data_6UQ2
# 
_entry.id   6UQ2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.326 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6UQ2         
WWPDB D_1000244995 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6UQ2 
_pdbx_database_status.recvd_initial_deposition_date   2019-10-18 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Oh, J.'   1 0000-0002-7625-2779 
'Wang, D.' 2 0000-0002-2829-1546 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            117 
_citation.language                  ? 
_citation.page_first                9338 
_citation.page_last                 9348 
_citation.title                     
'RNA polymerase II stalls on oxidative DNA damage via a torsion-latch mechanism involving lone pair-pi and CH-pi interactions.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1919904117 
_citation.pdbx_database_id_PubMed   32284409 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Oh, J.'        1 0000-0002-7625-2779 
primary 'Fleming, A.M.' 2 0000-0002-2000-0310 
primary 'Xu, J.'        3 ?                   
primary 'Chong, J.'     4 ?                   
primary 'Burrows, C.J.' 5 0000-0001-7253-8529 
primary 'Wang, D.'      6 0000-0002-2829-1546 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   99.370 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6UQ2 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     165.688 
_cell.length_a_esd                 ? 
_cell.length_b                     223.317 
_cell.length_b_esd                 ? 
_cell.length_c                     193.516 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6UQ2 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     syn RNA                                                          2934.831   1 ?       ? ? ? 
2  polymer     syn 'Template strand DNA'                                        8739.594   1 ?       ? ? ? 
3  polymer     syn 'Non-template strand DNA'                                    5663.694   1 ?       ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase II subunit RPB1'                191821.578 1 2.7.7.6 ? ? ? 
5  polymer     nat 'DNA-directed RNA polymerase II subunit RPB2'                138937.297 1 2.7.7.6 ? ? ? 
6  polymer     nat 'DNA-directed RNA polymerase II subunit RPB3'                35330.457  1 ?       ? ? ? 
7  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC1' 25117.094  1 ?       ? ? ? 
8  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC2' 17931.834  1 ?       ? ? ? 
9  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC3' 16525.363  1 ?       ? ? ? 
10 polymer     nat 'DNA-directed RNA polymerase II subunit RPB9'                14308.161  1 ?       ? ? ? 
11 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC5' 8290.732   1 ?       ? ? ? 
12 polymer     nat 'DNA-directed RNA polymerase II subunit RPB11'               13633.493  1 ?       ? ? ? 
13 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC4' 7729.969   1 ?       ? ? ? 
14 non-polymer syn 'ZINC ION'                                                   65.409     8 ?       ? ? ? 
15 non-polymer syn 'MAGNESIUM ION'                                              24.305     1 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
4  'RNA polymerase II subunit B1,DNA-directed RNA polymerase III largest subunit,RNA polymerase II subunit B220' 
5  'RNA polymerase II subunit 2,B150,DNA-directed RNA polymerase II 140 kDa polypeptide' 
6  'RNA polymerase II subunit B3,B44.5,DNA-directed RNA polymerase II 45 kDa polypeptide' 
7  'RNA polymerases I,II,and III subunit ABC1,ABC27,DNA-directed RNA polymerases I,and III 27 kDa polypeptide' 
8  'RNA polymerases I,II,and III subunit ABC2,ABC23,DNA-directed RNA polymerases I,and III 23 kDa polypeptide' 
9  'RNA polymerases I,II,and III subunit ABC3,ABC14.4,ABC14.5,DNA-directed RNA polymerases I,and III 14.5 kDa polypeptide' 
10 
'RNA polymerase II subunit B9,B12.6,DNA-directed RNA polymerase II 14.2 kDa polypeptide,DNA-directed RNA polymerase II subunit 9' 
11 'RNA polymerases I,II,and III subunit ABC5,ABC10-beta,ABC8,DNA-directed RNA polymerases I,and III 8.3 kDa polypeptide' 
12 'RNA polymerase II subunit B11,B13.6,DNA-directed RNA polymerase II 13.6 kDa polypeptide' 
13 'RNA polymerases I,II,and III subunit ABC4,ABC10-alpha' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polyribonucleotide      no no AUCGAGAGG AUCGAGAGG R ? 
2  polydeoxyribonucleotide no no 
;(DC)(DC)(DT)(DT)(DC)(DT)(DC)(DT)(DC)(DT)(DC)(DT)(DC)(DG)(DC)(DT)(DG)(DA)(DG)(DC)
(DC)(DT)(DC)(DT)(DC)(DG)(DA)(DT)(DG)
;
CCTTCTCTCTCTCGCTGAGCCTCTCGATG T ? 
3  polydeoxyribonucleotide no no '(DT)(DC)(DA)(DG)(DC)(DG)(DA)(DG)(DA)(DG)(DA)(DG)(DA)(DG)(DA)(DA)(DG)(DG)' TCAGCGAGAGAGAGAAGG N ? 
4  'polypeptide(L)'        no no 
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
A ? 
5  'polypeptide(L)'        no no 
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
B ? 
6  'polypeptide(L)'        no no 
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
C ? 
7  'polypeptide(L)'        no no 
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E ? 
8  'polypeptide(L)'        no no 
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F ? 
9  'polypeptide(L)'        no no 
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H ? 
10 'polypeptide(L)'        no no 
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
I ? 
11 'polypeptide(L)'        no no MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J ? 
12 'polypeptide(L)'        no no 
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
K ? 
13 'polypeptide(L)'        no no MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    A   n 
1  2    U   n 
1  3    C   n 
1  4    G   n 
1  5    A   n 
1  6    G   n 
1  7    A   n 
1  8    G   n 
1  9    G   n 
2  1    DC  n 
2  2    DC  n 
2  3    DT  n 
2  4    DT  n 
2  5    DC  n 
2  6    DT  n 
2  7    DC  n 
2  8    DT  n 
2  9    DC  n 
2  10   DT  n 
2  11   DC  n 
2  12   DT  n 
2  13   DC  n 
2  14   DG  n 
2  15   DC  n 
2  16   DT  n 
2  17   DG  n 
2  18   DA  n 
2  19   DG  n 
2  20   DC  n 
2  21   DC  n 
2  22   DT  n 
2  23   DC  n 
2  24   DT  n 
2  25   DC  n 
2  26   DG  n 
2  27   DA  n 
2  28   DT  n 
2  29   DG  n 
3  1    DT  n 
3  2    DC  n 
3  3    DA  n 
3  4    DG  n 
3  5    DC  n 
3  6    DG  n 
3  7    DA  n 
3  8    DG  n 
3  9    DA  n 
3  10   DG  n 
3  11   DA  n 
3  12   DG  n 
3  13   DA  n 
3  14   DG  n 
3  15   DA  n 
3  16   DA  n 
3  17   DG  n 
3  18   DG  n 
4  1    MET n 
4  2    VAL n 
4  3    GLY n 
4  4    GLN n 
4  5    GLN n 
4  6    TYR n 
4  7    SER n 
4  8    SER n 
4  9    ALA n 
4  10   PRO n 
4  11   LEU n 
4  12   ARG n 
4  13   THR n 
4  14   VAL n 
4  15   LYS n 
4  16   GLU n 
4  17   VAL n 
4  18   GLN n 
4  19   PHE n 
4  20   GLY n 
4  21   LEU n 
4  22   PHE n 
4  23   SER n 
4  24   PRO n 
4  25   GLU n 
4  26   GLU n 
4  27   VAL n 
4  28   ARG n 
4  29   ALA n 
4  30   ILE n 
4  31   SER n 
4  32   VAL n 
4  33   ALA n 
4  34   LYS n 
4  35   ILE n 
4  36   ARG n 
4  37   PHE n 
4  38   PRO n 
4  39   GLU n 
4  40   THR n 
4  41   MET n 
4  42   ASP n 
4  43   GLU n 
4  44   THR n 
4  45   GLN n 
4  46   THR n 
4  47   ARG n 
4  48   ALA n 
4  49   LYS n 
4  50   ILE n 
4  51   GLY n 
4  52   GLY n 
4  53   LEU n 
4  54   ASN n 
4  55   ASP n 
4  56   PRO n 
4  57   ARG n 
4  58   LEU n 
4  59   GLY n 
4  60   SER n 
4  61   ILE n 
4  62   ASP n 
4  63   ARG n 
4  64   ASN n 
4  65   LEU n 
4  66   LYS n 
4  67   CYS n 
4  68   GLN n 
4  69   THR n 
4  70   CYS n 
4  71   GLN n 
4  72   GLU n 
4  73   GLY n 
4  74   MET n 
4  75   ASN n 
4  76   GLU n 
4  77   CYS n 
4  78   PRO n 
4  79   GLY n 
4  80   HIS n 
4  81   PHE n 
4  82   GLY n 
4  83   HIS n 
4  84   ILE n 
4  85   ASP n 
4  86   LEU n 
4  87   ALA n 
4  88   LYS n 
4  89   PRO n 
4  90   VAL n 
4  91   PHE n 
4  92   HIS n 
4  93   VAL n 
4  94   GLY n 
4  95   PHE n 
4  96   ILE n 
4  97   ALA n 
4  98   LYS n 
4  99   ILE n 
4  100  LYS n 
4  101  LYS n 
4  102  VAL n 
4  103  CYS n 
4  104  GLU n 
4  105  CYS n 
4  106  VAL n 
4  107  CYS n 
4  108  MET n 
4  109  HIS n 
4  110  CYS n 
4  111  GLY n 
4  112  LYS n 
4  113  LEU n 
4  114  LEU n 
4  115  LEU n 
4  116  ASP n 
4  117  GLU n 
4  118  HIS n 
4  119  ASN n 
4  120  GLU n 
4  121  LEU n 
4  122  MET n 
4  123  ARG n 
4  124  GLN n 
4  125  ALA n 
4  126  LEU n 
4  127  ALA n 
4  128  ILE n 
4  129  LYS n 
4  130  ASP n 
4  131  SER n 
4  132  LYS n 
4  133  LYS n 
4  134  ARG n 
4  135  PHE n 
4  136  ALA n 
4  137  ALA n 
4  138  ILE n 
4  139  TRP n 
4  140  THR n 
4  141  LEU n 
4  142  CYS n 
4  143  LYS n 
4  144  THR n 
4  145  LYS n 
4  146  MET n 
4  147  VAL n 
4  148  CYS n 
4  149  GLU n 
4  150  THR n 
4  151  ASP n 
4  152  VAL n 
4  153  PRO n 
4  154  SER n 
4  155  GLU n 
4  156  ASP n 
4  157  ASP n 
4  158  PRO n 
4  159  THR n 
4  160  GLN n 
4  161  LEU n 
4  162  VAL n 
4  163  SER n 
4  164  ARG n 
4  165  GLY n 
4  166  GLY n 
4  167  CYS n 
4  168  GLY n 
4  169  ASN n 
4  170  THR n 
4  171  GLN n 
4  172  PRO n 
4  173  THR n 
4  174  ILE n 
4  175  ARG n 
4  176  LYS n 
4  177  ASP n 
4  178  GLY n 
4  179  LEU n 
4  180  LYS n 
4  181  LEU n 
4  182  VAL n 
4  183  GLY n 
4  184  SER n 
4  185  TRP n 
4  186  LYS n 
4  187  LYS n 
4  188  ASP n 
4  189  ARG n 
4  190  ALA n 
4  191  THR n 
4  192  GLY n 
4  193  ASP n 
4  194  ALA n 
4  195  ASP n 
4  196  GLU n 
4  197  PRO n 
4  198  GLU n 
4  199  LEU n 
4  200  ARG n 
4  201  VAL n 
4  202  LEU n 
4  203  SER n 
4  204  THR n 
4  205  GLU n 
4  206  GLU n 
4  207  ILE n 
4  208  LEU n 
4  209  ASN n 
4  210  ILE n 
4  211  PHE n 
4  212  LYS n 
4  213  HIS n 
4  214  ILE n 
4  215  SER n 
4  216  VAL n 
4  217  LYS n 
4  218  ASP n 
4  219  PHE n 
4  220  THR n 
4  221  SER n 
4  222  LEU n 
4  223  GLY n 
4  224  PHE n 
4  225  ASN n 
4  226  GLU n 
4  227  VAL n 
4  228  PHE n 
4  229  SER n 
4  230  ARG n 
4  231  PRO n 
4  232  GLU n 
4  233  TRP n 
4  234  MET n 
4  235  ILE n 
4  236  LEU n 
4  237  THR n 
4  238  CYS n 
4  239  LEU n 
4  240  PRO n 
4  241  VAL n 
4  242  PRO n 
4  243  PRO n 
4  244  PRO n 
4  245  PRO n 
4  246  VAL n 
4  247  ARG n 
4  248  PRO n 
4  249  SER n 
4  250  ILE n 
4  251  SER n 
4  252  PHE n 
4  253  ASN n 
4  254  GLU n 
4  255  SER n 
4  256  GLN n 
4  257  ARG n 
4  258  GLY n 
4  259  GLU n 
4  260  ASP n 
4  261  ASP n 
4  262  LEU n 
4  263  THR n 
4  264  PHE n 
4  265  LYS n 
4  266  LEU n 
4  267  ALA n 
4  268  ASP n 
4  269  ILE n 
4  270  LEU n 
4  271  LYS n 
4  272  ALA n 
4  273  ASN n 
4  274  ILE n 
4  275  SER n 
4  276  LEU n 
4  277  GLU n 
4  278  THR n 
4  279  LEU n 
4  280  GLU n 
4  281  HIS n 
4  282  ASN n 
4  283  GLY n 
4  284  ALA n 
4  285  PRO n 
4  286  HIS n 
4  287  HIS n 
4  288  ALA n 
4  289  ILE n 
4  290  GLU n 
4  291  GLU n 
4  292  ALA n 
4  293  GLU n 
4  294  SER n 
4  295  LEU n 
4  296  LEU n 
4  297  GLN n 
4  298  PHE n 
4  299  HIS n 
4  300  VAL n 
4  301  ALA n 
4  302  THR n 
4  303  TYR n 
4  304  MET n 
4  305  ASP n 
4  306  ASN n 
4  307  ASP n 
4  308  ILE n 
4  309  ALA n 
4  310  GLY n 
4  311  GLN n 
4  312  PRO n 
4  313  GLN n 
4  314  ALA n 
4  315  LEU n 
4  316  GLN n 
4  317  LYS n 
4  318  SER n 
4  319  GLY n 
4  320  ARG n 
4  321  PRO n 
4  322  VAL n 
4  323  LYS n 
4  324  SER n 
4  325  ILE n 
4  326  ARG n 
4  327  ALA n 
4  328  ARG n 
4  329  LEU n 
4  330  LYS n 
4  331  GLY n 
4  332  LYS n 
4  333  GLU n 
4  334  GLY n 
4  335  ARG n 
4  336  ILE n 
4  337  ARG n 
4  338  GLY n 
4  339  ASN n 
4  340  LEU n 
4  341  MET n 
4  342  GLY n 
4  343  LYS n 
4  344  ARG n 
4  345  VAL n 
4  346  ASP n 
4  347  PHE n 
4  348  SER n 
4  349  ALA n 
4  350  ARG n 
4  351  THR n 
4  352  VAL n 
4  353  ILE n 
4  354  SER n 
4  355  GLY n 
4  356  ASP n 
4  357  PRO n 
4  358  ASN n 
4  359  LEU n 
4  360  GLU n 
4  361  LEU n 
4  362  ASP n 
4  363  GLN n 
4  364  VAL n 
4  365  GLY n 
4  366  VAL n 
4  367  PRO n 
4  368  LYS n 
4  369  SER n 
4  370  ILE n 
4  371  ALA n 
4  372  LYS n 
4  373  THR n 
4  374  LEU n 
4  375  THR n 
4  376  TYR n 
4  377  PRO n 
4  378  GLU n 
4  379  VAL n 
4  380  VAL n 
4  381  THR n 
4  382  PRO n 
4  383  TYR n 
4  384  ASN n 
4  385  ILE n 
4  386  ASP n 
4  387  ARG n 
4  388  LEU n 
4  389  THR n 
4  390  GLN n 
4  391  LEU n 
4  392  VAL n 
4  393  ARG n 
4  394  ASN n 
4  395  GLY n 
4  396  PRO n 
4  397  ASN n 
4  398  GLU n 
4  399  HIS n 
4  400  PRO n 
4  401  GLY n 
4  402  ALA n 
4  403  LYS n 
4  404  TYR n 
4  405  VAL n 
4  406  ILE n 
4  407  ARG n 
4  408  ASP n 
4  409  SER n 
4  410  GLY n 
4  411  ASP n 
4  412  ARG n 
4  413  ILE n 
4  414  ASP n 
4  415  LEU n 
4  416  ARG n 
4  417  TYR n 
4  418  SER n 
4  419  LYS n 
4  420  ARG n 
4  421  ALA n 
4  422  GLY n 
4  423  ASP n 
4  424  ILE n 
4  425  GLN n 
4  426  LEU n 
4  427  GLN n 
4  428  TYR n 
4  429  GLY n 
4  430  TRP n 
4  431  LYS n 
4  432  VAL n 
4  433  GLU n 
4  434  ARG n 
4  435  HIS n 
4  436  ILE n 
4  437  MET n 
4  438  ASP n 
4  439  ASN n 
4  440  ASP n 
4  441  PRO n 
4  442  VAL n 
4  443  LEU n 
4  444  PHE n 
4  445  ASN n 
4  446  ARG n 
4  447  GLN n 
4  448  PRO n 
4  449  SER n 
4  450  LEU n 
4  451  HIS n 
4  452  LYS n 
4  453  MET n 
4  454  SER n 
4  455  MET n 
4  456  MET n 
4  457  ALA n 
4  458  HIS n 
4  459  ARG n 
4  460  VAL n 
4  461  LYS n 
4  462  VAL n 
4  463  ILE n 
4  464  PRO n 
4  465  TYR n 
4  466  SER n 
4  467  THR n 
4  468  PHE n 
4  469  ARG n 
4  470  LEU n 
4  471  ASN n 
4  472  LEU n 
4  473  SER n 
4  474  VAL n 
4  475  THR n 
4  476  SER n 
4  477  PRO n 
4  478  TYR n 
4  479  ASN n 
4  480  ALA n 
4  481  ASP n 
4  482  PHE n 
4  483  ASP n 
4  484  GLY n 
4  485  ASP n 
4  486  GLU n 
4  487  MET n 
4  488  ASN n 
4  489  LEU n 
4  490  HIS n 
4  491  VAL n 
4  492  PRO n 
4  493  GLN n 
4  494  SER n 
4  495  GLU n 
4  496  GLU n 
4  497  THR n 
4  498  ARG n 
4  499  ALA n 
4  500  GLU n 
4  501  LEU n 
4  502  SER n 
4  503  GLN n 
4  504  LEU n 
4  505  CYS n 
4  506  ALA n 
4  507  VAL n 
4  508  PRO n 
4  509  LEU n 
4  510  GLN n 
4  511  ILE n 
4  512  VAL n 
4  513  SER n 
4  514  PRO n 
4  515  GLN n 
4  516  SER n 
4  517  ASN n 
4  518  LYS n 
4  519  PRO n 
4  520  CYS n 
4  521  MET n 
4  522  GLY n 
4  523  ILE n 
4  524  VAL n 
4  525  GLN n 
4  526  ASP n 
4  527  THR n 
4  528  LEU n 
4  529  CYS n 
4  530  GLY n 
4  531  ILE n 
4  532  ARG n 
4  533  LYS n 
4  534  LEU n 
4  535  THR n 
4  536  LEU n 
4  537  ARG n 
4  538  ASP n 
4  539  THR n 
4  540  PHE n 
4  541  ILE n 
4  542  GLU n 
4  543  LEU n 
4  544  ASP n 
4  545  GLN n 
4  546  VAL n 
4  547  LEU n 
4  548  ASN n 
4  549  MET n 
4  550  LEU n 
4  551  TYR n 
4  552  TRP n 
4  553  VAL n 
4  554  PRO n 
4  555  ASP n 
4  556  TRP n 
4  557  ASP n 
4  558  GLY n 
4  559  VAL n 
4  560  ILE n 
4  561  PRO n 
4  562  THR n 
4  563  PRO n 
4  564  ALA n 
4  565  ILE n 
4  566  ILE n 
4  567  LYS n 
4  568  PRO n 
4  569  LYS n 
4  570  PRO n 
4  571  LEU n 
4  572  TRP n 
4  573  SER n 
4  574  GLY n 
4  575  LYS n 
4  576  GLN n 
4  577  ILE n 
4  578  LEU n 
4  579  SER n 
4  580  VAL n 
4  581  ALA n 
4  582  ILE n 
4  583  PRO n 
4  584  ASN n 
4  585  GLY n 
4  586  ILE n 
4  587  HIS n 
4  588  LEU n 
4  589  GLN n 
4  590  ARG n 
4  591  PHE n 
4  592  ASP n 
4  593  GLU n 
4  594  GLY n 
4  595  THR n 
4  596  THR n 
4  597  LEU n 
4  598  LEU n 
4  599  SER n 
4  600  PRO n 
4  601  LYS n 
4  602  ASP n 
4  603  ASN n 
4  604  GLY n 
4  605  MET n 
4  606  LEU n 
4  607  ILE n 
4  608  ILE n 
4  609  ASP n 
4  610  GLY n 
4  611  GLN n 
4  612  ILE n 
4  613  ILE n 
4  614  PHE n 
4  615  GLY n 
4  616  VAL n 
4  617  VAL n 
4  618  GLU n 
4  619  LYS n 
4  620  LYS n 
4  621  THR n 
4  622  VAL n 
4  623  GLY n 
4  624  SER n 
4  625  SER n 
4  626  ASN n 
4  627  GLY n 
4  628  GLY n 
4  629  LEU n 
4  630  ILE n 
4  631  HIS n 
4  632  VAL n 
4  633  VAL n 
4  634  THR n 
4  635  ARG n 
4  636  GLU n 
4  637  LYS n 
4  638  GLY n 
4  639  PRO n 
4  640  GLN n 
4  641  VAL n 
4  642  CYS n 
4  643  ALA n 
4  644  LYS n 
4  645  LEU n 
4  646  PHE n 
4  647  GLY n 
4  648  ASN n 
4  649  ILE n 
4  650  GLN n 
4  651  LYS n 
4  652  VAL n 
4  653  VAL n 
4  654  ASN n 
4  655  PHE n 
4  656  TRP n 
4  657  LEU n 
4  658  LEU n 
4  659  HIS n 
4  660  ASN n 
4  661  GLY n 
4  662  PHE n 
4  663  SER n 
4  664  THR n 
4  665  GLY n 
4  666  ILE n 
4  667  GLY n 
4  668  ASP n 
4  669  THR n 
4  670  ILE n 
4  671  ALA n 
4  672  ASP n 
4  673  GLY n 
4  674  PRO n 
4  675  THR n 
4  676  MET n 
4  677  ARG n 
4  678  GLU n 
4  679  ILE n 
4  680  THR n 
4  681  GLU n 
4  682  THR n 
4  683  ILE n 
4  684  ALA n 
4  685  GLU n 
4  686  ALA n 
4  687  LYS n 
4  688  LYS n 
4  689  LYS n 
4  690  VAL n 
4  691  LEU n 
4  692  ASP n 
4  693  VAL n 
4  694  THR n 
4  695  LYS n 
4  696  GLU n 
4  697  ALA n 
4  698  GLN n 
4  699  ALA n 
4  700  ASN n 
4  701  LEU n 
4  702  LEU n 
4  703  THR n 
4  704  ALA n 
4  705  LYS n 
4  706  HIS n 
4  707  GLY n 
4  708  MET n 
4  709  THR n 
4  710  LEU n 
4  711  ARG n 
4  712  GLU n 
4  713  SER n 
4  714  PHE n 
4  715  GLU n 
4  716  ASP n 
4  717  ASN n 
4  718  VAL n 
4  719  VAL n 
4  720  ARG n 
4  721  PHE n 
4  722  LEU n 
4  723  ASN n 
4  724  GLU n 
4  725  ALA n 
4  726  ARG n 
4  727  ASP n 
4  728  LYS n 
4  729  ALA n 
4  730  GLY n 
4  731  ARG n 
4  732  LEU n 
4  733  ALA n 
4  734  GLU n 
4  735  VAL n 
4  736  ASN n 
4  737  LEU n 
4  738  LYS n 
4  739  ASP n 
4  740  LEU n 
4  741  ASN n 
4  742  ASN n 
4  743  VAL n 
4  744  LYS n 
4  745  GLN n 
4  746  MET n 
4  747  VAL n 
4  748  MET n 
4  749  ALA n 
4  750  GLY n 
4  751  SER n 
4  752  LYS n 
4  753  GLY n 
4  754  SER n 
4  755  PHE n 
4  756  ILE n 
4  757  ASN n 
4  758  ILE n 
4  759  ALA n 
4  760  GLN n 
4  761  MET n 
4  762  SER n 
4  763  ALA n 
4  764  CYS n 
4  765  VAL n 
4  766  GLY n 
4  767  GLN n 
4  768  GLN n 
4  769  SER n 
4  770  VAL n 
4  771  GLU n 
4  772  GLY n 
4  773  LYS n 
4  774  ARG n 
4  775  ILE n 
4  776  ALA n 
4  777  PHE n 
4  778  GLY n 
4  779  PHE n 
4  780  VAL n 
4  781  ASP n 
4  782  ARG n 
4  783  THR n 
4  784  LEU n 
4  785  PRO n 
4  786  HIS n 
4  787  PHE n 
4  788  SER n 
4  789  LYS n 
4  790  ASP n 
4  791  ASP n 
4  792  TYR n 
4  793  SER n 
4  794  PRO n 
4  795  GLU n 
4  796  SER n 
4  797  LYS n 
4  798  GLY n 
4  799  PHE n 
4  800  VAL n 
4  801  GLU n 
4  802  ASN n 
4  803  SER n 
4  804  TYR n 
4  805  LEU n 
4  806  ARG n 
4  807  GLY n 
4  808  LEU n 
4  809  THR n 
4  810  PRO n 
4  811  GLN n 
4  812  GLU n 
4  813  PHE n 
4  814  PHE n 
4  815  PHE n 
4  816  HIS n 
4  817  ALA n 
4  818  MET n 
4  819  GLY n 
4  820  GLY n 
4  821  ARG n 
4  822  GLU n 
4  823  GLY n 
4  824  LEU n 
4  825  ILE n 
4  826  ASP n 
4  827  THR n 
4  828  ALA n 
4  829  VAL n 
4  830  LYS n 
4  831  THR n 
4  832  ALA n 
4  833  GLU n 
4  834  THR n 
4  835  GLY n 
4  836  TYR n 
4  837  ILE n 
4  838  GLN n 
4  839  ARG n 
4  840  ARG n 
4  841  LEU n 
4  842  VAL n 
4  843  LYS n 
4  844  ALA n 
4  845  LEU n 
4  846  GLU n 
4  847  ASP n 
4  848  ILE n 
4  849  MET n 
4  850  VAL n 
4  851  HIS n 
4  852  TYR n 
4  853  ASP n 
4  854  ASN n 
4  855  THR n 
4  856  THR n 
4  857  ARG n 
4  858  ASN n 
4  859  SER n 
4  860  LEU n 
4  861  GLY n 
4  862  ASN n 
4  863  VAL n 
4  864  ILE n 
4  865  GLN n 
4  866  PHE n 
4  867  ILE n 
4  868  TYR n 
4  869  GLY n 
4  870  GLU n 
4  871  ASP n 
4  872  GLY n 
4  873  MET n 
4  874  ASP n 
4  875  ALA n 
4  876  ALA n 
4  877  HIS n 
4  878  ILE n 
4  879  GLU n 
4  880  LYS n 
4  881  GLN n 
4  882  SER n 
4  883  LEU n 
4  884  ASP n 
4  885  THR n 
4  886  ILE n 
4  887  GLY n 
4  888  GLY n 
4  889  SER n 
4  890  ASP n 
4  891  ALA n 
4  892  ALA n 
4  893  PHE n 
4  894  GLU n 
4  895  LYS n 
4  896  ARG n 
4  897  TYR n 
4  898  ARG n 
4  899  VAL n 
4  900  ASP n 
4  901  LEU n 
4  902  LEU n 
4  903  ASN n 
4  904  THR n 
4  905  ASP n 
4  906  HIS n 
4  907  THR n 
4  908  LEU n 
4  909  ASP n 
4  910  PRO n 
4  911  SER n 
4  912  LEU n 
4  913  LEU n 
4  914  GLU n 
4  915  SER n 
4  916  GLY n 
4  917  SER n 
4  918  GLU n 
4  919  ILE n 
4  920  LEU n 
4  921  GLY n 
4  922  ASP n 
4  923  LEU n 
4  924  LYS n 
4  925  LEU n 
4  926  GLN n 
4  927  VAL n 
4  928  LEU n 
4  929  LEU n 
4  930  ASP n 
4  931  GLU n 
4  932  GLU n 
4  933  TYR n 
4  934  LYS n 
4  935  GLN n 
4  936  LEU n 
4  937  VAL n 
4  938  LYS n 
4  939  ASP n 
4  940  ARG n 
4  941  LYS n 
4  942  PHE n 
4  943  LEU n 
4  944  ARG n 
4  945  GLU n 
4  946  VAL n 
4  947  PHE n 
4  948  VAL n 
4  949  ASP n 
4  950  GLY n 
4  951  GLU n 
4  952  ALA n 
4  953  ASN n 
4  954  TRP n 
4  955  PRO n 
4  956  LEU n 
4  957  PRO n 
4  958  VAL n 
4  959  ASN n 
4  960  ILE n 
4  961  ARG n 
4  962  ARG n 
4  963  ILE n 
4  964  ILE n 
4  965  GLN n 
4  966  ASN n 
4  967  ALA n 
4  968  GLN n 
4  969  GLN n 
4  970  THR n 
4  971  PHE n 
4  972  HIS n 
4  973  ILE n 
4  974  ASP n 
4  975  HIS n 
4  976  THR n 
4  977  LYS n 
4  978  PRO n 
4  979  SER n 
4  980  ASP n 
4  981  LEU n 
4  982  THR n 
4  983  ILE n 
4  984  LYS n 
4  985  ASP n 
4  986  ILE n 
4  987  VAL n 
4  988  LEU n 
4  989  GLY n 
4  990  VAL n 
4  991  LYS n 
4  992  ASP n 
4  993  LEU n 
4  994  GLN n 
4  995  GLU n 
4  996  ASN n 
4  997  LEU n 
4  998  LEU n 
4  999  VAL n 
4  1000 LEU n 
4  1001 ARG n 
4  1002 GLY n 
4  1003 LYS n 
4  1004 ASN n 
4  1005 GLU n 
4  1006 ILE n 
4  1007 ILE n 
4  1008 GLN n 
4  1009 ASN n 
4  1010 ALA n 
4  1011 GLN n 
4  1012 ARG n 
4  1013 ASP n 
4  1014 ALA n 
4  1015 VAL n 
4  1016 THR n 
4  1017 LEU n 
4  1018 PHE n 
4  1019 CYS n 
4  1020 CYS n 
4  1021 LEU n 
4  1022 LEU n 
4  1023 ARG n 
4  1024 SER n 
4  1025 ARG n 
4  1026 LEU n 
4  1027 ALA n 
4  1028 THR n 
4  1029 ARG n 
4  1030 ARG n 
4  1031 VAL n 
4  1032 LEU n 
4  1033 GLN n 
4  1034 GLU n 
4  1035 TYR n 
4  1036 ARG n 
4  1037 LEU n 
4  1038 THR n 
4  1039 LYS n 
4  1040 GLN n 
4  1041 ALA n 
4  1042 PHE n 
4  1043 ASP n 
4  1044 TRP n 
4  1045 VAL n 
4  1046 LEU n 
4  1047 SER n 
4  1048 ASN n 
4  1049 ILE n 
4  1050 GLU n 
4  1051 ALA n 
4  1052 GLN n 
4  1053 PHE n 
4  1054 LEU n 
4  1055 ARG n 
4  1056 SER n 
4  1057 VAL n 
4  1058 VAL n 
4  1059 HIS n 
4  1060 PRO n 
4  1061 GLY n 
4  1062 GLU n 
4  1063 MET n 
4  1064 VAL n 
4  1065 GLY n 
4  1066 VAL n 
4  1067 LEU n 
4  1068 ALA n 
4  1069 ALA n 
4  1070 GLN n 
4  1071 SER n 
4  1072 ILE n 
4  1073 GLY n 
4  1074 GLU n 
4  1075 PRO n 
4  1076 ALA n 
4  1077 THR n 
4  1078 GLN n 
4  1079 MET n 
4  1080 THR n 
4  1081 LEU n 
4  1082 ASN n 
4  1083 THR n 
4  1084 PHE n 
4  1085 HIS n 
4  1086 PHE n 
4  1087 ALA n 
4  1088 GLY n 
4  1089 VAL n 
4  1090 ALA n 
4  1091 SER n 
4  1092 LYS n 
4  1093 LYS n 
4  1094 VAL n 
4  1095 THR n 
4  1096 SER n 
4  1097 GLY n 
4  1098 VAL n 
4  1099 PRO n 
4  1100 ARG n 
4  1101 LEU n 
4  1102 LYS n 
4  1103 GLU n 
4  1104 ILE n 
4  1105 LEU n 
4  1106 ASN n 
4  1107 VAL n 
4  1108 ALA n 
4  1109 LYS n 
4  1110 ASN n 
4  1111 MET n 
4  1112 LYS n 
4  1113 THR n 
4  1114 PRO n 
4  1115 SER n 
4  1116 LEU n 
4  1117 THR n 
4  1118 VAL n 
4  1119 TYR n 
4  1120 LEU n 
4  1121 GLU n 
4  1122 PRO n 
4  1123 GLY n 
4  1124 HIS n 
4  1125 ALA n 
4  1126 ALA n 
4  1127 ASP n 
4  1128 GLN n 
4  1129 GLU n 
4  1130 GLN n 
4  1131 ALA n 
4  1132 LYS n 
4  1133 LEU n 
4  1134 ILE n 
4  1135 ARG n 
4  1136 SER n 
4  1137 ALA n 
4  1138 ILE n 
4  1139 GLU n 
4  1140 HIS n 
4  1141 THR n 
4  1142 THR n 
4  1143 LEU n 
4  1144 LYS n 
4  1145 SER n 
4  1146 VAL n 
4  1147 THR n 
4  1148 ILE n 
4  1149 ALA n 
4  1150 SER n 
4  1151 GLU n 
4  1152 ILE n 
4  1153 TYR n 
4  1154 TYR n 
4  1155 ASP n 
4  1156 PRO n 
4  1157 ASP n 
4  1158 PRO n 
4  1159 ARG n 
4  1160 SER n 
4  1161 THR n 
4  1162 VAL n 
4  1163 ILE n 
4  1164 PRO n 
4  1165 GLU n 
4  1166 ASP n 
4  1167 GLU n 
4  1168 GLU n 
4  1169 ILE n 
4  1170 ILE n 
4  1171 GLN n 
4  1172 LEU n 
4  1173 HIS n 
4  1174 PHE n 
4  1175 SER n 
4  1176 LEU n 
4  1177 LEU n 
4  1178 ASP n 
4  1179 GLU n 
4  1180 GLU n 
4  1181 ALA n 
4  1182 GLU n 
4  1183 GLN n 
4  1184 SER n 
4  1185 PHE n 
4  1186 ASP n 
4  1187 GLN n 
4  1188 GLN n 
4  1189 SER n 
4  1190 PRO n 
4  1191 TRP n 
4  1192 LEU n 
4  1193 LEU n 
4  1194 ARG n 
4  1195 LEU n 
4  1196 GLU n 
4  1197 LEU n 
4  1198 ASP n 
4  1199 ARG n 
4  1200 ALA n 
4  1201 ALA n 
4  1202 MET n 
4  1203 ASN n 
4  1204 ASP n 
4  1205 LYS n 
4  1206 ASP n 
4  1207 LEU n 
4  1208 THR n 
4  1209 MET n 
4  1210 GLY n 
4  1211 GLN n 
4  1212 VAL n 
4  1213 GLY n 
4  1214 GLU n 
4  1215 ARG n 
4  1216 ILE n 
4  1217 LYS n 
4  1218 GLN n 
4  1219 THR n 
4  1220 PHE n 
4  1221 LYS n 
4  1222 ASN n 
4  1223 ASP n 
4  1224 LEU n 
4  1225 PHE n 
4  1226 VAL n 
4  1227 ILE n 
4  1228 TRP n 
4  1229 SER n 
4  1230 GLU n 
4  1231 ASP n 
4  1232 ASN n 
4  1233 ASP n 
4  1234 GLU n 
4  1235 LYS n 
4  1236 LEU n 
4  1237 ILE n 
4  1238 ILE n 
4  1239 ARG n 
4  1240 CYS n 
4  1241 ARG n 
4  1242 VAL n 
4  1243 VAL n 
4  1244 ARG n 
4  1245 PRO n 
4  1246 LYS n 
4  1247 SER n 
4  1248 LEU n 
4  1249 ASP n 
4  1250 ALA n 
4  1251 GLU n 
4  1252 THR n 
4  1253 GLU n 
4  1254 ALA n 
4  1255 GLU n 
4  1256 GLU n 
4  1257 ASP n 
4  1258 HIS n 
4  1259 MET n 
4  1260 LEU n 
4  1261 LYS n 
4  1262 LYS n 
4  1263 ILE n 
4  1264 GLU n 
4  1265 ASN n 
4  1266 THR n 
4  1267 MET n 
4  1268 LEU n 
4  1269 GLU n 
4  1270 ASN n 
4  1271 ILE n 
4  1272 THR n 
4  1273 LEU n 
4  1274 ARG n 
4  1275 GLY n 
4  1276 VAL n 
4  1277 GLU n 
4  1278 ASN n 
4  1279 ILE n 
4  1280 GLU n 
4  1281 ARG n 
4  1282 VAL n 
4  1283 VAL n 
4  1284 MET n 
4  1285 MET n 
4  1286 LYS n 
4  1287 TYR n 
4  1288 ASP n 
4  1289 ARG n 
4  1290 LYS n 
4  1291 VAL n 
4  1292 PRO n 
4  1293 SER n 
4  1294 PRO n 
4  1295 THR n 
4  1296 GLY n 
4  1297 GLU n 
4  1298 TYR n 
4  1299 VAL n 
4  1300 LYS n 
4  1301 GLU n 
4  1302 PRO n 
4  1303 GLU n 
4  1304 TRP n 
4  1305 VAL n 
4  1306 LEU n 
4  1307 GLU n 
4  1308 THR n 
4  1309 ASP n 
4  1310 GLY n 
4  1311 VAL n 
4  1312 ASN n 
4  1313 LEU n 
4  1314 SER n 
4  1315 GLU n 
4  1316 VAL n 
4  1317 MET n 
4  1318 THR n 
4  1319 VAL n 
4  1320 PRO n 
4  1321 GLY n 
4  1322 ILE n 
4  1323 ASP n 
4  1324 PRO n 
4  1325 THR n 
4  1326 ARG n 
4  1327 ILE n 
4  1328 TYR n 
4  1329 THR n 
4  1330 ASN n 
4  1331 SER n 
4  1332 PHE n 
4  1333 ILE n 
4  1334 ASP n 
4  1335 ILE n 
4  1336 MET n 
4  1337 GLU n 
4  1338 VAL n 
4  1339 LEU n 
4  1340 GLY n 
4  1341 ILE n 
4  1342 GLU n 
4  1343 ALA n 
4  1344 GLY n 
4  1345 ARG n 
4  1346 ALA n 
4  1347 ALA n 
4  1348 LEU n 
4  1349 TYR n 
4  1350 LYS n 
4  1351 GLU n 
4  1352 VAL n 
4  1353 TYR n 
4  1354 ASN n 
4  1355 VAL n 
4  1356 ILE n 
4  1357 ALA n 
4  1358 SER n 
4  1359 ASP n 
4  1360 GLY n 
4  1361 SER n 
4  1362 TYR n 
4  1363 VAL n 
4  1364 ASN n 
4  1365 TYR n 
4  1366 ARG n 
4  1367 HIS n 
4  1368 MET n 
4  1369 ALA n 
4  1370 LEU n 
4  1371 LEU n 
4  1372 VAL n 
4  1373 ASP n 
4  1374 VAL n 
4  1375 MET n 
4  1376 THR n 
4  1377 THR n 
4  1378 GLN n 
4  1379 GLY n 
4  1380 GLY n 
4  1381 LEU n 
4  1382 THR n 
4  1383 SER n 
4  1384 VAL n 
4  1385 THR n 
4  1386 ARG n 
4  1387 HIS n 
4  1388 GLY n 
4  1389 PHE n 
4  1390 ASN n 
4  1391 ARG n 
4  1392 SER n 
4  1393 ASN n 
4  1394 THR n 
4  1395 GLY n 
4  1396 ALA n 
4  1397 LEU n 
4  1398 MET n 
4  1399 ARG n 
4  1400 CYS n 
4  1401 SER n 
4  1402 PHE n 
4  1403 GLU n 
4  1404 GLU n 
4  1405 THR n 
4  1406 VAL n 
4  1407 GLU n 
4  1408 ILE n 
4  1409 LEU n 
4  1410 PHE n 
4  1411 GLU n 
4  1412 ALA n 
4  1413 GLY n 
4  1414 ALA n 
4  1415 SER n 
4  1416 ALA n 
4  1417 GLU n 
4  1418 LEU n 
4  1419 ASP n 
4  1420 ASP n 
4  1421 CYS n 
4  1422 ARG n 
4  1423 GLY n 
4  1424 VAL n 
4  1425 SER n 
4  1426 GLU n 
4  1427 ASN n 
4  1428 VAL n 
4  1429 ILE n 
4  1430 LEU n 
4  1431 GLY n 
4  1432 GLN n 
4  1433 MET n 
4  1434 ALA n 
4  1435 PRO n 
4  1436 ILE n 
4  1437 GLY n 
4  1438 THR n 
4  1439 GLY n 
4  1440 ALA n 
4  1441 PHE n 
4  1442 ASP n 
4  1443 VAL n 
4  1444 MET n 
4  1445 ILE n 
4  1446 ASP n 
4  1447 GLU n 
4  1448 GLU n 
4  1449 SER n 
4  1450 LEU n 
4  1451 VAL n 
4  1452 LYS n 
4  1453 TYR n 
4  1454 MET n 
4  1455 PRO n 
4  1456 GLU n 
4  1457 GLN n 
4  1458 LYS n 
4  1459 ILE n 
4  1460 THR n 
4  1461 GLU n 
4  1462 ILE n 
4  1463 GLU n 
4  1464 ASP n 
4  1465 GLY n 
4  1466 GLN n 
4  1467 ASP n 
4  1468 GLY n 
4  1469 GLY n 
4  1470 VAL n 
4  1471 THR n 
4  1472 PRO n 
4  1473 TYR n 
4  1474 SER n 
4  1475 ASN n 
4  1476 GLU n 
4  1477 SER n 
4  1478 GLY n 
4  1479 LEU n 
4  1480 VAL n 
4  1481 ASN n 
4  1482 ALA n 
4  1483 ASP n 
4  1484 LEU n 
4  1485 ASP n 
4  1486 VAL n 
4  1487 LYS n 
4  1488 ASP n 
4  1489 GLU n 
4  1490 LEU n 
4  1491 MET n 
4  1492 PHE n 
4  1493 SER n 
4  1494 PRO n 
4  1495 LEU n 
4  1496 VAL n 
4  1497 ASP n 
4  1498 SER n 
4  1499 GLY n 
4  1500 SER n 
4  1501 ASN n 
4  1502 ASP n 
4  1503 ALA n 
4  1504 MET n 
4  1505 ALA n 
4  1506 GLY n 
4  1507 GLY n 
4  1508 PHE n 
4  1509 THR n 
4  1510 ALA n 
4  1511 TYR n 
4  1512 GLY n 
4  1513 GLY n 
4  1514 ALA n 
4  1515 ASP n 
4  1516 TYR n 
4  1517 GLY n 
4  1518 GLU n 
4  1519 ALA n 
4  1520 THR n 
4  1521 SER n 
4  1522 PRO n 
4  1523 PHE n 
4  1524 GLY n 
4  1525 ALA n 
4  1526 TYR n 
4  1527 GLY n 
4  1528 GLU n 
4  1529 ALA n 
4  1530 PRO n 
4  1531 THR n 
4  1532 SER n 
4  1533 PRO n 
4  1534 GLY n 
4  1535 PHE n 
4  1536 GLY n 
4  1537 VAL n 
4  1538 SER n 
4  1539 SER n 
4  1540 PRO n 
4  1541 GLY n 
4  1542 PHE n 
4  1543 SER n 
4  1544 PRO n 
4  1545 THR n 
4  1546 SER n 
4  1547 PRO n 
4  1548 THR n 
4  1549 TYR n 
4  1550 SER n 
4  1551 PRO n 
4  1552 THR n 
4  1553 SER n 
4  1554 PRO n 
4  1555 ALA n 
4  1556 TYR n 
4  1557 SER n 
4  1558 PRO n 
4  1559 THR n 
4  1560 SER n 
4  1561 PRO n 
4  1562 SER n 
4  1563 TYR n 
4  1564 SER n 
4  1565 PRO n 
4  1566 THR n 
4  1567 SER n 
4  1568 PRO n 
4  1569 SER n 
4  1570 TYR n 
4  1571 SER n 
4  1572 PRO n 
4  1573 THR n 
4  1574 SER n 
4  1575 PRO n 
4  1576 SER n 
4  1577 TYR n 
4  1578 SER n 
4  1579 PRO n 
4  1580 THR n 
4  1581 SER n 
4  1582 PRO n 
4  1583 SER n 
4  1584 TYR n 
4  1585 SER n 
4  1586 PRO n 
4  1587 THR n 
4  1588 SER n 
4  1589 PRO n 
4  1590 SER n 
4  1591 TYR n 
4  1592 SER n 
4  1593 PRO n 
4  1594 THR n 
4  1595 SER n 
4  1596 PRO n 
4  1597 SER n 
4  1598 TYR n 
4  1599 SER n 
4  1600 PRO n 
4  1601 THR n 
4  1602 SER n 
4  1603 PRO n 
4  1604 SER n 
4  1605 TYR n 
4  1606 SER n 
4  1607 PRO n 
4  1608 THR n 
4  1609 SER n 
4  1610 PRO n 
4  1611 SER n 
4  1612 TYR n 
4  1613 SER n 
4  1614 PRO n 
4  1615 THR n 
4  1616 SER n 
4  1617 PRO n 
4  1618 SER n 
4  1619 TYR n 
4  1620 SER n 
4  1621 PRO n 
4  1622 THR n 
4  1623 SER n 
4  1624 PRO n 
4  1625 SER n 
4  1626 TYR n 
4  1627 SER n 
4  1628 PRO n 
4  1629 THR n 
4  1630 SER n 
4  1631 PRO n 
4  1632 SER n 
4  1633 TYR n 
4  1634 SER n 
4  1635 PRO n 
4  1636 THR n 
4  1637 SER n 
4  1638 PRO n 
4  1639 SER n 
4  1640 TYR n 
4  1641 SER n 
4  1642 PRO n 
4  1643 THR n 
4  1644 SER n 
4  1645 PRO n 
4  1646 SER n 
4  1647 TYR n 
4  1648 SER n 
4  1649 PRO n 
4  1650 THR n 
4  1651 SER n 
4  1652 PRO n 
4  1653 SER n 
4  1654 TYR n 
4  1655 SER n 
4  1656 PRO n 
4  1657 THR n 
4  1658 SER n 
4  1659 PRO n 
4  1660 ALA n 
4  1661 TYR n 
4  1662 SER n 
4  1663 PRO n 
4  1664 THR n 
4  1665 SER n 
4  1666 PRO n 
4  1667 SER n 
4  1668 TYR n 
4  1669 SER n 
4  1670 PRO n 
4  1671 THR n 
4  1672 SER n 
4  1673 PRO n 
4  1674 SER n 
4  1675 TYR n 
4  1676 SER n 
4  1677 PRO n 
4  1678 THR n 
4  1679 SER n 
4  1680 PRO n 
4  1681 SER n 
4  1682 TYR n 
4  1683 SER n 
4  1684 PRO n 
4  1685 THR n 
4  1686 SER n 
4  1687 PRO n 
4  1688 SER n 
4  1689 TYR n 
4  1690 SER n 
4  1691 PRO n 
4  1692 THR n 
4  1693 SER n 
4  1694 PRO n 
4  1695 ASN n 
4  1696 TYR n 
4  1697 SER n 
4  1698 PRO n 
4  1699 THR n 
4  1700 SER n 
4  1701 PRO n 
4  1702 SER n 
4  1703 TYR n 
4  1704 SER n 
4  1705 PRO n 
4  1706 THR n 
4  1707 SER n 
4  1708 PRO n 
4  1709 GLY n 
4  1710 TYR n 
4  1711 SER n 
4  1712 PRO n 
4  1713 GLY n 
4  1714 SER n 
4  1715 PRO n 
4  1716 ALA n 
4  1717 TYR n 
4  1718 SER n 
4  1719 PRO n 
4  1720 LYS n 
4  1721 GLN n 
4  1722 ASP n 
4  1723 GLU n 
4  1724 GLN n 
4  1725 LYS n 
4  1726 HIS n 
4  1727 ASN n 
4  1728 GLU n 
4  1729 ASN n 
4  1730 GLU n 
4  1731 ASN n 
4  1732 SER n 
4  1733 ARG n 
5  1    MET n 
5  2    SER n 
5  3    ASP n 
5  4    LEU n 
5  5    ALA n 
5  6    ASN n 
5  7    SER n 
5  8    GLU n 
5  9    LYS n 
5  10   TYR n 
5  11   TYR n 
5  12   ASP n 
5  13   GLU n 
5  14   ASP n 
5  15   PRO n 
5  16   TYR n 
5  17   GLY n 
5  18   PHE n 
5  19   GLU n 
5  20   ASP n 
5  21   GLU n 
5  22   SER n 
5  23   ALA n 
5  24   PRO n 
5  25   ILE n 
5  26   THR n 
5  27   ALA n 
5  28   GLU n 
5  29   ASP n 
5  30   SER n 
5  31   TRP n 
5  32   ALA n 
5  33   VAL n 
5  34   ILE n 
5  35   SER n 
5  36   ALA n 
5  37   PHE n 
5  38   PHE n 
5  39   ARG n 
5  40   GLU n 
5  41   LYS n 
5  42   GLY n 
5  43   LEU n 
5  44   VAL n 
5  45   SER n 
5  46   GLN n 
5  47   GLN n 
5  48   LEU n 
5  49   ASP n 
5  50   SER n 
5  51   PHE n 
5  52   ASN n 
5  53   GLN n 
5  54   PHE n 
5  55   VAL n 
5  56   ASP n 
5  57   TYR n 
5  58   THR n 
5  59   LEU n 
5  60   GLN n 
5  61   ASP n 
5  62   ILE n 
5  63   ILE n 
5  64   CYS n 
5  65   GLU n 
5  66   ASP n 
5  67   SER n 
5  68   THR n 
5  69   LEU n 
5  70   ILE n 
5  71   LEU n 
5  72   GLU n 
5  73   GLN n 
5  74   LEU n 
5  75   ALA n 
5  76   GLN n 
5  77   HIS n 
5  78   THR n 
5  79   THR n 
5  80   GLU n 
5  81   SER n 
5  82   ASP n 
5  83   ASN n 
5  84   ILE n 
5  85   SER n 
5  86   ARG n 
5  87   LYS n 
5  88   TYR n 
5  89   GLU n 
5  90   ILE n 
5  91   SER n 
5  92   PHE n 
5  93   GLY n 
5  94   LYS n 
5  95   ILE n 
5  96   TYR n 
5  97   VAL n 
5  98   THR n 
5  99   LYS n 
5  100  PRO n 
5  101  MET n 
5  102  VAL n 
5  103  ASN n 
5  104  GLU n 
5  105  SER n 
5  106  ASP n 
5  107  GLY n 
5  108  VAL n 
5  109  THR n 
5  110  HIS n 
5  111  ALA n 
5  112  LEU n 
5  113  TYR n 
5  114  PRO n 
5  115  GLN n 
5  116  GLU n 
5  117  ALA n 
5  118  ARG n 
5  119  LEU n 
5  120  ARG n 
5  121  ASN n 
5  122  LEU n 
5  123  THR n 
5  124  TYR n 
5  125  SER n 
5  126  SER n 
5  127  GLY n 
5  128  LEU n 
5  129  PHE n 
5  130  VAL n 
5  131  ASP n 
5  132  VAL n 
5  133  LYS n 
5  134  LYS n 
5  135  ARG n 
5  136  THR n 
5  137  TYR n 
5  138  GLU n 
5  139  ALA n 
5  140  ILE n 
5  141  ASP n 
5  142  VAL n 
5  143  PRO n 
5  144  GLY n 
5  145  ARG n 
5  146  GLU n 
5  147  LEU n 
5  148  LYS n 
5  149  TYR n 
5  150  GLU n 
5  151  LEU n 
5  152  ILE n 
5  153  ALA n 
5  154  GLU n 
5  155  GLU n 
5  156  SER n 
5  157  GLU n 
5  158  ASP n 
5  159  ASP n 
5  160  SER n 
5  161  GLU n 
5  162  SER n 
5  163  GLY n 
5  164  LYS n 
5  165  VAL n 
5  166  PHE n 
5  167  ILE n 
5  168  GLY n 
5  169  ARG n 
5  170  LEU n 
5  171  PRO n 
5  172  ILE n 
5  173  MET n 
5  174  LEU n 
5  175  ARG n 
5  176  SER n 
5  177  LYS n 
5  178  ASN n 
5  179  CYS n 
5  180  TYR n 
5  181  LEU n 
5  182  SER n 
5  183  GLU n 
5  184  ALA n 
5  185  THR n 
5  186  GLU n 
5  187  SER n 
5  188  ASP n 
5  189  LEU n 
5  190  TYR n 
5  191  LYS n 
5  192  LEU n 
5  193  LYS n 
5  194  GLU n 
5  195  CYS n 
5  196  PRO n 
5  197  PHE n 
5  198  ASP n 
5  199  MET n 
5  200  GLY n 
5  201  GLY n 
5  202  TYR n 
5  203  PHE n 
5  204  ILE n 
5  205  ILE n 
5  206  ASN n 
5  207  GLY n 
5  208  SER n 
5  209  GLU n 
5  210  LYS n 
5  211  VAL n 
5  212  LEU n 
5  213  ILE n 
5  214  ALA n 
5  215  GLN n 
5  216  GLU n 
5  217  ARG n 
5  218  SER n 
5  219  ALA n 
5  220  GLY n 
5  221  ASN n 
5  222  ILE n 
5  223  VAL n 
5  224  GLN n 
5  225  VAL n 
5  226  PHE n 
5  227  LYS n 
5  228  LYS n 
5  229  ALA n 
5  230  ALA n 
5  231  PRO n 
5  232  SER n 
5  233  PRO n 
5  234  ILE n 
5  235  SER n 
5  236  HIS n 
5  237  VAL n 
5  238  ALA n 
5  239  GLU n 
5  240  ILE n 
5  241  ARG n 
5  242  SER n 
5  243  ALA n 
5  244  LEU n 
5  245  GLU n 
5  246  LYS n 
5  247  GLY n 
5  248  SER n 
5  249  ARG n 
5  250  PHE n 
5  251  ILE n 
5  252  SER n 
5  253  THR n 
5  254  LEU n 
5  255  GLN n 
5  256  VAL n 
5  257  LYS n 
5  258  LEU n 
5  259  TYR n 
5  260  GLY n 
5  261  ARG n 
5  262  GLU n 
5  263  GLY n 
5  264  SER n 
5  265  SER n 
5  266  ALA n 
5  267  ARG n 
5  268  THR n 
5  269  ILE n 
5  270  LYS n 
5  271  ALA n 
5  272  THR n 
5  273  LEU n 
5  274  PRO n 
5  275  TYR n 
5  276  ILE n 
5  277  LYS n 
5  278  GLN n 
5  279  ASP n 
5  280  ILE n 
5  281  PRO n 
5  282  ILE n 
5  283  VAL n 
5  284  ILE n 
5  285  ILE n 
5  286  PHE n 
5  287  ARG n 
5  288  ALA n 
5  289  LEU n 
5  290  GLY n 
5  291  ILE n 
5  292  ILE n 
5  293  PRO n 
5  294  ASP n 
5  295  GLY n 
5  296  GLU n 
5  297  ILE n 
5  298  LEU n 
5  299  GLU n 
5  300  HIS n 
5  301  ILE n 
5  302  CYS n 
5  303  TYR n 
5  304  ASP n 
5  305  VAL n 
5  306  ASN n 
5  307  ASP n 
5  308  TRP n 
5  309  GLN n 
5  310  MET n 
5  311  LEU n 
5  312  GLU n 
5  313  MET n 
5  314  LEU n 
5  315  LYS n 
5  316  PRO n 
5  317  CYS n 
5  318  VAL n 
5  319  GLU n 
5  320  ASP n 
5  321  GLY n 
5  322  PHE n 
5  323  VAL n 
5  324  ILE n 
5  325  GLN n 
5  326  ASP n 
5  327  ARG n 
5  328  GLU n 
5  329  THR n 
5  330  ALA n 
5  331  LEU n 
5  332  ASP n 
5  333  PHE n 
5  334  ILE n 
5  335  GLY n 
5  336  ARG n 
5  337  ARG n 
5  338  GLY n 
5  339  THR n 
5  340  ALA n 
5  341  LEU n 
5  342  GLY n 
5  343  ILE n 
5  344  LYS n 
5  345  LYS n 
5  346  GLU n 
5  347  LYS n 
5  348  ARG n 
5  349  ILE n 
5  350  GLN n 
5  351  TYR n 
5  352  ALA n 
5  353  LYS n 
5  354  ASP n 
5  355  ILE n 
5  356  LEU n 
5  357  GLN n 
5  358  LYS n 
5  359  GLU n 
5  360  PHE n 
5  361  LEU n 
5  362  PRO n 
5  363  HIS n 
5  364  ILE n 
5  365  THR n 
5  366  GLN n 
5  367  LEU n 
5  368  GLU n 
5  369  GLY n 
5  370  PHE n 
5  371  GLU n 
5  372  SER n 
5  373  ARG n 
5  374  LYS n 
5  375  ALA n 
5  376  PHE n 
5  377  PHE n 
5  378  LEU n 
5  379  GLY n 
5  380  TYR n 
5  381  MET n 
5  382  ILE n 
5  383  ASN n 
5  384  ARG n 
5  385  LEU n 
5  386  LEU n 
5  387  LEU n 
5  388  CYS n 
5  389  ALA n 
5  390  LEU n 
5  391  ASP n 
5  392  ARG n 
5  393  LYS n 
5  394  ASP n 
5  395  GLN n 
5  396  ASP n 
5  397  ASP n 
5  398  ARG n 
5  399  ASP n 
5  400  HIS n 
5  401  PHE n 
5  402  GLY n 
5  403  LYS n 
5  404  LYS n 
5  405  ARG n 
5  406  LEU n 
5  407  ASP n 
5  408  LEU n 
5  409  ALA n 
5  410  GLY n 
5  411  PRO n 
5  412  LEU n 
5  413  LEU n 
5  414  ALA n 
5  415  GLN n 
5  416  LEU n 
5  417  PHE n 
5  418  LYS n 
5  419  THR n 
5  420  LEU n 
5  421  PHE n 
5  422  LYS n 
5  423  LYS n 
5  424  LEU n 
5  425  THR n 
5  426  LYS n 
5  427  ASP n 
5  428  ILE n 
5  429  PHE n 
5  430  ARG n 
5  431  TYR n 
5  432  MET n 
5  433  GLN n 
5  434  ARG n 
5  435  THR n 
5  436  VAL n 
5  437  GLU n 
5  438  GLU n 
5  439  ALA n 
5  440  HIS n 
5  441  ASP n 
5  442  PHE n 
5  443  ASN n 
5  444  MET n 
5  445  LYS n 
5  446  LEU n 
5  447  ALA n 
5  448  ILE n 
5  449  ASN n 
5  450  ALA n 
5  451  LYS n 
5  452  THR n 
5  453  ILE n 
5  454  THR n 
5  455  SER n 
5  456  GLY n 
5  457  LEU n 
5  458  LYS n 
5  459  TYR n 
5  460  ALA n 
5  461  LEU n 
5  462  ALA n 
5  463  THR n 
5  464  GLY n 
5  465  ASN n 
5  466  TRP n 
5  467  GLY n 
5  468  GLU n 
5  469  GLN n 
5  470  LYS n 
5  471  LYS n 
5  472  ALA n 
5  473  MET n 
5  474  SER n 
5  475  SER n 
5  476  ARG n 
5  477  ALA n 
5  478  GLY n 
5  479  VAL n 
5  480  SER n 
5  481  GLN n 
5  482  VAL n 
5  483  LEU n 
5  484  ASN n 
5  485  ARG n 
5  486  TYR n 
5  487  THR n 
5  488  TYR n 
5  489  SER n 
5  490  SER n 
5  491  THR n 
5  492  LEU n 
5  493  SER n 
5  494  HIS n 
5  495  LEU n 
5  496  ARG n 
5  497  ARG n 
5  498  THR n 
5  499  ASN n 
5  500  THR n 
5  501  PRO n 
5  502  ILE n 
5  503  GLY n 
5  504  ARG n 
5  505  ASP n 
5  506  GLY n 
5  507  LYS n 
5  508  LEU n 
5  509  ALA n 
5  510  LYS n 
5  511  PRO n 
5  512  ARG n 
5  513  GLN n 
5  514  LEU n 
5  515  HIS n 
5  516  ASN n 
5  517  THR n 
5  518  HIS n 
5  519  TRP n 
5  520  GLY n 
5  521  LEU n 
5  522  VAL n 
5  523  CYS n 
5  524  PRO n 
5  525  ALA n 
5  526  GLU n 
5  527  THR n 
5  528  PRO n 
5  529  GLU n 
5  530  GLY n 
5  531  GLN n 
5  532  ALA n 
5  533  CYS n 
5  534  GLY n 
5  535  LEU n 
5  536  VAL n 
5  537  LYS n 
5  538  ASN n 
5  539  LEU n 
5  540  SER n 
5  541  LEU n 
5  542  MET n 
5  543  SER n 
5  544  CYS n 
5  545  ILE n 
5  546  SER n 
5  547  VAL n 
5  548  GLY n 
5  549  THR n 
5  550  ASP n 
5  551  PRO n 
5  552  MET n 
5  553  PRO n 
5  554  ILE n 
5  555  ILE n 
5  556  THR n 
5  557  PHE n 
5  558  LEU n 
5  559  SER n 
5  560  GLU n 
5  561  TRP n 
5  562  GLY n 
5  563  MET n 
5  564  GLU n 
5  565  PRO n 
5  566  LEU n 
5  567  GLU n 
5  568  ASP n 
5  569  TYR n 
5  570  VAL n 
5  571  PRO n 
5  572  HIS n 
5  573  GLN n 
5  574  SER n 
5  575  PRO n 
5  576  ASP n 
5  577  ALA n 
5  578  THR n 
5  579  ARG n 
5  580  VAL n 
5  581  PHE n 
5  582  VAL n 
5  583  ASN n 
5  584  GLY n 
5  585  VAL n 
5  586  TRP n 
5  587  HIS n 
5  588  GLY n 
5  589  VAL n 
5  590  HIS n 
5  591  ARG n 
5  592  ASN n 
5  593  PRO n 
5  594  ALA n 
5  595  ARG n 
5  596  LEU n 
5  597  MET n 
5  598  GLU n 
5  599  THR n 
5  600  LEU n 
5  601  ARG n 
5  602  THR n 
5  603  LEU n 
5  604  ARG n 
5  605  ARG n 
5  606  LYS n 
5  607  GLY n 
5  608  ASP n 
5  609  ILE n 
5  610  ASN n 
5  611  PRO n 
5  612  GLU n 
5  613  VAL n 
5  614  SER n 
5  615  MET n 
5  616  ILE n 
5  617  ARG n 
5  618  ASP n 
5  619  ILE n 
5  620  ARG n 
5  621  GLU n 
5  622  LYS n 
5  623  GLU n 
5  624  LEU n 
5  625  LYS n 
5  626  ILE n 
5  627  PHE n 
5  628  THR n 
5  629  ASP n 
5  630  ALA n 
5  631  GLY n 
5  632  ARG n 
5  633  VAL n 
5  634  TYR n 
5  635  ARG n 
5  636  PRO n 
5  637  LEU n 
5  638  PHE n 
5  639  ILE n 
5  640  VAL n 
5  641  GLU n 
5  642  ASP n 
5  643  ASP n 
5  644  GLU n 
5  645  SER n 
5  646  LEU n 
5  647  GLY n 
5  648  HIS n 
5  649  LYS n 
5  650  GLU n 
5  651  LEU n 
5  652  LYS n 
5  653  VAL n 
5  654  ARG n 
5  655  LYS n 
5  656  GLY n 
5  657  HIS n 
5  658  ILE n 
5  659  ALA n 
5  660  LYS n 
5  661  LEU n 
5  662  MET n 
5  663  ALA n 
5  664  THR n 
5  665  GLU n 
5  666  TYR n 
5  667  GLN n 
5  668  ASP n 
5  669  ILE n 
5  670  GLU n 
5  671  GLY n 
5  672  GLY n 
5  673  PHE n 
5  674  GLU n 
5  675  ASP n 
5  676  VAL n 
5  677  GLU n 
5  678  GLU n 
5  679  TYR n 
5  680  THR n 
5  681  TRP n 
5  682  SER n 
5  683  SER n 
5  684  LEU n 
5  685  LEU n 
5  686  ASN n 
5  687  GLU n 
5  688  GLY n 
5  689  LEU n 
5  690  VAL n 
5  691  GLU n 
5  692  TYR n 
5  693  ILE n 
5  694  ASP n 
5  695  ALA n 
5  696  GLU n 
5  697  GLU n 
5  698  GLU n 
5  699  GLU n 
5  700  SER n 
5  701  ILE n 
5  702  LEU n 
5  703  ILE n 
5  704  ALA n 
5  705  MET n 
5  706  GLN n 
5  707  PRO n 
5  708  GLU n 
5  709  ASP n 
5  710  LEU n 
5  711  GLU n 
5  712  PRO n 
5  713  ALA n 
5  714  GLU n 
5  715  ALA n 
5  716  ASN n 
5  717  GLU n 
5  718  GLU n 
5  719  ASN n 
5  720  ASP n 
5  721  LEU n 
5  722  ASP n 
5  723  VAL n 
5  724  ASP n 
5  725  PRO n 
5  726  ALA n 
5  727  LYS n 
5  728  ARG n 
5  729  ILE n 
5  730  ARG n 
5  731  VAL n 
5  732  SER n 
5  733  HIS n 
5  734  HIS n 
5  735  ALA n 
5  736  THR n 
5  737  THR n 
5  738  PHE n 
5  739  THR n 
5  740  HIS n 
5  741  CYS n 
5  742  GLU n 
5  743  ILE n 
5  744  HIS n 
5  745  PRO n 
5  746  SER n 
5  747  MET n 
5  748  ILE n 
5  749  LEU n 
5  750  GLY n 
5  751  VAL n 
5  752  ALA n 
5  753  ALA n 
5  754  SER n 
5  755  ILE n 
5  756  ILE n 
5  757  PRO n 
5  758  PHE n 
5  759  PRO n 
5  760  ASP n 
5  761  HIS n 
5  762  ASN n 
5  763  GLN n 
5  764  SER n 
5  765  PRO n 
5  766  ARG n 
5  767  ASN n 
5  768  THR n 
5  769  TYR n 
5  770  GLN n 
5  771  SER n 
5  772  ALA n 
5  773  MET n 
5  774  GLY n 
5  775  LYS n 
5  776  GLN n 
5  777  ALA n 
5  778  MET n 
5  779  GLY n 
5  780  VAL n 
5  781  PHE n 
5  782  LEU n 
5  783  THR n 
5  784  ASN n 
5  785  TYR n 
5  786  ASN n 
5  787  VAL n 
5  788  ARG n 
5  789  MET n 
5  790  ASP n 
5  791  THR n 
5  792  MET n 
5  793  ALA n 
5  794  ASN n 
5  795  ILE n 
5  796  LEU n 
5  797  TYR n 
5  798  TYR n 
5  799  PRO n 
5  800  GLN n 
5  801  LYS n 
5  802  PRO n 
5  803  LEU n 
5  804  GLY n 
5  805  THR n 
5  806  THR n 
5  807  ARG n 
5  808  ALA n 
5  809  MET n 
5  810  GLU n 
5  811  TYR n 
5  812  LEU n 
5  813  LYS n 
5  814  PHE n 
5  815  ARG n 
5  816  GLU n 
5  817  LEU n 
5  818  PRO n 
5  819  ALA n 
5  820  GLY n 
5  821  GLN n 
5  822  ASN n 
5  823  ALA n 
5  824  ILE n 
5  825  VAL n 
5  826  ALA n 
5  827  ILE n 
5  828  ALA n 
5  829  CYS n 
5  830  TYR n 
5  831  SER n 
5  832  GLY n 
5  833  TYR n 
5  834  ASN n 
5  835  GLN n 
5  836  GLU n 
5  837  ASP n 
5  838  SER n 
5  839  MET n 
5  840  ILE n 
5  841  MET n 
5  842  ASN n 
5  843  GLN n 
5  844  SER n 
5  845  SER n 
5  846  ILE n 
5  847  ASP n 
5  848  ARG n 
5  849  GLY n 
5  850  LEU n 
5  851  PHE n 
5  852  ARG n 
5  853  SER n 
5  854  LEU n 
5  855  PHE n 
5  856  PHE n 
5  857  ARG n 
5  858  SER n 
5  859  TYR n 
5  860  MET n 
5  861  ASP n 
5  862  GLN n 
5  863  GLU n 
5  864  LYS n 
5  865  LYS n 
5  866  TYR n 
5  867  GLY n 
5  868  MET n 
5  869  SER n 
5  870  ILE n 
5  871  THR n 
5  872  GLU n 
5  873  THR n 
5  874  PHE n 
5  875  GLU n 
5  876  LYS n 
5  877  PRO n 
5  878  GLN n 
5  879  ARG n 
5  880  THR n 
5  881  ASN n 
5  882  THR n 
5  883  LEU n 
5  884  ARG n 
5  885  MET n 
5  886  LYS n 
5  887  HIS n 
5  888  GLY n 
5  889  THR n 
5  890  TYR n 
5  891  ASP n 
5  892  LYS n 
5  893  LEU n 
5  894  ASP n 
5  895  ASP n 
5  896  ASP n 
5  897  GLY n 
5  898  LEU n 
5  899  ILE n 
5  900  ALA n 
5  901  PRO n 
5  902  GLY n 
5  903  VAL n 
5  904  ARG n 
5  905  VAL n 
5  906  SER n 
5  907  GLY n 
5  908  GLU n 
5  909  ASP n 
5  910  VAL n 
5  911  ILE n 
5  912  ILE n 
5  913  GLY n 
5  914  LYS n 
5  915  THR n 
5  916  THR n 
5  917  PRO n 
5  918  ILE n 
5  919  SER n 
5  920  PRO n 
5  921  ASP n 
5  922  GLU n 
5  923  GLU n 
5  924  GLU n 
5  925  LEU n 
5  926  GLY n 
5  927  GLN n 
5  928  ARG n 
5  929  THR n 
5  930  ALA n 
5  931  TYR n 
5  932  HIS n 
5  933  SER n 
5  934  LYS n 
5  935  ARG n 
5  936  ASP n 
5  937  ALA n 
5  938  SER n 
5  939  THR n 
5  940  PRO n 
5  941  LEU n 
5  942  ARG n 
5  943  SER n 
5  944  THR n 
5  945  GLU n 
5  946  ASN n 
5  947  GLY n 
5  948  ILE n 
5  949  VAL n 
5  950  ASP n 
5  951  GLN n 
5  952  VAL n 
5  953  LEU n 
5  954  VAL n 
5  955  THR n 
5  956  THR n 
5  957  ASN n 
5  958  GLN n 
5  959  ASP n 
5  960  GLY n 
5  961  LEU n 
5  962  LYS n 
5  963  PHE n 
5  964  VAL n 
5  965  LYS n 
5  966  VAL n 
5  967  ARG n 
5  968  VAL n 
5  969  ARG n 
5  970  THR n 
5  971  THR n 
5  972  LYS n 
5  973  ILE n 
5  974  PRO n 
5  975  GLN n 
5  976  ILE n 
5  977  GLY n 
5  978  ASP n 
5  979  LYS n 
5  980  PHE n 
5  981  ALA n 
5  982  SER n 
5  983  ARG n 
5  984  HIS n 
5  985  GLY n 
5  986  GLN n 
5  987  LYS n 
5  988  GLY n 
5  989  THR n 
5  990  ILE n 
5  991  GLY n 
5  992  ILE n 
5  993  THR n 
5  994  TYR n 
5  995  ARG n 
5  996  ARG n 
5  997  GLU n 
5  998  ASP n 
5  999  MET n 
5  1000 PRO n 
5  1001 PHE n 
5  1002 THR n 
5  1003 ALA n 
5  1004 GLU n 
5  1005 GLY n 
5  1006 ILE n 
5  1007 VAL n 
5  1008 PRO n 
5  1009 ASP n 
5  1010 LEU n 
5  1011 ILE n 
5  1012 ILE n 
5  1013 ASN n 
5  1014 PRO n 
5  1015 HIS n 
5  1016 ALA n 
5  1017 ILE n 
5  1018 PRO n 
5  1019 SER n 
5  1020 ARG n 
5  1021 MET n 
5  1022 THR n 
5  1023 VAL n 
5  1024 ALA n 
5  1025 HIS n 
5  1026 LEU n 
5  1027 ILE n 
5  1028 GLU n 
5  1029 CYS n 
5  1030 LEU n 
5  1031 LEU n 
5  1032 SER n 
5  1033 LYS n 
5  1034 VAL n 
5  1035 ALA n 
5  1036 ALA n 
5  1037 LEU n 
5  1038 SER n 
5  1039 GLY n 
5  1040 ASN n 
5  1041 GLU n 
5  1042 GLY n 
5  1043 ASP n 
5  1044 ALA n 
5  1045 SER n 
5  1046 PRO n 
5  1047 PHE n 
5  1048 THR n 
5  1049 ASP n 
5  1050 ILE n 
5  1051 THR n 
5  1052 VAL n 
5  1053 GLU n 
5  1054 GLY n 
5  1055 ILE n 
5  1056 SER n 
5  1057 LYS n 
5  1058 LEU n 
5  1059 LEU n 
5  1060 ARG n 
5  1061 GLU n 
5  1062 HIS n 
5  1063 GLY n 
5  1064 TYR n 
5  1065 GLN n 
5  1066 SER n 
5  1067 ARG n 
5  1068 GLY n 
5  1069 PHE n 
5  1070 GLU n 
5  1071 VAL n 
5  1072 MET n 
5  1073 TYR n 
5  1074 ASN n 
5  1075 GLY n 
5  1076 HIS n 
5  1077 THR n 
5  1078 GLY n 
5  1079 LYS n 
5  1080 LYS n 
5  1081 LEU n 
5  1082 MET n 
5  1083 ALA n 
5  1084 GLN n 
5  1085 ILE n 
5  1086 PHE n 
5  1087 PHE n 
5  1088 GLY n 
5  1089 PRO n 
5  1090 THR n 
5  1091 TYR n 
5  1092 TYR n 
5  1093 GLN n 
5  1094 ARG n 
5  1095 LEU n 
5  1096 ARG n 
5  1097 HIS n 
5  1098 MET n 
5  1099 VAL n 
5  1100 ASP n 
5  1101 ASP n 
5  1102 LYS n 
5  1103 ILE n 
5  1104 HIS n 
5  1105 ALA n 
5  1106 ARG n 
5  1107 ALA n 
5  1108 ARG n 
5  1109 GLY n 
5  1110 PRO n 
5  1111 MET n 
5  1112 GLN n 
5  1113 VAL n 
5  1114 LEU n 
5  1115 THR n 
5  1116 ARG n 
5  1117 GLN n 
5  1118 PRO n 
5  1119 VAL n 
5  1120 GLU n 
5  1121 GLY n 
5  1122 ARG n 
5  1123 SER n 
5  1124 ARG n 
5  1125 ASP n 
5  1126 GLY n 
5  1127 GLY n 
5  1128 LEU n 
5  1129 ARG n 
5  1130 PHE n 
5  1131 GLY n 
5  1132 GLU n 
5  1133 MET n 
5  1134 GLU n 
5  1135 ARG n 
5  1136 ASP n 
5  1137 CYS n 
5  1138 MET n 
5  1139 ILE n 
5  1140 ALA n 
5  1141 HIS n 
5  1142 GLY n 
5  1143 ALA n 
5  1144 ALA n 
5  1145 SER n 
5  1146 PHE n 
5  1147 LEU n 
5  1148 LYS n 
5  1149 GLU n 
5  1150 ARG n 
5  1151 LEU n 
5  1152 MET n 
5  1153 GLU n 
5  1154 ALA n 
5  1155 SER n 
5  1156 ASP n 
5  1157 ALA n 
5  1158 PHE n 
5  1159 ARG n 
5  1160 VAL n 
5  1161 HIS n 
5  1162 ILE n 
5  1163 CYS n 
5  1164 GLY n 
5  1165 ILE n 
5  1166 CYS n 
5  1167 GLY n 
5  1168 LEU n 
5  1169 MET n 
5  1170 THR n 
5  1171 VAL n 
5  1172 ILE n 
5  1173 ALA n 
5  1174 LYS n 
5  1175 LEU n 
5  1176 ASN n 
5  1177 HIS n 
5  1178 ASN n 
5  1179 GLN n 
5  1180 PHE n 
5  1181 GLU n 
5  1182 CYS n 
5  1183 LYS n 
5  1184 GLY n 
5  1185 CYS n 
5  1186 ASP n 
5  1187 ASN n 
5  1188 LYS n 
5  1189 ILE n 
5  1190 ASP n 
5  1191 ILE n 
5  1192 TYR n 
5  1193 GLN n 
5  1194 ILE n 
5  1195 HIS n 
5  1196 ILE n 
5  1197 PRO n 
5  1198 TYR n 
5  1199 ALA n 
5  1200 ALA n 
5  1201 LYS n 
5  1202 LEU n 
5  1203 LEU n 
5  1204 PHE n 
5  1205 GLN n 
5  1206 GLU n 
5  1207 LEU n 
5  1208 MET n 
5  1209 ALA n 
5  1210 MET n 
5  1211 ASN n 
5  1212 ILE n 
5  1213 THR n 
5  1214 PRO n 
5  1215 ARG n 
5  1216 LEU n 
5  1217 TYR n 
5  1218 THR n 
5  1219 ASP n 
5  1220 ARG n 
5  1221 SER n 
5  1222 ARG n 
5  1223 ASP n 
5  1224 PHE n 
6  1    MET n 
6  2    SER n 
6  3    GLU n 
6  4    GLU n 
6  5    GLY n 
6  6    PRO n 
6  7    GLN n 
6  8    VAL n 
6  9    LYS n 
6  10   ILE n 
6  11   ARG n 
6  12   GLU n 
6  13   ALA n 
6  14   SER n 
6  15   LYS n 
6  16   ASP n 
6  17   ASN n 
6  18   VAL n 
6  19   ASP n 
6  20   PHE n 
6  21   ILE n 
6  22   LEU n 
6  23   SER n 
6  24   ASN n 
6  25   VAL n 
6  26   ASP n 
6  27   LEU n 
6  28   ALA n 
6  29   MET n 
6  30   ALA n 
6  31   ASN n 
6  32   SER n 
6  33   LEU n 
6  34   ARG n 
6  35   ARG n 
6  36   VAL n 
6  37   MET n 
6  38   ILE n 
6  39   ALA n 
6  40   GLU n 
6  41   ILE n 
6  42   PRO n 
6  43   THR n 
6  44   LEU n 
6  45   ALA n 
6  46   ILE n 
6  47   ASP n 
6  48   SER n 
6  49   VAL n 
6  50   GLU n 
6  51   VAL n 
6  52   GLU n 
6  53   THR n 
6  54   ASN n 
6  55   THR n 
6  56   THR n 
6  57   VAL n 
6  58   LEU n 
6  59   ALA n 
6  60   ASP n 
6  61   GLU n 
6  62   PHE n 
6  63   ILE n 
6  64   ALA n 
6  65   HIS n 
6  66   ARG n 
6  67   LEU n 
6  68   GLY n 
6  69   LEU n 
6  70   ILE n 
6  71   PRO n 
6  72   LEU n 
6  73   GLN n 
6  74   SER n 
6  75   MET n 
6  76   ASP n 
6  77   ILE n 
6  78   GLU n 
6  79   GLN n 
6  80   LEU n 
6  81   GLU n 
6  82   TYR n 
6  83   SER n 
6  84   ARG n 
6  85   ASP n 
6  86   CYS n 
6  87   PHE n 
6  88   CYS n 
6  89   GLU n 
6  90   ASP n 
6  91   HIS n 
6  92   CYS n 
6  93   ASP n 
6  94   LYS n 
6  95   CYS n 
6  96   SER n 
6  97   VAL n 
6  98   VAL n 
6  99   LEU n 
6  100  THR n 
6  101  LEU n 
6  102  GLN n 
6  103  ALA n 
6  104  PHE n 
6  105  GLY n 
6  106  GLU n 
6  107  SER n 
6  108  GLU n 
6  109  SER n 
6  110  THR n 
6  111  THR n 
6  112  ASN n 
6  113  VAL n 
6  114  TYR n 
6  115  SER n 
6  116  LYS n 
6  117  ASP n 
6  118  LEU n 
6  119  VAL n 
6  120  ILE n 
6  121  VAL n 
6  122  SER n 
6  123  ASN n 
6  124  LEU n 
6  125  MET n 
6  126  GLY n 
6  127  ARG n 
6  128  ASN n 
6  129  ILE n 
6  130  GLY n 
6  131  HIS n 
6  132  PRO n 
6  133  ILE n 
6  134  ILE n 
6  135  GLN n 
6  136  ASP n 
6  137  LYS n 
6  138  GLU n 
6  139  GLY n 
6  140  ASN n 
6  141  GLY n 
6  142  VAL n 
6  143  LEU n 
6  144  ILE n 
6  145  CYS n 
6  146  LYS n 
6  147  LEU n 
6  148  ARG n 
6  149  LYS n 
6  150  GLY n 
6  151  GLN n 
6  152  GLU n 
6  153  LEU n 
6  154  LYS n 
6  155  LEU n 
6  156  THR n 
6  157  CYS n 
6  158  VAL n 
6  159  ALA n 
6  160  LYS n 
6  161  LYS n 
6  162  GLY n 
6  163  ILE n 
6  164  ALA n 
6  165  LYS n 
6  166  GLU n 
6  167  HIS n 
6  168  ALA n 
6  169  LYS n 
6  170  TRP n 
6  171  GLY n 
6  172  PRO n 
6  173  ALA n 
6  174  ALA n 
6  175  ALA n 
6  176  ILE n 
6  177  GLU n 
6  178  PHE n 
6  179  GLU n 
6  180  TYR n 
6  181  ASP n 
6  182  PRO n 
6  183  TRP n 
6  184  ASN n 
6  185  LYS n 
6  186  LEU n 
6  187  LYS n 
6  188  HIS n 
6  189  THR n 
6  190  ASP n 
6  191  TYR n 
6  192  TRP n 
6  193  TYR n 
6  194  GLU n 
6  195  GLN n 
6  196  ASP n 
6  197  SER n 
6  198  ALA n 
6  199  LYS n 
6  200  GLU n 
6  201  TRP n 
6  202  PRO n 
6  203  GLN n 
6  204  SER n 
6  205  LYS n 
6  206  ASN n 
6  207  CYS n 
6  208  GLU n 
6  209  TYR n 
6  210  GLU n 
6  211  ASP n 
6  212  PRO n 
6  213  PRO n 
6  214  ASN n 
6  215  GLU n 
6  216  GLY n 
6  217  ASP n 
6  218  PRO n 
6  219  PHE n 
6  220  ASP n 
6  221  TYR n 
6  222  LYS n 
6  223  ALA n 
6  224  GLN n 
6  225  ALA n 
6  226  ASP n 
6  227  THR n 
6  228  PHE n 
6  229  TYR n 
6  230  MET n 
6  231  ASN n 
6  232  VAL n 
6  233  GLU n 
6  234  SER n 
6  235  VAL n 
6  236  GLY n 
6  237  SER n 
6  238  ILE n 
6  239  PRO n 
6  240  VAL n 
6  241  ASP n 
6  242  GLN n 
6  243  VAL n 
6  244  VAL n 
6  245  VAL n 
6  246  ARG n 
6  247  GLY n 
6  248  ILE n 
6  249  ASP n 
6  250  THR n 
6  251  LEU n 
6  252  GLN n 
6  253  LYS n 
6  254  LYS n 
6  255  VAL n 
6  256  ALA n 
6  257  SER n 
6  258  ILE n 
6  259  LEU n 
6  260  LEU n 
6  261  ALA n 
6  262  LEU n 
6  263  THR n 
6  264  GLN n 
6  265  MET n 
6  266  ASP n 
6  267  GLN n 
6  268  ASP n 
6  269  LYS n 
6  270  VAL n 
6  271  ASN n 
6  272  PHE n 
6  273  ALA n 
6  274  SER n 
6  275  GLY n 
6  276  ASP n 
6  277  ASN n 
6  278  ASN n 
6  279  THR n 
6  280  ALA n 
6  281  SER n 
6  282  ASN n 
6  283  MET n 
6  284  LEU n 
6  285  GLY n 
6  286  SER n 
6  287  ASN n 
6  288  GLU n 
6  289  ASP n 
6  290  VAL n 
6  291  MET n 
6  292  MET n 
6  293  THR n 
6  294  GLY n 
6  295  ALA n 
6  296  GLU n 
6  297  GLN n 
6  298  ASP n 
6  299  PRO n 
6  300  TYR n 
6  301  SER n 
6  302  ASN n 
6  303  ALA n 
6  304  SER n 
6  305  GLN n 
6  306  MET n 
6  307  GLY n 
6  308  ASN n 
6  309  THR n 
6  310  GLY n 
6  311  SER n 
6  312  GLY n 
6  313  GLY n 
6  314  TYR n 
6  315  ASP n 
6  316  ASN n 
6  317  ALA n 
6  318  TRP n 
7  1    MET n 
7  2    ASP n 
7  3    GLN n 
7  4    GLU n 
7  5    ASN n 
7  6    GLU n 
7  7    ARG n 
7  8    ASN n 
7  9    ILE n 
7  10   SER n 
7  11   ARG n 
7  12   LEU n 
7  13   TRP n 
7  14   ARG n 
7  15   ALA n 
7  16   PHE n 
7  17   ARG n 
7  18   THR n 
7  19   VAL n 
7  20   LYS n 
7  21   GLU n 
7  22   MET n 
7  23   VAL n 
7  24   LYS n 
7  25   ASP n 
7  26   ARG n 
7  27   GLY n 
7  28   TYR n 
7  29   PHE n 
7  30   ILE n 
7  31   THR n 
7  32   GLN n 
7  33   GLU n 
7  34   GLU n 
7  35   VAL n 
7  36   GLU n 
7  37   LEU n 
7  38   PRO n 
7  39   LEU n 
7  40   GLU n 
7  41   ASP n 
7  42   PHE n 
7  43   LYS n 
7  44   ALA n 
7  45   LYS n 
7  46   TYR n 
7  47   CYS n 
7  48   ASP n 
7  49   SER n 
7  50   MET n 
7  51   GLY n 
7  52   ARG n 
7  53   PRO n 
7  54   GLN n 
7  55   ARG n 
7  56   LYS n 
7  57   MET n 
7  58   MET n 
7  59   SER n 
7  60   PHE n 
7  61   GLN n 
7  62   ALA n 
7  63   ASN n 
7  64   PRO n 
7  65   THR n 
7  66   GLU n 
7  67   GLU n 
7  68   SER n 
7  69   ILE n 
7  70   SER n 
7  71   LYS n 
7  72   PHE n 
7  73   PRO n 
7  74   ASP n 
7  75   MET n 
7  76   GLY n 
7  77   SER n 
7  78   LEU n 
7  79   TRP n 
7  80   VAL n 
7  81   GLU n 
7  82   PHE n 
7  83   CYS n 
7  84   ASP n 
7  85   GLU n 
7  86   PRO n 
7  87   SER n 
7  88   VAL n 
7  89   GLY n 
7  90   VAL n 
7  91   LYS n 
7  92   THR n 
7  93   MET n 
7  94   LYS n 
7  95   THR n 
7  96   PHE n 
7  97   VAL n 
7  98   ILE n 
7  99   HIS n 
7  100  ILE n 
7  101  GLN n 
7  102  GLU n 
7  103  LYS n 
7  104  ASN n 
7  105  PHE n 
7  106  GLN n 
7  107  THR n 
7  108  GLY n 
7  109  ILE n 
7  110  PHE n 
7  111  VAL n 
7  112  TYR n 
7  113  GLN n 
7  114  ASN n 
7  115  ASN n 
7  116  ILE n 
7  117  THR n 
7  118  PRO n 
7  119  SER n 
7  120  ALA n 
7  121  MET n 
7  122  LYS n 
7  123  LEU n 
7  124  VAL n 
7  125  PRO n 
7  126  SER n 
7  127  ILE n 
7  128  PRO n 
7  129  PRO n 
7  130  ALA n 
7  131  THR n 
7  132  ILE n 
7  133  GLU n 
7  134  THR n 
7  135  PHE n 
7  136  ASN n 
7  137  GLU n 
7  138  ALA n 
7  139  ALA n 
7  140  LEU n 
7  141  VAL n 
7  142  VAL n 
7  143  ASN n 
7  144  ILE n 
7  145  THR n 
7  146  HIS n 
7  147  HIS n 
7  148  GLU n 
7  149  LEU n 
7  150  VAL n 
7  151  PRO n 
7  152  LYS n 
7  153  HIS n 
7  154  ILE n 
7  155  ARG n 
7  156  LEU n 
7  157  SER n 
7  158  SER n 
7  159  ASP n 
7  160  GLU n 
7  161  LYS n 
7  162  ARG n 
7  163  GLU n 
7  164  LEU n 
7  165  LEU n 
7  166  LYS n 
7  167  ARG n 
7  168  TYR n 
7  169  ARG n 
7  170  LEU n 
7  171  LYS n 
7  172  GLU n 
7  173  SER n 
7  174  GLN n 
7  175  LEU n 
7  176  PRO n 
7  177  ARG n 
7  178  ILE n 
7  179  GLN n 
7  180  ARG n 
7  181  ALA n 
7  182  ASP n 
7  183  PRO n 
7  184  VAL n 
7  185  ALA n 
7  186  LEU n 
7  187  TYR n 
7  188  LEU n 
7  189  GLY n 
7  190  LEU n 
7  191  LYS n 
7  192  ARG n 
7  193  GLY n 
7  194  GLU n 
7  195  VAL n 
7  196  VAL n 
7  197  LYS n 
7  198  ILE n 
7  199  ILE n 
7  200  ARG n 
7  201  LYS n 
7  202  SER n 
7  203  GLU n 
7  204  THR n 
7  205  SER n 
7  206  GLY n 
7  207  ARG n 
7  208  TYR n 
7  209  ALA n 
7  210  SER n 
7  211  TYR n 
7  212  ARG n 
7  213  ILE n 
7  214  CYS n 
7  215  MET n 
8  1    MET n 
8  2    SER n 
8  3    ASP n 
8  4    TYR n 
8  5    GLU n 
8  6    GLU n 
8  7    ALA n 
8  8    PHE n 
8  9    ASN n 
8  10   ASP n 
8  11   GLY n 
8  12   ASN n 
8  13   GLU n 
8  14   ASN n 
8  15   PHE n 
8  16   GLU n 
8  17   ASP n 
8  18   PHE n 
8  19   ASP n 
8  20   VAL n 
8  21   GLU n 
8  22   HIS n 
8  23   PHE n 
8  24   SER n 
8  25   ASP n 
8  26   GLU n 
8  27   GLU n 
8  28   THR n 
8  29   TYR n 
8  30   GLU n 
8  31   GLU n 
8  32   LYS n 
8  33   PRO n 
8  34   GLN n 
8  35   PHE n 
8  36   LYS n 
8  37   ASP n 
8  38   GLY n 
8  39   GLU n 
8  40   THR n 
8  41   THR n 
8  42   ASP n 
8  43   ALA n 
8  44   ASN n 
8  45   GLY n 
8  46   LYS n 
8  47   THR n 
8  48   ILE n 
8  49   VAL n 
8  50   THR n 
8  51   GLY n 
8  52   GLY n 
8  53   ASN n 
8  54   GLY n 
8  55   PRO n 
8  56   GLU n 
8  57   ASP n 
8  58   PHE n 
8  59   GLN n 
8  60   GLN n 
8  61   HIS n 
8  62   GLU n 
8  63   GLN n 
8  64   ILE n 
8  65   ARG n 
8  66   ARG n 
8  67   LYS n 
8  68   THR n 
8  69   LEU n 
8  70   LYS n 
8  71   GLU n 
8  72   LYS n 
8  73   ALA n 
8  74   ILE n 
8  75   PRO n 
8  76   LYS n 
8  77   ASP n 
8  78   GLN n 
8  79   ARG n 
8  80   ALA n 
8  81   THR n 
8  82   THR n 
8  83   PRO n 
8  84   TYR n 
8  85   MET n 
8  86   THR n 
8  87   LYS n 
8  88   TYR n 
8  89   GLU n 
8  90   ARG n 
8  91   ALA n 
8  92   ARG n 
8  93   ILE n 
8  94   LEU n 
8  95   GLY n 
8  96   THR n 
8  97   ARG n 
8  98   ALA n 
8  99   LEU n 
8  100  GLN n 
8  101  ILE n 
8  102  SER n 
8  103  MET n 
8  104  ASN n 
8  105  ALA n 
8  106  PRO n 
8  107  VAL n 
8  108  PHE n 
8  109  VAL n 
8  110  ASP n 
8  111  LEU n 
8  112  GLU n 
8  113  GLY n 
8  114  GLU n 
8  115  THR n 
8  116  ASP n 
8  117  PRO n 
8  118  LEU n 
8  119  ARG n 
8  120  ILE n 
8  121  ALA n 
8  122  MET n 
8  123  LYS n 
8  124  GLU n 
8  125  LEU n 
8  126  ALA n 
8  127  GLU n 
8  128  LYS n 
8  129  LYS n 
8  130  ILE n 
8  131  PRO n 
8  132  LEU n 
8  133  VAL n 
8  134  ILE n 
8  135  ARG n 
8  136  ARG n 
8  137  TYR n 
8  138  LEU n 
8  139  PRO n 
8  140  ASP n 
8  141  GLY n 
8  142  SER n 
8  143  PHE n 
8  144  GLU n 
8  145  ASP n 
8  146  TRP n 
8  147  SER n 
8  148  VAL n 
8  149  GLU n 
8  150  GLU n 
8  151  LEU n 
8  152  ILE n 
8  153  VAL n 
8  154  ASP n 
8  155  LEU n 
9  1    MET n 
9  2    SER n 
9  3    ASN n 
9  4    THR n 
9  5    LEU n 
9  6    PHE n 
9  7    ASP n 
9  8    ASP n 
9  9    ILE n 
9  10   PHE n 
9  11   GLN n 
9  12   VAL n 
9  13   SER n 
9  14   GLU n 
9  15   VAL n 
9  16   ASP n 
9  17   PRO n 
9  18   GLY n 
9  19   ARG n 
9  20   TYR n 
9  21   ASN n 
9  22   LYS n 
9  23   VAL n 
9  24   CYS n 
9  25   ARG n 
9  26   ILE n 
9  27   GLU n 
9  28   ALA n 
9  29   ALA n 
9  30   SER n 
9  31   THR n 
9  32   THR n 
9  33   GLN n 
9  34   ASP n 
9  35   GLN n 
9  36   CYS n 
9  37   LYS n 
9  38   LEU n 
9  39   THR n 
9  40   LEU n 
9  41   ASP n 
9  42   ILE n 
9  43   ASN n 
9  44   VAL n 
9  45   GLU n 
9  46   LEU n 
9  47   PHE n 
9  48   PRO n 
9  49   VAL n 
9  50   ALA n 
9  51   ALA n 
9  52   GLN n 
9  53   ASP n 
9  54   SER n 
9  55   LEU n 
9  56   THR n 
9  57   VAL n 
9  58   THR n 
9  59   ILE n 
9  60   ALA n 
9  61   SER n 
9  62   SER n 
9  63   LEU n 
9  64   ASN n 
9  65   LEU n 
9  66   GLU n 
9  67   ASP n 
9  68   THR n 
9  69   PRO n 
9  70   ALA n 
9  71   ASN n 
9  72   ASP n 
9  73   SER n 
9  74   SER n 
9  75   ALA n 
9  76   THR n 
9  77   ARG n 
9  78   SER n 
9  79   TRP n 
9  80   ARG n 
9  81   PRO n 
9  82   PRO n 
9  83   GLN n 
9  84   ALA n 
9  85   GLY n 
9  86   ASP n 
9  87   ARG n 
9  88   SER n 
9  89   LEU n 
9  90   ALA n 
9  91   ASP n 
9  92   ASP n 
9  93   TYR n 
9  94   ASP n 
9  95   TYR n 
9  96   VAL n 
9  97   MET n 
9  98   TYR n 
9  99   GLY n 
9  100  THR n 
9  101  ALA n 
9  102  TYR n 
9  103  LYS n 
9  104  PHE n 
9  105  GLU n 
9  106  GLU n 
9  107  VAL n 
9  108  SER n 
9  109  LYS n 
9  110  ASP n 
9  111  LEU n 
9  112  ILE n 
9  113  ALA n 
9  114  VAL n 
9  115  TYR n 
9  116  TYR n 
9  117  SER n 
9  118  PHE n 
9  119  GLY n 
9  120  GLY n 
9  121  LEU n 
9  122  LEU n 
9  123  MET n 
9  124  ARG n 
9  125  LEU n 
9  126  GLU n 
9  127  GLY n 
9  128  ASN n 
9  129  TYR n 
9  130  ARG n 
9  131  ASN n 
9  132  LEU n 
9  133  ASN n 
9  134  ASN n 
9  135  LEU n 
9  136  LYS n 
9  137  GLN n 
9  138  GLU n 
9  139  ASN n 
9  140  ALA n 
9  141  TYR n 
9  142  LEU n 
9  143  LEU n 
9  144  ILE n 
9  145  ARG n 
9  146  ARG n 
10 1    MET n 
10 2    THR n 
10 3    THR n 
10 4    PHE n 
10 5    ARG n 
10 6    PHE n 
10 7    CYS n 
10 8    ARG n 
10 9    ASP n 
10 10   CYS n 
10 11   ASN n 
10 12   ASN n 
10 13   MET n 
10 14   LEU n 
10 15   TYR n 
10 16   PRO n 
10 17   ARG n 
10 18   GLU n 
10 19   ASP n 
10 20   LYS n 
10 21   GLU n 
10 22   ASN n 
10 23   ASN n 
10 24   ARG n 
10 25   LEU n 
10 26   LEU n 
10 27   PHE n 
10 28   GLU n 
10 29   CYS n 
10 30   ARG n 
10 31   THR n 
10 32   CYS n 
10 33   SER n 
10 34   TYR n 
10 35   VAL n 
10 36   GLU n 
10 37   GLU n 
10 38   ALA n 
10 39   GLY n 
10 40   SER n 
10 41   PRO n 
10 42   LEU n 
10 43   VAL n 
10 44   TYR n 
10 45   ARG n 
10 46   HIS n 
10 47   GLU n 
10 48   LEU n 
10 49   ILE n 
10 50   THR n 
10 51   ASN n 
10 52   ILE n 
10 53   GLY n 
10 54   GLU n 
10 55   THR n 
10 56   ALA n 
10 57   GLY n 
10 58   VAL n 
10 59   VAL n 
10 60   GLN n 
10 61   ASP n 
10 62   ILE n 
10 63   GLY n 
10 64   SER n 
10 65   ASP n 
10 66   PRO n 
10 67   THR n 
10 68   LEU n 
10 69   PRO n 
10 70   ARG n 
10 71   SER n 
10 72   ASP n 
10 73   ARG n 
10 74   GLU n 
10 75   CYS n 
10 76   PRO n 
10 77   LYS n 
10 78   CYS n 
10 79   HIS n 
10 80   SER n 
10 81   ARG n 
10 82   GLU n 
10 83   ASN n 
10 84   VAL n 
10 85   PHE n 
10 86   PHE n 
10 87   GLN n 
10 88   SER n 
10 89   GLN n 
10 90   GLN n 
10 91   ARG n 
10 92   ARG n 
10 93   LYS n 
10 94   ASP n 
10 95   THR n 
10 96   SER n 
10 97   MET n 
10 98   VAL n 
10 99   LEU n 
10 100  PHE n 
10 101  PHE n 
10 102  VAL n 
10 103  CYS n 
10 104  LEU n 
10 105  SER n 
10 106  CYS n 
10 107  SER n 
10 108  HIS n 
10 109  ILE n 
10 110  PHE n 
10 111  THR n 
10 112  SER n 
10 113  ASP n 
10 114  GLN n 
10 115  LYS n 
10 116  ASN n 
10 117  LYS n 
10 118  ARG n 
10 119  THR n 
10 120  GLN n 
10 121  PHE n 
10 122  SER n 
11 1    MET n 
11 2    ILE n 
11 3    VAL n 
11 4    PRO n 
11 5    VAL n 
11 6    ARG n 
11 7    CYS n 
11 8    PHE n 
11 9    SER n 
11 10   CYS n 
11 11   GLY n 
11 12   LYS n 
11 13   VAL n 
11 14   VAL n 
11 15   GLY n 
11 16   ASP n 
11 17   LYS n 
11 18   TRP n 
11 19   GLU n 
11 20   SER n 
11 21   TYR n 
11 22   LEU n 
11 23   ASN n 
11 24   LEU n 
11 25   LEU n 
11 26   GLN n 
11 27   GLU n 
11 28   ASP n 
11 29   GLU n 
11 30   LEU n 
11 31   ASP n 
11 32   GLU n 
11 33   GLY n 
11 34   THR n 
11 35   ALA n 
11 36   LEU n 
11 37   SER n 
11 38   ARG n 
11 39   LEU n 
11 40   GLY n 
11 41   LEU n 
11 42   LYS n 
11 43   ARG n 
11 44   TYR n 
11 45   CYS n 
11 46   CYS n 
11 47   ARG n 
11 48   ARG n 
11 49   MET n 
11 50   ILE n 
11 51   LEU n 
11 52   THR n 
11 53   HIS n 
11 54   VAL n 
11 55   ASP n 
11 56   LEU n 
11 57   ILE n 
11 58   GLU n 
11 59   LYS n 
11 60   PHE n 
11 61   LEU n 
11 62   ARG n 
11 63   TYR n 
11 64   ASN n 
11 65   PRO n 
11 66   LEU n 
11 67   GLU n 
11 68   LYS n 
11 69   ARG n 
11 70   ASP n 
12 1    MET n 
12 2    ASN n 
12 3    ALA n 
12 4    PRO n 
12 5    ASP n 
12 6    ARG n 
12 7    PHE n 
12 8    GLU n 
12 9    LEU n 
12 10   PHE n 
12 11   LEU n 
12 12   LEU n 
12 13   GLY n 
12 14   GLU n 
12 15   GLY n 
12 16   GLU n 
12 17   SER n 
12 18   LYS n 
12 19   LEU n 
12 20   LYS n 
12 21   ILE n 
12 22   ASP n 
12 23   PRO n 
12 24   ASP n 
12 25   THR n 
12 26   LYS n 
12 27   ALA n 
12 28   PRO n 
12 29   ASN n 
12 30   ALA n 
12 31   VAL n 
12 32   VAL n 
12 33   ILE n 
12 34   THR n 
12 35   PHE n 
12 36   GLU n 
12 37   LYS n 
12 38   GLU n 
12 39   ASP n 
12 40   HIS n 
12 41   THR n 
12 42   LEU n 
12 43   GLY n 
12 44   ASN n 
12 45   LEU n 
12 46   ILE n 
12 47   ARG n 
12 48   ALA n 
12 49   GLU n 
12 50   LEU n 
12 51   LEU n 
12 52   ASN n 
12 53   ASP n 
12 54   ARG n 
12 55   LYS n 
12 56   VAL n 
12 57   LEU n 
12 58   PHE n 
12 59   ALA n 
12 60   ALA n 
12 61   TYR n 
12 62   LYS n 
12 63   VAL n 
12 64   GLU n 
12 65   HIS n 
12 66   PRO n 
12 67   PHE n 
12 68   PHE n 
12 69   ALA n 
12 70   ARG n 
12 71   PHE n 
12 72   LYS n 
12 73   LEU n 
12 74   ARG n 
12 75   ILE n 
12 76   GLN n 
12 77   THR n 
12 78   THR n 
12 79   GLU n 
12 80   GLY n 
12 81   TYR n 
12 82   ASP n 
12 83   PRO n 
12 84   LYS n 
12 85   ASP n 
12 86   ALA n 
12 87   LEU n 
12 88   LYS n 
12 89   ASN n 
12 90   ALA n 
12 91   CYS n 
12 92   ASN n 
12 93   SER n 
12 94   ILE n 
12 95   ILE n 
12 96   ASN n 
12 97   LYS n 
12 98   LEU n 
12 99   GLY n 
12 100  ALA n 
12 101  LEU n 
12 102  LYS n 
12 103  THR n 
12 104  ASN n 
12 105  PHE n 
12 106  GLU n 
12 107  THR n 
12 108  GLU n 
12 109  TRP n 
12 110  ASN n 
12 111  LEU n 
12 112  GLN n 
12 113  THR n 
12 114  LEU n 
12 115  ALA n 
12 116  ALA n 
12 117  ASP n 
12 118  ASP n 
12 119  ALA n 
12 120  PHE n 
13 1    MET n 
13 2    SER n 
13 3    ARG n 
13 4    GLU n 
13 5    GLY n 
13 6    PHE n 
13 7    GLN n 
13 8    ILE n 
13 9    PRO n 
13 10   THR n 
13 11   ASN n 
13 12   LEU n 
13 13   ASP n 
13 14   ALA n 
13 15   ALA n 
13 16   ALA n 
13 17   ALA n 
13 18   GLY n 
13 19   THR n 
13 20   SER n 
13 21   GLN n 
13 22   ALA n 
13 23   ARG n 
13 24   THR n 
13 25   ALA n 
13 26   THR n 
13 27   LEU n 
13 28   LYS n 
13 29   TYR n 
13 30   ILE n 
13 31   CYS n 
13 32   ALA n 
13 33   GLU n 
13 34   CYS n 
13 35   SER n 
13 36   SER n 
13 37   LYS n 
13 38   LEU n 
13 39   SER n 
13 40   LEU n 
13 41   SER n 
13 42   ARG n 
13 43   THR n 
13 44   ASP n 
13 45   ALA n 
13 46   VAL n 
13 47   ARG n 
13 48   CYS n 
13 49   LYS n 
13 50   ASP n 
13 51   CYS n 
13 52   GLY n 
13 53   HIS n 
13 54   ARG n 
13 55   ILE n 
13 56   LEU n 
13 57   LEU n 
13 58   LYS n 
13 59   ALA n 
13 60   ARG n 
13 61   THR n 
13 62   LYS n 
13 63   ARG n 
13 64   LEU n 
13 65   VAL n 
13 66   GLN n 
13 67   PHE n 
13 68   GLU n 
13 69   ALA n 
13 70   ARG n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
4  1 sample 1 1733 
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 1 1224 
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 1 318  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 1 215  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 1 155  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 1 146  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 1 122  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 1 70   
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 1 120  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample 1 70   
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample 1 9  'synthetic construct' ? 32630 ? 
2 1 sample 1 29 'synthetic construct' ? 32630 ? 
3 1 sample 1 18 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  PDB 6UQ2        6UQ2   ? 1  ? 1 
2  PDB 6UQ2        6UQ2   ? 2  ? 1 
3  PDB 6UQ2        6UQ2   ? 3  ? 1 
4  UNP RPB1_YEAST  P04050 ? 4  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
1 
5  UNP RPB2_YEAST  P08518 ? 5  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
1 
6  UNP RPB3_YEAST  P16370 ? 6  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
1 
7  UNP RPAB1_YEAST P20434 ? 7  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
1 
8  UNP RPAB2_YEAST P20435 ? 8  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
1 
9  UNP RPAB3_YEAST P20436 ? 9  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
1 
10 UNP RPB9_YEAST  P27999 ? 10 
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
1 
11 UNP RPAB5_YEAST P22139 ? 11 MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 1 
12 UNP RPB11_YEAST P38902 ? 12 
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
1 
13 UNP RPAB4_YEAST P40422 ? 13 MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6UQ2 R 1 ? 9    ? 6UQ2   1 ? 9    ? 1 9    
2  2  6UQ2 T 1 ? 29   ? 6UQ2   1 ? 29   ? 1 29   
3  3  6UQ2 N 1 ? 18   ? 6UQ2   1 ? 18   ? 1 18   
4  4  6UQ2 A 1 ? 1733 ? P04050 1 ? 1733 ? 1 1733 
5  5  6UQ2 B 1 ? 1224 ? P08518 1 ? 1224 ? 1 1224 
6  6  6UQ2 C 1 ? 318  ? P16370 1 ? 318  ? 1 318  
7  7  6UQ2 E 1 ? 215  ? P20434 1 ? 215  ? 1 215  
8  8  6UQ2 F 1 ? 155  ? P20435 1 ? 155  ? 1 155  
9  9  6UQ2 H 1 ? 146  ? P20436 1 ? 146  ? 1 146  
10 10 6UQ2 I 1 ? 122  ? P27999 1 ? 122  ? 1 122  
11 11 6UQ2 J 1 ? 70   ? P22139 1 ? 70   ? 1 70   
12 12 6UQ2 K 1 ? 120  ? P38902 1 ? 120  ? 1 120  
13 13 6UQ2 L 1 ? 70   ? P40422 1 ? 70   ? 1 70   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"           ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6UQ2 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.63 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         66.09 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              0.080 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '390mM (NH4)2HPO4/NaH2PO4, pH 6.5, 5mM dioxane, 5mM DTT, 10-12% PEG6000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-10-20 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97648 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 5.0.3' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97648 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   5.0.3 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            80.510 
_reflns.entry_id                         6UQ2 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.090 
_reflns.d_resolution_low                 49.754 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       126625 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.000 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.700 
_reflns.pdbx_Rmerge_I_obs                0.333 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            7.600 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.357 
_reflns.pdbx_Rpim_I_all                  0.128 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.992 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.090 
_reflns_shell.d_res_low                   3.140 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         48106 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           6215 
_reflns_shell.percent_possible_all        100.000 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                4.636 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.700 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   0.600 
_reflns_shell.pdbx_Rrim_I_all             4.969 
_reflns_shell.pdbx_Rpim_I_all             1.784 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.270 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                267.920 
_refine.B_iso_mean                               97.5133 
_refine.B_iso_min                                22.900 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6UQ2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.2000 
_refine.ls_d_res_low                             49.7540 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     113913 
_refine.ls_number_reflns_R_free                  1801 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.8500 
_refine.ls_percent_reflns_R_free                 1.5800 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2305 
_refine.ls_R_factor_R_free                       0.2803 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2297 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6BLO 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 31.9800 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4500 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       3.2000 
_refine_hist.d_res_low                        49.7540 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               29048 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       3595 
_refine_hist.pdbx_B_iso_mean_ligand           124.43 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        28007 
_refine_hist.pdbx_number_atoms_nucleic_acid   1032 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.2000 3.2865 . . 139 8557 99.0000  . . . 0.4206 0.0000 0.3911 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2865 3.3832 . . 138 8626 100.0000 . . . 0.4336 0.0000 0.3518 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3832 3.4924 . . 137 8543 100.0000 . . . 0.3671 0.0000 0.3222 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4924 3.6172 . . 138 8590 100.0000 . . . 0.3272 0.0000 0.2918 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6172 3.7619 . . 139 8657 100.0000 . . . 0.3205 0.0000 0.2672 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7619 3.9331 . . 138 8567 100.0000 . . . 0.3062 0.0000 0.2509 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9331 4.1404 . . 139 8648 100.0000 . . . 0.2884 0.0000 0.2208 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1404 4.3996 . . 138 8584 100.0000 . . . 0.2488 0.0000 0.1960 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3996 4.7391 . . 138 8648 100.0000 . . . 0.2415 0.0000 0.1836 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7391 5.2155 . . 139 8630 100.0000 . . . 0.2584 0.0000 0.1935 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.2155 5.9691 . . 140 8668 100.0000 . . . 0.3051 0.0000 0.2232 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.9691 7.5163 . . 138 8680 100.0000 . . . 0.2947 0.0000 0.2325 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.5163 49.754 . . 140 8714 100.0000 . . . 0.1983 0.0000 0.1824 . . . . . . . . . . . 
# 
_struct.entry_id                     6UQ2 
_struct.title                        'RNA polymerase II elongation complex with dG in state 1' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase II subunit RPB1, DNA-directed RNA polymerase II subunit RPB2, DNA-directed RNA polymerase II subunit RPB3, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase II subunit RPB9, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerase II subunit RPB11, DNA-directed RNA polymerases I, II, and III subunit RPABC4/RNA/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6UQ2 
_struct_keywords.text            
'RNA polymerase II, elongation complex, transcription, transcription coupled repair, TRANSCRIPTION-RNA-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/RNA/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 13 ? 
N N N 14 ? 
O N N 14 ? 
P N N 15 ? 
Q N N 14 ? 
R N N 14 ? 
S N N 14 ? 
T N N 14 ? 
U N N 14 ? 
V N N 14 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 SER D 23   ? SER D 31   ? SER A 23   SER A 31   1 ? 9  
HELX_P HELX_P2   AA2 PHE D 95   ? CYS D 105  ? PHE A 95   CYS A 105  1 ? 11 
HELX_P HELX_P3   AA3 ASN D 119  ? ALA D 127  ? ASN A 119  ALA A 127  1 ? 9  
HELX_P HELX_P4   AA4 ASP D 130  ? LYS D 143  ? ASP A 130  LYS A 143  1 ? 14 
HELX_P HELX_P5   AA5 SER D 203  ? HIS D 213  ? SER A 203  HIS A 213  1 ? 11 
HELX_P HELX_P6   AA6 SER D 215  ? LEU D 222  ? SER A 215  LEU A 222  1 ? 8  
HELX_P HELX_P7   AA7 ARG D 230  ? MET D 234  ? ARG A 230  MET A 234  5 ? 5  
HELX_P HELX_P8   AA8 ASP D 260  ? GLY D 283  ? ASP A 260  GLY A 283  1 ? 24 
HELX_P HELX_P9   AA9 PRO D 285  ? ASP D 305  ? PRO A 285  ASP A 305  1 ? 21 
HELX_P HELX_P10  AB1 GLN D 316  ? ARG D 320  ? GLN A 316  ARG A 320  5 ? 5  
HELX_P HELX_P11  AB2 SER D 324  ? LEU D 329  ? SER A 324  LEU A 329  1 ? 6  
HELX_P HELX_P12  AB3 GLY D 334  ? LEU D 340  ? GLY A 334  LEU A 340  1 ? 7  
HELX_P HELX_P13  AB4 LYS D 368  ? LEU D 374  ? LYS A 368  LEU A 374  1 ? 7  
HELX_P HELX_P14  AB5 ASN D 384  ? GLY D 395  ? ASN A 384  GLY A 395  1 ? 12 
HELX_P HELX_P15  AB6 HIS D 451  ? MET D 453  ? HIS A 451  MET A 453  5 ? 3  
HELX_P HELX_P16  AB7 VAL D 474  ? ASN D 479  ? VAL A 474  ASN A 479  1 ? 6  
HELX_P HELX_P17  AB8 SER D 494  ? LEU D 504  ? SER A 494  LEU A 504  1 ? 11 
HELX_P HELX_P18  AB9 VAL D 507  ? GLN D 510  ? VAL A 507  GLN A 510  5 ? 4  
HELX_P HELX_P19  AC1 PRO D 514  ? ASN D 517  ? PRO A 514  ASN A 517  5 ? 4  
HELX_P HELX_P20  AC2 VAL D 524  ? THR D 535  ? VAL A 524  THR A 535  1 ? 12 
HELX_P HELX_P21  AC3 GLU D 542  ? VAL D 553  ? GLU A 542  VAL A 553  1 ? 12 
HELX_P HELX_P22  AC4 GLY D 574  ? SER D 579  ? GLY A 574  SER A 579  1 ? 6  
HELX_P HELX_P23  AC5 GLU D 618  ? GLY D 623  ? GLU A 618  GLY A 623  1 ? 6  
HELX_P HELX_P24  AC6 GLY D 628  ? LYS D 637  ? GLY A 628  LYS A 637  1 ? 10 
HELX_P HELX_P25  AC7 GLY D 638  ? GLY D 661  ? GLY A 638  GLY A 661  1 ? 24 
HELX_P HELX_P26  AC8 GLY D 665  ? ILE D 670  ? GLY A 665  ILE A 670  5 ? 6  
HELX_P HELX_P27  AC9 ASP D 672  ? ALA D 699  ? ASP A 672  ALA A 699  1 ? 28 
HELX_P HELX_P28  AD1 THR D 709  ? LEU D 737  ? THR A 709  LEU A 737  1 ? 29 
HELX_P HELX_P29  AD2 ASN D 741  ? GLY D 750  ? ASN A 741  GLY A 750  1 ? 10 
HELX_P HELX_P30  AD3 SER D 754  ? ALA D 763  ? SER A 754  ALA A 763  1 ? 10 
HELX_P HELX_P31  AD4 THR D 809  ? LEU D 845  ? THR A 809  LEU A 845  1 ? 37 
HELX_P HELX_P32  AD5 ILE D 867  ? ASP D 871  ? ILE A 867  ASP A 871  5 ? 5  
HELX_P HELX_P33  AD6 SER D 889  ? ARG D 898  ? SER A 889  ARG A 898  1 ? 10 
HELX_P HELX_P34  AD7 ASP D 922  ? PHE D 947  ? ASP A 922  PHE A 947  1 ? 26 
HELX_P HELX_P35  AD8 ASN D 959  ? PHE D 971  ? ASN A 959  PHE A 971  1 ? 13 
HELX_P HELX_P36  AD9 THR D 982  ? LEU D 997  ? THR A 982  LEU A 997  1 ? 16 
HELX_P HELX_P37  AE1 ASN D 1004 ? VAL D 1015 ? ASN A 1004 VAL A 1015 1 ? 12 
HELX_P HELX_P38  AE2 VAL D 1015 ? LEU D 1026 ? VAL A 1015 LEU A 1026 1 ? 12 
HELX_P HELX_P39  AE3 ALA D 1027 ? GLU D 1034 ? ALA A 1027 GLU A 1034 1 ? 8  
HELX_P HELX_P40  AE4 THR D 1038 ? VAL D 1057 ? THR A 1038 VAL A 1057 1 ? 20 
HELX_P HELX_P41  AE5 MET D 1063 ? GLN D 1078 ? MET A 1063 GLN A 1078 1 ? 16 
HELX_P HELX_P42  AE6 SER D 1096 ? ASN D 1106 ? SER A 1096 ASN A 1106 1 ? 11 
HELX_P HELX_P43  AE7 ASP D 1127 ? GLU D 1139 ? ASP A 1127 GLU A 1139 1 ? 13 
HELX_P HELX_P44  AE8 ASP D 1166 ? LEU D 1172 ? ASP A 1166 LEU A 1172 1 ? 7  
HELX_P HELX_P45  AE9 ASP D 1198 ? LYS D 1205 ? ASP A 1198 LYS A 1205 1 ? 8  
HELX_P HELX_P46  AF1 THR D 1208 ? LYS D 1221 ? THR A 1208 LYS A 1221 1 ? 14 
HELX_P HELX_P47  AF2 HIS D 1258 ? ASN D 1270 ? HIS A 1258 ASN A 1270 1 ? 13 
HELX_P HELX_P48  AF3 ASN D 1312 ? MET D 1317 ? ASN A 1312 MET A 1317 1 ? 6  
HELX_P HELX_P49  AF4 SER D 1331 ? LEU D 1339 ? SER A 1331 LEU A 1339 1 ? 9  
HELX_P HELX_P50  AF5 GLY D 1340 ? GLY D 1360 ? GLY A 1340 GLY A 1360 1 ? 21 
HELX_P HELX_P51  AF6 ASN D 1364 ? THR D 1377 ? ASN A 1364 THR A 1377 1 ? 14 
HELX_P HELX_P52  AF7 GLY D 1388 ? SER D 1392 ? GLY A 1388 SER A 1392 5 ? 5  
HELX_P HELX_P53  AF8 MET D 1398 ? PHE D 1402 ? MET A 1398 PHE A 1402 5 ? 5  
HELX_P HELX_P54  AF9 GLU D 1404 ? SER D 1415 ? GLU A 1404 SER A 1415 1 ? 12 
HELX_P HELX_P55  AG1 GLY D 1423 ? GLY D 1431 ? GLY A 1423 GLY A 1431 1 ? 9  
HELX_P HELX_P56  AG2 ASP E 29   ? GLY E 42   ? ASP B 29   GLY B 42   1 ? 14 
HELX_P HELX_P57  AG3 VAL E 44   ? TYR E 57   ? VAL B 44   TYR B 57   1 ? 14 
HELX_P HELX_P58  AG4 TYR E 57   ? GLU E 65   ? TYR B 57   GLU B 65   1 ? 9  
HELX_P HELX_P59  AG5 TYR E 113  ? ARG E 120  ? TYR B 113  ARG B 120  1 ? 8  
HELX_P HELX_P60  AG6 THR E 185  ? LEU E 192  ? THR B 185  LEU B 192  1 ? 8  
HELX_P HELX_P61  AG7 ILE E 282  ? LEU E 289  ? ILE B 282  LEU B 289  1 ? 8  
HELX_P HELX_P62  AG8 PRO E 293  ? CYS E 302  ? PRO B 293  CYS B 302  1 ? 10 
HELX_P HELX_P63  AG9 ASP E 307  ? GLY E 321  ? ASP B 307  GLY B 321  1 ? 15 
HELX_P HELX_P64  AH1 ASP E 326  ? PHE E 333  ? ASP B 326  PHE B 333  1 ? 8  
HELX_P HELX_P65  AH2 GLU E 346  ? GLU E 359  ? GLU B 346  GLU B 359  1 ? 14 
HELX_P HELX_P66  AH3 PHE E 370  ? LEU E 390  ? PHE B 370  LEU B 390  1 ? 21 
HELX_P HELX_P67  AH4 LEU E 408  ? THR E 435  ? LEU B 408  THR B 435  1 ? 28 
HELX_P HELX_P68  AH5 ALA E 450  ? GLY E 464  ? ALA B 450  GLY B 464  1 ? 15 
HELX_P HELX_P69  AH6 THR E 487  ? ARG E 496  ? THR B 487  ARG B 496  1 ? 10 
HELX_P HELX_P70  AH7 HIS E 515  ? TRP E 519  ? HIS B 515  TRP B 519  5 ? 5  
HELX_P HELX_P71  AH8 PRO E 551  ? TRP E 561  ? PRO B 551  TRP B 561  1 ? 11 
HELX_P HELX_P72  AH9 ASN E 592  ? LYS E 606  ? ASN B 592  LYS B 606  1 ? 15 
HELX_P HELX_P73  AI1 ARG E 654  ? GLN E 667  ? ARG B 654  GLN B 667  1 ? 14 
HELX_P HELX_P74  AI2 THR E 680  ? GLU E 687  ? THR B 680  GLU B 687  1 ? 8  
HELX_P HELX_P75  AI3 GLU E 696  ? ILE E 701  ? GLU B 696  ILE B 701  5 ? 6  
HELX_P HELX_P76  AI4 GLN E 706  ? GLU E 711  ? GLN B 706  GLU B 711  5 ? 6  
HELX_P HELX_P77  AI5 HIS E 744  ? LEU E 749  ? HIS B 744  LEU B 749  5 ? 6  
HELX_P HELX_P78  AI6 PHE E 758  ? ASN E 762  ? PHE B 758  ASN B 762  5 ? 5  
HELX_P HELX_P79  AI7 GLN E 763  ? GLY E 774  ? GLN B 763  GLY B 774  1 ? 12 
HELX_P HELX_P80  AI8 THR E 806  ? GLU E 810  ? THR B 806  GLU B 810  5 ? 5  
HELX_P HELX_P81  AI9 GLN E 843  ? ARG E 848  ? GLN B 843  ARG B 848  1 ? 6  
HELX_P HELX_P82  AJ1 ASN E 1013 ? ILE E 1017 ? ASN B 1013 ILE B 1017 5 ? 5  
HELX_P HELX_P83  AJ2 THR E 1022 ? GLY E 1039 ? THR B 1022 GLY B 1039 1 ? 18 
HELX_P HELX_P84  AJ3 THR E 1051 ? HIS E 1062 ? THR B 1051 HIS B 1062 1 ? 12 
HELX_P HELX_P85  AJ4 MET E 1098 ? LYS E 1102 ? MET B 1098 LYS B 1102 5 ? 5  
HELX_P HELX_P86  AJ5 GLY E 1121 ? ASP E 1125 ? GLY B 1121 ASP B 1125 5 ? 5  
HELX_P HELX_P87  AJ6 GLY E 1131 ? GLY E 1142 ? GLY B 1131 GLY B 1142 1 ? 12 
HELX_P HELX_P88  AJ7 ALA E 1143 ? MET E 1152 ? ALA B 1143 MET B 1152 1 ? 10 
HELX_P HELX_P89  AJ8 TYR E 1198 ? MET E 1210 ? TYR B 1198 MET B 1210 1 ? 13 
HELX_P HELX_P90  AJ9 ASP F 26   ? GLU F 40   ? ASP C 26   GLU C 40   1 ? 15 
HELX_P HELX_P91  AK1 ALA F 59   ? LEU F 69   ? ALA C 59   LEU C 69   1 ? 11 
HELX_P HELX_P92  AK2 ASP F 76   ? LEU F 80   ? ASP C 76   LEU C 80   5 ? 5  
HELX_P HELX_P93  AK3 LYS F 116  ? LEU F 118  ? LYS C 116  LEU C 118  5 ? 3  
HELX_P HELX_P94  AK4 HIS F 167  ? GLY F 171  ? HIS C 167  GLY C 171  5 ? 5  
HELX_P HELX_P95  AK5 ASP F 196  ? TRP F 201  ? ASP C 196  TRP C 201  1 ? 6  
HELX_P HELX_P96  AK6 SER F 204  ? GLU F 210  ? SER C 204  GLU C 210  5 ? 7  
HELX_P HELX_P97  AK7 PRO F 239  ? ASP F 266  ? PRO C 239  ASP C 266  1 ? 28 
HELX_P HELX_P98  AK8 GLU G 6    ? GLY G 27   ? GLU E 6    GLY E 27   1 ? 22 
HELX_P HELX_P99  AK9 THR G 31   ? GLU G 36   ? THR E 31   GLU E 36   1 ? 6  
HELX_P HELX_P100 AL1 PRO G 38   ? CYS G 47   ? PRO E 38   CYS E 47   1 ? 10 
HELX_P HELX_P101 AL2 THR G 65   ? PHE G 72   ? THR E 65   PHE E 72   1 ? 8  
HELX_P HELX_P102 AL3 GLY G 89   ? ASN G 104  ? GLY E 89   ASN E 104  1 ? 16 
HELX_P HELX_P103 AL4 THR G 117  ? LYS G 122  ? THR E 117  LYS E 122  1 ? 6  
HELX_P HELX_P104 AL5 ASN G 136  ? VAL G 141  ? ASN E 136  VAL E 141  1 ? 6  
HELX_P HELX_P105 AL6 ASN G 143  ? HIS G 147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P106 AL7 SER G 157  ? TYR G 168  ? SER E 157  TYR E 168  1 ? 12 
HELX_P HELX_P107 AL8 ASP G 182  ? LEU G 188  ? ASP E 182  LEU E 188  1 ? 7  
HELX_P HELX_P108 AL9 THR H 86   ? MET H 103  ? THR F 86   MET F 103  1 ? 18 
HELX_P HELX_P109 AM1 ASP H 116  ? GLU H 127  ? ASP F 116  GLU F 127  1 ? 12 
HELX_P HELX_P110 AM2 TYR I 129  ? ASN I 133  ? TYR H 129  ASN H 133  5 ? 5  
HELX_P HELX_P111 AM3 VAL J 59   ? ASP J 65   ? VAL I 59   ASP I 65   5 ? 7  
HELX_P HELX_P112 AM4 VAL K 14   ? ASP K 16   ? VAL J 14   ASP J 16   5 ? 3  
HELX_P HELX_P113 AM5 LYS K 17   ? GLN K 26   ? LYS J 17   GLN J 26   1 ? 10 
HELX_P HELX_P114 AM6 ASP K 31   ? LEU K 39   ? ASP J 31   LEU J 39   1 ? 9  
HELX_P HELX_P115 AM7 ARG K 43   ? THR K 52   ? ARG J 43   THR J 52   1 ? 10 
HELX_P HELX_P116 AM8 LEU K 56   ? LEU K 61   ? LEU J 56   LEU J 61   1 ? 6  
HELX_P HELX_P117 AM9 ASP L 5    ? PHE L 10   ? ASP K 5    PHE K 10   5 ? 6  
HELX_P HELX_P118 AN1 ASP L 39   ? LEU L 51   ? ASP K 39   LEU K 51   1 ? 13 
HELX_P HELX_P119 AN2 ASP L 82   ? GLN L 112  ? ASP K 82   GLN K 112  1 ? 31 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A G   9    "O3'" ? ? ? 1_555 P MG .  MG ? ? R G   9    A MG 1803 1_555 ? ? ? ? ? ? ?               2.070 ? 
metalc2  metalc ? ? D CYS 67   SG    ? ? ? 1_555 O ZN .  ZN ? ? A CYS 67   A ZN 1802 1_555 ? ? ? ? ? ? ?               2.546 ? 
metalc3  metalc ? ? D CYS 70   SG    ? ? ? 1_555 O ZN .  ZN ? ? A CYS 70   A ZN 1802 1_555 ? ? ? ? ? ? ?               2.468 ? 
metalc4  metalc ? ? D CYS 77   SG    ? ? ? 1_555 O ZN .  ZN ? ? A CYS 77   A ZN 1802 1_555 ? ? ? ? ? ? ?               2.453 ? 
metalc5  metalc ? ? D HIS 80   NE2   ? ? ? 1_555 O ZN .  ZN ? ? A HIS 80   A ZN 1802 1_555 ? ? ? ? ? ? ?               2.201 ? 
metalc6  metalc ? ? D CYS 107  SG    ? ? ? 1_555 N ZN .  ZN ? ? A CYS 107  A ZN 1801 1_555 ? ? ? ? ? ? ?               2.480 ? 
metalc7  metalc ? ? D CYS 110  SG    ? ? ? 1_555 N ZN .  ZN ? ? A CYS 110  A ZN 1801 1_555 ? ? ? ? ? ? ?               2.599 ? 
metalc8  metalc ? ? D CYS 167  SG    ? ? ? 1_555 N ZN .  ZN ? ? A CYS 167  A ZN 1801 1_555 ? ? ? ? ? ? ?               2.513 ? 
metalc9  metalc ? ? D ASP 483  OD1   ? ? ? 1_555 P MG .  MG ? ? A ASP 483  A MG 1803 1_555 ? ? ? ? ? ? ?               2.170 ? 
metalc10 metalc ? ? D ASP 483  OD2   ? ? ? 1_555 P MG .  MG ? ? A ASP 483  A MG 1803 1_555 ? ? ? ? ? ? ?               2.036 ? 
metalc11 metalc ? ? D ASP 485  OD2   ? ? ? 1_555 P MG .  MG ? ? A ASP 485  A MG 1803 1_555 ? ? ? ? ? ? ?               2.286 ? 
metalc12 metalc ? ? E CYS 1163 SG    ? ? ? 1_555 Q ZN .  ZN ? ? B CYS 1163 B ZN 1301 1_555 ? ? ? ? ? ? ?               2.497 ? 
metalc13 metalc ? ? E CYS 1166 N     ? ? ? 1_555 Q ZN .  ZN ? ? B CYS 1166 B ZN 1301 1_555 ? ? ? ? ? ? ?               2.530 ? 
metalc14 metalc ? ? E CYS 1166 SG    ? ? ? 1_555 Q ZN .  ZN ? ? B CYS 1166 B ZN 1301 1_555 ? ? ? ? ? ? ?               2.455 ? 
metalc15 metalc ? ? E CYS 1182 SG    ? ? ? 1_555 Q ZN .  ZN ? ? B CYS 1182 B ZN 1301 1_555 ? ? ? ? ? ? ?               2.625 ? 
metalc16 metalc ? ? E CYS 1185 SG    ? ? ? 1_555 Q ZN .  ZN ? ? B CYS 1185 B ZN 1301 1_555 ? ? ? ? ? ? ?               2.489 ? 
metalc17 metalc ? ? F CYS 86   SG    ? ? ? 1_555 R ZN .  ZN ? ? C CYS 86   C ZN 401  1_555 ? ? ? ? ? ? ?               2.404 ? 
metalc18 metalc ? ? F CYS 88   SG    ? ? ? 1_555 R ZN .  ZN ? ? C CYS 88   C ZN 401  1_555 ? ? ? ? ? ? ?               2.405 ? 
metalc19 metalc ? ? F CYS 92   SG    ? ? ? 1_555 R ZN .  ZN ? ? C CYS 92   C ZN 401  1_555 ? ? ? ? ? ? ?               2.398 ? 
metalc20 metalc ? ? F CYS 95   SG    ? ? ? 1_555 R ZN .  ZN ? ? C CYS 95   C ZN 401  1_555 ? ? ? ? ? ? ?               2.416 ? 
metalc21 metalc ? ? J CYS 7    SG    ? ? ? 1_555 S ZN .  ZN ? ? I CYS 7    I ZN 201  1_555 ? ? ? ? ? ? ?               2.467 ? 
metalc22 metalc ? ? J CYS 10   SG    ? ? ? 1_555 S ZN .  ZN ? ? I CYS 10   I ZN 201  1_555 ? ? ? ? ? ? ?               2.465 ? 
metalc23 metalc ? ? J CYS 29   SG    ? ? ? 1_555 S ZN .  ZN ? ? I CYS 29   I ZN 201  1_555 ? ? ? ? ? ? ?               2.438 ? 
metalc24 metalc ? ? J CYS 32   SG    ? ? ? 1_555 S ZN .  ZN ? ? I CYS 32   I ZN 201  1_555 ? ? ? ? ? ? ?               2.513 ? 
metalc25 metalc ? ? J CYS 75   SG    ? ? ? 1_555 T ZN .  ZN ? ? I CYS 75   I ZN 202  1_555 ? ? ? ? ? ? ?               2.385 ? 
metalc26 metalc ? ? J CYS 78   SG    ? ? ? 1_555 T ZN .  ZN ? ? I CYS 78   I ZN 202  1_555 ? ? ? ? ? ? ?               2.405 ? 
metalc27 metalc ? ? J CYS 103  SG    ? ? ? 1_555 T ZN .  ZN ? ? I CYS 103  I ZN 202  1_555 ? ? ? ? ? ? ?               2.384 ? 
metalc28 metalc ? ? J CYS 106  SG    ? ? ? 1_555 T ZN .  ZN ? ? I CYS 106  I ZN 202  1_555 ? ? ? ? ? ? ?               2.420 ? 
metalc29 metalc ? ? K CYS 7    SG    ? ? ? 1_555 U ZN .  ZN ? ? J CYS 7    J ZN 101  1_555 ? ? ? ? ? ? ?               2.425 ? 
metalc30 metalc ? ? K CYS 10   SG    ? ? ? 1_555 U ZN .  ZN ? ? J CYS 10   J ZN 101  1_555 ? ? ? ? ? ? ?               2.521 ? 
metalc31 metalc ? ? K CYS 45   SG    ? ? ? 1_555 U ZN .  ZN ? ? J CYS 45   J ZN 101  1_555 ? ? ? ? ? ? ?               2.466 ? 
metalc32 metalc ? ? K CYS 46   N     ? ? ? 1_555 U ZN .  ZN ? ? J CYS 46   J ZN 101  1_555 ? ? ? ? ? ? ?               2.673 ? 
metalc33 metalc ? ? K CYS 46   SG    ? ? ? 1_555 U ZN .  ZN ? ? J CYS 46   J ZN 101  1_555 ? ? ? ? ? ? ?               2.519 ? 
metalc34 metalc ? ? M CYS 31   SG    ? ? ? 1_555 V ZN .  ZN ? ? L CYS 31   L ZN 101  1_555 ? ? ? ? ? ? ?               2.442 ? 
metalc35 metalc ? ? M CYS 34   SG    ? ? ? 1_555 V ZN .  ZN ? ? L CYS 34   L ZN 101  1_555 ? ? ? ? ? ? ?               2.426 ? 
metalc36 metalc ? ? M CYS 48   SG    ? ? ? 1_555 V ZN .  ZN ? ? L CYS 48   L ZN 101  1_555 ? ? ? ? ? ? ?               2.423 ? 
metalc37 metalc ? ? M CYS 51   SG    ? ? ? 1_555 V ZN .  ZN ? ? L CYS 51   L ZN 101  1_555 ? ? ? ? ? ? ?               2.417 ? 
hydrog1  hydrog ? ? A A   1    N1    ? ? ? 1_555 B DT 28 N3 ? ? R A   1    T DT 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2  hydrog ? ? A A   1    N6    ? ? ? 1_555 B DT 28 O4 ? ? R A   1    T DT 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3  hydrog ? ? A U   2    N3    ? ? ? 1_555 B DA 27 N1 ? ? R U   2    T DA 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4  hydrog ? ? A U   2    O4    ? ? ? 1_555 B DA 27 N6 ? ? R U   2    T DA 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5  hydrog ? ? A C   3    N3    ? ? ? 1_555 B DG 26 N1 ? ? R C   3    T DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ? ? A C   3    N4    ? ? ? 1_555 B DG 26 O6 ? ? R C   3    T DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ? ? A C   3    O2    ? ? ? 1_555 B DG 26 N2 ? ? R C   3    T DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8  hydrog ? ? A G   4    N1    ? ? ? 1_555 B DC 25 N3 ? ? R G   4    T DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9  hydrog ? ? A G   4    N2    ? ? ? 1_555 B DC 25 O2 ? ? R G   4    T DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ? ? A G   4    O6    ? ? ? 1_555 B DC 25 N4 ? ? R G   4    T DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11 hydrog ? ? A A   5    N1    ? ? ? 1_555 B DT 24 N3 ? ? R A   5    T DT 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12 hydrog ? ? A A   5    N6    ? ? ? 1_555 B DT 24 O4 ? ? R A   5    T DT 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13 hydrog ? ? A G   6    N1    ? ? ? 1_555 B DC 23 N3 ? ? R G   6    T DC 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14 hydrog ? ? A G   6    N2    ? ? ? 1_555 B DC 23 O2 ? ? R G   6    T DC 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15 hydrog ? ? A G   6    O6    ? ? ? 1_555 B DC 23 N4 ? ? R G   6    T DC 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16 hydrog ? ? A A   7    N1    ? ? ? 1_555 B DT 22 N3 ? ? R A   7    T DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17 hydrog ? ? A A   7    N6    ? ? ? 1_555 B DT 22 O4 ? ? R A   7    T DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18 hydrog ? ? A G   8    N1    ? ? ? 1_555 B DC 21 N3 ? ? R G   8    T DC 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19 hydrog ? ? A G   8    N2    ? ? ? 1_555 B DC 21 O2 ? ? R G   8    T DC 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20 hydrog ? ? A G   8    O6    ? ? ? 1_555 B DC 21 N4 ? ? R G   8    T DC 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21 hydrog ? ? A G   9    N1    ? ? ? 1_555 B DC 20 N3 ? ? R G   9    T DC 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22 hydrog ? ? A G   9    N2    ? ? ? 1_555 B DC 20 O2 ? ? R G   9    T DC 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23 hydrog ? ? A G   9    O6    ? ? ? 1_555 B DC 20 N4 ? ? R G   9    T DC 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24 hydrog ? ? B DT  3    N3    ? ? ? 1_555 C DA 16 N1 ? ? T DT  3    N DA 16   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog25 hydrog ? ? B DC  5    N3    ? ? ? 1_555 C DG 14 N1 ? ? T DC  5    N DG 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26 hydrog ? ? B DC  5    N4    ? ? ? 1_555 C DG 14 O6 ? ? T DC  5    N DG 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27 hydrog ? ? B DC  5    O2    ? ? ? 1_555 C DG 14 N2 ? ? T DC  5    N DG 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28 hydrog ? ? B DT  6    N3    ? ? ? 1_555 C DA 13 N1 ? ? T DT  6    N DA 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29 hydrog ? ? B DT  6    O4    ? ? ? 1_555 C DA 13 N6 ? ? T DT  6    N DA 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30 hydrog ? ? B DC  7    N3    ? ? ? 1_555 C DG 12 N1 ? ? T DC  7    N DG 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31 hydrog ? ? B DC  7    N4    ? ? ? 1_555 C DG 12 O6 ? ? T DC  7    N DG 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32 hydrog ? ? B DC  7    O2    ? ? ? 1_555 C DG 12 N2 ? ? T DC  7    N DG 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33 hydrog ? ? B DC  9    O2    ? ? ? 1_555 C DG 10 N2 ? ? T DC  9    N DG 10   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog34 hydrog ? ? B DT  10   N3    ? ? ? 1_555 C DA 9  N1 ? ? T DT  10   N DA 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35 hydrog ? ? B DT  10   O4    ? ? ? 1_555 C DA 9  N6 ? ? T DT  10   N DA 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36 hydrog ? ? B DC  11   N3    ? ? ? 1_555 C DG 8  N1 ? ? T DC  11   N DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37 hydrog ? ? B DC  11   N4    ? ? ? 1_555 C DG 8  O6 ? ? T DC  11   N DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38 hydrog ? ? B DC  11   O2    ? ? ? 1_555 C DG 8  N2 ? ? T DC  11   N DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39 hydrog ? ? B DT  12   N3    ? ? ? 1_555 C DA 7  N1 ? ? T DT  12   N DA 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40 hydrog ? ? B DT  12   O4    ? ? ? 1_555 C DA 7  N6 ? ? T DT  12   N DA 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41 hydrog ? ? B DC  13   N3    ? ? ? 1_555 C DG 6  N1 ? ? T DC  13   N DG 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42 hydrog ? ? B DC  13   N4    ? ? ? 1_555 C DG 6  O6 ? ? T DC  13   N DG 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43 hydrog ? ? B DC  13   O2    ? ? ? 1_555 C DG 6  N2 ? ? T DC  13   N DG 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44 hydrog ? ? B DG  14   N1    ? ? ? 1_555 C DC 5  N3 ? ? T DG  14   N DC 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45 hydrog ? ? B DG  14   N2    ? ? ? 1_555 C DC 5  O2 ? ? T DG  14   N DC 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46 hydrog ? ? B DG  14   O6    ? ? ? 1_555 C DC 5  N4 ? ? T DG  14   N DC 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47 hydrog ? ? B DC  15   N3    ? ? ? 1_555 C DG 4  N1 ? ? T DC  15   N DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48 hydrog ? ? B DC  15   N4    ? ? ? 1_555 C DG 4  O6 ? ? T DC  15   N DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49 hydrog ? ? B DC  15   O2    ? ? ? 1_555 C DG 4  N2 ? ? T DC  15   N DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50 hydrog ? ? B DT  16   O4    ? ? ? 1_555 C DC 2  N4 ? ? T DT  16   N DC 2    1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog51 hydrog ? ? B DG  17   N2    ? ? ? 1_555 C DC 2  O2 ? ? T DG  17   N DC 2    1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 399 D . ? HIS 399 A PRO 400 D ? PRO 400 A 1 -2.66 
2 GLN 447 D . ? GLN 447 A PRO 448 D ? PRO 448 A 1 9.28  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 8 ? 
AA6 ? 4 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 3 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 2 ? 
AB4 ? 4 ? 
AB5 ? 2 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 4 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 5 ? 
AC5 ? 3 ? 
AC6 ? 5 ? 
AC7 ? 2 ? 
AC8 ? 5 ? 
AC9 ? 7 ? 
AD1 ? 2 ? 
AD2 ? 6 ? 
AD3 ? 3 ? 
AD4 ? 3 ? 
AD5 ? 2 ? 
AD6 ? 2 ? 
AD7 ? 2 ? 
AD8 ? 2 ? 
AD9 ? 4 ? 
AE1 ? 4 ? 
AE2 ? 2 ? 
AE3 ? 3 ? 
AE4 ? 4 ? 
AE5 ? 9 ? 
AE6 ? 3 ? 
AE7 ? 3 ? 
AE8 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? parallel      
AA5 6 7 ? anti-parallel 
AA5 7 8 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? parallel      
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC4 4 5 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? parallel      
AC6 4 5 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC8 4 5 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AC9 4 5 ? anti-parallel 
AC9 5 6 ? anti-parallel 
AC9 6 7 ? anti-parallel 
AD1 1 2 ? parallel      
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? parallel      
AD2 4 5 ? anti-parallel 
AD2 5 6 ? parallel      
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AD9 3 4 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE1 3 4 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE3 1 2 ? parallel      
AE3 2 3 ? parallel      
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE4 3 4 ? parallel      
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE5 4 5 ? anti-parallel 
AE5 5 6 ? anti-parallel 
AE5 6 7 ? anti-parallel 
AE5 7 8 ? anti-parallel 
AE5 8 9 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE8 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU D 1418 ? ASP D 1419 ? LEU A 1418 ASP A 1419 
AA1 2 GLU D 16   ? GLN D 18   ? GLU A 16   GLN A 18   
AA1 3 ARG E 1215 ? TYR E 1217 ? ARG B 1215 TYR B 1217 
AA2 1 GLY D 82   ? VAL D 90   ? GLY A 82   VAL A 90   
AA2 2 LEU D 236  ? VAL D 241  ? LEU A 236  VAL A 241  
AA3 1 ILE D 174  ? ASP D 177  ? ILE A 174  ASP A 177  
AA3 2 LYS D 180  ? GLY D 183  ? LYS A 180  GLY A 183  
AA4 1 LYS D 343  ? VAL D 345  ? LYS A 343  VAL A 345  
AA4 2 LEU E 1128 ? PHE E 1130 ? LEU B 1128 PHE B 1130 
AA5 1 HIS E 1104 ? ARG E 1106 ? HIS B 1104 ARG B 1106 
AA5 2 SER D 348  ? GLY D 355  ? SER A 348  GLY A 355  
AA5 3 GLU D 486  ? HIS D 490  ? GLU A 486  HIS A 490  
AA5 4 PRO D 441  ? ASN D 445  ? PRO A 441  ASN A 445  
AA5 5 MET D 455  ? ILE D 463  ? MET A 455  ILE A 463  
AA5 6 GLN D 363  ? PRO D 367  ? GLN A 363  PRO A 367  
AA5 7 PHE D 468  ? LEU D 470  ? PHE A 468  LEU A 470  
AA5 8 SER D 348  ? GLY D 355  ? SER A 348  GLY A 355  
AA6 1 THR D 375  ? VAL D 379  ? THR A 375  VAL A 379  
AA6 2 LYS D 431  ? HIS D 435  ? LYS A 431  HIS A 435  
AA6 3 ALA D 402  ? ILE D 406  ? ALA A 402  ILE A 406  
AA6 4 ARG D 412  ? ASP D 414  ? ARG A 412  ASP A 414  
AA7 1 VAL D 512  ? SER D 513  ? VAL A 512  SER A 513  
AA7 2 LYS D 518  ? PRO D 519  ? LYS A 518  PRO A 519  
AA8 1 PHE D 540  ? ILE D 541  ? PHE A 540  ILE A 541  
AA8 2 TRP D 572  ? SER D 573  ? TRP A 572  SER A 573  
AA9 1 HIS D 587  ? ARG D 590  ? HIS A 587  ARG A 590  
AA9 2 MET D 605  ? ILE D 608  ? MET A 605  ILE A 608  
AA9 3 GLN D 611  ? PHE D 614  ? GLN A 611  PHE A 614  
AB1 1 GLY D 766  ? GLN D 767  ? GLY A 766  GLN A 767  
AB1 2 PHE D 799  ? VAL D 800  ? PHE A 799  VAL A 800  
AB2 1 MET D 849  ? VAL D 850  ? MET A 849  VAL A 850  
AB2 2 THR D 856  ? ARG D 857  ? THR A 856  ARG A 857  
AB3 1 GLU D 879  ? SER D 882  ? GLU A 879  SER A 882  
AB3 2 ASN D 953  ? LEU D 956  ? ASN A 953  LEU A 956  
AB4 1 VAL D 1282 ? LYS D 1286 ? VAL A 1282 LYS A 1286 
AB4 2 TRP D 1304 ? THR D 1308 ? TRP A 1304 THR A 1308 
AB4 3 LEU D 1116 ? TYR D 1119 ? LEU A 1116 TYR A 1119 
AB4 4 TYR D 1328 ? THR D 1329 ? TYR A 1328 THR A 1329 
AB5 1 THR D 1141 ? THR D 1142 ? THR A 1141 THR A 1142 
AB5 2 THR D 1272 ? LEU D 1273 ? THR A 1272 LEU A 1273 
AB6 1 PHE D 1225 ? TRP D 1228 ? PHE A 1225 TRP A 1228 
AB6 2 LEU D 1236 ? ARG D 1241 ? LEU A 1236 ARG A 1241 
AB6 3 TRP D 1191 ? LEU D 1197 ? TRP A 1191 LEU A 1197 
AB6 4 THR D 1147 ? TYR D 1154 ? THR A 1147 TYR A 1154 
AB6 5 LEU J 42   ? GLU J 47   ? LEU I 42   GLU I 47   
AB7 1 ARG D 1289 ? PRO D 1292 ? ARG A 1289 PRO A 1292 
AB7 2 TYR D 1298 ? GLU D 1301 ? TYR A 1298 GLU A 1301 
AB8 1 VAL D 1443 ? ILE D 1445 ? VAL A 1443 ILE A 1445 
AB8 2 LEU H 132  ? TYR H 137  ? LEU F 132  TYR F 137  
AB8 3 PHE H 143  ? SER H 147  ? PHE F 143  SER F 147  
AB9 1 LEU E 69   ? GLU E 72   ? LEU B 69   GLU B 72   
AB9 2 LYS E 87   ? VAL E 97   ? LYS B 87   VAL B 97   
AB9 3 SER E 125  ? THR E 136  ? SER B 125  THR B 136  
AB9 4 GLY E 163  ? PRO E 171  ? GLY B 163  PRO B 171  
AC1 1 MET E 101  ? ASN E 103  ? MET B 101  ASN B 103  
AC1 2 THR E 109  ? ALA E 111  ? THR B 109  ALA B 111  
AC2 1 PHE E 203  ? ILE E 205  ? PHE B 203  ILE B 205  
AC2 2 SER E 208  ? LEU E 212  ? SER B 208  LEU B 212  
AC2 3 SER E 480  ? VAL E 482  ? SER B 480  VAL B 482  
AC3 1 LYS E 404  ? ASP E 407  ? LYS B 404  ASP B 407  
AC3 2 ALA E 214  ? SER E 218  ? ALA B 214  SER B 218  
AC3 3 ARG E 497  ? ASN E 499  ? ARG B 497  ASN B 499  
AC3 4 LYS E 537  ? ASN E 538  ? LYS B 537  ASN B 538  
AC4 1 GLN E 224  ? LYS E 227  ? GLN B 224  LYS B 227  
AC4 2 ILE E 234  ? SER E 242  ? ILE B 234  SER B 242  
AC4 3 SER E 252  ? TYR E 259  ? SER B 252  TYR B 259  
AC4 4 ILE E 269  ? LEU E 273  ? ILE B 269  LEU B 273  
AC4 5 ILE E 276  ? PRO E 281  ? ILE B 276  PRO B 281  
AC5 1 CYS E 544  ? ILE E 545  ? CYS B 544  ILE B 545  
AC5 2 VAL E 633  ? PHE E 638  ? VAL B 633  PHE B 638  
AC5 3 VAL E 690  ? ASP E 694  ? VAL B 690  ASP B 694  
AC6 1 GLU E 564  ? PRO E 565  ? GLU B 564  PRO B 565  
AC6 2 VAL E 585  ? HIS E 590  ? VAL B 585  HIS B 590  
AC6 3 THR E 578  ? VAL E 582  ? THR B 578  VAL B 582  
AC6 4 GLU E 623  ? PHE E 627  ? GLU B 623  PHE B 627  
AC6 5 SER E 614  ? ASP E 618  ? SER B 614  ASP B 618  
AC7 1 VAL E 640  ? ASP E 642  ? VAL B 640  ASP B 642  
AC7 2 LYS E 649  ? LEU E 651  ? LYS B 649  LEU B 651  
AC8 1 MET E 792  ? LEU E 796  ? MET B 792  LEU B 796  
AC8 2 SER E 853  ? GLN E 862  ? SER B 853  GLN B 862  
AC8 3 LYS E 962  ? LYS E 972  ? LYS B 962  LYS B 972  
AC8 4 ASN E 946  ? THR E 956  ? ASN B 946  THR B 956  
AC8 5 ARG E 904  ? SER E 906  ? ARG B 904  SER B 906  
AC9 1 MET E 792  ? LEU E 796  ? MET B 792  LEU B 796  
AC9 2 SER E 853  ? GLN E 862  ? SER B 853  GLN B 862  
AC9 3 LYS E 962  ? LYS E 972  ? LYS B 962  LYS B 972  
AC9 4 ASN E 946  ? THR E 956  ? ASN B 946  THR B 956  
AC9 5 LEU M 56   ? LYS M 58   ? LEU L 56   LYS L 58   
AC9 6 TYR M 29   ? CYS M 31   ? TYR L 29   CYS L 31   
AC9 7 LYS M 37   ? LEU M 38   ? LYS L 37   LEU L 38   
AD1 1 GLY E 804  ? THR E 805  ? GLY B 804  THR B 805  
AD1 2 GLY E 1042 ? ASP E 1043 ? GLY B 1042 ASP B 1043 
AD2 1 PHE E 980  ? SER E 982  ? PHE B 980  SER B 982  
AD2 2 ILE E 1085 ? ARG E 1094 ? ILE B 1085 ARG B 1094 
AD2 3 GLY E 820  ? ILE E 827  ? GLY B 820  ILE B 827  
AD2 4 LEU E 1010 ? ILE E 1012 ? LEU B 1010 ILE B 1012 
AD2 5 MET E 839  ? ASN E 842  ? MET B 839  ASN B 842  
AD2 6 ILE E 990  ? TYR E 994  ? ILE B 990  TYR B 994  
AD3 1 PHE E 980  ? SER E 982  ? PHE B 980  SER B 982  
AD3 2 ILE E 1085 ? ARG E 1094 ? ILE B 1085 ARG B 1094 
AD3 3 PHE E 1069 ? GLU E 1070 ? PHE B 1069 GLU B 1070 
AD4 1 THR E 873  ? PHE E 874  ? THR B 873  PHE B 874  
AD4 2 LYS E 914  ? PRO E 917  ? LYS B 914  PRO B 917  
AD4 3 LYS E 934  ? ASP E 936  ? LYS B 934  ASP B 936  
AD5 1 VAL E 910  ? ILE E 912  ? VAL B 910  ILE B 912  
AD5 2 THR E 939  ? PRO E 940  ? THR B 939  PRO B 940  
AD6 1 PHE E 1001 ? THR E 1002 ? PHE B 1001 THR B 1002 
AD6 2 MET E 1072 ? TYR E 1073 ? MET B 1072 TYR B 1073 
AD7 1 ALA E 1157 ? CYS E 1163 ? ALA B 1157 CYS B 1163 
AD7 2 ILE E 1191 ? PRO E 1197 ? ILE B 1191 PRO B 1197 
AD8 1 VAL E 1171 ? LYS E 1174 ? VAL B 1171 LYS B 1174 
AD8 2 GLN E 1179 ? CYS E 1182 ? GLN B 1179 CYS B 1182 
AD9 1 GLN F 7    ? ALA F 13   ? GLN C 7    ALA C 13   
AD9 2 ASN F 17   ? SER F 23   ? ASN C 17   SER C 23   
AD9 3 PHE F 228  ? SER F 234  ? PHE C 228  SER C 234  
AD9 4 ALA F 173  ? TYR F 180  ? ALA C 173  TYR C 180  
AE1 1 THR F 43   ? ASN F 54   ? THR C 43   ASN C 54   
AE1 2 GLU F 152  ? GLY F 162  ? GLU C 152  GLY C 162  
AE1 3 VAL F 97   ? PHE F 104  ? VAL C 97   PHE C 104  
AE1 4 VAL F 119  ? ILE F 120  ? VAL C 119  ILE C 120  
AE2 1 THR F 111  ? TYR F 114  ? THR C 111  TYR C 114  
AE2 2 LEU F 143  ? LEU F 147  ? LEU C 143  LEU C 147  
AE3 1 LEU G 78   ? GLU G 81   ? LEU E 78   GLU E 81   
AE3 2 THR G 107  ? PHE G 110  ? THR E 107  PHE E 110  
AE3 3 THR G 131  ? THR G 134  ? THR E 131  THR E 134  
AE4 1 HIS G 153  ? ARG G 155  ? HIS E 153  ARG E 155  
AE4 2 VAL G 195  ? LYS G 201  ? VAL E 195  LYS E 201  
AE4 3 ARG G 207  ? CYS G 214  ? ARG E 207  CYS E 214  
AE4 4 ARG G 177  ? ILE G 178  ? ARG E 177  ILE E 178  
AE5 1 VAL I 96   ? TYR I 98   ? VAL H 96   TYR H 98   
AE5 2 TYR I 141  ? ARG I 145  ? TYR H 141  ARG H 145  
AE5 3 SER I 54   ? ALA I 60   ? SER H 54   ALA H 60   
AE5 4 THR I 4    ? ASP I 16   ? THR H 4    ASP H 16   
AE5 5 VAL I 23   ? SER I 30   ? VAL H 23   SER H 30   
AE5 6 LYS I 37   ? ASN I 43   ? LYS H 37   ASN H 43   
AE5 7 LEU I 121  ? GLY I 127  ? LEU H 121  GLY H 127  
AE5 8 LEU I 111  ? PHE I 118  ? LEU H 111  PHE H 118  
AE5 9 THR I 100  ? SER I 108  ? THR H 100  SER H 108  
AE6 1 TYR J 15   ? ASP J 19   ? TYR I 15   ASP I 19   
AE6 2 ARG J 24   ? GLU J 28   ? ARG I 24   GLU I 28   
AE6 3 VAL J 35   ? GLU J 37   ? VAL I 35   GLU I 37   
AE7 1 ASN J 83   ? PHE J 86   ? ASN I 83   PHE I 86   
AE7 2 PHE J 100  ? CYS J 103  ? PHE I 100  CYS I 103  
AE7 3 ILE J 109  ? THR J 111  ? ILE I 109  THR I 111  
AE8 1 LEU L 19   ? PRO L 23   ? LEU K 19   PRO K 23   
AE8 2 ALA L 30   ? GLU L 36   ? ALA K 30   GLU K 36   
AE8 3 ARG L 70   ? THR L 77   ? ARG K 70   THR K 77   
AE8 4 VAL L 56   ? LYS L 62   ? VAL K 56   LYS K 62   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ASP D 1419 ? O ASP A 1419 N VAL D 17   ? N VAL A 17   
AA1 2 3 N GLN D 18   ? N GLN A 18   O ARG E 1215 ? O ARG B 1215 
AA2 1 2 N VAL D 90   ? N VAL A 90   O LEU D 236  ? O LEU A 236  
AA3 1 2 N ARG D 175  ? N ARG A 175  O VAL D 182  ? O VAL A 182  
AA4 1 2 N LYS D 343  ? N LYS A 343  O PHE E 1130 ? O PHE B 1130 
AA5 1 2 O HIS E 1104 ? O HIS B 1104 N ARG D 350  ? N ARG A 350  
AA5 2 3 N ALA D 349  ? N ALA A 349  O LEU D 489  ? O LEU A 489  
AA5 3 4 O ASN D 488  ? O ASN A 488  N ASN D 445  ? N ASN A 445  
AA5 4 5 N PHE D 444  ? N PHE A 444  O MET D 456  ? O MET A 456  
AA5 5 6 O ILE D 463  ? O ILE A 463  N VAL D 366  ? N VAL A 366  
AA5 6 7 N GLY D 365  ? N GLY A 365  O ARG D 469  ? O ARG A 469  
AA5 7 8 O PHE D 468  ? O PHE A 468  N SER D 354  ? N SER A 354  
AA6 1 2 N GLU D 378  ? N GLU A 378  O VAL D 432  ? O VAL A 432  
AA6 2 3 O LYS D 431  ? O LYS A 431  N ILE D 406  ? N ILE A 406  
AA6 3 4 N VAL D 405  ? N VAL A 405  O ILE D 413  ? O ILE A 413  
AA7 1 2 N SER D 513  ? N SER A 513  O LYS D 518  ? O LYS A 518  
AA8 1 2 N ILE D 541  ? N ILE A 541  O TRP D 572  ? O TRP A 572  
AA9 1 2 N ARG D 590  ? N ARG A 590  O MET D 605  ? O MET A 605  
AA9 2 3 N ILE D 608  ? N ILE A 608  O GLN D 611  ? O GLN A 611  
AB1 1 2 N GLY D 766  ? N GLY A 766  O VAL D 800  ? O VAL A 800  
AB2 1 2 N MET D 849  ? N MET A 849  O ARG D 857  ? O ARG A 857  
AB3 1 2 N GLU D 879  ? N GLU A 879  O LEU D 956  ? O LEU A 956  
AB4 1 2 N MET D 1285 ? N MET A 1285 O VAL D 1305 ? O VAL A 1305 
AB4 2 3 O LEU D 1306 ? O LEU A 1306 N VAL D 1118 ? N VAL A 1118 
AB4 3 4 N THR D 1117 ? N THR A 1117 O TYR D 1328 ? O TYR A 1328 
AB5 1 2 N THR D 1141 ? N THR A 1141 O LEU D 1273 ? O LEU A 1273 
AB6 1 2 N PHE D 1225 ? N PHE A 1225 O ARG D 1241 ? O ARG A 1241 
AB6 2 3 O CYS D 1240 ? O CYS A 1240 N LEU D 1193 ? N LEU A 1193 
AB6 3 4 O LEU D 1192 ? O LEU A 1192 N TYR D 1153 ? N TYR A 1153 
AB6 4 5 N ILE D 1152 ? N ILE A 1152 O TYR J 44   ? O TYR I 44   
AB7 1 2 N ARG D 1289 ? N ARG A 1289 O GLU D 1301 ? O GLU A 1301 
AB8 1 2 N MET D 1444 ? N MET A 1444 O VAL H 133  ? O VAL F 133  
AB8 2 3 N ILE H 134  ? N ILE F 134  O TRP H 146  ? O TRP F 146  
AB9 1 2 N LEU E 71   ? N LEU B 71   O TYR E 88   ? O TYR B 88   
AB9 2 3 N TYR E 96   ? N TYR B 96   O PHE E 129  ? O PHE B 129  
AB9 3 4 N SER E 126  ? N SER B 126  O LEU E 170  ? O LEU B 170  
AC1 1 2 N VAL E 102  ? N VAL B 102  O HIS E 110  ? O HIS B 110  
AC2 1 2 N PHE E 203  ? N PHE B 203  O LYS E 210  ? O LYS B 210  
AC2 2 3 N VAL E 211  ? N VAL B 211  O GLN E 481  ? O GLN B 481  
AC3 1 2 O ARG E 405  ? O ARG B 405  N ARG E 217  ? N ARG B 217  
AC3 2 3 N ALA E 214  ? N ALA B 214  O ASN E 499  ? O ASN B 499  
AC3 3 4 N THR E 498  ? N THR B 498  O LYS E 537  ? O LYS B 537  
AC4 1 2 N GLN E 224  ? N GLN B 224  O GLU E 239  ? O GLU B 239  
AC4 2 3 N SER E 242  ? N SER B 242  O SER E 252  ? O SER B 252  
AC4 3 4 N GLN E 255  ? N GLN B 255  O THR E 272  ? O THR B 272  
AC4 4 5 N ALA E 271  ? N ALA B 271  O ILE E 280  ? O ILE B 280  
AC5 1 2 N CYS E 544  ? N CYS B 544  O TYR E 634  ? O TYR B 634  
AC5 2 3 N ARG E 635  ? N ARG B 635  O ILE E 693  ? O ILE B 693  
AC6 1 2 N GLU E 564  ? N GLU B 564  O VAL E 589  ? O VAL B 589  
AC6 2 3 O GLY E 588  ? O GLY B 588  N VAL E 580  ? N VAL B 580  
AC6 3 4 N PHE E 581  ? N PHE B 581  O LEU E 624  ? O LEU B 624  
AC6 4 5 O LYS E 625  ? O LYS B 625  N ILE E 616  ? N ILE B 616  
AC7 1 2 N GLU E 641  ? N GLU B 641  O GLU E 650  ? O GLU B 650  
AC8 1 2 N ILE E 795  ? N ILE B 795  O LEU E 854  ? O LEU B 854  
AC8 2 3 N SER E 853  ? N SER B 853  O LYS E 972  ? O LYS B 972  
AC8 3 4 O ARG E 969  ? O ARG B 969  N ILE E 948  ? N ILE B 948  
AC8 4 5 O GLY E 947  ? O GLY B 947  N VAL E 905  ? N VAL B 905  
AC9 1 2 N ILE E 795  ? N ILE B 795  O LEU E 854  ? O LEU B 854  
AC9 2 3 N SER E 853  ? N SER B 853  O LYS E 972  ? O LYS B 972  
AC9 3 4 O ARG E 969  ? O ARG B 969  N ILE E 948  ? N ILE B 948  
AC9 4 5 N VAL E 954  ? N VAL B 954  O LEU M 56   ? O LEU L 56   
AC9 5 6 O LEU M 57   ? O LEU L 57   N ILE M 30   ? N ILE L 30   
AC9 6 7 N TYR M 29   ? N TYR L 29   O LEU M 38   ? O LEU L 38   
AD1 1 2 N THR E 805  ? N THR B 805  O GLY E 1042 ? O GLY B 1042 
AD2 1 2 N ALA E 981  ? N ALA B 981  O GLN E 1093 ? O GLN B 1093 
AD2 2 3 O GLY E 1088 ? O GLY B 1088 N VAL E 825  ? N VAL B 825  
AD2 3 4 N ALA E 826  ? N ALA B 826  O LEU E 1010 ? O LEU B 1010 
AD2 4 5 O ILE E 1011 ? O ILE B 1011 N ILE E 840  ? N ILE B 840  
AD2 5 6 N MET E 839  ? N MET B 839  O GLY E 991  ? O GLY B 991  
AD3 1 2 N ALA E 981  ? N ALA B 981  O GLN E 1093 ? O GLN B 1093 
AD3 2 3 O ILE E 1085 ? O ILE B 1085 N GLU E 1070 ? N GLU B 1070 
AD4 1 2 N THR E 873  ? N THR B 873  O THR E 915  ? O THR B 915  
AD4 2 3 N THR E 916  ? N THR B 916  O ARG E 935  ? O ARG B 935  
AD5 1 2 N ILE E 912  ? N ILE B 912  O THR E 939  ? O THR B 939  
AD6 1 2 N PHE E 1001 ? N PHE B 1001 O TYR E 1073 ? O TYR B 1073 
AD7 1 2 N PHE E 1158 ? N PHE B 1158 O ILE E 1196 ? O ILE B 1196 
AD8 1 2 N LYS E 1174 ? N LYS B 1174 O GLN E 1179 ? O GLN B 1179 
AD9 1 2 N GLU F 12   ? N GLU C 12   O ASP F 19   ? O ASP C 19   
AD9 2 3 N LEU F 22   ? N LEU C 22   O PHE F 228  ? O PHE C 228  
AD9 3 4 O GLU F 233  ? O GLU C 233  N ALA F 174  ? N ALA C 174  
AE1 1 2 N THR F 53   ? N THR C 53   O LYS F 154  ? O LYS C 154  
AE1 2 3 O ALA F 159  ? O ALA C 159  N VAL F 97   ? N VAL C 97   
AE1 3 4 N THR F 100  ? N THR C 100  O VAL F 119  ? O VAL C 119  
AE2 1 2 N THR F 111  ? N THR C 111  O LEU F 147  ? O LEU C 147  
AE3 1 2 N GLU G 81   ? N GLU E 81   O ILE G 109  ? O ILE E 109  
AE3 2 3 N GLY G 108  ? N GLY E 108  O THR G 131  ? O THR E 131  
AE4 1 2 N ILE G 154  ? N ILE E 154  O LYS G 197  ? O LYS E 197  
AE4 2 3 N VAL G 196  ? N VAL E 196  O ARG G 212  ? O ARG E 212  
AE4 3 4 O ILE G 213  ? O ILE E 213  N ILE G 178  ? N ILE E 178  
AE5 1 2 N MET I 97   ? N MET H 97   O LEU I 142  ? O LEU H 142  
AE5 2 3 O LEU I 143  ? O LEU H 143  N THR I 58   ? N THR H 58   
AE5 3 4 O LEU I 55   ? O LEU H 55   N PHE I 10   ? N PHE H 10   
AE5 4 5 N SER I 13   ? N SER H 13   O GLU I 27   ? O GLU H 27   
AE5 5 6 N ILE I 26   ? N ILE H 26   O LEU I 40   ? O LEU H 40   
AE5 6 7 N THR I 39   ? N THR H 39   O ARG I 124  ? O ARG H 124  
AE5 7 8 O LEU I 121  ? O LEU H 121  N PHE I 118  ? N PHE H 118  
AE5 8 9 O SER I 117  ? O SER H 117  N THR I 100  ? N THR H 100  
AE6 1 2 N ARG J 17   ? N ARG I 17   O LEU J 26   ? O LEU I 26   
AE6 2 3 N PHE J 27   ? N PHE I 27   O GLU J 36   ? O GLU I 36   
AE7 1 2 N VAL J 84   ? N VAL I 84   O VAL J 102  ? O VAL I 102  
AE7 2 3 N PHE J 101  ? N PHE I 101  O PHE J 110  ? O PHE I 110  
AE8 1 2 N ASP L 22   ? N ASP K 22   O VAL L 32   ? O VAL K 32   
AE8 2 3 N PHE L 35   ? N PHE K 35   O PHE L 71   ? O PHE K 71   
AE8 3 4 O GLN L 76   ? O GLN K 76   N LEU L 57   ? N LEU K 57   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 1801 ? 3 'binding site for residue ZN A 1801' 
AC2 Software A ZN 1802 ? 4 'binding site for residue ZN A 1802' 
AC3 Software A MG 1803 ? 3 'binding site for residue MG A 1803' 
AC4 Software B ZN 1301 ? 5 'binding site for residue ZN B 1301' 
AC5 Software C ZN 401  ? 4 'binding site for residue ZN C 401'  
AC6 Software I ZN 201  ? 4 'binding site for residue ZN I 201'  
AC7 Software I ZN 202  ? 5 'binding site for residue ZN I 202'  
AC8 Software J ZN 101  ? 4 'binding site for residue ZN J 101'  
AC9 Software L ZN 101  ? 4 'binding site for residue ZN L 101'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 CYS D 107  ? CYS A 107  . ? 1_555 ? 
2  AC1 3 CYS D 110  ? CYS A 110  . ? 1_555 ? 
3  AC1 3 CYS D 167  ? CYS A 167  . ? 1_555 ? 
4  AC2 4 CYS D 67   ? CYS A 67   . ? 1_555 ? 
5  AC2 4 CYS D 70   ? CYS A 70   . ? 1_555 ? 
6  AC2 4 CYS D 77   ? CYS A 77   . ? 1_555 ? 
7  AC2 4 HIS D 80   ? HIS A 80   . ? 1_555 ? 
8  AC3 3 ASP D 483  ? ASP A 483  . ? 1_555 ? 
9  AC3 3 ASP D 485  ? ASP A 485  . ? 1_555 ? 
10 AC3 3 G   A 9    ? G   R 9    . ? 1_555 ? 
11 AC4 5 CYS E 1163 ? CYS B 1163 . ? 1_555 ? 
12 AC4 5 ILE E 1165 ? ILE B 1165 . ? 1_555 ? 
13 AC4 5 CYS E 1166 ? CYS B 1166 . ? 1_555 ? 
14 AC4 5 CYS E 1182 ? CYS B 1182 . ? 1_555 ? 
15 AC4 5 CYS E 1185 ? CYS B 1185 . ? 1_555 ? 
16 AC5 4 CYS F 86   ? CYS C 86   . ? 1_555 ? 
17 AC5 4 CYS F 88   ? CYS C 88   . ? 1_555 ? 
18 AC5 4 CYS F 92   ? CYS C 92   . ? 1_555 ? 
19 AC5 4 CYS F 95   ? CYS C 95   . ? 1_555 ? 
20 AC6 4 CYS J 7    ? CYS I 7    . ? 1_555 ? 
21 AC6 4 CYS J 10   ? CYS I 10   . ? 1_555 ? 
22 AC6 4 CYS J 29   ? CYS I 29   . ? 1_555 ? 
23 AC6 4 CYS J 32   ? CYS I 32   . ? 1_555 ? 
24 AC7 5 CYS J 75   ? CYS I 75   . ? 1_555 ? 
25 AC7 5 CYS J 78   ? CYS I 78   . ? 1_555 ? 
26 AC7 5 SER J 80   ? SER I 80   . ? 1_555 ? 
27 AC7 5 CYS J 103  ? CYS I 103  . ? 1_555 ? 
28 AC7 5 CYS J 106  ? CYS I 106  . ? 1_555 ? 
29 AC8 4 CYS K 7    ? CYS J 7    . ? 1_555 ? 
30 AC8 4 CYS K 10   ? CYS J 10   . ? 1_555 ? 
31 AC8 4 CYS K 45   ? CYS J 45   . ? 1_555 ? 
32 AC8 4 CYS K 46   ? CYS J 46   . ? 1_555 ? 
33 AC9 4 CYS M 31   ? CYS L 31   . ? 1_555 ? 
34 AC9 4 CYS M 34   ? CYS L 34   . ? 1_555 ? 
35 AC9 4 CYS M 48   ? CYS L 48   . ? 1_555 ? 
36 AC9 4 CYS M 51   ? CYS L 51   . ? 1_555 ? 
# 
_atom_sites.entry_id                    6UQ2 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.006035 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000995 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004478 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005237 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . A   A 1  1    ? 24.770  10.266  28.536  1.00 188.26 ? 1    A   R "O5'" 1 
ATOM   2     C  "C5'" . A   A 1  1    ? 24.470  11.372  27.698  1.00 190.89 ? 1    A   R "C5'" 1 
ATOM   3     C  "C4'" . A   A 1  1    ? 25.262  12.593  28.091  1.00 196.37 ? 1    A   R "C4'" 1 
ATOM   4     O  "O4'" . A   A 1  1    ? 24.885  13.715  27.254  1.00 198.36 ? 1    A   R "O4'" 1 
ATOM   5     C  "C3'" . A   A 1  1    ? 25.044  13.101  29.507  1.00 198.32 ? 1    A   R "C3'" 1 
ATOM   6     O  "O3'" . A   A 1  1    ? 25.785  12.377  30.474  1.00 192.54 ? 1    A   R "O3'" 1 
ATOM   7     C  "C2'" . A   A 1  1    ? 25.449  14.566  29.400  1.00 202.83 ? 1    A   R "C2'" 1 
ATOM   8     O  "O2'" . A   A 1  1    ? 26.862  14.703  29.444  1.00 209.37 ? 1    A   R "O2'" 1 
ATOM   9     C  "C1'" . A   A 1  1    ? 24.971  14.916  27.992  1.00 198.03 ? 1    A   R "C1'" 1 
ATOM   10    N  N9    . A   A 1  1    ? 23.650  15.571  28.002  1.00 187.64 ? 1    A   R N9    1 
ATOM   11    C  C8    . A   A 1  1    ? 22.439  15.061  27.604  1.00 181.41 ? 1    A   R C8    1 
ATOM   12    N  N7    . A   A 1  1    ? 21.446  15.906  27.736  1.00 175.80 ? 1    A   R N7    1 
ATOM   13    C  C5    . A   A 1  1    ? 22.047  17.045  28.253  1.00 179.62 ? 1    A   R C5    1 
ATOM   14    C  C6    . A   A 1  1    ? 21.543  18.302  28.621  1.00 176.51 ? 1    A   R C6    1 
ATOM   15    N  N6    . A   A 1  1    ? 20.260  18.633  28.510  1.00 169.97 ? 1    A   R N6    1 
ATOM   16    N  N1    . A   A 1  1    ? 22.406  19.223  29.105  1.00 179.66 ? 1    A   R N1    1 
ATOM   17    C  C2    . A   A 1  1    ? 23.699  18.894  29.213  1.00 183.46 ? 1    A   R C2    1 
ATOM   18    N  N3    . A   A 1  1    ? 24.293  17.745  28.901  1.00 186.32 ? 1    A   R N3    1 
ATOM   19    C  C4    . A   A 1  1    ? 23.404  16.855  28.423  1.00 184.77 ? 1    A   R C4    1 
ATOM   20    P  P     . U   A 1  2    ? 25.190  12.152  31.950  1.00 171.69 ? 2    U   R P     1 
ATOM   21    O  OP1   . U   A 1  2    ? 26.095  11.218  32.666  1.00 171.08 ? 2    U   R OP1   1 
ATOM   22    O  OP2   . U   A 1  2    ? 23.748  11.823  31.825  1.00 162.27 ? 2    U   R OP2   1 
ATOM   23    O  "O5'" . U   A 1  2    ? 25.316  13.583  32.640  1.00 171.71 ? 2    U   R "O5'" 1 
ATOM   24    C  "C5'" . U   A 1  2    ? 26.585  14.192  32.825  1.00 174.70 ? 2    U   R "C5'" 1 
ATOM   25    C  "C4'" . U   A 1  2    ? 26.455  15.648  33.194  1.00 178.86 ? 2    U   R "C4'" 1 
ATOM   26    O  "O4'" . U   A 1  2    ? 25.731  16.370  32.162  1.00 178.61 ? 2    U   R "O4'" 1 
ATOM   27    C  "C3'" . U   A 1  2    ? 25.673  15.945  34.460  1.00 179.76 ? 2    U   R "C3'" 1 
ATOM   28    O  "O3'" . U   A 1  2    ? 26.435  15.741  35.636  1.00 179.85 ? 2    U   R "O3'" 1 
ATOM   29    C  "C2'" . U   A 1  2    ? 25.251  17.392  34.253  1.00 180.73 ? 2    U   R "C2'" 1 
ATOM   30    O  "O2'" . U   A 1  2    ? 26.324  18.274  34.550  1.00 183.11 ? 2    U   R "O2'" 1 
ATOM   31    C  "C1'" . U   A 1  2    ? 24.997  17.429  32.745  1.00 182.29 ? 2    U   R "C1'" 1 
ATOM   32    N  N1    . U   A 1  2    ? 23.561  17.277  32.398  1.00 186.64 ? 2    U   R N1    1 
ATOM   33    C  C2    . U   A 1  2    ? 22.685  18.331  32.632  1.00 183.79 ? 2    U   R C2    1 
ATOM   34    O  O2    . U   A 1  2    ? 23.007  19.399  33.128  1.00 178.95 ? 2    U   R O2    1 
ATOM   35    N  N3    . U   A 1  2    ? 21.382  18.095  32.269  1.00 185.53 ? 2    U   R N3    1 
ATOM   36    C  C4    . U   A 1  2    ? 20.870  16.949  31.699  1.00 187.99 ? 2    U   R C4    1 
ATOM   37    O  O4    . U   A 1  2    ? 19.669  16.891  31.429  1.00 185.86 ? 2    U   R O4    1 
ATOM   38    C  C5    . U   A 1  2    ? 21.831  15.912  31.485  1.00 190.77 ? 2    U   R C5    1 
ATOM   39    C  C6    . U   A 1  2    ? 23.107  16.111  31.828  1.00 191.55 ? 2    U   R C6    1 
ATOM   40    P  P     . C   A 1  3    ? 25.731  15.186  36.968  1.00 174.25 ? 3    C   R P     1 
ATOM   41    O  OP1   . C   A 1  3    ? 26.790  15.036  37.999  1.00 178.66 ? 3    C   R OP1   1 
ATOM   42    O  OP2   . C   A 1  3    ? 24.895  14.015  36.603  1.00 174.21 ? 3    C   R OP2   1 
ATOM   43    O  "O5'" . C   A 1  3    ? 24.771  16.376  37.420  1.00 158.70 ? 3    C   R "O5'" 1 
ATOM   44    C  "C5'" . C   A 1  3    ? 25.316  17.583  37.930  1.00 151.23 ? 3    C   R "C5'" 1 
ATOM   45    C  "C4'" . C   A 1  3    ? 24.304  18.701  37.958  1.00 146.33 ? 3    C   R "C4'" 1 
ATOM   46    O  "O4'" . C   A 1  3    ? 23.759  18.933  36.629  1.00 148.63 ? 3    C   R "O4'" 1 
ATOM   47    C  "C3'" . C   A 1  3    ? 23.067  18.480  38.805  1.00 140.81 ? 3    C   R "C3'" 1 
ATOM   48    O  "O3'" . C   A 1  3    ? 23.287  18.614  40.197  1.00 136.01 ? 3    C   R "O3'" 1 
ATOM   49    C  "C2'" . C   A 1  3    ? 22.109  19.511  38.228  1.00 140.47 ? 3    C   R "C2'" 1 
ATOM   50    O  "O2'" . C   A 1  3    ? 22.454  20.815  38.669  1.00 141.87 ? 3    C   R "O2'" 1 
ATOM   51    C  "C1'" . C   A 1  3    ? 22.429  19.405  36.738  1.00 151.34 ? 3    C   R "C1'" 1 
ATOM   52    N  N1    . C   A 1  3    ? 21.507  18.469  36.043  1.00 160.37 ? 3    C   R N1    1 
ATOM   53    C  C2    . C   A 1  3    ? 20.223  18.919  35.694  1.00 156.55 ? 3    C   R C2    1 
ATOM   54    O  O2    . C   A 1  3    ? 19.881  20.082  35.957  1.00 156.41 ? 3    C   R O2    1 
ATOM   55    N  N3    . C   A 1  3    ? 19.368  18.079  35.067  1.00 153.88 ? 3    C   R N3    1 
ATOM   56    C  C4    . C   A 1  3    ? 19.741  16.832  34.788  1.00 155.96 ? 3    C   R C4    1 
ATOM   57    N  N4    . C   A 1  3    ? 18.863  16.042  34.167  1.00 153.41 ? 3    C   R N4    1 
ATOM   58    C  C5    . C   A 1  3    ? 21.033  16.340  35.129  1.00 162.76 ? 3    C   R C5    1 
ATOM   59    C  C6    . C   A 1  3    ? 21.872  17.182  35.747  1.00 166.33 ? 3    C   R C6    1 
ATOM   60    P  P     . G   A 1  4    ? 22.436  17.714  41.221  1.00 134.13 ? 4    G   R P     1 
ATOM   61    O  OP1   . G   A 1  4    ? 22.595  18.279  42.583  1.00 135.27 ? 4    G   R OP1   1 
ATOM   62    O  OP2   . G   A 1  4    ? 22.770  16.289  40.970  1.00 134.48 ? 4    G   R OP2   1 
ATOM   63    O  "O5'" . G   A 1  4    ? 20.925  17.947  40.772  1.00 125.81 ? 4    G   R "O5'" 1 
ATOM   64    C  "C5'" . G   A 1  4    ? 19.982  18.514  41.667  1.00 116.15 ? 4    G   R "C5'" 1 
ATOM   65    C  "C4'" . G   A 1  4    ? 19.034  19.462  40.973  1.00 113.36 ? 4    G   R "C4'" 1 
ATOM   66    O  "O4'" . G   A 1  4    ? 19.211  19.404  39.534  1.00 103.85 ? 4    G   R "O4'" 1 
ATOM   67    C  "C3'" . G   A 1  4    ? 17.557  19.176  41.168  1.00 111.59 ? 4    G   R "C3'" 1 
ATOM   68    O  "O3'" . G   A 1  4    ? 17.074  19.618  42.420  1.00 116.20 ? 4    G   R "O3'" 1 
ATOM   69    C  "C2'" . G   A 1  4    ? 16.930  19.877  39.973  1.00 107.41 ? 4    G   R "C2'" 1 
ATOM   70    O  "O2'" . G   A 1  4    ? 16.889  21.281  40.182  1.00 105.08 ? 4    G   R "O2'" 1 
ATOM   71    C  "C1'" . G   A 1  4    ? 17.967  19.584  38.889  1.00 112.24 ? 4    G   R "C1'" 1 
ATOM   72    N  N9    . G   A 1  4    ? 17.662  18.346  38.148  1.00 127.03 ? 4    G   R N9    1 
ATOM   73    C  C8    . G   A 1  4    ? 18.480  17.246  38.093  1.00 133.46 ? 4    G   R C8    1 
ATOM   74    N  N7    . G   A 1  4    ? 17.992  16.275  37.375  1.00 138.65 ? 4    G   R N7    1 
ATOM   75    C  C5    . G   A 1  4    ? 16.776  16.761  36.921  1.00 131.62 ? 4    G   R C5    1 
ATOM   76    C  C6    . G   A 1  4    ? 15.804  16.143  36.094  1.00 124.21 ? 4    G   R C6    1 
ATOM   77    O  O6    . G   A 1  4    ? 15.825  15.016  35.587  1.00 115.52 ? 4    G   R O6    1 
ATOM   78    N  N1    . G   A 1  4    ? 14.716  16.977  35.875  1.00 121.69 ? 4    G   R N1    1 
ATOM   79    C  C2    . G   A 1  4    ? 14.582  18.242  36.386  1.00 119.74 ? 4    G   R C2    1 
ATOM   80    N  N2    . G   A 1  4    ? 13.456  18.890  36.058  1.00 115.01 ? 4    G   R N2    1 
ATOM   81    N  N3    . G   A 1  4    ? 15.481  18.832  37.156  1.00 129.53 ? 4    G   R N3    1 
ATOM   82    C  C4    . G   A 1  4    ? 16.552  18.041  37.387  1.00 131.05 ? 4    G   R C4    1 
ATOM   83    P  P     . A   A 1  5    ? 16.788  18.551  43.584  1.00 121.72 ? 5    A   R P     1 
ATOM   84    O  OP1   . A   A 1  5    ? 17.122  19.196  44.877  1.00 115.77 ? 5    A   R OP1   1 
ATOM   85    O  OP2   . A   A 1  5    ? 17.417  17.258  43.218  1.00 131.06 ? 5    A   R OP2   1 
ATOM   86    O  "O5'" . A   A 1  5    ? 15.211  18.361  43.533  1.00 111.80 ? 5    A   R "O5'" 1 
ATOM   87    C  "C5'" . A   A 1  5    ? 14.360  19.441  43.870  1.00 105.49 ? 5    A   R "C5'" 1 
ATOM   88    C  "C4'" . A   A 1  5    ? 13.284  19.650  42.839  1.00 97.34  ? 5    A   R "C4'" 1 
ATOM   89    O  "O4'" . A   A 1  5    ? 13.836  19.563  41.499  1.00 95.65  ? 5    A   R "O4'" 1 
ATOM   90    C  "C3'" . A   A 1  5    ? 12.164  18.631  42.831  1.00 87.10  ? 5    A   R "C3'" 1 
ATOM   91    O  "O3'" . A   A 1  5    ? 11.225  18.849  43.866  1.00 84.17  ? 5    A   R "O3'" 1 
ATOM   92    C  "C2'" . A   A 1  5    ? 11.588  18.797  41.434  1.00 88.45  ? 5    A   R "C2'" 1 
ATOM   93    O  "O2'" . A   A 1  5    ? 10.779  19.960  41.366  1.00 80.29  ? 5    A   R "O2'" 1 
ATOM   94    C  "C1'" . A   A 1  5    ? 12.857  19.049  40.616  1.00 99.22  ? 5    A   R "C1'" 1 
ATOM   95    N  N9    . A   A 1  5    ? 13.373  17.815  39.991  1.00 109.67 ? 5    A   R N9    1 
ATOM   96    C  C8    . A   A 1  5    ? 14.601  17.234  40.185  1.00 110.00 ? 5    A   R C8    1 
ATOM   97    N  N7    . A   A 1  5    ? 14.789  16.139  39.491  1.00 106.19 ? 5    A   R N7    1 
ATOM   98    C  C5    . A   A 1  5    ? 13.603  15.986  38.787  1.00 111.26 ? 5    A   R C5    1 
ATOM   99    C  C6    . A   A 1  5    ? 13.166  15.012  37.870  1.00 119.58 ? 5    A   R C6    1 
ATOM   100   N  N6    . A   A 1  5    ? 13.906  13.968  37.489  1.00 126.20 ? 5    A   R N6    1 
ATOM   101   N  N1    . A   A 1  5    ? 11.929  15.146  37.345  1.00 115.88 ? 5    A   R N1    1 
ATOM   102   C  C2    . A   A 1  5    ? 11.180  16.189  37.720  1.00 110.26 ? 5    A   R C2    1 
ATOM   103   N  N3    . A   A 1  5    ? 11.481  17.166  38.571  1.00 107.77 ? 5    A   R N3    1 
ATOM   104   C  C4    . A   A 1  5    ? 12.720  17.010  39.080  1.00 109.11 ? 5    A   R C4    1 
ATOM   105   P  P     . G   A 1  6    ? 11.030  17.745  45.012  1.00 104.26 ? 6    G   R P     1 
ATOM   106   O  OP1   . G   A 1  6    ? 10.674  18.447  46.270  1.00 107.87 ? 6    G   R OP1   1 
ATOM   107   O  OP2   . G   A 1  6    ? 12.200  16.833  44.973  1.00 116.87 ? 6    G   R OP2   1 
ATOM   108   O  "O5'" . G   A 1  6    ? 9.751   16.936  44.529  1.00 110.00 ? 6    G   R "O5'" 1 
ATOM   109   C  "C5'" . G   A 1  6    ? 8.565   17.632  44.187  1.00 111.07 ? 6    G   R "C5'" 1 
ATOM   110   C  "C4'" . G   A 1  6    ? 7.865   17.004  43.011  1.00 104.52 ? 6    G   R "C4'" 1 
ATOM   111   O  "O4'" . G   A 1  6    ? 8.737   16.969  41.852  1.00 102.25 ? 6    G   R "O4'" 1 
ATOM   112   C  "C3'" . G   A 1  6    ? 7.438   15.559  43.178  1.00 81.67  ? 6    G   R "C3'" 1 
ATOM   113   O  "O3'" . G   A 1  6    ? 6.270   15.420  43.966  1.00 84.11  ? 6    G   R "O3'" 1 
ATOM   114   C  "C2'" . G   A 1  6    ? 7.259   15.112  41.736  1.00 79.10  ? 6    G   R "C2'" 1 
ATOM   115   O  "O2'" . G   A 1  6    ? 6.027   15.591  41.218  1.00 75.88  ? 6    G   R "O2'" 1 
ATOM   116   C  "C1'" . G   A 1  6    ? 8.399   15.861  41.041  1.00 96.42  ? 6    G   R "C1'" 1 
ATOM   117   N  N9    . G   A 1  6    ? 9.593   15.014  40.844  1.00 102.42 ? 6    G   R N9    1 
ATOM   118   C  C8    . G   A 1  6    ? 10.848  15.216  41.363  1.00 106.29 ? 6    G   R C8    1 
ATOM   119   N  N7    . G   A 1  6    ? 11.706  14.298  41.008  1.00 106.96 ? 6    G   R N7    1 
ATOM   120   C  C5    . G   A 1  6    ? 10.979  13.436  40.200  1.00 104.16 ? 6    G   R C5    1 
ATOM   121   C  C6    . G   A 1  6    ? 11.382  12.254  39.525  1.00 101.58 ? 6    G   R C6    1 
ATOM   122   O  O6    . G   A 1  6    ? 12.494  11.714  39.504  1.00 94.98  ? 6    G   R O6    1 
ATOM   123   N  N1    . G   A 1  6    ? 10.331  11.687  38.817  1.00 112.12 ? 6    G   R N1    1 
ATOM   124   C  C2    . G   A 1  6    ? 9.058   12.193  38.764  1.00 115.39 ? 6    G   R C2    1 
ATOM   125   N  N2    . G   A 1  6    ? 8.176   11.504  38.030  1.00 119.33 ? 6    G   R N2    1 
ATOM   126   N  N3    . G   A 1  6    ? 8.672   13.291  39.385  1.00 110.12 ? 6    G   R N3    1 
ATOM   127   C  C4    . G   A 1  6    ? 9.674   13.865  40.085  1.00 104.09 ? 6    G   R C4    1 
ATOM   128   P  P     . A   A 1  7    ? 6.192   14.277  45.091  1.00 111.02 ? 7    A   R P     1 
ATOM   129   O  OP1   . A   A 1  7    ? 4.977   14.523  45.910  1.00 106.96 ? 7    A   R OP1   1 
ATOM   130   O  OP2   . A   A 1  7    ? 7.519   14.182  45.747  1.00 116.75 ? 7    A   R OP2   1 
ATOM   131   O  "O5'" . A   A 1  7    ? 5.955   12.945  44.255  1.00 116.12 ? 7    A   R "O5'" 1 
ATOM   132   C  "C5'" . A   A 1  7    ? 4.867   12.862  43.351  1.00 94.04  ? 7    A   R "C5'" 1 
ATOM   133   C  "C4'" . A   A 1  7    ? 5.067   11.789  42.312  1.00 81.37  ? 7    A   R "C4'" 1 
ATOM   134   O  "O4'" . A   A 1  7    ? 6.307   11.978  41.587  1.00 88.13  ? 7    A   R "O4'" 1 
ATOM   135   C  "C3'" . A   A 1  7    ? 5.174   10.366  42.816  1.00 76.73  ? 7    A   R "C3'" 1 
ATOM   136   O  "O3'" . A   A 1  7    ? 3.921   9.836   43.207  1.00 76.45  ? 7    A   R "O3'" 1 
ATOM   137   C  "C2'" . A   A 1  7    ? 5.799   9.653   41.622  1.00 77.51  ? 7    A   R "C2'" 1 
ATOM   138   O  "O2'" . A   A 1  7    ? 4.818   9.381   40.634  1.00 76.99  ? 7    A   R "O2'" 1 
ATOM   139   C  "C1'" . A   A 1  7    ? 6.735   10.734  41.071  1.00 78.24  ? 7    A   R "C1'" 1 
ATOM   140   N  N9    . A   A 1  7    ? 8.150   10.491  41.411  1.00 79.29  ? 7    A   R N9    1 
ATOM   141   C  C8    . A   A 1  7    ? 8.994   11.213  42.214  1.00 79.78  ? 7    A   R C8    1 
ATOM   142   N  N7    . A   A 1  7    ? 10.205  10.709  42.287  1.00 93.97  ? 7    A   R N7    1 
ATOM   143   C  C5    . A   A 1  7    ? 10.156  9.585   41.473  1.00 81.86  ? 7    A   R C5    1 
ATOM   144   C  C6    . A   A 1  7    ? 11.111  8.612   41.122  1.00 86.01  ? 7    A   R C6    1 
ATOM   145   N  N6    . A   A 1  7    ? 12.370  8.605   41.564  1.00 93.20  ? 7    A   R N6    1 
ATOM   146   N  N1    . A   A 1  7    ? 10.725  7.624   40.285  1.00 90.65  ? 7    A   R N1    1 
ATOM   147   C  C2    . A   A 1  7    ? 9.467   7.611   39.835  1.00 91.43  ? 7    A   R C2    1 
ATOM   148   N  N3    . A   A 1  7    ? 8.486   8.470   40.087  1.00 80.80  ? 7    A   R N3    1 
ATOM   149   C  C4    . A   A 1  7    ? 8.896   9.442   40.924  1.00 80.60  ? 7    A   R C4    1 
ATOM   150   P  P     . G   A 1  8    ? 3.848   8.681   44.317  1.00 85.68  ? 8    G   R P     1 
ATOM   151   O  OP1   . G   A 1  8    ? 2.447   8.565   44.790  1.00 82.46  ? 8    G   R OP1   1 
ATOM   152   O  OP2   . G   A 1  8    ? 4.943   8.896   45.293  1.00 114.61 ? 8    G   R OP2   1 
ATOM   153   O  "O5'" . G   A 1  8    ? 4.199   7.365   43.503  1.00 77.58  ? 8    G   R "O5'" 1 
ATOM   154   C  "C5'" . G   A 1  8    ? 3.461   7.003   42.348  1.00 77.24  ? 8    G   R "C5'" 1 
ATOM   155   C  "C4'" . G   A 1  8    ? 3.936   5.680   41.827  1.00 78.29  ? 8    G   R "C4'" 1 
ATOM   156   O  "O4'" . G   A 1  8    ? 5.250   5.821   41.240  1.00 79.13  ? 8    G   R "O4'" 1 
ATOM   157   C  "C3'" . G   A 1  8    ? 4.109   4.624   42.897  1.00 79.12  ? 8    G   R "C3'" 1 
ATOM   158   O  "O3'" . G   A 1  8    ? 2.874   3.999   43.188  1.00 82.19  ? 8    G   R "O3'" 1 
ATOM   159   C  "C2'" . G   A 1  8    ? 5.157   3.691   42.301  1.00 80.44  ? 8    G   R "C2'" 1 
ATOM   160   O  "O2'" . G   A 1  8    ? 4.549   2.755   41.424  1.00 80.69  ? 8    G   R "O2'" 1 
ATOM   161   C  "C1'" . G   A 1  8    ? 6.010   4.658   41.471  1.00 80.45  ? 8    G   R "C1'" 1 
ATOM   162   N  N9    . G   A 1  8    ? 7.274   5.051   42.125  1.00 81.26  ? 8    G   R N9    1 
ATOM   163   C  C8    . G   A 1  8    ? 7.509   6.162   42.899  1.00 80.78  ? 8    G   R C8    1 
ATOM   164   N  N7    . G   A 1  8    ? 8.745   6.244   43.316  1.00 81.94  ? 8    G   R N7    1 
ATOM   165   C  C5    . G   A 1  8    ? 9.368   5.129   42.777  1.00 83.31  ? 8    G   R C5    1 
ATOM   166   C  C6    . G   A 1  8    ? 10.710  4.680   42.879  1.00 86.66  ? 8    G   R C6    1 
ATOM   167   O  O6    . G   A 1  8    ? 11.656  5.190   43.490  1.00 100.04 ? 8    G   R O6    1 
ATOM   168   N  N1    . G   A 1  8    ? 10.906  3.499   42.174  1.00 93.35  ? 8    G   R N1    1 
ATOM   169   C  C2    . G   A 1  8    ? 9.936   2.839   41.463  1.00 85.67  ? 8    G   R C2    1 
ATOM   170   N  N2    . G   A 1  8    ? 10.309  1.714   40.842  1.00 87.09  ? 8    G   R N2    1 
ATOM   171   N  N3    . G   A 1  8    ? 8.685   3.247   41.356  1.00 83.97  ? 8    G   R N3    1 
ATOM   172   C  C4    . G   A 1  8    ? 8.473   4.389   42.035  1.00 82.88  ? 8    G   R C4    1 
ATOM   173   P  P     . G   A 1  9    ? 2.641   3.258   44.586  1.00 84.87  ? 9    G   R P     1 
ATOM   174   O  OP1   . G   A 1  9    ? 1.218   3.419   44.976  1.00 79.02  ? 9    G   R OP1   1 
ATOM   175   O  OP2   . G   A 1  9    ? 3.711   3.686   45.521  1.00 85.35  ? 9    G   R OP2   1 
ATOM   176   O  "O5'" . G   A 1  9    ? 2.865   1.731   44.217  1.00 87.60  ? 9    G   R "O5'" 1 
ATOM   177   C  "C5'" . G   A 1  9    ? 3.044   0.763   45.232  1.00 92.70  ? 9    G   R "C5'" 1 
ATOM   178   C  "C4'" . G   A 1  9    ? 4.144   -0.193  44.867  1.00 91.18  ? 9    G   R "C4'" 1 
ATOM   179   O  "O4'" . G   A 1  9    ? 5.107   0.470   44.011  1.00 83.09  ? 9    G   R "O4'" 1 
ATOM   180   C  "C3'" . G   A 1  9    ? 4.976   -0.721  46.022  1.00 104.30 ? 9    G   R "C3'" 1 
ATOM   181   O  "O3'" . G   A 1  9    ? 4.349   -1.791  46.705  1.00 132.73 ? 9    G   R "O3'" 1 
ATOM   182   C  "C2'" . G   A 1  9    ? 6.278   -1.114  45.340  1.00 90.29  ? 9    G   R "C2'" 1 
ATOM   183   O  "O2'" . G   A 1  9    ? 6.149   -2.371  44.697  1.00 89.71  ? 9    G   R "O2'" 1 
ATOM   184   C  "C1'" . G   A 1  9    ? 6.399   -0.029  44.268  1.00 84.54  ? 9    G   R "C1'" 1 
ATOM   185   N  N9    . G   A 1  9    ? 7.251   1.082   44.718  1.00 84.39  ? 9    G   R N9    1 
ATOM   186   C  C8    . G   A 1  9    ? 6.880   2.319   45.183  1.00 83.18  ? 9    G   R C8    1 
ATOM   187   N  N7    . G   A 1  9    ? 7.906   3.061   45.506  1.00 83.58  ? 9    G   R N7    1 
ATOM   188   C  C5    . G   A 1  9    ? 9.009   2.262   45.240  1.00 85.21  ? 9    G   R C5    1 
ATOM   189   C  C6    . G   A 1  9    ? 10.396  2.509   45.389  1.00 86.54  ? 9    G   R C6    1 
ATOM   190   O  O6    . G   A 1  9    ? 10.959  3.529   45.801  1.00 90.68  ? 9    G   R O6    1 
ATOM   191   N  N1    . G   A 1  9    ? 11.155  1.412   44.995  1.00 88.26  ? 9    G   R N1    1 
ATOM   192   C  C2    . G   A 1  9    ? 10.646  0.229   44.522  1.00 88.59  ? 9    G   R C2    1 
ATOM   193   N  N2    . G   A 1  9    ? 11.528  -0.721  44.190  1.00 90.50  ? 9    G   R N2    1 
ATOM   194   N  N3    . G   A 1  9    ? 9.360   -0.015  44.379  1.00 87.33  ? 9    G   R N3    1 
ATOM   195   C  C4    . G   A 1  9    ? 8.614   1.038   44.756  1.00 85.71  ? 9    G   R C4    1 
ATOM   196   P  P     . DT  B 2  3    ? 61.114  20.422  92.442  1.00 214.22 ? 3    DT  T P     1 
ATOM   197   O  OP1   . DT  B 2  3    ? 59.771  21.042  92.416  1.00 205.72 ? 3    DT  T OP1   1 
ATOM   198   O  OP2   . DT  B 2  3    ? 61.340  19.184  93.219  1.00 213.09 ? 3    DT  T OP2   1 
ATOM   199   O  "O5'" . DT  B 2  3    ? 61.603  20.158  90.941  1.00 227.80 ? 3    DT  T "O5'" 1 
ATOM   200   C  "C5'" . DT  B 2  3    ? 62.353  21.153  90.256  1.00 237.17 ? 3    DT  T "C5'" 1 
ATOM   201   C  "C4'" . DT  B 2  3    ? 63.647  20.578  89.706  1.00 243.51 ? 3    DT  T "C4'" 1 
ATOM   202   O  "O4'" . DT  B 2  3    ? 64.344  19.849  90.752  1.00 246.24 ? 3    DT  T "O4'" 1 
ATOM   203   C  "C3'" . DT  B 2  3    ? 63.480  19.596  88.542  1.00 243.20 ? 3    DT  T "C3'" 1 
ATOM   204   O  "O3'" . DT  B 2  3    ? 64.433  19.885  87.532  1.00 234.01 ? 3    DT  T "O3'" 1 
ATOM   205   C  "C2'" . DT  B 2  3    ? 63.751  18.238  89.188  1.00 246.80 ? 3    DT  T "C2'" 1 
ATOM   206   C  "C1'" . DT  B 2  3    ? 64.784  18.618  90.233  1.00 245.42 ? 3    DT  T "C1'" 1 
ATOM   207   N  N1    . DT  B 2  3    ? 64.902  17.636  91.350  1.00 238.04 ? 3    DT  T N1    1 
ATOM   208   C  C2    . DT  B 2  3    ? 65.657  16.499  91.168  1.00 238.21 ? 3    DT  T C2    1 
ATOM   209   O  O2    . DT  B 2  3    ? 66.239  16.243  90.128  1.00 242.62 ? 3    DT  T O2    1 
ATOM   210   N  N3    . DT  B 2  3    ? 65.706  15.664  92.252  1.00 229.14 ? 3    DT  T N3    1 
ATOM   211   C  C4    . DT  B 2  3    ? 65.090  15.848  93.476  1.00 216.87 ? 3    DT  T C4    1 
ATOM   212   O  O4    . DT  B 2  3    ? 65.195  15.038  94.391  1.00 209.07 ? 3    DT  T O4    1 
ATOM   213   C  C5    . DT  B 2  3    ? 64.316  17.060  93.602  1.00 215.05 ? 3    DT  T C5    1 
ATOM   214   C  C7    . DT  B 2  3    ? 63.603  17.368  94.886  1.00 205.49 ? 3    DT  T C7    1 
ATOM   215   C  C6    . DT  B 2  3    ? 64.261  17.887  92.546  1.00 226.11 ? 3    DT  T C6    1 
ATOM   216   P  P     . DT  B 2  4    ? 64.029  20.802  86.277  1.00 222.85 ? 4    DT  T P     1 
ATOM   217   O  OP1   . DT  B 2  4    ? 64.435  22.191  86.584  1.00 220.49 ? 4    DT  T OP1   1 
ATOM   218   O  OP2   . DT  B 2  4    ? 62.622  20.501  85.933  1.00 220.29 ? 4    DT  T OP2   1 
ATOM   219   O  "O5'" . DT  B 2  4    ? 64.971  20.274  85.101  1.00 222.35 ? 4    DT  T "O5'" 1 
ATOM   220   C  "C5'" . DT  B 2  4    ? 64.394  19.691  83.948  1.00 222.06 ? 4    DT  T "C5'" 1 
ATOM   221   C  "C4'" . DT  B 2  4    ? 65.195  18.486  83.496  1.00 222.47 ? 4    DT  T "C4'" 1 
ATOM   222   O  "O4'" . DT  B 2  4    ? 65.214  17.493  84.556  1.00 218.64 ? 4    DT  T "O4'" 1 
ATOM   223   C  "C3'" . DT  B 2  4    ? 64.634  17.775  82.275  1.00 223.27 ? 4    DT  T "C3'" 1 
ATOM   224   O  "O3'" . DT  B 2  4    ? 65.686  17.201  81.520  1.00 224.84 ? 4    DT  T "O3'" 1 
ATOM   225   C  "C2'" . DT  B 2  4    ? 63.743  16.710  82.896  1.00 218.87 ? 4    DT  T "C2'" 1 
ATOM   226   C  "C1'" . DT  B 2  4    ? 64.539  16.324  84.136  1.00 213.22 ? 4    DT  T "C1'" 1 
ATOM   227   N  N1    . DT  B 2  4    ? 63.690  15.833  85.267  1.00 201.39 ? 4    DT  T N1    1 
ATOM   228   C  C2    . DT  B 2  4    ? 64.286  15.173  86.317  1.00 196.78 ? 4    DT  T C2    1 
ATOM   229   O  O2    . DT  B 2  4    ? 65.484  14.963  86.380  1.00 196.72 ? 4    DT  T O2    1 
ATOM   230   N  N3    . DT  B 2  4    ? 63.424  14.766  87.300  1.00 195.22 ? 4    DT  T N3    1 
ATOM   231   C  C4    . DT  B 2  4    ? 62.053  14.946  87.338  1.00 194.76 ? 4    DT  T C4    1 
ATOM   232   O  O4    . DT  B 2  4    ? 61.363  14.542  88.268  1.00 193.92 ? 4    DT  T O4    1 
ATOM   233   C  C5    . DT  B 2  4    ? 61.491  15.644  86.206  1.00 195.48 ? 4    DT  T C5    1 
ATOM   234   C  C7    . DT  B 2  4    ? 60.015  15.901  86.137  1.00 195.24 ? 4    DT  T C7    1 
ATOM   235   C  C6    . DT  B 2  4    ? 62.326  16.049  85.237  1.00 196.47 ? 4    DT  T C6    1 
ATOM   236   P  P     . DC  B 2  5    ? 65.475  16.881  79.960  1.00 224.47 ? 5    DC  T P     1 
ATOM   237   O  OP1   . DC  B 2  5    ? 66.738  17.189  79.256  1.00 223.07 ? 5    DC  T OP1   1 
ATOM   238   O  OP2   . DC  B 2  5    ? 64.217  17.533  79.535  1.00 222.32 ? 5    DC  T OP2   1 
ATOM   239   O  "O5'" . DC  B 2  5    ? 65.250  15.300  79.924  1.00 214.20 ? 5    DC  T "O5'" 1 
ATOM   240   C  "C5'" . DC  B 2  5    ? 65.489  14.585  78.726  1.00 206.75 ? 5    DC  T "C5'" 1 
ATOM   241   C  "C4'" . DC  B 2  5    ? 65.365  13.092  78.950  1.00 202.81 ? 5    DC  T "C4'" 1 
ATOM   242   O  "O4'" . DC  B 2  5    ? 64.711  12.843  80.228  1.00 201.42 ? 5    DC  T "O4'" 1 
ATOM   243   C  "C3'" . DC  B 2  5    ? 64.516  12.369  77.912  1.00 208.44 ? 5    DC  T "C3'" 1 
ATOM   244   O  "O3'" . DC  B 2  5    ? 64.989  11.042  77.736  1.00 220.73 ? 5    DC  T "O3'" 1 
ATOM   245   C  "C2'" . DC  B 2  5    ? 63.148  12.384  78.572  1.00 203.44 ? 5    DC  T "C2'" 1 
ATOM   246   C  "C1'" . DC  B 2  5    ? 63.536  12.092  80.007  1.00 201.32 ? 5    DC  T "C1'" 1 
ATOM   247   N  N1    . DC  B 2  5    ? 62.509  12.500  81.002  1.00 200.05 ? 5    DC  T N1    1 
ATOM   248   C  C2    . DC  B 2  5    ? 61.753  11.521  81.657  1.00 199.47 ? 5    DC  T C2    1 
ATOM   249   O  O2    . DC  B 2  5    ? 61.952  10.328  81.396  1.00 200.09 ? 5    DC  T O2    1 
ATOM   250   N  N3    . DC  B 2  5    ? 60.823  11.910  82.563  1.00 198.41 ? 5    DC  T N3    1 
ATOM   251   C  C4    . DC  B 2  5    ? 60.641  13.205  82.816  1.00 197.96 ? 5    DC  T C4    1 
ATOM   252   N  N4    . DC  B 2  5    ? 59.718  13.543  83.716  1.00 197.04 ? 5    DC  T N4    1 
ATOM   253   C  C5    . DC  B 2  5    ? 61.397  14.212  82.156  1.00 198.60 ? 5    DC  T C5    1 
ATOM   254   C  C6    . DC  B 2  5    ? 62.313  13.820  81.268  1.00 199.61 ? 5    DC  T C6    1 
ATOM   255   P  P     . DT  B 2  6    ? 64.674  10.243  76.378  1.00 233.58 ? 6    DT  T P     1 
ATOM   256   O  OP1   . DT  B 2  6    ? 65.966  10.004  75.700  1.00 237.36 ? 6    DT  T OP1   1 
ATOM   257   O  OP2   . DT  B 2  6    ? 63.593  10.958  75.663  1.00 232.93 ? 6    DT  T OP2   1 
ATOM   258   O  "O5'" . DT  B 2  6    ? 64.090  8.842   76.882  1.00 235.51 ? 6    DT  T "O5'" 1 
ATOM   259   C  "C5'" . DT  B 2  6    ? 63.236  8.797   78.018  1.00 236.45 ? 6    DT  T "C5'" 1 
ATOM   260   C  "C4'" . DT  B 2  6    ? 61.923  8.121   77.681  1.00 237.95 ? 6    DT  T "C4'" 1 
ATOM   261   O  "O4'" . DT  B 2  6    ? 60.865  8.692   78.499  1.00 237.72 ? 6    DT  T "O4'" 1 
ATOM   262   C  "C3'" . DT  B 2  6    ? 61.452  8.305   76.242  1.00 239.31 ? 6    DT  T "C3'" 1 
ATOM   263   O  "O3'" . DT  B 2  6    ? 60.577  7.239   75.877  1.00 239.87 ? 6    DT  T "O3'" 1 
ATOM   264   C  "C2'" . DT  B 2  6    ? 60.677  9.606   76.353  1.00 239.06 ? 6    DT  T "C2'" 1 
ATOM   265   C  "C1'" . DT  B 2  6    ? 59.941  9.359   77.663  1.00 237.07 ? 6    DT  T "C1'" 1 
ATOM   266   N  N1    . DT  B 2  6    ? 59.477  10.598  78.349  1.00 233.01 ? 6    DT  T N1    1 
ATOM   267   C  C2    . DT  B 2  6    ? 58.709  10.488  79.482  1.00 233.18 ? 6    DT  T C2    1 
ATOM   268   O  O2    . DT  B 2  6    ? 58.383  9.419   79.967  1.00 232.00 ? 6    DT  T O2    1 
ATOM   269   N  N3    . DT  B 2  6    ? 58.335  11.682  80.036  1.00 231.51 ? 6    DT  T N3    1 
ATOM   270   C  C4    . DT  B 2  6    ? 58.641  12.949  79.579  1.00 225.23 ? 6    DT  T C4    1 
ATOM   271   O  O4    . DT  B 2  6    ? 58.254  13.963  80.150  1.00 220.34 ? 6    DT  T O4    1 
ATOM   272   C  C5    . DT  B 2  6    ? 59.446  12.993  78.384  1.00 223.81 ? 6    DT  T C5    1 
ATOM   273   C  C7    . DT  B 2  6    ? 59.844  14.312  77.791  1.00 220.07 ? 6    DT  T C7    1 
ATOM   274   C  C6    . DT  B 2  6    ? 59.813  11.829  77.829  1.00 227.69 ? 6    DT  T C6    1 
ATOM   275   P  P     . DC  B 2  7    ? 61.139  5.788   75.473  1.00 243.33 ? 7    DC  T P     1 
ATOM   276   O  OP1   . DC  B 2  7    ? 62.617  5.787   75.550  1.00 242.71 ? 7    DC  T OP1   1 
ATOM   277   O  OP2   . DC  B 2  7    ? 60.482  5.413   74.203  1.00 243.06 ? 7    DC  T OP2   1 
ATOM   278   O  "O5'" . DC  B 2  7    ? 60.537  4.830   76.605  1.00 243.52 ? 7    DC  T "O5'" 1 
ATOM   279   C  "C5'" . DC  B 2  7    ? 59.581  5.343   77.529  1.00 239.28 ? 7    DC  T "C5'" 1 
ATOM   280   C  "C4'" . DC  B 2  7    ? 58.250  4.627   77.406  1.00 237.33 ? 7    DC  T "C4'" 1 
ATOM   281   O  "O4'" . DC  B 2  7    ? 57.207  5.474   77.944  1.00 233.75 ? 7    DC  T "O4'" 1 
ATOM   282   C  "C3'" . DC  B 2  7    ? 57.832  4.269   75.983  1.00 237.52 ? 7    DC  T "C3'" 1 
ATOM   283   O  "O3'" . DC  B 2  7    ? 57.302  2.892   75.935  1.00 242.35 ? 7    DC  T "O3'" 1 
ATOM   284   C  "C2'" . DC  B 2  7    ? 56.842  5.370   75.588  1.00 233.96 ? 7    DC  T "C2'" 1 
ATOM   285   C  "C1'" . DC  B 2  7    ? 56.339  5.920   76.923  1.00 230.17 ? 7    DC  T "C1'" 1 
ATOM   286   N  N1    . DC  B 2  7    ? 56.266  7.411   76.962  1.00 224.27 ? 7    DC  T N1    1 
ATOM   287   C  C2    . DC  B 2  7    ? 55.545  8.045   77.979  1.00 220.67 ? 7    DC  T C2    1 
ATOM   288   O  O2    . DC  B 2  7    ? 54.984  7.357   78.841  1.00 219.63 ? 7    DC  T O2    1 
ATOM   289   N  N3    . DC  B 2  7    ? 55.487  9.399   77.992  1.00 216.84 ? 7    DC  T N3    1 
ATOM   290   C  C4    . DC  B 2  7    ? 56.107  10.103  77.042  1.00 213.04 ? 7    DC  T C4    1 
ATOM   291   N  N4    . DC  B 2  7    ? 56.025  11.433  77.095  1.00 209.49 ? 7    DC  T N4    1 
ATOM   292   C  C5    . DC  B 2  7    ? 56.836  9.474   75.995  1.00 215.41 ? 7    DC  T C5    1 
ATOM   293   C  C6    . DC  B 2  7    ? 56.892  8.141   75.995  1.00 220.27 ? 7    DC  T C6    1 
ATOM   294   P  P     . DT  B 2  8    ? 55.787  2.497   75.528  1.00 179.82 ? 8    DT  T P     1 
ATOM   295   O  OP1   . DT  B 2  8    ? 55.750  1.028   75.677  1.00 183.77 ? 8    DT  T OP1   1 
ATOM   296   O  OP2   . DT  B 2  8    ? 55.374  3.032   74.209  1.00 170.80 ? 8    DT  T OP2   1 
ATOM   297   O  "O5'" . DT  B 2  8    ? 54.887  3.086   76.712  1.00 175.18 ? 8    DT  T "O5'" 1 
ATOM   298   C  "C5'" . DT  B 2  8    ? 53.537  2.676   76.855  1.00 167.68 ? 8    DT  T "C5'" 1 
ATOM   299   C  "C4'" . DT  B 2  8    ? 52.883  3.367   78.038  1.00 162.55 ? 8    DT  T "C4'" 1 
ATOM   300   O  "O4'" . DT  B 2  8    ? 53.262  4.774   78.047  1.00 158.58 ? 8    DT  T "O4'" 1 
ATOM   301   C  "C3'" . DT  B 2  8    ? 51.358  3.351   78.016  1.00 168.98 ? 8    DT  T "C3'" 1 
ATOM   302   O  "O3'" . DT  B 2  8    ? 50.837  3.292   79.342  1.00 184.41 ? 8    DT  T "O3'" 1 
ATOM   303   C  "C2'" . DT  B 2  8    ? 51.038  4.679   77.352  1.00 169.98 ? 8    DT  T "C2'" 1 
ATOM   304   C  "C1'" . DT  B 2  8    ? 52.102  5.575   77.950  1.00 171.29 ? 8    DT  T "C1'" 1 
ATOM   305   N  N1    . DT  B 2  8    ? 52.399  6.753   77.099  1.00 182.94 ? 8    DT  T N1    1 
ATOM   306   C  C2    . DT  B 2  8    ? 52.012  8.005   77.519  1.00 181.22 ? 8    DT  T C2    1 
ATOM   307   O  O2    . DT  B 2  8    ? 51.448  8.210   78.579  1.00 180.49 ? 8    DT  T O2    1 
ATOM   308   N  N3    . DT  B 2  8    ? 52.324  9.018   76.652  1.00 172.06 ? 8    DT  T N3    1 
ATOM   309   C  C4    . DT  B 2  8    ? 52.962  8.904   75.430  1.00 162.74 ? 8    DT  T C4    1 
ATOM   310   O  O4    . DT  B 2  8    ? 53.198  9.872   74.717  1.00 150.84 ? 8    DT  T O4    1 
ATOM   311   C  C5    . DT  B 2  8    ? 53.328  7.563   75.048  1.00 165.91 ? 8    DT  T C5    1 
ATOM   312   C  C7    . DT  B 2  8    ? 54.025  7.314   73.743  1.00 152.95 ? 8    DT  T C7    1 
ATOM   313   C  C6    . DT  B 2  8    ? 53.024  6.565   75.887  1.00 179.43 ? 8    DT  T C6    1 
ATOM   314   P  P     . DC  B 2  9    ? 49.382  2.660   79.619  1.00 197.25 ? 9    DC  T P     1 
ATOM   315   O  OP1   . DC  B 2  9    ? 48.946  3.103   80.961  1.00 202.96 ? 9    DC  T OP1   1 
ATOM   316   O  OP2   . DC  B 2  9    ? 49.464  1.216   79.308  1.00 200.70 ? 9    DC  T OP2   1 
ATOM   317   O  "O5'" . DC  B 2  9    ? 48.438  3.338   78.516  1.00 200.65 ? 9    DC  T "O5'" 1 
ATOM   318   C  "C5'" . DC  B 2  9    ? 47.064  3.578   78.787  1.00 198.71 ? 9    DC  T "C5'" 1 
ATOM   319   C  "C4'" . DC  B 2  9    ? 46.833  5.039   79.132  1.00 196.89 ? 9    DC  T "C4'" 1 
ATOM   320   O  "O4'" . DC  B 2  9    ? 47.865  5.857   78.516  1.00 195.54 ? 9    DC  T "O4'" 1 
ATOM   321   C  "C3'" . DC  B 2  9    ? 45.491  5.616   78.670  1.00 194.28 ? 9    DC  T "C3'" 1 
ATOM   322   O  "O3'" . DC  B 2  9    ? 44.905  6.363   79.729  1.00 195.88 ? 9    DC  T "O3'" 1 
ATOM   323   C  "C2'" . DC  B 2  9    ? 45.883  6.510   77.493  1.00 190.96 ? 9    DC  T "C2'" 1 
ATOM   324   C  "C1'" . DC  B 2  9    ? 47.270  6.971   77.895  1.00 192.49 ? 9    DC  T "C1'" 1 
ATOM   325   N  N1    . DC  B 2  9    ? 48.107  7.373   76.730  1.00 189.73 ? 9    DC  T N1    1 
ATOM   326   C  C2    . DC  B 2  9    ? 48.530  8.702   76.602  1.00 191.82 ? 9    DC  T C2    1 
ATOM   327   O  O2    . DC  B 2  9    ? 48.212  9.525   77.469  1.00 191.73 ? 9    DC  T O2    1 
ATOM   328   N  N3    . DC  B 2  9    ? 49.285  9.048   75.529  1.00 189.61 ? 9    DC  T N3    1 
ATOM   329   C  C4    . DC  B 2  9    ? 49.607  8.131   74.615  1.00 181.75 ? 9    DC  T C4    1 
ATOM   330   N  N4    . DC  B 2  9    ? 50.352  8.518   73.575  1.00 180.40 ? 9    DC  T N4    1 
ATOM   331   C  C5    . DC  B 2  9    ? 49.180  6.776   74.728  1.00 178.63 ? 9    DC  T C5    1 
ATOM   332   C  C6    . DC  B 2  9    ? 48.437  6.446   75.787  1.00 182.15 ? 9    DC  T C6    1 
ATOM   333   P  P     . DT  B 2  10   ? 43.367  6.837   79.678  1.00 196.43 ? 10   DT  T P     1 
ATOM   334   O  OP1   . DT  B 2  10   ? 42.634  6.036   80.681  1.00 196.24 ? 10   DT  T OP1   1 
ATOM   335   O  OP2   . DT  B 2  10   ? 42.860  6.878   78.288  1.00 191.55 ? 10   DT  T OP2   1 
ATOM   336   O  "O5'" . DT  B 2  10   ? 43.449  8.342   80.194  1.00 190.28 ? 10   DT  T "O5'" 1 
ATOM   337   C  "C5'" . DT  B 2  10   ? 44.641  9.088   79.988  1.00 186.30 ? 10   DT  T "C5'" 1 
ATOM   338   C  "C4'" . DT  B 2  10   ? 44.318  10.469  79.462  1.00 187.26 ? 10   DT  T "C4'" 1 
ATOM   339   O  "O4'" . DT  B 2  10   ? 45.232  10.803  78.387  1.00 185.34 ? 10   DT  T "O4'" 1 
ATOM   340   C  "C3'" . DT  B 2  10   ? 42.908  10.613  78.894  1.00 192.38 ? 10   DT  T "C3'" 1 
ATOM   341   O  "O3'" . DT  B 2  10   ? 42.307  11.794  79.390  1.00 199.84 ? 10   DT  T "O3'" 1 
ATOM   342   C  "C2'" . DT  B 2  10   ? 43.125  10.670  77.382  1.00 189.28 ? 10   DT  T "C2'" 1 
ATOM   343   C  "C1'" . DT  B 2  10   ? 44.510  11.286  77.280  1.00 185.96 ? 10   DT  T "C1'" 1 
ATOM   344   N  N1    . DT  B 2  10   ? 45.239  10.891  76.047  1.00 180.97 ? 10   DT  T N1    1 
ATOM   345   C  C2    . DT  B 2  10   ? 45.998  11.826  75.386  1.00 181.77 ? 10   DT  T C2    1 
ATOM   346   O  O2    . DT  B 2  10   ? 46.111  12.981  75.758  1.00 178.87 ? 10   DT  T O2    1 
ATOM   347   N  N3    . DT  B 2  10   ? 46.628  11.359  74.266  1.00 182.42 ? 10   DT  T N3    1 
ATOM   348   C  C4    . DT  B 2  10   ? 46.575  10.080  73.748  1.00 176.80 ? 10   DT  T C4    1 
ATOM   349   O  O4    . DT  B 2  10   ? 47.180  9.758   72.734  1.00 179.64 ? 10   DT  T O4    1 
ATOM   350   C  C5    . DT  B 2  10   ? 45.762  9.149   74.488  1.00 166.76 ? 10   DT  T C5    1 
ATOM   351   C  C7    . DT  B 2  10   ? 45.627  7.731   74.018  1.00 154.13 ? 10   DT  T C7    1 
ATOM   352   C  C6    . DT  B 2  10   ? 45.142  9.592   75.591  1.00 172.88 ? 10   DT  T C6    1 
ATOM   353   P  P     . DC  B 2  11   ? 40.751  12.079  79.122  1.00 205.58 ? 11   DC  T P     1 
ATOM   354   O  OP1   . DC  B 2  11   ? 40.238  12.863  80.267  1.00 206.55 ? 11   DC  T OP1   1 
ATOM   355   O  OP2   . DC  B 2  11   ? 40.107  10.795  78.765  1.00 201.22 ? 11   DC  T OP2   1 
ATOM   356   O  "O5'" . DC  B 2  11   ? 40.768  13.007  77.822  1.00 209.92 ? 11   DC  T "O5'" 1 
ATOM   357   C  "C5'" . DC  B 2  11   ? 41.706  14.070  77.736  1.00 208.62 ? 11   DC  T "C5'" 1 
ATOM   358   C  "C4'" . DC  B 2  11   ? 41.701  14.686  76.351  1.00 206.12 ? 11   DC  T "C4'" 1 
ATOM   359   O  "O4'" . DC  B 2  11   ? 42.548  13.914  75.462  1.00 202.38 ? 11   DC  T "O4'" 1 
ATOM   360   C  "C3'" . DC  B 2  11   ? 40.326  14.753  75.679  1.00 207.99 ? 11   DC  T "C3'" 1 
ATOM   361   O  "O3'" . DC  B 2  11   ? 40.090  16.065  75.209  1.00 212.81 ? 11   DC  T "O3'" 1 
ATOM   362   C  "C2'" . DC  B 2  11   ? 40.439  13.755  74.525  1.00 203.60 ? 11   DC  T "C2'" 1 
ATOM   363   C  "C1'" . DC  B 2  11   ? 41.920  13.836  74.210  1.00 202.56 ? 11   DC  T "C1'" 1 
ATOM   364   N  N1    . DC  B 2  11   ? 42.448  12.651  73.480  1.00 200.51 ? 11   DC  T N1    1 
ATOM   365   C  C2    . DC  B 2  11   ? 43.181  12.840  72.306  1.00 201.92 ? 11   DC  T C2    1 
ATOM   366   O  O2    . DC  B 2  11   ? 43.375  13.991  71.897  1.00 204.13 ? 11   DC  T O2    1 
ATOM   367   N  N3    . DC  B 2  11   ? 43.659  11.755  71.648  1.00 196.10 ? 11   DC  T N3    1 
ATOM   368   C  C4    . DC  B 2  11   ? 43.426  10.532  72.124  1.00 188.71 ? 11   DC  T C4    1 
ATOM   369   N  N4    . DC  B 2  11   ? 43.917  9.491   71.445  1.00 183.83 ? 11   DC  T N4    1 
ATOM   370   C  C5    . DC  B 2  11   ? 42.677  10.320  73.318  1.00 187.69 ? 11   DC  T C5    1 
ATOM   371   C  C6    . DC  B 2  11   ? 42.214  11.398  73.959  1.00 193.08 ? 11   DC  T C6    1 
ATOM   372   P  P     . DT  B 2  12   ? 38.589  16.627  75.111  1.00 217.67 ? 12   DT  T P     1 
ATOM   373   O  OP1   . DT  B 2  12   ? 38.620  18.051  75.508  1.00 224.65 ? 12   DT  T OP1   1 
ATOM   374   O  OP2   . DT  B 2  12   ? 37.705  15.682  75.828  1.00 219.36 ? 12   DT  T OP2   1 
ATOM   375   O  "O5'" . DT  B 2  12   ? 38.249  16.535  73.554  1.00 207.73 ? 12   DT  T "O5'" 1 
ATOM   376   C  "C5'" . DT  B 2  12   ? 38.075  17.722  72.800  1.00 199.09 ? 12   DT  T "C5'" 1 
ATOM   377   C  "C4'" . DT  B 2  12   ? 39.374  18.145  72.142  1.00 195.05 ? 12   DT  T "C4'" 1 
ATOM   378   O  "O4'" . DT  B 2  12   ? 40.244  16.984  71.997  1.00 195.68 ? 12   DT  T "O4'" 1 
ATOM   379   C  "C3'" . DT  B 2  12   ? 39.208  18.708  70.733  1.00 198.85 ? 12   DT  T "C3'" 1 
ATOM   380   O  "O3'" . DT  B 2  12   ? 40.197  19.692  70.467  1.00 204.54 ? 12   DT  T "O3'" 1 
ATOM   381   C  "C2'" . DT  B 2  12   ? 39.424  17.475  69.881  1.00 199.53 ? 12   DT  T "C2'" 1 
ATOM   382   C  "C1'" . DT  B 2  12   ? 40.565  16.825  70.633  1.00 202.13 ? 12   DT  T "C1'" 1 
ATOM   383   N  N1    . DT  B 2  12   ? 40.734  15.378  70.329  1.00 211.95 ? 12   DT  T N1    1 
ATOM   384   C  C2    . DT  B 2  12   ? 41.668  15.000  69.396  1.00 215.02 ? 12   DT  T C2    1 
ATOM   385   O  O2    . DT  B 2  12   ? 42.382  15.792  68.807  1.00 216.25 ? 12   DT  T O2    1 
ATOM   386   N  N3    . DT  B 2  12   ? 41.752  13.651  69.182  1.00 214.23 ? 12   DT  T N3    1 
ATOM   387   C  C4    . DT  B 2  12   ? 41.004  12.663  69.790  1.00 212.79 ? 12   DT  T C4    1 
ATOM   388   O  O4    . DT  B 2  12   ? 41.152  11.475  69.529  1.00 207.10 ? 12   DT  T O4    1 
ATOM   389   C  C5    . DT  B 2  12   ? 40.035  13.125  70.753  1.00 217.18 ? 12   DT  T C5    1 
ATOM   390   C  C7    . DT  B 2  12   ? 39.164  12.140  71.474  1.00 218.88 ? 12   DT  T C7    1 
ATOM   391   C  C6    . DT  B 2  12   ? 39.946  14.447  70.974  1.00 216.64 ? 12   DT  T C6    1 
ATOM   392   P  P     . DC  B 2  13   ? 39.979  20.741  69.268  1.00 214.17 ? 13   DC  T P     1 
ATOM   393   O  OP1   . DC  B 2  13   ? 40.963  21.832  69.438  1.00 218.12 ? 13   DC  T OP1   1 
ATOM   394   O  OP2   . DC  B 2  13   ? 38.532  21.047  69.218  1.00 212.37 ? 13   DC  T OP2   1 
ATOM   395   O  "O5'" . DC  B 2  13   ? 40.344  19.918  67.941  1.00 214.29 ? 13   DC  T "O5'" 1 
ATOM   396   C  "C5'" . DC  B 2  13   ? 41.575  20.162  67.272  1.00 217.18 ? 13   DC  T "C5'" 1 
ATOM   397   C  "C4'" . DC  B 2  13   ? 41.601  19.510  65.896  1.00 224.55 ? 13   DC  T "C4'" 1 
ATOM   398   O  "O4'" . DC  B 2  13   ? 41.676  18.067  66.031  1.00 225.00 ? 13   DC  T "O4'" 1 
ATOM   399   C  "C3'" . DC  B 2  13   ? 40.390  19.797  64.998  1.00 231.68 ? 13   DC  T "C3'" 1 
ATOM   400   O  "O3'" . DC  B 2  13   ? 40.849  20.183  63.693  1.00 243.00 ? 13   DC  T "O3'" 1 
ATOM   401   C  "C2'" . DC  B 2  13   ? 39.642  18.461  64.979  1.00 225.10 ? 13   DC  T "C2'" 1 
ATOM   402   C  "C1'" . DC  B 2  13   ? 40.779  17.470  65.126  1.00 223.04 ? 13   DC  T "C1'" 1 
ATOM   403   N  N1    . DC  B 2  13   ? 40.354  16.162  65.686  1.00 221.72 ? 13   DC  T N1    1 
ATOM   404   C  C2    . DC  B 2  13   ? 40.891  14.983  65.172  1.00 221.48 ? 13   DC  T C2    1 
ATOM   405   O  O2    . DC  B 2  13   ? 41.715  15.047  64.252  1.00 220.43 ? 13   DC  T O2    1 
ATOM   406   N  N3    . DC  B 2  13   ? 40.497  13.797  65.700  1.00 222.08 ? 13   DC  T N3    1 
ATOM   407   C  C4    . DC  B 2  13   ? 39.612  13.772  66.697  1.00 220.23 ? 13   DC  T C4    1 
ATOM   408   N  N4    . DC  B 2  13   ? 39.244  12.579  67.177  1.00 218.37 ? 13   DC  T N4    1 
ATOM   409   C  C5    . DC  B 2  13   ? 39.045  14.966  67.226  1.00 219.95 ? 13   DC  T C5    1 
ATOM   410   C  C6    . DC  B 2  13   ? 39.443  16.125  66.695  1.00 221.01 ? 13   DC  T C6    1 
ATOM   411   P  P     . DG  B 2  14   ? 39.848  20.304  62.436  1.00 252.67 ? 14   DG  T P     1 
ATOM   412   O  OP1   . DG  B 2  14   ? 40.434  21.328  61.547  1.00 256.94 ? 14   DG  T OP1   1 
ATOM   413   O  OP2   . DG  B 2  14   ? 38.442  20.471  62.872  1.00 255.10 ? 14   DG  T OP2   1 
ATOM   414   O  "O5'" . DG  B 2  14   ? 40.008  18.899  61.695  1.00 250.90 ? 14   DG  T "O5'" 1 
ATOM   415   C  "C5'" . DG  B 2  14   ? 41.223  18.598  61.007  1.00 251.87 ? 14   DG  T "C5'" 1 
ATOM   416   C  "C4'" . DG  B 2  14   ? 41.166  17.225  60.358  1.00 253.76 ? 14   DG  T "C4'" 1 
ATOM   417   O  "O4'" . DG  B 2  14   ? 40.848  16.227  61.361  1.00 254.65 ? 14   DG  T "O4'" 1 
ATOM   418   C  "C3'" . DG  B 2  14   ? 40.112  17.064  59.260  1.00 255.25 ? 14   DG  T "C3'" 1 
ATOM   419   O  "O3'" . DG  B 2  14   ? 40.620  16.228  58.226  1.00 250.62 ? 14   DG  T "O3'" 1 
ATOM   420   C  "C2'" . DG  B 2  14   ? 38.961  16.392  59.998  1.00 255.73 ? 14   DG  T "C2'" 1 
ATOM   421   C  "C1'" . DG  B 2  14   ? 39.730  15.482  60.936  1.00 255.34 ? 14   DG  T "C1'" 1 
ATOM   422   N  N9    . DG  B 2  14   ? 38.984  15.062  62.112  1.00 257.37 ? 14   DG  T N9    1 
ATOM   423   C  C8    . DG  B 2  14   ? 38.339  15.859  63.027  1.00 258.40 ? 14   DG  T C8    1 
ATOM   424   N  N7    . DG  B 2  14   ? 37.768  15.183  63.987  1.00 257.17 ? 14   DG  T N7    1 
ATOM   425   C  C5    . DG  B 2  14   ? 38.059  13.859  63.684  1.00 258.21 ? 14   DG  T C5    1 
ATOM   426   C  C6    . DG  B 2  14   ? 37.710  12.668  64.359  1.00 264.54 ? 14   DG  T C6    1 
ATOM   427   O  O6    . DG  B 2  14   ? 37.052  12.541  65.402  1.00 267.92 ? 14   DG  T O6    1 
ATOM   428   N  N1    . DG  B 2  14   ? 38.219  11.543  63.713  1.00 265.53 ? 14   DG  T N1    1 
ATOM   429   C  C2    . DG  B 2  14   ? 38.961  11.574  62.556  1.00 264.57 ? 14   DG  T C2    1 
ATOM   430   N  N2    . DG  B 2  14   ? 39.363  10.398  62.067  1.00 265.79 ? 14   DG  T N2    1 
ATOM   431   N  N3    . DG  B 2  14   ? 39.291  12.680  61.920  1.00 260.29 ? 14   DG  T N3    1 
ATOM   432   C  C4    . DG  B 2  14   ? 38.810  13.777  62.538  1.00 257.49 ? 14   DG  T C4    1 
ATOM   433   P  P     . DC  B 2  15   ? 40.256  16.530  56.691  1.00 235.84 ? 15   DC  T P     1 
ATOM   434   O  OP1   . DC  B 2  15   ? 41.526  16.594  55.935  1.00 240.01 ? 15   DC  T OP1   1 
ATOM   435   O  OP2   . DC  B 2  15   ? 39.317  17.672  56.667  1.00 244.63 ? 15   DC  T OP2   1 
ATOM   436   O  "O5'" . DC  B 2  15   ? 39.458  15.231  56.217  1.00 213.94 ? 15   DC  T "O5'" 1 
ATOM   437   C  "C5'" . DC  B 2  15   ? 40.088  14.292  55.361  1.00 198.11 ? 15   DC  T "C5'" 1 
ATOM   438   C  "C4'" . DC  B 2  15   ? 39.489  12.912  55.541  1.00 190.08 ? 15   DC  T "C4'" 1 
ATOM   439   O  "O4'" . DC  B 2  15   ? 39.276  12.662  56.947  1.00 187.01 ? 15   DC  T "O4'" 1 
ATOM   440   C  "C3'" . DC  B 2  15   ? 38.122  12.717  54.912  1.00 186.32 ? 15   DC  T "C3'" 1 
ATOM   441   O  "O3'" . DC  B 2  15   ? 38.237  12.421  53.487  1.00 180.01 ? 15   DC  T "O3'" 1 
ATOM   442   C  "C2'" . DC  B 2  15   ? 37.542  11.567  55.734  1.00 182.52 ? 15   DC  T "C2'" 1 
ATOM   443   C  "C1'" . DC  B 2  15   ? 38.161  11.803  57.116  1.00 181.50 ? 15   DC  T "C1'" 1 
ATOM   444   N  N1    . DC  B 2  15   ? 37.223  12.418  58.107  1.00 181.75 ? 15   DC  T N1    1 
ATOM   445   C  C2    . DC  B 2  15   ? 36.494  11.591  58.961  1.00 186.57 ? 15   DC  T C2    1 
ATOM   446   O  O2    . DC  B 2  15   ? 36.639  10.368  58.875  1.00 191.73 ? 15   DC  T O2    1 
ATOM   447   N  N3    . DC  B 2  15   ? 35.650  12.152  59.861  1.00 183.16 ? 15   DC  T N3    1 
ATOM   448   C  C4    . DC  B 2  15   ? 35.524  13.476  59.921  1.00 176.63 ? 15   DC  T C4    1 
ATOM   449   N  N4    . DC  B 2  15   ? 34.679  13.984  60.823  1.00 170.30 ? 15   DC  T N4    1 
ATOM   450   C  C5    . DC  B 2  15   ? 36.256  14.339  59.056  1.00 177.38 ? 15   DC  T C5    1 
ATOM   451   C  C6    . DC  B 2  15   ? 37.090  13.774  58.177  1.00 179.70 ? 15   DC  T C6    1 
ATOM   452   P  P     . DT  B 2  16   ? 38.660  10.973  52.909  1.00 165.46 ? 16   DT  T P     1 
ATOM   453   O  OP1   . DT  B 2  16   ? 39.668  10.280  53.741  1.00 166.68 ? 16   DT  T OP1   1 
ATOM   454   O  OP2   . DT  B 2  16   ? 38.989  11.216  51.491  1.00 163.47 ? 16   DT  T OP2   1 
ATOM   455   O  "O5'" . DT  B 2  16   ? 37.303  10.131  52.912  1.00 143.05 ? 16   DT  T "O5'" 1 
ATOM   456   C  "C5'" . DT  B 2  16   ? 37.352  8.727   53.094  1.00 137.37 ? 16   DT  T "C5'" 1 
ATOM   457   C  "C4'" . DT  B 2  16   ? 35.972  8.170   53.380  1.00 138.80 ? 16   DT  T "C4'" 1 
ATOM   458   O  "O4'" . DT  B 2  16   ? 35.484  8.669   54.654  1.00 141.68 ? 16   DT  T "O4'" 1 
ATOM   459   C  "C3'" . DT  B 2  16   ? 34.901  8.536   52.347  1.00 142.42 ? 16   DT  T "C3'" 1 
ATOM   460   O  "O3'" . DT  B 2  16   ? 34.192  7.375   51.973  1.00 137.73 ? 16   DT  T "O3'" 1 
ATOM   461   C  "C2'" . DT  B 2  16   ? 34.003  9.513   53.104  1.00 143.27 ? 16   DT  T "C2'" 1 
ATOM   462   C  "C1'" . DT  B 2  16   ? 34.120  8.964   54.509  1.00 140.10 ? 16   DT  T "C1'" 1 
ATOM   463   N  N1    . DT  B 2  16   ? 33.701  9.920   55.574  1.00 143.37 ? 16   DT  T N1    1 
ATOM   464   C  C2    . DT  B 2  16   ? 32.991  9.447   56.653  1.00 154.37 ? 16   DT  T C2    1 
ATOM   465   O  O2    . DT  B 2  16   ? 32.690  8.275   56.792  1.00 152.93 ? 16   DT  T O2    1 
ATOM   466   N  N3    . DT  B 2  16   ? 32.647  10.399  57.574  1.00 157.66 ? 16   DT  T N3    1 
ATOM   467   C  C4    . DT  B 2  16   ? 32.931  11.750  57.524  1.00 153.42 ? 16   DT  T C4    1 
ATOM   468   O  O4    . DT  B 2  16   ? 32.577  12.528  58.404  1.00 151.74 ? 16   DT  T O4    1 
ATOM   469   C  C5    . DT  B 2  16   ? 33.674  12.182  56.363  1.00 150.17 ? 16   DT  T C5    1 
ATOM   470   C  C7    . DT  B 2  16   ? 34.042  13.626  56.198  1.00 152.26 ? 16   DT  T C7    1 
ATOM   471   C  C6    . DT  B 2  16   ? 34.015  11.256  55.453  1.00 143.05 ? 16   DT  T C6    1 
ATOM   472   P  P     . DG  B 2  17   ? 33.839  7.106   50.432  1.00 128.38 ? 17   DG  T P     1 
ATOM   473   O  OP1   . DG  B 2  17   ? 35.088  6.776   49.714  1.00 127.49 ? 17   DG  T OP1   1 
ATOM   474   O  OP2   . DG  B 2  17   ? 32.999  8.230   49.965  1.00 142.72 ? 17   DG  T OP2   1 
ATOM   475   O  "O5'" . DG  B 2  17   ? 32.903  5.818   50.481  1.00 124.93 ? 17   DG  T "O5'" 1 
ATOM   476   C  "C5'" . DG  B 2  17   ? 31.505  5.975   50.384  1.00 124.78 ? 17   DG  T "C5'" 1 
ATOM   477   C  "C4'" . DG  B 2  17   ? 30.847  5.904   51.749  1.00 124.88 ? 17   DG  T "C4'" 1 
ATOM   478   O  "O4'" . DG  B 2  17   ? 31.331  6.967   52.587  1.00 125.93 ? 17   DG  T "O4'" 1 
ATOM   479   C  "C3'" . DG  B 2  17   ? 29.349  6.100   51.723  1.00 124.85 ? 17   DG  T "C3'" 1 
ATOM   480   O  "O3'" . DG  B 2  17   ? 28.718  4.857   51.460  1.00 123.76 ? 17   DG  T "O3'" 1 
ATOM   481   C  "C2'" . DG  B 2  17   ? 29.040  6.613   53.137  1.00 125.55 ? 17   DG  T "C2'" 1 
ATOM   482   C  "C1'" . DG  B 2  17   ? 30.368  7.240   53.588  1.00 126.25 ? 17   DG  T "C1'" 1 
ATOM   483   N  N9    . DG  B 2  17   ? 30.314  8.689   53.793  1.00 127.45 ? 17   DG  T N9    1 
ATOM   484   C  C8    . DG  B 2  17   ? 30.559  9.664   52.857  1.00 130.27 ? 17   DG  T C8    1 
ATOM   485   N  N7    . DG  B 2  17   ? 30.455  10.876  53.327  1.00 138.51 ? 17   DG  T N7    1 
ATOM   486   C  C5    . DG  B 2  17   ? 30.122  10.697  54.663  1.00 134.47 ? 17   DG  T C5    1 
ATOM   487   C  C6    . DG  B 2  17   ? 29.880  11.655  55.677  1.00 131.82 ? 17   DG  T C6    1 
ATOM   488   O  O6    . DG  B 2  17   ? 29.909  12.889  55.588  1.00 131.40 ? 17   DG  T O6    1 
ATOM   489   N  N1    . DG  B 2  17   ? 29.569  11.053  56.892  1.00 133.60 ? 17   DG  T N1    1 
ATOM   490   C  C2    . DG  B 2  17   ? 29.504  9.698   57.103  1.00 142.56 ? 17   DG  T C2    1 
ATOM   491   N  N2    . DG  B 2  17   ? 29.192  9.307   58.347  1.00 147.18 ? 17   DG  T N2    1 
ATOM   492   N  N3    . DG  B 2  17   ? 29.731  8.786   56.162  1.00 144.57 ? 17   DG  T N3    1 
ATOM   493   C  C4    . DG  B 2  17   ? 30.033  9.357   54.969  1.00 133.71 ? 17   DG  T C4    1 
ATOM   494   P  P     . DA  B 2  18   ? 27.800  4.682   50.156  1.00 93.23  ? 18   DA  T P     1 
ATOM   495   O  OP1   . DA  B 2  18   ? 27.841  3.262   49.747  1.00 91.45  ? 18   DA  T OP1   1 
ATOM   496   O  OP2   . DA  B 2  18   ? 28.179  5.735   49.188  1.00 95.43  ? 18   DA  T OP2   1 
ATOM   497   O  "O5'" . DA  B 2  18   ? 26.339  5.002   50.699  1.00 91.92  ? 18   DA  T "O5'" 1 
ATOM   498   C  "C5'" . DA  B 2  18   ? 25.940  4.491   51.959  1.00 90.41  ? 18   DA  T "C5'" 1 
ATOM   499   C  "C4'" . DA  B 2  18   ? 24.576  5.019   52.363  1.00 89.55  ? 18   DA  T "C4'" 1 
ATOM   500   O  "O4'" . DA  B 2  18   ? 24.732  6.191   53.196  1.00 93.01  ? 18   DA  T "O4'" 1 
ATOM   501   C  "C3'" . DA  B 2  18   ? 23.667  5.428   51.214  1.00 89.51  ? 18   DA  T "C3'" 1 
ATOM   502   O  "O3'" . DA  B 2  18   ? 22.334  5.085   51.513  1.00 87.56  ? 18   DA  T "O3'" 1 
ATOM   503   C  "C2'" . DA  B 2  18   ? 23.847  6.941   51.134  1.00 93.19  ? 18   DA  T "C2'" 1 
ATOM   504   C  "C1'" . DA  B 2  18   ? 24.158  7.321   52.575  1.00 97.29  ? 18   DA  T "C1'" 1 
ATOM   505   N  N9    . DA  B 2  18   ? 25.105  8.421   52.674  1.00 105.39 ? 18   DA  T N9    1 
ATOM   506   C  C8    . DA  B 2  18   ? 26.212  8.623   51.898  1.00 107.64 ? 18   DA  T C8    1 
ATOM   507   N  N7    . DA  B 2  18   ? 26.885  9.703   52.209  1.00 107.97 ? 18   DA  T N7    1 
ATOM   508   C  C5    . DA  B 2  18   ? 26.169  10.245  53.263  1.00 108.92 ? 18   DA  T C5    1 
ATOM   509   C  C6    . DA  B 2  18   ? 26.361  11.399  54.044  1.00 107.62 ? 18   DA  T C6    1 
ATOM   510   N  N6    . DA  B 2  18   ? 27.378  12.244  53.865  1.00 108.13 ? 18   DA  T N6    1 
ATOM   511   N  N1    . DA  B 2  18   ? 25.461  11.653  55.018  1.00 104.76 ? 18   DA  T N1    1 
ATOM   512   C  C2    . DA  B 2  18   ? 24.440  10.805  55.192  1.00 100.41 ? 18   DA  T C2    1 
ATOM   513   N  N3    . DA  B 2  18   ? 24.156  9.690   54.521  1.00 94.92  ? 18   DA  T N3    1 
ATOM   514   C  C4    . DA  B 2  18   ? 25.069  9.466   53.561  1.00 104.99 ? 18   DA  T C4    1 
ATOM   515   P  P     . DG  B 2  19   ? 21.276  4.880   50.326  1.00 91.77  ? 19   DG  T P     1 
ATOM   516   O  OP1   . DG  B 2  19   ? 21.884  5.375   49.073  1.00 108.88 ? 19   DG  T OP1   1 
ATOM   517   O  OP2   . DG  B 2  19   ? 19.983  5.430   50.789  1.00 90.52  ? 19   DG  T OP2   1 
ATOM   518   O  "O5'" . DG  B 2  19   ? 21.141  3.295   50.208  1.00 86.44  ? 19   DG  T "O5'" 1 
ATOM   519   C  "C5'" . DG  B 2  19   ? 20.114  2.629   50.900  1.00 82.21  ? 19   DG  T "C5'" 1 
ATOM   520   C  "C4'" . DG  B 2  19   ? 19.688  1.382   50.154  1.00 80.37  ? 19   DG  T "C4'" 1 
ATOM   521   O  "O4'" . DG  B 2  19   ? 18.371  0.996   50.614  1.00 85.49  ? 19   DG  T "O4'" 1 
ATOM   522   C  "C3'" . DG  B 2  19   ? 19.592  1.545   48.639  1.00 81.00  ? 19   DG  T "C3'" 1 
ATOM   523   O  "O3'" . DG  B 2  19   ? 20.768  1.009   48.019  1.00 81.66  ? 19   DG  T "O3'" 1 
ATOM   524   C  "C2'" . DG  B 2  19   ? 18.353  0.737   48.268  1.00 78.86  ? 19   DG  T "C2'" 1 
ATOM   525   C  "C1'" . DG  B 2  19   ? 17.498  0.811   49.525  1.00 79.16  ? 19   DG  T "C1'" 1 
ATOM   526   N  N9    . DG  B 2  19   ? 16.507  1.890   49.530  1.00 81.98  ? 19   DG  T N9    1 
ATOM   527   C  C8    . DG  B 2  19   ? 16.728  3.226   49.770  1.00 80.08  ? 19   DG  T C8    1 
ATOM   528   N  N7    . DG  B 2  19   ? 15.645  3.950   49.723  1.00 80.04  ? 19   DG  T N7    1 
ATOM   529   C  C5    . DG  B 2  19   ? 14.638  3.036   49.443  1.00 82.08  ? 19   DG  T C5    1 
ATOM   530   C  C6    . DG  B 2  19   ? 13.248  3.236   49.275  1.00 97.24  ? 19   DG  T C6    1 
ATOM   531   O  O6    . DG  B 2  19   ? 12.611  4.297   49.343  1.00 101.33 ? 19   DG  T O6    1 
ATOM   532   N  N1    . DG  B 2  19   ? 12.584  2.043   49.002  1.00 95.14  ? 19   DG  T N1    1 
ATOM   533   C  C2    . DG  B 2  19   ? 13.188  0.813   48.899  1.00 82.48  ? 19   DG  T C2    1 
ATOM   534   N  N2    . DG  B 2  19   ? 12.380  -0.223  48.633  1.00 71.97  ? 19   DG  T N2    1 
ATOM   535   N  N3    . DG  B 2  19   ? 14.489  0.611   49.058  1.00 84.42  ? 19   DG  T N3    1 
ATOM   536   C  C4    . DG  B 2  19   ? 15.151  1.764   49.326  1.00 82.07  ? 19   DG  T C4    1 
ATOM   537   P  P     . DC  B 2  20   ? 21.201  1.463   46.536  1.00 97.91  ? 20   DC  T P     1 
ATOM   538   O  OP1   . DC  B 2  20   ? 22.549  0.911   46.283  1.00 104.56 ? 20   DC  T OP1   1 
ATOM   539   O  OP2   . DC  B 2  20   ? 20.967  2.915   46.391  1.00 109.77 ? 20   DC  T OP2   1 
ATOM   540   O  "O5'" . DC  B 2  20   ? 20.188  0.681   45.582  1.00 85.72  ? 20   DC  T "O5'" 1 
ATOM   541   C  "C5'" . DC  B 2  20   ? 20.252  -0.730  45.498  1.00 79.76  ? 20   DC  T "C5'" 1 
ATOM   542   C  "C4'" . DC  B 2  20   ? 19.049  -1.284  44.761  1.00 78.15  ? 20   DC  T "C4'" 1 
ATOM   543   O  "O4'" . DC  B 2  20   ? 17.850  -1.058  45.534  1.00 77.01  ? 20   DC  T "O4'" 1 
ATOM   544   C  "C3'" . DC  B 2  20   ? 18.744  -0.614  43.444  1.00 79.28  ? 20   DC  T "C3'" 1 
ATOM   545   O  "O3'" . DC  B 2  20   ? 19.600  -1.107  42.419  1.00 80.55  ? 20   DC  T "O3'" 1 
ATOM   546   C  "C2'" . DC  B 2  20   ? 17.298  -1.041  43.229  1.00 77.44  ? 20   DC  T "C2'" 1 
ATOM   547   C  "C1'" . DC  B 2  20   ? 16.739  -1.046  44.653  1.00 76.33  ? 20   DC  T "C1'" 1 
ATOM   548   N  N1    . DC  B 2  20   ? 15.874  0.134   44.960  1.00 76.97  ? 20   DC  T N1    1 
ATOM   549   C  C2    . DC  B 2  20   ? 14.492  0.035   44.787  1.00 86.14  ? 20   DC  T C2    1 
ATOM   550   O  O2    . DC  B 2  20   ? 14.009  -1.031  44.387  1.00 78.55  ? 20   DC  T O2    1 
ATOM   551   N  N3    . DC  B 2  20   ? 13.715  1.111   45.066  1.00 91.99  ? 20   DC  T N3    1 
ATOM   552   C  C4    . DC  B 2  20   ? 14.273  2.243   45.496  1.00 85.79  ? 20   DC  T C4    1 
ATOM   553   N  N4    . DC  B 2  20   ? 13.469  3.277   45.759  1.00 78.91  ? 20   DC  T N4    1 
ATOM   554   C  C5    . DC  B 2  20   ? 15.681  2.365   45.674  1.00 82.89  ? 20   DC  T C5    1 
ATOM   555   C  C6    . DC  B 2  20   ? 16.435  1.298   45.393  1.00 81.94  ? 20   DC  T C6    1 
ATOM   556   P  P     . DC  B 2  21   ? 20.032  -0.148  41.203  1.00 85.91  ? 21   DC  T P     1 
ATOM   557   O  OP1   . DC  B 2  21   ? 20.968  -0.898  40.340  1.00 82.39  ? 21   DC  T OP1   1 
ATOM   558   O  OP2   . DC  B 2  21   ? 20.446  1.156   41.764  1.00 108.86 ? 21   DC  T OP2   1 
ATOM   559   O  "O5'" . DC  B 2  21   ? 18.681  0.051   40.377  1.00 84.63  ? 21   DC  T "O5'" 1 
ATOM   560   C  "C5'" . DC  B 2  21   ? 18.402  -0.797  39.281  1.00 87.34  ? 21   DC  T "C5'" 1 
ATOM   561   C  "C4'" . DC  B 2  21   ? 16.907  -0.938  39.065  1.00 84.51  ? 21   DC  T "C4'" 1 
ATOM   562   O  "O4'" . DC  B 2  21   ? 16.212  -0.778  40.321  1.00 78.08  ? 21   DC  T "O4'" 1 
ATOM   563   C  "C3'" . DC  B 2  21   ? 16.277  0.110   38.183  1.00 87.11  ? 21   DC  T "C3'" 1 
ATOM   564   O  "O3'" . DC  B 2  21   ? 16.501  -0.184  36.821  1.00 80.88  ? 21   DC  T "O3'" 1 
ATOM   565   C  "C2'" . DC  B 2  21   ? 14.812  -0.047  38.567  1.00 78.64  ? 21   DC  T "C2'" 1 
ATOM   566   C  "C1'" . DC  B 2  21   ? 14.912  -0.273  40.075  1.00 77.69  ? 21   DC  T "C1'" 1 
ATOM   567   N  N1    . DC  B 2  21   ? 14.701  0.977   40.876  1.00 85.97  ? 21   DC  T N1    1 
ATOM   568   C  C2    . DC  B 2  21   ? 13.402  1.352   41.226  1.00 93.15  ? 21   DC  T C2    1 
ATOM   569   O  O2    . DC  B 2  21   ? 12.455  0.635   40.879  1.00 76.35  ? 21   DC  T O2    1 
ATOM   570   N  N3    . DC  B 2  21   ? 13.216  2.489   41.940  1.00 91.87  ? 21   DC  T N3    1 
ATOM   571   C  C4    . DC  B 2  21   ? 14.262  3.234   42.294  1.00 80.81  ? 21   DC  T C4    1 
ATOM   572   N  N4    . DC  B 2  21   ? 14.028  4.346   42.995  1.00 81.79  ? 21   DC  T N4    1 
ATOM   573   C  C5    . DC  B 2  21   ? 15.595  2.873   41.944  1.00 81.69  ? 21   DC  T C5    1 
ATOM   574   C  C6    . DC  B 2  21   ? 15.768  1.749   41.242  1.00 89.57  ? 21   DC  T C6    1 
ATOM   575   P  P     . DT  B 2  22   ? 16.605  1.015   35.759  1.00 83.37  ? 22   DT  T P     1 
ATOM   576   O  OP1   . DT  B 2  22   ? 16.931  0.407   34.454  1.00 84.33  ? 22   DT  T OP1   1 
ATOM   577   O  OP2   . DT  B 2  22   ? 17.476  2.073   36.319  1.00 109.74 ? 22   DT  T OP2   1 
ATOM   578   O  "O5'" . DT  B 2  22   ? 15.115  1.581   35.687  1.00 82.66  ? 22   DT  T "O5'" 1 
ATOM   579   C  "C5'" . DT  B 2  22   ? 14.116  0.793   35.082  1.00 81.02  ? 22   DT  T "C5'" 1 
ATOM   580   C  "C4'" . DT  B 2  22   ? 12.726  1.285   35.433  1.00 80.28  ? 22   DT  T "C4'" 1 
ATOM   581   O  "O4'" . DT  B 2  22   ? 12.584  1.439   36.864  1.00 79.58  ? 22   DT  T "O4'" 1 
ATOM   582   C  "C3'" . DT  B 2  22   ? 12.373  2.655   34.925  1.00 82.16  ? 22   DT  T "C3'" 1 
ATOM   583   O  "O3'" . DT  B 2  22   ? 12.128  2.643   33.534  1.00 94.01  ? 22   DT  T "O3'" 1 
ATOM   584   C  "C2'" . DT  B 2  22   ? 11.114  2.908   35.739  1.00 80.96  ? 22   DT  T "C2'" 1 
ATOM   585   C  "C1'" . DT  B 2  22   ? 11.554  2.391   37.109  1.00 79.86  ? 22   DT  T "C1'" 1 
ATOM   586   N  N1    . DT  B 2  22   ? 12.069  3.479   37.994  1.00 81.33  ? 22   DT  T N1    1 
ATOM   587   C  C2    . DT  B 2  22   ? 11.165  4.251   38.680  1.00 84.04  ? 22   DT  T C2    1 
ATOM   588   O  O2    . DT  B 2  22   ? 9.961   4.078   38.621  1.00 80.00  ? 22   DT  T O2    1 
ATOM   589   N  N3    . DT  B 2  22   ? 11.720  5.234   39.453  1.00 92.47  ? 22   DT  T N3    1 
ATOM   590   C  C4    . DT  B 2  22   ? 13.063  5.524   39.597  1.00 87.44  ? 22   DT  T C4    1 
ATOM   591   O  O4    . DT  B 2  22   ? 13.464  6.431   40.317  1.00 88.67  ? 22   DT  T O4    1 
ATOM   592   C  C5    . DT  B 2  22   ? 13.961  4.685   38.843  1.00 84.23  ? 22   DT  T C5    1 
ATOM   593   C  C7    . DT  B 2  22   ? 15.442  4.906   38.920  1.00 85.85  ? 22   DT  T C7    1 
ATOM   594   C  C6    . DT  B 2  22   ? 13.429  3.714   38.085  1.00 82.81  ? 22   DT  T C6    1 
ATOM   595   P  P     . DC  B 2  23   ? 12.476  3.951   32.668  1.00 97.54  ? 23   DC  T P     1 
ATOM   596   O  OP1   . DC  B 2  23   ? 12.507  3.566   31.241  1.00 113.23 ? 23   DC  T OP1   1 
ATOM   597   O  OP2   . DC  B 2  23   ? 13.664  4.588   33.280  1.00 99.39  ? 23   DC  T OP2   1 
ATOM   598   O  "O5'" . DC  B 2  23   ? 11.225  4.909   32.924  1.00 94.16  ? 23   DC  T "O5'" 1 
ATOM   599   C  "C5'" . DC  B 2  23   ? 9.913   4.407   32.736  1.00 94.37  ? 23   DC  T "C5'" 1 
ATOM   600   C  "C4'" . DC  B 2  23   ? 8.888   5.275   33.437  1.00 96.84  ? 23   DC  T "C4'" 1 
ATOM   601   O  "O4'" . DC  B 2  23   ? 9.196   5.391   34.849  1.00 101.44 ? 23   DC  T "O4'" 1 
ATOM   602   C  "C3'" . DC  B 2  23   ? 8.852   6.702   32.965  1.00 104.39 ? 23   DC  T "C3'" 1 
ATOM   603   O  "O3'" . DC  B 2  23   ? 8.140   6.786   31.755  1.00 111.05 ? 23   DC  T "O3'" 1 
ATOM   604   C  "C2'" . DC  B 2  23   ? 8.112   7.366   34.112  1.00 108.42 ? 23   DC  T "C2'" 1 
ATOM   605   C  "C1'" . DC  B 2  23   ? 8.736   6.653   35.319  1.00 104.73 ? 23   DC  T "C1'" 1 
ATOM   606   N  N1    . DC  B 2  23   ? 9.896   7.392   35.928  1.00 100.87 ? 23   DC  T N1    1 
ATOM   607   C  C2    . DC  B 2  23   ? 9.675   8.579   36.648  1.00 97.00  ? 23   DC  T C2    1 
ATOM   608   O  O2    . DC  B 2  23   ? 8.522   9.006   36.786  1.00 98.05  ? 23   DC  T O2    1 
ATOM   609   N  N3    . DC  B 2  23   ? 10.738  9.222   37.189  1.00 102.27 ? 23   DC  T N3    1 
ATOM   610   C  C4    . DC  B 2  23   ? 11.968  8.734   37.033  1.00 100.70 ? 23   DC  T C4    1 
ATOM   611   N  N4    . DC  B 2  23   ? 12.982  9.410   37.583  1.00 111.06 ? 23   DC  T N4    1 
ATOM   612   C  C5    . DC  B 2  23   ? 12.214  7.534   36.304  1.00 91.93  ? 23   DC  T C5    1 
ATOM   613   C  C6    . DC  B 2  23   ? 11.161  6.903   35.775  1.00 99.81  ? 23   DC  T C6    1 
ATOM   614   P  P     . DT  B 2  24   ? 8.808   7.534   30.506  1.00 111.68 ? 24   DT  T P     1 
ATOM   615   O  OP1   . DT  B 2  24   ? 7.788   7.661   29.443  1.00 106.73 ? 24   DT  T OP1   1 
ATOM   616   O  OP2   . DT  B 2  24   ? 10.106  6.885   30.217  1.00 113.67 ? 24   DT  T OP2   1 
ATOM   617   O  "O5'" . DT  B 2  24   ? 9.132   8.982   31.078  1.00 106.82 ? 24   DT  T "O5'" 1 
ATOM   618   C  "C5'" . DT  B 2  24   ? 8.602   10.109  30.438  1.00 109.46 ? 24   DT  T "C5'" 1 
ATOM   619   C  "C4'" . DT  B 2  24   ? 7.516   10.742  31.279  1.00 107.84 ? 24   DT  T "C4'" 1 
ATOM   620   O  "O4'" . DT  B 2  24   ? 7.626   10.272  32.650  1.00 114.93 ? 24   DT  T "O4'" 1 
ATOM   621   C  "C3'" . DT  B 2  24   ? 7.617   12.247  31.364  1.00 109.06 ? 24   DT  T "C3'" 1 
ATOM   622   O  "O3'" . DT  B 2  24   ? 6.874   12.827  30.319  1.00 107.78 ? 24   DT  T "O3'" 1 
ATOM   623   C  "C2'" . DT  B 2  24   ? 7.002   12.541  32.724  1.00 112.72 ? 24   DT  T "C2'" 1 
ATOM   624   C  "C1'" . DT  B 2  24   ? 7.517   11.363  33.548  1.00 114.61 ? 24   DT  T "C1'" 1 
ATOM   625   N  N1    . DT  B 2  24   ? 8.868   11.588  34.194  1.00 120.52 ? 24   DT  T N1    1 
ATOM   626   C  C2    . DT  B 2  24   ? 9.009   12.525  35.199  1.00 122.50 ? 24   DT  T C2    1 
ATOM   627   O  O2    . DT  B 2  24   ? 8.094   13.214  35.618  1.00 117.72 ? 24   DT  T O2    1 
ATOM   628   N  N3    . DT  B 2  24   ? 10.277  12.624  35.711  1.00 128.07 ? 24   DT  T N3    1 
ATOM   629   C  C4    . DT  B 2  24   ? 11.393  11.897  35.336  1.00 123.18 ? 24   DT  T C4    1 
ATOM   630   O  O4    . DT  B 2  24   ? 12.492  12.066  35.852  1.00 121.03 ? 24   DT  T O4    1 
ATOM   631   C  C5    . DT  B 2  24   ? 11.177  10.938  34.281  1.00 115.70 ? 24   DT  T C5    1 
ATOM   632   C  C7    . DT  B 2  24   ? 12.312  10.096  33.782  1.00 112.10 ? 24   DT  T C7    1 
ATOM   633   C  C6    . DT  B 2  24   ? 9.944   10.826  33.777  1.00 118.36 ? 24   DT  T C6    1 
ATOM   634   P  P     . DC  B 2  25   ? 7.601   13.758  29.233  1.00 113.61 ? 25   DC  T P     1 
ATOM   635   O  OP1   . DC  B 2  25   ? 6.711   13.880  28.059  1.00 118.39 ? 25   DC  T OP1   1 
ATOM   636   O  OP2   . DC  B 2  25   ? 8.982   13.252  29.065  1.00 110.59 ? 25   DC  T OP2   1 
ATOM   637   O  "O5'" . DC  B 2  25   ? 7.676   15.175  29.956  1.00 103.69 ? 25   DC  T "O5'" 1 
ATOM   638   C  "C5'" . DC  B 2  25   ? 6.567   15.648  30.712  1.00 98.92  ? 25   DC  T "C5'" 1 
ATOM   639   C  "C4'" . DC  B 2  25   ? 6.998   16.770  31.628  1.00 100.34 ? 25   DC  T "C4'" 1 
ATOM   640   O  "O4'" . DC  B 2  25   ? 7.918   16.256  32.630  1.00 102.47 ? 25   DC  T "O4'" 1 
ATOM   641   C  "C3'" . DC  B 2  25   ? 7.733   17.901  30.916  1.00 114.13 ? 25   DC  T "C3'" 1 
ATOM   642   O  "O3'" . DC  B 2  25   ? 7.257   19.151  31.366  1.00 134.15 ? 25   DC  T "O3'" 1 
ATOM   643   C  "C2'" . DC  B 2  25   ? 9.192   17.679  31.301  1.00 111.86 ? 25   DC  T "C2'" 1 
ATOM   644   C  "C1'" . DC  B 2  25   ? 9.054   17.086  32.688  1.00 109.05 ? 25   DC  T "C1'" 1 
ATOM   645   N  N1    . DC  B 2  25   ? 10.226  16.269  33.076  1.00 103.53 ? 25   DC  T N1    1 
ATOM   646   C  C2    . DC  B 2  25   ? 11.243  16.842  33.846  1.00 115.00 ? 25   DC  T C2    1 
ATOM   647   O  O2    . DC  B 2  25   ? 11.135  18.020  34.208  1.00 121.92 ? 25   DC  T O2    1 
ATOM   648   N  N3    . DC  B 2  25   ? 12.316  16.085  34.181  1.00 112.48 ? 25   DC  T N3    1 
ATOM   649   C  C4    . DC  B 2  25   ? 12.392  14.820  33.770  1.00 100.61 ? 25   DC  T C4    1 
ATOM   650   N  N4    . DC  B 2  25   ? 13.469  14.112  34.125  1.00 100.29 ? 25   DC  T N4    1 
ATOM   651   C  C5    . DC  B 2  25   ? 11.369  14.225  32.974  1.00 99.32  ? 25   DC  T C5    1 
ATOM   652   C  C6    . DC  B 2  25   ? 10.316  14.978  32.655  1.00 99.74  ? 25   DC  T C6    1 
ATOM   653   P  P     . DG  B 2  26   ? 7.677   20.486  30.581  1.00 151.59 ? 26   DG  T P     1 
ATOM   654   O  OP1   . DG  B 2  26   ? 6.675   21.534  30.872  1.00 152.61 ? 26   DG  T OP1   1 
ATOM   655   O  OP2   . DG  B 2  26   ? 7.964   20.098  29.182  1.00 147.90 ? 26   DG  T OP2   1 
ATOM   656   O  "O5'" . DG  B 2  26   ? 9.052   20.911  31.270  1.00 153.15 ? 26   DG  T "O5'" 1 
ATOM   657   C  "C5'" . DG  B 2  26   ? 9.140   21.018  32.684  1.00 147.31 ? 26   DG  T "C5'" 1 
ATOM   658   C  "C4'" . DG  B 2  26   ? 10.387  21.780  33.064  1.00 146.47 ? 26   DG  T "C4'" 1 
ATOM   659   O  "O4'" . DG  B 2  26   ? 11.447  20.853  33.427  1.00 149.97 ? 26   DG  T "O4'" 1 
ATOM   660   C  "C3'" . DG  B 2  26   ? 10.952  22.652  31.940  1.00 143.39 ? 26   DG  T "C3'" 1 
ATOM   661   O  "O3'" . DG  B 2  26   ? 11.248  23.945  32.447  1.00 143.73 ? 26   DG  T "O3'" 1 
ATOM   662   C  "C2'" . DG  B 2  26   ? 12.215  21.897  31.513  1.00 145.27 ? 26   DG  T "C2'" 1 
ATOM   663   C  "C1'" . DG  B 2  26   ? 12.642  21.291  32.834  1.00 150.69 ? 26   DG  T "C1'" 1 
ATOM   664   N  N9    . DG  B 2  26   ? 13.557  20.158  32.706  1.00 151.76 ? 26   DG  T N9    1 
ATOM   665   C  C8    . DG  B 2  26   ? 13.296  18.937  32.134  1.00 153.61 ? 26   DG  T C8    1 
ATOM   666   N  N7    . DG  B 2  26   ? 14.312  18.119  32.170  1.00 152.05 ? 26   DG  T N7    1 
ATOM   667   C  C5    . DG  B 2  26   ? 15.311  18.845  32.805  1.00 156.51 ? 26   DG  T C5    1 
ATOM   668   C  C6    . DG  B 2  26   ? 16.638  18.478  33.130  1.00 176.61 ? 26   DG  T C6    1 
ATOM   669   O  O6    . DG  B 2  26   ? 17.214  17.405  32.908  1.00 186.31 ? 26   DG  T O6    1 
ATOM   670   N  N1    . DG  B 2  26   ? 17.316  19.512  33.772  1.00 182.07 ? 26   DG  T N1    1 
ATOM   671   C  C2    . DG  B 2  26   ? 16.776  20.740  34.068  1.00 183.06 ? 26   DG  T C2    1 
ATOM   672   N  N2    . DG  B 2  26   ? 17.585  21.610  34.690  1.00 187.39 ? 26   DG  T N2    1 
ATOM   673   N  N3    . DG  B 2  26   ? 15.535  21.096  33.769  1.00 174.02 ? 26   DG  T N3    1 
ATOM   674   C  C4    . DG  B 2  26   ? 14.862  20.101  33.142  1.00 156.75 ? 26   DG  T C4    1 
ATOM   675   P  P     . DA  B 2  27   ? 11.256  25.225  31.476  1.00 133.12 ? 27   DA  T P     1 
ATOM   676   O  OP1   . DA  B 2  27   ? 10.151  26.119  31.890  1.00 140.86 ? 27   DA  T OP1   1 
ATOM   677   O  OP2   . DA  B 2  27   ? 11.332  24.737  30.082  1.00 117.98 ? 27   DA  T OP2   1 
ATOM   678   O  "O5'" . DA  B 2  27   ? 12.656  25.913  31.809  1.00 139.31 ? 27   DA  T "O5'" 1 
ATOM   679   C  "C5'" . DA  B 2  27   ? 13.796  25.092  31.891  1.00 133.40 ? 27   DA  T "C5'" 1 
ATOM   680   C  "C4'" . DA  B 2  27   ? 14.985  25.817  32.474  1.00 121.42 ? 27   DA  T "C4'" 1 
ATOM   681   O  "O4'" . DA  B 2  27   ? 15.965  24.842  32.904  1.00 120.46 ? 27   DA  T "O4'" 1 
ATOM   682   C  "C3'" . DA  B 2  27   ? 15.720  26.714  31.502  1.00 128.10 ? 27   DA  T "C3'" 1 
ATOM   683   O  "O3'" . DA  B 2  27   ? 16.357  27.774  32.215  1.00 131.74 ? 27   DA  T "O3'" 1 
ATOM   684   C  "C2'" . DA  B 2  27   ? 16.724  25.758  30.843  1.00 134.11 ? 27   DA  T "C2'" 1 
ATOM   685   C  "C1'" . DA  B 2  27   ? 16.973  24.696  31.918  1.00 127.93 ? 27   DA  T "C1'" 1 
ATOM   686   N  N9    . DA  B 2  27   ? 16.929  23.324  31.403  1.00 145.18 ? 27   DA  T N9    1 
ATOM   687   C  C8    . DA  B 2  27   ? 15.883  22.715  30.767  1.00 152.85 ? 27   DA  T C8    1 
ATOM   688   N  N7    . DA  B 2  27   ? 16.118  21.478  30.415  1.00 155.79 ? 27   DA  T N7    1 
ATOM   689   C  C5    . DA  B 2  27   ? 17.412  21.254  30.839  1.00 155.27 ? 27   DA  T C5    1 
ATOM   690   C  C6    . DA  B 2  27   ? 18.248  20.128  30.757  1.00 157.69 ? 27   DA  T C6    1 
ATOM   691   N  N6    . DA  B 2  27   ? 17.868  18.976  30.198  1.00 153.17 ? 27   DA  T N6    1 
ATOM   692   N  N1    . DA  B 2  27   ? 19.488  20.228  31.283  1.00 162.69 ? 27   DA  T N1    1 
ATOM   693   C  C2    . DA  B 2  27   ? 19.858  21.385  31.848  1.00 166.90 ? 27   DA  T C2    1 
ATOM   694   N  N3    . DA  B 2  27   ? 19.158  22.514  31.983  1.00 164.30 ? 27   DA  T N3    1 
ATOM   695   C  C4    . DA  B 2  27   ? 17.933  22.380  31.451  1.00 155.02 ? 27   DA  T C4    1 
ATOM   696   P  P     . DT  B 2  28   ? 17.329  28.813  31.467  1.00 143.85 ? 28   DT  T P     1 
ATOM   697   O  OP1   . DT  B 2  28   ? 17.260  30.083  32.221  1.00 138.10 ? 28   DT  T OP1   1 
ATOM   698   O  OP2   . DT  B 2  28   ? 17.025  28.828  30.018  1.00 148.64 ? 28   DT  T OP2   1 
ATOM   699   O  "O5'" . DT  B 2  28   ? 18.776  28.171  31.681  1.00 155.79 ? 28   DT  T "O5'" 1 
ATOM   700   C  "C5'" . DT  B 2  28   ? 19.843  28.498  30.815  1.00 164.64 ? 28   DT  T "C5'" 1 
ATOM   701   C  "C4'" . DT  B 2  28   ? 21.036  27.601  31.089  1.00 167.07 ? 28   DT  T "C4'" 1 
ATOM   702   O  "O4'" . DT  B 2  28   ? 20.631  26.226  30.989  1.00 170.39 ? 28   DT  T "O4'" 1 
ATOM   703   C  "C3'" . DT  B 2  28   ? 22.184  27.742  30.102  1.00 160.16 ? 28   DT  T "C3'" 1 
ATOM   704   O  "O3'" . DT  B 2  28   ? 23.130  28.684  30.593  1.00 142.84 ? 28   DT  T "O3'" 1 
ATOM   705   C  "C2'" . DT  B 2  28   ? 22.787  26.327  30.021  1.00 167.18 ? 28   DT  T "C2'" 1 
ATOM   706   C  "C1'" . DT  B 2  28   ? 21.772  25.439  30.755  1.00 168.37 ? 28   DT  T "C1'" 1 
ATOM   707   N  N1    . DT  B 2  28   ? 21.364  24.225  29.982  1.00 166.42 ? 28   DT  T N1    1 
ATOM   708   C  C2    . DT  B 2  28   ? 22.217  23.146  29.919  1.00 163.89 ? 28   DT  T C2    1 
ATOM   709   O  O2    . DT  B 2  28   ? 23.307  23.121  30.464  1.00 163.68 ? 28   DT  T O2    1 
ATOM   710   N  N3    . DT  B 2  28   ? 21.748  22.087  29.189  1.00 160.07 ? 28   DT  T N3    1 
ATOM   711   C  C4    . DT  B 2  28   ? 20.536  21.998  28.530  1.00 157.65 ? 28   DT  T C4    1 
ATOM   712   O  O4    . DT  B 2  28   ? 20.203  21.002  27.898  1.00 152.15 ? 28   DT  T O4    1 
ATOM   713   C  C5    . DT  B 2  28   ? 19.688  23.161  28.637  1.00 158.21 ? 28   DT  T C5    1 
ATOM   714   C  C7    . DT  B 2  28   ? 18.348  23.181  27.962  1.00 154.65 ? 28   DT  T C7    1 
ATOM   715   C  C6    . DT  B 2  28   ? 20.138  24.206  29.349  1.00 162.35 ? 28   DT  T C6    1 
ATOM   716   P  P     . DC  C 3  2    ? 24.890  14.957  64.225  1.00 229.55 ? 2    DC  N P     1 
ATOM   717   O  OP1   . DC  C 3  2    ? 23.629  14.189  64.125  1.00 227.55 ? 2    DC  N OP1   1 
ATOM   718   O  OP2   . DC  C 3  2    ? 25.517  15.506  63.002  1.00 228.07 ? 2    DC  N OP2   1 
ATOM   719   O  "O5'" . DC  C 3  2    ? 25.975  14.060  64.988  1.00 227.65 ? 2    DC  N "O5'" 1 
ATOM   720   C  "C5'" . DC  C 3  2    ? 25.557  12.929  65.744  1.00 227.98 ? 2    DC  N "C5'" 1 
ATOM   721   C  "C4'" . DC  C 3  2    ? 25.748  11.642  64.959  1.00 226.33 ? 2    DC  N "C4'" 1 
ATOM   722   O  "O4'" . DC  C 3  2    ? 25.710  11.924  63.536  1.00 225.77 ? 2    DC  N "O4'" 1 
ATOM   723   C  "C3'" . DC  C 3  2    ? 27.080  10.944  65.178  1.00 224.57 ? 2    DC  N "C3'" 1 
ATOM   724   O  "O3'" . DC  C 3  2    ? 27.078  10.105  66.393  1.00 222.41 ? 2    DC  N "O3'" 1 
ATOM   725   C  "C2'" . DC  C 3  2    ? 27.265  10.160  63.883  1.00 224.35 ? 2    DC  N "C2'" 1 
ATOM   726   C  "C1'" . DC  C 3  2    ? 26.652  11.108  62.851  1.00 222.96 ? 2    DC  N "C1'" 1 
ATOM   727   N  N1    . DC  C 3  2    ? 27.649  12.001  62.156  1.00 215.44 ? 2    DC  N N1    1 
ATOM   728   C  C2    . DC  C 3  2    ? 28.448  11.490  61.124  1.00 210.27 ? 2    DC  N C2    1 
ATOM   729   O  O2    . DC  C 3  2    ? 28.335  10.301  60.802  1.00 210.04 ? 2    DC  N O2    1 
ATOM   730   N  N3    . DC  C 3  2    ? 29.330  12.317  60.507  1.00 203.76 ? 2    DC  N N3    1 
ATOM   731   C  C4    . DC  C 3  2    ? 29.420  13.595  60.878  1.00 199.31 ? 2    DC  N C4    1 
ATOM   732   N  N4    . DC  C 3  2    ? 30.305  14.371  60.242  1.00 195.18 ? 2    DC  N N4    1 
ATOM   733   C  C5    . DC  C 3  2    ? 28.617  14.133  61.922  1.00 200.42 ? 2    DC  N C5    1 
ATOM   734   C  C6    . DC  C 3  2    ? 27.753  13.311  62.521  1.00 207.36 ? 2    DC  N C6    1 
ATOM   735   P  P     . DA  C 3  3    ? 26.194  8.760   66.579  1.00 215.42 ? 3    DA  N P     1 
ATOM   736   O  OP1   . DA  C 3  3    ? 24.794  8.895   66.125  1.00 216.65 ? 3    DA  N OP1   1 
ATOM   737   O  OP2   . DA  C 3  3    ? 26.430  8.368   67.983  1.00 212.77 ? 3    DA  N OP2   1 
ATOM   738   O  "O5'" . DA  C 3  3    ? 26.925  7.649   65.695  1.00 201.19 ? 3    DA  N "O5'" 1 
ATOM   739   C  "C5'" . DA  C 3  3    ? 27.651  6.617   66.323  1.00 188.76 ? 3    DA  N "C5'" 1 
ATOM   740   C  "C4'" . DA  C 3  3    ? 29.079  6.585   65.823  1.00 181.59 ? 3    DA  N "C4'" 1 
ATOM   741   O  "O4'" . DA  C 3  3    ? 29.336  7.733   64.960  1.00 178.56 ? 3    DA  N "O4'" 1 
ATOM   742   C  "C3'" . DA  C 3  3    ? 30.152  6.651   66.928  1.00 181.49 ? 3    DA  N "C3'" 1 
ATOM   743   O  "O3'" . DA  C 3  3    ? 31.218  5.781   66.610  1.00 182.41 ? 3    DA  N "O3'" 1 
ATOM   744   C  "C2'" . DA  C 3  3    ? 30.622  8.091   66.819  1.00 179.18 ? 3    DA  N "C2'" 1 
ATOM   745   C  "C1'" . DA  C 3  3    ? 30.600  8.216   65.313  1.00 178.59 ? 3    DA  N "C1'" 1 
ATOM   746   N  N9    . DA  C 3  3    ? 30.829  9.567   64.811  1.00 184.44 ? 3    DA  N N9    1 
ATOM   747   C  C8    . DA  C 3  3    ? 30.554  10.744  65.447  1.00 188.26 ? 3    DA  N C8    1 
ATOM   748   N  N7    . DA  C 3  3    ? 30.907  11.808  64.764  1.00 188.87 ? 3    DA  N N7    1 
ATOM   749   C  C5    . DA  C 3  3    ? 31.474  11.291  63.612  1.00 187.49 ? 3    DA  N C5    1 
ATOM   750   C  C6    . DA  C 3  3    ? 32.045  11.901  62.478  1.00 184.77 ? 3    DA  N C6    1 
ATOM   751   N  N6    . DA  C 3  3    ? 32.147  13.224  62.331  1.00 179.53 ? 3    DA  N N6    1 
ATOM   752   N  N1    . DA  C 3  3    ? 32.521  11.095  61.503  1.00 189.21 ? 3    DA  N N1    1 
ATOM   753   C  C2    . DA  C 3  3    ? 32.423  9.769   61.657  1.00 191.24 ? 3    DA  N C2    1 
ATOM   754   N  N3    . DA  C 3  3    ? 31.908  9.082   62.677  1.00 191.14 ? 3    DA  N N3    1 
ATOM   755   C  C4    . DA  C 3  3    ? 31.442  9.912   63.628  1.00 188.37 ? 3    DA  N C4    1 
ATOM   756   P  P     . DG  C 3  4    ? 31.222  4.248   67.087  1.00 182.69 ? 4    DG  N P     1 
ATOM   757   O  OP1   . DG  C 3  4    ? 29.845  3.844   67.449  1.00 183.37 ? 4    DG  N OP1   1 
ATOM   758   O  OP2   . DG  C 3  4    ? 32.322  4.093   68.063  1.00 181.79 ? 4    DG  N OP2   1 
ATOM   759   O  "O5'" . DG  C 3  4    ? 31.675  3.477   65.768  1.00 183.75 ? 4    DG  N "O5'" 1 
ATOM   760   C  "C5'" . DG  C 3  4    ? 31.849  4.211   64.562  1.00 180.33 ? 4    DG  N "C5'" 1 
ATOM   761   C  "C4'" . DG  C 3  4    ? 33.300  4.195   64.122  1.00 180.47 ? 4    DG  N "C4'" 1 
ATOM   762   O  "O4'" . DG  C 3  4    ? 33.687  5.517   63.660  1.00 179.73 ? 4    DG  N "O4'" 1 
ATOM   763   C  "C3'" . DG  C 3  4    ? 34.308  3.856   65.212  1.00 181.22 ? 4    DG  N "C3'" 1 
ATOM   764   O  "O3'" . DG  C 3  4    ? 35.451  3.319   64.601  1.00 181.63 ? 4    DG  N "O3'" 1 
ATOM   765   C  "C2'" . DG  C 3  4    ? 34.606  5.235   65.777  1.00 180.68 ? 4    DG  N "C2'" 1 
ATOM   766   C  "C1'" . DG  C 3  4    ? 34.740  5.996   64.475  1.00 179.94 ? 4    DG  N "C1'" 1 
ATOM   767   N  N9    . DG  C 3  4    ? 34.611  7.440   64.592  1.00 180.47 ? 4    DG  N N9    1 
ATOM   768   C  C8    . DG  C 3  4    ? 33.982  8.148   65.582  1.00 180.93 ? 4    DG  N C8    1 
ATOM   769   N  N7    . DG  C 3  4    ? 34.016  9.440   65.396  1.00 178.54 ? 4    DG  N N7    1 
ATOM   770   C  C5    . DG  C 3  4    ? 34.720  9.589   64.208  1.00 180.70 ? 4    DG  N C5    1 
ATOM   771   C  C6    . DG  C 3  4    ? 35.081  10.758  63.499  1.00 182.66 ? 4    DG  N C6    1 
ATOM   772   O  O6    . DG  C 3  4    ? 34.834  11.936  63.786  1.00 183.17 ? 4    DG  N O6    1 
ATOM   773   N  N1    . DG  C 3  4    ? 35.790  10.455  62.337  1.00 181.91 ? 4    DG  N N1    1 
ATOM   774   C  C2    . DG  C 3  4    ? 36.112  9.183   61.924  1.00 181.56 ? 4    DG  N C2    1 
ATOM   775   N  N2    . DG  C 3  4    ? 36.805  9.079   60.785  1.00 181.56 ? 4    DG  N N2    1 
ATOM   776   N  N3    . DG  C 3  4    ? 35.779  8.088   62.579  1.00 180.93 ? 4    DG  N N3    1 
ATOM   777   C  C4    . DG  C 3  4    ? 35.087  8.365   63.705  1.00 181.17 ? 4    DG  N C4    1 
ATOM   778   P  P     . DC  C 3  5    ? 36.378  2.264   65.371  1.00 190.28 ? 5    DC  N P     1 
ATOM   779   O  OP1   . DC  C 3  5    ? 35.675  0.962   65.359  1.00 196.19 ? 5    DC  N OP1   1 
ATOM   780   O  OP2   . DC  C 3  5    ? 36.808  2.881   66.646  1.00 196.95 ? 5    DC  N OP2   1 
ATOM   781   O  "O5'" . DC  C 3  5    ? 37.658  2.166   64.427  1.00 182.99 ? 5    DC  N "O5'" 1 
ATOM   782   C  "C5'" . DC  C 3  5    ? 37.568  2.622   63.087  1.00 182.35 ? 5    DC  N "C5'" 1 
ATOM   783   C  "C4'" . DC  C 3  5    ? 38.584  3.714   62.823  1.00 181.99 ? 5    DC  N "C4'" 1 
ATOM   784   O  "O4'" . DC  C 3  5    ? 38.063  5.005   63.246  1.00 184.57 ? 5    DC  N "O4'" 1 
ATOM   785   C  "C3'" . DC  C 3  5    ? 39.923  3.542   63.556  1.00 185.71 ? 5    DC  N "C3'" 1 
ATOM   786   O  "O3'" . DC  C 3  5    ? 40.991  3.676   62.633  1.00 191.15 ? 5    DC  N "O3'" 1 
ATOM   787   C  "C2'" . DC  C 3  5    ? 39.916  4.691   64.569  1.00 192.23 ? 5    DC  N "C2'" 1 
ATOM   788   C  "C1'" . DC  C 3  5    ? 39.135  5.725   63.792  1.00 194.50 ? 5    DC  N "C1'" 1 
ATOM   789   N  N1    . DC  C 3  5    ? 38.628  6.869   64.611  1.00 201.53 ? 5    DC  N N1    1 
ATOM   790   C  C2    . DC  C 3  5    ? 38.832  8.168   64.151  1.00 200.58 ? 5    DC  N C2    1 
ATOM   791   O  O2    . DC  C 3  5    ? 39.418  8.335   63.076  1.00 200.68 ? 5    DC  N O2    1 
ATOM   792   N  N3    . DC  C 3  5    ? 38.385  9.212   64.891  1.00 196.25 ? 5    DC  N N3    1 
ATOM   793   C  C4    . DC  C 3  5    ? 37.762  8.989   66.045  1.00 192.05 ? 5    DC  N C4    1 
ATOM   794   N  N4    . DC  C 3  5    ? 37.337  10.050  66.740  1.00 186.15 ? 5    DC  N N4    1 
ATOM   795   C  C5    . DC  C 3  5    ? 37.546  7.667   66.540  1.00 195.86 ? 5    DC  N C5    1 
ATOM   796   C  C6    . DC  C 3  5    ? 37.998  6.646   65.799  1.00 200.43 ? 5    DC  N C6    1 
ATOM   797   P  P     . DG  C 3  6    ? 42.434  3.046   62.955  1.00 191.92 ? 6    DG  N P     1 
ATOM   798   O  OP1   . DG  C 3  6    ? 42.662  1.960   61.979  1.00 200.18 ? 6    DG  N OP1   1 
ATOM   799   O  OP2   . DG  C 3  6    ? 42.521  2.760   64.404  1.00 195.89 ? 6    DG  N OP2   1 
ATOM   800   O  "O5'" . DG  C 3  6    ? 43.447  4.231   62.609  1.00 183.72 ? 6    DG  N "O5'" 1 
ATOM   801   C  "C5'" . DG  C 3  6    ? 43.712  4.547   61.253  1.00 183.59 ? 6    DG  N "C5'" 1 
ATOM   802   C  "C4'" . DG  C 3  6    ? 44.005  6.024   61.087  1.00 182.86 ? 6    DG  N "C4'" 1 
ATOM   803   O  "O4'" . DG  C 3  6    ? 43.026  6.801   61.824  1.00 185.06 ? 6    DG  N "O4'" 1 
ATOM   804   C  "C3'" . DG  C 3  6    ? 45.374  6.474   61.597  1.00 184.14 ? 6    DG  N "C3'" 1 
ATOM   805   O  "O3'" . DG  C 3  6    ? 45.952  7.374   60.670  1.00 186.34 ? 6    DG  N "O3'" 1 
ATOM   806   C  "C2'" . DG  C 3  6    ? 45.044  7.168   62.917  1.00 185.19 ? 6    DG  N "C2'" 1 
ATOM   807   C  "C1'" . DG  C 3  6    ? 43.694  7.773   62.590  1.00 190.48 ? 6    DG  N "C1'" 1 
ATOM   808   N  N9    . DG  C 3  6    ? 42.885  8.076   63.762  1.00 199.76 ? 6    DG  N N9    1 
ATOM   809   C  C8    . DG  C 3  6    ? 42.327  7.182   64.640  1.00 201.07 ? 6    DG  N C8    1 
ATOM   810   N  N7    . DG  C 3  6    ? 41.646  7.752   65.595  1.00 200.46 ? 6    DG  N N7    1 
ATOM   811   C  C5    . DG  C 3  6    ? 41.762  9.110   65.330  1.00 202.25 ? 6    DG  N C5    1 
ATOM   812   C  C6    . DG  C 3  6    ? 41.229  10.224  66.018  1.00 206.91 ? 6    DG  N C6    1 
ATOM   813   O  O6    . DG  C 3  6    ? 40.532  10.231  67.040  1.00 202.89 ? 6    DG  N O6    1 
ATOM   814   N  N1    . DG  C 3  6    ? 41.590  11.424  65.409  1.00 215.44 ? 6    DG  N N1    1 
ATOM   815   C  C2    . DG  C 3  6    ? 42.358  11.528  64.272  1.00 218.86 ? 6    DG  N C2    1 
ATOM   816   N  N2    . DG  C 3  6    ? 42.607  12.766  63.829  1.00 221.99 ? 6    DG  N N2    1 
ATOM   817   N  N3    . DG  C 3  6    ? 42.860  10.493  63.622  1.00 214.20 ? 6    DG  N N3    1 
ATOM   818   C  C4    . DG  C 3  6    ? 42.520  9.321   64.202  1.00 204.50 ? 6    DG  N C4    1 
ATOM   819   P  P     . DA  C 3  7    ? 47.463  7.159   60.174  1.00 193.03 ? 7    DA  N P     1 
ATOM   820   O  OP1   . DA  C 3  7    ? 47.462  7.136   58.695  1.00 198.11 ? 7    DA  N OP1   1 
ATOM   821   O  OP2   . DA  C 3  7    ? 48.019  6.019   60.936  1.00 192.28 ? 7    DA  N OP2   1 
ATOM   822   O  "O5'" . DA  C 3  7    ? 48.215  8.475   60.670  1.00 187.81 ? 7    DA  N "O5'" 1 
ATOM   823   C  "C5'" . DA  C 3  7    ? 48.277  8.759   62.051  1.00 184.03 ? 7    DA  N "C5'" 1 
ATOM   824   C  "C4'" . DA  C 3  7    ? 48.304  10.250  62.293  1.00 185.17 ? 7    DA  N "C4'" 1 
ATOM   825   O  "O4'" . DA  C 3  7    ? 47.159  10.620  63.109  1.00 182.94 ? 7    DA  N "O4'" 1 
ATOM   826   C  "C3'" . DA  C 3  7    ? 49.506  10.729  63.082  1.00 192.83 ? 7    DA  N "C3'" 1 
ATOM   827   O  "O3'" . DA  C 3  7    ? 49.691  12.117  62.865  1.00 204.69 ? 7    DA  N "O3'" 1 
ATOM   828   C  "C2'" . DA  C 3  7    ? 49.034  10.458  64.496  1.00 191.77 ? 7    DA  N "C2'" 1 
ATOM   829   C  "C1'" . DA  C 3  7    ? 47.612  10.990  64.397  1.00 187.22 ? 7    DA  N "C1'" 1 
ATOM   830   N  N9    . DA  C 3  7    ? 46.693  10.448  65.393  1.00 190.92 ? 7    DA  N N9    1 
ATOM   831   C  C8    . DA  C 3  7    ? 46.649  9.169   65.872  1.00 194.56 ? 7    DA  N C8    1 
ATOM   832   N  N7    . DA  C 3  7    ? 45.705  8.972   66.764  1.00 194.92 ? 7    DA  N N7    1 
ATOM   833   C  C5    . DA  C 3  7    ? 45.088  10.207  66.873  1.00 195.69 ? 7    DA  N C5    1 
ATOM   834   C  C6    . DA  C 3  7    ? 44.010  10.667  67.656  1.00 196.40 ? 7    DA  N C6    1 
ATOM   835   N  N6    . DA  C 3  7    ? 43.337  9.890   68.510  1.00 194.09 ? 7    DA  N N6    1 
ATOM   836   N  N1    . DA  C 3  7    ? 43.647  11.961  67.524  1.00 197.87 ? 7    DA  N N1    1 
ATOM   837   C  C2    . DA  C 3  7    ? 44.321  12.737  66.666  1.00 198.65 ? 7    DA  N C2    1 
ATOM   838   N  N3    . DA  C 3  7    ? 45.348  12.418  65.881  1.00 198.04 ? 7    DA  N N3    1 
ATOM   839   C  C4    . DA  C 3  7    ? 45.684  11.127  66.034  1.00 195.29 ? 7    DA  N C4    1 
ATOM   840   P  P     . DG  C 3  8    ? 51.155  12.770  62.949  1.00 209.67 ? 8    DG  N P     1 
ATOM   841   O  OP1   . DG  C 3  8    ? 51.687  12.863  61.572  1.00 209.63 ? 8    DG  N OP1   1 
ATOM   842   O  OP2   . DG  C 3  8    ? 51.919  12.043  63.988  1.00 209.58 ? 8    DG  N OP2   1 
ATOM   843   O  "O5'" . DG  C 3  8    ? 50.877  14.245  63.495  1.00 212.50 ? 8    DG  N "O5'" 1 
ATOM   844   C  "C5'" . DG  C 3  8    ? 49.573  14.810  63.387  1.00 216.52 ? 8    DG  N "C5'" 1 
ATOM   845   C  "C4'" . DG  C 3  8    ? 49.177  15.508  64.677  1.00 221.55 ? 8    DG  N "C4'" 1 
ATOM   846   O  "O4'" . DG  C 3  8    ? 48.341  14.625  65.479  1.00 221.52 ? 8    DG  N "O4'" 1 
ATOM   847   C  "C3'" . DG  C 3  8    ? 50.348  15.908  65.585  1.00 229.89 ? 8    DG  N "C3'" 1 
ATOM   848   O  "O3'" . DG  C 3  8    ? 50.092  17.181  66.177  1.00 240.57 ? 8    DG  N "O3'" 1 
ATOM   849   C  "C2'" . DG  C 3  8    ? 50.333  14.806  66.634  1.00 225.07 ? 8    DG  N "C2'" 1 
ATOM   850   C  "C1'" . DG  C 3  8    ? 48.841  14.626  66.794  1.00 223.06 ? 8    DG  N "C1'" 1 
ATOM   851   N  N9    . DG  C 3  8    ? 48.465  13.390  67.469  1.00 225.09 ? 8    DG  N N9    1 
ATOM   852   C  C8    . DG  C 3  8    ? 49.104  12.180  67.401  1.00 225.71 ? 8    DG  N C8    1 
ATOM   853   N  N7    . DG  C 3  8    ? 48.540  11.251  68.122  1.00 225.10 ? 8    DG  N N7    1 
ATOM   854   C  C5    . DG  C 3  8    ? 47.470  11.897  68.724  1.00 225.29 ? 8    DG  N C5    1 
ATOM   855   C  C6    . DG  C 3  8    ? 46.498  11.404  69.623  1.00 226.33 ? 8    DG  N C6    1 
ATOM   856   O  O6    . DG  C 3  8    ? 46.384  10.258  70.076  1.00 227.10 ? 8    DG  N O6    1 
ATOM   857   N  N1    . DG  C 3  8    ? 45.587  12.392  69.987  1.00 226.43 ? 8    DG  N N1    1 
ATOM   858   C  C2    . DG  C 3  8    ? 45.619  13.691  69.539  1.00 226.25 ? 8    DG  N C2    1 
ATOM   859   N  N2    . DG  C 3  8    ? 44.664  14.504  70.000  1.00 225.00 ? 8    DG  N N2    1 
ATOM   860   N  N3    . DG  C 3  8    ? 46.524  14.163  68.697  1.00 226.80 ? 8    DG  N N3    1 
ATOM   861   C  C4    . DG  C 3  8    ? 47.412  13.213  68.331  1.00 225.55 ? 8    DG  N C4    1 
ATOM   862   P  P     . DA  C 3  9    ? 51.280  18.010  66.877  1.00 251.07 ? 9    DA  N P     1 
ATOM   863   O  OP1   . DA  C 3  9    ? 52.254  18.365  65.824  1.00 255.89 ? 9    DA  N OP1   1 
ATOM   864   O  OP2   . DA  C 3  9    ? 51.737  17.285  68.083  1.00 254.78 ? 9    DA  N OP2   1 
ATOM   865   O  "O5'" . DA  C 3  9    ? 50.561  19.337  67.404  1.00 252.86 ? 9    DA  N "O5'" 1 
ATOM   866   C  "C5'" . DA  C 3  9    ? 50.698  19.719  68.770  1.00 253.65 ? 9    DA  N "C5'" 1 
ATOM   867   C  "C4'" . DA  C 3  9    ? 49.461  19.342  69.567  1.00 253.38 ? 9    DA  N "C4'" 1 
ATOM   868   O  "O4'" . DA  C 3  9    ? 49.046  18.007  69.220  1.00 253.46 ? 9    DA  N "O4'" 1 
ATOM   869   C  "C3'" . DA  C 3  9    ? 49.658  19.277  71.068  1.00 253.60 ? 9    DA  N "C3'" 1 
ATOM   870   O  "O3'" . DA  C 3  9    ? 49.540  20.574  71.644  1.00 253.61 ? 9    DA  N "O3'" 1 
ATOM   871   C  "C2'" . DA  C 3  9    ? 48.509  18.370  71.506  1.00 252.96 ? 9    DA  N "C2'" 1 
ATOM   872   C  "C1'" . DA  C 3  9    ? 48.285  17.475  70.290  1.00 252.67 ? 9    DA  N "C1'" 1 
ATOM   873   N  N9    . DA  C 3  9    ? 48.672  16.088  70.513  1.00 254.01 ? 9    DA  N N9    1 
ATOM   874   C  C8    . DA  C 3  9    ? 49.751  15.435  69.993  1.00 254.54 ? 9    DA  N C8    1 
ATOM   875   N  N7    . DA  C 3  9    ? 49.839  14.179  70.364  1.00 255.04 ? 9    DA  N N7    1 
ATOM   876   C  C5    . DA  C 3  9    ? 48.751  14.006  71.202  1.00 255.41 ? 9    DA  N C5    1 
ATOM   877   C  C6    . DA  C 3  9    ? 48.274  12.896  71.925  1.00 256.20 ? 9    DA  N C6    1 
ATOM   878   N  N6    . DA  C 3  9    ? 48.874  11.700  71.921  1.00 255.57 ? 9    DA  N N6    1 
ATOM   879   N  N1    . DA  C 3  9    ? 47.157  13.063  72.662  1.00 256.92 ? 9    DA  N N1    1 
ATOM   880   C  C2    . DA  C 3  9    ? 46.559  14.259  72.672  1.00 255.72 ? 9    DA  N C2    1 
ATOM   881   N  N3    . DA  C 3  9    ? 46.905  15.370  72.025  1.00 254.49 ? 9    DA  N N3    1 
ATOM   882   C  C4    . DA  C 3  9    ? 48.022  15.174  71.305  1.00 254.63 ? 9    DA  N C4    1 
ATOM   883   P  P     . DG  C 3  10   ? 50.577  21.043  72.779  1.00 251.64 ? 10   DG  N P     1 
ATOM   884   O  OP1   . DG  C 3  10   ? 51.148  22.337  72.346  1.00 252.86 ? 10   DG  N OP1   1 
ATOM   885   O  OP2   . DG  C 3  10   ? 51.481  19.901  73.040  1.00 254.29 ? 10   DG  N OP2   1 
ATOM   886   O  "O5'" . DG  C 3  10   ? 49.673  21.295  74.083  1.00 251.42 ? 10   DG  N "O5'" 1 
ATOM   887   C  "C5'" . DG  C 3  10   ? 48.395  20.666  74.223  1.00 247.38 ? 10   DG  N "C5'" 1 
ATOM   888   C  "C4'" . DG  C 3  10   ? 48.412  19.635  75.340  1.00 242.98 ? 10   DG  N "C4'" 1 
ATOM   889   O  "O4'" . DG  C 3  10   ? 48.525  18.288  74.785  1.00 238.87 ? 10   DG  N "O4'" 1 
ATOM   890   C  "C3'" . DG  C 3  10   ? 49.572  19.777  76.330  1.00 242.09 ? 10   DG  N "C3'" 1 
ATOM   891   O  "O3'" . DG  C 3  10   ? 49.101  19.572  77.657  1.00 238.93 ? 10   DG  N "O3'" 1 
ATOM   892   C  "C2'" . DG  C 3  10   ? 50.509  18.658  75.897  1.00 241.22 ? 10   DG  N "C2'" 1 
ATOM   893   C  "C1'" . DG  C 3  10   ? 49.496  17.594  75.528  1.00 238.31 ? 10   DG  N "C1'" 1 
ATOM   894   N  N9    . DG  C 3  10   ? 50.052  16.497  74.736  1.00 236.32 ? 10   DG  N N9    1 
ATOM   895   C  C8    . DG  C 3  10   ? 50.813  16.596  73.597  1.00 235.71 ? 10   DG  N C8    1 
ATOM   896   N  N7    . DG  C 3  10   ? 51.188  15.440  73.120  1.00 236.12 ? 10   DG  N N7    1 
ATOM   897   C  C5    . DG  C 3  10   ? 50.647  14.514  74.004  1.00 237.26 ? 10   DG  N C5    1 
ATOM   898   C  C6    . DG  C 3  10   ? 50.727  13.101  74.008  1.00 235.82 ? 10   DG  N C6    1 
ATOM   899   O  O6    . DG  C 3  10   ? 51.294  12.362  73.190  1.00 233.85 ? 10   DG  N O6    1 
ATOM   900   N  N1    . DG  C 3  10   ? 50.032  12.547  75.079  1.00 235.06 ? 10   DG  N N1    1 
ATOM   901   C  C2    . DG  C 3  10   ? 49.359  13.267  76.036  1.00 231.89 ? 10   DG  N C2    1 
ATOM   902   N  N2    . DG  C 3  10   ? 48.758  12.557  77.001  1.00 227.68 ? 10   DG  N N2    1 
ATOM   903   N  N3    . DG  C 3  10   ? 49.284  14.592  76.050  1.00 234.06 ? 10   DG  N N3    1 
ATOM   904   C  C4    . DG  C 3  10   ? 49.951  15.148  75.008  1.00 236.57 ? 10   DG  N C4    1 
ATOM   905   P  P     . DA  C 3  11   ? 49.671  20.461  78.871  1.00 229.35 ? 11   DA  N P     1 
ATOM   906   O  OP1   . DA  C 3  11   ? 48.673  20.422  79.964  1.00 227.89 ? 11   DA  N OP1   1 
ATOM   907   O  OP2   . DA  C 3  11   ? 50.072  21.766  78.302  1.00 230.78 ? 11   DA  N OP2   1 
ATOM   908   O  "O5'" . DA  C 3  11   ? 51.006  19.698  79.330  1.00 227.19 ? 11   DA  N "O5'" 1 
ATOM   909   C  "C5'" . DA  C 3  11   ? 50.963  18.714  80.371  1.00 223.40 ? 11   DA  N "C5'" 1 
ATOM   910   C  "C4'" . DA  C 3  11   ? 50.159  17.502  79.937  1.00 222.42 ? 11   DA  N "C4'" 1 
ATOM   911   O  "O4'" . DA  C 3  11   ? 50.598  17.081  78.622  1.00 224.23 ? 11   DA  N "O4'" 1 
ATOM   912   C  "C3'" . DA  C 3  11   ? 50.290  16.273  80.825  1.00 220.63 ? 11   DA  N "C3'" 1 
ATOM   913   O  "O3'" . DA  C 3  11   ? 49.066  15.557  80.817  1.00 221.53 ? 11   DA  N "O3'" 1 
ATOM   914   C  "C2'" . DA  C 3  11   ? 51.388  15.488  80.121  1.00 219.73 ? 11   DA  N "C2'" 1 
ATOM   915   C  "C1'" . DA  C 3  11   ? 51.033  15.743  78.672  1.00 221.61 ? 11   DA  N "C1'" 1 
ATOM   916   N  N9    . DA  C 3  11   ? 52.150  15.579  77.744  1.00 219.48 ? 11   DA  N N9    1 
ATOM   917   C  C8    . DA  C 3  11   ? 52.931  16.566  77.209  1.00 216.93 ? 11   DA  N C8    1 
ATOM   918   N  N7    . DA  C 3  11   ? 53.857  16.125  76.391  1.00 215.72 ? 11   DA  N N7    1 
ATOM   919   C  C5    . DA  C 3  11   ? 53.671  14.754  76.389  1.00 216.63 ? 11   DA  N C5    1 
ATOM   920   C  C6    . DA  C 3  11   ? 54.333  13.707  75.720  1.00 210.65 ? 11   DA  N C6    1 
ATOM   921   N  N6    . DA  C 3  11   ? 55.366  13.897  74.893  1.00 202.17 ? 11   DA  N N6    1 
ATOM   922   N  N1    . DA  C 3  11   ? 53.896  12.450  75.942  1.00 214.70 ? 11   DA  N N1    1 
ATOM   923   C  C2    . DA  C 3  11   ? 52.863  12.261  76.772  1.00 216.68 ? 11   DA  N C2    1 
ATOM   924   N  N3    . DA  C 3  11   ? 52.163  13.163  77.455  1.00 217.52 ? 11   DA  N N3    1 
ATOM   925   C  C4    . DA  C 3  11   ? 52.620  14.401  77.216  1.00 218.53 ? 11   DA  N C4    1 
ATOM   926   P  P     . DG  C 3  12   ? 48.412  15.047  82.192  1.00 227.54 ? 12   DG  N P     1 
ATOM   927   O  OP1   . DG  C 3  12   ? 46.943  15.079  82.026  1.00 226.93 ? 12   DG  N OP1   1 
ATOM   928   O  OP2   . DG  C 3  12   ? 49.045  15.802  83.296  1.00 226.46 ? 12   DG  N OP2   1 
ATOM   929   O  "O5'" . DG  C 3  12   ? 48.882  13.522  82.294  1.00 226.69 ? 12   DG  N "O5'" 1 
ATOM   930   C  "C5'" . DG  C 3  12   ? 48.349  12.680  83.310  1.00 226.72 ? 12   DG  N "C5'" 1 
ATOM   931   C  "C4'" . DG  C 3  12   ? 49.457  12.011  84.105  1.00 228.67 ? 12   DG  N "C4'" 1 
ATOM   932   O  "O4'" . DG  C 3  12   ? 50.585  11.733  83.233  1.00 225.73 ? 12   DG  N "O4'" 1 
ATOM   933   C  "C3'" . DG  C 3  12   ? 50.036  12.844  85.257  1.00 233.40 ? 12   DG  N "C3'" 1 
ATOM   934   O  "O3'" . DG  C 3  12   ? 50.569  11.984  86.261  1.00 238.33 ? 12   DG  N "O3'" 1 
ATOM   935   C  "C2'" . DG  C 3  12   ? 51.182  13.545  84.551  1.00 228.80 ? 12   DG  N "C2'" 1 
ATOM   936   C  "C1'" . DG  C 3  12   ? 51.724  12.355  83.780  1.00 227.16 ? 12   DG  N "C1'" 1 
ATOM   937   N  N9    . DG  C 3  12   ? 52.650  12.691  82.713  1.00 227.95 ? 12   DG  N N9    1 
ATOM   938   C  C8    . DG  C 3  12   ? 53.227  13.910  82.472  1.00 228.12 ? 12   DG  N C8    1 
ATOM   939   N  N7    . DG  C 3  12   ? 54.025  13.909  81.441  1.00 228.70 ? 12   DG  N N7    1 
ATOM   940   C  C5    . DG  C 3  12   ? 53.984  12.599  80.982  1.00 228.78 ? 12   DG  N C5    1 
ATOM   941   C  C6    . DG  C 3  12   ? 54.656  11.995  79.898  1.00 228.91 ? 12   DG  N C6    1 
ATOM   942   O  O6    . DG  C 3  12   ? 55.443  12.517  79.098  1.00 226.53 ? 12   DG  N O6    1 
ATOM   943   N  N1    . DG  C 3  12   ? 54.339  10.642  79.784  1.00 230.62 ? 12   DG  N N1    1 
ATOM   944   C  C2    . DG  C 3  12   ? 53.482  9.963   80.617  1.00 228.17 ? 12   DG  N C2    1 
ATOM   945   N  N2    . DG  C 3  12   ? 53.300  8.662   80.351  1.00 224.42 ? 12   DG  N N2    1 
ATOM   946   N  N3    . DG  C 3  12   ? 52.848  10.520  81.639  1.00 228.67 ? 12   DG  N N3    1 
ATOM   947   C  C4    . DG  C 3  12   ? 53.148  11.835  81.761  1.00 228.87 ? 12   DG  N C4    1 
ATOM   948   P  P     . DA  C 3  13   ? 49.651  11.225  87.342  1.00 239.23 ? 13   DA  N P     1 
ATOM   949   O  OP1   . DA  C 3  13   ? 48.236  11.154  86.914  1.00 238.03 ? 13   DA  N OP1   1 
ATOM   950   O  OP2   . DA  C 3  13   ? 49.963  11.830  88.654  1.00 235.72 ? 13   DA  N OP2   1 
ATOM   951   O  "O5'" . DA  C 3  13   ? 50.272  9.752   87.340  1.00 237.68 ? 13   DA  N "O5'" 1 
ATOM   952   C  "C5'" . DA  C 3  13   ? 50.513  9.090   86.098  1.00 235.25 ? 13   DA  N "C5'" 1 
ATOM   953   C  "C4'" . DA  C 3  13   ? 51.950  8.598   85.994  1.00 232.75 ? 13   DA  N "C4'" 1 
ATOM   954   O  "O4'" . DA  C 3  13   ? 52.735  9.489   85.153  1.00 227.98 ? 13   DA  N "O4'" 1 
ATOM   955   C  "C3'" . DA  C 3  13   ? 52.719  8.496   87.317  1.00 235.46 ? 13   DA  N "C3'" 1 
ATOM   956   O  "O3'" . DA  C 3  13   ? 53.473  7.296   87.317  1.00 241.20 ? 13   DA  N "O3'" 1 
ATOM   957   C  "C2'" . DA  C 3  13   ? 53.638  9.715   87.260  1.00 231.46 ? 13   DA  N "C2'" 1 
ATOM   958   C  "C1'" . DA  C 3  13   ? 53.973  9.699   85.786  1.00 227.26 ? 13   DA  N "C1'" 1 
ATOM   959   N  N9    . DA  C 3  13   ? 54.579  10.925  85.276  1.00 223.37 ? 13   DA  N N9    1 
ATOM   960   C  C8    . DA  C 3  13   ? 54.485  12.187  85.795  1.00 221.91 ? 13   DA  N C8    1 
ATOM   961   N  N7    . DA  C 3  13   ? 55.142  13.091  85.103  1.00 220.37 ? 13   DA  N N7    1 
ATOM   962   C  C5    . DA  C 3  13   ? 55.713  12.366  84.070  1.00 222.82 ? 13   DA  N C5    1 
ATOM   963   C  C6    . DA  C 3  13   ? 56.545  12.734  82.992  1.00 225.92 ? 13   DA  N C6    1 
ATOM   964   N  N6    . DA  C 3  13   ? 56.946  13.989  82.767  1.00 223.71 ? 13   DA  N N6    1 
ATOM   965   N  N1    . DA  C 3  13   ? 56.935  11.758  82.143  1.00 228.43 ? 13   DA  N N1    1 
ATOM   966   C  C2    . DA  C 3  13   ? 56.524  10.503  82.368  1.00 227.70 ? 13   DA  N C2    1 
ATOM   967   N  N3    . DA  C 3  13   ? 55.750  10.040  83.342  1.00 225.92 ? 13   DA  N N3    1 
ATOM   968   C  C4    . DA  C 3  13   ? 55.377  11.031  84.167  1.00 223.22 ? 13   DA  N C4    1 
ATOM   969   P  P     . DG  C 3  14   ? 53.587  6.401   88.644  1.00 243.39 ? 14   DG  N P     1 
ATOM   970   O  OP1   . DG  C 3  14   ? 53.255  5.009   88.264  1.00 246.46 ? 14   DG  N OP1   1 
ATOM   971   O  OP2   . DG  C 3  14   ? 52.800  7.069   89.703  1.00 244.79 ? 14   DG  N OP2   1 
ATOM   972   O  "O5'" . DG  C 3  14   ? 55.135  6.506   89.042  1.00 243.21 ? 14   DG  N "O5'" 1 
ATOM   973   C  "C5'" . DG  C 3  14   ? 55.919  5.326   89.209  1.00 242.92 ? 14   DG  N "C5'" 1 
ATOM   974   C  "C4'" . DG  C 3  14   ? 56.501  4.870   87.882  1.00 241.22 ? 14   DG  N "C4'" 1 
ATOM   975   O  "O4'" . DG  C 3  14   ? 56.375  5.938   86.908  1.00 235.79 ? 14   DG  N "O4'" 1 
ATOM   976   C  "C3'" . DG  C 3  14   ? 57.980  4.501   87.917  1.00 243.00 ? 14   DG  N "C3'" 1 
ATOM   977   O  "O3'" . DG  C 3  14   ? 58.236  3.415   87.027  1.00 246.72 ? 14   DG  N "O3'" 1 
ATOM   978   C  "C2'" . DG  C 3  14   ? 58.658  5.787   87.457  1.00 238.61 ? 14   DG  N "C2'" 1 
ATOM   979   C  "C1'" . DG  C 3  14   ? 57.652  6.340   86.460  1.00 232.21 ? 14   DG  N "C1'" 1 
ATOM   980   N  N9    . DG  C 3  14   ? 57.675  7.792   86.390  1.00 221.40 ? 14   DG  N N9    1 
ATOM   981   C  C8    . DG  C 3  14   ? 57.019  8.668   87.217  1.00 218.40 ? 14   DG  N C8    1 
ATOM   982   N  N7    . DG  C 3  14   ? 57.233  9.919   86.922  1.00 216.48 ? 14   DG  N N7    1 
ATOM   983   C  C5    . DG  C 3  14   ? 58.095  9.866   85.835  1.00 215.17 ? 14   DG  N C5    1 
ATOM   984   C  C6    . DG  C 3  14   ? 58.669  10.910  85.083  1.00 209.31 ? 14   DG  N C6    1 
ATOM   985   O  O6    . DG  C 3  14   ? 58.540  12.130  85.243  1.00 207.25 ? 14   DG  N O6    1 
ATOM   986   N  N1    . DG  C 3  14   ? 59.488  10.424  84.066  1.00 207.55 ? 14   DG  N N1    1 
ATOM   987   C  C2    . DG  C 3  14   ? 59.711  9.094   83.807  1.00 208.02 ? 14   DG  N C2    1 
ATOM   988   N  N2    . DG  C 3  14   ? 60.527  8.816   82.781  1.00 206.40 ? 14   DG  N N2    1 
ATOM   989   N  N3    . DG  C 3  14   ? 59.173  8.104   84.503  1.00 212.29 ? 14   DG  N N3    1 
ATOM   990   C  C4    . DG  C 3  14   ? 58.379  8.564   85.498  1.00 216.40 ? 14   DG  N C4    1 
ATOM   991   P  P     . DA  C 3  15   ? 59.723  2.822   86.859  1.00 245.35 ? 15   DA  N P     1 
ATOM   992   O  OP1   . DA  C 3  15   ? 60.288  3.460   85.648  1.00 239.78 ? 15   DA  N OP1   1 
ATOM   993   O  OP2   . DA  C 3  15   ? 59.628  1.346   86.917  1.00 247.41 ? 15   DA  N OP2   1 
ATOM   994   O  "O5'" . DA  C 3  15   ? 60.497  3.308   88.180  1.00 241.87 ? 15   DA  N "O5'" 1 
ATOM   995   C  "C5'" . DA  C 3  15   ? 61.791  2.793   88.501  1.00 241.21 ? 15   DA  N "C5'" 1 
ATOM   996   C  "C4'" . DA  C 3  15   ? 62.867  3.438   87.644  1.00 238.91 ? 15   DA  N "C4'" 1 
ATOM   997   O  "O4'" . DA  C 3  15   ? 62.381  4.704   87.113  1.00 237.48 ? 15   DA  N "O4'" 1 
ATOM   998   C  "C3'" . DA  C 3  15   ? 64.177  3.768   88.372  1.00 235.73 ? 15   DA  N "C3'" 1 
ATOM   999   O  "O3'" . DA  C 3  15   ? 65.286  3.462   87.526  1.00 233.50 ? 15   DA  N "O3'" 1 
ATOM   1000  C  "C2'" . DA  C 3  15   ? 64.055  5.270   88.595  1.00 235.57 ? 15   DA  N "C2'" 1 
ATOM   1001  C  "C1'" . DA  C 3  15   ? 63.383  5.669   87.299  1.00 232.73 ? 15   DA  N "C1'" 1 
ATOM   1002  N  N9    . DA  C 3  15   ? 62.787  6.999   87.323  1.00 220.05 ? 15   DA  N N9    1 
ATOM   1003  C  C8    . DA  C 3  15   ? 62.042  7.556   88.323  1.00 215.60 ? 15   DA  N C8    1 
ATOM   1004  N  N7    . DA  C 3  15   ? 61.650  8.783   88.068  1.00 212.82 ? 15   DA  N N7    1 
ATOM   1005  C  C5    . DA  C 3  15   ? 62.181  9.046   86.816  1.00 212.33 ? 15   DA  N C5    1 
ATOM   1006  C  C6    . DA  C 3  15   ? 62.128  10.179  85.980  1.00 204.50 ? 15   DA  N C6    1 
ATOM   1007  N  N6    . DA  C 3  15   ? 61.486  11.303  86.308  1.00 202.21 ? 15   DA  N N6    1 
ATOM   1008  N  N1    . DA  C 3  15   ? 62.766  10.112  84.792  1.00 199.39 ? 15   DA  N N1    1 
ATOM   1009  C  C2    . DA  C 3  15   ? 63.413  8.985   84.468  1.00 197.41 ? 15   DA  N C2    1 
ATOM   1010  N  N3    . DA  C 3  15   ? 63.532  7.860   85.170  1.00 202.20 ? 15   DA  N N3    1 
ATOM   1011  C  C4    . DA  C 3  15   ? 62.887  7.958   86.344  1.00 212.50 ? 15   DA  N C4    1 
ATOM   1012  P  P     . DA  C 3  16   ? 66.794  3.700   88.032  1.00 225.38 ? 16   DA  N P     1 
ATOM   1013  O  OP1   . DA  C 3  16   ? 67.669  2.795   87.254  1.00 227.35 ? 16   DA  N OP1   1 
ATOM   1014  O  OP2   . DA  C 3  16   ? 66.792  3.628   89.510  1.00 226.00 ? 16   DA  N OP2   1 
ATOM   1015  O  "O5'" . DA  C 3  16   ? 67.122  5.212   87.612  1.00 224.80 ? 16   DA  N "O5'" 1 
ATOM   1016  C  "C5'" . DA  C 3  16   ? 66.970  5.627   86.257  1.00 219.34 ? 16   DA  N "C5'" 1 
ATOM   1017  C  "C4'" . DA  C 3  16   ? 67.575  7.005   86.038  1.00 211.37 ? 16   DA  N "C4'" 1 
ATOM   1018  O  "O4'" . DA  C 3  16   ? 66.672  8.027   86.536  1.00 209.83 ? 16   DA  N "O4'" 1 
ATOM   1019  C  "C3'" . DA  C 3  16   ? 68.919  7.242   86.731  1.00 204.20 ? 16   DA  N "C3'" 1 
ATOM   1020  O  "O3'" . DA  C 3  16   ? 69.836  7.838   85.824  1.00 198.09 ? 16   DA  N "O3'" 1 
ATOM   1021  C  "C2'" . DA  C 3  16   ? 68.571  8.187   87.882  1.00 204.76 ? 16   DA  N "C2'" 1 
ATOM   1022  C  "C1'" . DA  C 3  16   ? 67.395  8.958   87.305  1.00 206.43 ? 16   DA  N "C1'" 1 
ATOM   1023  N  N9    . DA  C 3  16   ? 66.503  9.509   88.323  1.00 202.98 ? 16   DA  N N9    1 
ATOM   1024  C  C8    . DA  C 3  16   ? 65.365  8.934   88.817  1.00 200.81 ? 16   DA  N C8    1 
ATOM   1025  N  N7    . DA  C 3  16   ? 64.759  9.658   89.729  1.00 197.64 ? 16   DA  N N7    1 
ATOM   1026  C  C5    . DA  C 3  16   ? 65.554  10.786  89.842  1.00 197.44 ? 16   DA  N C5    1 
ATOM   1027  C  C6    . DA  C 3  16   ? 65.456  11.941  90.643  1.00 193.13 ? 16   DA  N C6    1 
ATOM   1028  N  N6    . DA  C 3  16   ? 64.466  12.148  91.518  1.00 192.53 ? 16   DA  N N6    1 
ATOM   1029  N  N1    . DA  C 3  16   ? 66.418  12.879  90.510  1.00 192.33 ? 16   DA  N N1    1 
ATOM   1030  C  C2    . DA  C 3  16   ? 67.408  12.670  89.634  1.00 192.73 ? 16   DA  N C2    1 
ATOM   1031  N  N3    . DA  C 3  16   ? 67.606  11.627  88.827  1.00 195.05 ? 16   DA  N N3    1 
ATOM   1032  C  C4    . DA  C 3  16   ? 66.634  10.712  88.982  1.00 198.21 ? 16   DA  N C4    1 
ATOM   1033  N  N     . GLY D 4  3    ? 31.121  -6.092  15.890  1.00 89.85  ? 3    GLY A N     1 
ATOM   1034  C  CA    . GLY D 4  3    ? 31.600  -7.067  14.928  1.00 107.82 ? 3    GLY A CA    1 
ATOM   1035  C  C     . GLY D 4  3    ? 32.975  -7.602  15.273  1.00 121.57 ? 3    GLY A C     1 
ATOM   1036  O  O     . GLY D 4  3    ? 33.245  -8.793  15.105  1.00 125.84 ? 3    GLY A O     1 
ATOM   1037  N  N     . GLN D 4  4    ? 33.853  -6.691  15.705  1.00 123.09 ? 4    GLN A N     1 
ATOM   1038  C  CA    . GLN D 4  4    ? 35.160  -6.982  16.295  1.00 125.25 ? 4    GLN A CA    1 
ATOM   1039  C  C     . GLN D 4  4    ? 36.184  -7.610  15.353  1.00 112.22 ? 4    GLN A C     1 
ATOM   1040  O  O     . GLN D 4  4    ? 37.347  -7.747  15.744  1.00 124.26 ? 4    GLN A O     1 
ATOM   1041  C  CB    . GLN D 4  4    ? 35.004  -7.868  17.534  1.00 139.33 ? 4    GLN A CB    1 
ATOM   1042  C  CG    . GLN D 4  4    ? 35.883  -7.445  18.694  1.00 143.04 ? 4    GLN A CG    1 
ATOM   1043  C  CD    . GLN D 4  4    ? 35.639  -6.020  19.135  1.00 138.78 ? 4    GLN A CD    1 
ATOM   1044  O  OE1   . GLN D 4  4    ? 34.607  -5.702  19.729  1.00 136.01 ? 4    GLN A OE1   1 
ATOM   1045  N  NE2   . GLN D 4  4    ? 36.593  -5.146  18.841  1.00 137.37 ? 4    GLN A NE2   1 
ATOM   1046  N  N     . GLN D 4  5    ? 35.786  -7.977  14.136  1.00 97.93  ? 5    GLN A N     1 
ATOM   1047  C  CA    . GLN D 4  5    ? 36.674  -8.522  13.080  1.00 107.03 ? 5    GLN A CA    1 
ATOM   1048  C  C     . GLN D 4  5    ? 37.343  -9.799  13.600  1.00 93.98  ? 5    GLN A C     1 
ATOM   1049  O  O     . GLN D 4  5    ? 36.706  -10.587 14.317  1.00 98.37  ? 5    GLN A O     1 
ATOM   1050  C  CB    . GLN D 4  5    ? 37.641  -7.449  12.611  1.00 115.56 ? 5    GLN A CB    1 
ATOM   1051  C  CG    . GLN D 4  5    ? 37.215  -6.710  11.360  1.00 123.80 ? 5    GLN A CG    1 
ATOM   1052  C  CD    . GLN D 4  5    ? 38.030  -7.129  10.152  1.00 118.90 ? 5    GLN A CD    1 
ATOM   1053  O  OE1   . GLN D 4  5    ? 39.261  -7.113  10.185  1.00 106.96 ? 5    GLN A OE1   1 
ATOM   1054  N  NE2   . GLN D 4  5    ? 37.347  -7.519  9.082   1.00 117.64 ? 5    GLN A NE2   1 
ATOM   1055  N  N     . TYR D 4  6    ? 38.611  -10.025 13.261  1.00 86.65  ? 6    TYR A N     1 
ATOM   1056  C  CA    . TYR D 4  6    ? 39.366  -11.181 13.717  1.00 89.05  ? 6    TYR A CA    1 
ATOM   1057  C  C     . TYR D 4  6    ? 40.845  -10.840 13.639  1.00 104.35 ? 6    TYR A C     1 
ATOM   1058  O  O     . TYR D 4  6    ? 41.294  -10.221 12.671  1.00 89.43  ? 6    TYR A O     1 
ATOM   1059  C  CB    . TYR D 4  6    ? 39.070  -12.427 12.873  1.00 93.02  ? 6    TYR A CB    1 
ATOM   1060  C  CG    . TYR D 4  6    ? 40.194  -13.442 12.870  1.00 100.79 ? 6    TYR A CG    1 
ATOM   1061  C  CD1   . TYR D 4  6    ? 40.460  -14.218 13.993  1.00 101.66 ? 6    TYR A CD1   1 
ATOM   1062  C  CD2   . TYR D 4  6    ? 41.002  -13.613 11.750  1.00 103.79 ? 6    TYR A CD2   1 
ATOM   1063  C  CE1   . TYR D 4  6    ? 41.490  -15.141 13.998  1.00 103.44 ? 6    TYR A CE1   1 
ATOM   1064  C  CE2   . TYR D 4  6    ? 42.035  -14.532 11.748  1.00 109.66 ? 6    TYR A CE2   1 
ATOM   1065  C  CZ    . TYR D 4  6    ? 42.274  -15.292 12.874  1.00 106.24 ? 6    TYR A CZ    1 
ATOM   1066  O  OH    . TYR D 4  6    ? 43.300  -16.208 12.872  1.00 100.34 ? 6    TYR A OH    1 
ATOM   1067  N  N     . SER D 4  7    ? 41.592  -11.254 14.656  1.00 127.14 ? 7    SER A N     1 
ATOM   1068  C  CA    . SER D 4  7    ? 43.039  -11.144 14.656  1.00 129.14 ? 7    SER A CA    1 
ATOM   1069  C  C     . SER D 4  7    ? 43.648  -12.457 15.124  1.00 132.65 ? 7    SER A C     1 
ATOM   1070  O  O     . SER D 4  7    ? 43.068  -13.172 15.945  1.00 130.66 ? 7    SER A O     1 
ATOM   1071  C  CB    . SER D 4  7    ? 43.510  -10.004 15.545  1.00 119.10 ? 7    SER A CB    1 
ATOM   1072  O  OG    . SER D 4  7    ? 44.768  -10.295 16.128  1.00 115.48 ? 7    SER A OG    1 
ATOM   1073  N  N     . SER D 4  8    ? 44.840  -12.756 14.603  1.00 137.57 ? 8    SER A N     1 
ATOM   1074  C  CA    . SER D 4  8    ? 45.494  -14.034 14.860  1.00 141.20 ? 8    SER A CA    1 
ATOM   1075  C  C     . SER D 4  8    ? 45.974  -14.187 16.297  1.00 140.56 ? 8    SER A C     1 
ATOM   1076  O  O     . SER D 4  8    ? 46.332  -15.304 16.688  1.00 139.58 ? 8    SER A O     1 
ATOM   1077  C  CB    . SER D 4  8    ? 46.676  -14.219 13.906  1.00 151.41 ? 8    SER A CB    1 
ATOM   1078  O  OG    . SER D 4  8    ? 47.670  -15.050 14.481  1.00 158.11 ? 8    SER A OG    1 
ATOM   1079  N  N     . ALA D 4  9    ? 46.000  -13.109 17.077  1.00 136.49 ? 9    ALA A N     1 
ATOM   1080  C  CA    . ALA D 4  9    ? 46.425  -13.199 18.466  1.00 132.04 ? 9    ALA A CA    1 
ATOM   1081  C  C     . ALA D 4  9    ? 45.432  -14.044 19.258  1.00 122.00 ? 9    ALA A C     1 
ATOM   1082  O  O     . ALA D 4  9    ? 44.222  -13.793 19.194  1.00 127.98 ? 9    ALA A O     1 
ATOM   1083  C  CB    . ALA D 4  9    ? 46.541  -11.808 19.083  1.00 131.87 ? 9    ALA A CB    1 
ATOM   1084  N  N     . PRO D 4  10   ? 45.892  -15.053 19.989  1.00 108.42 ? 10   PRO A N     1 
ATOM   1085  C  CA    . PRO D 4  10   ? 44.966  -15.935 20.703  1.00 101.66 ? 10   PRO A CA    1 
ATOM   1086  C  C     . PRO D 4  10   ? 44.442  -15.296 21.976  1.00 95.24  ? 10   PRO A C     1 
ATOM   1087  O  O     . PRO D 4  10   ? 45.080  -14.430 22.578  1.00 95.92  ? 10   PRO A O     1 
ATOM   1088  C  CB    . PRO D 4  10   ? 45.824  -17.166 21.032  1.00 100.03 ? 10   PRO A CB    1 
ATOM   1089  C  CG    . PRO D 4  10   ? 47.148  -16.957 20.334  1.00 98.36  ? 10   PRO A CG    1 
ATOM   1090  C  CD    . PRO D 4  10   ? 47.288  -15.492 20.121  1.00 96.40  ? 10   PRO A CD    1 
ATOM   1091  N  N     . LEU D 4  11   ? 43.257  -15.742 22.387  1.00 92.55  ? 11   LEU A N     1 
ATOM   1092  C  CA    . LEU D 4  11   ? 42.690  -15.300 23.651  1.00 89.91  ? 11   LEU A CA    1 
ATOM   1093  C  C     . LEU D 4  11   ? 43.054  -16.281 24.757  1.00 101.98 ? 11   LEU A C     1 
ATOM   1094  O  O     . LEU D 4  11   ? 43.029  -17.500 24.563  1.00 94.76  ? 11   LEU A O     1 
ATOM   1095  C  CB    . LEU D 4  11   ? 41.170  -15.124 23.558  1.00 84.42  ? 11   LEU A CB    1 
ATOM   1096  C  CG    . LEU D 4  11   ? 40.223  -16.313 23.401  1.00 85.98  ? 11   LEU A CG    1 
ATOM   1097  C  CD1   . LEU D 4  11   ? 38.908  -16.028 24.107  1.00 79.48  ? 11   LEU A CD1   1 
ATOM   1098  C  CD2   . LEU D 4  11   ? 39.977  -16.611 21.932  1.00 86.73  ? 11   LEU A CD2   1 
ATOM   1099  N  N     . ARG D 4  12   ? 43.430  -15.733 25.916  1.00 112.23 ? 12   ARG A N     1 
ATOM   1100  C  CA    . ARG D 4  12   ? 43.923  -16.531 27.032  1.00 127.89 ? 12   ARG A CA    1 
ATOM   1101  C  C     . ARG D 4  12   ? 43.300  -16.148 28.368  1.00 130.52 ? 12   ARG A C     1 
ATOM   1102  O  O     . ARG D 4  12   ? 43.747  -16.656 29.404  1.00 140.69 ? 12   ARG A O     1 
ATOM   1103  C  CB    . ARG D 4  12   ? 45.448  -16.410 27.157  1.00 132.16 ? 12   ARG A CB    1 
ATOM   1104  C  CG    . ARG D 4  12   ? 46.257  -16.789 25.934  1.00 135.48 ? 12   ARG A CG    1 
ATOM   1105  C  CD    . ARG D 4  12   ? 46.992  -18.085 26.199  1.00 138.24 ? 12   ARG A CD    1 
ATOM   1106  N  NE    . ARG D 4  12   ? 48.382  -17.846 26.575  1.00 141.05 ? 12   ARG A NE    1 
ATOM   1107  C  CZ    . ARG D 4  12   ? 49.140  -18.727 27.219  1.00 140.15 ? 12   ARG A CZ    1 
ATOM   1108  N  NH1   . ARG D 4  12   ? 48.640  -19.906 27.562  1.00 140.61 ? 12   ARG A NH1   1 
ATOM   1109  N  NH2   . ARG D 4  12   ? 50.395  -18.428 27.527  1.00 137.29 ? 12   ARG A NH2   1 
ATOM   1110  N  N     . THR D 4  13   ? 42.299  -15.256 28.372  1.00 115.55 ? 13   THR A N     1 
ATOM   1111  C  CA    . THR D 4  13   ? 41.727  -14.619 29.564  1.00 115.14 ? 13   THR A CA    1 
ATOM   1112  C  C     . THR D 4  13   ? 42.786  -13.905 30.405  1.00 113.30 ? 13   THR A C     1 
ATOM   1113  O  O     . THR D 4  13   ? 43.939  -13.762 29.984  1.00 123.64 ? 13   THR A O     1 
ATOM   1114  C  CB    . THR D 4  13   ? 40.947  -15.629 30.422  1.00 115.93 ? 13   THR A CB    1 
ATOM   1115  O  OG1   . THR D 4  13   ? 41.858  -16.406 31.209  1.00 118.33 ? 13   THR A OG1   1 
ATOM   1116  C  CG2   . THR D 4  13   ? 40.090  -16.547 29.552  1.00 124.77 ? 13   THR A CG2   1 
ATOM   1117  N  N     . VAL D 4  14   ? 42.407  -13.415 31.582  1.00 94.26  ? 14   VAL A N     1 
ATOM   1118  C  CA    . VAL D 4  14   ? 43.322  -12.676 32.444  1.00 97.67  ? 14   VAL A CA    1 
ATOM   1119  C  C     . VAL D 4  14   ? 43.380  -13.386 33.788  1.00 115.41 ? 14   VAL A C     1 
ATOM   1120  O  O     . VAL D 4  14   ? 42.340  -13.669 34.394  1.00 118.40 ? 14   VAL A O     1 
ATOM   1121  C  CB    . VAL D 4  14   ? 42.899  -11.202 32.598  1.00 82.02  ? 14   VAL A CB    1 
ATOM   1122  C  CG1   . VAL D 4  14   ? 43.375  -10.623 33.927  1.00 94.28  ? 14   VAL A CG1   1 
ATOM   1123  C  CG2   . VAL D 4  14   ? 43.435  -10.378 31.442  1.00 73.70  ? 14   VAL A CG2   1 
ATOM   1124  N  N     . LYS D 4  15   ? 44.598  -13.695 34.236  1.00 106.19 ? 15   LYS A N     1 
ATOM   1125  C  CA    . LYS D 4  15   ? 44.813  -14.426 35.473  1.00 98.82  ? 15   LYS A CA    1 
ATOM   1126  C  C     . LYS D 4  15   ? 45.668  -13.674 36.481  1.00 111.10 ? 15   LYS A C     1 
ATOM   1127  O  O     . LYS D 4  15   ? 45.739  -14.096 37.640  1.00 123.04 ? 15   LYS A O     1 
ATOM   1128  C  CB    . LYS D 4  15   ? 45.473  -15.783 35.180  1.00 99.31  ? 15   LYS A CB    1 
ATOM   1129  C  CG    . LYS D 4  15   ? 44.860  -16.528 34.005  1.00 106.26 ? 15   LYS A CG    1 
ATOM   1130  C  CD    . LYS D 4  15   ? 43.940  -17.644 34.457  1.00 111.59 ? 15   LYS A CD    1 
ATOM   1131  C  CE    . LYS D 4  15   ? 43.679  -18.616 33.317  1.00 110.23 ? 15   LYS A CE    1 
ATOM   1132  N  NZ    . LYS D 4  15   ? 43.857  -20.033 33.735  1.00 105.47 ? 15   LYS A NZ    1 
ATOM   1133  N  N     . GLU D 4  16   ? 46.318  -12.584 36.079  1.00 107.07 ? 16   GLU A N     1 
ATOM   1134  C  CA    . GLU D 4  16   ? 47.199  -11.823 36.957  1.00 102.00 ? 16   GLU A CA    1 
ATOM   1135  C  C     . GLU D 4  16   ? 47.069  -10.349 36.617  1.00 96.39  ? 16   GLU A C     1 
ATOM   1136  O  O     . GLU D 4  16   ? 47.379  -9.944  35.494  1.00 103.31 ? 16   GLU A O     1 
ATOM   1137  C  CB    . GLU D 4  16   ? 48.655  -12.274 36.812  1.00 105.71 ? 16   GLU A CB    1 
ATOM   1138  C  CG    . GLU D 4  16   ? 49.352  -12.599 38.121  1.00 105.65 ? 16   GLU A CG    1 
ATOM   1139  C  CD    . GLU D 4  16   ? 50.755  -13.134 37.911  1.00 113.40 ? 16   GLU A CD    1 
ATOM   1140  O  OE1   . GLU D 4  16   ? 51.322  -12.913 36.820  1.00 114.80 ? 16   GLU A OE1   1 
ATOM   1141  O  OE2   . GLU D 4  16   ? 51.294  -13.772 38.839  1.00 117.16 ? 16   GLU A OE2   1 
ATOM   1142  N  N     . VAL D 4  17   ? 46.611  -9.551  37.576  1.00 80.20  ? 17   VAL A N     1 
ATOM   1143  C  CA    . VAL D 4  17   ? 46.613  -8.099  37.457  1.00 79.98  ? 17   VAL A CA    1 
ATOM   1144  C  C     . VAL D 4  17   ? 47.665  -7.567  38.416  1.00 87.38  ? 17   VAL A C     1 
ATOM   1145  O  O     . VAL D 4  17   ? 47.535  -7.703  39.639  1.00 99.92  ? 17   VAL A O     1 
ATOM   1146  C  CB    . VAL D 4  17   ? 45.239  -7.482  37.746  1.00 72.70  ? 17   VAL A CB    1 
ATOM   1147  C  CG1   . VAL D 4  17   ? 45.205  -6.058  37.247  1.00 72.41  ? 17   VAL A CG1   1 
ATOM   1148  C  CG2   . VAL D 4  17   ? 44.154  -8.275  37.062  1.00 73.54  ? 17   VAL A CG2   1 
ATOM   1149  N  N     . GLN D 4  18   ? 48.711  -6.962  37.866  1.00 84.89  ? 18   GLN A N     1 
ATOM   1150  C  CA    . GLN D 4  18   ? 49.789  -6.382  38.657  1.00 89.74  ? 18   GLN A CA    1 
ATOM   1151  C  C     . GLN D 4  18   ? 49.750  -4.867  38.511  1.00 92.63  ? 18   GLN A C     1 
ATOM   1152  O  O     . GLN D 4  18   ? 50.018  -4.331  37.430  1.00 100.70 ? 18   GLN A O     1 
ATOM   1153  C  CB    . GLN D 4  18   ? 51.147  -6.930  38.233  1.00 105.70 ? 18   GLN A CB    1 
ATOM   1154  C  CG    . GLN D 4  18   ? 52.293  -6.185  38.878  1.00 122.29 ? 18   GLN A CG    1 
ATOM   1155  C  CD    . GLN D 4  18   ? 52.299  -6.316  40.388  1.00 128.87 ? 18   GLN A CD    1 
ATOM   1156  O  OE1   . GLN D 4  18   ? 52.587  -7.383  40.928  1.00 127.83 ? 18   GLN A OE1   1 
ATOM   1157  N  NE2   . GLN D 4  18   ? 51.974  -5.229  41.079  1.00 132.18 ? 18   GLN A NE2   1 
ATOM   1158  N  N     . PHE D 4  19   ? 49.430  -4.181  39.600  1.00 86.11  ? 19   PHE A N     1 
ATOM   1159  C  CA    . PHE D 4  19   ? 49.412  -2.731  39.609  1.00 90.03  ? 19   PHE A CA    1 
ATOM   1160  C  C     . PHE D 4  19   ? 50.836  -2.191  39.711  1.00 105.95 ? 19   PHE A C     1 
ATOM   1161  O  O     . PHE D 4  19   ? 51.763  -2.881  40.144  1.00 121.15 ? 19   PHE A O     1 
ATOM   1162  C  CB    . PHE D 4  19   ? 48.561  -2.216  40.770  1.00 86.93  ? 19   PHE A CB    1 
ATOM   1163  C  CG    . PHE D 4  19   ? 47.080  -2.461  40.611  1.00 91.49  ? 19   PHE A CG    1 
ATOM   1164  C  CD1   . PHE D 4  19   ? 46.213  -2.110  41.625  1.00 97.67  ? 19   PHE A CD1   1 
ATOM   1165  C  CD2   . PHE D 4  19   ? 46.547  -2.966  39.433  1.00 96.17  ? 19   PHE A CD2   1 
ATOM   1166  C  CE1   . PHE D 4  19   ? 44.855  -2.313  41.503  1.00 99.42  ? 19   PHE A CE1   1 
ATOM   1167  C  CE2   . PHE D 4  19   ? 45.182  -3.161  39.302  1.00 99.41  ? 19   PHE A CE2   1 
ATOM   1168  C  CZ    . PHE D 4  19   ? 44.337  -2.833  40.338  1.00 95.76  ? 19   PHE A CZ    1 
ATOM   1169  N  N     . GLY D 4  20   ? 51.003  -0.941  39.297  1.00 107.41 ? 20   GLY A N     1 
ATOM   1170  C  CA    . GLY D 4  20   ? 52.320  -0.333  39.335  1.00 115.48 ? 20   GLY A CA    1 
ATOM   1171  C  C     . GLY D 4  20   ? 52.231  1.137   38.999  1.00 122.91 ? 20   GLY A C     1 
ATOM   1172  O  O     . GLY D 4  20   ? 51.152  1.677   38.741  1.00 130.45 ? 20   GLY A O     1 
ATOM   1173  N  N     . LEU D 4  21   ? 53.392  1.782   39.003  1.00 121.86 ? 21   LEU A N     1 
ATOM   1174  C  CA    . LEU D 4  21   ? 53.507  3.202   38.713  1.00 119.82 ? 21   LEU A CA    1 
ATOM   1175  C  C     . LEU D 4  21   ? 54.274  3.407   37.413  1.00 124.84 ? 21   LEU A C     1 
ATOM   1176  O  O     . LEU D 4  21   ? 55.179  2.637   37.077  1.00 124.93 ? 21   LEU A O     1 
ATOM   1177  C  CB    . LEU D 4  21   ? 54.206  3.943   39.858  1.00 118.34 ? 21   LEU A CB    1 
ATOM   1178  C  CG    . LEU D 4  21   ? 53.340  4.697   40.873  1.00 115.33 ? 21   LEU A CG    1 
ATOM   1179  C  CD1   . LEU D 4  21   ? 52.862  6.015   40.300  1.00 113.60 ? 21   LEU A CD1   1 
ATOM   1180  C  CD2   . LEU D 4  21   ? 52.158  3.862   41.323  1.00 109.33 ? 21   LEU A CD2   1 
ATOM   1181  N  N     . PHE D 4  22   ? 53.893  4.448   36.678  1.00 135.12 ? 22   PHE A N     1 
ATOM   1182  C  CA    . PHE D 4  22   ? 54.525  4.743   35.399  1.00 149.79 ? 22   PHE A CA    1 
ATOM   1183  C  C     . PHE D 4  22   ? 55.868  5.409   35.643  1.00 147.49 ? 22   PHE A C     1 
ATOM   1184  O  O     . PHE D 4  22   ? 55.942  6.441   36.319  1.00 145.81 ? 22   PHE A O     1 
ATOM   1185  C  CB    . PHE D 4  22   ? 53.656  5.662   34.539  1.00 163.15 ? 22   PHE A CB    1 
ATOM   1186  C  CG    . PHE D 4  22   ? 52.990  4.975   33.381  1.00 171.79 ? 22   PHE A CG    1 
ATOM   1187  C  CD1   . PHE D 4  22   ? 51.612  5.027   33.233  1.00 170.87 ? 22   PHE A CD1   1 
ATOM   1188  C  CD2   . PHE D 4  22   ? 53.735  4.271   32.449  1.00 175.61 ? 22   PHE A CD2   1 
ATOM   1189  C  CE1   . PHE D 4  22   ? 50.990  4.395   32.174  1.00 170.04 ? 22   PHE A CE1   1 
ATOM   1190  C  CE2   . PHE D 4  22   ? 53.118  3.635   31.386  1.00 173.88 ? 22   PHE A CE2   1 
ATOM   1191  C  CZ    . PHE D 4  22   ? 51.743  3.698   31.249  1.00 172.27 ? 22   PHE A CZ    1 
ATOM   1192  N  N     . SER D 4  23   ? 56.924  4.828   35.098  1.00 148.48 ? 23   SER A N     1 
ATOM   1193  C  CA    . SER D 4  23   ? 58.140  5.596   34.939  1.00 149.05 ? 23   SER A CA    1 
ATOM   1194  C  C     . SER D 4  23   ? 57.890  6.686   33.901  1.00 147.65 ? 23   SER A C     1 
ATOM   1195  O  O     . SER D 4  23   ? 57.192  6.445   32.910  1.00 147.99 ? 23   SER A O     1 
ATOM   1196  C  CB    . SER D 4  23   ? 59.300  4.707   34.496  1.00 150.94 ? 23   SER A CB    1 
ATOM   1197  O  OG    . SER D 4  23   ? 59.522  4.811   33.102  1.00 152.65 ? 23   SER A OG    1 
ATOM   1198  N  N     . PRO D 4  24   ? 58.399  7.900   34.118  1.00 148.19 ? 24   PRO A N     1 
ATOM   1199  C  CA    . PRO D 4  24   ? 58.329  8.921   33.062  1.00 152.87 ? 24   PRO A CA    1 
ATOM   1200  C  C     . PRO D 4  24   ? 59.049  8.514   31.791  1.00 158.55 ? 24   PRO A C     1 
ATOM   1201  O  O     . PRO D 4  24   ? 58.717  9.020   30.711  1.00 169.87 ? 24   PRO A O     1 
ATOM   1202  C  CB    . PRO D 4  24   ? 58.993  10.137  33.716  1.00 151.50 ? 24   PRO A CB    1 
ATOM   1203  C  CG    . PRO D 4  24   ? 58.753  9.940   35.173  1.00 148.20 ? 24   PRO A CG    1 
ATOM   1204  C  CD    . PRO D 4  24   ? 58.888  8.460   35.388  1.00 147.88 ? 24   PRO A CD    1 
ATOM   1205  N  N     . GLU D 4  25   ? 60.021  7.607   31.892  1.00 151.59 ? 25   GLU A N     1 
ATOM   1206  C  CA    . GLU D 4  25   ? 60.677  7.064   30.712  1.00 140.68 ? 25   GLU A CA    1 
ATOM   1207  C  C     . GLU D 4  25   ? 59.755  6.103   29.972  1.00 132.06 ? 25   GLU A C     1 
ATOM   1208  O  O     . GLU D 4  25   ? 59.789  6.031   28.738  1.00 118.81 ? 25   GLU A O     1 
ATOM   1209  C  CB    . GLU D 4  25   ? 61.986  6.357   31.095  1.00 134.82 ? 25   GLU A CB    1 
ATOM   1210  C  CG    . GLU D 4  25   ? 63.037  7.156   31.914  1.00 129.87 ? 25   GLU A CG    1 
ATOM   1211  C  CD    . GLU D 4  25   ? 62.630  7.475   33.352  1.00 127.44 ? 25   GLU A CD    1 
ATOM   1212  O  OE1   . GLU D 4  25   ? 61.962  6.631   33.987  1.00 125.51 ? 25   GLU A OE1   1 
ATOM   1213  O  OE2   . GLU D 4  25   ? 62.970  8.572   33.841  1.00 125.59 ? 25   GLU A OE2   1 
ATOM   1214  N  N     . GLU D 4  26   ? 58.933  5.349   30.711  1.00 139.53 ? 26   GLU A N     1 
ATOM   1215  C  CA    . GLU D 4  26   ? 57.959  4.463   30.078  1.00 142.05 ? 26   GLU A CA    1 
ATOM   1216  C  C     . GLU D 4  26   ? 56.897  5.257   29.336  1.00 129.87 ? 26   GLU A C     1 
ATOM   1217  O  O     . GLU D 4  26   ? 56.516  4.895   28.218  1.00 125.78 ? 26   GLU A O     1 
ATOM   1218  C  CB    . GLU D 4  26   ? 57.302  3.562   31.122  1.00 147.10 ? 26   GLU A CB    1 
ATOM   1219  C  CG    . GLU D 4  26   ? 57.045  2.140   30.661  1.00 147.61 ? 26   GLU A CG    1 
ATOM   1220  C  CD    . GLU D 4  26   ? 56.112  1.392   31.592  1.00 149.63 ? 26   GLU A CD    1 
ATOM   1221  O  OE1   . GLU D 4  26   ? 55.977  1.809   32.761  1.00 152.31 ? 26   GLU A OE1   1 
ATOM   1222  O  OE2   . GLU D 4  26   ? 55.509  0.390   31.154  1.00 148.84 ? 26   GLU A OE2   1 
ATOM   1223  N  N     . VAL D 4  27   ? 56.418  6.342   29.949  1.00 119.95 ? 27   VAL A N     1 
ATOM   1224  C  CA    . VAL D 4  27   ? 55.404  7.199   29.340  1.00 117.73 ? 27   VAL A CA    1 
ATOM   1225  C  C     . VAL D 4  27   ? 55.913  7.779   28.024  1.00 119.86 ? 27   VAL A C     1 
ATOM   1226  O  O     . VAL D 4  27   ? 55.171  7.869   27.037  1.00 127.17 ? 27   VAL A O     1 
ATOM   1227  C  CB    . VAL D 4  27   ? 54.991  8.290   30.349  1.00 113.14 ? 27   VAL A CB    1 
ATOM   1228  C  CG1   . VAL D 4  27   ? 54.483  9.537   29.669  1.00 103.51 ? 27   VAL A CG1   1 
ATOM   1229  C  CG2   . VAL D 4  27   ? 53.937  7.750   31.300  1.00 112.33 ? 27   VAL A CG2   1 
ATOM   1230  N  N     . ARG D 4  28   ? 57.201  8.127   27.974  1.00 119.27 ? 28   ARG A N     1 
ATOM   1231  C  CA    . ARG D 4  28   ? 57.807  8.566   26.722  1.00 122.47 ? 28   ARG A CA    1 
ATOM   1232  C  C     . ARG D 4  28   ? 57.894  7.422   25.719  1.00 128.36 ? 28   ARG A C     1 
ATOM   1233  O  O     . ARG D 4  28   ? 57.659  7.619   24.521  1.00 124.85 ? 28   ARG A O     1 
ATOM   1234  C  CB    . ARG D 4  28   ? 59.193  9.144   26.994  1.00 126.13 ? 28   ARG A CB    1 
ATOM   1235  C  CG    . ARG D 4  28   ? 59.173  10.530  27.602  1.00 132.32 ? 28   ARG A CG    1 
ATOM   1236  C  CD    . ARG D 4  28   ? 60.392  11.336  27.185  1.00 139.51 ? 28   ARG A CD    1 
ATOM   1237  N  NE    . ARG D 4  28   ? 61.316  11.533  28.300  1.00 142.96 ? 28   ARG A NE    1 
ATOM   1238  C  CZ    . ARG D 4  28   ? 61.158  12.443  29.256  1.00 145.49 ? 28   ARG A CZ    1 
ATOM   1239  N  NH1   . ARG D 4  28   ? 62.050  12.542  30.231  1.00 148.57 ? 28   ARG A NH1   1 
ATOM   1240  N  NH2   . ARG D 4  28   ? 60.115  13.261  29.235  1.00 143.88 ? 28   ARG A NH2   1 
ATOM   1241  N  N     . ALA D 4  29   ? 58.227  6.218   26.190  1.00 138.42 ? 29   ALA A N     1 
ATOM   1242  C  CA    . ALA D 4  29   ? 58.291  5.068   25.295  1.00 139.12 ? 29   ALA A CA    1 
ATOM   1243  C  C     . ALA D 4  29   ? 56.902  4.600   24.882  1.00 135.11 ? 29   ALA A C     1 
ATOM   1244  O  O     . ALA D 4  29   ? 56.747  3.984   23.822  1.00 129.82 ? 29   ALA A O     1 
ATOM   1245  C  CB    . ALA D 4  29   ? 59.061  3.927   25.958  1.00 132.74 ? 29   ALA A CB    1 
ATOM   1246  N  N     . ILE D 4  30   ? 55.886  4.887   25.695  1.00 135.78 ? 30   ILE A N     1 
ATOM   1247  C  CA    . ILE D 4  30   ? 54.531  4.445   25.384  1.00 133.57 ? 30   ILE A CA    1 
ATOM   1248  C  C     . ILE D 4  30   ? 53.898  5.343   24.328  1.00 139.21 ? 30   ILE A C     1 
ATOM   1249  O  O     . ILE D 4  30   ? 53.236  4.858   23.401  1.00 134.64 ? 30   ILE A O     1 
ATOM   1250  C  CB    . ILE D 4  30   ? 53.693  4.391   26.678  1.00 119.82 ? 30   ILE A CB    1 
ATOM   1251  C  CG1   . ILE D 4  30   ? 53.966  3.088   27.435  1.00 119.41 ? 30   ILE A CG1   1 
ATOM   1252  C  CG2   . ILE D 4  30   ? 52.201  4.551   26.404  1.00 110.66 ? 30   ILE A CG2   1 
ATOM   1253  C  CD1   . ILE D 4  30   ? 53.752  1.844   26.621  1.00 119.33 ? 30   ILE A CD1   1 
ATOM   1254  N  N     . SER D 4  31   ? 54.134  6.651   24.428  1.00 145.27 ? 31   SER A N     1 
ATOM   1255  C  CA    . SER D 4  31   ? 53.384  7.641   23.664  1.00 143.59 ? 31   SER A CA    1 
ATOM   1256  C  C     . SER D 4  31   ? 53.628  7.535   22.167  1.00 139.01 ? 31   SER A C     1 
ATOM   1257  O  O     . SER D 4  31   ? 54.678  7.080   21.712  1.00 136.72 ? 31   SER A O     1 
ATOM   1258  C  CB    . SER D 4  31   ? 53.757  9.045   24.120  1.00 148.33 ? 31   SER A CB    1 
ATOM   1259  O  OG    . SER D 4  31   ? 53.353  10.007  23.163  1.00 151.12 ? 31   SER A OG    1 
ATOM   1260  N  N     . VAL D 4  32   ? 52.633  7.972   21.400  1.00 132.75 ? 32   VAL A N     1 
ATOM   1261  C  CA    . VAL D 4  32   ? 52.765  8.122   19.955  1.00 124.13 ? 32   VAL A CA    1 
ATOM   1262  C  C     . VAL D 4  32   ? 52.813  9.577   19.529  1.00 126.09 ? 32   VAL A C     1 
ATOM   1263  O  O     . VAL D 4  32   ? 53.083  9.851   18.347  1.00 124.60 ? 32   VAL A O     1 
ATOM   1264  C  CB    . VAL D 4  32   ? 51.628  7.399   19.203  1.00 106.93 ? 32   VAL A CB    1 
ATOM   1265  C  CG1   . VAL D 4  32   ? 51.560  5.941   19.621  1.00 101.79 ? 32   VAL A CG1   1 
ATOM   1266  C  CG2   . VAL D 4  32   ? 50.304  8.098   19.463  1.00 97.85  ? 32   VAL A CG2   1 
ATOM   1267  N  N     . ALA D 4  33   ? 52.570  10.516  20.441  1.00 135.53 ? 33   ALA A N     1 
ATOM   1268  C  CA    . ALA D 4  33   ? 52.451  11.924  20.089  1.00 145.70 ? 33   ALA A CA    1 
ATOM   1269  C  C     . ALA D 4  33   ? 52.662  12.763  21.340  1.00 151.11 ? 33   ALA A C     1 
ATOM   1270  O  O     . ALA D 4  33   ? 52.749  12.242  22.454  1.00 159.28 ? 33   ALA A O     1 
ATOM   1271  C  CB    . ALA D 4  33   ? 51.091  12.220  19.462  1.00 146.91 ? 33   ALA A CB    1 
ATOM   1272  N  N     . LYS D 4  34   ? 52.735  14.078  21.141  1.00 147.71 ? 34   LYS A N     1 
ATOM   1273  C  CA    . LYS D 4  34   ? 52.934  15.021  22.230  1.00 141.66 ? 34   LYS A CA    1 
ATOM   1274  C  C     . LYS D 4  34   ? 51.837  16.076  22.257  1.00 140.33 ? 34   LYS A C     1 
ATOM   1275  O  O     . LYS D 4  34   ? 51.263  16.432  21.224  1.00 133.10 ? 34   LYS A O     1 
ATOM   1276  C  CB    . LYS D 4  34   ? 54.306  15.703  22.147  1.00 140.61 ? 34   LYS A CB    1 
ATOM   1277  C  CG    . LYS D 4  34   ? 55.466  14.731  22.054  1.00 138.57 ? 34   LYS A CG    1 
ATOM   1278  C  CD    . LYS D 4  34   ? 56.763  15.365  22.513  1.00 139.28 ? 34   LYS A CD    1 
ATOM   1279  C  CE    . LYS D 4  34   ? 57.957  14.526  22.094  1.00 141.21 ? 34   LYS A CE    1 
ATOM   1280  N  NZ    . LYS D 4  34   ? 58.903  14.315  23.225  1.00 141.72 ? 34   LYS A NZ    1 
ATOM   1281  N  N     . ILE D 4  35   ? 51.554  16.567  23.460  1.00 141.56 ? 35   ILE A N     1 
ATOM   1282  C  CA    . ILE D 4  35   ? 50.536  17.612  23.652  1.00 139.51 ? 35   ILE A CA    1 
ATOM   1283  C  C     . ILE D 4  35   ? 51.279  18.941  23.592  1.00 142.58 ? 35   ILE A C     1 
ATOM   1284  O  O     . ILE D 4  35   ? 51.626  19.556  24.603  1.00 133.97 ? 35   ILE A O     1 
ATOM   1285  C  CB    . ILE D 4  35   ? 49.751  17.424  24.953  1.00 132.67 ? 35   ILE A CB    1 
ATOM   1286  N  N     . ARG D 4  36   ? 51.533  19.397  22.365  1.00 157.80 ? 36   ARG A N     1 
ATOM   1287  C  CA    . ARG D 4  36   ? 52.215  20.671  22.166  1.00 168.13 ? 36   ARG A CA    1 
ATOM   1288  C  C     . ARG D 4  36   ? 51.286  21.860  22.392  1.00 166.88 ? 36   ARG A C     1 
ATOM   1289  O  O     . ARG D 4  36   ? 51.707  22.878  22.953  1.00 174.56 ? 36   ARG A O     1 
ATOM   1290  C  CB    . ARG D 4  36   ? 52.816  20.730  20.760  1.00 174.22 ? 36   ARG A CB    1 
ATOM   1291  C  CG    . ARG D 4  36   ? 54.223  20.165  20.627  1.00 175.47 ? 36   ARG A CG    1 
ATOM   1292  C  CD    . ARG D 4  36   ? 55.256  21.268  20.838  1.00 181.11 ? 36   ARG A CD    1 
ATOM   1293  N  NE    . ARG D 4  36   ? 56.526  20.778  21.368  1.00 184.94 ? 36   ARG A NE    1 
ATOM   1294  C  CZ    . ARG D 4  36   ? 56.753  20.506  22.649  1.00 185.63 ? 36   ARG A CZ    1 
ATOM   1295  N  NH1   . ARG D 4  36   ? 55.796  20.684  23.549  1.00 184.86 ? 36   ARG A NH1   1 
ATOM   1296  N  NH2   . ARG D 4  36   ? 57.944  20.064  23.031  1.00 186.13 ? 36   ARG A NH2   1 
ATOM   1297  N  N     . PHE D 4  37   ? 50.028  21.760  21.967  1.00 157.07 ? 37   PHE A N     1 
ATOM   1298  C  CA    . PHE D 4  37   ? 49.131  22.902  22.053  1.00 146.84 ? 37   PHE A CA    1 
ATOM   1299  C  C     . PHE D 4  37   ? 47.835  22.524  22.755  1.00 140.96 ? 37   PHE A C     1 
ATOM   1300  O  O     . PHE D 4  37   ? 47.336  21.407  22.588  1.00 135.84 ? 37   PHE A O     1 
ATOM   1301  C  CB    . PHE D 4  37   ? 48.806  23.468  20.659  1.00 150.52 ? 37   PHE A CB    1 
ATOM   1302  C  CG    . PHE D 4  37   ? 49.998  24.024  19.935  1.00 151.25 ? 37   PHE A CG    1 
ATOM   1303  C  CD1   . PHE D 4  37   ? 50.841  23.199  19.210  1.00 149.23 ? 37   PHE A CD1   1 
ATOM   1304  C  CD2   . PHE D 4  37   ? 50.285  25.377  19.997  1.00 152.91 ? 37   PHE A CD2   1 
ATOM   1305  C  CE1   . PHE D 4  37   ? 51.942  23.711  18.552  1.00 151.06 ? 37   PHE A CE1   1 
ATOM   1306  C  CE2   . PHE D 4  37   ? 51.383  25.897  19.342  1.00 155.35 ? 37   PHE A CE2   1 
ATOM   1307  C  CZ    . PHE D 4  37   ? 52.213  25.063  18.618  1.00 156.69 ? 37   PHE A CZ    1 
ATOM   1308  N  N     . PRO D 4  38   ? 47.266  23.434  23.550  1.00 137.11 ? 38   PRO A N     1 
ATOM   1309  C  CA    . PRO D 4  38   ? 45.981  23.158  24.200  1.00 136.46 ? 38   PRO A CA    1 
ATOM   1310  C  C     . PRO D 4  38   ? 44.779  23.406  23.307  1.00 129.12 ? 38   PRO A C     1 
ATOM   1311  O  O     . PRO D 4  38   ? 43.643  23.305  23.786  1.00 117.49 ? 38   PRO A O     1 
ATOM   1312  C  CB    . PRO D 4  38   ? 45.996  24.140  25.374  1.00 138.40 ? 38   PRO A CB    1 
ATOM   1313  C  CG    . PRO D 4  38   ? 46.678  25.327  24.778  1.00 135.19 ? 38   PRO A CG    1 
ATOM   1314  C  CD    . PRO D 4  38   ? 47.823  24.724  23.998  1.00 134.96 ? 38   PRO A CD    1 
ATOM   1315  N  N     . GLU D 4  39   ? 45.002  23.729  22.037  1.00 141.83 ? 39   GLU A N     1 
ATOM   1316  C  CA    . GLU D 4  39   ? 43.914  24.122  21.155  1.00 155.58 ? 39   GLU A CA    1 
ATOM   1317  C  C     . GLU D 4  39   ? 43.056  22.912  20.807  1.00 171.13 ? 39   GLU A C     1 
ATOM   1318  O  O     . GLU D 4  39   ? 43.571  21.830  20.511  1.00 165.38 ? 39   GLU A O     1 
ATOM   1319  C  CB    . GLU D 4  39   ? 44.478  24.771  19.890  1.00 151.61 ? 39   GLU A CB    1 
ATOM   1320  C  CG    . GLU D 4  39   ? 45.494  25.907  20.137  1.00 145.24 ? 39   GLU A CG    1 
ATOM   1321  C  CD    . GLU D 4  39   ? 44.906  27.170  20.770  1.00 138.19 ? 39   GLU A CD    1 
ATOM   1322  O  OE1   . GLU D 4  39   ? 44.493  27.147  21.952  1.00 136.09 ? 39   GLU A OE1   1 
ATOM   1323  O  OE2   . GLU D 4  39   ? 44.870  28.206  20.075  1.00 134.31 ? 39   GLU A OE2   1 
ATOM   1324  N  N     . THR D 4  40   ? 41.734  23.117  20.844  1.00 186.13 ? 40   THR A N     1 
ATOM   1325  C  CA    . THR D 4  40   ? 40.774  22.015  20.815  1.00 185.14 ? 40   THR A CA    1 
ATOM   1326  C  C     . THR D 4  40   ? 40.834  21.246  19.501  1.00 171.69 ? 40   THR A C     1 
ATOM   1327  O  O     . THR D 4  40   ? 41.181  20.058  19.475  1.00 170.28 ? 40   THR A O     1 
ATOM   1328  C  CB    . THR D 4  40   ? 39.361  22.554  21.047  1.00 194.77 ? 40   THR A CB    1 
ATOM   1329  O  OG1   . THR D 4  40   ? 39.348  23.388  22.213  1.00 196.98 ? 40   THR A OG1   1 
ATOM   1330  C  CG2   . THR D 4  40   ? 38.381  21.406  21.236  1.00 194.15 ? 40   THR A CG2   1 
ATOM   1331  N  N     . MET D 4  41   ? 40.478  21.904  18.399  1.00 165.28 ? 41   MET A N     1 
ATOM   1332  C  CA    . MET D 4  41   ? 40.576  21.287  17.085  1.00 152.65 ? 41   MET A CA    1 
ATOM   1333  C  C     . MET D 4  41   ? 41.840  21.766  16.386  1.00 164.22 ? 41   MET A C     1 
ATOM   1334  O  O     . MET D 4  41   ? 42.864  22.020  17.030  1.00 161.85 ? 41   MET A O     1 
ATOM   1335  C  CB    . MET D 4  41   ? 39.336  21.611  16.245  1.00 134.36 ? 41   MET A CB    1 
ATOM   1336  N  N     . ASP D 4  42   ? 41.771  21.897  15.067  1.00 176.31 ? 42   ASP A N     1 
ATOM   1337  C  CA    . ASP D 4  42   ? 42.840  22.551  14.340  1.00 192.19 ? 42   ASP A CA    1 
ATOM   1338  C  C     . ASP D 4  42   ? 42.728  24.064  14.485  1.00 198.46 ? 42   ASP A C     1 
ATOM   1339  O  O     . ASP D 4  42   ? 41.672  24.610  14.815  1.00 194.94 ? 42   ASP A O     1 
ATOM   1340  C  CB    . ASP D 4  42   ? 42.809  22.153  12.867  1.00 199.52 ? 42   ASP A CB    1 
ATOM   1341  C  CG    . ASP D 4  42   ? 41.410  21.990  12.349  1.00 204.43 ? 42   ASP A CG    1 
ATOM   1342  O  OD1   . ASP D 4  42   ? 40.470  22.236  13.129  1.00 206.44 ? 42   ASP A OD1   1 
ATOM   1343  O  OD2   . ASP D 4  42   ? 41.244  21.656  11.158  1.00 206.41 ? 42   ASP A OD2   1 
ATOM   1344  N  N     . GLU D 4  43   ? 43.844  24.744  14.232  1.00 207.64 ? 43   GLU A N     1 
ATOM   1345  C  CA    . GLU D 4  43   ? 43.866  26.191  14.361  1.00 212.52 ? 43   GLU A CA    1 
ATOM   1346  C  C     . GLU D 4  43   ? 43.121  26.852  13.199  1.00 213.31 ? 43   GLU A C     1 
ATOM   1347  O  O     . GLU D 4  43   ? 42.717  26.203  12.228  1.00 213.18 ? 43   GLU A O     1 
ATOM   1348  C  CB    . GLU D 4  43   ? 45.303  26.711  14.436  1.00 212.80 ? 43   GLU A CB    1 
ATOM   1349  C  CG    . GLU D 4  43   ? 46.073  26.284  15.680  1.00 205.63 ? 43   GLU A CG    1 
ATOM   1350  C  CD    . GLU D 4  43   ? 47.196  25.313  15.376  1.00 198.22 ? 43   GLU A CD    1 
ATOM   1351  O  OE1   . GLU D 4  43   ? 47.581  25.195  14.195  1.00 197.00 ? 43   GLU A OE1   1 
ATOM   1352  O  OE2   . GLU D 4  43   ? 47.712  24.687  16.326  1.00 193.33 ? 43   GLU A OE2   1 
ATOM   1353  N  N     . THR D 4  44   ? 42.954  28.178  13.325  1.00 208.80 ? 44   THR A N     1 
ATOM   1354  C  CA    . THR D 4  44   ? 42.222  29.026  12.374  1.00 205.70 ? 44   THR A CA    1 
ATOM   1355  C  C     . THR D 4  44   ? 40.791  28.538  12.150  1.00 200.94 ? 44   THR A C     1 
ATOM   1356  O  O     . THR D 4  44   ? 40.257  28.627  11.042  1.00 205.07 ? 44   THR A O     1 
ATOM   1357  C  CB    . THR D 4  44   ? 42.961  29.166  11.038  1.00 204.26 ? 44   THR A CB    1 
ATOM   1358  O  OG1   . THR D 4  44   ? 42.743  27.994  10.240  1.00 204.69 ? 44   THR A OG1   1 
ATOM   1359  C  CG2   . THR D 4  44   ? 44.456  29.390  11.252  1.00 201.23 ? 44   THR A CG2   1 
ATOM   1360  N  N     . GLN D 4  45   ? 40.174  28.015  13.215  1.00 194.79 ? 45   GLN A N     1 
ATOM   1361  C  CA    . GLN D 4  45   ? 38.763  27.618  13.272  1.00 186.89 ? 45   GLN A CA    1 
ATOM   1362  C  C     . GLN D 4  45   ? 38.372  26.597  12.207  1.00 185.05 ? 45   GLN A C     1 
ATOM   1363  O  O     . GLN D 4  45   ? 37.191  26.484  11.860  1.00 183.45 ? 45   GLN A O     1 
ATOM   1364  C  CB    . GLN D 4  45   ? 37.835  28.838  13.180  1.00 182.22 ? 45   GLN A CB    1 
ATOM   1365  C  CG    . GLN D 4  45   ? 38.237  30.010  14.053  1.00 168.81 ? 45   GLN A CG    1 
ATOM   1366  C  CD    . GLN D 4  45   ? 37.312  31.198  13.880  1.00 157.09 ? 45   GLN A CD    1 
ATOM   1367  O  OE1   . GLN D 4  45   ? 37.519  32.037  13.004  1.00 162.31 ? 45   GLN A OE1   1 
ATOM   1368  N  NE2   . GLN D 4  45   ? 36.280  31.271  14.713  1.00 143.33 ? 45   GLN A NE2   1 
ATOM   1369  N  N     . THR D 4  46   ? 39.328  25.835  11.683  1.00 183.56 ? 46   THR A N     1 
ATOM   1370  C  CA    . THR D 4  46   ? 39.034  24.839  10.666  1.00 178.44 ? 46   THR A CA    1 
ATOM   1371  C  C     . THR D 4  46   ? 38.387  23.605  11.306  1.00 172.45 ? 46   THR A C     1 
ATOM   1372  O  O     . THR D 4  46   ? 38.081  23.581  12.502  1.00 169.82 ? 46   THR A O     1 
ATOM   1373  C  CB    . THR D 4  46   ? 40.302  24.508  9.884   1.00 175.42 ? 46   THR A CB    1 
ATOM   1374  O  OG1   . THR D 4  46   ? 41.431  24.545  10.765  1.00 170.97 ? 46   THR A OG1   1 
ATOM   1375  C  CG2   . THR D 4  46   ? 40.517  25.518  8.767   1.00 175.35 ? 46   THR A CG2   1 
ATOM   1376  N  N     . ARG D 4  47   ? 38.144  22.571  10.505  1.00 169.74 ? 47   ARG A N     1 
ATOM   1377  C  CA    . ARG D 4  47   ? 37.321  21.434  10.927  1.00 158.10 ? 47   ARG A CA    1 
ATOM   1378  C  C     . ARG D 4  47   ? 38.121  20.136  10.816  1.00 152.38 ? 47   ARG A C     1 
ATOM   1379  O  O     . ARG D 4  47   ? 37.845  19.292  9.957   1.00 150.21 ? 47   ARG A O     1 
ATOM   1380  C  CB    . ARG D 4  47   ? 36.019  21.370  10.104  1.00 155.14 ? 47   ARG A CB    1 
ATOM   1381  C  CG    . ARG D 4  47   ? 35.585  22.705  9.517   1.00 156.70 ? 47   ARG A CG    1 
ATOM   1382  C  CD    . ARG D 4  47   ? 34.074  22.856  9.523   1.00 156.75 ? 47   ARG A CD    1 
ATOM   1383  N  NE    . ARG D 4  47   ? 33.678  24.261  9.467   1.00 160.13 ? 47   ARG A NE    1 
ATOM   1384  C  CZ    . ARG D 4  47   ? 32.421  24.689  9.520   1.00 157.56 ? 47   ARG A CZ    1 
ATOM   1385  N  NH1   . ARG D 4  47   ? 31.425  23.822  9.637   1.00 152.65 ? 47   ARG A NH1   1 
ATOM   1386  N  NH2   . ARG D 4  47   ? 32.160  25.988  9.460   1.00 157.40 ? 47   ARG A NH2   1 
ATOM   1387  N  N     . ALA D 4  48   ? 39.105  19.979  11.703  1.00 148.64 ? 48   ALA A N     1 
ATOM   1388  C  CA    . ALA D 4  48   ? 39.819  18.725  11.922  1.00 137.98 ? 48   ALA A CA    1 
ATOM   1389  C  C     . ALA D 4  48   ? 40.469  18.778  13.298  1.00 128.10 ? 48   ALA A C     1 
ATOM   1390  O  O     . ALA D 4  48   ? 39.793  19.091  14.284  1.00 123.10 ? 48   ALA A O     1 
ATOM   1391  C  CB    . ALA D 4  48   ? 40.866  18.467  10.834  1.00 135.84 ? 48   ALA A CB    1 
ATOM   1392  N  N     . LYS D 4  49   ? 41.768  18.487  13.379  1.00 123.60 ? 49   LYS A N     1 
ATOM   1393  C  CA    . LYS D 4  49   ? 42.503  18.631  14.632  1.00 122.54 ? 49   LYS A CA    1 
ATOM   1394  C  C     . LYS D 4  49   ? 43.997  18.657  14.334  1.00 134.32 ? 49   LYS A C     1 
ATOM   1395  O  O     . LYS D 4  49   ? 44.500  17.800  13.604  1.00 143.41 ? 49   LYS A O     1 
ATOM   1396  C  CB    . LYS D 4  49   ? 42.171  17.499  15.615  1.00 116.43 ? 49   LYS A CB    1 
ATOM   1397  N  N     . ILE D 4  50   ? 44.693  19.638  14.905  1.00 138.24 ? 50   ILE A N     1 
ATOM   1398  C  CA    . ILE D 4  50   ? 46.141  19.726  14.757  1.00 146.16 ? 50   ILE A CA    1 
ATOM   1399  C  C     . ILE D 4  50   ? 46.861  18.719  15.653  1.00 146.60 ? 50   ILE A C     1 
ATOM   1400  O  O     . ILE D 4  50   ? 46.292  18.144  16.590  1.00 145.18 ? 50   ILE A O     1 
ATOM   1401  C  CB    . ILE D 4  50   ? 46.633  21.182  14.970  1.00 159.89 ? 50   ILE A CB    1 
ATOM   1402  C  CG1   . ILE D 4  50   ? 46.106  21.878  16.264  1.00 165.60 ? 50   ILE A CG1   1 
ATOM   1403  C  CG2   . ILE D 4  50   ? 46.410  22.030  13.721  1.00 164.85 ? 50   ILE A CG2   1 
ATOM   1404  C  CD1   . ILE D 4  50   ? 46.328  21.286  17.648  1.00 164.90 ? 50   ILE A CD1   1 
ATOM   1405  N  N     . GLY D 4  51   ? 48.144  18.531  15.366  1.00 144.42 ? 51   GLY A N     1 
ATOM   1406  C  CA    . GLY D 4  51   ? 49.034  17.667  16.106  1.00 146.26 ? 51   GLY A CA    1 
ATOM   1407  C  C     . GLY D 4  51   ? 49.452  18.169  17.461  1.00 148.28 ? 51   GLY A C     1 
ATOM   1408  O  O     . GLY D 4  51   ? 50.144  17.456  18.193  1.00 150.12 ? 51   GLY A O     1 
ATOM   1409  N  N     . GLY D 4  52   ? 49.050  19.389  17.824  1.00 155.76 ? 52   GLY A N     1 
ATOM   1410  C  CA    . GLY D 4  52   ? 49.418  19.928  19.120  1.00 165.07 ? 52   GLY A CA    1 
ATOM   1411  C  C     . GLY D 4  52   ? 48.585  19.398  20.268  1.00 166.75 ? 52   GLY A C     1 
ATOM   1412  O  O     . GLY D 4  52   ? 49.035  19.414  21.417  1.00 174.62 ? 52   GLY A O     1 
ATOM   1413  N  N     . LEU D 4  53   ? 47.364  18.936  19.991  1.00 151.65 ? 53   LEU A N     1 
ATOM   1414  C  CA    . LEU D 4  53   ? 46.588  18.269  21.029  1.00 135.87 ? 53   LEU A CA    1 
ATOM   1415  C  C     . LEU D 4  53   ? 46.156  16.888  20.546  1.00 136.38 ? 53   LEU A C     1 
ATOM   1416  O  O     . LEU D 4  53   ? 46.992  15.991  20.392  1.00 154.67 ? 53   LEU A O     1 
ATOM   1417  C  CB    . LEU D 4  53   ? 45.365  19.096  21.442  1.00 117.03 ? 53   LEU A CB    1 
ATOM   1418  C  CG    . LEU D 4  53   ? 44.928  19.046  22.925  1.00 100.80 ? 53   LEU A CG    1 
ATOM   1419  C  CD1   . LEU D 4  53   ? 43.778  20.007  23.198  1.00 105.92 ? 53   LEU A CD1   1 
ATOM   1420  C  CD2   . LEU D 4  53   ? 44.592  17.659  23.482  1.00 89.43  ? 53   LEU A CD2   1 
ATOM   1421  N  N     . ASN D 4  54   ? 44.859  16.707  20.298  1.00 122.96 ? 54   ASN A N     1 
ATOM   1422  C  CA    . ASN D 4  54   ? 44.263  15.378  20.149  1.00 108.62 ? 54   ASN A CA    1 
ATOM   1423  C  C     . ASN D 4  54   ? 43.969  15.073  18.679  1.00 112.06 ? 54   ASN A C     1 
ATOM   1424  O  O     . ASN D 4  54   ? 42.910  15.430  18.155  1.00 110.64 ? 54   ASN A O     1 
ATOM   1425  C  CB    . ASN D 4  54   ? 43.023  15.253  21.039  1.00 103.97 ? 54   ASN A CB    1 
ATOM   1426  C  CG    . ASN D 4  54   ? 42.008  16.363  20.817  1.00 106.48 ? 54   ASN A CG    1 
ATOM   1427  O  OD1   . ASN D 4  54   ? 41.914  17.300  21.608  1.00 111.23 ? 54   ASN A OD1   1 
ATOM   1428  N  ND2   . ASN D 4  54   ? 41.229  16.248  19.748  1.00 103.98 ? 54   ASN A ND2   1 
ATOM   1429  N  N     . ASP D 4  55   ? 44.912  14.383  18.028  1.00 108.83 ? 55   ASP A N     1 
ATOM   1430  C  CA    . ASP D 4  55   ? 44.796  13.906  16.650  1.00 119.52 ? 55   ASP A CA    1 
ATOM   1431  C  C     . ASP D 4  55   ? 45.884  12.905  16.248  1.00 128.09 ? 55   ASP A C     1 
ATOM   1432  O  O     . ASP D 4  55   ? 45.530  11.793  15.833  1.00 114.43 ? 55   ASP A O     1 
ATOM   1433  C  CB    . ASP D 4  55   ? 44.791  15.069  15.650  1.00 115.18 ? 55   ASP A CB    1 
ATOM   1434  N  N     . PRO D 4  56   ? 47.229  13.236  16.327  1.00 140.67 ? 56   PRO A N     1 
ATOM   1435  C  CA    . PRO D 4  56   ? 48.211  12.405  15.606  1.00 147.20 ? 56   PRO A CA    1 
ATOM   1436  C  C     . PRO D 4  56   ? 48.357  11.005  16.177  1.00 145.19 ? 56   PRO A C     1 
ATOM   1437  O  O     . PRO D 4  56   ? 48.894  10.825  17.275  1.00 154.31 ? 56   PRO A O     1 
ATOM   1438  C  CB    . PRO D 4  56   ? 49.521  13.191  15.743  1.00 140.78 ? 56   PRO A CB    1 
ATOM   1439  C  CG    . PRO D 4  56   ? 49.343  14.039  16.907  1.00 133.19 ? 56   PRO A CG    1 
ATOM   1440  C  CD    . PRO D 4  56   ? 47.903  14.339  17.045  1.00 135.62 ? 56   PRO A CD    1 
ATOM   1441  N  N     . ARG D 4  57   ? 47.858  10.019  15.420  1.00 132.59 ? 57   ARG A N     1 
ATOM   1442  C  CA    . ARG D 4  57   ? 47.834  8.606   15.809  1.00 114.84 ? 57   ARG A CA    1 
ATOM   1443  C  C     . ARG D 4  57   ? 47.100  8.391   17.127  1.00 120.32 ? 57   ARG A C     1 
ATOM   1444  O  O     . ARG D 4  57   ? 47.435  7.487   17.890  1.00 127.52 ? 57   ARG A O     1 
ATOM   1445  C  CB    . ARG D 4  57   ? 49.247  8.019   15.885  1.00 95.08  ? 57   ARG A CB    1 
ATOM   1446  N  N     . LEU D 4  58   ? 46.089  9.216   17.396  1.00 121.78 ? 58   LEU A N     1 
ATOM   1447  C  CA    . LEU D 4  58   ? 45.401  9.216   18.677  1.00 127.43 ? 58   LEU A CA    1 
ATOM   1448  C  C     . LEU D 4  58   ? 43.979  8.679   18.605  1.00 135.43 ? 58   LEU A C     1 
ATOM   1449  O  O     . LEU D 4  58   ? 43.395  8.383   19.654  1.00 133.97 ? 58   LEU A O     1 
ATOM   1450  C  CB    . LEU D 4  58   ? 45.381  10.641  19.253  1.00 122.33 ? 58   LEU A CB    1 
ATOM   1451  C  CG    . LEU D 4  58   ? 46.105  10.863  20.581  1.00 104.67 ? 58   LEU A CG    1 
ATOM   1452  C  CD1   . LEU D 4  58   ? 45.942  12.284  21.059  1.00 93.38  ? 58   LEU A CD1   1 
ATOM   1453  C  CD2   . LEU D 4  58   ? 45.566  9.923   21.615  1.00 101.69 ? 58   LEU A CD2   1 
ATOM   1454  N  N     . GLY D 4  59   ? 43.416  8.532   17.408  1.00 138.42 ? 59   GLY A N     1 
ATOM   1455  C  CA    . GLY D 4  59   ? 42.033  8.130   17.264  1.00 127.78 ? 59   GLY A CA    1 
ATOM   1456  C  C     . GLY D 4  59   ? 41.233  9.192   16.544  1.00 123.23 ? 59   GLY A C     1 
ATOM   1457  O  O     . GLY D 4  59   ? 41.500  10.385  16.708  1.00 126.51 ? 59   GLY A O     1 
ATOM   1458  N  N     . SER D 4  60   ? 40.266  8.774   15.739  1.00 115.21 ? 60   SER A N     1 
ATOM   1459  C  CA    . SER D 4  60   ? 39.483  9.684   14.919  1.00 105.25 ? 60   SER A CA    1 
ATOM   1460  C  C     . SER D 4  60   ? 38.189  10.064  15.627  1.00 106.81 ? 60   SER A C     1 
ATOM   1461  O  O     . SER D 4  60   ? 37.737  9.386   16.552  1.00 105.96 ? 60   SER A O     1 
ATOM   1462  C  CB    . SER D 4  60   ? 39.168  9.051   13.565  1.00 99.09  ? 60   SER A CB    1 
ATOM   1463  O  OG    . SER D 4  60   ? 40.358  8.766   12.856  1.00 98.24  ? 60   SER A OG    1 
ATOM   1464  N  N     . ILE D 4  61   ? 37.595  11.175  15.180  1.00 116.61 ? 61   ILE A N     1 
ATOM   1465  C  CA    . ILE D 4  61   ? 36.373  11.704  15.770  1.00 125.49 ? 61   ILE A CA    1 
ATOM   1466  C  C     . ILE D 4  61   ? 35.239  11.783  14.755  1.00 147.11 ? 61   ILE A C     1 
ATOM   1467  O  O     . ILE D 4  61   ? 34.075  11.532  15.095  1.00 145.12 ? 61   ILE A O     1 
ATOM   1468  C  CB    . ILE D 4  61   ? 36.607  13.087  16.430  1.00 108.90 ? 61   ILE A CB    1 
ATOM   1469  C  CG1   . ILE D 4  61   ? 37.929  13.108  17.209  1.00 100.59 ? 61   ILE A CG1   1 
ATOM   1470  C  CG2   . ILE D 4  61   ? 35.466  13.444  17.363  1.00 105.11 ? 61   ILE A CG2   1 
ATOM   1471  C  CD1   . ILE D 4  61   ? 39.051  13.868  16.517  1.00 95.77  ? 61   ILE A CD1   1 
ATOM   1472  N  N     . ASP D 4  62   ? 35.546  12.103  13.496  1.00 162.98 ? 62   ASP A N     1 
ATOM   1473  C  CA    . ASP D 4  62   ? 34.521  12.217  12.455  1.00 173.91 ? 62   ASP A CA    1 
ATOM   1474  C  C     . ASP D 4  62   ? 34.236  10.869  11.790  1.00 166.58 ? 62   ASP A C     1 
ATOM   1475  O  O     . ASP D 4  62   ? 33.945  10.798  10.593  1.00 174.64 ? 62   ASP A O     1 
ATOM   1476  C  CB    . ASP D 4  62   ? 34.949  13.273  11.436  1.00 185.19 ? 62   ASP A CB    1 
ATOM   1477  C  CG    . ASP D 4  62   ? 33.802  13.744  10.539  1.00 188.46 ? 62   ASP A CG    1 
ATOM   1478  O  OD1   . ASP D 4  62   ? 33.786  13.364  9.350   1.00 188.62 ? 62   ASP A OD1   1 
ATOM   1479  O  OD2   . ASP D 4  62   ? 32.921  14.479  11.028  1.00 188.14 ? 62   ASP A OD2   1 
ATOM   1480  N  N     . ARG D 4  63   ? 34.314  9.787   12.575  1.00 153.10 ? 63   ARG A N     1 
ATOM   1481  C  CA    . ARG D 4  63   ? 34.022  8.414   12.142  1.00 141.69 ? 63   ARG A CA    1 
ATOM   1482  C  C     . ARG D 4  63   ? 34.841  8.019   10.916  1.00 145.51 ? 63   ARG A C     1 
ATOM   1483  O  O     . ARG D 4  63   ? 34.326  7.483   9.933   1.00 143.15 ? 63   ARG A O     1 
ATOM   1484  C  CB    . ARG D 4  63   ? 32.527  8.220   11.892  1.00 133.52 ? 63   ARG A CB    1 
ATOM   1485  C  CG    . ARG D 4  63   ? 31.702  8.190   13.161  1.00 129.08 ? 63   ARG A CG    1 
ATOM   1486  C  CD    . ARG D 4  63   ? 30.424  8.980   12.996  1.00 135.04 ? 63   ARG A CD    1 
ATOM   1487  N  NE    . ARG D 4  63   ? 29.320  8.114   12.601  1.00 140.89 ? 63   ARG A NE    1 
ATOM   1488  C  CZ    . ARG D 4  63   ? 28.042  8.372   12.851  1.00 142.96 ? 63   ARG A CZ    1 
ATOM   1489  N  NH1   . ARG D 4  63   ? 27.704  9.477   13.499  1.00 139.99 ? 63   ARG A NH1   1 
ATOM   1490  N  NH2   . ARG D 4  63   ? 27.103  7.524   12.455  1.00 144.37 ? 63   ARG A NH2   1 
ATOM   1491  N  N     . ASN D 4  64   ? 36.133  8.305   10.979  1.00 142.51 ? 64   ASN A N     1 
ATOM   1492  C  CA    . ASN D 4  64   ? 37.053  8.012   9.897   1.00 146.98 ? 64   ASN A CA    1 
ATOM   1493  C  C     . ASN D 4  64   ? 38.079  6.994   10.376  1.00 157.05 ? 64   ASN A C     1 
ATOM   1494  O  O     . ASN D 4  64   ? 38.193  6.707   11.569  1.00 165.02 ? 64   ASN A O     1 
ATOM   1495  C  CB    . ASN D 4  64   ? 37.731  9.295   9.404   1.00 134.60 ? 64   ASN A CB    1 
ATOM   1496  C  CG    . ASN D 4  64   ? 36.732  10.308  8.887   1.00 130.80 ? 64   ASN A CG    1 
ATOM   1497  O  OD1   . ASN D 4  64   ? 36.825  11.499  9.186   1.00 132.03 ? 64   ASN A OD1   1 
ATOM   1498  N  ND2   . ASN D 4  64   ? 35.759  9.838   8.114   1.00 121.04 ? 64   ASN A ND2   1 
ATOM   1499  N  N     . LEU D 4  65   ? 38.821  6.430   9.426   1.00 159.49 ? 65   LEU A N     1 
ATOM   1500  C  CA    . LEU D 4  65   ? 39.832  5.429   9.734   1.00 154.42 ? 65   LEU A CA    1 
ATOM   1501  C  C     . LEU D 4  65   ? 41.204  6.044   9.981   1.00 163.50 ? 65   LEU A C     1 
ATOM   1502  O  O     . LEU D 4  65   ? 42.212  5.328   9.933   1.00 165.01 ? 65   LEU A O     1 
ATOM   1503  C  CB    . LEU D 4  65   ? 39.914  4.386   8.613   1.00 145.09 ? 65   LEU A CB    1 
ATOM   1504  C  CG    . LEU D 4  65   ? 38.906  3.226   8.553   1.00 129.46 ? 65   LEU A CG    1 
ATOM   1505  C  CD1   . LEU D 4  65   ? 37.470  3.670   8.275   1.00 125.29 ? 65   LEU A CD1   1 
ATOM   1506  C  CD2   . LEU D 4  65   ? 39.349  2.191   7.526   1.00 122.47 ? 65   LEU A CD2   1 
ATOM   1507  N  N     . LYS D 4  66   ? 41.261  7.347   10.254  1.00 170.97 ? 66   LYS A N     1 
ATOM   1508  C  CA    . LYS D 4  66   ? 42.534  8.038   10.415  1.00 172.33 ? 66   LYS A CA    1 
ATOM   1509  C  C     . LYS D 4  66   ? 43.203  7.630   11.721  1.00 158.74 ? 66   LYS A C     1 
ATOM   1510  O  O     . LYS D 4  66   ? 42.586  7.677   12.790  1.00 155.01 ? 66   LYS A O     1 
ATOM   1511  C  CB    . LYS D 4  66   ? 42.325  9.552   10.385  1.00 175.32 ? 66   LYS A CB    1 
ATOM   1512  C  CG    . LYS D 4  66   ? 42.307  10.169  8.996   1.00 172.55 ? 66   LYS A CG    1 
ATOM   1513  C  CD    . LYS D 4  66   ? 43.462  9.679   8.141   1.00 166.44 ? 66   LYS A CD    1 
ATOM   1514  C  CE    . LYS D 4  66   ? 43.093  9.707   6.668   1.00 158.30 ? 66   LYS A CE    1 
ATOM   1515  N  NZ    . LYS D 4  66   ? 42.629  8.379   6.178   1.00 150.20 ? 66   LYS A NZ    1 
ATOM   1516  N  N     . CYS D 4  67   ? 44.474  7.239   11.625  1.00 148.59 ? 67   CYS A N     1 
ATOM   1517  C  CA    . CYS D 4  67   ? 45.283  6.832   12.767  1.00 143.08 ? 67   CYS A CA    1 
ATOM   1518  C  C     . CYS D 4  67   ? 46.758  6.840   12.391  1.00 145.45 ? 67   CYS A C     1 
ATOM   1519  O  O     . CYS D 4  67   ? 47.253  7.789   11.775  1.00 129.33 ? 67   CYS A O     1 
ATOM   1520  C  CB    . CYS D 4  67   ? 44.883  5.435   13.255  1.00 147.16 ? 67   CYS A CB    1 
ATOM   1521  S  SG    . CYS D 4  67   ? 43.764  5.378   14.677  1.00 158.52 ? 67   CYS A SG    1 
ATOM   1522  N  N     . GLN D 4  68   ? 47.459  5.774   12.768  1.00 170.23 ? 68   GLN A N     1 
ATOM   1523  C  CA    . GLN D 4  68   ? 48.838  5.518   12.375  1.00 200.31 ? 68   GLN A CA    1 
ATOM   1524  C  C     . GLN D 4  68   ? 48.951  4.380   11.365  1.00 233.38 ? 68   GLN A C     1 
ATOM   1525  O  O     . GLN D 4  68   ? 49.973  3.694   11.320  1.00 244.59 ? 68   GLN A O     1 
ATOM   1526  C  CB    . GLN D 4  68   ? 49.688  5.275   13.625  1.00 189.66 ? 68   GLN A CB    1 
ATOM   1527  C  CG    . GLN D 4  68   ? 49.126  4.284   14.671  1.00 182.21 ? 68   GLN A CG    1 
ATOM   1528  C  CD    . GLN D 4  68   ? 48.717  2.910   14.167  1.00 182.34 ? 68   GLN A CD    1 
ATOM   1529  O  OE1   . GLN D 4  68   ? 49.489  2.206   13.523  1.00 192.59 ? 68   GLN A OE1   1 
ATOM   1530  N  NE2   . GLN D 4  68   ? 47.485  2.526   14.464  1.00 174.66 ? 68   GLN A NE2   1 
ATOM   1531  N  N     . THR D 4  69   ? 47.935  4.258   10.503  1.00 252.30 ? 69   THR A N     1 
ATOM   1532  C  CA    . THR D 4  69   ? 47.546  3.090   9.711   1.00 253.58 ? 69   THR A CA    1 
ATOM   1533  C  C     . THR D 4  69   ? 47.086  1.988   10.659  1.00 244.36 ? 69   THR A C     1 
ATOM   1534  O  O     . THR D 4  69   ? 47.644  0.886   10.668  1.00 256.35 ? 69   THR A O     1 
ATOM   1535  C  CB    . THR D 4  69   ? 48.662  2.587   8.779   1.00 262.14 ? 69   THR A CB    1 
ATOM   1536  O  OG1   . THR D 4  69   ? 49.374  3.707   8.239   1.00 266.41 ? 69   THR A OG1   1 
ATOM   1537  C  CG2   . THR D 4  69   ? 48.080  1.773   7.619   1.00 264.25 ? 69   THR A CG2   1 
ATOM   1538  N  N     . CYS D 4  70   ? 46.078  2.292   11.481  1.00 206.86 ? 70   CYS A N     1 
ATOM   1539  C  CA    . CYS D 4  70   ? 45.328  1.226   12.133  1.00 168.93 ? 70   CYS A CA    1 
ATOM   1540  C  C     . CYS D 4  70   ? 44.538  0.424   11.117  1.00 172.74 ? 70   CYS A C     1 
ATOM   1541  O  O     . CYS D 4  70   ? 44.394  -0.794  11.266  1.00 157.44 ? 70   CYS A O     1 
ATOM   1542  C  CB    . CYS D 4  70   ? 44.373  1.795   13.183  1.00 142.08 ? 70   CYS A CB    1 
ATOM   1543  S  SG    . CYS D 4  70   ? 44.950  1.725   14.880  1.00 121.86 ? 70   CYS A SG    1 
ATOM   1544  N  N     . GLN D 4  71   ? 44.007  1.105   10.092  1.00 196.46 ? 71   GLN A N     1 
ATOM   1545  C  CA    . GLN D 4  71   ? 43.013  0.587   9.147   1.00 211.01 ? 71   GLN A CA    1 
ATOM   1546  C  C     . GLN D 4  71   ? 41.735  0.155   9.887   1.00 211.12 ? 71   GLN A C     1 
ATOM   1547  O  O     . GLN D 4  71   ? 40.930  -0.640  9.388   1.00 228.24 ? 71   GLN A O     1 
ATOM   1548  C  CB    . GLN D 4  71   ? 43.629  -0.533  8.280   1.00 217.87 ? 71   GLN A CB    1 
ATOM   1549  C  CG    . GLN D 4  71   ? 42.853  -1.056  7.072   1.00 216.21 ? 71   GLN A CG    1 
ATOM   1550  C  CD    . GLN D 4  71   ? 42.548  -2.528  7.217   1.00 210.39 ? 71   GLN A CD    1 
ATOM   1551  O  OE1   . GLN D 4  71   ? 43.175  -3.221  8.016   1.00 206.48 ? 71   GLN A OE1   1 
ATOM   1552  N  NE2   . GLN D 4  71   ? 41.578  -3.015  6.452   1.00 208.54 ? 71   GLN A NE2   1 
ATOM   1553  N  N     . GLU D 4  72   ? 41.516  0.701   11.082  1.00 174.05 ? 72   GLU A N     1 
ATOM   1554  C  CA    . GLU D 4  72   ? 40.399  0.333   11.937  1.00 136.23 ? 72   GLU A CA    1 
ATOM   1555  C  C     . GLU D 4  72   ? 39.680  1.590   12.393  1.00 115.21 ? 72   GLU A C     1 
ATOM   1556  O  O     . GLU D 4  72   ? 40.311  2.615   12.668  1.00 103.67 ? 72   GLU A O     1 
ATOM   1557  C  CB    . GLU D 4  72   ? 40.868  -0.475  13.154  1.00 125.42 ? 72   GLU A CB    1 
ATOM   1558  C  CG    . GLU D 4  72   ? 41.676  -1.721  12.820  1.00 120.92 ? 72   GLU A CG    1 
ATOM   1559  C  CD    . GLU D 4  72   ? 40.983  -2.635  11.823  1.00 119.13 ? 72   GLU A CD    1 
ATOM   1560  O  OE1   . GLU D 4  72   ? 41.672  -3.161  10.925  1.00 121.97 ? 72   GLU A OE1   1 
ATOM   1561  O  OE2   . GLU D 4  72   ? 39.760  -2.853  11.954  1.00 112.74 ? 72   GLU A OE2   1 
ATOM   1562  N  N     . GLY D 4  73   ? 38.359  1.504   12.477  1.00 107.29 ? 73   GLY A N     1 
ATOM   1563  C  CA    . GLY D 4  73   ? 37.538  2.648   12.809  1.00 107.13 ? 73   GLY A CA    1 
ATOM   1564  C  C     . GLY D 4  73   ? 37.465  2.905   14.300  1.00 101.78 ? 73   GLY A C     1 
ATOM   1565  O  O     . GLY D 4  73   ? 38.319  2.478   15.082  1.00 108.44 ? 73   GLY A O     1 
ATOM   1566  N  N     . MET D 4  74   ? 36.412  3.626   14.694  1.00 90.38  ? 74   MET A N     1 
ATOM   1567  C  CA    . MET D 4  74   ? 36.192  3.937   16.101  1.00 99.44  ? 74   MET A CA    1 
ATOM   1568  C  C     . MET D 4  74   ? 35.778  2.721   16.916  1.00 98.77  ? 74   MET A C     1 
ATOM   1569  O  O     . MET D 4  74   ? 35.934  2.734   18.139  1.00 102.08 ? 74   MET A O     1 
ATOM   1570  C  CB    . MET D 4  74   ? 35.128  5.026   16.239  1.00 102.33 ? 74   MET A CB    1 
ATOM   1571  C  CG    . MET D 4  74   ? 35.560  6.383   15.728  1.00 110.92 ? 74   MET A CG    1 
ATOM   1572  S  SD    . MET D 4  74   ? 34.933  7.726   16.752  1.00 121.51 ? 74   MET A SD    1 
ATOM   1573  C  CE    . MET D 4  74   ? 33.283  7.137   17.125  1.00 113.54 ? 74   MET A CE    1 
ATOM   1574  N  N     . ASN D 4  75   ? 35.257  1.678   16.275  1.00 99.70  ? 75   ASN A N     1 
ATOM   1575  C  CA    . ASN D 4  75   ? 34.778  0.493   16.970  1.00 97.78  ? 75   ASN A CA    1 
ATOM   1576  C  C     . ASN D 4  75   ? 35.853  -0.581  17.112  1.00 103.19 ? 75   ASN A C     1 
ATOM   1577  O  O     . ASN D 4  75   ? 35.555  -1.684  17.578  1.00 114.88 ? 75   ASN A O     1 
ATOM   1578  C  CB    . ASN D 4  75   ? 33.550  -0.066  16.243  1.00 99.67  ? 75   ASN A CB    1 
ATOM   1579  C  CG    . ASN D 4  75   ? 32.646  -0.874  17.159  1.00 109.39 ? 75   ASN A CG    1 
ATOM   1580  O  OD1   . ASN D 4  75   ? 32.594  -0.636  18.365  1.00 113.45 ? 75   ASN A OD1   1 
ATOM   1581  N  ND2   . ASN D 4  75   ? 31.929  -1.835  16.587  1.00 118.80 ? 75   ASN A ND2   1 
ATOM   1582  N  N     . GLU D 4  76   ? 37.094  -0.284  16.728  1.00 90.95  ? 76   GLU A N     1 
ATOM   1583  C  CA    . GLU D 4  76   ? 38.187  -1.243  16.855  1.00 82.14  ? 76   GLU A CA    1 
ATOM   1584  C  C     . GLU D 4  76   ? 39.435  -0.597  17.441  1.00 97.16  ? 76   GLU A C     1 
ATOM   1585  O  O     . GLU D 4  76   ? 40.239  -1.278  18.084  1.00 109.47 ? 76   GLU A O     1 
ATOM   1586  C  CB    . GLU D 4  76   ? 38.500  -1.883  15.500  1.00 84.46  ? 76   GLU A CB    1 
ATOM   1587  C  CG    . GLU D 4  76   ? 39.403  -3.136  15.514  1.00 88.63  ? 76   GLU A CG    1 
ATOM   1588  C  CD    . GLU D 4  76   ? 39.260  -4.036  16.739  1.00 100.43 ? 76   GLU A CD    1 
ATOM   1589  O  OE1   . GLU D 4  76   ? 38.129  -4.381  17.144  1.00 102.64 ? 76   GLU A OE1   1 
ATOM   1590  O  OE2   . GLU D 4  76   ? 40.310  -4.391  17.317  1.00 108.53 ? 76   GLU A OE2   1 
ATOM   1591  N  N     . CYS D 4  77   ? 39.608  0.698   17.222  1.00 105.99 ? 77   CYS A N     1 
ATOM   1592  C  CA    . CYS D 4  77   ? 40.737  1.413   17.807  1.00 99.81  ? 77   CYS A CA    1 
ATOM   1593  C  C     . CYS D 4  77   ? 40.558  1.500   19.316  1.00 92.11  ? 77   CYS A C     1 
ATOM   1594  O  O     . CYS D 4  77   ? 39.559  2.066   19.777  1.00 79.61  ? 77   CYS A O     1 
ATOM   1595  C  CB    . CYS D 4  77   ? 40.860  2.812   17.210  1.00 93.66  ? 77   CYS A CB    1 
ATOM   1596  S  SG    . CYS D 4  77   ? 42.080  3.868   18.029  1.00 98.71  ? 77   CYS A SG    1 
ATOM   1597  N  N     . PRO D 4  78   ? 41.474  0.945   20.117  1.00 103.29 ? 78   PRO A N     1 
ATOM   1598  C  CA    . PRO D 4  78   ? 41.323  1.059   21.574  1.00 105.82 ? 78   PRO A CA    1 
ATOM   1599  C  C     . PRO D 4  78   ? 41.483  2.481   22.070  1.00 107.47 ? 78   PRO A C     1 
ATOM   1600  O  O     . PRO D 4  78   ? 40.840  2.871   23.049  1.00 102.73 ? 78   PRO A O     1 
ATOM   1601  C  CB    . PRO D 4  78   ? 42.437  0.150   22.112  1.00 96.46  ? 78   PRO A CB    1 
ATOM   1602  C  CG    . PRO D 4  78   ? 43.458  0.139   21.022  1.00 94.82  ? 78   PRO A CG    1 
ATOM   1603  C  CD    . PRO D 4  78   ? 42.659  0.151   19.750  1.00 102.21 ? 78   PRO A CD    1 
ATOM   1604  N  N     . GLY D 4  79   ? 42.299  3.283   21.410  1.00 112.00 ? 79   GLY A N     1 
ATOM   1605  C  CA    . GLY D 4  79   ? 42.596  4.584   21.953  1.00 113.18 ? 79   GLY A CA    1 
ATOM   1606  C  C     . GLY D 4  79   ? 44.046  4.642   22.364  1.00 111.62 ? 79   GLY A C     1 
ATOM   1607  O  O     . GLY D 4  79   ? 44.423  4.222   23.462  1.00 109.72 ? 79   GLY A O     1 
ATOM   1608  N  N     . HIS D 4  80   ? 44.867  5.156   21.462  1.00 110.84 ? 80   HIS A N     1 
ATOM   1609  C  CA    . HIS D 4  80   ? 46.302  5.193   21.641  1.00 117.79 ? 80   HIS A CA    1 
ATOM   1610  C  C     . HIS D 4  80   ? 46.657  6.291   22.638  1.00 120.95 ? 80   HIS A C     1 
ATOM   1611  O  O     . HIS D 4  80   ? 45.808  7.078   23.058  1.00 127.30 ? 80   HIS A O     1 
ATOM   1612  C  CB    . HIS D 4  80   ? 46.955  5.398   20.282  1.00 122.96 ? 80   HIS A CB    1 
ATOM   1613  C  CG    . HIS D 4  80   ? 46.231  4.690   19.177  1.00 133.71 ? 80   HIS A CG    1 
ATOM   1614  N  ND1   . HIS D 4  80   ? 46.286  3.325   19.006  1.00 136.10 ? 80   HIS A ND1   1 
ATOM   1615  C  CD2   . HIS D 4  80   ? 45.391  5.154   18.221  1.00 137.91 ? 80   HIS A CD2   1 
ATOM   1616  C  CE1   . HIS D 4  80   ? 45.532  2.980   17.978  1.00 138.92 ? 80   HIS A CE1   1 
ATOM   1617  N  NE2   . HIS D 4  80   ? 44.980  4.072   17.481  1.00 137.56 ? 80   HIS A NE2   1 
ATOM   1618  N  N     . PHE D 4  81   ? 47.914  6.331   23.052  1.00 113.16 ? 81   PHE A N     1 
ATOM   1619  C  CA    . PHE D 4  81   ? 48.314  7.250   24.105  1.00 107.76 ? 81   PHE A CA    1 
ATOM   1620  C  C     . PHE D 4  81   ? 49.353  8.245   23.611  1.00 109.24 ? 81   PHE A C     1 
ATOM   1621  O  O     . PHE D 4  81   ? 50.214  7.907   22.796  1.00 103.89 ? 81   PHE A O     1 
ATOM   1622  C  CB    . PHE D 4  81   ? 48.849  6.502   25.329  1.00 111.88 ? 81   PHE A CB    1 
ATOM   1623  C  CG    . PHE D 4  81   ? 47.914  6.532   26.502  1.00 111.56 ? 81   PHE A CG    1 
ATOM   1624  C  CD1   . PHE D 4  81   ? 46.838  5.663   26.573  1.00 111.67 ? 81   PHE A CD1   1 
ATOM   1625  C  CD2   . PHE D 4  81   ? 48.101  7.447   27.524  1.00 110.55 ? 81   PHE A CD2   1 
ATOM   1626  C  CE1   . PHE D 4  81   ? 45.971  5.700   27.654  1.00 113.09 ? 81   PHE A CE1   1 
ATOM   1627  C  CE2   . PHE D 4  81   ? 47.241  7.491   28.601  1.00 111.63 ? 81   PHE A CE2   1 
ATOM   1628  C  CZ    . PHE D 4  81   ? 46.175  6.618   28.669  1.00 110.51 ? 81   PHE A CZ    1 
ATOM   1629  N  N     . GLY D 4  82   ? 49.239  9.480   24.110  1.00 121.93 ? 82   GLY A N     1 
ATOM   1630  C  CA    . GLY D 4  82   ? 50.252  10.493  23.934  1.00 133.81 ? 82   GLY A CA    1 
ATOM   1631  C  C     . GLY D 4  82   ? 50.773  10.942  25.291  1.00 137.27 ? 82   GLY A C     1 
ATOM   1632  O  O     . GLY D 4  82   ? 50.237  10.577  26.345  1.00 134.25 ? 82   GLY A O     1 
ATOM   1633  N  N     . HIS D 4  83   ? 51.825  11.757  25.253  1.00 138.45 ? 83   HIS A N     1 
ATOM   1634  C  CA    . HIS D 4  83   ? 52.487  12.209  26.468  1.00 136.68 ? 83   HIS A CA    1 
ATOM   1635  C  C     . HIS D 4  83   ? 52.775  13.697  26.400  1.00 137.42 ? 83   HIS A C     1 
ATOM   1636  O  O     . HIS D 4  83   ? 52.900  14.272  25.321  1.00 132.87 ? 83   HIS A O     1 
ATOM   1637  C  CB    . HIS D 4  83   ? 53.789  11.454  26.711  1.00 140.08 ? 83   HIS A CB    1 
ATOM   1638  C  CG    . HIS D 4  83   ? 54.984  12.068  26.051  1.00 142.22 ? 83   HIS A CG    1 
ATOM   1639  N  ND1   . HIS D 4  83   ? 55.954  12.747  26.757  1.00 145.49 ? 83   HIS A ND1   1 
ATOM   1640  C  CD2   . HIS D 4  83   ? 55.374  12.097  24.754  1.00 142.02 ? 83   HIS A CD2   1 
ATOM   1641  C  CE1   . HIS D 4  83   ? 56.887  13.172  25.922  1.00 145.70 ? 83   HIS A CE1   1 
ATOM   1642  N  NE2   . HIS D 4  83   ? 56.559  12.790  24.702  1.00 143.74 ? 83   HIS A NE2   1 
ATOM   1643  N  N     . ILE D 4  84   ? 52.884  14.309  27.574  1.00 139.17 ? 84   ILE A N     1 
ATOM   1644  C  CA    . ILE D 4  84   ? 53.287  15.701  27.694  1.00 136.83 ? 84   ILE A CA    1 
ATOM   1645  C  C     . ILE D 4  84   ? 54.293  15.799  28.837  1.00 142.72 ? 84   ILE A C     1 
ATOM   1646  O  O     . ILE D 4  84   ? 53.941  15.583  30.003  1.00 149.75 ? 84   ILE A O     1 
ATOM   1647  C  CB    . ILE D 4  84   ? 52.094  16.648  27.912  1.00 128.97 ? 84   ILE A CB    1 
ATOM   1648  C  CG1   . ILE D 4  84   ? 52.572  18.029  28.362  1.00 134.06 ? 84   ILE A CG1   1 
ATOM   1649  C  CG2   . ILE D 4  84   ? 51.030  16.048  28.842  1.00 122.12 ? 84   ILE A CG2   1 
ATOM   1650  C  CD1   . ILE D 4  84   ? 51.611  19.129  28.027  1.00 141.67 ? 84   ILE A CD1   1 
ATOM   1651  N  N     . ASP D 4  85   ? 55.549  16.078  28.503  1.00 138.98 ? 85   ASP A N     1 
ATOM   1652  C  CA    . ASP D 4  85   ? 56.575  16.333  29.507  1.00 134.65 ? 85   ASP A CA    1 
ATOM   1653  C  C     . ASP D 4  85   ? 56.555  17.816  29.866  1.00 140.15 ? 85   ASP A C     1 
ATOM   1654  O  O     . ASP D 4  85   ? 56.893  18.673  29.047  1.00 148.02 ? 85   ASP A O     1 
ATOM   1655  C  CB    . ASP D 4  85   ? 57.946  15.855  29.025  1.00 126.37 ? 85   ASP A CB    1 
ATOM   1656  C  CG    . ASP D 4  85   ? 58.196  16.122  27.544  1.00 128.39 ? 85   ASP A CG    1 
ATOM   1657  O  OD1   . ASP D 4  85   ? 58.990  15.362  26.949  1.00 126.30 ? 85   ASP A OD1   1 
ATOM   1658  O  OD2   . ASP D 4  85   ? 57.590  17.038  26.956  1.00 129.67 ? 85   ASP A OD2   1 
ATOM   1659  N  N     . LEU D 4  86   ? 56.149  18.115  31.094  1.00 141.11 ? 86   LEU A N     1 
ATOM   1660  C  CA    . LEU D 4  86   ? 55.947  19.491  31.516  1.00 146.22 ? 86   LEU A CA    1 
ATOM   1661  C  C     . LEU D 4  86   ? 57.255  20.077  32.051  1.00 153.90 ? 86   LEU A C     1 
ATOM   1662  O  O     . LEU D 4  86   ? 58.332  19.492  31.907  1.00 160.26 ? 86   LEU A O     1 
ATOM   1663  C  CB    . LEU D 4  86   ? 54.794  19.559  32.520  1.00 142.07 ? 86   LEU A CB    1 
ATOM   1664  C  CG    . LEU D 4  86   ? 54.603  18.479  33.592  1.00 141.50 ? 86   LEU A CG    1 
ATOM   1665  C  CD1   . LEU D 4  86   ? 55.635  18.563  34.702  1.00 148.20 ? 86   LEU A CD1   1 
ATOM   1666  C  CD2   . LEU D 4  86   ? 53.196  18.559  34.168  1.00 134.04 ? 86   LEU A CD2   1 
ATOM   1667  N  N     . ALA D 4  87   ? 57.171  21.255  32.667  1.00 155.24 ? 87   ALA A N     1 
ATOM   1668  C  CA    . ALA D 4  87   ? 58.356  21.961  33.139  1.00 154.59 ? 87   ALA A CA    1 
ATOM   1669  C  C     . ALA D 4  87   ? 58.739  21.521  34.546  1.00 160.18 ? 87   ALA A C     1 
ATOM   1670  O  O     . ALA D 4  87   ? 59.426  20.510  34.722  1.00 154.86 ? 87   ALA A O     1 
ATOM   1671  C  CB    . ALA D 4  87   ? 58.126  23.473  33.102  1.00 149.22 ? 87   ALA A CB    1 
ATOM   1672  N  N     . LYS D 4  88   ? 58.311  22.284  35.546  1.00 166.51 ? 88   LYS A N     1 
ATOM   1673  C  CA    . LYS D 4  88   ? 58.579  21.926  36.933  1.00 174.35 ? 88   LYS A CA    1 
ATOM   1674  C  C     . LYS D 4  88   ? 57.796  20.670  37.302  1.00 168.03 ? 88   LYS A C     1 
ATOM   1675  O  O     . LYS D 4  88   ? 56.590  20.605  37.038  1.00 172.11 ? 88   LYS A O     1 
ATOM   1676  C  CB    . LYS D 4  88   ? 58.204  23.083  37.859  1.00 177.19 ? 88   LYS A CB    1 
ATOM   1677  C  CG    . LYS D 4  88   ? 57.875  22.672  39.285  1.00 171.28 ? 88   LYS A CG    1 
ATOM   1678  C  CD    . LYS D 4  88   ? 58.390  23.685  40.290  1.00 164.89 ? 88   LYS A CD    1 
ATOM   1679  C  CE    . LYS D 4  88   ? 58.381  23.112  41.696  1.00 158.85 ? 88   LYS A CE    1 
ATOM   1680  N  NZ    . LYS D 4  88   ? 57.109  23.422  42.406  1.00 155.00 ? 88   LYS A NZ    1 
ATOM   1681  N  N     . PRO D 4  89   ? 58.438  19.661  37.895  1.00 158.10 ? 89   PRO A N     1 
ATOM   1682  C  CA    . PRO D 4  89   ? 57.739  18.412  38.232  1.00 150.06 ? 89   PRO A CA    1 
ATOM   1683  C  C     . PRO D 4  89   ? 56.644  18.638  39.264  1.00 144.96 ? 89   PRO A C     1 
ATOM   1684  O  O     . PRO D 4  89   ? 56.570  19.673  39.929  1.00 141.75 ? 89   PRO A O     1 
ATOM   1685  C  CB    . PRO D 4  89   ? 58.851  17.510  38.781  1.00 151.88 ? 89   PRO A CB    1 
ATOM   1686  C  CG    . PRO D 4  89   ? 60.130  18.126  38.309  1.00 154.85 ? 89   PRO A CG    1 
ATOM   1687  C  CD    . PRO D 4  89   ? 59.877  19.594  38.198  1.00 158.44 ? 89   PRO A CD    1 
ATOM   1688  N  N     . VAL D 4  90   ? 55.764  17.646  39.387  1.00 142.10 ? 90   VAL A N     1 
ATOM   1689  C  CA    . VAL D 4  90   ? 54.520  17.832  40.120  1.00 145.59 ? 90   VAL A CA    1 
ATOM   1690  C  C     . VAL D 4  90   ? 54.214  16.621  40.991  1.00 140.66 ? 90   VAL A C     1 
ATOM   1691  O  O     . VAL D 4  90   ? 54.657  15.502  40.717  1.00 141.05 ? 90   VAL A O     1 
ATOM   1692  C  CB    . VAL D 4  90   ? 53.347  18.121  39.159  1.00 148.94 ? 90   VAL A CB    1 
ATOM   1693  C  CG1   . VAL D 4  90   ? 53.325  19.586  38.790  1.00 158.87 ? 90   VAL A CG1   1 
ATOM   1694  C  CG2   . VAL D 4  90   ? 53.476  17.297  37.905  1.00 142.87 ? 90   VAL A CG2   1 
ATOM   1695  N  N     . PHE D 4  91   ? 53.446  16.863  42.053  1.00 132.19 ? 91   PHE A N     1 
ATOM   1696  C  CA    . PHE D 4  91   ? 52.981  15.811  42.944  1.00 123.02 ? 91   PHE A CA    1 
ATOM   1697  C  C     . PHE D 4  91   ? 51.855  15.007  42.301  1.00 105.21 ? 91   PHE A C     1 
ATOM   1698  O  O     . PHE D 4  91   ? 51.340  15.337  41.229  1.00 111.64 ? 91   PHE A O     1 
ATOM   1699  C  CB    . PHE D 4  91   ? 52.440  16.391  44.252  1.00 127.67 ? 91   PHE A CB    1 
ATOM   1700  C  CG    . PHE D 4  91   ? 53.442  17.160  45.059  1.00 130.01 ? 91   PHE A CG    1 
ATOM   1701  C  CD1   . PHE D 4  91   ? 54.701  16.647  45.314  1.00 128.37 ? 91   PHE A CD1   1 
ATOM   1702  C  CD2   . PHE D 4  91   ? 53.103  18.394  45.592  1.00 135.10 ? 91   PHE A CD2   1 
ATOM   1703  C  CE1   . PHE D 4  91   ? 55.611  17.361  46.073  1.00 132.40 ? 91   PHE A CE1   1 
ATOM   1704  C  CE2   . PHE D 4  91   ? 54.004  19.113  46.346  1.00 134.69 ? 91   PHE A CE2   1 
ATOM   1705  C  CZ    . PHE D 4  91   ? 55.261  18.597  46.589  1.00 135.19 ? 91   PHE A CZ    1 
ATOM   1706  N  N     . HIS D 4  92   ? 51.458  13.945  43.002  1.00 96.35  ? 92   HIS A N     1 
ATOM   1707  C  CA    . HIS D 4  92   ? 50.179  13.281  42.787  1.00 91.20  ? 92   HIS A CA    1 
ATOM   1708  C  C     . HIS D 4  92   ? 49.152  13.961  43.688  1.00 89.66  ? 92   HIS A C     1 
ATOM   1709  O  O     . HIS D 4  92   ? 49.305  15.142  44.014  1.00 97.36  ? 92   HIS A O     1 
ATOM   1710  C  CB    . HIS D 4  92   ? 50.297  11.790  43.104  1.00 96.64  ? 92   HIS A CB    1 
ATOM   1711  C  CG    . HIS D 4  92   ? 49.519  10.899  42.186  1.00 108.80 ? 92   HIS A CG    1 
ATOM   1712  N  ND1   . HIS D 4  92   ? 48.187  10.607  42.380  1.00 111.05 ? 92   HIS A ND1   1 
ATOM   1713  C  CD2   . HIS D 4  92   ? 49.890  10.233  41.066  1.00 109.91 ? 92   HIS A CD2   1 
ATOM   1714  C  CE1   . HIS D 4  92   ? 47.771  9.798   41.421  1.00 108.78 ? 92   HIS A CE1   1 
ATOM   1715  N  NE2   . HIS D 4  92   ? 48.785  9.557   40.611  1.00 107.52 ? 92   HIS A NE2   1 
ATOM   1716  N  N     . VAL D 4  93   ? 48.097  13.251  44.094  1.00 91.89  ? 93   VAL A N     1 
ATOM   1717  C  CA    . VAL D 4  93   ? 47.165  13.812  45.072  1.00 109.01 ? 93   VAL A CA    1 
ATOM   1718  C  C     . VAL D 4  93   ? 47.052  12.872  46.261  1.00 117.48 ? 93   VAL A C     1 
ATOM   1719  O  O     . VAL D 4  93   ? 47.461  13.208  47.377  1.00 113.52 ? 93   VAL A O     1 
ATOM   1720  C  CB    . VAL D 4  93   ? 45.768  14.075  44.479  1.00 123.29 ? 93   VAL A CB    1 
ATOM   1721  C  CG1   . VAL D 4  93   ? 45.020  15.072  45.348  1.00 125.00 ? 93   VAL A CG1   1 
ATOM   1722  C  CG2   . VAL D 4  93   ? 45.854  14.572  43.050  1.00 126.00 ? 93   VAL A CG2   1 
ATOM   1723  N  N     . GLY D 4  94   ? 46.481  11.689  46.029  1.00 125.83 ? 94   GLY A N     1 
ATOM   1724  C  CA    . GLY D 4  94   ? 46.377  10.658  47.044  1.00 125.94 ? 94   GLY A CA    1 
ATOM   1725  C  C     . GLY D 4  94   ? 47.689  10.041  47.466  1.00 125.76 ? 94   GLY A C     1 
ATOM   1726  O  O     . GLY D 4  94   ? 47.708  9.234   48.399  1.00 122.73 ? 94   GLY A O     1 
ATOM   1727  N  N     . PHE D 4  95   ? 48.783  10.392  46.798  1.00 125.21 ? 95   PHE A N     1 
ATOM   1728  C  CA    . PHE D 4  95   ? 50.114  9.971   47.197  1.00 130.92 ? 95   PHE A CA    1 
ATOM   1729  C  C     . PHE D 4  95   ? 50.804  10.999  48.080  1.00 140.59 ? 95   PHE A C     1 
ATOM   1730  O  O     . PHE D 4  95   ? 51.791  10.659  48.742  1.00 148.19 ? 95   PHE A O     1 
ATOM   1731  C  CB    . PHE D 4  95   ? 50.969  9.710   45.954  1.00 133.68 ? 95   PHE A CB    1 
ATOM   1732  C  CG    . PHE D 4  95   ? 50.634  8.429   45.231  1.00 141.32 ? 95   PHE A CG    1 
ATOM   1733  C  CD1   . PHE D 4  95   ? 51.231  8.133   44.015  1.00 145.77 ? 95   PHE A CD1   1 
ATOM   1734  C  CD2   . PHE D 4  95   ? 49.737  7.519   45.769  1.00 139.07 ? 95   PHE A CD2   1 
ATOM   1735  C  CE1   . PHE D 4  95   ? 50.926  6.965   43.341  1.00 142.59 ? 95   PHE A CE1   1 
ATOM   1736  C  CE2   . PHE D 4  95   ? 49.429  6.349   45.102  1.00 138.35 ? 95   PHE A CE2   1 
ATOM   1737  C  CZ    . PHE D 4  95   ? 50.026  6.070   43.886  1.00 140.74 ? 95   PHE A CZ    1 
ATOM   1738  N  N     . ILE D 4  96   ? 50.295  12.239  48.101  1.00 134.30 ? 96   ILE A N     1 
ATOM   1739  C  CA    . ILE D 4  96   ? 50.869  13.309  48.918  1.00 130.77 ? 96   ILE A CA    1 
ATOM   1740  C  C     . ILE D 4  96   ? 50.819  12.943  50.395  1.00 127.10 ? 96   ILE A C     1 
ATOM   1741  O  O     . ILE D 4  96   ? 51.796  13.137  51.131  1.00 126.26 ? 96   ILE A O     1 
ATOM   1742  C  CB    . ILE D 4  96   ? 50.140  14.640  48.635  1.00 129.95 ? 96   ILE A CB    1 
ATOM   1743  C  CG1   . ILE D 4  96   ? 50.702  15.312  47.378  1.00 128.18 ? 96   ILE A CG1   1 
ATOM   1744  C  CG2   . ILE D 4  96   ? 50.203  15.590  49.841  1.00 125.48 ? 96   ILE A CG2   1 
ATOM   1745  C  CD1   . ILE D 4  96   ? 50.283  16.765  47.214  1.00 124.66 ? 96   ILE A CD1   1 
ATOM   1746  N  N     . ALA D 4  97   ? 49.687  12.387  50.845  1.00 125.51 ? 97   ALA A N     1 
ATOM   1747  C  CA    . ALA D 4  97   ? 49.573  11.931  52.226  1.00 125.67 ? 97   ALA A CA    1 
ATOM   1748  C  C     . ALA D 4  97   ? 50.556  10.808  52.528  1.00 137.04 ? 97   ALA A C     1 
ATOM   1749  O  O     . ALA D 4  97   ? 50.995  10.663  53.673  1.00 140.31 ? 97   ALA A O     1 
ATOM   1750  C  CB    . ALA D 4  97   ? 48.143  11.478  52.514  1.00 117.31 ? 97   ALA A CB    1 
ATOM   1751  N  N     . LYS D 4  98   ? 50.917  10.013  51.520  1.00 134.00 ? 98   LYS A N     1 
ATOM   1752  C  CA    . LYS D 4  98   ? 52.013  9.070   51.682  1.00 132.27 ? 98   LYS A CA    1 
ATOM   1753  C  C     . LYS D 4  98   ? 53.365  9.720   51.429  1.00 131.95 ? 98   LYS A C     1 
ATOM   1754  O  O     . LYS D 4  98   ? 54.352  9.313   52.047  1.00 144.77 ? 98   LYS A O     1 
ATOM   1755  C  CB    . LYS D 4  98   ? 51.831  7.871   50.753  1.00 119.21 ? 98   LYS A CB    1 
ATOM   1756  C  CG    . LYS D 4  98   ? 51.882  6.530   51.466  1.00 104.01 ? 98   LYS A CG    1 
ATOM   1757  C  CD    . LYS D 4  98   ? 52.484  5.453   50.581  1.00 95.55  ? 98   LYS A CD    1 
ATOM   1758  C  CE    . LYS D 4  98   ? 52.733  4.180   51.368  1.00 90.71  ? 98   LYS A CE    1 
ATOM   1759  N  NZ    . LYS D 4  98   ? 52.690  2.969   50.506  1.00 88.61  ? 98   LYS A NZ    1 
ATOM   1760  N  N     . ILE D 4  99   ? 53.423  10.715  50.532  1.00 121.99 ? 99   ILE A N     1 
ATOM   1761  C  CA    . ILE D 4  99   ? 54.664  11.450  50.277  1.00 130.57 ? 99   ILE A CA    1 
ATOM   1762  C  C     . ILE D 4  99   ? 55.170  12.110  51.551  1.00 145.86 ? 99   ILE A C     1 
ATOM   1763  O  O     . ILE D 4  99   ? 56.374  12.091  51.837  1.00 142.10 ? 99   ILE A O     1 
ATOM   1764  C  CB    . ILE D 4  99   ? 54.464  12.471  49.137  1.00 119.36 ? 99   ILE A CB    1 
ATOM   1765  C  CG1   . ILE D 4  99   ? 54.659  11.797  47.781  1.00 118.16 ? 99   ILE A CG1   1 
ATOM   1766  C  CG2   . ILE D 4  99   ? 55.394  13.674  49.266  1.00 122.57 ? 99   ILE A CG2   1 
ATOM   1767  C  CD1   . ILE D 4  99   ? 56.079  11.334  47.563  1.00 119.58 ? 99   ILE A CD1   1 
ATOM   1768  N  N     . LYS D 4  100  ? 54.258  12.675  52.349  1.00 156.33 ? 100  LYS A N     1 
ATOM   1769  C  CA    . LYS D 4  100  ? 54.648  13.239  53.639  1.00 155.26 ? 100  LYS A CA    1 
ATOM   1770  C  C     . LYS D 4  100  ? 55.250  12.176  54.545  1.00 154.33 ? 100  LYS A C     1 
ATOM   1771  O  O     . LYS D 4  100  ? 56.300  12.399  55.153  1.00 160.91 ? 100  LYS A O     1 
ATOM   1772  C  CB    . LYS D 4  100  ? 53.444  13.888  54.320  1.00 153.34 ? 100  LYS A CB    1 
ATOM   1773  C  CG    . LYS D 4  100  ? 53.649  14.130  55.806  1.00 152.90 ? 100  LYS A CG    1 
ATOM   1774  C  CD    . LYS D 4  100  ? 52.365  14.023  56.601  1.00 150.89 ? 100  LYS A CD    1 
ATOM   1775  C  CE    . LYS D 4  100  ? 52.620  14.367  58.060  1.00 148.74 ? 100  LYS A CE    1 
ATOM   1776  N  NZ    . LYS D 4  100  ? 51.499  15.136  58.663  1.00 149.53 ? 100  LYS A NZ    1 
ATOM   1777  N  N     . LYS D 4  101  ? 54.628  10.995  54.595  1.00 147.98 ? 101  LYS A N     1 
ATOM   1778  C  CA    . LYS D 4  101  ? 55.061  9.947   55.514  1.00 145.52 ? 101  LYS A CA    1 
ATOM   1779  C  C     . LYS D 4  101  ? 56.437  9.406   55.148  1.00 139.62 ? 101  LYS A C     1 
ATOM   1780  O  O     . LYS D 4  101  ? 57.251  9.120   56.033  1.00 158.99 ? 101  LYS A O     1 
ATOM   1781  C  CB    . LYS D 4  101  ? 54.030  8.821   55.526  1.00 147.89 ? 101  LYS A CB    1 
ATOM   1782  C  CG    . LYS D 4  101  ? 52.674  9.249   56.051  1.00 149.87 ? 101  LYS A CG    1 
ATOM   1783  C  CD    . LYS D 4  101  ? 51.912  8.092   56.659  1.00 146.65 ? 101  LYS A CD    1 
ATOM   1784  C  CE    . LYS D 4  101  ? 50.745  8.596   57.488  1.00 146.71 ? 101  LYS A CE    1 
ATOM   1785  N  NZ    . LYS D 4  101  ? 50.056  7.482   58.183  1.00 147.63 ? 101  LYS A NZ    1 
ATOM   1786  N  N     . VAL D 4  102  ? 56.726  9.265   53.856  1.00 116.52 ? 102  VAL A N     1 
ATOM   1787  C  CA    . VAL D 4  102  ? 58.043  8.772   53.482  1.00 114.46 ? 102  VAL A CA    1 
ATOM   1788  C  C     . VAL D 4  102  ? 59.072  9.908   53.539  1.00 133.19 ? 102  VAL A C     1 
ATOM   1789  O  O     . VAL D 4  102  ? 60.255  9.666   53.802  1.00 128.08 ? 102  VAL A O     1 
ATOM   1790  C  CB    . VAL D 4  102  ? 57.971  8.079   52.106  1.00 100.80 ? 102  VAL A CB    1 
ATOM   1791  C  CG1   . VAL D 4  102  ? 57.361  8.992   51.063  1.00 94.64  ? 102  VAL A CG1   1 
ATOM   1792  C  CG2   . VAL D 4  102  ? 59.325  7.524   51.664  1.00 97.80  ? 102  VAL A CG2   1 
ATOM   1793  N  N     . CYS D 4  103  ? 58.641  11.162  53.356  1.00 165.25 ? 103  CYS A N     1 
ATOM   1794  C  CA    . CYS D 4  103  ? 59.518  12.302  53.610  1.00 177.47 ? 103  CYS A CA    1 
ATOM   1795  C  C     . CYS D 4  103  ? 59.624  12.662  55.084  1.00 154.32 ? 103  CYS A C     1 
ATOM   1796  O  O     . CYS D 4  103  ? 60.565  13.375  55.451  1.00 145.05 ? 103  CYS A O     1 
ATOM   1797  C  CB    . CYS D 4  103  ? 59.051  13.552  52.858  1.00 202.09 ? 103  CYS A CB    1 
ATOM   1798  S  SG    . CYS D 4  103  ? 59.156  13.480  51.069  1.00 214.63 ? 103  CYS A SG    1 
ATOM   1799  N  N     . GLU D 4  104  ? 58.679  12.215  55.922  1.00 141.88 ? 104  GLU A N     1 
ATOM   1800  C  CA    . GLU D 4  104  ? 58.713  12.556  57.345  1.00 124.60 ? 104  GLU A CA    1 
ATOM   1801  C  C     . GLU D 4  104  ? 59.975  12.034  58.008  1.00 157.89 ? 104  GLU A C     1 
ATOM   1802  O  O     . GLU D 4  104  ? 60.550  12.702  58.875  1.00 167.21 ? 104  GLU A O     1 
ATOM   1803  C  CB    . GLU D 4  104  ? 57.482  12.002  58.062  1.00 101.32 ? 104  GLU A CB    1 
ATOM   1804  N  N     . CYS D 4  105  ? 60.431  10.851  57.602  1.00 165.24 ? 105  CYS A N     1 
ATOM   1805  C  CA    . CYS D 4  105  ? 61.677  10.290  58.121  1.00 182.94 ? 105  CYS A CA    1 
ATOM   1806  C  C     . CYS D 4  105  ? 62.403  9.532   57.014  1.00 181.56 ? 105  CYS A C     1 
ATOM   1807  O  O     . CYS D 4  105  ? 62.202  8.333   56.806  1.00 173.62 ? 105  CYS A O     1 
ATOM   1808  C  CB    . CYS D 4  105  ? 61.422  9.429   59.340  1.00 191.31 ? 105  CYS A CB    1 
ATOM   1809  S  SG    . CYS D 4  105  ? 61.412  10.422  60.840  1.00 192.99 ? 105  CYS A SG    1 
ATOM   1810  N  N     . VAL D 4  106  ? 63.215  10.285  56.278  1.00 192.49 ? 106  VAL A N     1 
ATOM   1811  C  CA    . VAL D 4  106  ? 64.354  9.782   55.525  1.00 197.07 ? 106  VAL A CA    1 
ATOM   1812  C  C     . VAL D 4  106  ? 65.366  10.913  55.617  1.00 211.79 ? 106  VAL A C     1 
ATOM   1813  O  O     . VAL D 4  106  ? 65.032  12.024  56.034  1.00 220.23 ? 106  VAL A O     1 
ATOM   1814  C  CB    . VAL D 4  106  ? 63.982  9.425   54.060  1.00 182.34 ? 106  VAL A CB    1 
ATOM   1815  C  CG1   . VAL D 4  106  ? 64.070  10.645  53.149  1.00 177.67 ? 106  VAL A CG1   1 
ATOM   1816  C  CG2   . VAL D 4  106  ? 64.832  8.280   53.549  1.00 179.42 ? 106  VAL A CG2   1 
ATOM   1817  N  N     . CYS D 4  107  ? 66.619  10.640  55.280  1.00 214.87 ? 107  CYS A N     1 
ATOM   1818  C  CA    . CYS D 4  107  ? 67.571  11.739  55.321  1.00 218.80 ? 107  CYS A CA    1 
ATOM   1819  C  C     . CYS D 4  107  ? 67.451  12.555  54.044  1.00 213.01 ? 107  CYS A C     1 
ATOM   1820  O  O     . CYS D 4  107  ? 67.219  12.012  52.961  1.00 212.74 ? 107  CYS A O     1 
ATOM   1821  C  CB    . CYS D 4  107  ? 69.006  11.267  55.497  1.00 229.77 ? 107  CYS A CB    1 
ATOM   1822  S  SG    . CYS D 4  107  ? 70.127  12.543  54.907  1.00 238.41 ? 107  CYS A SG    1 
ATOM   1823  N  N     . MET D 4  108  ? 67.588  13.873  54.182  1.00 206.59 ? 108  MET A N     1 
ATOM   1824  C  CA    . MET D 4  108  ? 67.533  14.747  53.016  1.00 197.32 ? 108  MET A CA    1 
ATOM   1825  C  C     . MET D 4  108  ? 68.822  14.674  52.206  1.00 193.90 ? 108  MET A C     1 
ATOM   1826  O  O     . MET D 4  108  ? 68.788  14.482  50.985  1.00 193.92 ? 108  MET A O     1 
ATOM   1827  C  CB    . MET D 4  108  ? 67.241  16.182  53.455  1.00 194.86 ? 108  MET A CB    1 
ATOM   1828  C  CG    . MET D 4  108  ? 65.819  16.466  53.974  1.00 192.96 ? 108  MET A CG    1 
ATOM   1829  S  SD    . MET D 4  108  ? 65.001  15.272  55.060  1.00 192.80 ? 108  MET A SD    1 
ATOM   1830  C  CE    . MET D 4  108  ? 64.056  14.288  53.897  1.00 185.65 ? 108  MET A CE    1 
ATOM   1831  N  N     . HIS D 4  109  ? 69.971  14.824  52.867  1.00 188.51 ? 109  HIS A N     1 
ATOM   1832  C  CA    . HIS D 4  109  ? 71.243  14.792  52.152  1.00 188.85 ? 109  HIS A CA    1 
ATOM   1833  C  C     . HIS D 4  109  ? 71.575  13.378  51.688  1.00 190.40 ? 109  HIS A C     1 
ATOM   1834  O  O     . HIS D 4  109  ? 71.731  13.123  50.490  1.00 185.15 ? 109  HIS A O     1 
ATOM   1835  C  CB    . HIS D 4  109  ? 72.366  15.344  53.033  1.00 184.49 ? 109  HIS A CB    1 
ATOM   1836  C  CG    . HIS D 4  109  ? 72.332  16.832  53.208  1.00 179.89 ? 109  HIS A CG    1 
ATOM   1837  N  ND1   . HIS D 4  109  ? 71.160  17.557  53.240  1.00 175.48 ? 109  HIS A ND1   1 
ATOM   1838  C  CD2   . HIS D 4  109  ? 73.334  17.733  53.342  1.00 181.39 ? 109  HIS A CD2   1 
ATOM   1839  C  CE1   . HIS D 4  109  ? 71.441  18.838  53.403  1.00 177.20 ? 109  HIS A CE1   1 
ATOM   1840  N  NE2   . HIS D 4  109  ? 72.753  18.971  53.467  1.00 182.27 ? 109  HIS A NE2   1 
ATOM   1841  N  N     . CYS D 4  110  ? 71.690  12.447  52.628  1.00 204.81 ? 110  CYS A N     1 
ATOM   1842  C  CA    . CYS D 4  110  ? 72.014  11.069  52.291  1.00 210.07 ? 110  CYS A CA    1 
ATOM   1843  C  C     . CYS D 4  110  ? 70.749  10.326  51.885  1.00 208.54 ? 110  CYS A C     1 
ATOM   1844  O  O     . CYS D 4  110  ? 69.664  10.584  52.411  1.00 209.58 ? 110  CYS A O     1 
ATOM   1845  C  CB    . CYS D 4  110  ? 72.671  10.376  53.484  1.00 211.26 ? 110  CYS A CB    1 
ATOM   1846  S  SG    . CYS D 4  110  ? 73.684  11.468  54.511  1.00 211.20 ? 110  CYS A SG    1 
ATOM   1847  N  N     . GLY D 4  111  ? 70.887  9.396   50.946  1.00 205.47 ? 111  GLY A N     1 
ATOM   1848  C  CA    . GLY D 4  111  ? 69.734  8.654   50.472  1.00 198.75 ? 111  GLY A CA    1 
ATOM   1849  C  C     . GLY D 4  111  ? 69.393  7.440   51.312  1.00 195.53 ? 111  GLY A C     1 
ATOM   1850  O  O     . GLY D 4  111  ? 69.168  6.351   50.777  1.00 193.22 ? 111  GLY A O     1 
ATOM   1851  N  N     . LYS D 4  112  ? 69.351  7.613   52.630  1.00 190.23 ? 112  LYS A N     1 
ATOM   1852  C  CA    . LYS D 4  112  ? 69.082  6.529   53.561  1.00 184.26 ? 112  LYS A CA    1 
ATOM   1853  C  C     . LYS D 4  112  ? 68.064  7.005   54.586  1.00 177.99 ? 112  LYS A C     1 
ATOM   1854  O  O     . LYS D 4  112  ? 67.922  8.204   54.838  1.00 180.63 ? 112  LYS A O     1 
ATOM   1855  C  CB    . LYS D 4  112  ? 70.360  6.052   54.285  1.00 182.79 ? 112  LYS A CB    1 
ATOM   1856  C  CG    . LYS D 4  112  ? 71.510  5.618   53.376  1.00 179.53 ? 112  LYS A CG    1 
ATOM   1857  C  CD    . LYS D 4  112  ? 72.467  6.773   53.109  1.00 176.26 ? 112  LYS A CD    1 
ATOM   1858  C  CE    . LYS D 4  112  ? 73.109  6.685   51.736  1.00 173.31 ? 112  LYS A CE    1 
ATOM   1859  N  NZ    . LYS D 4  112  ? 74.250  7.634   51.604  1.00 175.73 ? 112  LYS A NZ    1 
ATOM   1860  N  N     . LEU D 4  113  ? 67.354  6.053   55.186  1.00 168.94 ? 113  LEU A N     1 
ATOM   1861  C  CA    . LEU D 4  113  ? 66.401  6.395   56.231  1.00 157.78 ? 113  LEU A CA    1 
ATOM   1862  C  C     . LEU D 4  113  ? 67.142  6.685   57.534  1.00 161.64 ? 113  LEU A C     1 
ATOM   1863  O  O     . LEU D 4  113  ? 68.370  6.583   57.621  1.00 156.50 ? 113  LEU A O     1 
ATOM   1864  C  CB    . LEU D 4  113  ? 65.354  5.295   56.411  1.00 135.36 ? 113  LEU A CB    1 
ATOM   1865  C  CG    . LEU D 4  113  ? 65.623  4.016   57.214  1.00 118.83 ? 113  LEU A CG    1 
ATOM   1866  C  CD1   . LEU D 4  113  ? 64.345  3.203   57.313  1.00 106.87 ? 113  LEU A CD1   1 
ATOM   1867  C  CD2   . LEU D 4  113  ? 66.718  3.168   56.601  1.00 123.40 ? 113  LEU A CD2   1 
ATOM   1868  N  N     . LEU D 4  114  ? 66.381  7.055   58.565  1.00 171.74 ? 114  LEU A N     1 
ATOM   1869  C  CA    . LEU D 4  114  ? 66.988  7.479   59.821  1.00 185.23 ? 114  LEU A CA    1 
ATOM   1870  C  C     . LEU D 4  114  ? 67.630  6.305   60.550  1.00 189.67 ? 114  LEU A C     1 
ATOM   1871  O  O     . LEU D 4  114  ? 68.789  6.384   60.975  1.00 198.22 ? 114  LEU A O     1 
ATOM   1872  C  CB    . LEU D 4  114  ? 65.952  8.160   60.719  1.00 189.09 ? 114  LEU A CB    1 
ATOM   1873  C  CG    . LEU D 4  114  ? 65.547  9.636   60.556  1.00 193.50 ? 114  LEU A CG    1 
ATOM   1874  C  CD1   . LEU D 4  114  ? 66.554  10.519  61.275  1.00 202.51 ? 114  LEU A CD1   1 
ATOM   1875  C  CD2   . LEU D 4  114  ? 65.361  10.101  59.116  1.00 190.69 ? 114  LEU A CD2   1 
ATOM   1876  N  N     . LEU D 4  115  ? 66.901  5.208   60.697  1.00 178.81 ? 115  LEU A N     1 
ATOM   1877  C  CA    . LEU D 4  115  ? 67.355  4.102   61.518  1.00 173.64 ? 115  LEU A CA    1 
ATOM   1878  C  C     . LEU D 4  115  ? 68.040  3.050   60.649  1.00 167.85 ? 115  LEU A C     1 
ATOM   1879  O  O     . LEU D 4  115  ? 68.260  3.246   59.451  1.00 169.13 ? 115  LEU A O     1 
ATOM   1880  C  CB    . LEU D 4  115  ? 66.184  3.510   62.301  1.00 165.22 ? 115  LEU A CB    1 
ATOM   1881  C  CG    . LEU D 4  115  ? 65.979  4.066   63.714  1.00 164.06 ? 115  LEU A CG    1 
ATOM   1882  C  CD1   . LEU D 4  115  ? 67.243  3.882   64.537  1.00 160.45 ? 115  LEU A CD1   1 
ATOM   1883  C  CD2   . LEU D 4  115  ? 65.531  5.523   63.715  1.00 161.39 ? 115  LEU A CD2   1 
ATOM   1884  N  N     . ASP D 4  116  ? 68.393  1.924   61.267  1.00 168.61 ? 116  ASP A N     1 
ATOM   1885  C  CA    . ASP D 4  116  ? 68.943  0.780   60.544  1.00 164.69 ? 116  ASP A CA    1 
ATOM   1886  C  C     . ASP D 4  116  ? 68.684  -0.474  61.379  1.00 164.70 ? 116  ASP A C     1 
ATOM   1887  O  O     . ASP D 4  116  ? 67.689  -0.540  62.109  1.00 154.55 ? 116  ASP A O     1 
ATOM   1888  C  CB    . ASP D 4  116  ? 70.435  1.027   60.237  1.00 164.76 ? 116  ASP A CB    1 
ATOM   1889  C  CG    . ASP D 4  116  ? 70.884  0.353   58.954  1.00 163.27 ? 116  ASP A CG    1 
ATOM   1890  O  OD1   . ASP D 4  116  ? 70.972  1.042   57.916  1.00 161.70 ? 116  ASP A OD1   1 
ATOM   1891  O  OD2   . ASP D 4  116  ? 71.152  -0.867  58.984  1.00 160.87 ? 116  ASP A OD2   1 
ATOM   1892  N  N     . GLU D 4  117  ? 69.582  -1.456  61.279  1.00 176.85 ? 117  GLU A N     1 
ATOM   1893  C  CA    . GLU D 4  117  ? 69.473  -2.659  62.092  1.00 188.09 ? 117  GLU A CA    1 
ATOM   1894  C  C     . GLU D 4  117  ? 69.846  -2.389  63.546  1.00 199.55 ? 117  GLU A C     1 
ATOM   1895  O  O     . GLU D 4  117  ? 69.396  -3.122  64.433  1.00 206.78 ? 117  GLU A O     1 
ATOM   1896  C  CB    . GLU D 4  117  ? 70.353  -3.761  61.478  1.00 188.10 ? 117  GLU A CB    1 
ATOM   1897  C  CG    . GLU D 4  117  ? 70.109  -5.208  61.949  1.00 187.12 ? 117  GLU A CG    1 
ATOM   1898  C  CD    . GLU D 4  117  ? 70.731  -5.540  63.297  1.00 189.36 ? 117  GLU A CD    1 
ATOM   1899  O  OE1   . GLU D 4  117  ? 71.941  -5.291  63.476  1.00 190.78 ? 117  GLU A OE1   1 
ATOM   1900  O  OE2   . GLU D 4  117  ? 70.004  -6.049  64.179  1.00 187.36 ? 117  GLU A OE2   1 
ATOM   1901  N  N     . HIS D 4  118  ? 70.607  -1.317  63.806  1.00 198.66 ? 118  HIS A N     1 
ATOM   1902  C  CA    . HIS D 4  118  ? 71.207  -1.090  65.121  1.00 194.24 ? 118  HIS A CA    1 
ATOM   1903  C  C     . HIS D 4  118  ? 70.169  -0.893  66.215  1.00 186.37 ? 118  HIS A C     1 
ATOM   1904  O  O     . HIS D 4  118  ? 70.415  -1.257  67.370  1.00 191.18 ? 118  HIS A O     1 
ATOM   1905  C  CB    . HIS D 4  118  ? 72.141  0.117   65.061  1.00 197.48 ? 118  HIS A CB    1 
ATOM   1906  C  CG    . HIS D 4  118  ? 73.222  -0.013  64.035  1.00 197.37 ? 118  HIS A CG    1 
ATOM   1907  N  ND1   . HIS D 4  118  ? 73.726  -1.233  63.640  1.00 197.16 ? 118  HIS A ND1   1 
ATOM   1908  C  CD2   . HIS D 4  118  ? 73.897  0.921   63.324  1.00 197.56 ? 118  HIS A CD2   1 
ATOM   1909  C  CE1   . HIS D 4  118  ? 74.665  -1.046  62.730  1.00 197.60 ? 118  HIS A CE1   1 
ATOM   1910  N  NE2   . HIS D 4  118  ? 74.788  0.251   62.521  1.00 198.24 ? 118  HIS A NE2   1 
ATOM   1911  N  N     . ASN D 4  119  ? 69.015  -0.321  65.889  1.00 171.63 ? 119  ASN A N     1 
ATOM   1912  C  CA    . ASN D 4  119  ? 67.911  -0.294  66.836  1.00 166.63 ? 119  ASN A CA    1 
ATOM   1913  C  C     . ASN D 4  119  ? 67.243  -1.661  66.793  1.00 178.50 ? 119  ASN A C     1 
ATOM   1914  O  O     . ASN D 4  119  ? 66.691  -2.055  65.759  1.00 170.18 ? 119  ASN A O     1 
ATOM   1915  C  CB    . ASN D 4  119  ? 66.934  0.832   66.494  1.00 145.69 ? 119  ASN A CB    1 
ATOM   1916  C  CG    . ASN D 4  119  ? 65.826  1.023   67.543  1.00 136.83 ? 119  ASN A CG    1 
ATOM   1917  O  OD1   . ASN D 4  119  ? 65.201  0.071   68.017  1.00 140.16 ? 119  ASN A OD1   1 
ATOM   1918  N  ND2   . ASN D 4  119  ? 65.591  2.276   67.908  1.00 128.09 ? 119  ASN A ND2   1 
ATOM   1919  N  N     . GLU D 4  120  ? 67.316  -2.387  67.910  1.00 196.89 ? 120  GLU A N     1 
ATOM   1920  C  CA    . GLU D 4  120  ? 66.737  -3.725  67.981  1.00 200.29 ? 120  GLU A CA    1 
ATOM   1921  C  C     . GLU D 4  120  ? 65.217  -3.680  67.874  1.00 200.74 ? 120  GLU A C     1 
ATOM   1922  O  O     . GLU D 4  120  ? 64.613  -4.519  67.193  1.00 204.23 ? 120  GLU A O     1 
ATOM   1923  C  CB    . GLU D 4  120  ? 67.173  -4.399  69.284  1.00 199.58 ? 120  GLU A CB    1 
ATOM   1924  C  CG    . GLU D 4  120  ? 66.283  -5.537  69.749  1.00 193.82 ? 120  GLU A CG    1 
ATOM   1925  C  CD    . GLU D 4  120  ? 66.172  -5.601  71.257  1.00 190.09 ? 120  GLU A CD    1 
ATOM   1926  O  OE1   . GLU D 4  120  ? 65.096  -5.253  71.787  1.00 185.85 ? 120  GLU A OE1   1 
ATOM   1927  O  OE2   . GLU D 4  120  ? 67.159  -5.994  71.912  1.00 188.98 ? 120  GLU A OE2   1 
ATOM   1928  N  N     . LEU D 4  121  ? 64.589  -2.696  68.521  1.00 196.29 ? 121  LEU A N     1 
ATOM   1929  C  CA    . LEU D 4  121  ? 63.135  -2.580  68.481  1.00 184.92 ? 121  LEU A CA    1 
ATOM   1930  C  C     . LEU D 4  121  ? 62.666  -2.200  67.080  1.00 186.19 ? 121  LEU A C     1 
ATOM   1931  O  O     . LEU D 4  121  ? 61.611  -2.654  66.627  1.00 185.01 ? 121  LEU A O     1 
ATOM   1932  C  CB    . LEU D 4  121  ? 62.679  -1.551  69.522  1.00 169.50 ? 121  LEU A CB    1 
ATOM   1933  C  CG    . LEU D 4  121  ? 61.290  -1.500  70.186  1.00 149.90 ? 121  LEU A CG    1 
ATOM   1934  C  CD1   . LEU D 4  121  ? 61.201  -0.270  71.085  1.00 139.82 ? 121  LEU A CD1   1 
ATOM   1935  C  CD2   . LEU D 4  121  ? 60.093  -1.549  69.248  1.00 143.96 ? 121  LEU A CD2   1 
ATOM   1936  N  N     . MET D 4  122  ? 63.444  -1.374  66.376  1.00 183.08 ? 122  MET A N     1 
ATOM   1937  C  CA    . MET D 4  122  ? 63.122  -1.064  64.988  1.00 172.94 ? 122  MET A CA    1 
ATOM   1938  C  C     . MET D 4  122  ? 63.302  -2.291  64.103  1.00 161.94 ? 122  MET A C     1 
ATOM   1939  O  O     . MET D 4  122  ? 62.487  -2.540  63.208  1.00 149.13 ? 122  MET A O     1 
ATOM   1940  C  CB    . MET D 4  122  ? 63.994  0.094   64.497  1.00 177.27 ? 122  MET A CB    1 
ATOM   1941  C  CG    . MET D 4  122  ? 63.954  0.348   62.994  1.00 180.32 ? 122  MET A CG    1 
ATOM   1942  S  SD    . MET D 4  122  ? 62.305  0.693   62.342  1.00 186.78 ? 122  MET A SD    1 
ATOM   1943  C  CE    . MET D 4  122  ? 61.733  1.965   63.469  1.00 183.84 ? 122  MET A CE    1 
ATOM   1944  N  N     . ARG D 4  123  ? 64.346  -3.087  64.368  1.00 165.82 ? 123  ARG A N     1 
ATOM   1945  C  CA    . ARG D 4  123  ? 64.607  -4.295  63.589  1.00 164.26 ? 123  ARG A CA    1 
ATOM   1946  C  C     . ARG D 4  123  ? 63.500  -5.331  63.772  1.00 166.96 ? 123  ARG A C     1 
ATOM   1947  O  O     . ARG D 4  123  ? 63.246  -6.135  62.865  1.00 165.90 ? 123  ARG A O     1 
ATOM   1948  C  CB    . ARG D 4  123  ? 65.987  -4.848  63.973  1.00 166.65 ? 123  ARG A CB    1 
ATOM   1949  C  CG    . ARG D 4  123  ? 66.214  -6.344  63.786  1.00 161.79 ? 123  ARG A CG    1 
ATOM   1950  C  CD    . ARG D 4  123  ? 66.543  -7.015  65.105  1.00 159.23 ? 123  ARG A CD    1 
ATOM   1951  N  NE    . ARG D 4  123  ? 67.751  -6.456  65.705  1.00 158.11 ? 123  ARG A NE    1 
ATOM   1952  C  CZ    . ARG D 4  123  ? 68.269  -6.861  66.859  1.00 160.70 ? 123  ARG A CZ    1 
ATOM   1953  N  NH1   . ARG D 4  123  ? 67.682  -7.830  67.549  1.00 159.52 ? 123  ARG A NH1   1 
ATOM   1954  N  NH2   . ARG D 4  123  ? 69.373  -6.295  67.325  1.00 161.73 ? 123  ARG A NH2   1 
ATOM   1955  N  N     . GLN D 4  124  ? 62.806  -5.288  64.916  1.00 167.72 ? 124  GLN A N     1 
ATOM   1956  C  CA    . GLN D 4  124  ? 61.668  -6.170  65.173  1.00 162.97 ? 124  GLN A CA    1 
ATOM   1957  C  C     . GLN D 4  124  ? 60.588  -6.029  64.104  1.00 151.60 ? 124  GLN A C     1 
ATOM   1958  O  O     . GLN D 4  124  ? 60.004  -7.027  63.664  1.00 147.02 ? 124  GLN A O     1 
ATOM   1959  C  CB    . GLN D 4  124  ? 61.098  -5.868  66.560  1.00 165.63 ? 124  GLN A CB    1 
ATOM   1960  C  CG    . GLN D 4  124  ? 59.714  -6.429  66.834  1.00 165.96 ? 124  GLN A CG    1 
ATOM   1961  C  CD    . GLN D 4  124  ? 58.825  -5.439  67.563  1.00 164.82 ? 124  GLN A CD    1 
ATOM   1962  O  OE1   . GLN D 4  124  ? 58.292  -4.506  66.962  1.00 160.72 ? 124  GLN A OE1   1 
ATOM   1963  N  NE2   . GLN D 4  124  ? 58.660  -5.639  68.866  1.00 165.83 ? 124  GLN A NE2   1 
ATOM   1964  N  N     . ALA D 4  125  ? 60.335  -4.803  63.646  1.00 140.67 ? 125  ALA A N     1 
ATOM   1965  C  CA    . ALA D 4  125  ? 59.302  -4.580  62.645  1.00 132.93 ? 125  ALA A CA    1 
ATOM   1966  C  C     . ALA D 4  125  ? 59.775  -4.852  61.221  1.00 142.14 ? 125  ALA A C     1 
ATOM   1967  O  O     . ALA D 4  125  ? 58.938  -5.138  60.357  1.00 134.88 ? 125  ALA A O     1 
ATOM   1968  C  CB    . ALA D 4  125  ? 58.778  -3.146  62.746  1.00 121.61 ? 125  ALA A CB    1 
ATOM   1969  N  N     . LEU D 4  126  ? 61.085  -4.777  60.954  1.00 151.05 ? 126  LEU A N     1 
ATOM   1970  C  CA    . LEU D 4  126  ? 61.580  -4.923  59.586  1.00 145.90 ? 126  LEU A CA    1 
ATOM   1971  C  C     . LEU D 4  126  ? 61.458  -6.346  59.056  1.00 146.76 ? 126  LEU A C     1 
ATOM   1972  O  O     . LEU D 4  126  ? 61.530  -6.542  57.839  1.00 145.58 ? 126  LEU A O     1 
ATOM   1973  C  CB    . LEU D 4  126  ? 63.045  -4.491  59.480  1.00 142.15 ? 126  LEU A CB    1 
ATOM   1974  C  CG    . LEU D 4  126  ? 63.602  -3.279  60.224  1.00 144.01 ? 126  LEU A CG    1 
ATOM   1975  C  CD1   . LEU D 4  126  ? 65.042  -3.030  59.815  1.00 144.50 ? 126  LEU A CD1   1 
ATOM   1976  C  CD2   . LEU D 4  126  ? 62.777  -2.044  59.967  1.00 145.53 ? 126  LEU A CD2   1 
ATOM   1977  N  N     . ALA D 4  127  ? 61.293  -7.338  59.930  1.00 148.05 ? 127  ALA A N     1 
ATOM   1978  C  CA    . ALA D 4  127  ? 61.275  -8.724  59.483  1.00 144.91 ? 127  ALA A CA    1 
ATOM   1979  C  C     . ALA D 4  127  ? 59.914  -9.172  58.970  1.00 148.77 ? 127  ALA A C     1 
ATOM   1980  O  O     . ALA D 4  127  ? 59.849  -10.154 58.222  1.00 151.45 ? 127  ALA A O     1 
ATOM   1981  C  CB    . ALA D 4  127  ? 61.714  -9.653  60.618  1.00 142.90 ? 127  ALA A CB    1 
ATOM   1982  N  N     . ILE D 4  128  ? 58.831  -8.490  59.353  1.00 151.81 ? 128  ILE A N     1 
ATOM   1983  C  CA    . ILE D 4  128  ? 57.500  -8.964  58.994  1.00 157.65 ? 128  ILE A CA    1 
ATOM   1984  C  C     . ILE D 4  128  ? 57.241  -8.715  57.508  1.00 166.08 ? 128  ILE A C     1 
ATOM   1985  O  O     . ILE D 4  128  ? 57.745  -7.753  56.910  1.00 169.07 ? 128  ILE A O     1 
ATOM   1986  C  CB    . ILE D 4  128  ? 56.430  -8.318  59.899  1.00 147.91 ? 128  ILE A CB    1 
ATOM   1987  C  CG1   . ILE D 4  128  ? 55.109  -9.101  59.860  1.00 143.37 ? 128  ILE A CG1   1 
ATOM   1988  C  CG2   . ILE D 4  128  ? 56.208  -6.864  59.565  1.00 138.90 ? 128  ILE A CG2   1 
ATOM   1989  C  CD1   . ILE D 4  128  ? 55.269  -10.603 59.954  1.00 136.48 ? 128  ILE A CD1   1 
ATOM   1990  N  N     . LYS D 4  129  ? 56.470  -9.616  56.901  1.00 164.19 ? 129  LYS A N     1 
ATOM   1991  C  CA    . LYS D 4  129  ? 56.385  -9.732  55.450  1.00 161.90 ? 129  LYS A CA    1 
ATOM   1992  C  C     . LYS D 4  129  ? 55.321  -8.840  54.828  1.00 156.76 ? 129  LYS A C     1 
ATOM   1993  O  O     . LYS D 4  129  ? 55.435  -8.489  53.647  1.00 153.10 ? 129  LYS A O     1 
ATOM   1994  C  CB    . LYS D 4  129  ? 56.111  -11.190 55.072  1.00 164.81 ? 129  LYS A CB    1 
ATOM   1995  C  CG    . LYS D 4  129  ? 56.802  -12.176 56.001  1.00 167.08 ? 129  LYS A CG    1 
ATOM   1996  C  CD    . LYS D 4  129  ? 56.197  -13.566 55.917  1.00 167.71 ? 129  LYS A CD    1 
ATOM   1997  C  CE    . LYS D 4  129  ? 56.540  -14.245 54.606  1.00 166.21 ? 129  LYS A CE    1 
ATOM   1998  N  NZ    . LYS D 4  129  ? 57.611  -15.261 54.793  1.00 164.02 ? 129  LYS A NZ    1 
ATOM   1999  N  N     . ASP D 4  130  ? 54.290  -8.474  55.590  1.00 152.99 ? 130  ASP A N     1 
ATOM   2000  C  CA    . ASP D 4  130  ? 53.234  -7.600  55.088  1.00 146.33 ? 130  ASP A CA    1 
ATOM   2001  C  C     . ASP D 4  130  ? 53.840  -6.225  54.842  1.00 146.78 ? 130  ASP A C     1 
ATOM   2002  O  O     . ASP D 4  130  ? 54.167  -5.507  55.790  1.00 149.83 ? 130  ASP A O     1 
ATOM   2003  C  CB    . ASP D 4  130  ? 52.081  -7.551  56.092  1.00 140.58 ? 130  ASP A CB    1 
ATOM   2004  C  CG    . ASP D 4  130  ? 50.884  -6.714  55.618  1.00 133.08 ? 130  ASP A CG    1 
ATOM   2005  O  OD1   . ASP D 4  130  ? 51.026  -5.529  55.237  1.00 132.61 ? 130  ASP A OD1   1 
ATOM   2006  O  OD2   . ASP D 4  130  ? 49.763  -7.261  55.634  1.00 132.28 ? 130  ASP A OD2   1 
ATOM   2007  N  N     . SER D 4  131  ? 53.990  -5.861  53.566  1.00 146.94 ? 131  SER A N     1 
ATOM   2008  C  CA    . SER D 4  131  ? 54.670  -4.618  53.217  1.00 152.10 ? 131  SER A CA    1 
ATOM   2009  C  C     . SER D 4  131  ? 53.859  -3.388  53.604  1.00 156.73 ? 131  SER A C     1 
ATOM   2010  O  O     . SER D 4  131  ? 54.440  -2.334  53.888  1.00 156.47 ? 131  SER A O     1 
ATOM   2011  C  CB    . SER D 4  131  ? 54.978  -4.604  51.722  1.00 146.12 ? 131  SER A CB    1 
ATOM   2012  O  OG    . SER D 4  131  ? 55.433  -5.876  51.291  1.00 141.46 ? 131  SER A OG    1 
ATOM   2013  N  N     . LYS D 4  132  ? 52.530  -3.496  53.625  1.00 157.35 ? 132  LYS A N     1 
ATOM   2014  C  CA    . LYS D 4  132  ? 51.704  -2.357  54.013  1.00 147.72 ? 132  LYS A CA    1 
ATOM   2015  C  C     . LYS D 4  132  ? 51.713  -2.155  55.524  1.00 139.78 ? 132  LYS A C     1 
ATOM   2016  O  O     . LYS D 4  132  ? 51.838  -1.024  56.005  1.00 138.32 ? 132  LYS A O     1 
ATOM   2017  C  CB    . LYS D 4  132  ? 50.269  -2.544  53.515  1.00 134.99 ? 132  LYS A CB    1 
ATOM   2018  C  CG    . LYS D 4  132  ? 50.143  -3.100  52.108  1.00 120.01 ? 132  LYS A CG    1 
ATOM   2019  C  CD    . LYS D 4  132  ? 48.689  -3.092  51.663  1.00 109.08 ? 132  LYS A CD    1 
ATOM   2020  C  CE    . LYS D 4  132  ? 48.066  -4.473  51.777  1.00 106.84 ? 132  LYS A CE    1 
ATOM   2021  N  NZ    . LYS D 4  132  ? 46.579  -4.403  51.813  1.00 96.62  ? 132  LYS A NZ    1 
ATOM   2022  N  N     . LYS D 4  133  ? 51.573  -3.245  56.285  1.00 130.58 ? 133  LYS A N     1 
ATOM   2023  C  CA    . LYS D 4  133  ? 51.513  -3.132  57.739  1.00 124.88 ? 133  LYS A CA    1 
ATOM   2024  C  C     . LYS D 4  133  ? 52.865  -2.744  58.322  1.00 118.95 ? 133  LYS A C     1 
ATOM   2025  O  O     . LYS D 4  133  ? 52.931  -2.009  59.313  1.00 119.15 ? 133  LYS A O     1 
ATOM   2026  C  CB    . LYS D 4  133  ? 51.031  -4.446  58.351  1.00 124.40 ? 133  LYS A CB    1 
ATOM   2027  C  CG    . LYS D 4  133  ? 49.546  -4.710  58.180  1.00 123.23 ? 133  LYS A CG    1 
ATOM   2028  C  CD    . LYS D 4  133  ? 49.147  -6.015  58.849  1.00 118.49 ? 133  LYS A CD    1 
ATOM   2029  C  CE    . LYS D 4  133  ? 47.754  -5.926  59.447  1.00 108.78 ? 133  LYS A CE    1 
ATOM   2030  N  NZ    . LYS D 4  133  ? 47.134  -7.270  59.605  1.00 99.08  ? 133  LYS A NZ    1 
ATOM   2031  N  N     . ARG D 4  134  ? 53.952  -3.227  57.718  1.00 116.03 ? 134  ARG A N     1 
ATOM   2032  C  CA    . ARG D 4  134  ? 55.284  -2.937  58.236  1.00 113.21 ? 134  ARG A CA    1 
ATOM   2033  C  C     . ARG D 4  134  ? 55.670  -1.483  58.010  1.00 115.98 ? 134  ARG A C     1 
ATOM   2034  O  O     . ARG D 4  134  ? 56.241  -0.849  58.905  1.00 107.67 ? 134  ARG A O     1 
ATOM   2035  C  CB    . ARG D 4  134  ? 56.301  -3.867  57.585  1.00 109.11 ? 134  ARG A CB    1 
ATOM   2036  C  CG    . ARG D 4  134  ? 57.743  -3.445  57.705  1.00 110.89 ? 134  ARG A CG    1 
ATOM   2037  C  CD    . ARG D 4  134  ? 58.356  -3.488  56.334  1.00 111.49 ? 134  ARG A CD    1 
ATOM   2038  N  NE    . ARG D 4  134  ? 58.272  -4.832  55.775  1.00 119.93 ? 134  ARG A NE    1 
ATOM   2039  C  CZ    . ARG D 4  134  ? 58.893  -5.223  54.669  1.00 122.55 ? 134  ARG A CZ    1 
ATOM   2040  N  NH1   . ARG D 4  134  ? 58.762  -6.469  54.235  1.00 122.67 ? 134  ARG A NH1   1 
ATOM   2041  N  NH2   . ARG D 4  134  ? 59.632  -4.364  53.987  1.00 122.24 ? 134  ARG A NH2   1 
ATOM   2042  N  N     . PHE D 4  135  ? 55.356  -0.944  56.824  1.00 129.34 ? 135  PHE A N     1 
ATOM   2043  C  CA    . PHE D 4  135  ? 55.728  0.427   56.472  1.00 144.97 ? 135  PHE A CA    1 
ATOM   2044  C  C     . PHE D 4  135  ? 55.156  1.428   57.464  1.00 148.67 ? 135  PHE A C     1 
ATOM   2045  O  O     . PHE D 4  135  ? 55.874  2.305   57.959  1.00 160.13 ? 135  PHE A O     1 
ATOM   2046  C  CB    . PHE D 4  135  ? 55.258  0.736   55.042  1.00 151.63 ? 135  PHE A CB    1 
ATOM   2047  C  CG    . PHE D 4  135  ? 55.380  2.193   54.640  1.00 145.13 ? 135  PHE A CG    1 
ATOM   2048  C  CD1   . PHE D 4  135  ? 56.504  2.638   53.965  1.00 141.36 ? 135  PHE A CD1   1 
ATOM   2049  C  CD2   . PHE D 4  135  ? 54.339  3.096   54.855  1.00 140.45 ? 135  PHE A CD2   1 
ATOM   2050  C  CE1   . PHE D 4  135  ? 56.617  3.961   53.575  1.00 142.06 ? 135  PHE A CE1   1 
ATOM   2051  C  CE2   . PHE D 4  135  ? 54.455  4.417   54.476  1.00 140.91 ? 135  PHE A CE2   1 
ATOM   2052  C  CZ    . PHE D 4  135  ? 55.591  4.848   53.829  1.00 143.48 ? 135  PHE A CZ    1 
ATOM   2053  N  N     . ALA D 4  136  ? 53.857  1.325   57.748  1.00 140.87 ? 136  ALA A N     1 
ATOM   2054  C  CA    . ALA D 4  136  ? 53.255  2.196   58.750  1.00 140.89 ? 136  ALA A CA    1 
ATOM   2055  C  C     . ALA D 4  136  ? 53.839  1.924   60.129  1.00 152.69 ? 136  ALA A C     1 
ATOM   2056  O  O     . ALA D 4  136  ? 54.082  2.858   60.899  1.00 158.87 ? 136  ALA A O     1 
ATOM   2057  C  CB    . ALA D 4  136  ? 51.737  2.019   58.758  1.00 132.72 ? 136  ALA A CB    1 
ATOM   2058  N  N     . ALA D 4  137  ? 54.112  0.653   60.443  1.00 158.05 ? 137  ALA A N     1 
ATOM   2059  C  CA    . ALA D 4  137  ? 54.714  0.321   61.730  1.00 165.81 ? 137  ALA A CA    1 
ATOM   2060  C  C     . ALA D 4  137  ? 56.151  0.817   61.814  1.00 164.98 ? 137  ALA A C     1 
ATOM   2061  O  O     . ALA D 4  137  ? 56.604  1.236   62.887  1.00 174.83 ? 137  ALA A O     1 
ATOM   2062  C  CB    . ALA D 4  137  ? 54.656  -1.186  61.970  1.00 171.09 ? 137  ALA A CB    1 
ATOM   2063  N  N     . ILE D 4  138  ? 56.886  0.757   60.699  1.00 149.45 ? 138  ILE A N     1 
ATOM   2064  C  CA    . ILE D 4  138  ? 58.215  1.362   60.632  1.00 129.27 ? 138  ILE A CA    1 
ATOM   2065  C  C     . ILE D 4  138  ? 58.121  2.857   60.901  1.00 125.48 ? 138  ILE A C     1 
ATOM   2066  O  O     . ILE D 4  138  ? 58.869  3.411   61.715  1.00 132.04 ? 138  ILE A O     1 
ATOM   2067  C  CB    . ILE D 4  138  ? 58.861  1.088   59.260  1.00 113.75 ? 138  ILE A CB    1 
ATOM   2068  C  CG1   . ILE D 4  138  ? 59.410  -0.335  59.172  1.00 109.73 ? 138  ILE A CG1   1 
ATOM   2069  C  CG2   . ILE D 4  138  ? 59.974  2.093   58.967  1.00 105.35 ? 138  ILE A CG2   1 
ATOM   2070  C  CD1   . ILE D 4  138  ? 60.174  -0.594  57.888  1.00 107.77 ? 138  ILE A CD1   1 
ATOM   2071  N  N     . TRP D 4  139  ? 57.164  3.519   60.250  1.00 122.63 ? 139  TRP A N     1 
ATOM   2072  C  CA    . TRP D 4  139  ? 57.134  4.975   60.244  1.00 126.24 ? 139  TRP A CA    1 
ATOM   2073  C  C     . TRP D 4  139  ? 56.704  5.538   61.594  1.00 140.96 ? 139  TRP A C     1 
ATOM   2074  O  O     . TRP D 4  139  ? 57.185  6.600   61.996  1.00 146.57 ? 139  TRP A O     1 
ATOM   2075  C  CB    . TRP D 4  139  ? 56.216  5.461   59.123  1.00 114.66 ? 139  TRP A CB    1 
ATOM   2076  C  CG    . TRP D 4  139  ? 55.754  6.874   59.259  1.00 106.39 ? 139  TRP A CG    1 
ATOM   2077  C  CD1   . TRP D 4  139  ? 56.366  7.986   58.766  1.00 106.91 ? 139  TRP A CD1   1 
ATOM   2078  C  CD2   . TRP D 4  139  ? 54.566  7.327   59.914  1.00 105.69 ? 139  TRP A CD2   1 
ATOM   2079  N  NE1   . TRP D 4  139  ? 55.638  9.107   59.081  1.00 110.79 ? 139  TRP A NE1   1 
ATOM   2080  C  CE2   . TRP D 4  139  ? 54.528  8.728   59.789  1.00 115.25 ? 139  TRP A CE2   1 
ATOM   2081  C  CE3   . TRP D 4  139  ? 53.537  6.683   60.604  1.00 102.87 ? 139  TRP A CE3   1 
ATOM   2082  C  CZ2   . TRP D 4  139  ? 53.498  9.496   60.326  1.00 123.27 ? 139  TRP A CZ2   1 
ATOM   2083  C  CZ3   . TRP D 4  139  ? 52.517  7.444   61.137  1.00 111.48 ? 139  TRP A CZ3   1 
ATOM   2084  C  CH2   . TRP D 4  139  ? 52.504  8.836   60.995  1.00 122.02 ? 139  TRP A CH2   1 
ATOM   2085  N  N     . THR D 4  140  ? 55.803  4.848   62.306  1.00 145.86 ? 140  THR A N     1 
ATOM   2086  C  CA    . THR D 4  140  ? 55.366  5.320   63.622  1.00 149.25 ? 140  THR A CA    1 
ATOM   2087  C  C     . THR D 4  140  ? 56.521  5.370   64.613  1.00 156.25 ? 140  THR A C     1 
ATOM   2088  O  O     . THR D 4  140  ? 56.705  6.368   65.320  1.00 155.69 ? 140  THR A O     1 
ATOM   2089  C  CB    . THR D 4  140  ? 54.250  4.433   64.181  1.00 148.41 ? 140  THR A CB    1 
ATOM   2090  O  OG1   . THR D 4  140  ? 54.710  3.078   64.288  1.00 150.38 ? 140  THR A OG1   1 
ATOM   2091  C  CG2   . THR D 4  140  ? 52.971  4.526   63.362  1.00 139.74 ? 140  THR A CG2   1 
ATOM   2092  N  N     . LEU D 4  141  ? 57.306  4.297   64.683  1.00 164.50 ? 141  LEU A N     1 
ATOM   2093  C  CA    . LEU D 4  141  ? 58.394  4.242   65.652  1.00 168.54 ? 141  LEU A CA    1 
ATOM   2094  C  C     . LEU D 4  141  ? 59.556  5.132   65.243  1.00 175.93 ? 141  LEU A C     1 
ATOM   2095  O  O     . LEU D 4  141  ? 60.287  5.631   66.105  1.00 186.00 ? 141  LEU A O     1 
ATOM   2096  C  CB    . LEU D 4  141  ? 58.861  2.799   65.817  1.00 159.09 ? 141  LEU A CB    1 
ATOM   2097  C  CG    . LEU D 4  141  ? 57.958  1.948   66.705  1.00 147.73 ? 141  LEU A CG    1 
ATOM   2098  C  CD1   . LEU D 4  141  ? 58.439  0.517   66.712  1.00 143.69 ? 141  LEU A CD1   1 
ATOM   2099  C  CD2   . LEU D 4  141  ? 57.922  2.516   68.114  1.00 145.52 ? 141  LEU A CD2   1 
ATOM   2100  N  N     . CYS D 4  142  ? 59.736  5.345   63.945  1.00 167.12 ? 142  CYS A N     1 
ATOM   2101  C  CA    . CYS D 4  142  ? 60.870  6.100   63.441  1.00 163.16 ? 142  CYS A CA    1 
ATOM   2102  C  C     . CYS D 4  142  ? 60.553  7.585   63.275  1.00 165.22 ? 142  CYS A C     1 
ATOM   2103  O  O     . CYS D 4  142  ? 61.490  8.379   63.156  1.00 176.21 ? 142  CYS A O     1 
ATOM   2104  C  CB    . CYS D 4  142  ? 61.342  5.448   62.127  1.00 154.79 ? 142  CYS A CB    1 
ATOM   2105  S  SG    . CYS D 4  142  ? 62.269  6.402   60.910  1.00 149.68 ? 142  CYS A SG    1 
ATOM   2106  N  N     . LYS D 4  143  ? 59.267  7.968   63.377  1.00 160.01 ? 143  LYS A N     1 
ATOM   2107  C  CA    . LYS D 4  143  ? 58.815  9.342   63.121  1.00 153.91 ? 143  LYS A CA    1 
ATOM   2108  C  C     . LYS D 4  143  ? 59.528  10.359  64.008  1.00 175.96 ? 143  LYS A C     1 
ATOM   2109  O  O     . LYS D 4  143  ? 59.897  11.445  63.545  1.00 173.37 ? 143  LYS A O     1 
ATOM   2110  C  CB    . LYS D 4  143  ? 57.297  9.434   63.326  1.00 131.46 ? 143  LYS A CB    1 
ATOM   2111  C  CG    . LYS D 4  143  ? 56.780  10.697  64.008  1.00 123.24 ? 143  LYS A CG    1 
ATOM   2112  C  CD    . LYS D 4  143  ? 55.273  10.851  63.855  1.00 116.81 ? 143  LYS A CD    1 
ATOM   2113  C  CE    . LYS D 4  143  ? 54.533  9.705   64.532  1.00 105.70 ? 143  LYS A CE    1 
ATOM   2114  N  NZ    . LYS D 4  143  ? 53.150  10.084  64.940  1.00 99.49  ? 143  LYS A NZ    1 
ATOM   2115  N  N     . THR D 4  144  ? 59.749  10.021  65.279  1.00 193.05 ? 144  THR A N     1 
ATOM   2116  C  CA    . THR D 4  144  ? 60.341  10.958  66.235  1.00 197.73 ? 144  THR A CA    1 
ATOM   2117  C  C     . THR D 4  144  ? 61.861  10.879  66.116  1.00 191.63 ? 144  THR A C     1 
ATOM   2118  O  O     . THR D 4  144  ? 62.544  10.164  66.852  1.00 198.66 ? 144  THR A O     1 
ATOM   2119  C  CB    . THR D 4  144  ? 59.868  10.650  67.648  1.00 206.33 ? 144  THR A CB    1 
ATOM   2120  O  OG1   . THR D 4  144  ? 58.508  10.187  67.602  1.00 208.01 ? 144  THR A OG1   1 
ATOM   2121  C  CG2   . THR D 4  144  ? 59.935  11.893  68.517  1.00 207.01 ? 144  THR A CG2   1 
ATOM   2122  N  N     . LYS D 4  145  ? 62.398  11.648  65.163  1.00 171.12 ? 145  LYS A N     1 
ATOM   2123  C  CA    . LYS D 4  145  ? 63.840  11.657  64.913  1.00 154.63 ? 145  LYS A CA    1 
ATOM   2124  C  C     . LYS D 4  145  ? 64.166  12.939  64.148  1.00 155.15 ? 145  LYS A C     1 
ATOM   2125  O  O     . LYS D 4  145  ? 63.985  12.995  62.928  1.00 151.25 ? 145  LYS A O     1 
ATOM   2126  C  CB    . LYS D 4  145  ? 64.272  10.418  64.149  1.00 143.93 ? 145  LYS A CB    1 
ATOM   2127  N  N     . MET D 4  146  ? 64.649  13.953  64.871  1.00 166.99 ? 146  MET A N     1 
ATOM   2128  C  CA    . MET D 4  146  ? 64.966  15.231  64.238  1.00 178.65 ? 146  MET A CA    1 
ATOM   2129  C  C     . MET D 4  146  ? 66.216  15.137  63.365  1.00 181.64 ? 146  MET A C     1 
ATOM   2130  O  O     . MET D 4  146  ? 66.242  15.681  62.256  1.00 184.79 ? 146  MET A O     1 
ATOM   2131  C  CB    . MET D 4  146  ? 65.125  16.321  65.305  1.00 188.06 ? 146  MET A CB    1 
ATOM   2132  C  CG    . MET D 4  146  ? 66.064  15.966  66.458  1.00 192.72 ? 146  MET A CG    1 
ATOM   2133  S  SD    . MET D 4  146  ? 66.557  17.385  67.453  1.00 197.61 ? 146  MET A SD    1 
ATOM   2134  C  CE    . MET D 4  146  ? 66.149  16.799  69.093  1.00 193.76 ? 146  MET A CE    1 
ATOM   2135  N  N     . VAL D 4  147  ? 67.263  14.471  63.852  1.00 179.61 ? 147  VAL A N     1 
ATOM   2136  C  CA    . VAL D 4  147  ? 68.486  14.233  63.101  1.00 179.91 ? 147  VAL A CA    1 
ATOM   2137  C  C     . VAL D 4  147  ? 68.751  12.735  63.101  1.00 179.09 ? 147  VAL A C     1 
ATOM   2138  O  O     . VAL D 4  147  ? 68.151  11.968  63.858  1.00 174.12 ? 147  VAL A O     1 
ATOM   2139  C  CB    . VAL D 4  147  ? 69.702  14.952  63.712  1.00 181.60 ? 147  VAL A CB    1 
ATOM   2140  C  CG1   . VAL D 4  147  ? 69.531  16.452  63.708  1.00 181.56 ? 147  VAL A CG1   1 
ATOM   2141  C  CG2   . VAL D 4  147  ? 69.952  14.413  65.135  1.00 181.44 ? 147  VAL A CG2   1 
ATOM   2142  N  N     . CYS D 4  148  ? 69.672  12.325  62.246  1.00 187.24 ? 148  CYS A N     1 
ATOM   2143  C  CA    . CYS D 4  148  ? 70.341  11.047  62.406  1.00 198.42 ? 148  CYS A CA    1 
ATOM   2144  C  C     . CYS D 4  148  ? 71.710  11.316  63.016  1.00 210.68 ? 148  CYS A C     1 
ATOM   2145  O  O     . CYS D 4  148  ? 72.479  12.128  62.491  1.00 216.36 ? 148  CYS A O     1 
ATOM   2146  C  CB    . CYS D 4  148  ? 70.463  10.302  61.076  1.00 196.23 ? 148  CYS A CB    1 
ATOM   2147  S  SG    . CYS D 4  148  ? 71.842  9.131   60.989  1.00 201.19 ? 148  CYS A SG    1 
ATOM   2148  N  N     . GLU D 4  149  ? 72.007  10.636  64.122  1.00 216.05 ? 149  GLU A N     1 
ATOM   2149  C  CA    . GLU D 4  149  ? 73.240  10.871  64.864  1.00 223.09 ? 149  GLU A CA    1 
ATOM   2150  C  C     . GLU D 4  149  ? 74.455  10.403  64.061  1.00 221.48 ? 149  GLU A C     1 
ATOM   2151  O  O     . GLU D 4  149  ? 74.344  9.847   62.963  1.00 222.52 ? 149  GLU A O     1 
ATOM   2152  C  CB    . GLU D 4  149  ? 73.190  10.163  66.216  1.00 221.11 ? 149  GLU A CB    1 
ATOM   2153  C  CG    . GLU D 4  149  ? 72.181  10.728  67.206  1.00 213.66 ? 149  GLU A CG    1 
ATOM   2154  C  CD    . GLU D 4  149  ? 72.696  11.955  67.933  1.00 206.63 ? 149  GLU A CD    1 
ATOM   2155  O  OE1   . GLU D 4  149  ? 73.923  12.187  67.914  1.00 204.39 ? 149  GLU A OE1   1 
ATOM   2156  O  OE2   . GLU D 4  149  ? 71.876  12.679  68.536  1.00 202.36 ? 149  GLU A OE2   1 
ATOM   2157  N  N     . THR D 4  150  ? 75.642  10.640  64.623  1.00 212.97 ? 150  THR A N     1 
ATOM   2158  C  CA    . THR D 4  150  ? 76.864  10.136  64.008  1.00 203.53 ? 150  THR A CA    1 
ATOM   2159  C  C     . THR D 4  150  ? 76.897  8.615   64.050  1.00 208.65 ? 150  THR A C     1 
ATOM   2160  O  O     . THR D 4  150  ? 76.909  7.953   63.005  1.00 212.04 ? 150  THR A O     1 
ATOM   2161  C  CB    . THR D 4  150  ? 78.091  10.721  64.708  1.00 193.80 ? 150  THR A CB    1 
ATOM   2162  O  OG1   . THR D 4  150  ? 77.835  10.826  66.115  1.00 194.49 ? 150  THR A OG1   1 
ATOM   2163  C  CG2   . THR D 4  150  ? 78.422  12.094  64.148  1.00 186.60 ? 150  THR A CG2   1 
ATOM   2164  N  N     . ASP D 4  151  ? 76.880  8.043   65.253  1.00 207.38 ? 151  ASP A N     1 
ATOM   2165  C  CA    . ASP D 4  151  ? 76.928  6.596   65.401  1.00 206.00 ? 151  ASP A CA    1 
ATOM   2166  C  C     . ASP D 4  151  ? 76.322  6.198   66.741  1.00 202.85 ? 151  ASP A C     1 
ATOM   2167  O  O     . ASP D 4  151  ? 76.078  7.035   67.613  1.00 204.51 ? 151  ASP A O     1 
ATOM   2168  C  CB    . ASP D 4  151  ? 78.361  6.085   65.268  1.00 210.65 ? 151  ASP A CB    1 
ATOM   2169  C  CG    . ASP D 4  151  ? 78.669  5.606   63.869  1.00 212.30 ? 151  ASP A CG    1 
ATOM   2170  O  OD1   . ASP D 4  151  ? 77.888  4.781   63.351  1.00 210.10 ? 151  ASP A OD1   1 
ATOM   2171  O  OD2   . ASP D 4  151  ? 79.684  6.050   63.287  1.00 215.06 ? 151  ASP A OD2   1 
ATOM   2172  N  N     . VAL D 4  152  ? 76.060  4.897   66.876  1.00 199.43 ? 152  VAL A N     1 
ATOM   2173  C  CA    . VAL D 4  152  ? 75.398  4.270   68.024  1.00 194.18 ? 152  VAL A CA    1 
ATOM   2174  C  C     . VAL D 4  152  ? 76.105  2.947   68.322  1.00 195.35 ? 152  VAL A C     1 
ATOM   2175  O  O     . VAL D 4  152  ? 76.928  2.505   67.505  1.00 201.99 ? 152  VAL A O     1 
ATOM   2176  C  CB    . VAL D 4  152  ? 73.896  4.051   67.752  1.00 187.42 ? 152  VAL A CB    1 
ATOM   2177  C  CG1   . VAL D 4  152  ? 73.133  5.368   67.605  1.00 187.22 ? 152  VAL A CG1   1 
ATOM   2178  C  CG2   . VAL D 4  152  ? 73.721  3.210   66.507  1.00 179.55 ? 152  VAL A CG2   1 
ATOM   2179  N  N     . PRO D 4  153  ? 75.853  2.287   69.479  1.00 194.43 ? 153  PRO A N     1 
ATOM   2180  C  CA    . PRO D 4  153  ? 76.344  0.932   69.768  1.00 194.81 ? 153  PRO A CA    1 
ATOM   2181  C  C     . PRO D 4  153  ? 76.050  -0.114  68.690  1.00 194.71 ? 153  PRO A C     1 
ATOM   2182  O  O     . PRO D 4  153  ? 76.629  -1.199  68.749  1.00 193.27 ? 153  PRO A O     1 
ATOM   2183  C  CB    . PRO D 4  153  ? 75.594  0.568   71.066  1.00 191.94 ? 153  PRO A CB    1 
ATOM   2184  C  CG    . PRO D 4  153  ? 74.609  1.721   71.290  1.00 187.09 ? 153  PRO A CG    1 
ATOM   2185  C  CD    . PRO D 4  153  ? 75.354  2.873   70.730  1.00 190.83 ? 153  PRO A CD    1 
ATOM   2186  N  N     . LEU D 4  161  ? 79.270  2.650   69.666  1.00 160.32 ? 161  LEU A N     1 
ATOM   2187  C  CA    . LEU D 4  161  ? 80.672  2.254   69.680  1.00 168.01 ? 161  LEU A CA    1 
ATOM   2188  C  C     . LEU D 4  161  ? 81.083  1.678   68.324  1.00 173.47 ? 161  LEU A C     1 
ATOM   2189  O  O     . LEU D 4  161  ? 82.265  1.448   68.071  1.00 176.65 ? 161  LEU A O     1 
ATOM   2190  C  CB    . LEU D 4  161  ? 80.930  1.235   70.795  1.00 167.65 ? 161  LEU A CB    1 
ATOM   2191  C  CG    . LEU D 4  161  ? 81.725  1.722   72.012  1.00 163.69 ? 161  LEU A CG    1 
ATOM   2192  C  CD1   . LEU D 4  161  ? 80.875  2.637   72.883  1.00 163.54 ? 161  LEU A CD1   1 
ATOM   2193  C  CD2   . LEU D 4  161  ? 82.256  0.548   72.821  1.00 163.18 ? 161  LEU A CD2   1 
ATOM   2194  N  N     . VAL D 4  162  ? 80.101  1.450   67.455  1.00 171.27 ? 162  VAL A N     1 
ATOM   2195  C  CA    . VAL D 4  162  ? 80.335  0.916   66.121  1.00 176.07 ? 162  VAL A CA    1 
ATOM   2196  C  C     . VAL D 4  162  ? 80.021  2.001   65.097  1.00 193.59 ? 162  VAL A C     1 
ATOM   2197  O  O     . VAL D 4  162  ? 79.392  3.017   65.404  1.00 197.11 ? 162  VAL A O     1 
ATOM   2198  C  CB    . VAL D 4  162  ? 79.507  -0.360  65.859  1.00 162.57 ? 162  VAL A CB    1 
ATOM   2199  C  CG1   . VAL D 4  162  ? 79.555  -1.280  67.072  1.00 147.78 ? 162  VAL A CG1   1 
ATOM   2200  C  CG2   . VAL D 4  162  ? 78.069  -0.001  65.524  1.00 166.71 ? 162  VAL A CG2   1 
ATOM   2201  N  N     . SER D 4  163  ? 80.466  1.778   63.858  1.00 207.29 ? 163  SER A N     1 
ATOM   2202  C  CA    . SER D 4  163  ? 80.430  2.804   62.820  1.00 210.87 ? 163  SER A CA    1 
ATOM   2203  C  C     . SER D 4  163  ? 79.548  2.360   61.659  1.00 214.36 ? 163  SER A C     1 
ATOM   2204  O  O     . SER D 4  163  ? 79.792  1.312   61.053  1.00 206.81 ? 163  SER A O     1 
ATOM   2205  C  CB    . SER D 4  163  ? 81.838  3.133   62.319  1.00 209.73 ? 163  SER A CB    1 
ATOM   2206  O  OG    . SER D 4  163  ? 81.789  4.060   61.246  1.00 204.66 ? 163  SER A OG    1 
ATOM   2207  N  N     . ARG D 4  164  ? 78.543  3.169   61.339  1.00 225.74 ? 164  ARG A N     1 
ATOM   2208  C  CA    . ARG D 4  164  ? 77.700  2.955   60.167  1.00 221.51 ? 164  ARG A CA    1 
ATOM   2209  C  C     . ARG D 4  164  ? 77.634  4.271   59.395  1.00 215.97 ? 164  ARG A C     1 
ATOM   2210  O  O     . ARG D 4  164  ? 78.468  5.170   59.567  1.00 226.32 ? 164  ARG A O     1 
ATOM   2211  C  CB    . ARG D 4  164  ? 76.314  2.438   60.573  1.00 217.64 ? 164  ARG A CB    1 
ATOM   2212  C  CG    . ARG D 4  164  ? 75.505  3.411   61.429  1.00 214.00 ? 164  ARG A CG    1 
ATOM   2213  C  CD    . ARG D 4  164  ? 74.084  3.599   60.904  1.00 205.32 ? 164  ARG A CD    1 
ATOM   2214  N  NE    . ARG D 4  164  ? 73.495  4.841   61.401  1.00 199.71 ? 164  ARG A NE    1 
ATOM   2215  C  CZ    . ARG D 4  164  ? 72.265  5.260   61.118  1.00 188.00 ? 164  ARG A CZ    1 
ATOM   2216  N  NH1   . ARG D 4  164  ? 71.821  6.407   61.618  1.00 187.74 ? 164  ARG A NH1   1 
ATOM   2217  N  NH2   . ARG D 4  164  ? 71.486  4.547   60.319  1.00 177.86 ? 164  ARG A NH2   1 
ATOM   2218  N  N     . GLY D 4  165  ? 76.637  4.390   58.520  1.00 195.67 ? 165  GLY A N     1 
ATOM   2219  C  CA    . GLY D 4  165  ? 76.427  5.638   57.808  1.00 178.90 ? 165  GLY A CA    1 
ATOM   2220  C  C     . GLY D 4  165  ? 75.967  6.743   58.745  1.00 176.82 ? 165  GLY A C     1 
ATOM   2221  O  O     . GLY D 4  165  ? 75.212  6.513   59.691  1.00 171.12 ? 165  GLY A O     1 
ATOM   2222  N  N     . GLY D 4  166  ? 76.434  7.949   58.476  1.00 174.07 ? 166  GLY A N     1 
ATOM   2223  C  CA    . GLY D 4  166  ? 76.147  9.090   59.332  1.00 174.17 ? 166  GLY A CA    1 
ATOM   2224  C  C     . GLY D 4  166  ? 75.617  10.266  58.544  1.00 177.65 ? 166  GLY A C     1 
ATOM   2225  O  O     . GLY D 4  166  ? 76.052  10.522  57.424  1.00 174.51 ? 166  GLY A O     1 
ATOM   2226  N  N     . CYS D 4  167  ? 74.675  10.983  59.149  1.00 185.95 ? 167  CYS A N     1 
ATOM   2227  C  CA    . CYS D 4  167  ? 74.059  12.146  58.531  1.00 194.84 ? 167  CYS A CA    1 
ATOM   2228  C  C     . CYS D 4  167  ? 74.714  13.446  58.966  1.00 198.42 ? 167  CYS A C     1 
ATOM   2229  O  O     . CYS D 4  167  ? 75.489  14.046  58.215  1.00 194.72 ? 167  CYS A O     1 
ATOM   2230  C  CB    . CYS D 4  167  ? 72.570  12.199  58.869  1.00 195.69 ? 167  CYS A CB    1 
ATOM   2231  S  SG    . CYS D 4  167  ? 71.634  13.410  57.931  1.00 194.18 ? 167  CYS A SG    1 
ATOM   2232  N  N     . GLY D 4  168  ? 74.388  13.894  60.175  1.00 203.90 ? 168  GLY A N     1 
ATOM   2233  C  CA    . GLY D 4  168  ? 74.801  15.200  60.627  1.00 212.55 ? 168  GLY A CA    1 
ATOM   2234  C  C     . GLY D 4  168  ? 73.899  16.334  60.200  1.00 212.35 ? 168  GLY A C     1 
ATOM   2235  O  O     . GLY D 4  168  ? 74.236  17.497  60.448  1.00 220.90 ? 168  GLY A O     1 
ATOM   2236  N  N     . ASN D 4  169  ? 72.764  16.040  59.568  1.00 202.40 ? 169  ASN A N     1 
ATOM   2237  C  CA    . ASN D 4  169  ? 71.828  17.058  59.119  1.00 196.47 ? 169  ASN A CA    1 
ATOM   2238  C  C     . ASN D 4  169  ? 70.498  16.907  59.840  1.00 196.32 ? 169  ASN A C     1 
ATOM   2239  O  O     . ASN D 4  169  ? 70.144  15.834  60.333  1.00 184.42 ? 169  ASN A O     1 
ATOM   2240  C  CB    . ASN D 4  169  ? 71.603  17.002  57.602  1.00 191.50 ? 169  ASN A CB    1 
ATOM   2241  C  CG    . ASN D 4  169  ? 72.894  17.048  56.824  1.00 192.08 ? 169  ASN A CG    1 
ATOM   2242  O  OD1   . ASN D 4  169  ? 73.318  18.113  56.379  1.00 191.21 ? 169  ASN A OD1   1 
ATOM   2243  N  ND2   . ASN D 4  169  ? 73.517  15.892  56.633  1.00 192.57 ? 169  ASN A ND2   1 
ATOM   2244  N  N     . THR D 4  170  ? 69.756  18.007  59.883  1.00 206.05 ? 170  THR A N     1 
ATOM   2245  C  CA    . THR D 4  170  ? 68.518  18.086  60.642  1.00 215.03 ? 170  THR A CA    1 
ATOM   2246  C  C     . THR D 4  170  ? 67.297  18.022  59.740  1.00 211.73 ? 170  THR A C     1 
ATOM   2247  O  O     . THR D 4  170  ? 67.238  18.695  58.707  1.00 213.20 ? 170  THR A O     1 
ATOM   2248  C  CB    . THR D 4  170  ? 68.505  19.344  61.515  1.00 223.48 ? 170  THR A CB    1 
ATOM   2249  O  OG1   . THR D 4  170  ? 67.183  19.577  62.026  1.00 224.82 ? 170  THR A OG1   1 
ATOM   2250  C  CG2   . THR D 4  170  ? 69.069  20.554  60.783  1.00 225.26 ? 170  THR A CG2   1 
ATOM   2251  N  N     . GLN D 4  171  ? 66.328  17.201  60.142  1.00 205.70 ? 171  GLN A N     1 
ATOM   2252  C  CA    . GLN D 4  171  ? 65.124  16.979  59.368  1.00 199.73 ? 171  GLN A CA    1 
ATOM   2253  C  C     . GLN D 4  171  ? 63.948  17.538  60.147  1.00 198.00 ? 171  GLN A C     1 
ATOM   2254  O  O     . GLN D 4  171  ? 63.723  17.131  61.296  1.00 197.01 ? 171  GLN A O     1 
ATOM   2255  C  CB    . GLN D 4  171  ? 64.935  15.489  59.092  1.00 200.08 ? 171  GLN A CB    1 
ATOM   2256  C  CG    . GLN D 4  171  ? 66.231  14.637  59.051  1.00 205.03 ? 171  GLN A CG    1 
ATOM   2257  C  CD    . GLN D 4  171  ? 67.235  14.946  57.925  1.00 211.04 ? 171  GLN A CD    1 
ATOM   2258  O  OE1   . GLN D 4  171  ? 67.188  15.979  57.255  1.00 213.24 ? 171  GLN A OE1   1 
ATOM   2259  N  NE2   . GLN D 4  171  ? 68.163  14.019  57.726  1.00 213.67 ? 171  GLN A NE2   1 
ATOM   2260  N  N     . PRO D 4  172  ? 63.195  18.468  59.576  1.00 193.89 ? 172  PRO A N     1 
ATOM   2261  C  CA    . PRO D 4  172  ? 62.211  19.218  60.357  1.00 194.95 ? 172  PRO A CA    1 
ATOM   2262  C  C     . PRO D 4  172  ? 60.945  18.421  60.637  1.00 188.70 ? 172  PRO A C     1 
ATOM   2263  O  O     . PRO D 4  172  ? 60.629  17.430  59.975  1.00 175.61 ? 172  PRO A O     1 
ATOM   2264  C  CB    . PRO D 4  172  ? 61.904  20.414  59.452  1.00 193.74 ? 172  PRO A CB    1 
ATOM   2265  C  CG    . PRO D 4  172  ? 62.083  19.865  58.078  1.00 190.26 ? 172  PRO A CG    1 
ATOM   2266  C  CD    . PRO D 4  172  ? 63.263  18.935  58.182  1.00 192.99 ? 172  PRO A CD    1 
ATOM   2267  N  N     . THR D 4  173  ? 60.217  18.889  61.651  1.00 197.07 ? 173  THR A N     1 
ATOM   2268  C  CA    . THR D 4  173  ? 58.882  18.377  61.930  1.00 198.67 ? 173  THR A CA    1 
ATOM   2269  C  C     . THR D 4  173  ? 57.946  18.816  60.811  1.00 195.76 ? 173  THR A C     1 
ATOM   2270  O  O     . THR D 4  173  ? 57.707  20.013  60.624  1.00 200.93 ? 173  THR A O     1 
ATOM   2271  C  CB    . THR D 4  173  ? 58.383  18.881  63.281  1.00 200.46 ? 173  THR A CB    1 
ATOM   2272  O  OG1   . THR D 4  173  ? 57.941  20.238  63.151  1.00 204.44 ? 173  THR A OG1   1 
ATOM   2273  C  CG2   . THR D 4  173  ? 59.495  18.810  64.320  1.00 199.81 ? 173  THR A CG2   1 
ATOM   2274  N  N     . ILE D 4  174  ? 57.415  17.849  60.073  1.00 180.56 ? 174  ILE A N     1 
ATOM   2275  C  CA    . ILE D 4  174  ? 56.768  18.130  58.797  1.00 155.57 ? 174  ILE A CA    1 
ATOM   2276  C  C     . ILE D 4  174  ? 55.335  18.587  59.037  1.00 154.25 ? 174  ILE A C     1 
ATOM   2277  O  O     . ILE D 4  174  ? 54.563  17.920  59.736  1.00 145.93 ? 174  ILE A O     1 
ATOM   2278  C  CB    . ILE D 4  174  ? 56.819  16.895  57.884  1.00 127.96 ? 174  ILE A CB    1 
ATOM   2279  C  CG1   . ILE D 4  174  ? 58.182  16.798  57.199  1.00 108.88 ? 174  ILE A CG1   1 
ATOM   2280  C  CG2   . ILE D 4  174  ? 55.741  16.964  56.816  1.00 132.40 ? 174  ILE A CG2   1 
ATOM   2281  C  CD1   . ILE D 4  174  ? 58.567  18.036  56.421  1.00 107.92 ? 174  ILE A CD1   1 
ATOM   2282  N  N     . ARG D 4  175  ? 54.984  19.734  58.464  1.00 156.24 ? 175  ARG A N     1 
ATOM   2283  C  CA    . ARG D 4  175  ? 53.616  20.220  58.388  1.00 159.15 ? 175  ARG A CA    1 
ATOM   2284  C  C     . ARG D 4  175  ? 53.172  20.232  56.930  1.00 153.11 ? 175  ARG A C     1 
ATOM   2285  O  O     . ARG D 4  175  ? 53.993  20.298  56.013  1.00 158.60 ? 175  ARG A O     1 
ATOM   2286  C  CB    . ARG D 4  175  ? 53.497  21.627  58.984  1.00 165.97 ? 175  ARG A CB    1 
ATOM   2287  C  CG    . ARG D 4  175  ? 53.058  21.677  60.437  1.00 165.75 ? 175  ARG A CG    1 
ATOM   2288  C  CD    . ARG D 4  175  ? 51.632  22.205  60.571  1.00 160.35 ? 175  ARG A CD    1 
ATOM   2289  N  NE    . ARG D 4  175  ? 51.559  23.662  60.460  1.00 156.61 ? 175  ARG A NE    1 
ATOM   2290  C  CZ    . ARG D 4  175  ? 51.851  24.512  61.442  1.00 157.99 ? 175  ARG A CZ    1 
ATOM   2291  N  NH1   . ARG D 4  175  ? 52.245  24.062  62.626  1.00 162.26 ? 175  ARG A NH1   1 
ATOM   2292  N  NH2   . ARG D 4  175  ? 51.749  25.818  61.238  1.00 157.33 ? 175  ARG A NH2   1 
ATOM   2293  N  N     . LYS D 4  176  ? 51.861  20.162  56.716  1.00 145.13 ? 176  LYS A N     1 
ATOM   2294  C  CA    . LYS D 4  176  ? 51.294  20.211  55.375  1.00 141.62 ? 176  LYS A CA    1 
ATOM   2295  C  C     . LYS D 4  176  ? 50.301  21.360  55.295  1.00 149.71 ? 176  LYS A C     1 
ATOM   2296  O  O     . LYS D 4  176  ? 49.369  21.436  56.101  1.00 144.18 ? 176  LYS A O     1 
ATOM   2297  C  CB    . LYS D 4  176  ? 50.602  18.897  55.000  1.00 135.07 ? 176  LYS A CB    1 
ATOM   2298  C  CG    . LYS D 4  176  ? 49.952  18.931  53.622  1.00 131.67 ? 176  LYS A CG    1 
ATOM   2299  C  CD    . LYS D 4  176  ? 49.125  17.687  53.343  1.00 121.56 ? 176  LYS A CD    1 
ATOM   2300  C  CE    . LYS D 4  176  ? 48.197  17.899  52.156  1.00 103.20 ? 176  LYS A CE    1 
ATOM   2301  N  NZ    . LYS D 4  176  ? 46.767  17.969  52.560  1.00 92.26  ? 176  LYS A NZ    1 
ATOM   2302  N  N     . ASP D 4  177  ? 50.503  22.250  54.326  1.00 159.98 ? 177  ASP A N     1 
ATOM   2303  C  CA    . ASP D 4  177  ? 49.635  23.405  54.120  1.00 156.68 ? 177  ASP A CA    1 
ATOM   2304  C  C     . ASP D 4  177  ? 49.045  23.332  52.719  1.00 150.30 ? 177  ASP A C     1 
ATOM   2305  O  O     . ASP D 4  177  ? 49.772  23.463  51.728  1.00 154.04 ? 177  ASP A O     1 
ATOM   2306  C  CB    . ASP D 4  177  ? 50.397  24.713  54.320  1.00 160.98 ? 177  ASP A CB    1 
ATOM   2307  C  CG    . ASP D 4  177  ? 49.476  25.916  54.381  1.00 164.62 ? 177  ASP A CG    1 
ATOM   2308  O  OD1   . ASP D 4  177  ? 48.916  26.184  55.464  1.00 165.65 ? 177  ASP A OD1   1 
ATOM   2309  O  OD2   . ASP D 4  177  ? 49.308  26.590  53.343  1.00 166.12 ? 177  ASP A OD2   1 
ATOM   2310  N  N     . GLY D 4  178  ? 47.728  23.137  52.647  1.00 140.43 ? 178  GLY A N     1 
ATOM   2311  C  CA    . GLY D 4  178  ? 47.018  23.064  51.386  1.00 134.62 ? 178  GLY A CA    1 
ATOM   2312  C  C     . GLY D 4  178  ? 47.479  21.918  50.513  1.00 133.02 ? 178  GLY A C     1 
ATOM   2313  O  O     . GLY D 4  178  ? 47.142  20.756  50.758  1.00 127.72 ? 178  GLY A O     1 
ATOM   2314  N  N     . LEU D 4  179  ? 48.263  22.241  49.489  1.00 133.90 ? 179  LEU A N     1 
ATOM   2315  C  CA    . LEU D 4  179  ? 48.862  21.241  48.619  1.00 125.51 ? 179  LEU A CA    1 
ATOM   2316  C  C     . LEU D 4  179  ? 50.292  20.894  49.009  1.00 123.68 ? 179  LEU A C     1 
ATOM   2317  O  O     . LEU D 4  179  ? 50.716  19.751  48.810  1.00 126.81 ? 179  LEU A O     1 
ATOM   2318  C  CB    . LEU D 4  179  ? 48.818  21.733  47.163  1.00 125.85 ? 179  LEU A CB    1 
ATOM   2319  C  CG    . LEU D 4  179  ? 49.576  21.033  46.033  1.00 114.27 ? 179  LEU A CG    1 
ATOM   2320  C  CD1   . LEU D 4  179  ? 48.732  21.046  44.775  1.00 91.48  ? 179  LEU A CD1   1 
ATOM   2321  C  CD2   . LEU D 4  179  ? 50.904  21.738  45.785  1.00 122.97 ? 179  LEU A CD2   1 
ATOM   2322  N  N     . LYS D 4  180  ? 51.035  21.841  49.569  1.00 121.73 ? 180  LYS A N     1 
ATOM   2323  C  CA    . LYS D 4  180  ? 52.462  21.683  49.792  1.00 118.22 ? 180  LYS A CA    1 
ATOM   2324  C  C     . LYS D 4  180  ? 52.756  21.327  51.246  1.00 120.80 ? 180  LYS A C     1 
ATOM   2325  O  O     . LYS D 4  180  ? 51.890  21.377  52.122  1.00 106.82 ? 180  LYS A O     1 
ATOM   2326  C  CB    . LYS D 4  180  ? 53.205  22.960  49.391  1.00 112.35 ? 180  LYS A CB    1 
ATOM   2327  C  CG    . LYS D 4  180  ? 54.582  22.724  48.781  1.00 107.78 ? 180  LYS A CG    1 
ATOM   2328  C  CD    . LYS D 4  180  ? 54.776  23.533  47.512  1.00 109.50 ? 180  LYS A CD    1 
ATOM   2329  C  CE    . LYS D 4  180  ? 54.441  25.000  47.729  1.00 110.47 ? 180  LYS A CE    1 
ATOM   2330  N  NZ    . LYS D 4  180  ? 54.331  25.740  46.443  1.00 111.51 ? 180  LYS A NZ    1 
ATOM   2331  N  N     . LEU D 4  181  ? 54.013  20.964  51.487  1.00 132.64 ? 181  LEU A N     1 
ATOM   2332  C  CA    . LEU D 4  181  ? 54.499  20.548  52.791  1.00 149.32 ? 181  LEU A CA    1 
ATOM   2333  C  C     . LEU D 4  181  ? 55.563  21.523  53.277  1.00 168.72 ? 181  LEU A C     1 
ATOM   2334  O  O     . LEU D 4  181  ? 56.318  22.086  52.480  1.00 169.00 ? 181  LEU A O     1 
ATOM   2335  C  CB    . LEU D 4  181  ? 55.086  19.137  52.725  1.00 146.32 ? 181  LEU A CB    1 
ATOM   2336  C  CG    . LEU D 4  181  ? 54.181  18.056  52.140  1.00 132.02 ? 181  LEU A CG    1 
ATOM   2337  C  CD1   . LEU D 4  181  ? 54.994  17.055  51.337  1.00 119.98 ? 181  LEU A CD1   1 
ATOM   2338  C  CD2   . LEU D 4  181  ? 53.423  17.365  53.246  1.00 131.88 ? 181  LEU A CD2   1 
ATOM   2339  N  N     . VAL D 4  182  ? 55.618  21.723  54.595  1.00 186.63 ? 182  VAL A N     1 
ATOM   2340  C  CA    . VAL D 4  182  ? 56.619  22.581  55.222  1.00 197.65 ? 182  VAL A CA    1 
ATOM   2341  C  C     . VAL D 4  182  ? 57.163  21.885  56.464  1.00 203.15 ? 182  VAL A C     1 
ATOM   2342  O  O     . VAL D 4  182  ? 56.660  20.849  56.903  1.00 204.33 ? 182  VAL A O     1 
ATOM   2343  C  CB    . VAL D 4  182  ? 56.064  23.974  55.589  1.00 195.85 ? 182  VAL A CB    1 
ATOM   2344  C  CG1   . VAL D 4  182  ? 55.896  24.832  54.344  1.00 194.88 ? 182  VAL A CG1   1 
ATOM   2345  C  CG2   . VAL D 4  182  ? 54.745  23.845  56.325  1.00 191.92 ? 182  VAL A CG2   1 
ATOM   2346  N  N     . GLY D 4  183  ? 58.215  22.474  57.030  1.00 206.64 ? 183  GLY A N     1 
ATOM   2347  C  CA    . GLY D 4  183  ? 58.829  21.965  58.239  1.00 207.71 ? 183  GLY A CA    1 
ATOM   2348  C  C     . GLY D 4  183  ? 59.291  23.076  59.158  1.00 212.31 ? 183  GLY A C     1 
ATOM   2349  O  O     . GLY D 4  183  ? 59.815  24.088  58.684  1.00 216.01 ? 183  GLY A O     1 
ATOM   2350  N  N     . SER D 4  184  ? 59.097  22.897  60.470  1.00 208.43 ? 184  SER A N     1 
ATOM   2351  C  CA    . SER D 4  184  ? 59.411  23.953  61.430  1.00 199.85 ? 184  SER A CA    1 
ATOM   2352  C  C     . SER D 4  184  ? 60.903  24.257  61.451  1.00 201.59 ? 184  SER A C     1 
ATOM   2353  O  O     . SER D 4  184  ? 61.306  25.426  61.423  1.00 207.98 ? 184  SER A O     1 
ATOM   2354  C  CB    . SER D 4  184  ? 58.924  23.555  62.826  1.00 188.40 ? 184  SER A CB    1 
ATOM   2355  O  OG    . SER D 4  184  ? 59.715  24.155  63.838  1.00 178.43 ? 184  SER A OG    1 
ATOM   2356  N  N     . TRP D 4  185  ? 61.732  23.206  61.510  1.00 190.29 ? 185  TRP A N     1 
ATOM   2357  C  CA    . TRP D 4  185  ? 63.188  23.296  61.364  1.00 189.25 ? 185  TRP A CA    1 
ATOM   2358  C  C     . TRP D 4  185  ? 63.811  24.185  62.440  1.00 188.30 ? 185  TRP A C     1 
ATOM   2359  O  O     . TRP D 4  185  ? 64.739  24.953  62.172  1.00 192.22 ? 185  TRP A O     1 
ATOM   2360  C  CB    . TRP D 4  185  ? 63.568  23.777  59.961  1.00 188.56 ? 185  TRP A CB    1 
ATOM   2361  C  CG    . TRP D 4  185  ? 64.731  23.070  59.366  1.00 184.59 ? 185  TRP A CG    1 
ATOM   2362  C  CD1   . TRP D 4  185  ? 65.888  22.728  59.995  1.00 185.15 ? 185  TRP A CD1   1 
ATOM   2363  C  CD2   . TRP D 4  185  ? 64.853  22.606  58.015  1.00 176.18 ? 185  TRP A CD2   1 
ATOM   2364  N  NE1   . TRP D 4  185  ? 66.726  22.087  59.120  1.00 181.81 ? 185  TRP A NE1   1 
ATOM   2365  C  CE2   . TRP D 4  185  ? 66.115  21.996  57.898  1.00 175.20 ? 185  TRP A CE2   1 
ATOM   2366  C  CE3   . TRP D 4  185  ? 64.019  22.651  56.894  1.00 161.23 ? 185  TRP A CE3   1 
ATOM   2367  C  CZ2   . TRP D 4  185  ? 66.567  21.433  56.707  1.00 166.13 ? 185  TRP A CZ2   1 
ATOM   2368  C  CZ3   . TRP D 4  185  ? 64.467  22.091  55.711  1.00 151.03 ? 185  TRP A CZ3   1 
ATOM   2369  C  CH2   . TRP D 4  185  ? 65.731  21.490  55.627  1.00 156.37 ? 185  TRP A CH2   1 
ATOM   2370  N  N     . LYS D 4  186  ? 63.283  24.072  63.662  1.00 178.79 ? 186  LYS A N     1 
ATOM   2371  C  CA    . LYS D 4  186  ? 63.688  24.864  64.830  1.00 168.89 ? 186  LYS A CA    1 
ATOM   2372  C  C     . LYS D 4  186  ? 63.607  26.369  64.580  1.00 169.83 ? 186  LYS A C     1 
ATOM   2373  O  O     . LYS D 4  186  ? 62.964  27.100  65.334  1.00 168.74 ? 186  LYS A O     1 
ATOM   2374  C  CB    . LYS D 4  186  ? 65.103  24.485  65.283  1.00 163.21 ? 186  LYS A CB    1 
ATOM   2375  C  CG    . LYS D 4  186  ? 65.155  23.866  66.665  1.00 163.89 ? 186  LYS A CG    1 
ATOM   2376  C  CD    . LYS D 4  186  ? 64.554  24.804  67.697  1.00 167.46 ? 186  LYS A CD    1 
ATOM   2377  C  CE    . LYS D 4  186  ? 64.170  24.061  68.962  1.00 167.05 ? 186  LYS A CE    1 
ATOM   2378  N  NZ    . LYS D 4  186  ? 63.516  24.963  69.948  1.00 166.91 ? 186  LYS A NZ    1 
ATOM   2379  N  N     . LEU D 4  199  ? 60.023  26.590  58.052  1.00 148.82 ? 199  LEU A N     1 
ATOM   2380  C  CA    . LEU D 4  199  ? 61.113  27.556  57.995  1.00 161.81 ? 199  LEU A CA    1 
ATOM   2381  C  C     . LEU D 4  199  ? 61.303  28.007  56.550  1.00 185.24 ? 199  LEU A C     1 
ATOM   2382  O  O     . LEU D 4  199  ? 61.257  29.199  56.247  1.00 181.92 ? 199  LEU A O     1 
ATOM   2383  C  CB    . LEU D 4  199  ? 62.403  26.940  58.557  1.00 145.97 ? 199  LEU A CB    1 
ATOM   2384  C  CG    . LEU D 4  199  ? 63.589  27.777  59.069  1.00 133.22 ? 199  LEU A CG    1 
ATOM   2385  C  CD1   . LEU D 4  199  ? 64.289  28.609  57.993  1.00 134.47 ? 199  LEU A CD1   1 
ATOM   2386  C  CD2   . LEU D 4  199  ? 63.152  28.659  60.233  1.00 134.29 ? 199  LEU A CD2   1 
ATOM   2387  N  N     . ARG D 4  200  ? 61.513  27.040  55.662  1.00 212.95 ? 200  ARG A N     1 
ATOM   2388  C  CA    . ARG D 4  200  ? 61.799  27.296  54.259  1.00 225.48 ? 200  ARG A CA    1 
ATOM   2389  C  C     . ARG D 4  200  ? 60.902  26.409  53.407  1.00 224.31 ? 200  ARG A C     1 
ATOM   2390  O  O     . ARG D 4  200  ? 60.610  25.270  53.787  1.00 230.29 ? 200  ARG A O     1 
ATOM   2391  C  CB    . ARG D 4  200  ? 63.298  27.056  53.971  1.00 233.64 ? 200  ARG A CB    1 
ATOM   2392  C  CG    . ARG D 4  200  ? 63.710  26.952  52.510  1.00 236.67 ? 200  ARG A CG    1 
ATOM   2393  C  CD    . ARG D 4  200  ? 64.161  25.540  52.172  1.00 237.97 ? 200  ARG A CD    1 
ATOM   2394  N  NE    . ARG D 4  200  ? 64.514  25.396  50.762  1.00 240.81 ? 200  ARG A NE    1 
ATOM   2395  C  CZ    . ARG D 4  200  ? 65.105  24.322  50.248  1.00 242.38 ? 200  ARG A CZ    1 
ATOM   2396  N  NH1   . ARG D 4  200  ? 65.415  23.298  51.031  1.00 242.36 ? 200  ARG A NH1   1 
ATOM   2397  N  NH2   . ARG D 4  200  ? 65.394  24.275  48.955  1.00 242.84 ? 200  ARG A NH2   1 
ATOM   2398  N  N     . VAL D 4  201  ? 60.441  26.949  52.274  1.00 214.34 ? 201  VAL A N     1 
ATOM   2399  C  CA    . VAL D 4  201  ? 59.511  26.223  51.419  1.00 193.69 ? 201  VAL A CA    1 
ATOM   2400  C  C     . VAL D 4  201  ? 60.182  24.974  50.844  1.00 176.27 ? 201  VAL A C     1 
ATOM   2401  O  O     . VAL D 4  201  ? 61.400  24.927  50.630  1.00 178.14 ? 201  VAL A O     1 
ATOM   2402  C  CB    . VAL D 4  201  ? 58.972  27.134  50.301  1.00 190.77 ? 201  VAL A CB    1 
ATOM   2403  C  CG1   . VAL D 4  201  ? 58.333  28.379  50.899  1.00 191.26 ? 201  VAL A CG1   1 
ATOM   2404  C  CG2   . VAL D 4  201  ? 60.079  27.533  49.332  1.00 191.73 ? 201  VAL A CG2   1 
ATOM   2405  N  N     . LEU D 4  202  ? 59.380  23.938  50.626  1.00 162.82 ? 202  LEU A N     1 
ATOM   2406  C  CA    . LEU D 4  202  ? 59.905  22.661  50.166  1.00 163.23 ? 202  LEU A CA    1 
ATOM   2407  C  C     . LEU D 4  202  ? 59.903  22.607  48.646  1.00 169.02 ? 202  LEU A C     1 
ATOM   2408  O  O     . LEU D 4  202  ? 58.962  23.064  47.993  1.00 178.26 ? 202  LEU A O     1 
ATOM   2409  C  CB    . LEU D 4  202  ? 59.102  21.489  50.734  1.00 152.70 ? 202  LEU A CB    1 
ATOM   2410  C  CG    . LEU D 4  202  ? 59.583  20.882  52.062  1.00 146.92 ? 202  LEU A CG    1 
ATOM   2411  C  CD1   . LEU D 4  202  ? 59.719  21.913  53.183  1.00 148.89 ? 202  LEU A CD1   1 
ATOM   2412  C  CD2   . LEU D 4  202  ? 58.698  19.727  52.494  1.00 140.47 ? 202  LEU A CD2   1 
ATOM   2413  N  N     . SER D 4  203  ? 60.971  22.047  48.090  1.00 165.97 ? 203  SER A N     1 
ATOM   2414  C  CA    . SER D 4  203  ? 61.138  21.939  46.650  1.00 157.62 ? 203  SER A CA    1 
ATOM   2415  C  C     . SER D 4  203  ? 60.660  20.569  46.192  1.00 142.41 ? 203  SER A C     1 
ATOM   2416  O  O     . SER D 4  203  ? 61.104  19.545  46.724  1.00 131.30 ? 203  SER A O     1 
ATOM   2417  C  CB    . SER D 4  203  ? 62.598  22.158  46.255  1.00 165.25 ? 203  SER A CB    1 
ATOM   2418  O  OG    . SER D 4  203  ? 62.939  21.377  45.123  1.00 167.42 ? 203  SER A OG    1 
ATOM   2419  N  N     . THR D 4  204  ? 59.741  20.562  45.222  1.00 143.63 ? 204  THR A N     1 
ATOM   2420  C  CA    . THR D 4  204  ? 59.357  19.328  44.544  1.00 146.12 ? 204  THR A CA    1 
ATOM   2421  C  C     . THR D 4  204  ? 60.572  18.649  43.924  1.00 148.46 ? 204  THR A C     1 
ATOM   2422  O  O     . THR D 4  204  ? 60.739  17.427  44.027  1.00 146.65 ? 204  THR A O     1 
ATOM   2423  C  CB    . THR D 4  204  ? 58.307  19.636  43.471  1.00 138.74 ? 204  THR A CB    1 
ATOM   2424  O  OG1   . THR D 4  204  ? 57.060  19.969  44.094  1.00 135.30 ? 204  THR A OG1   1 
ATOM   2425  C  CG2   . THR D 4  204  ? 58.103  18.450  42.536  1.00 130.20 ? 204  THR A CG2   1 
ATOM   2426  N  N     . GLU D 4  205  ? 61.454  19.444  43.311  1.00 154.21 ? 205  GLU A N     1 
ATOM   2427  C  CA    . GLU D 4  205  ? 62.656  18.913  42.680  1.00 156.23 ? 205  GLU A CA    1 
ATOM   2428  C  C     . GLU D 4  205  ? 63.614  18.312  43.704  1.00 158.84 ? 205  GLU A C     1 
ATOM   2429  O  O     . GLU D 4  205  ? 64.332  17.355  43.390  1.00 159.42 ? 205  GLU A O     1 
ATOM   2430  C  CB    . GLU D 4  205  ? 63.342  20.026  41.881  1.00 156.72 ? 205  GLU A CB    1 
ATOM   2431  C  CG    . GLU D 4  205  ? 64.608  19.638  41.110  1.00 163.87 ? 205  GLU A CG    1 
ATOM   2432  C  CD    . GLU D 4  205  ? 64.357  18.799  39.854  1.00 167.81 ? 205  GLU A CD    1 
ATOM   2433  O  OE1   . GLU D 4  205  ? 65.290  18.705  39.030  1.00 173.12 ? 205  GLU A OE1   1 
ATOM   2434  O  OE2   . GLU D 4  205  ? 63.245  18.268  39.652  1.00 168.55 ? 205  GLU A OE2   1 
ATOM   2435  N  N     . GLU D 4  206  ? 63.633  18.853  44.926  1.00 154.59 ? 206  GLU A N     1 
ATOM   2436  C  CA    . GLU D 4  206  ? 64.440  18.272  45.994  1.00 146.97 ? 206  GLU A CA    1 
ATOM   2437  C  C     . GLU D 4  206  ? 63.947  16.879  46.351  1.00 131.68 ? 206  GLU A C     1 
ATOM   2438  O  O     . GLU D 4  206  ? 64.740  15.937  46.452  1.00 134.54 ? 206  GLU A O     1 
ATOM   2439  C  CB    . GLU D 4  206  ? 64.400  19.174  47.227  1.00 151.18 ? 206  GLU A CB    1 
ATOM   2440  C  CG    . GLU D 4  206  ? 65.662  19.184  48.064  1.00 161.76 ? 206  GLU A CG    1 
ATOM   2441  C  CD    . GLU D 4  206  ? 65.696  20.364  49.013  1.00 173.98 ? 206  GLU A CD    1 
ATOM   2442  O  OE1   . GLU D 4  206  ? 66.529  20.361  49.944  1.00 180.00 ? 206  GLU A OE1   1 
ATOM   2443  O  OE2   . GLU D 4  206  ? 64.881  21.293  48.831  1.00 177.28 ? 206  GLU A OE2   1 
ATOM   2444  N  N     . ILE D 4  207  ? 62.630  16.738  46.537  1.00 122.13 ? 207  ILE A N     1 
ATOM   2445  C  CA    . ILE D 4  207  ? 62.031  15.460  46.917  1.00 120.58 ? 207  ILE A CA    1 
ATOM   2446  C  C     . ILE D 4  207  ? 62.301  14.396  45.860  1.00 137.06 ? 207  ILE A C     1 
ATOM   2447  O  O     . ILE D 4  207  ? 62.529  13.226  46.185  1.00 134.54 ? 207  ILE A O     1 
ATOM   2448  C  CB    . ILE D 4  207  ? 60.523  15.646  47.178  1.00 108.48 ? 207  ILE A CB    1 
ATOM   2449  C  CG1   . ILE D 4  207  ? 60.294  16.785  48.182  1.00 107.53 ? 207  ILE A CG1   1 
ATOM   2450  C  CG2   . ILE D 4  207  ? 59.883  14.346  47.627  1.00 101.72 ? 207  ILE A CG2   1 
ATOM   2451  C  CD1   . ILE D 4  207  ? 58.993  16.702  48.969  1.00 103.04 ? 207  ILE A CD1   1 
ATOM   2452  N  N     . LEU D 4  208  ? 62.317  14.790  44.583  1.00 143.03 ? 208  LEU A N     1 
ATOM   2453  C  CA    . LEU D 4  208  ? 62.693  13.861  43.520  1.00 144.70 ? 208  LEU A CA    1 
ATOM   2454  C  C     . LEU D 4  208  ? 64.151  13.437  43.652  1.00 154.98 ? 208  LEU A C     1 
ATOM   2455  O  O     . LEU D 4  208  ? 64.469  12.243  43.594  1.00 154.81 ? 208  LEU A O     1 
ATOM   2456  C  CB    . LEU D 4  208  ? 62.424  14.501  42.152  1.00 133.92 ? 208  LEU A CB    1 
ATOM   2457  C  CG    . LEU D 4  208  ? 62.711  13.800  40.810  1.00 125.95 ? 208  LEU A CG    1 
ATOM   2458  C  CD1   . LEU D 4  208  ? 64.131  14.056  40.300  1.00 123.63 ? 208  LEU A CD1   1 
ATOM   2459  C  CD2   . LEU D 4  208  ? 62.433  12.297  40.869  1.00 122.93 ? 208  LEU A CD2   1 
ATOM   2460  N  N     . ASN D 4  209  ? 65.055  14.407  43.819  1.00 163.56 ? 209  ASN A N     1 
ATOM   2461  C  CA    . ASN D 4  209  ? 66.475  14.083  43.920  1.00 164.79 ? 209  ASN A CA    1 
ATOM   2462  C  C     . ASN D 4  209  ? 66.787  13.341  45.213  1.00 164.08 ? 209  ASN A C     1 
ATOM   2463  O  O     . ASN D 4  209  ? 67.688  12.494  45.235  1.00 167.83 ? 209  ASN A O     1 
ATOM   2464  C  CB    . ASN D 4  209  ? 67.309  15.364  43.805  1.00 162.96 ? 209  ASN A CB    1 
ATOM   2465  C  CG    . ASN D 4  209  ? 68.800  15.118  43.976  1.00 165.15 ? 209  ASN A CG    1 
ATOM   2466  O  OD1   . ASN D 4  209  ? 69.304  14.997  45.093  1.00 168.18 ? 209  ASN A OD1   1 
ATOM   2467  N  ND2   . ASN D 4  209  ? 69.514  15.039  42.858  1.00 164.96 ? 209  ASN A ND2   1 
ATOM   2468  N  N     . ILE D 4  210  ? 66.058  13.642  46.289  1.00 161.53 ? 210  ILE A N     1 
ATOM   2469  C  CA    . ILE D 4  210  ? 66.207  12.886  47.529  1.00 157.29 ? 210  ILE A CA    1 
ATOM   2470  C  C     . ILE D 4  210  ? 65.758  11.444  47.326  1.00 148.31 ? 210  ILE A C     1 
ATOM   2471  O  O     . ILE D 4  210  ? 66.424  10.501  47.772  1.00 145.97 ? 210  ILE A O     1 
ATOM   2472  C  CB    . ILE D 4  210  ? 65.427  13.574  48.669  1.00 156.88 ? 210  ILE A CB    1 
ATOM   2473  C  CG1   . ILE D 4  210  ? 66.143  14.848  49.124  1.00 153.57 ? 210  ILE A CG1   1 
ATOM   2474  C  CG2   . ILE D 4  210  ? 65.228  12.642  49.854  1.00 159.52 ? 210  ILE A CG2   1 
ATOM   2475  C  CD1   . ILE D 4  210  ? 65.286  15.752  49.982  1.00 150.70 ? 210  ILE A CD1   1 
ATOM   2476  N  N     . PHE D 4  211  ? 64.650  11.245  46.608  1.00 142.61 ? 211  PHE A N     1 
ATOM   2477  C  CA    . PHE D 4  211  ? 64.039  9.925   46.549  1.00 150.46 ? 211  PHE A CA    1 
ATOM   2478  C  C     . PHE D 4  211  ? 64.679  9.014   45.514  1.00 163.42 ? 211  PHE A C     1 
ATOM   2479  O  O     . PHE D 4  211  ? 64.547  7.791   45.629  1.00 169.84 ? 211  PHE A O     1 
ATOM   2480  C  CB    . PHE D 4  211  ? 62.549  10.042  46.257  1.00 148.48 ? 211  PHE A CB    1 
ATOM   2481  C  CG    . PHE D 4  211  ? 61.723  10.173  47.488  1.00 139.86 ? 211  PHE A CG    1 
ATOM   2482  C  CD1   . PHE D 4  211  ? 62.189  9.676   48.691  1.00 139.78 ? 211  PHE A CD1   1 
ATOM   2483  C  CD2   . PHE D 4  211  ? 60.493  10.799  47.453  1.00 131.17 ? 211  PHE A CD2   1 
ATOM   2484  C  CE1   . PHE D 4  211  ? 61.450  9.800   49.833  1.00 138.72 ? 211  PHE A CE1   1 
ATOM   2485  C  CE2   . PHE D 4  211  ? 59.744  10.920  48.596  1.00 123.95 ? 211  PHE A CE2   1 
ATOM   2486  C  CZ    . PHE D 4  211  ? 60.232  10.425  49.786  1.00 130.03 ? 211  PHE A CZ    1 
ATOM   2487  N  N     . LYS D 4  212  ? 65.339  9.580   44.501  1.00 161.59 ? 212  LYS A N     1 
ATOM   2488  C  CA    . LYS D 4  212  ? 66.098  8.764   43.560  1.00 162.57 ? 212  LYS A CA    1 
ATOM   2489  C  C     . LYS D 4  212  ? 67.208  8.004   44.271  1.00 165.48 ? 212  LYS A C     1 
ATOM   2490  O  O     . LYS D 4  212  ? 67.447  6.823   43.992  1.00 165.43 ? 212  LYS A O     1 
ATOM   2491  C  CB    . LYS D 4  212  ? 66.675  9.652   42.457  1.00 165.72 ? 212  LYS A CB    1 
ATOM   2492  C  CG    . LYS D 4  212  ? 67.787  9.004   41.651  1.00 171.14 ? 212  LYS A CG    1 
ATOM   2493  C  CD    . LYS D 4  212  ? 69.090  9.764   41.830  1.00 177.32 ? 212  LYS A CD    1 
ATOM   2494  C  CE    . LYS D 4  212  ? 70.211  9.142   41.017  1.00 179.25 ? 212  LYS A CE    1 
ATOM   2495  N  NZ    . LYS D 4  212  ? 71.253  10.139  40.650  1.00 180.27 ? 212  LYS A NZ    1 
ATOM   2496  N  N     . HIS D 4  213  ? 67.866  8.655   45.225  1.00 166.89 ? 213  HIS A N     1 
ATOM   2497  C  CA    . HIS D 4  213  ? 69.017  8.100   45.919  1.00 161.30 ? 213  HIS A CA    1 
ATOM   2498  C  C     . HIS D 4  213  ? 68.637  7.197   47.084  1.00 165.59 ? 213  HIS A C     1 
ATOM   2499  O  O     . HIS D 4  213  ? 69.529  6.780   47.830  1.00 172.70 ? 213  HIS A O     1 
ATOM   2500  C  CB    . HIS D 4  213  ? 69.912  9.235   46.415  1.00 156.86 ? 213  HIS A CB    1 
ATOM   2501  C  CG    . HIS D 4  213  ? 70.760  9.840   45.343  1.00 161.89 ? 213  HIS A CG    1 
ATOM   2502  N  ND1   . HIS D 4  213  ? 71.729  9.128   44.671  1.00 165.45 ? 213  HIS A ND1   1 
ATOM   2503  C  CD2   . HIS D 4  213  ? 70.777  11.087  44.817  1.00 166.59 ? 213  HIS A CD2   1 
ATOM   2504  C  CE1   . HIS D 4  213  ? 72.311  9.912   43.781  1.00 169.00 ? 213  HIS A CE1   1 
ATOM   2505  N  NE2   . HIS D 4  213  ? 71.752  11.106  43.850  1.00 169.55 ? 213  HIS A NE2   1 
ATOM   2506  N  N     . ILE D 4  214  ? 67.350  6.892   47.261  1.00 159.63 ? 214  ILE A N     1 
ATOM   2507  C  CA    . ILE D 4  214  ? 66.924  6.021   48.349  1.00 149.55 ? 214  ILE A CA    1 
ATOM   2508  C  C     . ILE D 4  214  ? 67.441  4.614   48.083  1.00 151.67 ? 214  ILE A C     1 
ATOM   2509  O  O     . ILE D 4  214  ? 67.467  4.156   46.932  1.00 146.52 ? 214  ILE A O     1 
ATOM   2510  C  CB    . ILE D 4  214  ? 65.390  6.062   48.491  1.00 132.07 ? 214  ILE A CB    1 
ATOM   2511  C  CG1   . ILE D 4  214  ? 64.932  7.415   49.038  1.00 130.13 ? 214  ILE A CG1   1 
ATOM   2512  C  CG2   . ILE D 4  214  ? 64.869  4.982   49.434  1.00 122.99 ? 214  ILE A CG2   1 
ATOM   2513  C  CD1   . ILE D 4  214  ? 65.864  8.053   50.052  1.00 135.82 ? 214  ILE A CD1   1 
ATOM   2514  N  N     . SER D 4  215  ? 67.907  3.947   49.144  1.00 156.90 ? 215  SER A N     1 
ATOM   2515  C  CA    . SER D 4  215  ? 68.553  2.648   49.017  1.00 158.54 ? 215  SER A CA    1 
ATOM   2516  C  C     . SER D 4  215  ? 67.617  1.618   48.397  1.00 156.91 ? 215  SER A C     1 
ATOM   2517  O  O     . SER D 4  215  ? 66.421  1.573   48.703  1.00 151.34 ? 215  SER A O     1 
ATOM   2518  C  CB    . SER D 4  215  ? 69.026  2.159   50.387  1.00 159.31 ? 215  SER A CB    1 
ATOM   2519  O  OG    . SER D 4  215  ? 69.477  3.236   51.189  1.00 159.93 ? 215  SER A OG    1 
ATOM   2520  N  N     . VAL D 4  216  ? 68.176  0.811   47.492  1.00 160.77 ? 216  VAL A N     1 
ATOM   2521  C  CA    . VAL D 4  216  ? 67.425  -0.280  46.876  1.00 165.96 ? 216  VAL A CA    1 
ATOM   2522  C  C     . VAL D 4  216  ? 66.988  -1.283  47.938  1.00 170.16 ? 216  VAL A C     1 
ATOM   2523  O  O     . VAL D 4  216  ? 65.886  -1.845  47.874  1.00 173.50 ? 216  VAL A O     1 
ATOM   2524  C  CB    . VAL D 4  216  ? 68.272  -0.931  45.761  1.00 164.70 ? 216  VAL A CB    1 
ATOM   2525  C  CG1   . VAL D 4  216  ? 69.694  -1.191  46.244  1.00 166.76 ? 216  VAL A CG1   1 
ATOM   2526  C  CG2   . VAL D 4  216  ? 67.635  -2.215  45.244  1.00 158.10 ? 216  VAL A CG2   1 
ATOM   2527  N  N     . LYS D 4  217  ? 67.825  -1.486  48.958  1.00 163.64 ? 217  LYS A N     1 
ATOM   2528  C  CA    . LYS D 4  217  ? 67.417  -2.286  50.104  1.00 151.05 ? 217  LYS A CA    1 
ATOM   2529  C  C     . LYS D 4  217  ? 66.316  -1.597  50.898  1.00 140.66 ? 217  LYS A C     1 
ATOM   2530  O  O     . LYS D 4  217  ? 65.439  -2.270  51.448  1.00 133.08 ? 217  LYS A O     1 
ATOM   2531  C  CB    . LYS D 4  217  ? 68.622  -2.568  50.998  1.00 152.55 ? 217  LYS A CB    1 
ATOM   2532  C  CG    . LYS D 4  217  ? 69.306  -3.890  50.705  1.00 146.86 ? 217  LYS A CG    1 
ATOM   2533  C  CD    . LYS D 4  217  ? 69.843  -4.537  51.969  1.00 141.52 ? 217  LYS A CD    1 
ATOM   2534  C  CE    . LYS D 4  217  ? 70.234  -5.984  51.713  1.00 139.39 ? 217  LYS A CE    1 
ATOM   2535  N  NZ    . LYS D 4  217  ? 70.367  -6.765  52.974  1.00 139.05 ? 217  LYS A NZ    1 
ATOM   2536  N  N     . ASP D 4  218  ? 66.337  -0.263  50.958  1.00 140.58 ? 218  ASP A N     1 
ATOM   2537  C  CA    . ASP D 4  218  ? 65.303  0.452   51.694  1.00 144.28 ? 218  ASP A CA    1 
ATOM   2538  C  C     . ASP D 4  218  ? 63.997  0.530   50.914  1.00 149.15 ? 218  ASP A C     1 
ATOM   2539  O  O     . ASP D 4  218  ? 62.937  0.670   51.530  1.00 148.79 ? 218  ASP A O     1 
ATOM   2540  C  CB    . ASP D 4  218  ? 65.788  1.854   52.068  1.00 146.62 ? 218  ASP A CB    1 
ATOM   2541  C  CG    . ASP D 4  218  ? 66.703  1.847   53.280  1.00 143.98 ? 218  ASP A CG    1 
ATOM   2542  O  OD1   . ASP D 4  218  ? 66.518  0.976   54.156  1.00 139.66 ? 218  ASP A OD1   1 
ATOM   2543  O  OD2   . ASP D 4  218  ? 67.603  2.711   53.358  1.00 141.00 ? 218  ASP A OD2   1 
ATOM   2544  N  N     . PHE D 4  219  ? 64.058  0.457   49.577  1.00 150.17 ? 219  PHE A N     1 
ATOM   2545  C  CA    . PHE D 4  219  ? 62.861  0.274   48.754  1.00 141.58 ? 219  PHE A CA    1 
ATOM   2546  C  C     . PHE D 4  219  ? 62.041  -0.913  49.236  1.00 139.96 ? 219  PHE A C     1 
ATOM   2547  O  O     . PHE D 4  219  ? 60.879  -0.773  49.636  1.00 129.76 ? 219  PHE A O     1 
ATOM   2548  C  CB    . PHE D 4  219  ? 63.238  0.039   47.289  1.00 140.04 ? 219  PHE A CB    1 
ATOM   2549  C  CG    . PHE D 4  219  ? 63.709  1.255   46.551  1.00 145.78 ? 219  PHE A CG    1 
ATOM   2550  C  CD1   . PHE D 4  219  ? 64.387  1.105   45.352  1.00 149.57 ? 219  PHE A CD1   1 
ATOM   2551  C  CD2   . PHE D 4  219  ? 63.446  2.533   47.010  1.00 149.99 ? 219  PHE A CD2   1 
ATOM   2552  C  CE1   . PHE D 4  219  ? 64.821  2.200   44.637  1.00 154.21 ? 219  PHE A CE1   1 
ATOM   2553  C  CE2   . PHE D 4  219  ? 63.881  3.636   46.293  1.00 155.60 ? 219  PHE A CE2   1 
ATOM   2554  C  CZ    . PHE D 4  219  ? 64.567  3.468   45.108  1.00 156.92 ? 219  PHE A CZ    1 
ATOM   2555  N  N     . THR D 4  220  ? 62.649  -2.101  49.189  1.00 151.61 ? 220  THR A N     1 
ATOM   2556  C  CA    . THR D 4  220  ? 61.987  -3.317  49.642  1.00 161.74 ? 220  THR A CA    1 
ATOM   2557  C  C     . THR D 4  220  ? 61.679  -3.264  51.132  1.00 171.00 ? 220  THR A C     1 
ATOM   2558  O  O     . THR D 4  220  ? 60.707  -3.877  51.586  1.00 178.92 ? 220  THR A O     1 
ATOM   2559  C  CB    . THR D 4  220  ? 62.869  -4.523  49.320  1.00 166.19 ? 220  THR A CB    1 
ATOM   2560  O  OG1   . THR D 4  220  ? 63.536  -4.304  48.071  1.00 167.36 ? 220  THR A OG1   1 
ATOM   2561  C  CG2   . THR D 4  220  ? 62.029  -5.783  49.215  1.00 163.37 ? 220  THR A CG2   1 
ATOM   2562  N  N     . SER D 4  221  ? 62.489  -2.533  51.903  1.00 161.87 ? 221  SER A N     1 
ATOM   2563  C  CA    . SER D 4  221  ? 62.165  -2.311  53.307  1.00 145.78 ? 221  SER A CA    1 
ATOM   2564  C  C     . SER D 4  221  ? 60.930  -1.433  53.454  1.00 121.44 ? 221  SER A C     1 
ATOM   2565  O  O     . SER D 4  221  ? 60.119  -1.643  54.362  1.00 109.31 ? 221  SER A O     1 
ATOM   2566  C  CB    . SER D 4  221  ? 63.354  -1.691  54.038  1.00 148.98 ? 221  SER A CB    1 
ATOM   2567  O  OG    . SER D 4  221  ? 64.579  -2.214  53.560  1.00 149.62 ? 221  SER A OG    1 
ATOM   2568  N  N     . LEU D 4  222  ? 60.760  -0.452  52.571  1.00 119.90 ? 222  LEU A N     1 
ATOM   2569  C  CA    . LEU D 4  222  ? 59.568  0.382   52.610  1.00 118.63 ? 222  LEU A CA    1 
ATOM   2570  C  C     . LEU D 4  222  ? 58.409  -0.221  51.825  1.00 114.93 ? 222  LEU A C     1 
ATOM   2571  O  O     . LEU D 4  222  ? 57.362  0.421   51.697  1.00 103.69 ? 222  LEU A O     1 
ATOM   2572  C  CB    . LEU D 4  222  ? 59.878  1.793   52.092  1.00 116.98 ? 222  LEU A CB    1 
ATOM   2573  C  CG    . LEU D 4  222  ? 60.806  2.644   52.975  1.00 98.62  ? 222  LEU A CG    1 
ATOM   2574  C  CD1   . LEU D 4  222  ? 61.666  3.591   52.136  1.00 98.98  ? 222  LEU A CD1   1 
ATOM   2575  C  CD2   . LEU D 4  222  ? 60.066  3.398   54.062  1.00 97.18  ? 222  LEU A CD2   1 
ATOM   2576  N  N     . GLY D 4  223  ? 58.573  -1.436  51.302  1.00 118.91 ? 223  GLY A N     1 
ATOM   2577  C  CA    . GLY D 4  223  ? 57.490  -2.167  50.676  1.00 119.23 ? 223  GLY A CA    1 
ATOM   2578  C  C     . GLY D 4  223  ? 57.247  -1.853  49.221  1.00 114.93 ? 223  GLY A C     1 
ATOM   2579  O  O     . GLY D 4  223  ? 56.195  -2.226  48.690  1.00 100.62 ? 223  GLY A O     1 
ATOM   2580  N  N     . PHE D 4  224  ? 58.184  -1.189  48.556  1.00 122.96 ? 224  PHE A N     1 
ATOM   2581  C  CA    . PHE D 4  224  ? 57.994  -0.684  47.204  1.00 119.32 ? 224  PHE A CA    1 
ATOM   2582  C  C     . PHE D 4  224  ? 58.828  -1.521  46.245  1.00 122.78 ? 224  PHE A C     1 
ATOM   2583  O  O     . PHE D 4  224  ? 60.029  -1.706  46.466  1.00 125.63 ? 224  PHE A O     1 
ATOM   2584  C  CB    . PHE D 4  224  ? 58.397  0.793   47.103  1.00 122.45 ? 224  PHE A CB    1 
ATOM   2585  C  CG    . PHE D 4  224  ? 57.464  1.765   47.815  1.00 123.09 ? 224  PHE A CG    1 
ATOM   2586  C  CD1   . PHE D 4  224  ? 57.634  3.126   47.641  1.00 114.29 ? 224  PHE A CD1   1 
ATOM   2587  C  CD2   . PHE D 4  224  ? 56.417  1.337   48.619  1.00 124.53 ? 224  PHE A CD2   1 
ATOM   2588  C  CE1   . PHE D 4  224  ? 56.808  4.040   48.271  1.00 107.07 ? 224  PHE A CE1   1 
ATOM   2589  C  CE2   . PHE D 4  224  ? 55.589  2.242   49.253  1.00 124.48 ? 224  PHE A CE2   1 
ATOM   2590  C  CZ    . PHE D 4  224  ? 55.783  3.597   49.076  1.00 115.46 ? 224  PHE A CZ    1 
ATOM   2591  N  N     . ASN D 4  225  ? 58.194  -2.030  45.190  1.00 127.23 ? 225  ASN A N     1 
ATOM   2592  C  CA    . ASN D 4  225  ? 58.915  -2.851  44.225  1.00 130.02 ? 225  ASN A CA    1 
ATOM   2593  C  C     . ASN D 4  225  ? 59.852  -1.972  43.408  1.00 139.95 ? 225  ASN A C     1 
ATOM   2594  O  O     . ASN D 4  225  ? 59.527  -0.830  43.072  1.00 139.39 ? 225  ASN A O     1 
ATOM   2595  C  CB    . ASN D 4  225  ? 57.932  -3.599  43.315  1.00 121.58 ? 225  ASN A CB    1 
ATOM   2596  C  CG    . ASN D 4  225  ? 58.617  -4.619  42.393  1.00 118.57 ? 225  ASN A CG    1 
ATOM   2597  O  OD1   . ASN D 4  225  ? 59.514  -4.294  41.612  1.00 116.47 ? 225  ASN A OD1   1 
ATOM   2598  N  ND2   . ASN D 4  225  ? 58.188  -5.871  42.498  1.00 116.55 ? 225  ASN A ND2   1 
ATOM   2599  N  N     . GLU D 4  226  ? 61.026  -2.519  43.091  1.00 142.37 ? 226  GLU A N     1 
ATOM   2600  C  CA    . GLU D 4  226  ? 62.046  -1.771  42.365  1.00 144.89 ? 226  GLU A CA    1 
ATOM   2601  C  C     . GLU D 4  226  ? 61.667  -1.509  40.913  1.00 138.82 ? 226  GLU A C     1 
ATOM   2602  O  O     . GLU D 4  226  ? 62.194  -0.570  40.308  1.00 138.41 ? 226  GLU A O     1 
ATOM   2603  C  CB    . GLU D 4  226  ? 63.373  -2.530  42.414  1.00 147.45 ? 226  GLU A CB    1 
ATOM   2604  C  CG    . GLU D 4  226  ? 63.211  -4.041  42.319  1.00 147.36 ? 226  GLU A CG    1 
ATOM   2605  C  CD    . GLU D 4  226  ? 64.525  -4.760  42.102  1.00 149.66 ? 226  GLU A CD    1 
ATOM   2606  O  OE1   . GLU D 4  226  ? 65.588  -4.149  42.339  1.00 149.69 ? 226  GLU A OE1   1 
ATOM   2607  O  OE2   . GLU D 4  226  ? 64.494  -5.940  41.696  1.00 148.56 ? 226  GLU A OE2   1 
ATOM   2608  N  N     . VAL D 4  227  ? 60.771  -2.307  40.341  1.00 138.19 ? 227  VAL A N     1 
ATOM   2609  C  CA    . VAL D 4  227  ? 60.427  -2.225  38.930  1.00 144.23 ? 227  VAL A CA    1 
ATOM   2610  C  C     . VAL D 4  227  ? 59.044  -1.625  38.716  1.00 145.19 ? 227  VAL A C     1 
ATOM   2611  O  O     . VAL D 4  227  ? 58.830  -0.886  37.751  1.00 142.03 ? 227  VAL A O     1 
ATOM   2612  C  CB    . VAL D 4  227  ? 60.525  -3.614  38.264  1.00 140.39 ? 227  VAL A CB    1 
ATOM   2613  C  CG1   . VAL D 4  227  ? 60.645  -3.482  36.755  1.00 134.31 ? 227  VAL A CG1   1 
ATOM   2614  C  CG2   . VAL D 4  227  ? 61.704  -4.397  38.826  1.00 137.04 ? 227  VAL A CG2   1 
ATOM   2615  N  N     . PHE D 4  228  ? 58.095  -1.937  39.592  1.00 147.70 ? 228  PHE A N     1 
ATOM   2616  C  CA    . PHE D 4  228  ? 56.707  -1.552  39.381  1.00 145.92 ? 228  PHE A CA    1 
ATOM   2617  C  C     . PHE D 4  228  ? 56.354  -0.230  40.048  1.00 145.68 ? 228  PHE A C     1 
ATOM   2618  O  O     . PHE D 4  228  ? 55.598  0.566   39.480  1.00 155.02 ? 228  PHE A O     1 
ATOM   2619  C  CB    . PHE D 4  228  ? 55.781  -2.655  39.897  1.00 138.40 ? 228  PHE A CB    1 
ATOM   2620  C  CG    . PHE D 4  228  ? 55.925  -3.953  39.160  1.00 133.65 ? 228  PHE A CG    1 
ATOM   2621  C  CD1   . PHE D 4  228  ? 55.644  -5.155  39.786  1.00 128.39 ? 228  PHE A CD1   1 
ATOM   2622  C  CD2   . PHE D 4  228  ? 56.323  -3.971  37.832  1.00 133.30 ? 228  PHE A CD2   1 
ATOM   2623  C  CE1   . PHE D 4  228  ? 55.779  -6.351  39.109  1.00 128.41 ? 228  PHE A CE1   1 
ATOM   2624  C  CE2   . PHE D 4  228  ? 56.455  -5.162  37.148  1.00 131.18 ? 228  PHE A CE2   1 
ATOM   2625  C  CZ    . PHE D 4  228  ? 56.179  -6.354  37.786  1.00 128.69 ? 228  PHE A CZ    1 
ATOM   2626  N  N     . SER D 4  229  ? 56.896  0.030   41.241  1.00 139.14 ? 229  SER A N     1 
ATOM   2627  C  CA    . SER D 4  229  ? 56.468  1.178   42.030  1.00 128.66 ? 229  SER A CA    1 
ATOM   2628  C  C     . SER D 4  229  ? 57.652  1.722   42.833  1.00 129.84 ? 229  SER A C     1 
ATOM   2629  O  O     . SER D 4  229  ? 57.709  1.645   44.057  1.00 117.27 ? 229  SER A O     1 
ATOM   2630  C  CB    . SER D 4  229  ? 55.304  0.809   42.951  1.00 114.31 ? 229  SER A CB    1 
ATOM   2631  O  OG    . SER D 4  229  ? 55.198  1.725   44.027  1.00 98.67  ? 229  SER A OG    1 
ATOM   2632  N  N     . ARG D 4  230  ? 58.624  2.297   42.134  1.00 145.40 ? 230  ARG A N     1 
ATOM   2633  C  CA    . ARG D 4  230  ? 59.694  2.992   42.829  1.00 150.78 ? 230  ARG A CA    1 
ATOM   2634  C  C     . ARG D 4  230  ? 59.175  4.334   43.344  1.00 148.22 ? 230  ARG A C     1 
ATOM   2635  O  O     . ARG D 4  230  ? 58.414  5.012   42.648  1.00 149.81 ? 230  ARG A O     1 
ATOM   2636  C  CB    . ARG D 4  230  ? 60.900  3.202   41.910  1.00 162.04 ? 230  ARG A CB    1 
ATOM   2637  C  CG    . ARG D 4  230  ? 62.054  2.249   42.202  1.00 170.23 ? 230  ARG A CG    1 
ATOM   2638  C  CD    . ARG D 4  230  ? 63.196  2.398   41.206  1.00 174.08 ? 230  ARG A CD    1 
ATOM   2639  N  NE    . ARG D 4  230  ? 64.129  3.449   41.596  1.00 175.93 ? 230  ARG A NE    1 
ATOM   2640  C  CZ    . ARG D 4  230  ? 65.372  3.558   41.139  1.00 172.82 ? 230  ARG A CZ    1 
ATOM   2641  N  NH1   . ARG D 4  230  ? 66.146  4.552   41.551  1.00 170.41 ? 230  ARG A NH1   1 
ATOM   2642  N  NH2   . ARG D 4  230  ? 65.843  2.672   40.272  1.00 171.37 ? 230  ARG A NH2   1 
ATOM   2643  N  N     . PRO D 4  231  ? 59.553  4.733   44.564  1.00 139.99 ? 231  PRO A N     1 
ATOM   2644  C  CA    . PRO D 4  231  ? 58.957  5.941   45.166  1.00 141.60 ? 231  PRO A CA    1 
ATOM   2645  C  C     . PRO D 4  231  ? 59.345  7.239   44.484  1.00 139.57 ? 231  PRO A C     1 
ATOM   2646  O  O     . PRO D 4  231  ? 58.712  8.266   44.752  1.00 128.65 ? 231  PRO A O     1 
ATOM   2647  C  CB    . PRO D 4  231  ? 59.473  5.914   46.610  1.00 146.90 ? 231  PRO A CB    1 
ATOM   2648  C  CG    . PRO D 4  231  ? 60.644  5.001   46.587  1.00 147.58 ? 231  PRO A CG    1 
ATOM   2649  C  CD    . PRO D 4  231  ? 60.369  3.984   45.530  1.00 144.68 ? 231  PRO A CD    1 
ATOM   2650  N  N     . GLU D 4  232  ? 60.365  7.238   43.624  1.00 153.52 ? 232  GLU A N     1 
ATOM   2651  C  CA    . GLU D 4  232  ? 60.660  8.432   42.841  1.00 164.18 ? 232  GLU A CA    1 
ATOM   2652  C  C     . GLU D 4  232  ? 59.597  8.692   41.784  1.00 157.42 ? 232  GLU A C     1 
ATOM   2653  O  O     . GLU D 4  232  ? 59.515  9.809   41.262  1.00 156.95 ? 232  GLU A O     1 
ATOM   2654  C  CB    . GLU D 4  232  ? 62.034  8.305   42.188  1.00 174.33 ? 232  GLU A CB    1 
ATOM   2655  C  CG    . GLU D 4  232  ? 62.087  7.282   41.072  1.00 182.04 ? 232  GLU A CG    1 
ATOM   2656  C  CD    . GLU D 4  232  ? 63.341  6.444   41.118  1.00 191.86 ? 232  GLU A CD    1 
ATOM   2657  O  OE1   . GLU D 4  232  ? 63.750  6.047   42.230  1.00 195.27 ? 232  GLU A OE1   1 
ATOM   2658  O  OE2   . GLU D 4  232  ? 63.915  6.171   40.043  1.00 195.03 ? 232  GLU A OE2   1 
ATOM   2659  N  N     . TRP D 4  233  ? 58.784  7.688   41.465  1.00 148.46 ? 233  TRP A N     1 
ATOM   2660  C  CA    . TRP D 4  233  ? 57.686  7.816   40.522  1.00 138.53 ? 233  TRP A CA    1 
ATOM   2661  C  C     . TRP D 4  233  ? 56.388  8.220   41.203  1.00 134.74 ? 233  TRP A C     1 
ATOM   2662  O  O     . TRP D 4  233  ? 55.353  8.308   40.533  1.00 145.57 ? 233  TRP A O     1 
ATOM   2663  C  CB    . TRP D 4  233  ? 57.506  6.496   39.773  1.00 132.59 ? 233  TRP A CB    1 
ATOM   2664  C  CG    . TRP D 4  233  ? 58.717  6.148   38.976  1.00 140.75 ? 233  TRP A CG    1 
ATOM   2665  C  CD1   . TRP D 4  233  ? 59.625  7.018   38.451  1.00 148.48 ? 233  TRP A CD1   1 
ATOM   2666  C  CD2   . TRP D 4  233  ? 59.187  4.835   38.654  1.00 142.31 ? 233  TRP A CD2   1 
ATOM   2667  N  NE1   . TRP D 4  233  ? 60.619  6.331   37.799  1.00 149.63 ? 233  TRP A NE1   1 
ATOM   2668  C  CE2   . TRP D 4  233  ? 60.374  4.988   37.911  1.00 145.36 ? 233  TRP A CE2   1 
ATOM   2669  C  CE3   . TRP D 4  233  ? 58.713  3.545   38.911  1.00 141.61 ? 233  TRP A CE3   1 
ATOM   2670  C  CZ2   . TRP D 4  233  ? 61.096  3.899   37.426  1.00 145.53 ? 233  TRP A CZ2   1 
ATOM   2671  C  CZ3   . TRP D 4  233  ? 59.429  2.466   38.426  1.00 142.21 ? 233  TRP A CZ3   1 
ATOM   2672  C  CH2   . TRP D 4  233  ? 60.607  2.650   37.690  1.00 144.44 ? 233  TRP A CH2   1 
ATOM   2673  N  N     . MET D 4  234  ? 56.422  8.439   42.523  1.00 126.61 ? 234  MET A N     1 
ATOM   2674  C  CA    . MET D 4  234  ? 55.281  9.016   43.227  1.00 114.07 ? 234  MET A CA    1 
ATOM   2675  C  C     . MET D 4  234  ? 54.942  10.391  42.677  1.00 117.68 ? 234  MET A C     1 
ATOM   2676  O  O     . MET D 4  234  ? 53.769  10.713  42.460  1.00 112.38 ? 234  MET A O     1 
ATOM   2677  C  CB    . MET D 4  234  ? 55.593  9.120   44.717  1.00 106.02 ? 234  MET A CB    1 
ATOM   2678  C  CG    . MET D 4  234  ? 55.480  7.834   45.510  1.00 108.06 ? 234  MET A CG    1 
ATOM   2679  S  SD    . MET D 4  234  ? 53.888  7.648   46.318  1.00 121.30 ? 234  MET A SD    1 
ATOM   2680  C  CE    . MET D 4  234  ? 54.368  7.825   48.033  1.00 102.58 ? 234  MET A CE    1 
ATOM   2681  N  N     . ILE D 4  235  ? 55.957  11.213  42.452  1.00 121.45 ? 235  ILE A N     1 
ATOM   2682  C  CA    . ILE D 4  235  ? 55.779  12.525  41.858  1.00 130.06 ? 235  ILE A CA    1 
ATOM   2683  C  C     . ILE D 4  235  ? 55.817  12.384  40.340  1.00 130.91 ? 235  ILE A C     1 
ATOM   2684  O  O     . ILE D 4  235  ? 56.320  11.400  39.792  1.00 132.63 ? 235  ILE A O     1 
ATOM   2685  C  CB    . ILE D 4  235  ? 56.834  13.532  42.377  1.00 141.17 ? 235  ILE A CB    1 
ATOM   2686  C  CG1   . ILE D 4  235  ? 58.268  13.021  42.179  1.00 152.98 ? 235  ILE A CG1   1 
ATOM   2687  C  CG2   . ILE D 4  235  ? 56.590  13.851  43.847  1.00 136.10 ? 235  ILE A CG2   1 
ATOM   2688  C  CD1   . ILE D 4  235  ? 58.956  13.521  40.915  1.00 159.76 ? 235  ILE A CD1   1 
ATOM   2689  N  N     . LEU D 4  236  ? 55.289  13.387  39.651  1.00 136.82 ? 236  LEU A N     1 
ATOM   2690  C  CA    . LEU D 4  236  ? 55.113  13.344  38.208  1.00 135.31 ? 236  LEU A CA    1 
ATOM   2691  C  C     . LEU D 4  236  ? 56.078  14.297  37.521  1.00 140.01 ? 236  LEU A C     1 
ATOM   2692  O  O     . LEU D 4  236  ? 56.217  15.451  37.935  1.00 138.43 ? 236  LEU A O     1 
ATOM   2693  C  CB    . LEU D 4  236  ? 53.675  13.695  37.828  1.00 130.45 ? 236  LEU A CB    1 
ATOM   2694  C  CG    . LEU D 4  236  ? 52.580  12.706  38.202  1.00 127.11 ? 236  LEU A CG    1 
ATOM   2695  C  CD1   . LEU D 4  236  ? 51.307  13.419  38.598  1.00 126.33 ? 236  LEU A CD1   1 
ATOM   2696  C  CD2   . LEU D 4  236  ? 52.332  11.860  36.988  1.00 125.81 ? 236  LEU A CD2   1 
ATOM   2697  N  N     . THR D 4  237  ? 56.746  13.804  36.478  1.00 143.95 ? 237  THR A N     1 
ATOM   2698  C  CA    . THR D 4  237  ? 57.467  14.653  35.538  1.00 147.75 ? 237  THR A CA    1 
ATOM   2699  C  C     . THR D 4  237  ? 56.833  14.572  34.155  1.00 150.29 ? 237  THR A C     1 
ATOM   2700  O  O     . THR D 4  237  ? 56.453  15.594  33.578  1.00 143.93 ? 237  THR A O     1 
ATOM   2701  C  CB    . THR D 4  237  ? 58.954  14.268  35.460  1.00 142.29 ? 237  THR A CB    1 
ATOM   2702  O  OG1   . THR D 4  237  ? 59.128  13.250  34.470  1.00 136.67 ? 237  THR A OG1   1 
ATOM   2703  C  CG2   . THR D 4  237  ? 59.453  13.745  36.799  1.00 142.34 ? 237  THR A CG2   1 
ATOM   2704  N  N     . CYS D 4  238  ? 56.698  13.367  33.609  1.00 154.88 ? 238  CYS A N     1 
ATOM   2705  C  CA    . CYS D 4  238  ? 56.064  13.147  32.317  1.00 158.59 ? 238  CYS A CA    1 
ATOM   2706  C  C     . CYS D 4  238  ? 54.636  12.669  32.544  1.00 148.86 ? 238  CYS A C     1 
ATOM   2707  O  O     . CYS D 4  238  ? 54.415  11.646  33.200  1.00 143.19 ? 238  CYS A O     1 
ATOM   2708  C  CB    . CYS D 4  238  ? 56.848  12.128  31.490  1.00 165.97 ? 238  CYS A CB    1 
ATOM   2709  S  SG    . CYS D 4  238  ? 56.849  12.444  29.713  1.00 171.89 ? 238  CYS A SG    1 
ATOM   2710  N  N     . LEU D 4  239  ? 53.673  13.408  32.002  1.00 145.00 ? 239  LEU A N     1 
ATOM   2711  C  CA    . LEU D 4  239  ? 52.260  13.078  32.121  1.00 138.40 ? 239  LEU A CA    1 
ATOM   2712  C  C     . LEU D 4  239  ? 51.768  12.373  30.866  1.00 138.98 ? 239  LEU A C     1 
ATOM   2713  O  O     . LEU D 4  239  ? 52.156  12.741  29.753  1.00 145.24 ? 239  LEU A O     1 
ATOM   2714  C  CB    . LEU D 4  239  ? 51.425  14.338  32.344  1.00 130.79 ? 239  LEU A CB    1 
ATOM   2715  C  CG    . LEU D 4  239  ? 50.096  14.192  33.091  1.00 120.32 ? 239  LEU A CG    1 
ATOM   2716  C  CD1   . LEU D 4  239  ? 50.302  13.505  34.421  1.00 117.49 ? 239  LEU A CD1   1 
ATOM   2717  C  CD2   . LEU D 4  239  ? 49.433  15.545  33.283  1.00 118.77 ? 239  LEU A CD2   1 
ATOM   2718  N  N     . PRO D 4  240  ? 50.927  11.348  31.009  1.00 130.45 ? 240  PRO A N     1 
ATOM   2719  C  CA    . PRO D 4  240  ? 50.292  10.745  29.832  1.00 132.35 ? 240  PRO A CA    1 
ATOM   2720  C  C     . PRO D 4  240  ? 48.966  11.402  29.477  1.00 125.67 ? 240  PRO A C     1 
ATOM   2721  O  O     . PRO D 4  240  ? 48.185  11.821  30.336  1.00 129.94 ? 240  PRO A O     1 
ATOM   2722  C  CB    . PRO D 4  240  ? 50.098  9.290   30.278  1.00 122.39 ? 240  PRO A CB    1 
ATOM   2723  C  CG    . PRO D 4  240  ? 49.772  9.426   31.725  1.00 111.54 ? 240  PRO A CG    1 
ATOM   2724  C  CD    . PRO D 4  240  ? 50.686  10.540  32.219  1.00 115.78 ? 240  PRO A CD    1 
ATOM   2725  N  N     . VAL D 4  241  ? 48.718  11.507  28.178  1.00 118.40 ? 241  VAL A N     1 
ATOM   2726  C  CA    . VAL D 4  241  ? 47.503  12.120  27.647  1.00 115.55 ? 241  VAL A CA    1 
ATOM   2727  C  C     . VAL D 4  241  ? 46.530  11.008  27.277  1.00 121.32 ? 241  VAL A C     1 
ATOM   2728  O  O     . VAL D 4  241  ? 46.875  10.154  26.446  1.00 127.39 ? 241  VAL A O     1 
ATOM   2729  C  CB    . VAL D 4  241  ? 47.796  13.014  26.435  1.00 110.92 ? 241  VAL A CB    1 
ATOM   2730  C  CG1   . VAL D 4  241  ? 46.649  13.979  26.218  1.00 101.65 ? 241  VAL A CG1   1 
ATOM   2731  C  CG2   . VAL D 4  241  ? 49.096  13.763  26.633  1.00 114.28 ? 241  VAL A CG2   1 
ATOM   2732  N  N     . PRO D 4  242  ? 45.328  10.976  27.853  1.00 114.37 ? 242  PRO A N     1 
ATOM   2733  C  CA    . PRO D 4  242  ? 44.378  9.928   27.496  1.00 109.88 ? 242  PRO A CA    1 
ATOM   2734  C  C     . PRO D 4  242  ? 43.838  10.154  26.094  1.00 116.46 ? 242  PRO A C     1 
ATOM   2735  O  O     . PRO D 4  242  ? 43.813  11.293  25.600  1.00 116.47 ? 242  PRO A O     1 
ATOM   2736  C  CB    . PRO D 4  242  ? 43.265  10.077  28.549  1.00 106.29 ? 242  PRO A CB    1 
ATOM   2737  C  CG    . PRO D 4  242  ? 43.626  11.228  29.407  1.00 110.76 ? 242  PRO A CG    1 
ATOM   2738  C  CD    . PRO D 4  242  ? 44.807  11.923  28.851  1.00 113.58 ? 242  PRO A CD    1 
ATOM   2739  N  N     . PRO D 4  243  ? 43.406  9.098   25.417  1.00 117.32 ? 243  PRO A N     1 
ATOM   2740  C  CA    . PRO D 4  243  ? 42.820  9.256   24.085  1.00 115.34 ? 243  PRO A CA    1 
ATOM   2741  C  C     . PRO D 4  243  ? 41.453  9.913   24.158  1.00 116.87 ? 243  PRO A C     1 
ATOM   2742  O  O     . PRO D 4  243  ? 40.834  9.958   25.232  1.00 116.28 ? 243  PRO A O     1 
ATOM   2743  C  CB    . PRO D 4  243  ? 42.716  7.811   23.576  1.00 116.97 ? 243  PRO A CB    1 
ATOM   2744  C  CG    . PRO D 4  243  ? 42.754  6.969   24.802  1.00 120.52 ? 243  PRO A CG    1 
ATOM   2745  C  CD    . PRO D 4  243  ? 43.659  7.686   25.740  1.00 119.68 ? 243  PRO A CD    1 
ATOM   2746  N  N     . PRO D 4  244  ? 40.962  10.447  23.041  1.00 116.75 ? 244  PRO A N     1 
ATOM   2747  C  CA    . PRO D 4  244  ? 39.601  11.026  22.999  1.00 111.84 ? 244  PRO A CA    1 
ATOM   2748  C  C     . PRO D 4  244  ? 38.484  10.047  23.345  1.00 102.56 ? 244  PRO A C     1 
ATOM   2749  O  O     . PRO D 4  244  ? 37.412  10.508  23.763  1.00 93.91  ? 244  PRO A O     1 
ATOM   2750  C  CB    . PRO D 4  244  ? 39.472  11.521  21.550  1.00 116.33 ? 244  PRO A CB    1 
ATOM   2751  C  CG    . PRO D 4  244  ? 40.858  11.740  21.090  1.00 121.17 ? 244  PRO A CG    1 
ATOM   2752  C  CD    . PRO D 4  244  ? 41.755  10.808  21.851  1.00 121.27 ? 244  PRO A CD    1 
ATOM   2753  N  N     . PRO D 4  245  ? 38.629  8.719   23.166  1.00 99.14  ? 245  PRO A N     1 
ATOM   2754  C  CA    . PRO D 4  245  ? 37.620  7.819   23.762  1.00 99.81  ? 245  PRO A CA    1 
ATOM   2755  C  C     . PRO D 4  245  ? 37.473  7.920   25.275  1.00 99.66  ? 245  PRO A C     1 
ATOM   2756  O  O     . PRO D 4  245  ? 36.433  7.509   25.799  1.00 99.10  ? 245  PRO A O     1 
ATOM   2757  C  CB    . PRO D 4  245  ? 38.107  6.430   23.340  1.00 96.43  ? 245  PRO A CB    1 
ATOM   2758  C  CG    . PRO D 4  245  ? 38.626  6.670   22.008  1.00 95.54  ? 245  PRO A CG    1 
ATOM   2759  C  CD    . PRO D 4  245  ? 39.354  7.984   22.102  1.00 98.42  ? 245  PRO A CD    1 
ATOM   2760  N  N     . VAL D 4  246  ? 38.463  8.448   25.994  1.00 94.52  ? 246  VAL A N     1 
ATOM   2761  C  CA    . VAL D 4  246  ? 38.264  8.706   27.413  1.00 89.31  ? 246  VAL A CA    1 
ATOM   2762  C  C     . VAL D 4  246  ? 37.408  9.956   27.617  1.00 97.37  ? 246  VAL A C     1 
ATOM   2763  O  O     . VAL D 4  246  ? 36.659  10.052  28.597  1.00 99.33  ? 246  VAL A O     1 
ATOM   2764  C  CB    . VAL D 4  246  ? 39.631  8.819   28.112  1.00 85.65  ? 246  VAL A CB    1 
ATOM   2765  C  CG1   . VAL D 4  246  ? 39.481  9.015   29.618  1.00 78.07  ? 246  VAL A CG1   1 
ATOM   2766  C  CG2   . VAL D 4  246  ? 40.473  7.592   27.814  1.00 88.25  ? 246  VAL A CG2   1 
ATOM   2767  N  N     . ARG D 4  247  ? 37.470  10.909  26.685  1.00 98.43  ? 247  ARG A N     1 
ATOM   2768  C  CA    . ARG D 4  247  ? 36.825  12.215  26.849  1.00 99.68  ? 247  ARG A CA    1 
ATOM   2769  C  C     . ARG D 4  247  ? 36.100  12.628  25.560  1.00 101.67 ? 247  ARG A C     1 
ATOM   2770  O  O     . ARG D 4  247  ? 36.411  13.648  24.939  1.00 98.72  ? 247  ARG A O     1 
ATOM   2771  C  CB    . ARG D 4  247  ? 37.865  13.241  27.317  1.00 105.96 ? 247  ARG A CB    1 
ATOM   2772  C  CG    . ARG D 4  247  ? 39.059  13.500  26.380  1.00 112.63 ? 247  ARG A CG    1 
ATOM   2773  C  CD    . ARG D 4  247  ? 40.407  13.404  27.053  1.00 116.48 ? 247  ARG A CD    1 
ATOM   2774  N  NE    . ARG D 4  247  ? 41.431  12.986  26.101  1.00 119.33 ? 247  ARG A NE    1 
ATOM   2775  C  CZ    . ARG D 4  247  ? 42.023  13.797  25.229  1.00 121.04 ? 247  ARG A CZ    1 
ATOM   2776  N  NH1   . ARG D 4  247  ? 41.706  15.087  25.181  1.00 108.99 ? 247  ARG A NH1   1 
ATOM   2777  N  NH2   . ARG D 4  247  ? 42.941  13.318  24.401  1.00 131.21 ? 247  ARG A NH2   1 
ATOM   2778  N  N     . PRO D 4  248  ? 35.069  11.878  25.167  1.00 108.90 ? 248  PRO A N     1 
ATOM   2779  C  CA    . PRO D 4  248  ? 34.469  12.080  23.842  1.00 118.22 ? 248  PRO A CA    1 
ATOM   2780  C  C     . PRO D 4  248  ? 33.681  13.381  23.757  1.00 132.16 ? 248  PRO A C     1 
ATOM   2781  O  O     . PRO D 4  248  ? 33.356  14.022  24.759  1.00 150.92 ? 248  PRO A O     1 
ATOM   2782  C  CB    . PRO D 4  248  ? 33.556  10.865  23.689  1.00 108.60 ? 248  PRO A CB    1 
ATOM   2783  C  CG    . PRO D 4  248  ? 33.110  10.584  25.080  1.00 99.78  ? 248  PRO A CG    1 
ATOM   2784  C  CD    . PRO D 4  248  ? 34.263  10.957  25.990  1.00 107.94 ? 248  PRO A CD    1 
ATOM   2785  N  N     . SER D 4  249  ? 33.383  13.770  22.522  1.00 119.86 ? 249  SER A N     1 
ATOM   2786  C  CA    . SER D 4  249  ? 32.661  15.009  22.260  1.00 108.91 ? 249  SER A CA    1 
ATOM   2787  C  C     . SER D 4  249  ? 31.202  14.737  21.914  1.00 100.30 ? 249  SER A C     1 
ATOM   2788  O  O     . SER D 4  249  ? 30.328  15.560  22.184  1.00 94.11  ? 249  SER A O     1 
ATOM   2789  C  CB    . SER D 4  249  ? 33.330  15.791  21.127  1.00 110.35 ? 249  SER A CB    1 
ATOM   2790  O  OG    . SER D 4  249  ? 33.888  14.917  20.163  1.00 109.90 ? 249  SER A OG    1 
ATOM   2791  N  N     . ARG D 4  257  ? 28.542  19.381  19.413  1.00 149.72 ? 257  ARG A N     1 
ATOM   2792  C  CA    . ARG D 4  257  ? 27.591  19.453  20.515  1.00 147.76 ? 257  ARG A CA    1 
ATOM   2793  C  C     . ARG D 4  257  ? 28.236  20.047  21.767  1.00 157.18 ? 257  ARG A C     1 
ATOM   2794  O  O     . ARG D 4  257  ? 27.742  21.023  22.327  1.00 155.04 ? 257  ARG A O     1 
ATOM   2795  C  CB    . ARG D 4  257  ? 27.022  18.066  20.822  1.00 129.71 ? 257  ARG A CB    1 
ATOM   2796  N  N     . GLY D 4  258  ? 29.342  19.453  22.197  1.00 165.83 ? 258  GLY A N     1 
ATOM   2797  C  CA    . GLY D 4  258  ? 30.024  19.916  23.392  1.00 163.15 ? 258  GLY A CA    1 
ATOM   2798  C  C     . GLY D 4  258  ? 31.285  19.112  23.610  1.00 155.37 ? 258  GLY A C     1 
ATOM   2799  O  O     . GLY D 4  258  ? 31.536  18.108  22.937  1.00 156.74 ? 258  GLY A O     1 
ATOM   2800  N  N     . GLU D 4  259  ? 32.078  19.572  24.574  1.00 146.94 ? 259  GLU A N     1 
ATOM   2801  C  CA    . GLU D 4  259  ? 33.373  18.983  24.877  1.00 138.57 ? 259  GLU A CA    1 
ATOM   2802  C  C     . GLU D 4  259  ? 33.388  18.488  26.318  1.00 138.27 ? 259  GLU A C     1 
ATOM   2803  O  O     . GLU D 4  259  ? 32.747  19.072  27.198  1.00 130.50 ? 259  GLU A O     1 
ATOM   2804  C  CB    . GLU D 4  259  ? 34.504  19.998  24.632  1.00 134.53 ? 259  GLU A CB    1 
ATOM   2805  C  CG    . GLU D 4  259  ? 35.947  19.501  24.802  1.00 132.44 ? 259  GLU A CG    1 
ATOM   2806  C  CD    . GLU D 4  259  ? 36.272  18.244  24.005  1.00 130.60 ? 259  GLU A CD    1 
ATOM   2807  O  OE1   . GLU D 4  259  ? 35.945  17.126  24.463  1.00 127.00 ? 259  GLU A OE1   1 
ATOM   2808  O  OE2   . GLU D 4  259  ? 36.856  18.375  22.910  1.00 128.75 ? 259  GLU A OE2   1 
ATOM   2809  N  N     . ASP D 4  260  ? 34.120  17.396  26.542  1.00 147.69 ? 260  ASP A N     1 
ATOM   2810  C  CA    . ASP D 4  260  ? 34.136  16.709  27.827  1.00 152.38 ? 260  ASP A CA    1 
ATOM   2811  C  C     . ASP D 4  260  ? 34.748  17.596  28.909  1.00 153.95 ? 260  ASP A C     1 
ATOM   2812  O  O     . ASP D 4  260  ? 35.598  18.449  28.640  1.00 168.89 ? 260  ASP A O     1 
ATOM   2813  C  CB    . ASP D 4  260  ? 34.905  15.390  27.692  1.00 147.44 ? 260  ASP A CB    1 
ATOM   2814  C  CG    . ASP D 4  260  ? 34.822  14.509  28.934  1.00 142.45 ? 260  ASP A CG    1 
ATOM   2815  O  OD1   . ASP D 4  260  ? 34.286  13.387  28.814  1.00 140.03 ? 260  ASP A OD1   1 
ATOM   2816  O  OD2   . ASP D 4  260  ? 35.331  14.892  30.010  1.00 142.44 ? 260  ASP A OD2   1 
ATOM   2817  N  N     . ASP D 4  261  ? 34.302  17.373  30.151  1.00 135.47 ? 261  ASP A N     1 
ATOM   2818  C  CA    . ASP D 4  261  ? 34.634  18.274  31.253  1.00 118.95 ? 261  ASP A CA    1 
ATOM   2819  C  C     . ASP D 4  261  ? 36.108  18.215  31.633  1.00 109.88 ? 261  ASP A C     1 
ATOM   2820  O  O     . ASP D 4  261  ? 36.652  19.209  32.126  1.00 119.48 ? 261  ASP A O     1 
ATOM   2821  C  CB    . ASP D 4  261  ? 33.765  17.955  32.469  1.00 111.68 ? 261  ASP A CB    1 
ATOM   2822  C  CG    . ASP D 4  261  ? 32.479  18.757  32.491  1.00 117.26 ? 261  ASP A CG    1 
ATOM   2823  O  OD1   . ASP D 4  261  ? 31.829  18.872  31.431  1.00 120.74 ? 261  ASP A OD1   1 
ATOM   2824  O  OD2   . ASP D 4  261  ? 32.117  19.269  33.572  1.00 115.38 ? 261  ASP A OD2   1 
ATOM   2825  N  N     . LEU D 4  262  ? 36.772  17.079  31.422  1.00 102.78 ? 262  LEU A N     1 
ATOM   2826  C  CA    . LEU D 4  262  ? 38.195  16.996  31.721  1.00 106.30 ? 262  LEU A CA    1 
ATOM   2827  C  C     . LEU D 4  262  ? 39.070  17.428  30.552  1.00 112.58 ? 262  LEU A C     1 
ATOM   2828  O  O     . LEU D 4  262  ? 40.264  17.660  30.753  1.00 103.91 ? 262  LEU A O     1 
ATOM   2829  C  CB    . LEU D 4  262  ? 38.569  15.574  32.188  1.00 104.45 ? 262  LEU A CB    1 
ATOM   2830  C  CG    . LEU D 4  262  ? 38.702  14.311  31.322  1.00 102.73 ? 262  LEU A CG    1 
ATOM   2831  C  CD1   . LEU D 4  262  ? 40.048  14.187  30.627  1.00 100.41 ? 262  LEU A CD1   1 
ATOM   2832  C  CD2   . LEU D 4  262  ? 38.485  13.094  32.196  1.00 93.93  ? 262  LEU A CD2   1 
ATOM   2833  N  N     . THR D 4  263  ? 38.510  17.541  29.344  1.00 124.94 ? 263  THR A N     1 
ATOM   2834  C  CA    . THR D 4  263  ? 39.285  18.056  28.220  1.00 131.15 ? 263  THR A CA    1 
ATOM   2835  C  C     . THR D 4  263  ? 39.599  19.536  28.394  1.00 134.83 ? 263  THR A C     1 
ATOM   2836  O  O     . THR D 4  263  ? 40.636  20.009  27.917  1.00 130.06 ? 263  THR A O     1 
ATOM   2837  C  CB    . THR D 4  263  ? 38.533  17.823  26.910  1.00 118.79 ? 263  THR A CB    1 
ATOM   2838  O  OG1   . THR D 4  263  ? 37.893  16.543  26.946  1.00 115.75 ? 263  THR A OG1   1 
ATOM   2839  C  CG2   . THR D 4  263  ? 39.495  17.854  25.733  1.00 110.51 ? 263  THR A CG2   1 
ATOM   2840  N  N     . PHE D 4  264  ? 38.715  20.279  29.066  1.00 143.05 ? 264  PHE A N     1 
ATOM   2841  C  CA    . PHE D 4  264  ? 39.028  21.653  29.444  1.00 146.18 ? 264  PHE A CA    1 
ATOM   2842  C  C     . PHE D 4  264  ? 40.168  21.695  30.449  1.00 146.77 ? 264  PHE A C     1 
ATOM   2843  O  O     . PHE D 4  264  ? 41.084  22.517  30.328  1.00 148.91 ? 264  PHE A O     1 
ATOM   2844  C  CB    . PHE D 4  264  ? 37.803  22.343  30.051  1.00 141.16 ? 264  PHE A CB    1 
ATOM   2845  C  CG    . PHE D 4  264  ? 36.606  22.427  29.141  1.00 137.18 ? 264  PHE A CG    1 
ATOM   2846  C  CD1   . PHE D 4  264  ? 35.352  22.672  29.677  1.00 133.00 ? 264  PHE A CD1   1 
ATOM   2847  C  CD2   . PHE D 4  264  ? 36.733  22.342  27.762  1.00 133.82 ? 264  PHE A CD2   1 
ATOM   2848  C  CE1   . PHE D 4  264  ? 34.239  22.770  28.867  1.00 129.39 ? 264  PHE A CE1   1 
ATOM   2849  C  CE2   . PHE D 4  264  ? 35.624  22.444  26.946  1.00 130.06 ? 264  PHE A CE2   1 
ATOM   2850  C  CZ    . PHE D 4  264  ? 34.376  22.658  27.498  1.00 128.78 ? 264  PHE A CZ    1 
ATOM   2851  N  N     . LYS D 4  265  ? 40.125  20.811  31.448  1.00 133.41 ? 265  LYS A N     1 
ATOM   2852  C  CA    . LYS D 4  265  ? 41.028  20.920  32.586  1.00 122.51 ? 265  LYS A CA    1 
ATOM   2853  C  C     . LYS D 4  265  ? 42.448  20.508  32.218  1.00 121.26 ? 265  LYS A C     1 
ATOM   2854  O  O     . LYS D 4  265  ? 43.409  21.077  32.747  1.00 123.26 ? 265  LYS A O     1 
ATOM   2855  C  CB    . LYS D 4  265  ? 40.478  20.078  33.744  1.00 106.56 ? 265  LYS A CB    1 
ATOM   2856  C  CG    . LYS D 4  265  ? 41.202  20.141  35.103  1.00 108.55 ? 265  LYS A CG    1 
ATOM   2857  C  CD    . LYS D 4  265  ? 41.788  21.495  35.565  1.00 121.21 ? 265  LYS A CD    1 
ATOM   2858  C  CE    . LYS D 4  265  ? 40.772  22.648  35.647  1.00 126.61 ? 265  LYS A CE    1 
ATOM   2859  N  NZ    . LYS D 4  265  ? 40.031  22.636  36.940  1.00 128.55 ? 265  LYS A NZ    1 
ATOM   2860  N  N     . LEU D 4  266  ? 42.608  19.541  31.307  1.00 114.60 ? 266  LEU A N     1 
ATOM   2861  C  CA    . LEU D 4  266  ? 43.944  19.254  30.791  1.00 110.91 ? 266  LEU A CA    1 
ATOM   2862  C  C     . LEU D 4  266  ? 44.420  20.352  29.852  1.00 122.09 ? 266  LEU A C     1 
ATOM   2863  O  O     . LEU D 4  266  ? 45.625  20.605  29.760  1.00 124.93 ? 266  LEU A O     1 
ATOM   2864  C  CB    . LEU D 4  266  ? 43.975  17.890  30.093  1.00 95.99  ? 266  LEU A CB    1 
ATOM   2865  C  CG    . LEU D 4  266  ? 42.996  17.534  28.968  1.00 98.12  ? 266  LEU A CG    1 
ATOM   2866  C  CD1   . LEU D 4  266  ? 43.467  17.981  27.587  1.00 118.22 ? 266  LEU A CD1   1 
ATOM   2867  C  CD2   . LEU D 4  266  ? 42.760  16.040  28.971  1.00 83.99  ? 266  LEU A CD2   1 
ATOM   2868  N  N     . ALA D 4  267  ? 43.497  20.996  29.133  1.00 130.99 ? 267  ALA A N     1 
ATOM   2869  C  CA    . ALA D 4  267  ? 43.872  22.162  28.342  1.00 139.45 ? 267  ALA A CA    1 
ATOM   2870  C  C     . ALA D 4  267  ? 44.244  23.332  29.237  1.00 143.86 ? 267  ALA A C     1 
ATOM   2871  O  O     . ALA D 4  267  ? 45.076  24.165  28.858  1.00 150.92 ? 267  ALA A O     1 
ATOM   2872  C  CB    . ALA D 4  267  ? 42.733  22.550  27.400  1.00 137.26 ? 267  ALA A CB    1 
ATOM   2873  N  N     . ASP D 4  268  ? 43.646  23.404  30.427  1.00 140.96 ? 268  ASP A N     1 
ATOM   2874  C  CA    . ASP D 4  268  ? 44.039  24.411  31.402  1.00 138.71 ? 268  ASP A CA    1 
ATOM   2875  C  C     . ASP D 4  268  ? 45.414  24.115  31.985  1.00 130.31 ? 268  ASP A C     1 
ATOM   2876  O  O     . ASP D 4  268  ? 46.095  25.033  32.455  1.00 129.42 ? 268  ASP A O     1 
ATOM   2877  C  CB    . ASP D 4  268  ? 42.990  24.490  32.507  1.00 139.28 ? 268  ASP A CB    1 
ATOM   2878  C  CG    . ASP D 4  268  ? 41.713  25.166  32.052  1.00 138.69 ? 268  ASP A CG    1 
ATOM   2879  O  OD1   . ASP D 4  268  ? 41.542  25.356  30.830  1.00 139.70 ? 268  ASP A OD1   1 
ATOM   2880  O  OD2   . ASP D 4  268  ? 40.876  25.496  32.919  1.00 136.75 ? 268  ASP A OD2   1 
ATOM   2881  N  N     . ILE D 4  269  ? 45.831  22.846  31.970  1.00 123.62 ? 269  ILE A N     1 
ATOM   2882  C  CA    . ILE D 4  269  ? 47.193  22.498  32.368  1.00 120.26 ? 269  ILE A CA    1 
ATOM   2883  C  C     . ILE D 4  269  ? 48.192  23.049  31.360  1.00 133.09 ? 269  ILE A C     1 
ATOM   2884  O  O     . ILE D 4  269  ? 49.175  23.700  31.730  1.00 134.59 ? 269  ILE A O     1 
ATOM   2885  C  CB    . ILE D 4  269  ? 47.342  20.971  32.513  1.00 102.19 ? 269  ILE A CB    1 
ATOM   2886  C  CG1   . ILE D 4  269  ? 46.587  20.454  33.737  1.00 101.26 ? 269  ILE A CG1   1 
ATOM   2887  C  CG2   . ILE D 4  269  ? 48.809  20.567  32.583  1.00 92.10  ? 269  ILE A CG2   1 
ATOM   2888  C  CD1   . ILE D 4  269  ? 46.351  18.962  33.714  1.00 95.04  ? 269  ILE A CD1   1 
ATOM   2889  N  N     . LEU D 4  270  ? 47.938  22.810  30.068  1.00 142.39 ? 270  LEU A N     1 
ATOM   2890  C  CA    . LEU D 4  270  ? 48.930  23.083  29.032  1.00 154.05 ? 270  LEU A CA    1 
ATOM   2891  C  C     . LEU D 4  270  ? 49.161  24.580  28.866  1.00 170.09 ? 270  LEU A C     1 
ATOM   2892  O  O     . LEU D 4  270  ? 50.297  25.013  28.646  1.00 173.14 ? 270  LEU A O     1 
ATOM   2893  C  CB    . LEU D 4  270  ? 48.482  22.454  27.713  1.00 149.80 ? 270  LEU A CB    1 
ATOM   2894  C  CG    . LEU D 4  270  ? 49.532  21.909  26.739  1.00 151.00 ? 270  LEU A CG    1 
ATOM   2895  C  CD1   . LEU D 4  270  ? 48.860  20.983  25.739  1.00 146.07 ? 270  LEU A CD1   1 
ATOM   2896  C  CD2   . LEU D 4  270  ? 50.334  22.987  26.019  1.00 154.57 ? 270  LEU A CD2   1 
ATOM   2897  N  N     . LYS D 4  271  ? 48.096  25.382  28.960  1.00 171.15 ? 271  LYS A N     1 
ATOM   2898  C  CA    . LYS D 4  271  ? 48.262  26.832  28.954  1.00 175.12 ? 271  LYS A CA    1 
ATOM   2899  C  C     . LYS D 4  271  ? 49.027  27.291  30.190  1.00 185.08 ? 271  LYS A C     1 
ATOM   2900  O  O     . LYS D 4  271  ? 49.898  28.166  30.102  1.00 195.86 ? 271  LYS A O     1 
ATOM   2901  C  CB    . LYS D 4  271  ? 46.898  27.522  28.875  1.00 167.20 ? 271  LYS A CB    1 
ATOM   2902  C  CG    . LYS D 4  271  ? 46.930  29.045  29.027  1.00 163.32 ? 271  LYS A CG    1 
ATOM   2903  C  CD    . LYS D 4  271  ? 47.897  29.717  28.051  1.00 159.36 ? 271  LYS A CD    1 
ATOM   2904  C  CE    . LYS D 4  271  ? 48.120  31.174  28.424  1.00 153.26 ? 271  LYS A CE    1 
ATOM   2905  N  NZ    . LYS D 4  271  ? 47.219  32.097  27.680  1.00 148.01 ? 271  LYS A NZ    1 
ATOM   2906  N  N     . ALA D 4  272  ? 48.722  26.707  31.350  1.00 175.28 ? 272  ALA A N     1 
ATOM   2907  C  CA    . ALA D 4  272  ? 49.523  26.987  32.535  1.00 164.79 ? 272  ALA A CA    1 
ATOM   2908  C  C     . ALA D 4  272  ? 50.937  26.442  32.392  1.00 155.90 ? 272  ALA A C     1 
ATOM   2909  O  O     . ALA D 4  272  ? 51.885  27.051  32.898  1.00 162.63 ? 272  ALA A O     1 
ATOM   2910  C  CB    . ALA D 4  272  ? 48.848  26.405  33.777  1.00 161.26 ? 272  ALA A CB    1 
ATOM   2911  N  N     . ASN D 4  273  ? 51.101  25.319  31.689  1.00 141.21 ? 273  ASN A N     1 
ATOM   2912  C  CA    . ASN D 4  273  ? 52.432  24.753  31.496  1.00 135.35 ? 273  ASN A CA    1 
ATOM   2913  C  C     . ASN D 4  273  ? 53.246  25.557  30.490  1.00 137.75 ? 273  ASN A C     1 
ATOM   2914  O  O     . ASN D 4  273  ? 54.452  25.751  30.679  1.00 117.35 ? 273  ASN A O     1 
ATOM   2915  C  CB    . ASN D 4  273  ? 52.320  23.294  31.056  1.00 125.45 ? 273  ASN A CB    1 
ATOM   2916  C  CG    . ASN D 4  273  ? 53.579  22.792  30.382  1.00 121.82 ? 273  ASN A CG    1 
ATOM   2917  O  OD1   . ASN D 4  273  ? 54.555  22.449  31.044  1.00 115.61 ? 273  ASN A OD1   1 
ATOM   2918  N  ND2   . ASN D 4  273  ? 53.556  22.730  29.056  1.00 122.53 ? 273  ASN A ND2   1 
ATOM   2919  N  N     . ILE D 4  274  ? 52.609  26.032  29.415  1.00 161.92 ? 274  ILE A N     1 
ATOM   2920  C  CA    . ILE D 4  274  ? 53.347  26.750  28.380  1.00 173.56 ? 274  ILE A CA    1 
ATOM   2921  C  C     . ILE D 4  274  ? 53.787  28.125  28.873  1.00 181.37 ? 274  ILE A C     1 
ATOM   2922  O  O     . ILE D 4  274  ? 54.727  28.706  28.319  1.00 195.80 ? 274  ILE A O     1 
ATOM   2923  C  CB    . ILE D 4  274  ? 52.506  26.846  27.088  1.00 171.83 ? 274  ILE A CB    1 
ATOM   2924  C  CG1   . ILE D 4  274  ? 53.381  27.140  25.864  1.00 172.63 ? 274  ILE A CG1   1 
ATOM   2925  C  CG2   . ILE D 4  274  ? 51.423  27.905  27.210  1.00 170.51 ? 274  ILE A CG2   1 
ATOM   2926  C  CD1   . ILE D 4  274  ? 54.646  26.311  25.788  1.00 172.64 ? 274  ILE A CD1   1 
ATOM   2927  N  N     . SER D 4  275  ? 53.146  28.654  29.922  1.00 168.90 ? 275  SER A N     1 
ATOM   2928  C  CA    . SER D 4  275  ? 53.637  29.876  30.546  1.00 154.12 ? 275  SER A CA    1 
ATOM   2929  C  C     . SER D 4  275  ? 54.985  29.649  31.215  1.00 155.47 ? 275  SER A C     1 
ATOM   2930  O  O     . SER D 4  275  ? 55.826  30.554  31.228  1.00 144.81 ? 275  SER A O     1 
ATOM   2931  C  CB    . SER D 4  275  ? 52.624  30.392  31.567  1.00 139.71 ? 275  SER A CB    1 
ATOM   2932  O  OG    . SER D 4  275  ? 52.595  29.559  32.712  1.00 134.38 ? 275  SER A OG    1 
ATOM   2933  N  N     . LEU D 4  276  ? 55.207  28.452  31.768  1.00 174.11 ? 276  LEU A N     1 
ATOM   2934  C  CA    . LEU D 4  276  ? 56.507  28.130  32.349  1.00 185.02 ? 276  LEU A CA    1 
ATOM   2935  C  C     . LEU D 4  276  ? 57.573  28.022  31.270  1.00 200.96 ? 276  LEU A C     1 
ATOM   2936  O  O     . LEU D 4  276  ? 58.690  28.516  31.445  1.00 209.51 ? 276  LEU A O     1 
ATOM   2937  C  CB    . LEU D 4  276  ? 56.445  26.822  33.140  1.00 174.10 ? 276  LEU A CB    1 
ATOM   2938  C  CG    . LEU D 4  276  ? 55.983  26.820  34.598  1.00 166.38 ? 276  LEU A CG    1 
ATOM   2939  C  CD1   . LEU D 4  276  ? 56.930  27.651  35.460  1.00 165.49 ? 276  LEU A CD1   1 
ATOM   2940  C  CD2   . LEU D 4  276  ? 54.542  27.264  34.752  1.00 161.16 ? 276  LEU A CD2   1 
ATOM   2941  N  N     . GLU D 4  277  ? 57.244  27.378  30.148  1.00 200.75 ? 277  GLU A N     1 
ATOM   2942  C  CA    . GLU D 4  277  ? 58.159  27.325  29.017  1.00 192.83 ? 277  GLU A CA    1 
ATOM   2943  C  C     . GLU D 4  277  ? 58.378  28.701  28.407  1.00 190.91 ? 277  GLU A C     1 
ATOM   2944  O  O     . GLU D 4  277  ? 59.418  28.931  27.783  1.00 194.16 ? 277  GLU A O     1 
ATOM   2945  C  CB    . GLU D 4  277  ? 57.622  26.357  27.966  1.00 178.96 ? 277  GLU A CB    1 
ATOM   2946  C  CG    . GLU D 4  277  ? 57.399  24.944  28.486  1.00 164.75 ? 277  GLU A CG    1 
ATOM   2947  C  CD    . GLU D 4  277  ? 58.577  24.023  28.239  1.00 160.70 ? 277  GLU A CD    1 
ATOM   2948  O  OE1   . GLU D 4  277  ? 59.701  24.520  28.011  1.00 161.08 ? 277  GLU A OE1   1 
ATOM   2949  O  OE2   . GLU D 4  277  ? 58.378  22.791  28.286  1.00 156.10 ? 277  GLU A OE2   1 
ATOM   2950  N  N     . THR D 4  278  ? 57.421  29.614  28.582  1.00 181.53 ? 278  THR A N     1 
ATOM   2951  C  CA    . THR D 4  278  ? 57.603  31.003  28.183  1.00 173.42 ? 278  THR A CA    1 
ATOM   2952  C  C     . THR D 4  278  ? 58.460  31.760  29.194  1.00 170.14 ? 278  THR A C     1 
ATOM   2953  O  O     . THR D 4  278  ? 59.499  32.323  28.840  1.00 163.01 ? 278  THR A O     1 
ATOM   2954  C  CB    . THR D 4  278  ? 56.238  31.685  28.024  1.00 164.64 ? 278  THR A CB    1 
ATOM   2955  O  OG1   . THR D 4  278  ? 55.309  30.769  27.431  1.00 158.04 ? 278  THR A OG1   1 
ATOM   2956  C  CG2   . THR D 4  278  ? 56.345  32.920  27.143  1.00 165.59 ? 278  THR A CG2   1 
ATOM   2957  N  N     . LEU D 4  279  ? 58.042  31.759  30.467  1.00 170.71 ? 279  LEU A N     1 
ATOM   2958  C  CA    . LEU D 4  279  ? 58.626  32.662  31.457  1.00 176.46 ? 279  LEU A CA    1 
ATOM   2959  C  C     . LEU D 4  279  ? 60.050  32.266  31.829  1.00 192.56 ? 279  LEU A C     1 
ATOM   2960  O  O     . LEU D 4  279  ? 60.886  33.136  32.100  1.00 203.68 ? 279  LEU A O     1 
ATOM   2961  C  CB    . LEU D 4  279  ? 57.755  32.709  32.711  1.00 161.23 ? 279  LEU A CB    1 
ATOM   2962  C  CG    . LEU D 4  279  ? 56.525  33.615  32.704  1.00 146.26 ? 279  LEU A CG    1 
ATOM   2963  C  CD1   . LEU D 4  279  ? 56.017  33.813  34.122  1.00 137.53 ? 279  LEU A CD1   1 
ATOM   2964  C  CD2   . LEU D 4  279  ? 56.850  34.954  32.065  1.00 144.51 ? 279  LEU A CD2   1 
ATOM   2965  N  N     . GLU D 4  280  ? 60.349  30.963  31.856  1.00 190.25 ? 280  GLU A N     1 
ATOM   2966  C  CA    . GLU D 4  280  ? 61.673  30.511  32.273  1.00 192.58 ? 280  GLU A CA    1 
ATOM   2967  C  C     . GLU D 4  280  ? 62.757  30.896  31.273  1.00 198.81 ? 280  GLU A C     1 
ATOM   2968  O  O     . GLU D 4  280  ? 63.941  30.874  31.623  1.00 199.08 ? 280  GLU A O     1 
ATOM   2969  C  CB    . GLU D 4  280  ? 61.673  28.997  32.485  1.00 188.43 ? 280  GLU A CB    1 
ATOM   2970  C  CG    . GLU D 4  280  ? 62.484  28.522  33.677  1.00 186.95 ? 280  GLU A CG    1 
ATOM   2971  C  CD    . GLU D 4  280  ? 61.957  27.220  34.251  1.00 181.16 ? 280  GLU A CD    1 
ATOM   2972  O  OE1   . GLU D 4  280  ? 62.617  26.176  34.079  1.00 178.60 ? 280  GLU A OE1   1 
ATOM   2973  O  OE2   . GLU D 4  280  ? 60.874  27.244  34.875  1.00 176.94 ? 280  GLU A OE2   1 
ATOM   2974  N  N     . HIS D 4  281  ? 62.380  31.245  30.043  1.00 202.03 ? 281  HIS A N     1 
ATOM   2975  C  CA    . HIS D 4  281  ? 63.301  31.801  29.061  1.00 201.13 ? 281  HIS A CA    1 
ATOM   2976  C  C     . HIS D 4  281  ? 62.971  33.244  28.711  1.00 193.31 ? 281  HIS A C     1 
ATOM   2977  O  O     . HIS D 4  281  ? 63.718  33.871  27.953  1.00 193.34 ? 281  HIS A O     1 
ATOM   2978  C  CB    . HIS D 4  281  ? 63.320  30.942  27.786  1.00 202.30 ? 281  HIS A CB    1 
ATOM   2979  C  CG    . HIS D 4  281  ? 63.871  29.561  27.986  1.00 200.88 ? 281  HIS A CG    1 
ATOM   2980  N  ND1   . HIS D 4  281  ? 63.474  28.731  29.013  1.00 198.44 ? 281  HIS A ND1   1 
ATOM   2981  C  CD2   . HIS D 4  281  ? 64.801  28.868  27.286  1.00 201.00 ? 281  HIS A CD2   1 
ATOM   2982  C  CE1   . HIS D 4  281  ? 64.132  27.589  28.936  1.00 197.38 ? 281  HIS A CE1   1 
ATOM   2983  N  NE2   . HIS D 4  281  ? 64.944  27.646  27.896  1.00 200.03 ? 281  HIS A NE2   1 
ATOM   2984  N  N     . ASN D 4  282  ? 61.872  33.787  29.240  1.00 186.44 ? 282  ASN A N     1 
ATOM   2985  C  CA    . ASN D 4  282  ? 61.577  35.207  29.077  1.00 180.56 ? 282  ASN A CA    1 
ATOM   2986  C  C     . ASN D 4  282  ? 62.388  36.038  30.064  1.00 186.95 ? 282  ASN A C     1 
ATOM   2987  O  O     . ASN D 4  282  ? 62.838  37.139  29.730  1.00 189.30 ? 282  ASN A O     1 
ATOM   2988  C  CB    . ASN D 4  282  ? 60.068  35.443  29.254  1.00 168.75 ? 282  ASN A CB    1 
ATOM   2989  C  CG    . ASN D 4  282  ? 59.639  36.900  29.041  1.00 162.56 ? 282  ASN A CG    1 
ATOM   2990  O  OD1   . ASN D 4  282  ? 60.053  37.814  29.755  1.00 163.56 ? 282  ASN A OD1   1 
ATOM   2991  N  ND2   . ASN D 4  282  ? 58.786  37.109  28.044  1.00 155.97 ? 282  ASN A ND2   1 
ATOM   2992  N  N     . GLY D 4  283  ? 62.601  35.519  31.271  1.00 186.15 ? 283  GLY A N     1 
ATOM   2993  C  CA    . GLY D 4  283  ? 63.187  36.307  32.338  1.00 187.22 ? 283  GLY A CA    1 
ATOM   2994  C  C     . GLY D 4  283  ? 62.094  36.920  33.183  1.00 183.46 ? 283  GLY A C     1 
ATOM   2995  O  O     . GLY D 4  283  ? 61.448  37.885  32.763  1.00 185.32 ? 283  GLY A O     1 
ATOM   2996  N  N     . ALA D 4  284  ? 61.868  36.370  34.371  1.00 174.84 ? 284  ALA A N     1 
ATOM   2997  C  CA    . ALA D 4  284  ? 60.687  36.695  35.152  1.00 169.08 ? 284  ALA A CA    1 
ATOM   2998  C  C     . ALA D 4  284  ? 61.060  36.921  36.608  1.00 175.83 ? 284  ALA A C     1 
ATOM   2999  O  O     . ALA D 4  284  ? 62.093  36.421  37.072  1.00 179.42 ? 284  ALA A O     1 
ATOM   3000  C  CB    . ALA D 4  284  ? 59.643  35.568  35.059  1.00 156.17 ? 284  ALA A CB    1 
ATOM   3001  N  N     . PRO D 4  285  ? 60.252  37.686  37.347  1.00 175.15 ? 285  PRO A N     1 
ATOM   3002  C  CA    . PRO D 4  285  ? 60.398  37.709  38.805  1.00 179.07 ? 285  PRO A CA    1 
ATOM   3003  C  C     . PRO D 4  285  ? 60.113  36.334  39.391  1.00 189.41 ? 285  PRO A C     1 
ATOM   3004  O  O     . PRO D 4  285  ? 59.260  35.596  38.897  1.00 189.05 ? 285  PRO A O     1 
ATOM   3005  C  CB    . PRO D 4  285  ? 59.356  38.746  39.243  1.00 173.12 ? 285  PRO A CB    1 
ATOM   3006  C  CG    . PRO D 4  285  ? 58.342  38.711  38.126  1.00 164.03 ? 285  PRO A CG    1 
ATOM   3007  C  CD    . PRO D 4  285  ? 59.222  38.644  36.913  1.00 168.72 ? 285  PRO A CD    1 
ATOM   3008  N  N     . HIS D 4  286  ? 60.839  35.990  40.457  1.00 199.83 ? 286  HIS A N     1 
ATOM   3009  C  CA    . HIS D 4  286  ? 60.765  34.637  40.994  1.00 211.42 ? 286  HIS A CA    1 
ATOM   3010  C  C     . HIS D 4  286  ? 59.459  34.352  41.723  1.00 215.07 ? 286  HIS A C     1 
ATOM   3011  O  O     . HIS D 4  286  ? 59.193  33.188  42.036  1.00 208.03 ? 286  HIS A O     1 
ATOM   3012  C  CB    . HIS D 4  286  ? 61.941  34.369  41.934  1.00 220.42 ? 286  HIS A CB    1 
ATOM   3013  C  CG    . HIS D 4  286  ? 61.738  34.897  43.319  1.00 231.29 ? 286  HIS A CG    1 
ATOM   3014  N  ND1   . HIS D 4  286  ? 61.592  36.240  43.590  1.00 235.84 ? 286  HIS A ND1   1 
ATOM   3015  C  CD2   . HIS D 4  286  ? 61.658  34.261  44.512  1.00 232.57 ? 286  HIS A CD2   1 
ATOM   3016  C  CE1   . HIS D 4  286  ? 61.432  36.409  44.891  1.00 236.31 ? 286  HIS A CE1   1 
ATOM   3017  N  NE2   . HIS D 4  286  ? 61.469  35.224  45.473  1.00 233.48 ? 286  HIS A NE2   1 
ATOM   3018  N  N     . HIS D 4  287  ? 58.648  35.368  42.011  1.00 219.78 ? 287  HIS A N     1 
ATOM   3019  C  CA    . HIS D 4  287  ? 57.325  35.124  42.564  1.00 218.28 ? 287  HIS A CA    1 
ATOM   3020  C  C     . HIS D 4  287  ? 56.244  35.032  41.499  1.00 211.77 ? 287  HIS A C     1 
ATOM   3021  O  O     . HIS D 4  287  ? 55.115  34.655  41.823  1.00 215.83 ? 287  HIS A O     1 
ATOM   3022  C  CB    . HIS D 4  287  ? 56.963  36.198  43.590  1.00 223.78 ? 287  HIS A CB    1 
ATOM   3023  C  CG    . HIS D 4  287  ? 57.517  35.922  44.951  1.00 225.72 ? 287  HIS A CG    1 
ATOM   3024  N  ND1   . HIS D 4  287  ? 58.753  35.345  45.143  1.00 227.52 ? 287  HIS A ND1   1 
ATOM   3025  C  CD2   . HIS D 4  287  ? 56.994  36.113  46.186  1.00 226.14 ? 287  HIS A CD2   1 
ATOM   3026  C  CE1   . HIS D 4  287  ? 58.976  35.206  46.438  1.00 228.35 ? 287  HIS A CE1   1 
ATOM   3027  N  NE2   . HIS D 4  287  ? 57.924  35.665  47.093  1.00 228.16 ? 287  HIS A NE2   1 
ATOM   3028  N  N     . ALA D 4  288  ? 56.554  35.369  40.246  1.00 202.93 ? 288  ALA A N     1 
ATOM   3029  C  CA    . ALA D 4  288  ? 55.732  34.871  39.151  1.00 187.86 ? 288  ALA A CA    1 
ATOM   3030  C  C     . ALA D 4  288  ? 55.892  33.367  39.011  1.00 181.99 ? 288  ALA A C     1 
ATOM   3031  O  O     . ALA D 4  288  ? 54.938  32.670  38.646  1.00 180.66 ? 288  ALA A O     1 
ATOM   3032  C  CB    . ALA D 4  288  ? 56.097  35.573  37.845  1.00 182.77 ? 288  ALA A CB    1 
ATOM   3033  N  N     . ILE D 4  289  ? 57.089  32.855  39.307  1.00 185.35 ? 289  ILE A N     1 
ATOM   3034  C  CA    . ILE D 4  289  ? 57.313  31.417  39.326  1.00 182.40 ? 289  ILE A CA    1 
ATOM   3035  C  C     . ILE D 4  289  ? 56.600  30.782  40.513  1.00 195.00 ? 289  ILE A C     1 
ATOM   3036  O  O     . ILE D 4  289  ? 56.117  29.650  40.415  1.00 189.28 ? 289  ILE A O     1 
ATOM   3037  C  CB    . ILE D 4  289  ? 58.826  31.123  39.342  1.00 167.73 ? 289  ILE A CB    1 
ATOM   3038  C  CG1   . ILE D 4  289  ? 59.534  31.920  38.241  1.00 158.45 ? 289  ILE A CG1   1 
ATOM   3039  C  CG2   . ILE D 4  289  ? 59.100  29.633  39.168  1.00 159.81 ? 289  ILE A CG2   1 
ATOM   3040  C  CD1   . ILE D 4  289  ? 59.273  31.410  36.837  1.00 149.98 ? 289  ILE A CD1   1 
ATOM   3041  N  N     . GLU D 4  290  ? 56.504  31.497  41.642  1.00 212.40 ? 290  GLU A N     1 
ATOM   3042  C  CA    . GLU D 4  290  ? 55.809  30.954  42.807  1.00 220.54 ? 290  GLU A CA    1 
ATOM   3043  C  C     . GLU D 4  290  ? 54.323  30.774  42.525  1.00 226.16 ? 290  GLU A C     1 
ATOM   3044  O  O     . GLU D 4  290  ? 53.735  29.753  42.902  1.00 228.47 ? 290  GLU A O     1 
ATOM   3045  C  CB    . GLU D 4  290  ? 56.032  31.858  44.025  1.00 222.41 ? 290  GLU A CB    1 
ATOM   3046  C  CG    . GLU D 4  290  ? 55.040  31.660  45.180  1.00 217.89 ? 290  GLU A CG    1 
ATOM   3047  C  CD    . GLU D 4  290  ? 53.869  32.629  45.142  1.00 216.77 ? 290  GLU A CD    1 
ATOM   3048  O  OE1   . GLU D 4  290  ? 53.823  33.472  44.225  1.00 220.37 ? 290  GLU A OE1   1 
ATOM   3049  O  OE2   . GLU D 4  290  ? 52.991  32.536  46.027  1.00 213.86 ? 290  GLU A OE2   1 
ATOM   3050  N  N     . GLU D 4  291  ? 53.701  31.751  41.857  1.00 224.71 ? 291  GLU A N     1 
ATOM   3051  C  CA    . GLU D 4  291  ? 52.330  31.575  41.387  1.00 211.68 ? 291  GLU A CA    1 
ATOM   3052  C  C     . GLU D 4  291  ? 52.252  30.457  40.357  1.00 194.43 ? 291  GLU A C     1 
ATOM   3053  O  O     . GLU D 4  291  ? 51.254  29.729  40.288  1.00 199.67 ? 291  GLU A O     1 
ATOM   3054  C  CB    . GLU D 4  291  ? 51.802  32.877  40.778  1.00 210.93 ? 291  GLU A CB    1 
ATOM   3055  C  CG    . GLU D 4  291  ? 51.927  34.112  41.657  1.00 209.15 ? 291  GLU A CG    1 
ATOM   3056  C  CD    . GLU D 4  291  ? 50.940  34.144  42.809  1.00 203.78 ? 291  GLU A CD    1 
ATOM   3057  O  OE1   . GLU D 4  291  ? 49.985  33.338  42.815  1.00 199.17 ? 291  GLU A OE1   1 
ATOM   3058  O  OE2   . GLU D 4  291  ? 51.121  34.985  43.714  1.00 204.52 ? 291  GLU A OE2   1 
ATOM   3059  N  N     . ALA D 4  292  ? 53.300  30.312  39.545  1.00 171.34 ? 292  ALA A N     1 
ATOM   3060  C  CA    . ALA D 4  292  ? 53.332  29.259  38.539  1.00 145.47 ? 292  ALA A CA    1 
ATOM   3061  C  C     . ALA D 4  292  ? 53.446  27.883  39.184  1.00 142.74 ? 292  ALA A C     1 
ATOM   3062  O  O     . ALA D 4  292  ? 52.810  26.926  38.729  1.00 132.31 ? 292  ALA A O     1 
ATOM   3063  C  CB    . ALA D 4  292  ? 54.486  29.509  37.573  1.00 139.46 ? 292  ALA A CB    1 
ATOM   3064  N  N     . GLU D 4  293  ? 54.248  27.765  40.248  1.00 154.69 ? 293  GLU A N     1 
ATOM   3065  C  CA    . GLU D 4  293  ? 54.248  26.539  41.040  1.00 157.52 ? 293  GLU A CA    1 
ATOM   3066  C  C     . GLU D 4  293  ? 52.923  26.342  41.765  1.00 162.82 ? 293  GLU A C     1 
ATOM   3067  O  O     . GLU D 4  293  ? 52.530  25.202  42.035  1.00 157.18 ? 293  GLU A O     1 
ATOM   3068  C  CB    . GLU D 4  293  ? 55.384  26.554  42.064  1.00 158.72 ? 293  GLU A CB    1 
ATOM   3069  C  CG    . GLU D 4  293  ? 56.773  26.740  41.495  1.00 163.68 ? 293  GLU A CG    1 
ATOM   3070  C  CD    . GLU D 4  293  ? 57.726  27.363  42.495  1.00 168.68 ? 293  GLU A CD    1 
ATOM   3071  O  OE1   . GLU D 4  293  ? 57.770  26.894  43.652  1.00 167.75 ? 293  GLU A OE1   1 
ATOM   3072  O  OE2   . GLU D 4  293  ? 58.431  28.323  42.126  1.00 169.49 ? 293  GLU A OE2   1 
ATOM   3073  N  N     . SER D 4  294  ? 52.226  27.434  42.086  1.00 169.49 ? 294  SER A N     1 
ATOM   3074  C  CA    . SER D 4  294  ? 51.000  27.355  42.867  1.00 173.41 ? 294  SER A CA    1 
ATOM   3075  C  C     . SER D 4  294  ? 49.772  27.024  42.030  1.00 170.23 ? 294  SER A C     1 
ATOM   3076  O  O     . SER D 4  294  ? 48.738  26.664  42.601  1.00 170.48 ? 294  SER A O     1 
ATOM   3077  C  CB    . SER D 4  294  ? 50.761  28.674  43.608  1.00 177.84 ? 294  SER A CB    1 
ATOM   3078  O  OG    . SER D 4  294  ? 49.378  28.951  43.724  1.00 177.32 ? 294  SER A OG    1 
ATOM   3079  N  N     . LEU D 4  295  ? 49.843  27.146  40.703  1.00 162.85 ? 295  LEU A N     1 
ATOM   3080  C  CA    . LEU D 4  295  ? 48.671  26.917  39.867  1.00 151.40 ? 295  LEU A CA    1 
ATOM   3081  C  C     . LEU D 4  295  ? 48.843  25.838  38.808  1.00 141.56 ? 295  LEU A C     1 
ATOM   3082  O  O     . LEU D 4  295  ? 47.857  25.176  38.475  1.00 146.40 ? 295  LEU A O     1 
ATOM   3083  C  CB    . LEU D 4  295  ? 48.233  28.219  39.178  1.00 149.01 ? 295  LEU A CB    1 
ATOM   3084  C  CG    . LEU D 4  295  ? 46.928  28.779  39.750  1.00 146.01 ? 295  LEU A CG    1 
ATOM   3085  C  CD1   . LEU D 4  295  ? 47.163  29.379  41.128  1.00 147.84 ? 295  LEU A CD1   1 
ATOM   3086  C  CD2   . LEU D 4  295  ? 46.297  29.792  38.811  1.00 141.91 ? 295  LEU A CD2   1 
ATOM   3087  N  N     . LEU D 4  296  ? 50.046  25.656  38.255  1.00 135.16 ? 296  LEU A N     1 
ATOM   3088  C  CA    . LEU D 4  296  ? 50.269  24.542  37.336  1.00 128.42 ? 296  LEU A CA    1 
ATOM   3089  C  C     . LEU D 4  296  ? 50.113  23.216  38.064  1.00 128.99 ? 296  LEU A C     1 
ATOM   3090  O  O     . LEU D 4  296  ? 49.376  22.330  37.618  1.00 107.21 ? 296  LEU A O     1 
ATOM   3091  C  CB    . LEU D 4  296  ? 51.655  24.657  36.689  1.00 124.42 ? 296  LEU A CB    1 
ATOM   3092  C  CG    . LEU D 4  296  ? 52.179  23.652  35.645  1.00 116.79 ? 296  LEU A CG    1 
ATOM   3093  C  CD1   . LEU D 4  296  ? 52.891  22.435  36.254  1.00 110.96 ? 296  LEU A CD1   1 
ATOM   3094  C  CD2   . LEU D 4  296  ? 51.069  23.204  34.699  1.00 110.97 ? 296  LEU A CD2   1 
ATOM   3095  N  N     . GLN D 4  297  ? 50.807  23.069  39.194  1.00 140.70 ? 297  GLN A N     1 
ATOM   3096  C  CA    . GLN D 4  297  ? 50.678  21.869  40.010  1.00 150.42 ? 297  GLN A CA    1 
ATOM   3097  C  C     . GLN D 4  297  ? 49.271  21.739  40.587  1.00 156.35 ? 297  GLN A C     1 
ATOM   3098  O  O     . GLN D 4  297  ? 48.765  20.621  40.751  1.00 166.22 ? 297  GLN A O     1 
ATOM   3099  C  CB    . GLN D 4  297  ? 51.743  21.900  41.109  1.00 147.55 ? 297  GLN A CB    1 
ATOM   3100  C  CG    . GLN D 4  297  ? 51.456  21.059  42.322  1.00 142.74 ? 297  GLN A CG    1 
ATOM   3101  C  CD    . GLN D 4  297  ? 51.835  19.609  42.145  1.00 139.06 ? 297  GLN A CD    1 
ATOM   3102  O  OE1   . GLN D 4  297  ? 52.915  19.192  42.556  1.00 143.73 ? 297  GLN A OE1   1 
ATOM   3103  N  NE2   . GLN D 4  297  ? 50.947  18.828  41.541  1.00 134.23 ? 297  GLN A NE2   1 
ATOM   3104  N  N     . PHE D 4  298  ? 48.616  22.872  40.861  1.00 149.13 ? 298  PHE A N     1 
ATOM   3105  C  CA    . PHE D 4  298  ? 47.210  22.857  41.254  1.00 134.85 ? 298  PHE A CA    1 
ATOM   3106  C  C     . PHE D 4  298  ? 46.336  22.268  40.153  1.00 132.36 ? 298  PHE A C     1 
ATOM   3107  O  O     . PHE D 4  298  ? 45.358  21.565  40.436  1.00 129.38 ? 298  PHE A O     1 
ATOM   3108  C  CB    . PHE D 4  298  ? 46.773  24.282  41.622  1.00 129.90 ? 298  PHE A CB    1 
ATOM   3109  C  CG    . PHE D 4  298  ? 45.278  24.497  41.676  1.00 124.07 ? 298  PHE A CG    1 
ATOM   3110  C  CD1   . PHE D 4  298  ? 44.605  24.389  42.880  1.00 116.41 ? 298  PHE A CD1   1 
ATOM   3111  C  CD2   . PHE D 4  298  ? 44.566  24.923  40.556  1.00 117.35 ? 298  PHE A CD2   1 
ATOM   3112  C  CE1   . PHE D 4  298  ? 43.244  24.609  42.951  1.00 108.83 ? 298  PHE A CE1   1 
ATOM   3113  C  CE2   . PHE D 4  298  ? 43.206  25.141  40.621  1.00 109.61 ? 298  PHE A CE2   1 
ATOM   3114  C  CZ    . PHE D 4  298  ? 42.544  24.990  41.821  1.00 107.59 ? 298  PHE A CZ    1 
ATOM   3115  N  N     . HIS D 4  299  ? 46.670  22.551  38.893  1.00 128.44 ? 299  HIS A N     1 
ATOM   3116  C  CA    . HIS D 4  299  ? 45.858  22.062  37.785  1.00 128.20 ? 299  HIS A CA    1 
ATOM   3117  C  C     . HIS D 4  299  ? 45.992  20.555  37.620  1.00 111.97 ? 299  HIS A C     1 
ATOM   3118  O  O     . HIS D 4  299  ? 45.009  19.870  37.315  1.00 107.57 ? 299  HIS A O     1 
ATOM   3119  C  CB    . HIS D 4  299  ? 46.253  22.770  36.491  1.00 132.50 ? 299  HIS A CB    1 
ATOM   3120  C  CG    . HIS D 4  299  ? 45.371  23.925  36.139  1.00 129.57 ? 299  HIS A CG    1 
ATOM   3121  N  ND1   . HIS D 4  299  ? 44.000  23.881  36.270  1.00 124.33 ? 299  HIS A ND1   1 
ATOM   3122  C  CD2   . HIS D 4  299  ? 45.661  25.144  35.627  1.00 132.55 ? 299  HIS A CD2   1 
ATOM   3123  C  CE1   . HIS D 4  299  ? 43.485  25.032  35.878  1.00 129.45 ? 299  HIS A CE1   1 
ATOM   3124  N  NE2   . HIS D 4  299  ? 44.471  25.814  35.478  1.00 133.69 ? 299  HIS A NE2   1 
ATOM   3125  N  N     . VAL D 4  300  ? 47.200  20.023  37.815  1.00 102.89 ? 300  VAL A N     1 
ATOM   3126  C  CA    . VAL D 4  300  ? 47.413  18.588  37.660  1.00 95.15  ? 300  VAL A CA    1 
ATOM   3127  C  C     . VAL D 4  300  ? 46.695  17.818  38.760  1.00 99.30  ? 300  VAL A C     1 
ATOM   3128  O  O     . VAL D 4  300  ? 46.168  16.726  38.525  1.00 97.59  ? 300  VAL A O     1 
ATOM   3129  C  CB    . VAL D 4  300  ? 48.919  18.271  37.635  1.00 88.42  ? 300  VAL A CB    1 
ATOM   3130  C  CG1   . VAL D 4  300  ? 49.154  16.832  37.208  1.00 87.31  ? 300  VAL A CG1   1 
ATOM   3131  C  CG2   . VAL D 4  300  ? 49.639  19.217  36.697  1.00 90.52  ? 300  VAL A CG2   1 
ATOM   3132  N  N     . ALA D 4  301  ? 46.635  18.383  39.966  1.00 106.93 ? 301  ALA A N     1 
ATOM   3133  C  CA    . ALA D 4  301  ? 45.975  17.690  41.067  1.00 118.37 ? 301  ALA A CA    1 
ATOM   3134  C  C     . ALA D 4  301  ? 44.459  17.751  40.937  1.00 122.18 ? 301  ALA A C     1 
ATOM   3135  O  O     . ALA D 4  301  ? 43.773  16.745  41.152  1.00 126.89 ? 301  ALA A O     1 
ATOM   3136  C  CB    . ALA D 4  301  ? 46.422  18.280  42.403  1.00 126.03 ? 301  ALA A CB    1 
ATOM   3137  N  N     . THR D 4  302  ? 43.921  18.923  40.583  1.00 120.33 ? 302  THR A N     1 
ATOM   3138  C  CA    . THR D 4  302  ? 42.473  19.091  40.498  1.00 118.10 ? 302  THR A CA    1 
ATOM   3139  C  C     . THR D 4  302  ? 41.877  18.276  39.358  1.00 115.22 ? 302  THR A C     1 
ATOM   3140  O  O     . THR D 4  302  ? 40.709  17.876  39.423  1.00 104.31 ? 302  THR A O     1 
ATOM   3141  C  CB    . THR D 4  302  ? 42.131  20.569  40.330  1.00 113.94 ? 302  THR A CB    1 
ATOM   3142  O  OG1   . THR D 4  302  ? 43.047  21.359  41.100  1.00 112.27 ? 302  THR A OG1   1 
ATOM   3143  C  CG2   . THR D 4  302  ? 40.717  20.842  40.815  1.00 108.99 ? 302  THR A CG2   1 
ATOM   3144  N  N     . TYR D 4  303  ? 42.669  18.009  38.319  1.00 113.86 ? 303  TYR A N     1 
ATOM   3145  C  CA    . TYR D 4  303  ? 42.244  17.142  37.230  1.00 98.22  ? 303  TYR A CA    1 
ATOM   3146  C  C     . TYR D 4  303  ? 42.157  15.683  37.664  1.00 104.22 ? 303  TYR A C     1 
ATOM   3147  O  O     . TYR D 4  303  ? 41.410  14.912  37.055  1.00 100.21 ? 303  TYR A O     1 
ATOM   3148  C  CB    . TYR D 4  303  ? 43.210  17.336  36.057  1.00 93.04  ? 303  TYR A CB    1 
ATOM   3149  C  CG    . TYR D 4  303  ? 43.540  16.134  35.206  1.00 92.51  ? 303  TYR A CG    1 
ATOM   3150  C  CD1   . TYR D 4  303  ? 42.671  15.697  34.217  1.00 82.42  ? 303  TYR A CD1   1 
ATOM   3151  C  CD2   . TYR D 4  303  ? 44.752  15.472  35.354  1.00 95.05  ? 303  TYR A CD2   1 
ATOM   3152  C  CE1   . TYR D 4  303  ? 42.985  14.611  33.420  1.00 79.30  ? 303  TYR A CE1   1 
ATOM   3153  C  CE2   . TYR D 4  303  ? 45.073  14.389  34.565  1.00 86.66  ? 303  TYR A CE2   1 
ATOM   3154  C  CZ    . TYR D 4  303  ? 44.190  13.962  33.602  1.00 81.49  ? 303  TYR A CZ    1 
ATOM   3155  O  OH    . TYR D 4  303  ? 44.511  12.882  32.815  1.00 83.92  ? 303  TYR A OH    1 
ATOM   3156  N  N     . MET D 4  304  ? 42.880  15.299  38.718  1.00 113.28 ? 304  MET A N     1 
ATOM   3157  C  CA    . MET D 4  304  ? 42.825  13.947  39.264  1.00 111.33 ? 304  MET A CA    1 
ATOM   3158  C  C     . MET D 4  304  ? 41.797  13.839  40.386  1.00 101.25 ? 304  MET A C     1 
ATOM   3159  O  O     . MET D 4  304  ? 40.989  12.908  40.400  1.00 98.22  ? 304  MET A O     1 
ATOM   3160  C  CB    . MET D 4  304  ? 44.211  13.529  39.761  1.00 106.67 ? 304  MET A CB    1 
ATOM   3161  C  CG    . MET D 4  304  ? 45.285  13.672  38.703  1.00 118.03 ? 304  MET A CG    1 
ATOM   3162  S  SD    . MET D 4  304  ? 45.710  12.182  37.798  1.00 130.43 ? 304  MET A SD    1 
ATOM   3163  C  CE    . MET D 4  304  ? 47.271  11.767  38.560  1.00 118.87 ? 304  MET A CE    1 
ATOM   3164  N  N     . ASP D 4  305  ? 41.815  14.784  41.328  1.00 90.12  ? 305  ASP A N     1 
ATOM   3165  C  CA    . ASP D 4  305  ? 40.852  14.827  42.420  1.00 84.89  ? 305  ASP A CA    1 
ATOM   3166  C  C     . ASP D 4  305  ? 40.423  16.273  42.606  1.00 96.11  ? 305  ASP A C     1 
ATOM   3167  O  O     . ASP D 4  305  ? 41.264  17.149  42.815  1.00 110.88 ? 305  ASP A O     1 
ATOM   3168  C  CB    . ASP D 4  305  ? 41.460  14.280  43.722  1.00 89.98  ? 305  ASP A CB    1 
ATOM   3169  C  CG    . ASP D 4  305  ? 40.502  14.345  44.920  1.00 95.44  ? 305  ASP A CG    1 
ATOM   3170  O  OD1   . ASP D 4  305  ? 39.299  14.656  44.768  1.00 95.43  ? 305  ASP A OD1   1 
ATOM   3171  O  OD2   . ASP D 4  305  ? 40.971  14.072  46.045  1.00 93.74  ? 305  ASP A OD2   1 
ATOM   3172  N  N     . ASN D 4  306  ? 39.115  16.511  42.561  1.00 94.62  ? 306  ASN A N     1 
ATOM   3173  C  CA    . ASN D 4  306  ? 38.572  17.840  42.814  1.00 113.81 ? 306  ASN A CA    1 
ATOM   3174  C  C     . ASN D 4  306  ? 38.224  18.076  44.279  1.00 126.37 ? 306  ASN A C     1 
ATOM   3175  O  O     . ASN D 4  306  ? 38.425  19.182  44.790  1.00 138.35 ? 306  ASN A O     1 
ATOM   3176  C  CB    . ASN D 4  306  ? 37.343  18.081  41.937  1.00 124.12 ? 306  ASN A CB    1 
ATOM   3177  C  CG    . ASN D 4  306  ? 36.960  19.539  41.875  1.00 137.75 ? 306  ASN A CG    1 
ATOM   3178  O  OD1   . ASN D 4  306  ? 36.397  20.072  42.827  1.00 139.40 ? 306  ASN A OD1   1 
ATOM   3179  N  ND2   . ASN D 4  306  ? 37.293  20.203  40.778  1.00 146.46 ? 306  ASN A ND2   1 
ATOM   3180  N  N     . ASP D 4  307  ? 37.703  17.066  44.967  1.00 120.18 ? 307  ASP A N     1 
ATOM   3181  C  CA    . ASP D 4  307  ? 37.260  17.234  46.352  1.00 113.69 ? 307  ASP A CA    1 
ATOM   3182  C  C     . ASP D 4  307  ? 38.461  17.057  47.271  1.00 111.14 ? 307  ASP A C     1 
ATOM   3183  O  O     . ASP D 4  307  ? 38.815  15.946  47.666  1.00 120.81 ? 307  ASP A O     1 
ATOM   3184  C  CB    . ASP D 4  307  ? 36.146  16.249  46.680  1.00 111.71 ? 307  ASP A CB    1 
ATOM   3185  C  CG    . ASP D 4  307  ? 35.021  16.882  47.474  1.00 113.79 ? 307  ASP A CG    1 
ATOM   3186  O  OD1   . ASP D 4  307  ? 35.262  17.255  48.638  1.00 119.00 ? 307  ASP A OD1   1 
ATOM   3187  O  OD2   . ASP D 4  307  ? 33.900  17.010  46.937  1.00 108.59 ? 307  ASP A OD2   1 
ATOM   3188  N  N     . ILE D 4  308  ? 39.114  18.176  47.603  1.00 102.61 ? 308  ILE A N     1 
ATOM   3189  C  CA    . ILE D 4  308  ? 40.249  18.168  48.523  1.00 97.07  ? 308  ILE A CA    1 
ATOM   3190  C  C     . ILE D 4  308  ? 39.876  19.067  49.700  1.00 104.12 ? 308  ILE A C     1 
ATOM   3191  O  O     . ILE D 4  308  ? 38.693  19.350  49.919  1.00 111.36 ? 308  ILE A O     1 
ATOM   3192  C  CB    . ILE D 4  308  ? 41.548  18.632  47.832  1.00 92.54  ? 308  ILE A CB    1 
ATOM   3193  C  CG1   . ILE D 4  308  ? 41.524  18.296  46.343  1.00 90.34  ? 308  ILE A CG1   1 
ATOM   3194  C  CG2   . ILE D 4  308  ? 42.766  17.906  48.414  1.00 84.65  ? 308  ILE A CG2   1 
ATOM   3195  C  CD1   . ILE D 4  308  ? 42.707  18.837  45.582  1.00 82.21  ? 308  ILE A CD1   1 
ATOM   3196  N  N     . ALA D 4  309  ? 40.866  19.518  50.467  1.00 100.21 ? 309  ALA A N     1 
ATOM   3197  C  CA    . ALA D 4  309  ? 40.668  20.384  51.617  1.00 98.67  ? 309  ALA A CA    1 
ATOM   3198  C  C     . ALA D 4  309  ? 41.123  21.804  51.301  1.00 115.01 ? 309  ALA A C     1 
ATOM   3199  O  O     . ALA D 4  309  ? 41.856  22.049  50.338  1.00 124.61 ? 309  ALA A O     1 
ATOM   3200  C  CB    . ALA D 4  309  ? 41.431  19.858  52.838  1.00 93.12  ? 309  ALA A CB    1 
ATOM   3201  N  N     . GLY D 4  310  ? 40.694  22.743  52.141  1.00 123.02 ? 310  GLY A N     1 
ATOM   3202  C  CA    . GLY D 4  310  ? 40.945  24.144  51.880  1.00 137.15 ? 310  GLY A CA    1 
ATOM   3203  C  C     . GLY D 4  310  ? 39.992  24.773  50.892  1.00 160.91 ? 310  GLY A C     1 
ATOM   3204  O  O     . GLY D 4  310  ? 40.148  25.961  50.574  1.00 169.24 ? 310  GLY A O     1 
ATOM   3205  N  N     . GLN D 4  311  ? 39.007  24.011  50.420  1.00 172.91 ? 311  GLN A N     1 
ATOM   3206  C  CA    . GLN D 4  311  ? 38.024  24.447  49.434  1.00 179.93 ? 311  GLN A CA    1 
ATOM   3207  C  C     . GLN D 4  311  ? 38.589  25.137  48.182  1.00 174.75 ? 311  GLN A C     1 
ATOM   3208  O  O     . GLN D 4  311  ? 38.253  26.284  47.899  1.00 184.24 ? 311  GLN A O     1 
ATOM   3209  C  CB    . GLN D 4  311  ? 36.991  25.344  50.103  1.00 187.51 ? 311  GLN A CB    1 
ATOM   3210  C  CG    . GLN D 4  311  ? 36.588  24.897  51.500  1.00 183.73 ? 311  GLN A CG    1 
ATOM   3211  C  CD    . GLN D 4  311  ? 36.255  26.066  52.406  1.00 178.34 ? 311  GLN A CD    1 
ATOM   3212  O  OE1   . GLN D 4  311  ? 37.133  26.847  52.777  1.00 175.30 ? 311  GLN A OE1   1 
ATOM   3213  N  NE2   . GLN D 4  311  ? 34.984  26.193  52.767  1.00 172.75 ? 311  GLN A NE2   1 
ATOM   3214  N  N     . PRO D 4  312  ? 39.439  24.442  47.385  1.00 155.23 ? 312  PRO A N     1 
ATOM   3215  C  CA    . PRO D 4  312  ? 39.700  24.939  46.032  1.00 146.14 ? 312  PRO A CA    1 
ATOM   3216  C  C     . PRO D 4  312  ? 38.899  24.134  45.023  1.00 150.13 ? 312  PRO A C     1 
ATOM   3217  O  O     . PRO D 4  312  ? 39.408  23.169  44.440  1.00 153.48 ? 312  PRO A O     1 
ATOM   3218  C  CB    . PRO D 4  312  ? 41.211  24.724  45.867  1.00 135.51 ? 312  PRO A CB    1 
ATOM   3219  C  CG    . PRO D 4  312  ? 41.621  23.811  47.035  1.00 135.41 ? 312  PRO A CG    1 
ATOM   3220  C  CD    . PRO D 4  312  ? 40.351  23.321  47.660  1.00 142.87 ? 312  PRO A CD    1 
ATOM   3221  N  N     . GLN D 4  313  ? 37.643  24.530  44.809  1.00 143.47 ? 313  GLN A N     1 
ATOM   3222  C  CA    . GLN D 4  313  ? 36.703  23.692  44.072  1.00 133.24 ? 313  GLN A CA    1 
ATOM   3223  C  C     . GLN D 4  313  ? 36.978  23.700  42.572  1.00 133.21 ? 313  GLN A C     1 
ATOM   3224  O  O     . GLN D 4  313  ? 36.745  22.686  41.903  1.00 135.91 ? 313  GLN A O     1 
ATOM   3225  C  CB    . GLN D 4  313  ? 35.271  24.158  44.360  1.00 127.99 ? 313  GLN A CB    1 
ATOM   3226  C  CG    . GLN D 4  313  ? 34.131  23.334  43.735  1.00 129.73 ? 313  GLN A CG    1 
ATOM   3227  C  CD    . GLN D 4  313  ? 33.908  21.977  44.407  1.00 122.66 ? 313  GLN A CD    1 
ATOM   3228  O  OE1   . GLN D 4  313  ? 32.916  21.789  45.111  1.00 117.85 ? 313  GLN A OE1   1 
ATOM   3229  N  NE2   . GLN D 4  313  ? 34.800  21.026  44.165  1.00 113.74 ? 313  GLN A NE2   1 
ATOM   3230  N  N     . ALA D 4  314  ? 37.483  24.818  42.045  1.00 128.97 ? 314  ALA A N     1 
ATOM   3231  C  CA    . ALA D 4  314  ? 37.859  24.990  40.639  1.00 118.24 ? 314  ALA A CA    1 
ATOM   3232  C  C     . ALA D 4  314  ? 36.688  24.658  39.709  1.00 115.83 ? 314  ALA A C     1 
ATOM   3233  O  O     . ALA D 4  314  ? 36.663  23.639  39.019  1.00 112.87 ? 314  ALA A O     1 
ATOM   3234  C  CB    . ALA D 4  314  ? 39.097  24.154  40.294  1.00 106.19 ? 314  ALA A CB    1 
ATOM   3235  N  N     . LEU D 4  315  ? 35.707  25.553  39.732  1.00 120.18 ? 315  LEU A N     1 
ATOM   3236  C  CA    . LEU D 4  315  ? 34.545  25.407  38.869  1.00 121.81 ? 315  LEU A CA    1 
ATOM   3237  C  C     . LEU D 4  315  ? 34.942  25.634  37.415  1.00 135.40 ? 315  LEU A C     1 
ATOM   3238  O  O     . LEU D 4  315  ? 35.775  26.490  37.111  1.00 133.24 ? 315  LEU A O     1 
ATOM   3239  C  CB    . LEU D 4  315  ? 33.453  26.392  39.285  1.00 112.79 ? 315  LEU A CB    1 
ATOM   3240  N  N     . GLN D 4  316  ? 34.353  24.844  36.513  1.00 144.64 ? 316  GLN A N     1 
ATOM   3241  C  CA    . GLN D 4  316  ? 34.628  24.978  35.086  1.00 144.24 ? 316  GLN A CA    1 
ATOM   3242  C  C     . GLN D 4  316  ? 33.746  26.046  34.456  1.00 154.98 ? 316  GLN A C     1 
ATOM   3243  O  O     . GLN D 4  316  ? 33.449  27.072  35.077  1.00 162.01 ? 316  GLN A O     1 
ATOM   3244  C  CB    . GLN D 4  316  ? 34.414  23.645  34.365  1.00 132.32 ? 316  GLN A CB    1 
ATOM   3245  N  N     . LYS D 4  317  ? 33.324  25.804  33.221  1.00 156.02 ? 317  LYS A N     1 
ATOM   3246  C  CA    . LYS D 4  317  ? 32.380  26.697  32.578  1.00 150.83 ? 317  LYS A CA    1 
ATOM   3247  C  C     . LYS D 4  317  ? 31.007  26.553  33.220  1.00 152.88 ? 317  LYS A C     1 
ATOM   3248  O  O     . LYS D 4  317  ? 30.622  25.473  33.681  1.00 151.23 ? 317  LYS A O     1 
ATOM   3249  C  CB    . LYS D 4  317  ? 32.300  26.404  31.082  1.00 141.39 ? 317  LYS A CB    1 
ATOM   3250  N  N     . SER D 4  318  ? 30.286  27.678  33.268  1.00 152.13 ? 318  SER A N     1 
ATOM   3251  C  CA    . SER D 4  318  ? 28.924  27.774  33.804  1.00 147.12 ? 318  SER A CA    1 
ATOM   3252  C  C     . SER D 4  318  ? 28.849  27.364  35.275  1.00 140.18 ? 318  SER A C     1 
ATOM   3253  O  O     . SER D 4  318  ? 27.818  26.871  35.736  1.00 136.82 ? 318  SER A O     1 
ATOM   3254  C  CB    . SER D 4  318  ? 27.930  26.961  32.967  1.00 143.21 ? 318  SER A CB    1 
ATOM   3255  N  N     . GLY D 4  319  ? 29.937  27.558  36.023  1.00 137.77 ? 319  GLY A N     1 
ATOM   3256  C  CA    . GLY D 4  319  ? 29.960  27.287  37.444  1.00 137.02 ? 319  GLY A CA    1 
ATOM   3257  C  C     . GLY D 4  319  ? 29.945  25.830  37.846  1.00 143.28 ? 319  GLY A C     1 
ATOM   3258  O  O     . GLY D 4  319  ? 29.856  25.543  39.044  1.00 130.08 ? 319  GLY A O     1 
ATOM   3259  N  N     . ARG D 4  320  ? 30.024  24.906  36.900  1.00 163.42 ? 320  ARG A N     1 
ATOM   3260  C  CA    . ARG D 4  320  ? 30.032  23.490  37.245  1.00 156.93 ? 320  ARG A CA    1 
ATOM   3261  C  C     . ARG D 4  320  ? 31.418  23.082  37.730  1.00 154.95 ? 320  ARG A C     1 
ATOM   3262  O  O     . ARG D 4  320  ? 32.413  23.392  37.065  1.00 163.94 ? 320  ARG A O     1 
ATOM   3263  C  CB    . ARG D 4  320  ? 29.628  22.635  36.041  1.00 150.86 ? 320  ARG A CB    1 
ATOM   3264  N  N     . PRO D 4  321  ? 31.529  22.427  38.888  1.00 131.70 ? 321  PRO A N     1 
ATOM   3265  C  CA    . PRO D 4  321  ? 32.807  21.807  39.259  1.00 112.95 ? 321  PRO A CA    1 
ATOM   3266  C  C     . PRO D 4  321  ? 33.168  20.718  38.264  1.00 116.21 ? 321  PRO A C     1 
ATOM   3267  O  O     . PRO D 4  321  ? 32.295  20.010  37.758  1.00 124.40 ? 321  PRO A O     1 
ATOM   3268  C  CB    . PRO D 4  321  ? 32.543  21.230  40.654  1.00 104.03 ? 321  PRO A CB    1 
ATOM   3269  C  CG    . PRO D 4  321  ? 31.283  21.862  41.130  1.00 109.27 ? 321  PRO A CG    1 
ATOM   3270  C  CD    . PRO D 4  321  ? 30.497  22.259  39.924  1.00 118.27 ? 321  PRO A CD    1 
ATOM   3271  N  N     . VAL D 4  322  ? 34.465  20.608  37.963  1.00 108.31 ? 322  VAL A N     1 
ATOM   3272  C  CA    . VAL D 4  322  ? 34.888  19.643  36.952  1.00 110.42 ? 322  VAL A CA    1 
ATOM   3273  C  C     . VAL D 4  322  ? 34.691  18.228  37.483  1.00 119.91 ? 322  VAL A C     1 
ATOM   3274  O  O     . VAL D 4  322  ? 34.629  17.979  38.695  1.00 120.34 ? 322  VAL A O     1 
ATOM   3275  C  CB    . VAL D 4  322  ? 36.347  19.871  36.519  1.00 97.59  ? 322  VAL A CB    1 
ATOM   3276  C  CG1   . VAL D 4  322  ? 36.597  21.337  36.205  1.00 91.58  ? 322  VAL A CG1   1 
ATOM   3277  C  CG2   . VAL D 4  322  ? 37.318  19.359  37.574  1.00 93.62  ? 322  VAL A CG2   1 
ATOM   3278  N  N     . LYS D 4  323  ? 34.552  17.289  36.555  1.00 132.15 ? 323  LYS A N     1 
ATOM   3279  C  CA    . LYS D 4  323  ? 34.443  15.883  36.925  1.00 134.32 ? 323  LYS A CA    1 
ATOM   3280  C  C     . LYS D 4  323  ? 35.850  15.309  36.903  1.00 117.72 ? 323  LYS A C     1 
ATOM   3281  O  O     . LYS D 4  323  ? 36.365  14.898  35.862  1.00 122.72 ? 323  LYS A O     1 
ATOM   3282  C  CB    . LYS D 4  323  ? 33.498  15.132  35.995  1.00 143.99 ? 323  LYS A CB    1 
ATOM   3283  C  CG    . LYS D 4  323  ? 32.082  15.022  36.543  1.00 141.39 ? 323  LYS A CG    1 
ATOM   3284  C  CD    . LYS D 4  323  ? 31.499  13.629  36.344  1.00 132.71 ? 323  LYS A CD    1 
ATOM   3285  C  CE    . LYS D 4  323  ? 30.181  13.485  37.090  1.00 127.56 ? 323  LYS A CE    1 
ATOM   3286  N  NZ    . LYS D 4  323  ? 29.963  12.103  37.602  1.00 122.75 ? 323  LYS A NZ    1 
ATOM   3287  N  N     . SER D 4  324  ? 36.486  15.309  38.072  1.00 94.53  ? 324  SER A N     1 
ATOM   3288  C  CA    . SER D 4  324  ? 37.801  14.710  38.210  1.00 89.50  ? 324  SER A CA    1 
ATOM   3289  C  C     . SER D 4  324  ? 37.717  13.207  37.973  1.00 91.51  ? 324  SER A C     1 
ATOM   3290  O  O     . SER D 4  324  ? 36.652  12.591  38.085  1.00 97.23  ? 324  SER A O     1 
ATOM   3291  C  CB    . SER D 4  324  ? 38.375  15.004  39.595  1.00 106.05 ? 324  SER A CB    1 
ATOM   3292  O  OG    . SER D 4  324  ? 37.539  14.483  40.613  1.00 112.80 ? 324  SER A OG    1 
ATOM   3293  N  N     . ILE D 4  325  ? 38.866  12.618  37.629  1.00 87.89  ? 325  ILE A N     1 
ATOM   3294  C  CA    . ILE D 4  325  ? 38.909  11.195  37.308  1.00 80.41  ? 325  ILE A CA    1 
ATOM   3295  C  C     . ILE D 4  325  ? 38.567  10.360  38.535  1.00 88.40  ? 325  ILE A C     1 
ATOM   3296  O  O     . ILE D 4  325  ? 38.056  9.241   38.413  1.00 97.10  ? 325  ILE A O     1 
ATOM   3297  C  CB    . ILE D 4  325  ? 40.292  10.823  36.745  1.00 75.37  ? 325  ILE A CB    1 
ATOM   3298  C  CG1   . ILE D 4  325  ? 40.790  11.917  35.800  1.00 76.49  ? 325  ILE A CG1   1 
ATOM   3299  C  CG2   . ILE D 4  325  ? 40.205  9.510   35.986  1.00 73.86  ? 325  ILE A CG2   1 
ATOM   3300  C  CD1   . ILE D 4  325  ? 41.974  11.507  34.948  1.00 78.45  ? 325  ILE A CD1   1 
ATOM   3301  N  N     . ARG D 4  326  ? 38.832  10.896  39.730  1.00 89.67  ? 326  ARG A N     1 
ATOM   3302  C  CA    . ARG D 4  326  ? 38.429  10.236  40.965  1.00 92.70  ? 326  ARG A CA    1 
ATOM   3303  C  C     . ARG D 4  326  ? 36.914  10.121  41.060  1.00 102.57 ? 326  ARG A C     1 
ATOM   3304  O  O     . ARG D 4  326  ? 36.380  9.042   41.338  1.00 109.05 ? 326  ARG A O     1 
ATOM   3305  C  CB    . ARG D 4  326  ? 38.991  11.003  42.161  1.00 103.33 ? 326  ARG A CB    1 
ATOM   3306  C  CG    . ARG D 4  326  ? 38.356  10.649  43.482  1.00 109.38 ? 326  ARG A CG    1 
ATOM   3307  C  CD    . ARG D 4  326  ? 39.154  11.213  44.646  1.00 113.38 ? 326  ARG A CD    1 
ATOM   3308  N  NE    . ARG D 4  326  ? 38.783  10.625  45.931  1.00 117.32 ? 326  ARG A NE    1 
ATOM   3309  C  CZ    . ARG D 4  326  ? 37.702  10.953  46.632  1.00 124.35 ? 326  ARG A CZ    1 
ATOM   3310  N  NH1   . ARG D 4  326  ? 36.870  11.885  46.187  1.00 128.98 ? 326  ARG A NH1   1 
ATOM   3311  N  NH2   . ARG D 4  326  ? 37.456  10.352  47.788  1.00 126.53 ? 326  ARG A NH2   1 
ATOM   3312  N  N     . ALA D 4  327  ? 36.203  11.222  40.807  1.00 98.14  ? 327  ALA A N     1 
ATOM   3313  C  CA    . ALA D 4  327  ? 34.747  11.215  40.902  1.00 86.71  ? 327  ALA A CA    1 
ATOM   3314  C  C     . ALA D 4  327  ? 34.093  10.418  39.782  1.00 83.21  ? 327  ALA A C     1 
ATOM   3315  O  O     . ALA D 4  327  ? 32.923  10.040  39.911  1.00 75.51  ? 327  ALA A O     1 
ATOM   3316  C  CB    . ALA D 4  327  ? 34.211  12.645  40.896  1.00 75.63  ? 327  ALA A CB    1 
ATOM   3317  N  N     . ARG D 4  328  ? 34.819  10.171  38.689  1.00 89.06  ? 328  ARG A N     1 
ATOM   3318  C  CA    . ARG D 4  328  ? 34.290  9.363   37.596  1.00 100.74 ? 328  ARG A CA    1 
ATOM   3319  C  C     . ARG D 4  328  ? 34.017  7.934   38.039  1.00 97.29  ? 328  ARG A C     1 
ATOM   3320  O  O     . ARG D 4  328  ? 33.050  7.309   37.590  1.00 97.10  ? 328  ARG A O     1 
ATOM   3321  C  CB    . ARG D 4  328  ? 35.271  9.375   36.424  1.00 113.36 ? 328  ARG A CB    1 
ATOM   3322  C  CG    . ARG D 4  328  ? 34.942  10.361  35.321  1.00 117.46 ? 328  ARG A CG    1 
ATOM   3323  C  CD    . ARG D 4  328  ? 36.173  10.675  34.488  1.00 121.53 ? 328  ARG A CD    1 
ATOM   3324  N  NE    . ARG D 4  328  ? 36.114  10.077  33.157  1.00 113.51 ? 328  ARG A NE    1 
ATOM   3325  C  CZ    . ARG D 4  328  ? 35.748  10.726  32.056  1.00 104.96 ? 328  ARG A CZ    1 
ATOM   3326  N  NH1   . ARG D 4  328  ? 35.739  10.096  30.887  1.00 109.50 ? 328  ARG A NH1   1 
ATOM   3327  N  NH2   . ARG D 4  328  ? 35.361  11.991  32.125  1.00 85.59  ? 328  ARG A NH2   1 
ATOM   3328  N  N     . LEU D 4  329  ? 34.852  7.404   38.930  1.00 88.72  ? 329  LEU A N     1 
ATOM   3329  C  CA    . LEU D 4  329  ? 34.781  6.005   39.328  1.00 83.38  ? 329  LEU A CA    1 
ATOM   3330  C  C     . LEU D 4  329  ? 34.555  5.836   40.828  1.00 76.73  ? 329  LEU A C     1 
ATOM   3331  O  O     . LEU D 4  329  ? 34.735  4.735   41.356  1.00 72.74  ? 329  LEU A O     1 
ATOM   3332  C  CB    . LEU D 4  329  ? 36.047  5.278   38.869  1.00 71.72  ? 329  LEU A CB    1 
ATOM   3333  C  CG    . LEU D 4  329  ? 37.403  5.988   39.013  1.00 67.69  ? 329  LEU A CG    1 
ATOM   3334  C  CD1   . LEU D 4  329  ? 37.733  6.400   40.442  1.00 84.06  ? 329  LEU A CD1   1 
ATOM   3335  C  CD2   . LEU D 4  329  ? 38.524  5.141   38.435  1.00 68.13  ? 329  LEU A CD2   1 
ATOM   3336  N  N     . LYS D 4  330  ? 34.155  6.900   41.526  1.00 77.78  ? 330  LYS A N     1 
ATOM   3337  C  CA    . LYS D 4  330  ? 34.056  6.831   42.985  1.00 97.79  ? 330  LYS A CA    1 
ATOM   3338  C  C     . LYS D 4  330  ? 32.724  6.232   43.428  1.00 89.75  ? 330  LYS A C     1 
ATOM   3339  O  O     . LYS D 4  330  ? 32.682  5.141   44.003  1.00 102.63 ? 330  LYS A O     1 
ATOM   3340  C  CB    . LYS D 4  330  ? 34.257  8.225   43.595  1.00 110.29 ? 330  LYS A CB    1 
ATOM   3341  C  CG    . LYS D 4  330  ? 33.842  8.356   45.058  1.00 110.97 ? 330  LYS A CG    1 
ATOM   3342  C  CD    . LYS D 4  330  ? 33.393  9.772   45.380  1.00 110.32 ? 330  LYS A CD    1 
ATOM   3343  C  CE    . LYS D 4  330  ? 32.956  9.900   46.830  1.00 109.59 ? 330  LYS A CE    1 
ATOM   3344  N  NZ    . LYS D 4  330  ? 31.579  9.372   47.036  1.00 108.59 ? 330  LYS A NZ    1 
ATOM   3345  N  N     . GLY D 4  331  ? 31.626  6.928   43.153  1.00 75.60  ? 331  GLY A N     1 
ATOM   3346  C  CA    . GLY D 4  331  ? 30.376  6.676   43.833  1.00 70.09  ? 331  GLY A CA    1 
ATOM   3347  C  C     . GLY D 4  331  ? 29.627  5.472   43.300  1.00 69.25  ? 331  GLY A C     1 
ATOM   3348  O  O     . GLY D 4  331  ? 30.159  4.616   42.592  1.00 74.09  ? 331  GLY A O     1 
ATOM   3349  N  N     . LYS D 4  332  ? 28.346  5.416   43.675  1.00 66.83  ? 332  LYS A N     1 
ATOM   3350  C  CA    . LYS D 4  332  ? 27.471  4.349   43.203  1.00 64.01  ? 332  LYS A CA    1 
ATOM   3351  C  C     . LYS D 4  332  ? 27.262  4.439   41.701  1.00 64.84  ? 332  LYS A C     1 
ATOM   3352  O  O     . LYS D 4  332  ? 27.190  3.415   41.009  1.00 61.25  ? 332  LYS A O     1 
ATOM   3353  C  CB    . LYS D 4  332  ? 26.139  4.411   43.958  1.00 63.21  ? 332  LYS A CB    1 
ATOM   3354  C  CG    . LYS D 4  332  ? 24.897  4.044   43.164  1.00 64.27  ? 332  LYS A CG    1 
ATOM   3355  C  CD    . LYS D 4  332  ? 23.650  4.187   44.024  1.00 81.33  ? 332  LYS A CD    1 
ATOM   3356  C  CE    . LYS D 4  332  ? 23.589  5.548   44.708  1.00 94.30  ? 332  LYS A CE    1 
ATOM   3357  N  NZ    . LYS D 4  332  ? 22.735  5.526   45.929  1.00 89.00  ? 332  LYS A NZ    1 
ATOM   3358  N  N     . GLU D 4  333  ? 27.203  5.657   41.172  1.00 68.52  ? 333  GLU A N     1 
ATOM   3359  C  CA    . GLU D 4  333  ? 27.085  5.887   39.743  1.00 62.18  ? 333  GLU A CA    1 
ATOM   3360  C  C     . GLU D 4  333  ? 28.444  6.009   39.064  1.00 66.83  ? 333  GLU A C     1 
ATOM   3361  O  O     . GLU D 4  333  ? 28.541  6.608   37.987  1.00 82.43  ? 333  GLU A O     1 
ATOM   3362  C  CB    . GLU D 4  333  ? 26.238  7.135   39.496  1.00 75.23  ? 333  GLU A CB    1 
ATOM   3363  C  CG    . GLU D 4  333  ? 24.786  6.822   39.182  1.00 87.15  ? 333  GLU A CG    1 
ATOM   3364  C  CD    . GLU D 4  333  ? 23.819  7.708   39.944  1.00 102.00 ? 333  GLU A CD    1 
ATOM   3365  O  OE1   . GLU D 4  333  ? 22.638  7.324   40.076  1.00 101.58 ? 333  GLU A OE1   1 
ATOM   3366  O  OE2   . GLU D 4  333  ? 24.242  8.781   40.422  1.00 110.73 ? 333  GLU A OE2   1 
ATOM   3367  N  N     . GLY D 4  334  ? 29.493  5.461   39.674  1.00 62.85  ? 334  GLY A N     1 
ATOM   3368  C  CA    . GLY D 4  334  ? 30.813  5.461   39.086  1.00 64.48  ? 334  GLY A CA    1 
ATOM   3369  C  C     . GLY D 4  334  ? 31.013  4.282   38.154  1.00 78.90  ? 334  GLY A C     1 
ATOM   3370  O  O     . GLY D 4  334  ? 30.081  3.559   37.799  1.00 79.43  ? 334  GLY A O     1 
ATOM   3371  N  N     . ARG D 4  335  ? 32.272  4.092   37.749  1.00 71.07  ? 335  ARG A N     1 
ATOM   3372  C  CA    . ARG D 4  335  ? 32.603  3.000   36.836  1.00 81.77  ? 335  ARG A CA    1 
ATOM   3373  C  C     . ARG D 4  335  ? 32.443  1.645   37.505  1.00 78.50  ? 335  ARG A C     1 
ATOM   3374  O  O     . ARG D 4  335  ? 31.812  0.738   36.952  1.00 93.02  ? 335  ARG A O     1 
ATOM   3375  C  CB    . ARG D 4  335  ? 34.034  3.147   36.320  1.00 88.58  ? 335  ARG A CB    1 
ATOM   3376  C  CG    . ARG D 4  335  ? 34.258  4.255   35.318  1.00 89.36  ? 335  ARG A CG    1 
ATOM   3377  C  CD    . ARG D 4  335  ? 33.500  3.993   34.028  1.00 75.42  ? 335  ARG A CD    1 
ATOM   3378  N  NE    . ARG D 4  335  ? 32.322  4.847   33.909  1.00 82.52  ? 335  ARG A NE    1 
ATOM   3379  C  CZ    . ARG D 4  335  ? 32.355  6.126   33.549  1.00 86.77  ? 335  ARG A CZ    1 
ATOM   3380  N  NH1   . ARG D 4  335  ? 33.509  6.710   33.250  1.00 85.63  ? 335  ARG A NH1   1 
ATOM   3381  N  NH2   . ARG D 4  335  ? 31.230  6.822   33.474  1.00 78.93  ? 335  ARG A NH2   1 
ATOM   3382  N  N     . ILE D 4  336  ? 33.029  1.482   38.688  1.00 74.02  ? 336  ILE A N     1 
ATOM   3383  C  CA    . ILE D 4  336  ? 33.059  0.173   39.332  1.00 71.49  ? 336  ILE A CA    1 
ATOM   3384  C  C     . ILE D 4  336  ? 31.671  -0.206  39.826  1.00 70.26  ? 336  ILE A C     1 
ATOM   3385  O  O     . ILE D 4  336  ? 31.062  -1.170  39.348  1.00 66.00  ? 336  ILE A O     1 
ATOM   3386  C  CB    . ILE D 4  336  ? 34.080  0.170   40.481  1.00 63.55  ? 336  ILE A CB    1 
ATOM   3387  C  CG1   . ILE D 4  336  ? 35.385  0.816   40.025  1.00 63.17  ? 336  ILE A CG1   1 
ATOM   3388  C  CG2   . ILE D 4  336  ? 34.318  -1.244  40.970  1.00 59.82  ? 336  ILE A CG2   1 
ATOM   3389  C  CD1   . ILE D 4  336  ? 36.068  0.058   38.921  1.00 50.05  ? 336  ILE A CD1   1 
ATOM   3390  N  N     . ARG D 4  337  ? 31.143  0.568   40.772  1.00 64.34  ? 337  ARG A N     1 
ATOM   3391  C  CA    . ARG D 4  337  ? 29.855  0.303   41.392  1.00 70.77  ? 337  ARG A CA    1 
ATOM   3392  C  C     . ARG D 4  337  ? 28.662  0.521   40.460  1.00 76.54  ? 337  ARG A C     1 
ATOM   3393  O  O     . ARG D 4  337  ? 27.564  0.055   40.781  1.00 79.05  ? 337  ARG A O     1 
ATOM   3394  C  CB    . ARG D 4  337  ? 29.769  1.157   42.668  1.00 69.22  ? 337  ARG A CB    1 
ATOM   3395  C  CG    . ARG D 4  337  ? 28.719  0.742   43.678  1.00 68.34  ? 337  ARG A CG    1 
ATOM   3396  C  CD    . ARG D 4  337  ? 28.956  1.353   45.050  1.00 58.91  ? 337  ARG A CD    1 
ATOM   3397  N  NE    . ARG D 4  337  ? 27.790  2.075   45.546  1.00 75.47  ? 337  ARG A NE    1 
ATOM   3398  C  CZ    . ARG D 4  337  ? 26.779  1.532   46.211  1.00 84.02  ? 337  ARG A CZ    1 
ATOM   3399  N  NH1   . ARG D 4  337  ? 25.774  2.290   46.634  1.00 93.75  ? 337  ARG A NH1   1 
ATOM   3400  N  NH2   . ARG D 4  337  ? 26.725  0.227   46.363  1.00 88.77  ? 337  ARG A NH2   1 
ATOM   3401  N  N     . GLY D 4  338  ? 28.839  1.158   39.304  1.00 69.52  ? 338  GLY A N     1 
ATOM   3402  C  CA    . GLY D 4  338  ? 27.697  1.436   38.452  1.00 67.99  ? 338  GLY A CA    1 
ATOM   3403  C  C     . GLY D 4  338  ? 27.812  1.054   36.988  1.00 73.00  ? 338  GLY A C     1 
ATOM   3404  O  O     . GLY D 4  338  ? 26.827  1.140   36.245  1.00 67.92  ? 338  GLY A O     1 
ATOM   3405  N  N     . ASN D 4  339  ? 29.003  0.640   36.545  1.00 74.80  ? 339  ASN A N     1 
ATOM   3406  C  CA    . ASN D 4  339  ? 29.178  0.237   35.155  1.00 49.88  ? 339  ASN A CA    1 
ATOM   3407  C  C     . ASN D 4  339  ? 30.007  -1.035  35.011  1.00 66.61  ? 339  ASN A C     1 
ATOM   3408  O  O     . ASN D 4  339  ? 30.418  -1.364  33.891  1.00 80.87  ? 339  ASN A O     1 
ATOM   3409  C  CB    . ASN D 4  339  ? 29.829  1.368   34.343  1.00 46.30  ? 339  ASN A CB    1 
ATOM   3410  C  CG    . ASN D 4  339  ? 28.903  2.557   34.138  1.00 58.70  ? 339  ASN A CG    1 
ATOM   3411  O  OD1   . ASN D 4  339  ? 29.360  3.694   34.005  1.00 80.01  ? 339  ASN A OD1   1 
ATOM   3412  N  ND2   . ASN D 4  339  ? 27.601  2.299   34.089  1.00 61.06  ? 339  ASN A ND2   1 
ATOM   3413  N  N     . LEU D 4  340  ? 30.279  -1.750  36.102  1.00 74.85  ? 340  LEU A N     1 
ATOM   3414  C  CA    . LEU D 4  340  ? 31.035  -2.997  36.040  1.00 62.22  ? 340  LEU A CA    1 
ATOM   3415  C  C     . LEU D 4  340  ? 30.439  -4.029  36.983  1.00 56.17  ? 340  LEU A C     1 
ATOM   3416  O  O     . LEU D 4  340  ? 30.255  -5.191  36.610  1.00 70.71  ? 340  LEU A O     1 
ATOM   3417  C  CB    . LEU D 4  340  ? 32.507  -2.768  36.388  1.00 52.13  ? 340  LEU A CB    1 
ATOM   3418  C  CG    . LEU D 4  340  ? 33.388  -2.211  35.276  1.00 60.10  ? 340  LEU A CG    1 
ATOM   3419  C  CD1   . LEU D 4  340  ? 34.651  -1.587  35.837  1.00 62.62  ? 340  LEU A CD1   1 
ATOM   3420  C  CD2   . LEU D 4  340  ? 33.730  -3.330  34.318  1.00 67.48  ? 340  LEU A CD2   1 
ATOM   3421  N  N     . MET D 4  341  ? 30.143  -3.613  38.210  1.00 50.53  ? 341  MET A N     1 
ATOM   3422  C  CA    . MET D 4  341  ? 29.446  -4.468  39.157  1.00 68.85  ? 341  MET A CA    1 
ATOM   3423  C  C     . MET D 4  341  ? 27.965  -4.595  38.836  1.00 77.81  ? 341  MET A C     1 
ATOM   3424  O  O     . MET D 4  341  ? 27.274  -5.404  39.468  1.00 89.16  ? 341  MET A O     1 
ATOM   3425  C  CB    . MET D 4  341  ? 29.606  -3.928  40.574  1.00 71.54  ? 341  MET A CB    1 
ATOM   3426  C  CG    . MET D 4  341  ? 31.037  -3.894  41.062  1.00 70.19  ? 341  MET A CG    1 
ATOM   3427  S  SD    . MET D 4  341  ? 31.849  -5.483  40.957  1.00 60.02  ? 341  MET A SD    1 
ATOM   3428  C  CE    . MET D 4  341  ? 31.209  -6.208  42.451  1.00 62.74  ? 341  MET A CE    1 
ATOM   3429  N  N     . GLY D 4  342  ? 27.468  -3.805  37.888  1.00 69.71  ? 342  GLY A N     1 
ATOM   3430  C  CA    . GLY D 4  342  ? 26.081  -3.802  37.483  1.00 64.29  ? 342  GLY A CA    1 
ATOM   3431  C  C     . GLY D 4  342  ? 25.870  -2.818  36.353  1.00 72.27  ? 342  GLY A C     1 
ATOM   3432  O  O     . GLY D 4  342  ? 26.301  -1.667  36.449  1.00 63.34  ? 342  GLY A O     1 
ATOM   3433  N  N     . LYS D 4  343  ? 25.229  -3.251  35.272  1.00 78.08  ? 343  LYS A N     1 
ATOM   3434  C  CA    . LYS D 4  343  ? 25.076  -2.406  34.100  1.00 70.06  ? 343  LYS A CA    1 
ATOM   3435  C  C     . LYS D 4  343  ? 23.747  -2.715  33.432  1.00 68.08  ? 343  LYS A C     1 
ATOM   3436  O  O     . LYS D 4  343  ? 23.046  -3.661  33.797  1.00 62.52  ? 343  LYS A O     1 
ATOM   3437  C  CB    . LYS D 4  343  ? 26.229  -2.613  33.119  1.00 47.88  ? 343  LYS A CB    1 
ATOM   3438  C  CG    . LYS D 4  343  ? 26.782  -4.016  33.150  1.00 46.76  ? 343  LYS A CG    1 
ATOM   3439  C  CD    . LYS D 4  343  ? 27.896  -4.181  32.155  1.00 48.61  ? 343  LYS A CD    1 
ATOM   3440  C  CE    . LYS D 4  343  ? 28.977  -5.092  32.695  1.00 61.31  ? 343  LYS A CE    1 
ATOM   3441  N  NZ    . LYS D 4  343  ? 30.038  -5.323  31.677  1.00 55.73  ? 343  LYS A NZ    1 
ATOM   3442  N  N     . ARG D 4  344  ? 23.404  -1.896  32.444  1.00 68.50  ? 344  ARG A N     1 
ATOM   3443  C  CA    . ARG D 4  344  ? 22.208  -2.144  31.659  1.00 72.45  ? 344  ARG A CA    1 
ATOM   3444  C  C     . ARG D 4  344  ? 22.519  -3.144  30.555  1.00 78.57  ? 344  ARG A C     1 
ATOM   3445  O  O     . ARG D 4  344  ? 23.635  -3.198  30.032  1.00 79.28  ? 344  ARG A O     1 
ATOM   3446  C  CB    . ARG D 4  344  ? 21.661  -0.841  31.084  1.00 69.93  ? 344  ARG A CB    1 
ATOM   3447  C  CG    . ARG D 4  344  ? 20.952  -0.015  32.136  1.00 48.35  ? 344  ARG A CG    1 
ATOM   3448  C  CD    . ARG D 4  344  ? 20.821  1.446   31.746  1.00 42.45  ? 344  ARG A CD    1 
ATOM   3449  N  NE    . ARG D 4  344  ? 20.366  2.264   32.868  1.00 48.47  ? 344  ARG A NE    1 
ATOM   3450  C  CZ    . ARG D 4  344  ? 19.120  2.292   33.335  1.00 63.23  ? 344  ARG A CZ    1 
ATOM   3451  N  NH1   . ARG D 4  344  ? 18.169  1.557   32.774  1.00 55.31  ? 344  ARG A NH1   1 
ATOM   3452  N  NH2   . ARG D 4  344  ? 18.822  3.069   34.366  1.00 74.39  ? 344  ARG A NH2   1 
ATOM   3453  N  N     . VAL D 4  345  ? 21.522  -3.960  30.226  1.00 69.76  ? 345  VAL A N     1 
ATOM   3454  C  CA    . VAL D 4  345  ? 21.731  -5.177  29.454  1.00 65.51  ? 345  VAL A CA    1 
ATOM   3455  C  C     . VAL D 4  345  ? 20.740  -5.248  28.301  1.00 66.51  ? 345  VAL A C     1 
ATOM   3456  O  O     . VAL D 4  345  ? 19.614  -4.748  28.387  1.00 66.85  ? 345  VAL A O     1 
ATOM   3457  C  CB    . VAL D 4  345  ? 21.615  -6.433  30.350  1.00 67.59  ? 345  VAL A CB    1 
ATOM   3458  C  CG1   . VAL D 4  345  ? 22.760  -6.485  31.342  1.00 46.89  ? 345  VAL A CG1   1 
ATOM   3459  C  CG2   . VAL D 4  345  ? 20.285  -6.443  31.101  1.00 65.23  ? 345  VAL A CG2   1 
ATOM   3460  N  N     . ASP D 4  346  ? 21.178  -5.869  27.208  1.00 56.92  ? 346  ASP A N     1 
ATOM   3461  C  CA    . ASP D 4  346  ? 20.273  -6.213  26.126  1.00 53.07  ? 346  ASP A CA    1 
ATOM   3462  C  C     . ASP D 4  346  ? 19.440  -7.430  26.522  1.00 50.67  ? 346  ASP A C     1 
ATOM   3463  O  O     . ASP D 4  346  ? 19.722  -8.112  27.512  1.00 68.51  ? 346  ASP A O     1 
ATOM   3464  C  CB    . ASP D 4  346  ? 21.049  -6.504  24.842  1.00 47.16  ? 346  ASP A CB    1 
ATOM   3465  C  CG    . ASP D 4  346  ? 21.806  -5.298  24.328  1.00 63.38  ? 346  ASP A CG    1 
ATOM   3466  O  OD1   . ASP D 4  346  ? 21.326  -4.163  24.519  1.00 54.66  ? 346  ASP A OD1   1 
ATOM   3467  O  OD2   . ASP D 4  346  ? 22.887  -5.487  23.729  1.00 66.76  ? 346  ASP A OD2   1 
ATOM   3468  N  N     . PHE D 4  347  ? 18.408  -7.698  25.715  1.00 46.60  ? 347  PHE A N     1 
ATOM   3469  C  CA    . PHE D 4  347  ? 17.480  -8.821  25.898  1.00 49.87  ? 347  PHE A CA    1 
ATOM   3470  C  C     . PHE D 4  347  ? 16.839  -8.780  27.285  1.00 54.78  ? 347  PHE A C     1 
ATOM   3471  O  O     . PHE D 4  347  ? 16.932  -9.714  28.085  1.00 69.79  ? 347  PHE A O     1 
ATOM   3472  C  CB    . PHE D 4  347  ? 18.171  -10.159 25.616  1.00 47.89  ? 347  PHE A CB    1 
ATOM   3473  C  CG    . PHE D 4  347  ? 19.021  -10.133 24.384  1.00 54.86  ? 347  PHE A CG    1 
ATOM   3474  C  CD1   . PHE D 4  347  ? 20.396  -9.994  24.473  1.00 48.84  ? 347  PHE A CD1   1 
ATOM   3475  C  CD2   . PHE D 4  347  ? 18.437  -10.190 23.129  1.00 52.83  ? 347  PHE A CD2   1 
ATOM   3476  C  CE1   . PHE D 4  347  ? 21.177  -9.942  23.334  1.00 68.83  ? 347  PHE A CE1   1 
ATOM   3477  C  CE2   . PHE D 4  347  ? 19.211  -10.139 21.984  1.00 58.18  ? 347  PHE A CE2   1 
ATOM   3478  C  CZ    . PHE D 4  347  ? 20.583  -10.009 22.087  1.00 76.92  ? 347  PHE A CZ    1 
ATOM   3479  N  N     . SER D 4  348  ? 16.186  -7.653  27.552  1.00 45.49  ? 348  SER A N     1 
ATOM   3480  C  CA    . SER D 4  348  ? 15.545  -7.404  28.830  1.00 50.55  ? 348  SER A CA    1 
ATOM   3481  C  C     . SER D 4  348  ? 14.201  -6.742  28.580  1.00 53.79  ? 348  SER A C     1 
ATOM   3482  O  O     . SER D 4  348  ? 13.971  -6.130  27.534  1.00 70.59  ? 348  SER A O     1 
ATOM   3483  C  CB    . SER D 4  348  ? 16.418  -6.526  29.733  1.00 55.65  ? 348  SER A CB    1 
ATOM   3484  O  OG    . SER D 4  348  ? 17.129  -5.571  28.968  1.00 57.57  ? 348  SER A OG    1 
ATOM   3485  N  N     . ALA D 4  349  ? 13.314  -6.870  29.561  1.00 44.01  ? 349  ALA A N     1 
ATOM   3486  C  CA    . ALA D 4  349  ? 11.976  -6.316  29.442  1.00 43.49  ? 349  ALA A CA    1 
ATOM   3487  C  C     . ALA D 4  349  ? 11.411  -6.091  30.832  1.00 54.13  ? 349  ALA A C     1 
ATOM   3488  O  O     . ALA D 4  349  ? 11.861  -6.694  31.810  1.00 76.41  ? 349  ALA A O     1 
ATOM   3489  C  CB    . ALA D 4  349  ? 11.060  -7.238  28.637  1.00 47.11  ? 349  ALA A CB    1 
ATOM   3490  N  N     . ARG D 4  350  ? 10.397  -5.227  30.898  1.00 42.45  ? 350  ARG A N     1 
ATOM   3491  C  CA    . ARG D 4  350  ? 9.781   -4.864  32.167  1.00 42.03  ? 350  ARG A CA    1 
ATOM   3492  C  C     . ARG D 4  350  ? 8.429   -4.195  31.956  1.00 46.19  ? 350  ARG A C     1 
ATOM   3493  O  O     . ARG D 4  350  ? 8.323   -3.242  31.177  1.00 67.06  ? 350  ARG A O     1 
ATOM   3494  C  CB    . ARG D 4  350  ? 10.709  -3.936  32.949  1.00 59.48  ? 350  ARG A CB    1 
ATOM   3495  C  CG    . ARG D 4  350  ? 10.129  -3.406  34.236  1.00 71.00  ? 350  ARG A CG    1 
ATOM   3496  C  CD    . ARG D 4  350  ? 10.876  -2.177  34.698  1.00 59.52  ? 350  ARG A CD    1 
ATOM   3497  N  NE    . ARG D 4  350  ? 10.120  -1.419  35.685  1.00 58.88  ? 350  ARG A NE    1 
ATOM   3498  C  CZ    . ARG D 4  350  ? 10.461  -1.336  36.965  1.00 58.89  ? 350  ARG A CZ    1 
ATOM   3499  N  NH1   . ARG D 4  350  ? 11.543  -1.963  37.402  1.00 66.43  ? 350  ARG A NH1   1 
ATOM   3500  N  NH2   . ARG D 4  350  ? 9.723   -0.629  37.809  1.00 72.40  ? 350  ARG A NH2   1 
ATOM   3501  N  N     . THR D 4  351  ? 7.396   -4.676  32.642  1.00 42.11  ? 351  THR A N     1 
ATOM   3502  C  CA    . THR D 4  351  ? 6.086   -4.035  32.620  1.00 45.64  ? 351  THR A CA    1 
ATOM   3503  C  C     . THR D 4  351  ? 5.311   -4.455  33.862  1.00 45.18  ? 351  THR A C     1 
ATOM   3504  O  O     . THR D 4  351  ? 5.788   -5.238  34.687  1.00 61.61  ? 351  THR A O     1 
ATOM   3505  C  CB    . THR D 4  351  ? 5.307   -4.376  31.347  1.00 51.37  ? 351  THR A CB    1 
ATOM   3506  O  OG1   . THR D 4  351  ? 3.931   -4.011  31.514  1.00 58.70  ? 351  THR A OG1   1 
ATOM   3507  C  CG2   . THR D 4  351  ? 5.398   -5.862  31.048  1.00 75.69  ? 351  THR A CG2   1 
ATOM   3508  N  N     . VAL D 4  352  ? 4.092   -3.925  33.974  1.00 40.96  ? 352  VAL A N     1 
ATOM   3509  C  CA    . VAL D 4  352  ? 3.255   -4.135  35.149  1.00 40.99  ? 352  VAL A CA    1 
ATOM   3510  C  C     . VAL D 4  352  ? 2.765   -5.580  35.190  1.00 47.45  ? 352  VAL A C     1 
ATOM   3511  O  O     . VAL D 4  352  ? 2.547   -6.219  34.153  1.00 69.08  ? 352  VAL A O     1 
ATOM   3512  C  CB    . VAL D 4  352  ? 2.095   -3.121  35.109  1.00 40.51  ? 352  VAL A CB    1 
ATOM   3513  C  CG1   . VAL D 4  352  ? 1.007   -3.392  36.148  1.00 40.65  ? 352  VAL A CG1   1 
ATOM   3514  C  CG2   . VAL D 4  352  ? 2.627   -1.705  35.246  1.00 62.37  ? 352  VAL A CG2   1 
ATOM   3515  N  N     . ILE D 4  353  ? 2.621   -6.111  36.405  1.00 42.85  ? 353  ILE A N     1 
ATOM   3516  C  CA    . ILE D 4  353  ? 2.258   -7.501  36.632  1.00 42.73  ? 353  ILE A CA    1 
ATOM   3517  C  C     . ILE D 4  353  ? 0.835   -7.609  37.171  1.00 49.21  ? 353  ILE A C     1 
ATOM   3518  O  O     . ILE D 4  353  ? 0.270   -6.664  37.733  1.00 52.17  ? 353  ILE A O     1 
ATOM   3519  C  CB    . ILE D 4  353  ? 3.270   -8.167  37.585  1.00 47.05  ? 353  ILE A CB    1 
ATOM   3520  C  CG1   . ILE D 4  353  ? 2.895   -7.924  39.045  1.00 60.48  ? 353  ILE A CG1   1 
ATOM   3521  C  CG2   . ILE D 4  353  ? 4.627   -7.600  37.353  1.00 57.63  ? 353  ILE A CG2   1 
ATOM   3522  C  CD1   . ILE D 4  353  ? 3.778   -8.644  40.029  1.00 43.43  ? 353  ILE A CD1   1 
ATOM   3523  N  N     . SER D 4  354  ? 0.244   -8.784  36.956  1.00 61.17  ? 354  SER A N     1 
ATOM   3524  C  CA    . SER D 4  354  ? -0.988  -9.199  37.618  1.00 65.43  ? 354  SER A CA    1 
ATOM   3525  C  C     . SER D 4  354  ? -0.990  -10.724 37.680  1.00 62.64  ? 354  SER A C     1 
ATOM   3526  O  O     . SER D 4  354  ? -0.095  -11.384 37.144  1.00 61.04  ? 354  SER A O     1 
ATOM   3527  C  CB    . SER D 4  354  ? -2.231  -8.647  36.913  1.00 62.85  ? 354  SER A CB    1 
ATOM   3528  O  OG    . SER D 4  354  ? -2.052  -8.595  35.514  1.00 61.71  ? 354  SER A OG    1 
ATOM   3529  N  N     . GLY D 4  355  ? -2.001  -11.286 38.339  1.00 45.40  ? 355  GLY A N     1 
ATOM   3530  C  CA    . GLY D 4  355  ? -2.019  -12.700 38.675  1.00 46.37  ? 355  GLY A CA    1 
ATOM   3531  C  C     . GLY D 4  355  ? -3.076  -13.490 37.930  1.00 63.32  ? 355  GLY A C     1 
ATOM   3532  O  O     . GLY D 4  355  ? -4.156  -12.979 37.621  1.00 95.85  ? 355  GLY A O     1 
ATOM   3533  N  N     . ASP D 4  356  ? -2.767  -14.756 37.672  1.00 47.91  ? 356  ASP A N     1 
ATOM   3534  C  CA    . ASP D 4  356  ? -3.615  -15.642 36.878  1.00 48.69  ? 356  ASP A CA    1 
ATOM   3535  C  C     . ASP D 4  356  ? -3.794  -16.970 37.603  1.00 49.76  ? 356  ASP A C     1 
ATOM   3536  O  O     . ASP D 4  356  ? -2.808  -17.719 37.768  1.00 55.04  ? 356  ASP A O     1 
ATOM   3537  C  CB    . ASP D 4  356  ? -2.999  -15.855 35.498  1.00 74.73  ? 356  ASP A CB    1 
ATOM   3538  C  CG    . ASP D 4  356  ? -4.028  -16.176 34.436  1.00 82.32  ? 356  ASP A CG    1 
ATOM   3539  O  OD1   . ASP D 4  356  ? -5.236  -16.200 34.744  1.00 72.41  ? 356  ASP A OD1   1 
ATOM   3540  O  OD2   . ASP D 4  356  ? -3.620  -16.392 33.279  1.00 82.73  ? 356  ASP A OD2   1 
ATOM   3541  N  N     . PRO D 4  357  ? -5.006  -17.301 38.058  1.00 50.27  ? 357  PRO A N     1 
ATOM   3542  C  CA    . PRO D 4  357  ? -5.218  -18.611 38.699  1.00 51.41  ? 357  PRO A CA    1 
ATOM   3543  C  C     . PRO D 4  357  ? -5.083  -19.780 37.747  1.00 56.38  ? 357  PRO A C     1 
ATOM   3544  O  O     . PRO D 4  357  ? -4.878  -20.909 38.207  1.00 53.27  ? 357  PRO A O     1 
ATOM   3545  C  CB    . PRO D 4  357  ? -6.650  -18.517 39.239  1.00 55.08  ? 357  PRO A CB    1 
ATOM   3546  C  CG    . PRO D 4  357  ? -6.955  -17.085 39.289  1.00 50.61  ? 357  PRO A CG    1 
ATOM   3547  C  CD    . PRO D 4  357  ? -6.175  -16.422 38.201  1.00 49.84  ? 357  PRO A CD    1 
ATOM   3548  N  N     . ASN D 4  358  ? -5.209  -19.552 36.440  1.00 65.86  ? 358  ASN A N     1 
ATOM   3549  C  CA    . ASN D 4  358  ? -5.088  -20.602 35.439  1.00 58.10  ? 358  ASN A CA    1 
ATOM   3550  C  C     . ASN D 4  358  ? -3.709  -20.621 34.794  1.00 56.64  ? 358  ASN A C     1 
ATOM   3551  O  O     . ASN D 4  358  ? -3.574  -20.970 33.618  1.00 63.43  ? 358  ASN A O     1 
ATOM   3552  C  CB    . ASN D 4  358  ? -6.182  -20.445 34.386  1.00 53.13  ? 358  ASN A CB    1 
ATOM   3553  C  CG    . ASN D 4  358  ? -7.567  -20.479 34.991  1.00 53.49  ? 358  ASN A CG    1 
ATOM   3554  O  OD1   . ASN D 4  358  ? -7.996  -21.501 35.524  1.00 54.51  ? 358  ASN A OD1   1 
ATOM   3555  N  ND2   . ASN D 4  358  ? -8.269  -19.354 34.931  1.00 52.71  ? 358  ASN A ND2   1 
ATOM   3556  N  N     . LEU D 4  359  ? -2.684  -20.241 35.545  1.00 52.24  ? 359  LEU A N     1 
ATOM   3557  C  CA    . LEU D 4  359  ? -1.300  -20.375 35.126  1.00 55.83  ? 359  LEU A CA    1 
ATOM   3558  C  C     . LEU D 4  359  ? -0.603  -21.345 36.070  1.00 76.33  ? 359  LEU A C     1 
ATOM   3559  O  O     . LEU D 4  359  ? -0.974  -21.464 37.242  1.00 57.21  ? 359  LEU A O     1 
ATOM   3560  C  CB    . LEU D 4  359  ? -0.572  -19.023 35.137  1.00 62.19  ? 359  LEU A CB    1 
ATOM   3561  C  CG    . LEU D 4  359  ? -0.241  -18.353 33.799  1.00 64.72  ? 359  LEU A CG    1 
ATOM   3562  C  CD1   . LEU D 4  359  ? 0.940   -17.397 33.939  1.00 59.42  ? 359  LEU A CD1   1 
ATOM   3563  C  CD2   . LEU D 4  359  ? 0.015   -19.366 32.700  1.00 80.08  ? 359  LEU A CD2   1 
ATOM   3564  N  N     . GLU D 4  360  ? 0.400   -22.048 35.559  1.00 86.04  ? 360  GLU A N     1 
ATOM   3565  C  CA    . GLU D 4  360  ? 1.153   -22.932 36.434  1.00 82.33  ? 360  GLU A CA    1 
ATOM   3566  C  C     . GLU D 4  360  ? 2.210   -22.139 37.195  1.00 82.33  ? 360  GLU A C     1 
ATOM   3567  O  O     . GLU D 4  360  ? 2.508   -20.986 36.873  1.00 98.60  ? 360  GLU A O     1 
ATOM   3568  C  CB    . GLU D 4  360  ? 1.796   -24.071 35.644  1.00 76.60  ? 360  GLU A CB    1 
ATOM   3569  C  CG    . GLU D 4  360  ? 0.789   -25.023 35.023  1.00 71.89  ? 360  GLU A CG    1 
ATOM   3570  C  CD    . GLU D 4  360  ? -0.044  -25.740 36.065  1.00 76.85  ? 360  GLU A CD    1 
ATOM   3571  O  OE1   . GLU D 4  360  ? 0.529   -26.208 37.069  1.00 87.20  ? 360  GLU A OE1   1 
ATOM   3572  O  OE2   . GLU D 4  360  ? -1.275  -25.824 35.884  1.00 81.04  ? 360  GLU A OE2   1 
ATOM   3573  N  N     . LEU D 4  361  ? 2.774   -22.781 38.224  1.00 72.12  ? 361  LEU A N     1 
ATOM   3574  C  CA    . LEU D 4  361  ? 3.680   -22.087 39.136  1.00 54.74  ? 361  LEU A CA    1 
ATOM   3575  C  C     . LEU D 4  361  ? 4.966   -21.669 38.440  1.00 65.00  ? 361  LEU A C     1 
ATOM   3576  O  O     . LEU D 4  361  ? 5.442   -20.543 38.625  1.00 93.22  ? 361  LEU A O     1 
ATOM   3577  C  CB    . LEU D 4  361  ? 3.983   -22.971 40.344  1.00 54.00  ? 361  LEU A CB    1 
ATOM   3578  C  CG    . LEU D 4  361  ? 4.584   -22.294 41.577  1.00 53.46  ? 361  LEU A CG    1 
ATOM   3579  C  CD1   . LEU D 4  361  ? 3.500   -21.892 42.555  1.00 53.25  ? 361  LEU A CD1   1 
ATOM   3580  C  CD2   . LEU D 4  361  ? 5.565   -23.228 42.248  1.00 54.32  ? 361  LEU A CD2   1 
ATOM   3581  N  N     . ASP D 4  362  ? 5.531   -22.548 37.622  1.00 53.49  ? 362  ASP A N     1 
ATOM   3582  C  CA    . ASP D 4  362  ? 6.774   -22.239 36.935  1.00 55.25  ? 362  ASP A CA    1 
ATOM   3583  C  C     . ASP D 4  362  ? 6.570   -21.433 35.658  1.00 60.46  ? 362  ASP A C     1 
ATOM   3584  O  O     . ASP D 4  362  ? 7.555   -21.120 34.983  1.00 66.79  ? 362  ASP A O     1 
ATOM   3585  C  CB    . ASP D 4  362  ? 7.531   -23.533 36.628  1.00 54.39  ? 362  ASP A CB    1 
ATOM   3586  C  CG    . ASP D 4  362  ? 6.621   -24.637 36.132  1.00 60.38  ? 362  ASP A CG    1 
ATOM   3587  O  OD1   . ASP D 4  362  ? 7.124   -25.574 35.480  1.00 67.85  ? 362  ASP A OD1   1 
ATOM   3588  O  OD2   . ASP D 4  362  ? 5.402   -24.569 36.390  1.00 72.27  ? 362  ASP A OD2   1 
ATOM   3589  N  N     . GLN D 4  363  ? 5.338   -21.076 35.315  1.00 71.19  ? 363  GLN A N     1 
ATOM   3590  C  CA    . GLN D 4  363  ? 5.082   -20.318 34.100  1.00 74.59  ? 363  GLN A CA    1 
ATOM   3591  C  C     . GLN D 4  363  ? 5.105   -18.816 34.368  1.00 85.17  ? 363  GLN A C     1 
ATOM   3592  O  O     . GLN D 4  363  ? 4.901   -18.352 35.492  1.00 98.61  ? 363  GLN A O     1 
ATOM   3593  C  CB    . GLN D 4  363  ? 3.737   -20.709 33.480  1.00 52.50  ? 363  GLN A CB    1 
ATOM   3594  C  CG    . GLN D 4  363  ? 3.825   -21.834 32.459  1.00 58.80  ? 363  GLN A CG    1 
ATOM   3595  C  CD    . GLN D 4  363  ? 2.506   -22.557 32.263  1.00 69.19  ? 363  GLN A CD    1 
ATOM   3596  O  OE1   . GLN D 4  363  ? 1.516   -22.262 32.930  1.00 55.59  ? 363  GLN A OE1   1 
ATOM   3597  N  NE2   . GLN D 4  363  ? 2.485   -23.505 31.333  1.00 84.35  ? 363  GLN A NE2   1 
ATOM   3598  N  N     . VAL D 4  364  ? 5.371   -18.056 33.306  1.00 69.47  ? 364  VAL A N     1 
ATOM   3599  C  CA    . VAL D 4  364  ? 5.223   -16.605 33.307  1.00 58.22  ? 364  VAL A CA    1 
ATOM   3600  C  C     . VAL D 4  364  ? 4.403   -16.207 32.086  1.00 62.72  ? 364  VAL A C     1 
ATOM   3601  O  O     . VAL D 4  364  ? 4.659   -16.678 30.972  1.00 58.54  ? 364  VAL A O     1 
ATOM   3602  C  CB    . VAL D 4  364  ? 6.582   -15.869 33.334  1.00 48.30  ? 364  VAL A CB    1 
ATOM   3603  C  CG1   . VAL D 4  364  ? 7.511   -16.338 32.230  1.00 48.80  ? 364  VAL A CG1   1 
ATOM   3604  C  CG2   . VAL D 4  364  ? 6.373   -14.378 33.188  1.00 47.24  ? 364  VAL A CG2   1 
ATOM   3605  N  N     . GLY D 4  365  ? 3.388   -15.379 32.304  1.00 69.59  ? 365  GLY A N     1 
ATOM   3606  C  CA    . GLY D 4  365  ? 2.624   -14.855 31.195  1.00 47.76  ? 365  GLY A CA    1 
ATOM   3607  C  C     . GLY D 4  365  ? 3.318   -13.713 30.488  1.00 47.02  ? 365  GLY A C     1 
ATOM   3608  O  O     . GLY D 4  365  ? 3.286   -12.572 30.954  1.00 67.51  ? 365  GLY A O     1 
ATOM   3609  N  N     . VAL D 4  366  ? 3.944   -14.003 29.353  1.00 54.57  ? 366  VAL A N     1 
ATOM   3610  C  CA    . VAL D 4  366  ? 4.657   -12.993 28.578  1.00 56.92  ? 366  VAL A CA    1 
ATOM   3611  C  C     . VAL D 4  366  ? 3.703   -12.402 27.546  1.00 59.26  ? 366  VAL A C     1 
ATOM   3612  O  O     . VAL D 4  366  ? 3.016   -13.155 26.842  1.00 56.11  ? 366  VAL A O     1 
ATOM   3613  C  CB    . VAL D 4  366  ? 5.902   -13.597 27.911  1.00 61.94  ? 366  VAL A CB    1 
ATOM   3614  C  CG1   . VAL D 4  366  ? 6.506   -12.629 26.901  1.00 46.96  ? 366  VAL A CG1   1 
ATOM   3615  C  CG2   . VAL D 4  366  ? 6.918   -13.983 28.966  1.00 60.13  ? 366  VAL A CG2   1 
ATOM   3616  N  N     . PRO D 4  367  ? 3.604   -11.080 27.435  1.00 56.27  ? 367  PRO A N     1 
ATOM   3617  C  CA    . PRO D 4  367  ? 2.788   -10.484 26.373  1.00 47.82  ? 367  PRO A CA    1 
ATOM   3618  C  C     . PRO D 4  367  ? 3.366   -10.750 24.992  1.00 63.33  ? 367  PRO A C     1 
ATOM   3619  O  O     . PRO D 4  367  ? 4.552   -11.043 24.822  1.00 67.80  ? 367  PRO A O     1 
ATOM   3620  C  CB    . PRO D 4  367  ? 2.818   -8.987  26.698  1.00 45.23  ? 367  PRO A CB    1 
ATOM   3621  C  CG    . PRO D 4  367  ? 3.149   -8.914  28.141  1.00 56.09  ? 367  PRO A CG    1 
ATOM   3622  C  CD    . PRO D 4  367  ? 4.058   -10.075 28.409  1.00 70.09  ? 367  PRO A CD    1 
ATOM   3623  N  N     . LYS D 4  368  ? 2.492   -10.637 23.989  1.00 59.47  ? 368  LYS A N     1 
ATOM   3624  C  CA    . LYS D 4  368  ? 2.914   -10.850 22.609  1.00 46.71  ? 368  LYS A CA    1 
ATOM   3625  C  C     . LYS D 4  368  ? 3.854   -9.748  22.134  1.00 56.55  ? 368  LYS A C     1 
ATOM   3626  O  O     . LYS D 4  368  ? 4.766   -10.009 21.342  1.00 62.87  ? 368  LYS A O     1 
ATOM   3627  C  CB    . LYS D 4  368  ? 1.699   -10.938 21.688  1.00 47.96  ? 368  LYS A CB    1 
ATOM   3628  C  CG    . LYS D 4  368  ? 1.481   -12.302 21.052  1.00 48.14  ? 368  LYS A CG    1 
ATOM   3629  C  CD    . LYS D 4  368  ? 0.161   -12.338 20.299  1.00 60.62  ? 368  LYS A CD    1 
ATOM   3630  C  CE    . LYS D 4  368  ? -0.960  -12.884 21.164  1.00 66.84  ? 368  LYS A CE    1 
ATOM   3631  N  NZ    . LYS D 4  368  ? -2.306  -12.583 20.600  1.00 67.21  ? 368  LYS A NZ    1 
ATOM   3632  N  N     . SER D 4  369  ? 3.640   -8.510  22.597  1.00 56.60  ? 369  SER A N     1 
ATOM   3633  C  CA    . SER D 4  369  ? 4.521   -7.407  22.216  1.00 55.52  ? 369  SER A CA    1 
ATOM   3634  C  C     . SER D 4  369  ? 5.933   -7.631  22.728  1.00 83.94  ? 369  SER A C     1 
ATOM   3635  O  O     . SER D 4  369  ? 6.912   -7.296  22.051  1.00 79.76  ? 369  SER A O     1 
ATOM   3636  C  CB    . SER D 4  369  ? 3.987   -6.083  22.757  1.00 43.93  ? 369  SER A CB    1 
ATOM   3637  O  OG    . SER D 4  369  ? 2.579   -6.048  22.729  1.00 62.12  ? 369  SER A OG    1 
ATOM   3638  N  N     . ILE D 4  370  ? 6.053   -8.191  23.930  1.00 88.31  ? 370  ILE A N     1 
ATOM   3639  C  CA    . ILE D 4  370  ? 7.364   -8.509  24.476  1.00 76.03  ? 370  ILE A CA    1 
ATOM   3640  C  C     . ILE D 4  370  ? 7.962   -9.703  23.743  1.00 71.64  ? 370  ILE A C     1 
ATOM   3641  O  O     . ILE D 4  370  ? 9.172   -9.755  23.492  1.00 72.57  ? 370  ILE A O     1 
ATOM   3642  C  CB    . ILE D 4  370  ? 7.245   -8.770  25.987  1.00 70.24  ? 370  ILE A CB    1 
ATOM   3643  C  CG1   . ILE D 4  370  ? 6.473   -7.629  26.665  1.00 58.24  ? 370  ILE A CG1   1 
ATOM   3644  C  CG2   . ILE D 4  370  ? 8.612   -8.984  26.601  1.00 66.73  ? 370  ILE A CG2   1 
ATOM   3645  C  CD1   . ILE D 4  370  ? 7.306   -6.433  27.064  1.00 49.32  ? 370  ILE A CD1   1 
ATOM   3646  N  N     . ALA D 4  371  ? 7.116   -10.671 23.375  1.00 59.27  ? 371  ALA A N     1 
ATOM   3647  C  CA    . ALA D 4  371  ? 7.589   -11.868 22.690  1.00 54.92  ? 371  ALA A CA    1 
ATOM   3648  C  C     . ALA D 4  371  ? 8.089   -11.547 21.288  1.00 70.55  ? 371  ALA A C     1 
ATOM   3649  O  O     . ALA D 4  371  ? 9.070   -12.141 20.825  1.00 80.79  ? 371  ALA A O     1 
ATOM   3650  C  CB    . ALA D 4  371  ? 6.476   -12.913 22.635  1.00 52.79  ? 371  ALA A CB    1 
ATOM   3651  N  N     . LYS D 4  372  ? 7.432   -10.609 20.598  1.00 69.60  ? 372  LYS A N     1 
ATOM   3652  C  CA    . LYS D 4  372  ? 7.904   -10.188 19.285  1.00 64.70  ? 372  LYS A CA    1 
ATOM   3653  C  C     . LYS D 4  372  ? 9.178   -9.362  19.365  1.00 63.64  ? 372  LYS A C     1 
ATOM   3654  O  O     . LYS D 4  372  ? 9.886   -9.241  18.360  1.00 65.72  ? 372  LYS A O     1 
ATOM   3655  C  CB    . LYS D 4  372  ? 6.836   -9.377  18.552  1.00 67.28  ? 372  LYS A CB    1 
ATOM   3656  C  CG    . LYS D 4  372  ? 5.584   -10.139 18.174  1.00 64.67  ? 372  LYS A CG    1 
ATOM   3657  C  CD    . LYS D 4  372  ? 4.795   -9.352  17.141  1.00 70.45  ? 372  LYS A CD    1 
ATOM   3658  C  CE    . LYS D 4  372  ? 3.356   -9.143  17.569  1.00 75.91  ? 372  LYS A CE    1 
ATOM   3659  N  NZ    . LYS D 4  372  ? 2.950   -7.719  17.423  1.00 71.93  ? 372  LYS A NZ    1 
ATOM   3660  N  N     . THR D 4  373  ? 9.483   -8.791  20.527  1.00 49.20  ? 373  THR A N     1 
ATOM   3661  C  CA    . THR D 4  373  ? 10.663  -7.956  20.685  1.00 46.30  ? 373  THR A CA    1 
ATOM   3662  C  C     . THR D 4  373  ? 11.896  -8.755  21.087  1.00 46.90  ? 373  THR A C     1 
ATOM   3663  O  O     . THR D 4  373  ? 13.006  -8.439  20.648  1.00 47.05  ? 373  THR A O     1 
ATOM   3664  C  CB    . THR D 4  373  ? 10.390  -6.867  21.724  1.00 45.34  ? 373  THR A CB    1 
ATOM   3665  O  OG1   . THR D 4  373  ? 9.035   -6.420  21.605  1.00 44.93  ? 373  THR A OG1   1 
ATOM   3666  C  CG2   . THR D 4  373  ? 11.313  -5.687  21.504  1.00 44.97  ? 373  THR A CG2   1 
ATOM   3667  N  N     . LEU D 4  374  ? 11.723  -9.792  21.903  1.00 48.65  ? 374  LEU A N     1 
ATOM   3668  C  CA    . LEU D 4  374  ? 12.838  -10.547 22.457  1.00 47.64  ? 374  LEU A CA    1 
ATOM   3669  C  C     . LEU D 4  374  ? 13.178  -11.727 21.557  1.00 56.99  ? 374  LEU A C     1 
ATOM   3670  O  O     . LEU D 4  374  ? 12.285  -12.463 21.129  1.00 75.00  ? 374  LEU A O     1 
ATOM   3671  C  CB    . LEU D 4  374  ? 12.492  -11.034 23.863  1.00 48.96  ? 374  LEU A CB    1 
ATOM   3672  C  CG    . LEU D 4  374  ? 12.320  -9.938  24.917  1.00 47.02  ? 374  LEU A CG    1 
ATOM   3673  C  CD1   . LEU D 4  374  ? 12.005  -10.528 26.279  1.00 46.45  ? 374  LEU A CD1   1 
ATOM   3674  C  CD2   . LEU D 4  374  ? 13.566  -9.079  24.991  1.00 50.74  ? 374  LEU A CD2   1 
ATOM   3675  N  N     . THR D 4  375  ? 14.468  -11.911 21.284  1.00 52.91  ? 375  THR A N     1 
ATOM   3676  C  CA    . THR D 4  375  ? 14.942  -12.970 20.410  1.00 54.38  ? 375  THR A CA    1 
ATOM   3677  C  C     . THR D 4  375  ? 15.807  -13.960 21.176  1.00 64.99  ? 375  THR A C     1 
ATOM   3678  O  O     . THR D 4  375  ? 16.272  -13.689 22.285  1.00 74.57  ? 375  THR A O     1 
ATOM   3679  C  CB    . THR D 4  375  ? 15.754  -12.414 19.236  1.00 69.15  ? 375  THR A CB    1 
ATOM   3680  O  OG1   . THR D 4  375  ? 17.133  -12.316 19.616  1.00 81.36  ? 375  THR A OG1   1 
ATOM   3681  C  CG2   . THR D 4  375  ? 15.247  -11.044 18.829  1.00 67.29  ? 375  THR A CG2   1 
ATOM   3682  N  N     . TYR D 4  376  ? 16.008  -15.127 20.565  1.00 67.31  ? 376  TYR A N     1 
ATOM   3683  C  CA    . TYR D 4  376  ? 16.997  -16.089 21.027  1.00 52.71  ? 376  TYR A CA    1 
ATOM   3684  C  C     . TYR D 4  376  ? 17.694  -16.702 19.818  1.00 55.55  ? 376  TYR A C     1 
ATOM   3685  O  O     . TYR D 4  376  ? 17.027  -17.257 18.938  1.00 72.97  ? 376  TYR A O     1 
ATOM   3686  C  CB    . TYR D 4  376  ? 16.364  -17.198 21.866  1.00 53.06  ? 376  TYR A CB    1 
ATOM   3687  C  CG    . TYR D 4  376  ? 17.293  -18.376 22.039  1.00 57.58  ? 376  TYR A CG    1 
ATOM   3688  C  CD1   . TYR D 4  376  ? 18.488  -18.244 22.732  1.00 73.62  ? 376  TYR A CD1   1 
ATOM   3689  C  CD2   . TYR D 4  376  ? 16.997  -19.608 21.473  1.00 69.51  ? 376  TYR A CD2   1 
ATOM   3690  C  CE1   . TYR D 4  376  ? 19.350  -19.306 22.881  1.00 71.01  ? 376  TYR A CE1   1 
ATOM   3691  C  CE2   . TYR D 4  376  ? 17.855  -20.680 21.616  1.00 82.62  ? 376  TYR A CE2   1 
ATOM   3692  C  CZ    . TYR D 4  376  ? 19.031  -20.522 22.317  1.00 83.70  ? 376  TYR A CZ    1 
ATOM   3693  O  OH    . TYR D 4  376  ? 19.890  -21.585 22.467  1.00 92.37  ? 376  TYR A OH    1 
ATOM   3694  N  N     . PRO D 4  377  ? 19.023  -16.621 19.738  1.00 57.13  ? 377  PRO A N     1 
ATOM   3695  C  CA    . PRO D 4  377  ? 19.744  -17.213 18.601  1.00 55.24  ? 377  PRO A CA    1 
ATOM   3696  C  C     . PRO D 4  377  ? 19.659  -18.730 18.630  1.00 59.26  ? 377  PRO A C     1 
ATOM   3697  O  O     . PRO D 4  377  ? 20.114  -19.374 19.577  1.00 74.18  ? 377  PRO A O     1 
ATOM   3698  C  CB    . PRO D 4  377  ? 21.185  -16.724 18.793  1.00 55.32  ? 377  PRO A CB    1 
ATOM   3699  C  CG    . PRO D 4  377  ? 21.120  -15.612 19.762  1.00 63.56  ? 377  PRO A CG    1 
ATOM   3700  C  CD    . PRO D 4  377  ? 19.895  -15.805 20.592  1.00 65.23  ? 377  PRO A CD    1 
ATOM   3701  N  N     . GLU D 4  378  ? 19.068  -19.291 17.582  1.00 62.52  ? 378  GLU A N     1 
ATOM   3702  C  CA    . GLU D 4  378  ? 18.951  -20.729 17.396  1.00 58.15  ? 378  GLU A CA    1 
ATOM   3703  C  C     . GLU D 4  378  ? 19.741  -21.112 16.157  1.00 60.47  ? 378  GLU A C     1 
ATOM   3704  O  O     . GLU D 4  378  ? 19.524  -20.545 15.081  1.00 74.03  ? 378  GLU A O     1 
ATOM   3705  C  CB    . GLU D 4  378  ? 17.484  -21.141 17.249  1.00 58.11  ? 378  GLU A CB    1 
ATOM   3706  C  CG    . GLU D 4  378  ? 17.198  -22.614 17.486  1.00 59.16  ? 378  GLU A CG    1 
ATOM   3707  C  CD    . GLU D 4  378  ? 15.765  -22.848 17.917  1.00 70.90  ? 378  GLU A CD    1 
ATOM   3708  O  OE1   . GLU D 4  378  ? 15.143  -21.894 18.425  1.00 66.57  ? 378  GLU A OE1   1 
ATOM   3709  O  OE2   . GLU D 4  378  ? 15.257  -23.975 17.746  1.00 79.17  ? 378  GLU A OE2   1 
ATOM   3710  N  N     . VAL D 4  379  ? 20.663  -22.047 16.306  1.00 60.24  ? 379  VAL A N     1 
ATOM   3711  C  CA    . VAL D 4  379  ? 21.439  -22.541 15.177  1.00 78.40  ? 379  VAL A CA    1 
ATOM   3712  C  C     . VAL D 4  379  ? 20.641  -23.646 14.506  1.00 80.46  ? 379  VAL A C     1 
ATOM   3713  O  O     . VAL D 4  379  ? 20.099  -24.532 15.178  1.00 100.65 ? 379  VAL A O     1 
ATOM   3714  C  CB    . VAL D 4  379  ? 22.826  -23.035 15.628  1.00 67.93  ? 379  VAL A CB    1 
ATOM   3715  C  CG1   . VAL D 4  379  ? 23.657  -23.452 14.428  1.00 71.92  ? 379  VAL A CG1   1 
ATOM   3716  C  CG2   . VAL D 4  379  ? 23.536  -21.953 16.414  1.00 70.85  ? 379  VAL A CG2   1 
ATOM   3717  N  N     . VAL D 4  380  ? 20.550  -23.592 13.181  1.00 65.70  ? 380  VAL A N     1 
ATOM   3718  C  CA    . VAL D 4  380  ? 19.687  -24.519 12.460  1.00 91.03  ? 380  VAL A CA    1 
ATOM   3719  C  C     . VAL D 4  380  ? 20.337  -25.897 12.415  1.00 81.11  ? 380  VAL A C     1 
ATOM   3720  O  O     . VAL D 4  380  ? 21.561  -26.039 12.290  1.00 68.55  ? 380  VAL A O     1 
ATOM   3721  C  CB    . VAL D 4  380  ? 19.350  -23.980 11.054  1.00 88.90  ? 380  VAL A CB    1 
ATOM   3722  C  CG1   . VAL D 4  380  ? 18.807  -22.566 11.146  1.00 71.37  ? 380  VAL A CG1   1 
ATOM   3723  C  CG2   . VAL D 4  380  ? 20.548  -23.982 10.161  1.00 93.04  ? 380  VAL A CG2   1 
ATOM   3724  N  N     . THR D 4  381  ? 19.512  -26.920 12.596  1.00 82.45  ? 381  THR A N     1 
ATOM   3725  C  CA    . THR D 4  381  ? 19.919  -28.319 12.621  1.00 93.75  ? 381  THR A CA    1 
ATOM   3726  C  C     . THR D 4  381  ? 18.897  -29.103 11.806  1.00 100.21 ? 381  THR A C     1 
ATOM   3727  O  O     . THR D 4  381  ? 17.875  -28.529 11.413  1.00 93.61  ? 381  THR A O     1 
ATOM   3728  C  CB    . THR D 4  381  ? 19.999  -28.841 14.063  1.00 97.24  ? 381  THR A CB    1 
ATOM   3729  O  OG1   . THR D 4  381  ? 18.761  -28.595 14.740  1.00 99.00  ? 381  THR A OG1   1 
ATOM   3730  C  CG2   . THR D 4  381  ? 21.146  -28.199 14.829  1.00 105.56 ? 381  THR A CG2   1 
ATOM   3731  N  N     . PRO D 4  382  ? 19.121  -30.384 11.499  1.00 92.96  ? 382  PRO A N     1 
ATOM   3732  C  CA    . PRO D 4  382  ? 18.031  -31.175 10.905  1.00 95.47  ? 382  PRO A CA    1 
ATOM   3733  C  C     . PRO D 4  382  ? 16.825  -31.336 11.816  1.00 93.08  ? 382  PRO A C     1 
ATOM   3734  O  O     . PRO D 4  382  ? 15.717  -31.560 11.314  1.00 103.80 ? 382  PRO A O     1 
ATOM   3735  C  CB    . PRO D 4  382  ? 18.697  -32.524 10.616  1.00 104.24 ? 382  PRO A CB    1 
ATOM   3736  C  CG    . PRO D 4  382  ? 20.110  -32.181 10.381  1.00 97.66  ? 382  PRO A CG    1 
ATOM   3737  C  CD    . PRO D 4  382  ? 20.417  -31.077 11.354  1.00 88.29  ? 382  PRO A CD    1 
ATOM   3738  N  N     . TYR D 4  383  ? 16.999  -31.213 13.134  1.00 77.99  ? 383  TYR A N     1 
ATOM   3739  C  CA    . TYR D 4  383  ? 15.875  -31.399 14.042  1.00 88.24  ? 383  TYR A CA    1 
ATOM   3740  C  C     . TYR D 4  383  ? 14.949  -30.188 14.057  1.00 93.99  ? 383  TYR A C     1 
ATOM   3741  O  O     . TYR D 4  383  ? 13.762  -30.326 14.371  1.00 98.74  ? 383  TYR A O     1 
ATOM   3742  C  CB    . TYR D 4  383  ? 16.379  -31.680 15.459  1.00 108.00 ? 383  TYR A CB    1 
ATOM   3743  C  CG    . TYR D 4  383  ? 17.757  -32.305 15.540  1.00 118.12 ? 383  TYR A CG    1 
ATOM   3744  C  CD1   . TYR D 4  383  ? 18.837  -31.577 16.022  1.00 114.35 ? 383  TYR A CD1   1 
ATOM   3745  C  CD2   . TYR D 4  383  ? 17.977  -33.620 15.149  1.00 127.21 ? 383  TYR A CD2   1 
ATOM   3746  C  CE1   . TYR D 4  383  ? 20.100  -32.133 16.103  1.00 108.84 ? 383  TYR A CE1   1 
ATOM   3747  C  CE2   . TYR D 4  383  ? 19.240  -34.187 15.228  1.00 127.95 ? 383  TYR A CE2   1 
ATOM   3748  C  CZ    . TYR D 4  383  ? 20.295  -33.437 15.706  1.00 116.48 ? 383  TYR A CZ    1 
ATOM   3749  O  OH    . TYR D 4  383  ? 21.550  -33.995 15.787  1.00 115.89 ? 383  TYR A OH    1 
ATOM   3750  N  N     . ASN D 4  384  ? 15.462  -29.002 13.719  1.00 95.20  ? 384  ASN A N     1 
ATOM   3751  C  CA    . ASN D 4  384  ? 14.718  -27.762 13.903  1.00 95.29  ? 384  ASN A CA    1 
ATOM   3752  C  C     . ASN D 4  384  ? 14.366  -27.001 12.630  1.00 94.59  ? 384  ASN A C     1 
ATOM   3753  O  O     . ASN D 4  384  ? 13.545  -26.078 12.702  1.00 79.41  ? 384  ASN A O     1 
ATOM   3754  C  CB    . ASN D 4  384  ? 15.480  -26.831 14.871  1.00 85.52  ? 384  ASN A CB    1 
ATOM   3755  C  CG    . ASN D 4  384  ? 16.804  -26.280 14.300  1.00 84.93  ? 384  ASN A CG    1 
ATOM   3756  O  OD1   . ASN D 4  384  ? 17.135  -26.428 13.125  1.00 86.38  ? 384  ASN A OD1   1 
ATOM   3757  N  ND2   . ASN D 4  384  ? 17.564  -25.624 15.166  1.00 89.09  ? 384  ASN A ND2   1 
ATOM   3758  N  N     . ILE D 4  385  ? 14.959  -27.349 11.484  1.00 93.64  ? 385  ILE A N     1 
ATOM   3759  C  CA    . ILE D 4  385  ? 14.907  -26.487 10.304  1.00 87.40  ? 385  ILE A CA    1 
ATOM   3760  C  C     . ILE D 4  385  ? 13.487  -26.380 9.751   1.00 72.43  ? 385  ILE A C     1 
ATOM   3761  O  O     . ILE D 4  385  ? 13.096  -25.329 9.228   1.00 64.59  ? 385  ILE A O     1 
ATOM   3762  C  CB    . ILE D 4  385  ? 15.912  -26.999 9.251   1.00 80.03  ? 385  ILE A CB    1 
ATOM   3763  C  CG1   . ILE D 4  385  ? 15.873  -26.162 7.971   1.00 66.71  ? 385  ILE A CG1   1 
ATOM   3764  C  CG2   . ILE D 4  385  ? 15.671  -28.471 8.940   1.00 76.72  ? 385  ILE A CG2   1 
ATOM   3765  C  CD1   . ILE D 4  385  ? 17.160  -26.210 7.187   1.00 67.57  ? 385  ILE A CD1   1 
ATOM   3766  N  N     . ASP D 4  386  ? 12.679  -27.432 9.898   1.00 80.26  ? 386  ASP A N     1 
ATOM   3767  C  CA    . ASP D 4  386  ? 11.309  -27.383 9.401   1.00 94.48  ? 386  ASP A CA    1 
ATOM   3768  C  C     . ASP D 4  386  ? 10.452  -26.416 10.203  1.00 96.97  ? 386  ASP A C     1 
ATOM   3769  O  O     . ASP D 4  386  ? 9.538   -25.795 9.651   1.00 94.10  ? 386  ASP A O     1 
ATOM   3770  C  CB    . ASP D 4  386  ? 10.699  -28.782 9.422   1.00 111.22 ? 386  ASP A CB    1 
ATOM   3771  C  CG    . ASP D 4  386  ? 10.976  -29.554 8.150   1.00 118.37 ? 386  ASP A CG    1 
ATOM   3772  O  OD1   . ASP D 4  386  ? 12.013  -29.289 7.506   1.00 119.73 ? 386  ASP A OD1   1 
ATOM   3773  O  OD2   . ASP D 4  386  ? 10.159  -30.430 7.798   1.00 124.78 ? 386  ASP A OD2   1 
ATOM   3774  N  N     . ARG D 4  387  ? 10.732  -26.267 11.497  1.00 95.71  ? 387  ARG A N     1 
ATOM   3775  C  CA    . ARG D 4  387  ? 10.035  -25.264 12.290  1.00 96.49  ? 387  ARG A CA    1 
ATOM   3776  C  C     . ARG D 4  387  ? 10.626  -23.879 12.069  1.00 91.70  ? 387  ARG A C     1 
ATOM   3777  O  O     . ARG D 4  387  ? 9.894   -22.886 12.050  1.00 88.60  ? 387  ARG A O     1 
ATOM   3778  C  CB    . ARG D 4  387  ? 10.089  -25.631 13.772  1.00 101.15 ? 387  ARG A CB    1 
ATOM   3779  C  CG    . ARG D 4  387  ? 9.074   -24.899 14.637  1.00 104.59 ? 387  ARG A CG    1 
ATOM   3780  C  CD    . ARG D 4  387  ? 9.477   -24.961 16.100  1.00 116.48 ? 387  ARG A CD    1 
ATOM   3781  N  NE    . ARG D 4  387  ? 10.926  -24.861 16.253  1.00 116.66 ? 387  ARG A NE    1 
ATOM   3782  C  CZ    . ARG D 4  387  ? 11.550  -24.724 17.418  1.00 104.47 ? 387  ARG A CZ    1 
ATOM   3783  N  NH1   . ARG D 4  387  ? 10.852  -24.660 18.543  1.00 106.47 ? 387  ARG A NH1   1 
ATOM   3784  N  NH2   . ARG D 4  387  ? 12.872  -24.642 17.454  1.00 93.38  ? 387  ARG A NH2   1 
ATOM   3785  N  N     . LEU D 4  388  ? 11.947  -23.799 11.889  1.00 78.25  ? 388  LEU A N     1 
ATOM   3786  C  CA    . LEU D 4  388  ? 12.602  -22.500 11.791  1.00 67.10  ? 388  LEU A CA    1 
ATOM   3787  C  C     . LEU D 4  388  ? 12.319  -21.829 10.454  1.00 67.69  ? 388  LEU A C     1 
ATOM   3788  O  O     . LEU D 4  388  ? 12.154  -20.606 10.397  1.00 63.78  ? 388  LEU A O     1 
ATOM   3789  C  CB    . LEU D 4  388  ? 14.106  -22.656 12.015  1.00 65.16  ? 388  LEU A CB    1 
ATOM   3790  C  CG    . LEU D 4  388  ? 14.602  -22.623 13.464  1.00 66.09  ? 388  LEU A CG    1 
ATOM   3791  C  CD1   . LEU D 4  388  ? 16.061  -22.238 13.518  1.00 60.38  ? 388  LEU A CD1   1 
ATOM   3792  C  CD2   . LEU D 4  388  ? 13.789  -21.648 14.295  1.00 69.82  ? 388  LEU A CD2   1 
ATOM   3793  N  N     . THR D 4  389  ? 12.255  -22.608 9.370   1.00 76.39  ? 389  THR A N     1 
ATOM   3794  C  CA    . THR D 4  389  ? 11.985  -22.028 8.057   1.00 69.12  ? 389  THR A CA    1 
ATOM   3795  C  C     . THR D 4  389  ? 10.579  -21.445 7.989   1.00 64.21  ? 389  THR A C     1 
ATOM   3796  O  O     . THR D 4  389  ? 10.360  -20.411 7.347   1.00 71.74  ? 389  THR A O     1 
ATOM   3797  C  CB    . THR D 4  389  ? 12.182  -23.077 6.964   1.00 65.94  ? 389  THR A CB    1 
ATOM   3798  O  OG1   . THR D 4  389  ? 13.245  -23.961 7.338   1.00 81.30  ? 389  THR A OG1   1 
ATOM   3799  C  CG2   . THR D 4  389  ? 12.529  -22.406 5.647   1.00 63.99  ? 389  THR A CG2   1 
ATOM   3800  N  N     . GLN D 4  390  ? 9.621   -22.084 8.660   1.00 61.42  ? 390  GLN A N     1 
ATOM   3801  C  CA    . GLN D 4  390  ? 8.286   -21.512 8.783   1.00 64.57  ? 390  GLN A CA    1 
ATOM   3802  C  C     . GLN D 4  390  ? 8.300   -20.268 9.667   1.00 63.28  ? 390  GLN A C     1 
ATOM   3803  O  O     . GLN D 4  390  ? 7.538   -19.325 9.418   1.00 81.43  ? 390  GLN A O     1 
ATOM   3804  C  CB    . GLN D 4  390  ? 7.330   -22.581 9.327   1.00 86.04  ? 390  GLN A CB    1 
ATOM   3805  C  CG    . GLN D 4  390  ? 6.223   -22.139 10.302  1.00 106.05 ? 390  GLN A CG    1 
ATOM   3806  C  CD    . GLN D 4  390  ? 5.146   -21.235 9.698   1.00 121.67 ? 390  GLN A CD    1 
ATOM   3807  O  OE1   . GLN D 4  390  ? 5.165   -20.903 8.511   1.00 127.91 ? 390  GLN A OE1   1 
ATOM   3808  N  NE2   . GLN D 4  390  ? 4.198   -20.831 10.533  1.00 126.67 ? 390  GLN A NE2   1 
ATOM   3809  N  N     . LEU D 4  391  ? 9.170   -20.241 10.681  1.00 65.37  ? 391  LEU A N     1 
ATOM   3810  C  CA    . LEU D 4  391  ? 9.250   -19.089 11.576  1.00 77.23  ? 391  LEU A CA    1 
ATOM   3811  C  C     . LEU D 4  391  ? 9.758   -17.861 10.837  1.00 71.39  ? 391  LEU A C     1 
ATOM   3812  O  O     . LEU D 4  391  ? 9.206   -16.763 10.976  1.00 75.45  ? 391  LEU A O     1 
ATOM   3813  C  CB    . LEU D 4  391  ? 10.169  -19.402 12.757  1.00 86.05  ? 391  LEU A CB    1 
ATOM   3814  C  CG    . LEU D 4  391  ? 9.666   -20.255 13.921  1.00 86.54  ? 391  LEU A CG    1 
ATOM   3815  C  CD1   . LEU D 4  391  ? 10.465  -19.964 15.179  1.00 80.37  ? 391  LEU A CD1   1 
ATOM   3816  C  CD2   . LEU D 4  391  ? 8.190   -20.049 14.157  1.00 97.23  ? 391  LEU A CD2   1 
ATOM   3817  N  N     . VAL D 4  392  ? 10.830  -18.033 10.059  1.00 65.85  ? 392  VAL A N     1 
ATOM   3818  C  CA    . VAL D 4  392  ? 11.392  -16.942 9.268   1.00 61.73  ? 392  VAL A CA    1 
ATOM   3819  C  C     . VAL D 4  392  ? 10.370  -16.435 8.261   1.00 73.29  ? 392  VAL A C     1 
ATOM   3820  O  O     . VAL D 4  392  ? 10.201  -15.224 8.073   1.00 71.81  ? 392  VAL A O     1 
ATOM   3821  C  CB    . VAL D 4  392  ? 12.685  -17.411 8.579   1.00 58.27  ? 392  VAL A CB    1 
ATOM   3822  C  CG1   . VAL D 4  392  ? 13.287  -16.305 7.788   1.00 58.05  ? 392  VAL A CG1   1 
ATOM   3823  C  CG2   . VAL D 4  392  ? 13.679  -17.873 9.611   1.00 63.99  ? 392  VAL A CG2   1 
ATOM   3824  N  N     . ARG D 4  393  ? 9.656   -17.364 7.620   1.00 78.86  ? 393  ARG A N     1 
ATOM   3825  C  CA    . ARG D 4  393  ? 8.572   -17.010 6.710   1.00 73.01  ? 393  ARG A CA    1 
ATOM   3826  C  C     . ARG D 4  393  ? 7.445   -16.273 7.419   1.00 63.75  ? 393  ARG A C     1 
ATOM   3827  O  O     . ARG D 4  393  ? 6.803   -15.401 6.821   1.00 77.81  ? 393  ARG A O     1 
ATOM   3828  C  CB    . ARG D 4  393  ? 8.034   -18.277 6.049   1.00 86.72  ? 393  ARG A CB    1 
ATOM   3829  C  CG    . ARG D 4  393  ? 7.115   -18.036 4.871   1.00 99.99  ? 393  ARG A CG    1 
ATOM   3830  C  CD    . ARG D 4  393  ? 7.181   -19.187 3.875   1.00 104.81 ? 393  ARG A CD    1 
ATOM   3831  N  NE    . ARG D 4  393  ? 6.698   -18.831 2.540   1.00 110.62 ? 393  ARG A NE    1 
ATOM   3832  C  CZ    . ARG D 4  393  ? 5.424   -18.603 2.223   1.00 109.81 ? 393  ARG A CZ    1 
ATOM   3833  N  NH1   . ARG D 4  393  ? 4.463   -18.719 3.131   1.00 111.93 ? 393  ARG A NH1   1 
ATOM   3834  N  NH2   . ARG D 4  393  ? 5.104   -18.287 0.976   1.00 103.98 ? 393  ARG A NH2   1 
ATOM   3835  N  N     . ASN D 4  394  ? 7.192   -16.600 8.687   1.00 59.19  ? 394  ASN A N     1 
ATOM   3836  C  CA    . ASN D 4  394  ? 6.107   -15.960 9.417   1.00 61.58  ? 394  ASN A CA    1 
ATOM   3837  C  C     . ASN D 4  394  ? 6.421   -14.510 9.766   1.00 69.72  ? 394  ASN A C     1 
ATOM   3838  O  O     . ASN D 4  394  ? 5.500   -13.745 10.068  1.00 78.88  ? 394  ASN A O     1 
ATOM   3839  C  CB    . ASN D 4  394  ? 5.796   -16.759 10.679  1.00 66.02  ? 394  ASN A CB    1 
ATOM   3840  C  CG    . ASN D 4  394  ? 4.324   -16.731 11.037  1.00 81.94  ? 394  ASN A CG    1 
ATOM   3841  O  OD1   . ASN D 4  394  ? 3.596   -15.817 10.653  1.00 86.98  ? 394  ASN A OD1   1 
ATOM   3842  N  ND2   . ASN D 4  394  ? 3.875   -17.746 11.762  1.00 96.75  ? 394  ASN A ND2   1 
ATOM   3843  N  N     . GLY D 4  395  ? 7.692   -14.116 9.740   1.00 69.69  ? 395  GLY A N     1 
ATOM   3844  C  CA    . GLY D 4  395  ? 8.057   -12.719 9.801   1.00 83.06  ? 395  GLY A CA    1 
ATOM   3845  C  C     . GLY D 4  395  ? 8.015   -12.110 11.189  1.00 85.71  ? 395  GLY A C     1 
ATOM   3846  O  O     . GLY D 4  395  ? 7.381   -12.635 12.110  1.00 91.74  ? 395  GLY A O     1 
ATOM   3847  N  N     . PRO D 4  396  ? 8.691   -10.968 11.358  1.00 75.55  ? 396  PRO A N     1 
ATOM   3848  C  CA    . PRO D 4  396  ? 8.805   -10.356 12.689  1.00 60.01  ? 396  PRO A CA    1 
ATOM   3849  C  C     . PRO D 4  396  ? 7.555   -9.661  13.204  1.00 51.37  ? 396  PRO A C     1 
ATOM   3850  O  O     . PRO D 4  396  ? 7.526   -9.303  14.389  1.00 66.43  ? 396  PRO A O     1 
ATOM   3851  C  CB    . PRO D 4  396  ? 9.937   -9.334  12.500  1.00 57.92  ? 396  PRO A CB    1 
ATOM   3852  C  CG    . PRO D 4  396  ? 9.905   -9.023  11.044  1.00 50.84  ? 396  PRO A CG    1 
ATOM   3853  C  CD    . PRO D 4  396  ? 9.610   -10.339 10.395  1.00 65.06  ? 396  PRO A CD    1 
ATOM   3854  N  N     . ASN D 4  397  ? 6.535   -9.442  12.381  1.00 49.92  ? 397  ASN A N     1 
ATOM   3855  C  CA    . ASN D 4  397  ? 5.368   -8.699  12.835  1.00 84.22  ? 397  ASN A CA    1 
ATOM   3856  C  C     . ASN D 4  397  ? 4.225   -9.589  13.304  1.00 81.49  ? 397  ASN A C     1 
ATOM   3857  O  O     . ASN D 4  397  ? 3.175   -9.064  13.681  1.00 86.28  ? 397  ASN A O     1 
ATOM   3858  C  CB    . ASN D 4  397  ? 4.881   -7.743  11.741  1.00 103.51 ? 397  ASN A CB    1 
ATOM   3859  C  CG    . ASN D 4  397  ? 5.241   -6.297  12.040  1.00 108.95 ? 397  ASN A CG    1 
ATOM   3860  O  OD1   . ASN D 4  397  ? 4.751   -5.712  13.008  1.00 107.69 ? 397  ASN A OD1   1 
ATOM   3861  N  ND2   . ASN D 4  397  ? 6.110   -5.719  11.220  1.00 110.63 ? 397  ASN A ND2   1 
ATOM   3862  N  N     . GLU D 4  398  ? 4.398   -10.911 13.304  1.00 71.57  ? 398  GLU A N     1 
ATOM   3863  C  CA    . GLU D 4  398  ? 3.481   -11.761 14.048  1.00 88.86  ? 398  GLU A CA    1 
ATOM   3864  C  C     . GLU D 4  398  ? 4.201   -12.999 14.563  1.00 85.37  ? 398  GLU A C     1 
ATOM   3865  O  O     . GLU D 4  398  ? 5.294   -13.354 14.112  1.00 88.11  ? 398  GLU A O     1 
ATOM   3866  C  CB    . GLU D 4  398  ? 2.243   -12.168 13.236  1.00 99.83  ? 398  GLU A CB    1 
ATOM   3867  C  CG    . GLU D 4  398  ? 0.950   -11.537 13.766  1.00 109.19 ? 398  GLU A CG    1 
ATOM   3868  C  CD    . GLU D 4  398  ? 0.712   -11.774 15.262  1.00 105.06 ? 398  GLU A CD    1 
ATOM   3869  O  OE1   . GLU D 4  398  ? 1.042   -12.866 15.781  1.00 97.57  ? 398  GLU A OE1   1 
ATOM   3870  O  OE2   . GLU D 4  398  ? 0.204   -10.849 15.931  1.00 95.18  ? 398  GLU A OE2   1 
ATOM   3871  N  N     . HIS D 4  399  ? 3.536   -13.654 15.516  1.00 75.06  ? 399  HIS A N     1 
ATOM   3872  C  CA    . HIS D 4  399  ? 4.066   -14.689 16.387  1.00 78.60  ? 399  HIS A CA    1 
ATOM   3873  C  C     . HIS D 4  399  ? 3.504   -16.050 16.012  1.00 77.13  ? 399  HIS A C     1 
ATOM   3874  O  O     . HIS D 4  399  ? 2.300   -16.162 15.750  1.00 93.44  ? 399  HIS A O     1 
ATOM   3875  C  CB    . HIS D 4  399  ? 3.706   -14.350 17.834  1.00 87.81  ? 399  HIS A CB    1 
ATOM   3876  C  CG    . HIS D 4  399  ? 4.601   -14.969 18.858  1.00 77.35  ? 399  HIS A CG    1 
ATOM   3877  N  ND1   . HIS D 4  399  ? 4.138   -15.883 19.780  1.00 81.36  ? 399  HIS A ND1   1 
ATOM   3878  C  CD2   . HIS D 4  399  ? 5.917   -14.799 19.124  1.00 80.83  ? 399  HIS A CD2   1 
ATOM   3879  C  CE1   . HIS D 4  399  ? 5.133   -16.255 20.564  1.00 92.63  ? 399  HIS A CE1   1 
ATOM   3880  N  NE2   . HIS D 4  399  ? 6.224   -15.613 20.188  1.00 85.56  ? 399  HIS A NE2   1 
ATOM   3881  N  N     . PRO D 4  400  ? 4.326   -17.112 15.993  1.00 61.24  ? 400  PRO A N     1 
ATOM   3882  C  CA    . PRO D 4  400  ? 5.770   -17.105 16.251  1.00 53.33  ? 400  PRO A CA    1 
ATOM   3883  C  C     . PRO D 4  400  ? 6.571   -16.764 15.001  1.00 57.83  ? 400  PRO A C     1 
ATOM   3884  O  O     . PRO D 4  400  ? 6.252   -17.260 13.921  1.00 75.53  ? 400  PRO A O     1 
ATOM   3885  C  CB    . PRO D 4  400  ? 6.061   -18.545 16.695  1.00 54.29  ? 400  PRO A CB    1 
ATOM   3886  C  CG    . PRO D 4  400  ? 4.731   -19.232 16.804  1.00 54.74  ? 400  PRO A CG    1 
ATOM   3887  C  CD    . PRO D 4  400  ? 3.798   -18.481 15.918  1.00 59.94  ? 400  PRO A CD    1 
ATOM   3888  N  N     . GLY D 4  401  ? 7.598   -15.935 15.148  1.00 55.75  ? 401  GLY A N     1 
ATOM   3889  C  CA    . GLY D 4  401  ? 8.402   -15.546 14.008  1.00 56.47  ? 401  GLY A CA    1 
ATOM   3890  C  C     . GLY D 4  401  ? 9.872   -15.373 14.323  1.00 53.33  ? 401  GLY A C     1 
ATOM   3891  O  O     . GLY D 4  401  ? 10.334  -15.736 15.407  1.00 53.18  ? 401  GLY A O     1 
ATOM   3892  N  N     . ALA D 4  402  ? 10.618  -14.831 13.370  1.00 57.13  ? 402  ALA A N     1 
ATOM   3893  C  CA    . ALA D 4  402  ? 12.014  -14.476 13.553  1.00 69.15  ? 402  ALA A CA    1 
ATOM   3894  C  C     . ALA D 4  402  ? 12.199  -13.004 13.217  1.00 74.59  ? 402  ALA A C     1 
ATOM   3895  O  O     . ALA D 4  402  ? 11.322  -12.360 12.641  1.00 90.46  ? 402  ALA A O     1 
ATOM   3896  C  CB    . ALA D 4  402  ? 12.931  -15.341 12.680  1.00 69.19  ? 402  ALA A CB    1 
ATOM   3897  N  N     . LYS D 4  403  ? 13.355  -12.466 13.583  1.00 54.40  ? 403  LYS A N     1 
ATOM   3898  C  CA    . LYS D 4  403  ? 13.665  -11.074 13.300  1.00 51.73  ? 403  LYS A CA    1 
ATOM   3899  C  C     . LYS D 4  403  ? 14.936  -10.883 12.492  1.00 52.34  ? 403  LYS A C     1 
ATOM   3900  O  O     . LYS D 4  403  ? 14.992  -9.971  11.666  1.00 71.76  ? 403  LYS A O     1 
ATOM   3901  C  CB    . LYS D 4  403  ? 13.784  -10.272 14.605  1.00 50.67  ? 403  LYS A CB    1 
ATOM   3902  C  CG    . LYS D 4  403  ? 12.516  -10.259 15.446  1.00 52.72  ? 403  LYS A CG    1 
ATOM   3903  C  CD    . LYS D 4  403  ? 12.205  -8.863  15.961  1.00 57.41  ? 403  LYS A CD    1 
ATOM   3904  C  CE    . LYS D 4  403  ? 13.395  -8.275  16.705  1.00 52.31  ? 403  LYS A CE    1 
ATOM   3905  N  NZ    . LYS D 4  403  ? 12.979  -7.543  17.931  1.00 49.97  ? 403  LYS A NZ    1 
ATOM   3906  N  N     . TYR D 4  404  ? 15.961  -11.699 12.717  1.00 53.02  ? 404  TYR A N     1 
ATOM   3907  C  CA    . TYR D 4  404  ? 17.203  -11.608 11.967  1.00 53.72  ? 404  TYR A CA    1 
ATOM   3908  C  C     . TYR D 4  404  ? 17.631  -13.010 11.560  1.00 55.58  ? 404  TYR A C     1 
ATOM   3909  O  O     . TYR D 4  404  ? 17.124  -14.012 12.071  1.00 62.72  ? 404  TYR A O     1 
ATOM   3910  C  CB    . TYR D 4  404  ? 18.318  -10.928 12.777  1.00 66.25  ? 404  TYR A CB    1 
ATOM   3911  C  CG    . TYR D 4  404  ? 18.119  -9.451  13.058  1.00 71.89  ? 404  TYR A CG    1 
ATOM   3912  C  CD1   . TYR D 4  404  ? 17.204  -9.012  14.007  1.00 71.87  ? 404  TYR A CD1   1 
ATOM   3913  C  CD2   . TYR D 4  404  ? 18.857  -8.496  12.372  1.00 75.92  ? 404  TYR A CD2   1 
ATOM   3914  C  CE1   . TYR D 4  404  ? 17.026  -7.669  14.261  1.00 75.07  ? 404  TYR A CE1   1 
ATOM   3915  C  CE2   . TYR D 4  404  ? 18.687  -7.150  12.620  1.00 79.83  ? 404  TYR A CE2   1 
ATOM   3916  C  CZ    . TYR D 4  404  ? 17.770  -6.743  13.566  1.00 84.08  ? 404  TYR A CZ    1 
ATOM   3917  O  OH    . TYR D 4  404  ? 17.598  -5.403  13.817  1.00 96.92  ? 404  TYR A OH    1 
ATOM   3918  N  N     . VAL D 4  405  ? 18.571  -13.070 10.621  1.00 64.54  ? 405  VAL A N     1 
ATOM   3919  C  CA    . VAL D 4  405  ? 19.148  -14.324 10.145  1.00 72.49  ? 405  VAL A CA    1 
ATOM   3920  C  C     . VAL D 4  405  ? 20.635  -14.080 9.922   1.00 69.56  ? 405  VAL A C     1 
ATOM   3921  O  O     . VAL D 4  405  ? 21.014  -13.115 9.249   1.00 83.45  ? 405  VAL A O     1 
ATOM   3922  C  CB    . VAL D 4  405  ? 18.465  -14.822 8.851   1.00 63.19  ? 405  VAL A CB    1 
ATOM   3923  C  CG1   . VAL D 4  405  ? 19.415  -15.665 8.002   1.00 59.30  ? 405  VAL A CG1   1 
ATOM   3924  C  CG2   . VAL D 4  405  ? 17.206  -15.612 9.171   1.00 57.84  ? 405  VAL A CG2   1 
ATOM   3925  N  N     . ILE D 4  406  ? 21.478  -14.929 10.505  1.00 58.14  ? 406  ILE A N     1 
ATOM   3926  C  CA    . ILE D 4  406  ? 22.926  -14.769 10.439  1.00 60.33  ? 406  ILE A CA    1 
ATOM   3927  C  C     . ILE D 4  406  ? 23.507  -15.929 9.645   1.00 75.42  ? 406  ILE A C     1 
ATOM   3928  O  O     . ILE D 4  406  ? 23.333  -17.096 10.016  1.00 74.98  ? 406  ILE A O     1 
ATOM   3929  C  CB    . ILE D 4  406  ? 23.560  -14.698 11.835  1.00 63.95  ? 406  ILE A CB    1 
ATOM   3930  C  CG1   . ILE D 4  406  ? 22.606  -14.035 12.830  1.00 67.00  ? 406  ILE A CG1   1 
ATOM   3931  C  CG2   . ILE D 4  406  ? 24.886  -13.955 11.774  1.00 80.93  ? 406  ILE A CG2   1 
ATOM   3932  C  CD1   . ILE D 4  406  ? 23.205  -13.836 14.202  1.00 75.95  ? 406  ILE A CD1   1 
ATOM   3933  N  N     . ARG D 4  407  ? 24.208  -15.607 8.560   1.00 103.37 ? 407  ARG A N     1 
ATOM   3934  C  CA    . ARG D 4  407  ? 24.900  -16.614 7.774   1.00 112.54 ? 407  ARG A CA    1 
ATOM   3935  C  C     . ARG D 4  407  ? 26.254  -16.937 8.400   1.00 116.58 ? 407  ARG A C     1 
ATOM   3936  O  O     . ARG D 4  407  ? 26.666  -16.348 9.404   1.00 109.48 ? 407  ARG A O     1 
ATOM   3937  C  CB    . ARG D 4  407  ? 25.076  -16.147 6.331   1.00 117.57 ? 407  ARG A CB    1 
ATOM   3938  C  CG    . ARG D 4  407  ? 23.893  -15.391 5.760   1.00 120.78 ? 407  ARG A CG    1 
ATOM   3939  C  CD    . ARG D 4  407  ? 24.097  -15.094 4.282   1.00 118.95 ? 407  ARG A CD    1 
ATOM   3940  N  NE    . ARG D 4  407  ? 25.346  -14.373 4.055   1.00 114.89 ? 407  ARG A NE    1 
ATOM   3941  C  CZ    . ARG D 4  407  ? 25.424  -13.059 3.873   1.00 104.44 ? 407  ARG A CZ    1 
ATOM   3942  N  NH1   . ARG D 4  407  ? 24.324  -12.321 3.892   1.00 95.51  ? 407  ARG A NH1   1 
ATOM   3943  N  NH2   . ARG D 4  407  ? 26.601  -12.482 3.678   1.00 101.17 ? 407  ARG A NH2   1 
ATOM   3944  N  N     . ASP D 4  408  ? 26.957  -17.892 7.785   1.00 124.04 ? 408  ASP A N     1 
ATOM   3945  C  CA    . ASP D 4  408  ? 28.311  -18.224 8.214   1.00 127.46 ? 408  ASP A CA    1 
ATOM   3946  C  C     . ASP D 4  408  ? 29.272  -17.066 7.982   1.00 124.85 ? 408  ASP A C     1 
ATOM   3947  O  O     . ASP D 4  408  ? 30.284  -16.949 8.683   1.00 120.96 ? 408  ASP A O     1 
ATOM   3948  C  CB    . ASP D 4  408  ? 28.788  -19.480 7.485   1.00 133.78 ? 408  ASP A CB    1 
ATOM   3949  C  CG    . ASP D 4  408  ? 28.542  -19.419 5.984   1.00 139.42 ? 408  ASP A CG    1 
ATOM   3950  O  OD1   . ASP D 4  408  ? 29.012  -18.469 5.320   1.00 140.78 ? 408  ASP A OD1   1 
ATOM   3951  O  OD2   . ASP D 4  408  ? 27.866  -20.330 5.465   1.00 137.78 ? 408  ASP A OD2   1 
ATOM   3952  N  N     . SER D 4  409  ? 28.975  -16.209 7.001   1.00 129.41 ? 409  SER A N     1 
ATOM   3953  C  CA    . SER D 4  409  ? 29.764  -15.001 6.795   1.00 134.01 ? 409  SER A CA    1 
ATOM   3954  C  C     . SER D 4  409  ? 29.644  -14.041 7.971   1.00 121.80 ? 409  SER A C     1 
ATOM   3955  O  O     . SER D 4  409  ? 30.571  -13.271 8.240   1.00 127.02 ? 409  SER A O     1 
ATOM   3956  C  CB    . SER D 4  409  ? 29.324  -14.312 5.505   1.00 149.68 ? 409  SER A CB    1 
ATOM   3957  O  OG    . SER D 4  409  ? 28.147  -13.552 5.721   1.00 158.63 ? 409  SER A OG    1 
ATOM   3958  N  N     . GLY D 4  410  ? 28.520  -14.070 8.681   1.00 113.07 ? 410  GLY A N     1 
ATOM   3959  C  CA    . GLY D 4  410  ? 28.352  -13.223 9.842   1.00 108.50 ? 410  GLY A CA    1 
ATOM   3960  C  C     . GLY D 4  410  ? 27.768  -11.861 9.554   1.00 116.87 ? 410  GLY A C     1 
ATOM   3961  O  O     . GLY D 4  410  ? 28.109  -10.891 10.243  1.00 112.85 ? 410  GLY A O     1 
ATOM   3962  N  N     . ASP D 4  411  ? 26.901  -11.751 8.552   1.00 122.55 ? 411  ASP A N     1 
ATOM   3963  C  CA    . ASP D 4  411  ? 26.227  -10.504 8.218   1.00 124.03 ? 411  ASP A CA    1 
ATOM   3964  C  C     . ASP D 4  411  ? 24.737  -10.692 8.453   1.00 113.54 ? 411  ASP A C     1 
ATOM   3965  O  O     . ASP D 4  411  ? 24.129  -11.612 7.895   1.00 108.74 ? 411  ASP A O     1 
ATOM   3966  C  CB    . ASP D 4  411  ? 26.502  -10.092 6.771   1.00 136.86 ? 411  ASP A CB    1 
ATOM   3967  C  CG    . ASP D 4  411  ? 27.909  -10.438 6.328   1.00 151.75 ? 411  ASP A CG    1 
ATOM   3968  O  OD1   . ASP D 4  411  ? 28.871  -9.987  6.987   1.00 154.80 ? 411  ASP A OD1   1 
ATOM   3969  O  OD2   . ASP D 4  411  ? 28.053  -11.152 5.314   1.00 157.42 ? 411  ASP A OD2   1 
ATOM   3970  N  N     . ARG D 4  412  ? 24.157  -9.824  9.276   1.00 110.68 ? 412  ARG A N     1 
ATOM   3971  C  CA    . ARG D 4  412  ? 22.758  -9.960  9.650   1.00 107.47 ? 412  ARG A CA    1 
ATOM   3972  C  C     . ARG D 4  412  ? 21.843  -9.617  8.484   1.00 89.32  ? 412  ARG A C     1 
ATOM   3973  O  O     . ARG D 4  412  ? 22.091  -8.671  7.731   1.00 89.10  ? 412  ARG A O     1 
ATOM   3974  C  CB    . ARG D 4  412  ? 22.440  -9.064  10.845  1.00 110.05 ? 412  ARG A CB    1 
ATOM   3975  C  CG    . ARG D 4  412  ? 23.147  -9.459  12.127  1.00 105.98 ? 412  ARG A CG    1 
ATOM   3976  C  CD    . ARG D 4  412  ? 22.682  -8.591  13.279  1.00 105.80 ? 412  ARG A CD    1 
ATOM   3977  N  NE    . ARG D 4  412  ? 22.117  -9.369  14.375  1.00 113.21 ? 412  ARG A NE    1 
ATOM   3978  C  CZ    . ARG D 4  412  ? 21.684  -8.837  15.513  1.00 116.64 ? 412  ARG A CZ    1 
ATOM   3979  N  NH1   . ARG D 4  412  ? 21.181  -9.607  16.463  1.00 104.74 ? 412  ARG A NH1   1 
ATOM   3980  N  NH2   . ARG D 4  412  ? 21.755  -7.527  15.700  1.00 123.70 ? 412  ARG A NH2   1 
ATOM   3981  N  N     . ILE D 4  413  ? 20.775  -10.395 8.342   1.00 71.05  ? 413  ILE A N     1 
ATOM   3982  C  CA    . ILE D 4  413  ? 19.774  -10.194 7.304   1.00 58.78  ? 413  ILE A CA    1 
ATOM   3983  C  C     . ILE D 4  413  ? 18.511  -9.715  8.009   1.00 60.73  ? 413  ILE A C     1 
ATOM   3984  O  O     . ILE D 4  413  ? 17.862  -10.479 8.736   1.00 79.10  ? 413  ILE A O     1 
ATOM   3985  C  CB    . ILE D 4  413  ? 19.534  -11.474 6.492   1.00 60.21  ? 413  ILE A CB    1 
ATOM   3986  C  CG1   . ILE D 4  413  ? 20.700  -11.703 5.533   1.00 58.77  ? 413  ILE A CG1   1 
ATOM   3987  C  CG2   . ILE D 4  413  ? 18.252  -11.384 5.682   1.00 70.26  ? 413  ILE A CG2   1 
ATOM   3988  C  CD1   . ILE D 4  413  ? 20.980  -13.159 5.259   1.00 59.96  ? 413  ILE A CD1   1 
ATOM   3989  N  N     . ASP D 4  414  ? 18.177  -8.444  7.820   1.00 55.81  ? 414  ASP A N     1 
ATOM   3990  C  CA    . ASP D 4  414  ? 17.087  -7.823  8.561   1.00 59.43  ? 414  ASP A CA    1 
ATOM   3991  C  C     . ASP D 4  414  ? 15.766  -8.195  7.903   1.00 66.80  ? 414  ASP A C     1 
ATOM   3992  O  O     . ASP D 4  414  ? 15.519  -7.833  6.751   1.00 88.19  ? 414  ASP A O     1 
ATOM   3993  C  CB    . ASP D 4  414  ? 17.271  -6.307  8.593   1.00 67.62  ? 414  ASP A CB    1 
ATOM   3994  C  CG    . ASP D 4  414  ? 16.414  -5.622  9.644   1.00 72.91  ? 414  ASP A CG    1 
ATOM   3995  O  OD1   . ASP D 4  414  ? 15.344  -6.146  10.016  1.00 71.21  ? 414  ASP A OD1   1 
ATOM   3996  O  OD2   . ASP D 4  414  ? 16.821  -4.536  10.102  1.00 75.75  ? 414  ASP A OD2   1 
ATOM   3997  N  N     . LEU D 4  415  ? 14.912  -8.902  8.636   1.00 65.36  ? 415  LEU A N     1 
ATOM   3998  C  CA    . LEU D 4  415  ? 13.626  -9.341  8.110   1.00 64.16  ? 415  LEU A CA    1 
ATOM   3999  C  C     . LEU D 4  415  ? 12.533  -8.295  8.233   1.00 60.76  ? 415  LEU A C     1 
ATOM   4000  O  O     . LEU D 4  415  ? 11.434  -8.516  7.711   1.00 52.68  ? 415  LEU A O     1 
ATOM   4001  C  CB    . LEU D 4  415  ? 13.167  -10.603 8.827   1.00 60.22  ? 415  LEU A CB    1 
ATOM   4002  C  CG    . LEU D 4  415  ? 14.028  -11.855 8.815   1.00 61.85  ? 415  LEU A CG    1 
ATOM   4003  C  CD1   . LEU D 4  415  ? 13.065  -12.972 8.992   1.00 67.80  ? 415  LEU A CD1   1 
ATOM   4004  C  CD2   . LEU D 4  415  ? 14.781  -12.023 7.505   1.00 55.72  ? 415  LEU A CD2   1 
ATOM   4005  N  N     . ARG D 4  416  ? 12.790  -7.195  8.943   1.00 76.73  ? 416  ARG A N     1 
ATOM   4006  C  CA    . ARG D 4  416  ? 11.811  -6.117  9.015   1.00 87.39  ? 416  ARG A CA    1 
ATOM   4007  C  C     . ARG D 4  416  ? 11.577  -5.517  7.637   1.00 87.37  ? 416  ARG A C     1 
ATOM   4008  O  O     . ARG D 4  416  ? 10.442  -5.184  7.277   1.00 86.31  ? 416  ARG A O     1 
ATOM   4009  C  CB    . ARG D 4  416  ? 12.286  -5.044  9.996   1.00 89.34  ? 416  ARG A CB    1 
ATOM   4010  C  CG    . ARG D 4  416  ? 12.409  -5.529  11.437  1.00 95.18  ? 416  ARG A CG    1 
ATOM   4011  C  CD    . ARG D 4  416  ? 12.440  -4.367  12.437  1.00 88.44  ? 416  ARG A CD    1 
ATOM   4012  N  NE    . ARG D 4  416  ? 13.418  -3.327  12.105  1.00 79.77  ? 416  ARG A NE    1 
ATOM   4013  C  CZ    . ARG D 4  416  ? 14.742  -3.463  12.165  1.00 70.38  ? 416  ARG A CZ    1 
ATOM   4014  N  NH1   . ARG D 4  416  ? 15.297  -4.599  12.569  1.00 68.61  ? 416  ARG A NH1   1 
ATOM   4015  N  NH2   . ARG D 4  416  ? 15.522  -2.443  11.834  1.00 66.08  ? 416  ARG A NH2   1 
ATOM   4016  N  N     . TYR D 4  417  ? 12.645  -5.405  6.842   1.00 79.22  ? 417  TYR A N     1 
ATOM   4017  C  CA    . TYR D 4  417  ? 12.540  -4.946  5.455   1.00 75.55  ? 417  TYR A CA    1 
ATOM   4018  C  C     . TYR D 4  417  ? 13.799  -5.384  4.695   1.00 79.38  ? 417  TYR A C     1 
ATOM   4019  O  O     . TYR D 4  417  ? 14.820  -4.698  4.711   1.00 83.06  ? 417  TYR A O     1 
ATOM   4020  C  CB    . TYR D 4  417  ? 12.309  -3.445  5.371   1.00 85.26  ? 417  TYR A CB    1 
ATOM   4021  C  CG    . TYR D 4  417  ? 12.903  -2.614  6.496   1.00 84.93  ? 417  TYR A CG    1 
ATOM   4022  C  CD1   . TYR D 4  417  ? 14.272  -2.422  6.619   1.00 85.84  ? 417  TYR A CD1   1 
ATOM   4023  C  CD2   . TYR D 4  417  ? 12.075  -2.015  7.436   1.00 84.24  ? 417  TYR A CD2   1 
ATOM   4024  C  CE1   . TYR D 4  417  ? 14.798  -1.661  7.639   1.00 92.40  ? 417  TYR A CE1   1 
ATOM   4025  C  CE2   . TYR D 4  417  ? 12.591  -1.253  8.460   1.00 78.77  ? 417  TYR A CE2   1 
ATOM   4026  C  CZ    . TYR D 4  417  ? 13.953  -1.079  8.557   1.00 92.67  ? 417  TYR A CZ    1 
ATOM   4027  O  OH    . TYR D 4  417  ? 14.474  -0.320  9.577   1.00 98.89  ? 417  TYR A OH    1 
ATOM   4028  N  N     . SER D 4  418  ? 13.704  -6.533  4.034   1.00 77.83  ? 418  SER A N     1 
ATOM   4029  C  CA    . SER D 4  418  ? 14.716  -6.954  3.079   1.00 79.14  ? 418  SER A CA    1 
ATOM   4030  C  C     . SER D 4  418  ? 14.044  -7.344  1.775   1.00 96.50  ? 418  SER A C     1 
ATOM   4031  O  O     . SER D 4  418  ? 12.832  -7.562  1.714   1.00 105.11 ? 418  SER A O     1 
ATOM   4032  C  CB    . SER D 4  418  ? 15.557  -8.130  3.588   1.00 64.36  ? 418  SER A CB    1 
ATOM   4033  O  OG    . SER D 4  418  ? 16.484  -8.550  2.602   1.00 57.37  ? 418  SER A OG    1 
ATOM   4034  N  N     . LYS D 4  419  ? 14.865  -7.407  0.726   1.00 101.48 ? 419  LYS A N     1 
ATOM   4035  C  CA    . LYS D 4  419  ? 14.417  -7.925  -0.561  1.00 76.08  ? 419  LYS A CA    1 
ATOM   4036  C  C     . LYS D 4  419  ? 13.935  -9.357  -0.426  1.00 87.95  ? 419  LYS A C     1 
ATOM   4037  O  O     . LYS D 4  419  ? 12.827  -9.704  -0.851  1.00 94.34  ? 419  LYS A O     1 
ATOM   4038  C  CB    . LYS D 4  419  ? 15.568  -7.881  -1.557  1.00 59.73  ? 419  LYS A CB    1 
ATOM   4039  C  CG    . LYS D 4  419  ? 15.621  -6.674  -2.418  1.00 59.79  ? 419  LYS A CG    1 
ATOM   4040  C  CD    . LYS D 4  419  ? 16.924  -6.677  -3.165  1.00 60.84  ? 419  LYS A CD    1 
ATOM   4041  C  CE    . LYS D 4  419  ? 17.068  -5.396  -3.926  1.00 91.54  ? 419  LYS A CE    1 
ATOM   4042  N  NZ    . LYS D 4  419  ? 17.740  -5.576  -5.227  1.00 106.04 ? 419  LYS A NZ    1 
ATOM   4043  N  N     . ARG D 4  420  ? 14.760  -10.197 0.186   1.00 82.71  ? 420  ARG A N     1 
ATOM   4044  C  CA    . ARG D 4  420  ? 14.627  -11.640 0.127   1.00 73.05  ? 420  ARG A CA    1 
ATOM   4045  C  C     . ARG D 4  420  ? 14.131  -12.230 1.440   1.00 63.73  ? 420  ARG A C     1 
ATOM   4046  O  O     . ARG D 4  420  ? 14.483  -13.357 1.789   1.00 65.31  ? 420  ARG A O     1 
ATOM   4047  C  CB    . ARG D 4  420  ? 15.965  -12.253 -0.273  1.00 67.72  ? 420  ARG A CB    1 
ATOM   4048  C  CG    . ARG D 4  420  ? 16.710  -11.457 -1.314  1.00 67.78  ? 420  ARG A CG    1 
ATOM   4049  C  CD    . ARG D 4  420  ? 17.925  -12.227 -1.745  1.00 63.20  ? 420  ARG A CD    1 
ATOM   4050  N  NE    . ARG D 4  420  ? 17.596  -13.638 -1.918  1.00 64.12  ? 420  ARG A NE    1 
ATOM   4051  C  CZ    . ARG D 4  420  ? 18.464  -14.571 -2.290  1.00 77.16  ? 420  ARG A CZ    1 
ATOM   4052  N  NH1   . ARG D 4  420  ? 19.727  -14.251 -2.528  1.00 75.92  ? 420  ARG A NH1   1 
ATOM   4053  N  NH2   . ARG D 4  420  ? 18.065  -15.828 -2.421  1.00 88.01  ? 420  ARG A NH2   1 
ATOM   4054  N  N     . ALA D 4  421  ? 13.291  -11.490 2.163   1.00 58.41  ? 421  ALA A N     1 
ATOM   4055  C  CA    . ALA D 4  421  ? 12.708  -11.992 3.402   1.00 62.81  ? 421  ALA A CA    1 
ATOM   4056  C  C     . ALA D 4  421  ? 11.650  -13.064 3.176   1.00 83.44  ? 421  ALA A C     1 
ATOM   4057  O  O     . ALA D 4  421  ? 11.133  -13.607 4.159   1.00 93.72  ? 421  ALA A O     1 
ATOM   4058  C  CB    . ALA D 4  421  ? 12.103  -10.836 4.200   1.00 67.34  ? 421  ALA A CB    1 
ATOM   4059  N  N     . GLY D 4  422  ? 11.313  -13.382 1.927   1.00 93.55  ? 422  GLY A N     1 
ATOM   4060  C  CA    . GLY D 4  422  ? 10.288  -14.366 1.647   1.00 101.09 ? 422  GLY A CA    1 
ATOM   4061  C  C     . GLY D 4  422  ? 10.762  -15.616 0.932   1.00 106.53 ? 422  GLY A C     1 
ATOM   4062  O  O     . GLY D 4  422  ? 10.066  -16.636 0.952   1.00 116.75 ? 422  GLY A O     1 
ATOM   4063  N  N     . ASP D 4  423  ? 11.933  -15.570 0.295   1.00 103.19 ? 423  ASP A N     1 
ATOM   4064  C  CA    . ASP D 4  423  ? 12.422  -16.707 -0.479  1.00 110.31 ? 423  ASP A CA    1 
ATOM   4065  C  C     . ASP D 4  423  ? 13.627  -17.391 0.157   1.00 107.60 ? 423  ASP A C     1 
ATOM   4066  O  O     . ASP D 4  423  ? 14.295  -18.185 -0.517  1.00 134.62 ? 423  ASP A O     1 
ATOM   4067  C  CB    . ASP D 4  423  ? 12.754  -16.274 -1.914  1.00 124.47 ? 423  ASP A CB    1 
ATOM   4068  C  CG    . ASP D 4  423  ? 14.122  -15.631 -2.036  1.00 133.06 ? 423  ASP A CG    1 
ATOM   4069  O  OD1   . ASP D 4  423  ? 14.471  -14.832 -1.153  1.00 133.38 ? 423  ASP A OD1   1 
ATOM   4070  O  OD2   . ASP D 4  423  ? 14.853  -15.941 -2.999  1.00 136.13 ? 423  ASP A OD2   1 
ATOM   4071  N  N     . ILE D 4  424  ? 13.914  -17.109 1.432   1.00 81.84  ? 424  ILE A N     1 
ATOM   4072  C  CA    . ILE D 4  424  ? 15.059  -17.672 2.148   1.00 83.03  ? 424  ILE A CA    1 
ATOM   4073  C  C     . ILE D 4  424  ? 15.117  -19.196 2.087   1.00 86.31  ? 424  ILE A C     1 
ATOM   4074  O  O     . ILE D 4  424  ? 14.091  -19.874 1.969   1.00 105.33 ? 424  ILE A O     1 
ATOM   4075  C  CB    . ILE D 4  424  ? 15.108  -17.128 3.598   1.00 74.26  ? 424  ILE A CB    1 
ATOM   4076  C  CG1   . ILE D 4  424  ? 13.755  -17.145 4.352   1.00 86.93  ? 424  ILE A CG1   1 
ATOM   4077  C  CG2   . ILE D 4  424  ? 15.732  -15.734 3.640   1.00 60.90  ? 424  ILE A CG2   1 
ATOM   4078  C  CD1   . ILE D 4  424  ? 12.971  -18.433 4.536   1.00 77.14  ? 424  ILE A CD1   1 
ATOM   4079  N  N     . GLN D 4  425  ? 16.331  -19.738 2.091   1.00 76.35  ? 425  GLN A N     1 
ATOM   4080  C  CA    . GLN D 4  425  ? 16.536  -21.172 1.938   1.00 95.08  ? 425  GLN A CA    1 
ATOM   4081  C  C     . GLN D 4  425  ? 17.668  -21.511 2.894   1.00 89.54  ? 425  GLN A C     1 
ATOM   4082  O  O     . GLN D 4  425  ? 18.829  -21.200 2.616   1.00 90.47  ? 425  GLN A O     1 
ATOM   4083  C  CB    . GLN D 4  425  ? 16.866  -21.532 0.488   1.00 113.53 ? 425  GLN A CB    1 
ATOM   4084  C  CG    . GLN D 4  425  ? 16.500  -22.954 0.020   1.00 120.54 ? 425  GLN A CG    1 
ATOM   4085  C  CD    . GLN D 4  425  ? 16.854  -24.064 0.994   1.00 133.19 ? 425  GLN A CD    1 
ATOM   4086  O  OE1   . GLN D 4  425  ? 17.984  -24.162 1.468   1.00 131.96 ? 425  GLN A OE1   1 
ATOM   4087  N  NE2   . GLN D 4  425  ? 15.874  -24.907 1.301   1.00 138.63 ? 425  GLN A NE2   1 
ATOM   4088  N  N     . LEU D 4  426  ? 17.325  -22.142 4.012   1.00 85.22  ? 426  LEU A N     1 
ATOM   4089  C  CA    . LEU D 4  426  ? 18.214  -22.158 5.162   1.00 84.02  ? 426  LEU A CA    1 
ATOM   4090  C  C     . LEU D 4  426  ? 19.381  -23.114 4.959   1.00 94.16  ? 426  LEU A C     1 
ATOM   4091  O  O     . LEU D 4  426  ? 19.219  -24.230 4.461   1.00 111.24 ? 426  LEU A O     1 
ATOM   4092  C  CB    . LEU D 4  426  ? 17.432  -22.531 6.419   1.00 72.68  ? 426  LEU A CB    1 
ATOM   4093  C  CG    . LEU D 4  426  ? 16.556  -21.388 6.936   1.00 66.43  ? 426  LEU A CG    1 
ATOM   4094  C  CD1   . LEU D 4  426  ? 15.735  -21.817 8.138   1.00 62.75  ? 426  LEU A CD1   1 
ATOM   4095  C  CD2   . LEU D 4  426  ? 17.404  -20.172 7.269   1.00 62.41  ? 426  LEU A CD2   1 
ATOM   4096  N  N     . GLN D 4  427  ? 20.567  -22.657 5.348   1.00 86.28  ? 427  GLN A N     1 
ATOM   4097  C  CA    . GLN D 4  427  ? 21.803  -23.419 5.266   1.00 102.37 ? 427  GLN A CA    1 
ATOM   4098  C  C     . GLN D 4  427  ? 22.224  -23.826 6.668   1.00 98.41  ? 427  GLN A C     1 
ATOM   4099  O  O     . GLN D 4  427  ? 22.137  -23.017 7.595   1.00 95.07  ? 427  GLN A O     1 
ATOM   4100  C  CB    . GLN D 4  427  ? 22.913  -22.579 4.631   1.00 108.05 ? 427  GLN A CB    1 
ATOM   4101  C  CG    . GLN D 4  427  ? 23.829  -23.323 3.680   1.00 122.60 ? 427  GLN A CG    1 
ATOM   4102  C  CD    . GLN D 4  427  ? 23.336  -23.301 2.247   1.00 137.20 ? 427  GLN A CD    1 
ATOM   4103  O  OE1   . GLN D 4  427  ? 22.145  -23.136 1.982   1.00 147.69 ? 427  GLN A OE1   1 
ATOM   4104  N  NE2   . GLN D 4  427  ? 24.262  -23.455 1.309   1.00 144.38 ? 427  GLN A NE2   1 
ATOM   4105  N  N     . TYR D 4  428  ? 22.689  -25.070 6.819   1.00 86.41  ? 428  TYR A N     1 
ATOM   4106  C  CA    . TYR D 4  428  ? 23.171  -25.539 8.114   1.00 86.52  ? 428  TYR A CA    1 
ATOM   4107  C  C     . TYR D 4  428  ? 24.345  -24.694 8.599   1.00 86.15  ? 428  TYR A C     1 
ATOM   4108  O  O     . TYR D 4  428  ? 25.164  -24.211 7.813   1.00 85.68  ? 428  TYR A O     1 
ATOM   4109  C  CB    . TYR D 4  428  ? 23.588  -27.009 8.048   1.00 96.02  ? 428  TYR A CB    1 
ATOM   4110  C  CG    . TYR D 4  428  ? 22.449  -27.991 7.880   1.00 106.83 ? 428  TYR A CG    1 
ATOM   4111  C  CD1   . TYR D 4  428  ? 22.488  -28.965 6.891   1.00 118.17 ? 428  TYR A CD1   1 
ATOM   4112  C  CD2   . TYR D 4  428  ? 21.346  -27.959 8.724   1.00 107.61 ? 428  TYR A CD2   1 
ATOM   4113  C  CE1   . TYR D 4  428  ? 21.455  -29.872 6.740   1.00 123.53 ? 428  TYR A CE1   1 
ATOM   4114  C  CE2   . TYR D 4  428  ? 20.306  -28.861 8.578   1.00 111.73 ? 428  TYR A CE2   1 
ATOM   4115  C  CZ    . TYR D 4  428  ? 20.368  -29.816 7.586   1.00 119.74 ? 428  TYR A CZ    1 
ATOM   4116  O  OH    . TYR D 4  428  ? 19.340  -30.717 7.436   1.00 123.38 ? 428  TYR A OH    1 
ATOM   4117  N  N     . GLY D 4  429  ? 24.405  -24.501 9.913   1.00 85.98  ? 429  GLY A N     1 
ATOM   4118  C  CA    . GLY D 4  429  ? 25.387  -23.626 10.512  1.00 87.46  ? 429  GLY A CA    1 
ATOM   4119  C  C     . GLY D 4  429  ? 24.966  -22.179 10.625  1.00 77.97  ? 429  GLY A C     1 
ATOM   4120  O  O     . GLY D 4  429  ? 25.791  -21.339 11.004  1.00 70.30  ? 429  GLY A O     1 
ATOM   4121  N  N     . TRP D 4  430  ? 23.715  -21.860 10.313  1.00 83.51  ? 430  TRP A N     1 
ATOM   4122  C  CA    . TRP D 4  430  ? 23.212  -20.497 10.356  1.00 87.18  ? 430  TRP A CA    1 
ATOM   4123  C  C     . TRP D 4  430  ? 22.410  -20.268 11.628  1.00 79.12  ? 430  TRP A C     1 
ATOM   4124  O  O     . TRP D 4  430  ? 21.874  -21.199 12.231  1.00 83.60  ? 430  TRP A O     1 
ATOM   4125  C  CB    . TRP D 4  430  ? 22.334  -20.199 9.139   1.00 97.19  ? 430  TRP A CB    1 
ATOM   4126  C  CG    . TRP D 4  430  ? 23.102  -19.928 7.890   1.00 97.44  ? 430  TRP A CG    1 
ATOM   4127  C  CD1   . TRP D 4  430  ? 24.439  -20.114 7.692   1.00 103.24 ? 430  TRP A CD1   1 
ATOM   4128  C  CD2   . TRP D 4  430  ? 22.579  -19.423 6.658   1.00 91.33  ? 430  TRP A CD2   1 
ATOM   4129  N  NE1   . TRP D 4  430  ? 24.781  -19.755 6.411   1.00 103.20 ? 430  TRP A NE1   1 
ATOM   4130  C  CE2   . TRP D 4  430  ? 23.656  -19.327 5.756   1.00 102.75 ? 430  TRP A CE2   1 
ATOM   4131  C  CE3   . TRP D 4  430  ? 21.304  -19.043 6.231   1.00 76.40  ? 430  TRP A CE3   1 
ATOM   4132  C  CZ2   . TRP D 4  430  ? 23.497  -18.865 4.451   1.00 103.33 ? 430  TRP A CZ2   1 
ATOM   4133  C  CZ3   . TRP D 4  430  ? 21.148  -18.585 4.937   1.00 83.83  ? 430  TRP A CZ3   1 
ATOM   4134  C  CH2   . TRP D 4  430  ? 22.238  -18.500 4.062   1.00 95.95  ? 430  TRP A CH2   1 
ATOM   4135  N  N     . LYS D 4  431  ? 22.317  -19.002 12.018  1.00 75.50  ? 431  LYS A N     1 
ATOM   4136  C  CA    . LYS D 4  431  ? 21.607  -18.596 13.220  1.00 76.30  ? 431  LYS A CA    1 
ATOM   4137  C  C     . LYS D 4  431  ? 20.299  -17.922 12.833  1.00 66.46  ? 431  LYS A C     1 
ATOM   4138  O  O     . LYS D 4  431  ? 20.259  -17.110 11.904  1.00 74.25  ? 431  LYS A O     1 
ATOM   4139  C  CB    . LYS D 4  431  ? 22.453  -17.638 14.061  1.00 79.75  ? 431  LYS A CB    1 
ATOM   4140  C  CG    . LYS D 4  431  ? 23.423  -18.327 14.999  1.00 84.43  ? 431  LYS A CG    1 
ATOM   4141  C  CD    . LYS D 4  431  ? 24.535  -17.383 15.417  1.00 88.12  ? 431  LYS A CD    1 
ATOM   4142  C  CE    . LYS D 4  431  ? 25.897  -17.950 15.055  1.00 94.60  ? 431  LYS A CE    1 
ATOM   4143  N  NZ    . LYS D 4  431  ? 26.404  -18.894 16.086  1.00 97.15  ? 431  LYS A NZ    1 
ATOM   4144  N  N     . VAL D 4  432  ? 19.233  -18.268 13.544  1.00 59.26  ? 432  VAL A N     1 
ATOM   4145  C  CA    . VAL D 4  432  ? 17.928  -17.651 13.359  1.00 60.04  ? 432  VAL A CA    1 
ATOM   4146  C  C     . VAL D 4  432  ? 17.539  -17.037 14.693  1.00 61.00  ? 432  VAL A C     1 
ATOM   4147  O  O     . VAL D 4  432  ? 17.290  -17.757 15.670  1.00 75.27  ? 432  VAL A O     1 
ATOM   4148  C  CB    . VAL D 4  432  ? 16.873  -18.655 12.880  1.00 62.41  ? 432  VAL A CB    1 
ATOM   4149  C  CG1   . VAL D 4  432  ? 15.482  -18.050 12.971  1.00 57.09  ? 432  VAL A CG1   1 
ATOM   4150  C  CG2   . VAL D 4  432  ? 17.170  -19.091 11.461  1.00 77.84  ? 432  VAL A CG2   1 
ATOM   4151  N  N     . GLU D 4  433  ? 17.495  -15.707 14.743  1.00 59.14  ? 433  GLU A N     1 
ATOM   4152  C  CA    . GLU D 4  433  ? 17.078  -14.988 15.945  1.00 58.39  ? 433  GLU A CA    1 
ATOM   4153  C  C     . GLU D 4  433  ? 15.556  -15.029 16.022  1.00 62.61  ? 433  GLU A C     1 
ATOM   4154  O  O     . GLU D 4  433  ? 14.854  -14.058 15.733  1.00 76.13  ? 433  GLU A O     1 
ATOM   4155  C  CB    . GLU D 4  433  ? 17.604  -13.562 15.923  1.00 62.66  ? 433  GLU A CB    1 
ATOM   4156  C  CG    . GLU D 4  433  ? 19.091  -13.468 15.680  1.00 65.54  ? 433  GLU A CG    1 
ATOM   4157  C  CD    . GLU D 4  433  ? 19.718  -12.326 16.437  1.00 82.69  ? 433  GLU A CD    1 
ATOM   4158  O  OE1   . GLU D 4  433  ? 18.968  -11.485 16.976  1.00 82.01  ? 433  GLU A OE1   1 
ATOM   4159  O  OE2   . GLU D 4  433  ? 20.963  -12.259 16.488  1.00 85.90  ? 433  GLU A OE2   1 
ATOM   4160  N  N     . ARG D 4  434  ? 15.042  -16.185 16.426  1.00 54.03  ? 434  ARG A N     1 
ATOM   4161  C  CA    . ARG D 4  434  ? 13.607  -16.400 16.449  1.00 61.07  ? 434  ARG A CA    1 
ATOM   4162  C  C     . ARG D 4  434  ? 12.994  -15.747 17.684  1.00 56.11  ? 434  ARG A C     1 
ATOM   4163  O  O     . ARG D 4  434  ? 13.688  -15.333 18.614  1.00 56.02  ? 434  ARG A O     1 
ATOM   4164  C  CB    . ARG D 4  434  ? 13.288  -17.888 16.440  1.00 60.11  ? 434  ARG A CB    1 
ATOM   4165  C  CG    . ARG D 4  434  ? 13.944  -18.646 17.569  1.00 55.23  ? 434  ARG A CG    1 
ATOM   4166  C  CD    . ARG D 4  434  ? 12.904  -19.505 18.247  1.00 56.46  ? 434  ARG A CD    1 
ATOM   4167  N  NE    . ARG D 4  434  ? 13.471  -20.426 19.223  1.00 77.84  ? 434  ARG A NE    1 
ATOM   4168  C  CZ    . ARG D 4  434  ? 13.138  -20.434 20.508  1.00 93.07  ? 434  ARG A CZ    1 
ATOM   4169  N  NH1   . ARG D 4  434  ? 13.697  -21.303 21.338  1.00 88.52  ? 434  ARG A NH1   1 
ATOM   4170  N  NH2   . ARG D 4  434  ? 12.235  -19.576 20.963  1.00 91.18  ? 434  ARG A NH2   1 
ATOM   4171  N  N     . HIS D 4  435  ? 11.667  -15.676 17.693  1.00 63.58  ? 435  HIS A N     1 
ATOM   4172  C  CA    . HIS D 4  435  ? 10.953  -15.069 18.803  1.00 55.12  ? 435  HIS A CA    1 
ATOM   4173  C  C     . HIS D 4  435  ? 11.032  -15.944 20.045  1.00 59.04  ? 435  HIS A C     1 
ATOM   4174  O  O     . HIS D 4  435  ? 11.224  -17.161 19.967  1.00 68.93  ? 435  HIS A O     1 
ATOM   4175  C  CB    . HIS D 4  435  ? 9.488   -14.848 18.436  1.00 70.22  ? 435  HIS A CB    1 
ATOM   4176  C  CG    . HIS D 4  435  ? 9.262   -13.688 17.519  1.00 75.29  ? 435  HIS A CG    1 
ATOM   4177  N  ND1   . HIS D 4  435  ? 8.007   -13.187 17.248  1.00 68.21  ? 435  HIS A ND1   1 
ATOM   4178  C  CD2   . HIS D 4  435  ? 10.132  -12.921 16.821  1.00 73.51  ? 435  HIS A CD2   1 
ATOM   4179  C  CE1   . HIS D 4  435  ? 8.113   -12.171 16.411  1.00 72.47  ? 435  HIS A CE1   1 
ATOM   4180  N  NE2   . HIS D 4  435  ? 9.393   -11.985 16.140  1.00 70.33  ? 435  HIS A NE2   1 
ATOM   4181  N  N     . ILE D 4  436  ? 10.899  -15.301 21.206  1.00 69.51  ? 436  ILE A N     1 
ATOM   4182  C  CA    . ILE D 4  436  ? 10.640  -16.037 22.435  1.00 79.54  ? 436  ILE A CA    1 
ATOM   4183  C  C     . ILE D 4  436  ? 9.290   -16.724 22.295  1.00 75.81  ? 436  ILE A C     1 
ATOM   4184  O  O     . ILE D 4  436  ? 8.292   -16.104 21.905  1.00 69.41  ? 436  ILE A O     1 
ATOM   4185  C  CB    . ILE D 4  436  ? 10.713  -15.098 23.655  1.00 66.74  ? 436  ILE A CB    1 
ATOM   4186  C  CG1   . ILE D 4  436  ? 12.102  -15.118 24.308  1.00 61.14  ? 436  ILE A CG1   1 
ATOM   4187  C  CG2   . ILE D 4  436  ? 9.689   -15.458 24.716  1.00 64.27  ? 436  ILE A CG2   1 
ATOM   4188  C  CD1   . ILE D 4  436  ? 13.264  -14.831 23.402  1.00 59.37  ? 436  ILE A CD1   1 
ATOM   4189  N  N     . MET D 4  437  ? 9.266   -18.024 22.553  1.00 66.14  ? 437  MET A N     1 
ATOM   4190  C  CA    . MET D 4  437  ? 8.089   -18.847 22.333  1.00 63.37  ? 437  MET A CA    1 
ATOM   4191  C  C     . MET D 4  437  ? 7.679   -19.505 23.643  1.00 63.48  ? 437  MET A C     1 
ATOM   4192  O  O     . MET D 4  437  ? 8.315   -19.311 24.679  1.00 65.18  ? 437  MET A O     1 
ATOM   4193  C  CB    . MET D 4  437  ? 8.356   -19.905 21.260  1.00 71.21  ? 437  MET A CB    1 
ATOM   4194  C  CG    . MET D 4  437  ? 7.319   -19.941 20.154  1.00 63.19  ? 437  MET A CG    1 
ATOM   4195  S  SD    . MET D 4  437  ? 7.765   -21.115 18.865  1.00 83.42  ? 437  MET A SD    1 
ATOM   4196  C  CE    . MET D 4  437  ? 9.515   -20.784 18.712  1.00 68.02  ? 437  MET A CE    1 
ATOM   4197  N  N     . ASP D 4  438  ? 6.606   -20.293 23.576  1.00 62.25  ? 438  ASP A N     1 
ATOM   4198  C  CA    . ASP D 4  438  ? 6.114   -21.013 24.743  1.00 53.74  ? 438  ASP A CA    1 
ATOM   4199  C  C     . ASP D 4  438  ? 7.154   -21.993 25.265  1.00 58.66  ? 438  ASP A C     1 
ATOM   4200  O  O     . ASP D 4  438  ? 7.849   -22.656 24.488  1.00 56.28  ? 438  ASP A O     1 
ATOM   4201  C  CB    . ASP D 4  438  ? 4.831   -21.766 24.401  1.00 54.44  ? 438  ASP A CB    1 
ATOM   4202  C  CG    . ASP D 4  438  ? 3.595   -20.921 24.575  1.00 63.94  ? 438  ASP A CG    1 
ATOM   4203  O  OD1   . ASP D 4  438  ? 3.703   -19.680 24.507  1.00 66.42  ? 438  ASP A OD1   1 
ATOM   4204  O  OD2   . ASP D 4  438  ? 2.512   -21.504 24.777  1.00 72.12  ? 438  ASP A OD2   1 
ATOM   4205  N  N     . ASN D 4  439  ? 7.256   -22.061 26.596  1.00 73.73  ? 439  ASN A N     1 
ATOM   4206  C  CA    . ASN D 4  439  ? 8.135   -22.990 27.310  1.00 65.44  ? 439  ASN A CA    1 
ATOM   4207  C  C     . ASN D 4  439  ? 9.599   -22.798 26.926  1.00 71.14  ? 439  ASN A C     1 
ATOM   4208  O  O     . ASN D 4  439  ? 10.349  -23.759 26.749  1.00 86.51  ? 439  ASN A O     1 
ATOM   4209  C  CB    . ASN D 4  439  ? 7.687   -24.439 27.111  1.00 61.17  ? 439  ASN A CB    1 
ATOM   4210  C  CG    . ASN D 4  439  ? 6.276   -24.668 27.596  1.00 78.57  ? 439  ASN A CG    1 
ATOM   4211  O  OD1   . ASN D 4  439  ? 5.630   -23.748 28.103  1.00 80.83  ? 439  ASN A OD1   1 
ATOM   4212  N  ND2   . ASN D 4  439  ? 5.783   -25.886 27.436  1.00 99.34  ? 439  ASN A ND2   1 
ATOM   4213  N  N     . ASP D 4  440  ? 9.986   -21.571 26.779  1.00 67.37  ? 440  ASP A N     1 
ATOM   4214  C  CA    . ASP D 4  440  ? 11.371  -21.139 26.802  1.00 72.39  ? 440  ASP A CA    1 
ATOM   4215  C  C     . ASP D 4  440  ? 11.773  -20.844 28.243  1.00 78.13  ? 440  ASP A C     1 
ATOM   4216  O  O     . ASP D 4  440  ? 10.919  -20.523 29.076  1.00 84.00  ? 440  ASP A O     1 
ATOM   4217  C  CB    . ASP D 4  440  ? 11.559  -19.885 25.953  1.00 85.71  ? 440  ASP A CB    1 
ATOM   4218  C  CG    . ASP D 4  440  ? 11.839  -20.192 24.496  1.00 82.93  ? 440  ASP A CG    1 
ATOM   4219  O  OD1   . ASP D 4  440  ? 10.872  -20.336 23.722  1.00 79.71  ? 440  ASP A OD1   1 
ATOM   4220  O  OD2   . ASP D 4  440  ? 13.025  -20.258 24.117  1.00 80.36  ? 440  ASP A OD2   1 
ATOM   4221  N  N     . PRO D 4  441  ? 13.042  -20.961 28.595  1.00 72.70  ? 441  PRO A N     1 
ATOM   4222  C  CA    . PRO D 4  441  ? 13.454  -20.545 29.942  1.00 55.41  ? 441  PRO A CA    1 
ATOM   4223  C  C     . PRO D 4  441  ? 13.798  -19.065 30.000  1.00 53.43  ? 441  PRO A C     1 
ATOM   4224  O  O     . PRO D 4  441  ? 14.630  -18.593 29.226  1.00 67.06  ? 441  PRO A O     1 
ATOM   4225  C  CB    . PRO D 4  441  ? 14.678  -21.424 30.221  1.00 53.93  ? 441  PRO A CB    1 
ATOM   4226  C  CG    . PRO D 4  441  ? 15.236  -21.736 28.870  1.00 64.90  ? 441  PRO A CG    1 
ATOM   4227  C  CD    . PRO D 4  441  ? 14.097  -21.709 27.886  1.00 67.85  ? 441  PRO A CD    1 
ATOM   4228  N  N     . VAL D 4  442  ? 13.155  -18.314 30.888  1.00 51.08  ? 442  VAL A N     1 
ATOM   4229  C  CA    . VAL D 4  442  ? 13.498  -16.914 31.102  1.00 54.87  ? 442  VAL A CA    1 
ATOM   4230  C  C     . VAL D 4  442  ? 13.659  -16.664 32.592  1.00 53.59  ? 442  VAL A C     1 
ATOM   4231  O  O     . VAL D 4  442  ? 13.017  -17.314 33.422  1.00 50.00  ? 442  VAL A O     1 
ATOM   4232  C  CB    . VAL D 4  442  ? 12.454  -15.940 30.507  1.00 56.87  ? 442  VAL A CB    1 
ATOM   4233  C  CG1   . VAL D 4  442  ? 12.454  -16.015 28.994  1.00 56.26  ? 442  VAL A CG1   1 
ATOM   4234  C  CG2   . VAL D 4  442  ? 11.072  -16.228 31.062  1.00 49.20  ? 442  VAL A CG2   1 
ATOM   4235  N  N     . LEU D 4  443  ? 14.523  -15.715 32.931  1.00 57.05  ? 443  LEU A N     1 
ATOM   4236  C  CA    . LEU D 4  443  ? 14.694  -15.306 34.316  1.00 53.86  ? 443  LEU A CA    1 
ATOM   4237  C  C     . LEU D 4  443  ? 13.701  -14.193 34.625  1.00 55.42  ? 443  LEU A C     1 
ATOM   4238  O  O     . LEU D 4  443  ? 13.603  -13.209 33.886  1.00 79.91  ? 443  LEU A O     1 
ATOM   4239  C  CB    . LEU D 4  443  ? 16.142  -14.861 34.570  1.00 48.76  ? 443  LEU A CB    1 
ATOM   4240  C  CG    . LEU D 4  443  ? 16.840  -14.832 35.936  1.00 51.49  ? 443  LEU A CG    1 
ATOM   4241  C  CD1   . LEU D 4  443  ? 18.243  -14.279 35.792  1.00 49.61  ? 443  LEU A CD1   1 
ATOM   4242  C  CD2   . LEU D 4  443  ? 16.108  -14.004 36.950  1.00 61.08  ? 443  LEU A CD2   1 
ATOM   4243  N  N     . PHE D 4  444  ? 12.978  -14.352 35.726  1.00 52.39  ? 444  PHE A N     1 
ATOM   4244  C  CA    . PHE D 4  444  ? 11.940  -13.424 36.145  1.00 46.92  ? 444  PHE A CA    1 
ATOM   4245  C  C     . PHE D 4  444  ? 12.483  -12.704 37.372  1.00 56.41  ? 444  PHE A C     1 
ATOM   4246  O  O     . PHE D 4  444  ? 13.106  -13.335 38.231  1.00 76.58  ? 444  PHE A O     1 
ATOM   4247  C  CB    . PHE D 4  444  ? 10.665  -14.189 36.501  1.00 47.25  ? 444  PHE A CB    1 
ATOM   4248  C  CG    . PHE D 4  444  ? 9.399   -13.389 36.399  1.00 46.58  ? 444  PHE A CG    1 
ATOM   4249  C  CD1   . PHE D 4  444  ? 9.416   -12.021 36.230  1.00 48.59  ? 444  PHE A CD1   1 
ATOM   4250  C  CD2   . PHE D 4  444  ? 8.175   -14.022 36.528  1.00 46.91  ? 444  PHE A CD2   1 
ATOM   4251  C  CE1   . PHE D 4  444  ? 8.249   -11.315 36.128  1.00 49.55  ? 444  PHE A CE1   1 
ATOM   4252  C  CE2   . PHE D 4  444  ? 7.003   -13.308 36.452  1.00 46.36  ? 444  PHE A CE2   1 
ATOM   4253  C  CZ    . PHE D 4  444  ? 7.040   -11.950 36.254  1.00 45.47  ? 444  PHE A CZ    1 
ATOM   4254  N  N     . ASN D 4  445  ? 12.259  -11.394 37.467  1.00 77.65  ? 445  ASN A N     1 
ATOM   4255  C  CA    . ASN D 4  445  ? 12.927  -10.573 38.468  1.00 77.53  ? 445  ASN A CA    1 
ATOM   4256  C  C     . ASN D 4  445  ? 11.917  -9.631  39.105  1.00 57.48  ? 445  ASN A C     1 
ATOM   4257  O  O     . ASN D 4  445  ? 10.974  -9.190  38.453  1.00 56.10  ? 445  ASN A O     1 
ATOM   4258  C  CB    . ASN D 4  445  ? 14.073  -9.781  37.813  1.00 85.93  ? 445  ASN A CB    1 
ATOM   4259  C  CG    . ASN D 4  445  ? 14.893  -8.948  38.797  1.00 76.08  ? 445  ASN A CG    1 
ATOM   4260  O  OD1   . ASN D 4  445  ? 14.379  -8.160  39.594  1.00 86.59  ? 445  ASN A OD1   1 
ATOM   4261  N  ND2   . ASN D 4  445  ? 16.195  -9.109  38.713  1.00 78.25  ? 445  ASN A ND2   1 
ATOM   4262  N  N     . ARG D 4  446  ? 12.152  -9.298  40.377  1.00 48.86  ? 446  ARG A N     1 
ATOM   4263  C  CA    . ARG D 4  446  ? 11.397  -8.274  41.092  1.00 49.46  ? 446  ARG A CA    1 
ATOM   4264  C  C     . ARG D 4  446  ? 12.357  -7.507  41.988  1.00 57.04  ? 446  ARG A C     1 
ATOM   4265  O  O     . ARG D 4  446  ? 13.245  -8.103  42.603  1.00 60.10  ? 446  ARG A O     1 
ATOM   4266  C  CB    . ARG D 4  446  ? 10.259  -8.881  41.927  1.00 44.01  ? 446  ARG A CB    1 
ATOM   4267  C  CG    . ARG D 4  446  ? 9.770   -8.047  43.105  1.00 43.59  ? 446  ARG A CG    1 
ATOM   4268  C  CD    . ARG D 4  446  ? 8.908   -6.870  42.678  1.00 43.06  ? 446  ARG A CD    1 
ATOM   4269  N  NE    . ARG D 4  446  ? 7.895   -6.544  43.682  1.00 72.75  ? 446  ARG A NE    1 
ATOM   4270  C  CZ    . ARG D 4  446  ? 8.110   -5.792  44.758  1.00 77.61  ? 446  ARG A CZ    1 
ATOM   4271  N  NH1   . ARG D 4  446  ? 9.309   -5.279  44.987  1.00 61.60  ? 446  ARG A NH1   1 
ATOM   4272  N  NH2   . ARG D 4  446  ? 7.124   -5.553  45.611  1.00 80.20  ? 446  ARG A NH2   1 
ATOM   4273  N  N     . GLN D 4  447  ? 12.187  -6.181  42.050  1.00 56.57  ? 447  GLN A N     1 
ATOM   4274  C  CA    . GLN D 4  447  ? 13.080  -5.356  42.843  1.00 59.43  ? 447  GLN A CA    1 
ATOM   4275  C  C     . GLN D 4  447  ? 12.362  -4.793  44.066  1.00 72.65  ? 447  GLN A C     1 
ATOM   4276  O  O     . GLN D 4  447  ? 11.205  -4.371  43.958  1.00 81.42  ? 447  GLN A O     1 
ATOM   4277  C  CB    . GLN D 4  447  ? 13.641  -4.213  41.994  1.00 52.47  ? 447  GLN A CB    1 
ATOM   4278  C  CG    . GLN D 4  447  ? 14.775  -4.689  41.124  1.00 42.54  ? 447  GLN A CG    1 
ATOM   4279  C  CD    . GLN D 4  447  ? 14.850  -3.987  39.794  1.00 54.70  ? 447  GLN A CD    1 
ATOM   4280  O  OE1   . GLN D 4  447  ? 13.887  -3.367  39.347  1.00 59.94  ? 447  GLN A OE1   1 
ATOM   4281  N  NE2   . GLN D 4  447  ? 15.988  -4.123  39.125  1.00 57.66  ? 447  GLN A NE2   1 
ATOM   4282  N  N     . PRO D 4  448  ? 13.015  -4.752  45.242  1.00 60.92  ? 448  PRO A N     1 
ATOM   4283  C  CA    . PRO D 4  448  ? 14.432  -5.010  45.528  1.00 43.01  ? 448  PRO A CA    1 
ATOM   4284  C  C     . PRO D 4  448  ? 14.821  -6.485  45.537  1.00 50.56  ? 448  PRO A C     1 
ATOM   4285  O  O     . PRO D 4  448  ? 14.013  -7.354  45.857  1.00 51.29  ? 448  PRO A O     1 
ATOM   4286  C  CB    . PRO D 4  448  ? 14.622  -4.399  46.925  1.00 44.89  ? 448  PRO A CB    1 
ATOM   4287  C  CG    . PRO D 4  448  ? 13.232  -4.028  47.417  1.00 47.59  ? 448  PRO A CG    1 
ATOM   4288  C  CD    . PRO D 4  448  ? 12.247  -4.643  46.490  1.00 49.92  ? 448  PRO A CD    1 
ATOM   4289  N  N     . SER D 4  449  ? 16.074  -6.748  45.177  1.00 62.03  ? 449  SER A N     1 
ATOM   4290  C  CA    . SER D 4  449  ? 16.553  -8.104  44.944  1.00 57.14  ? 449  SER A CA    1 
ATOM   4291  C  C     . SER D 4  449  ? 17.281  -8.589  46.193  1.00 72.92  ? 449  SER A C     1 
ATOM   4292  O  O     . SER D 4  449  ? 18.509  -8.603  46.274  1.00 88.22  ? 449  SER A O     1 
ATOM   4293  C  CB    . SER D 4  449  ? 17.439  -8.131  43.709  1.00 62.46  ? 449  SER A CB    1 
ATOM   4294  O  OG    . SER D 4  449  ? 16.765  -7.554  42.606  1.00 74.33  ? 449  SER A OG    1 
ATOM   4295  N  N     . LEU D 4  450  ? 16.488  -9.000  47.181  1.00 70.57  ? 450  LEU A N     1 
ATOM   4296  C  CA    . LEU D 4  450  ? 17.023  -9.429  48.466  1.00 59.22  ? 450  LEU A CA    1 
ATOM   4297  C  C     . LEU D 4  450  ? 17.413  -10.903 48.432  1.00 74.61  ? 450  LEU A C     1 
ATOM   4298  O  O     . LEU D 4  450  ? 18.529  -11.268 48.811  1.00 67.55  ? 450  LEU A O     1 
ATOM   4299  C  CB    . LEU D 4  450  ? 15.985  -9.173  49.559  1.00 60.59  ? 450  LEU A CB    1 
ATOM   4300  C  CG    . LEU D 4  450  ? 15.376  -7.764  49.594  1.00 61.45  ? 450  LEU A CG    1 
ATOM   4301  C  CD1   . LEU D 4  450  ? 14.143  -7.722  50.485  1.00 66.13  ? 450  LEU A CD1   1 
ATOM   4302  C  CD2   . LEU D 4  450  ? 16.378  -6.713  50.032  1.00 50.49  ? 450  LEU A CD2   1 
ATOM   4303  N  N     . HIS D 4  451  ? 16.503  -11.756 47.974  1.00 88.39  ? 451  HIS A N     1 
ATOM   4304  C  CA    . HIS D 4  451  ? 16.673  -13.201 47.930  1.00 75.89  ? 451  HIS A CA    1 
ATOM   4305  C  C     . HIS D 4  451  ? 17.326  -13.676 46.643  1.00 86.59  ? 451  HIS A C     1 
ATOM   4306  O  O     . HIS D 4  451  ? 17.275  -13.013 45.611  1.00 92.70  ? 451  HIS A O     1 
ATOM   4307  C  CB    . HIS D 4  451  ? 15.329  -13.910 48.016  1.00 78.37  ? 451  HIS A CB    1 
ATOM   4308  C  CG    . HIS D 4  451  ? 14.689  -13.870 49.356  1.00 86.18  ? 451  HIS A CG    1 
ATOM   4309  N  ND1   . HIS D 4  451  ? 13.323  -13.812 49.520  1.00 84.63  ? 451  HIS A ND1   1 
ATOM   4310  C  CD2   . HIS D 4  451  ? 15.220  -13.923 50.596  1.00 88.32  ? 451  HIS A CD2   1 
ATOM   4311  C  CE1   . HIS D 4  451  ? 13.041  -13.819 50.809  1.00 93.18  ? 451  HIS A CE1   1 
ATOM   4312  N  NE2   . HIS D 4  451  ? 14.174  -13.894 51.483  1.00 98.02  ? 451  HIS A NE2   1 
ATOM   4313  N  N     . LYS D 4  452  ? 17.869  -14.896 46.696  1.00 78.30  ? 452  LYS A N     1 
ATOM   4314  C  CA    . LYS D 4  452  ? 18.003  -15.668 45.467  1.00 69.16  ? 452  LYS A CA    1 
ATOM   4315  C  C     . LYS D 4  452  ? 16.634  -15.999 44.881  1.00 60.18  ? 452  LYS A C     1 
ATOM   4316  O  O     . LYS D 4  452  ? 16.475  -16.039 43.657  1.00 55.46  ? 452  LYS A O     1 
ATOM   4317  C  CB    . LYS D 4  452  ? 18.807  -16.948 45.718  1.00 67.42  ? 452  LYS A CB    1 
ATOM   4318  C  CG    . LYS D 4  452  ? 18.222  -17.878 46.777  1.00 65.97  ? 452  LYS A CG    1 
ATOM   4319  C  CD    . LYS D 4  452  ? 18.609  -19.335 46.553  1.00 71.01  ? 452  LYS A CD    1 
ATOM   4320  C  CE    . LYS D 4  452  ? 20.083  -19.511 46.265  1.00 67.98  ? 452  LYS A CE    1 
ATOM   4321  N  NZ    . LYS D 4  452  ? 20.598  -20.816 46.758  1.00 54.57  ? 452  LYS A NZ    1 
ATOM   4322  N  N     . MET D 4  453  ? 15.625  -16.175 45.737  1.00 49.83  ? 453  MET A N     1 
ATOM   4323  C  CA    . MET D 4  453  ? 14.251  -16.470 45.348  1.00 56.61  ? 453  MET A CA    1 
ATOM   4324  C  C     . MET D 4  453  ? 13.508  -15.238 44.839  1.00 58.24  ? 453  MET A C     1 
ATOM   4325  O  O     . MET D 4  453  ? 12.273  -15.235 44.779  1.00 54.31  ? 453  MET A O     1 
ATOM   4326  C  CB    . MET D 4  453  ? 13.499  -17.066 46.537  1.00 50.69  ? 453  MET A CB    1 
ATOM   4327  C  CG    . MET D 4  453  ? 14.247  -18.187 47.238  1.00 74.31  ? 453  MET A CG    1 
ATOM   4328  S  SD    . MET D 4  453  ? 14.940  -17.669 48.819  1.00 91.49  ? 453  MET A SD    1 
ATOM   4329  C  CE    . MET D 4  453  ? 13.450  -17.401 49.776  1.00 95.24  ? 453  MET A CE    1 
ATOM   4330  N  N     . SER D 4  454  ? 14.238  -14.177 44.506  1.00 61.99  ? 454  SER A N     1 
ATOM   4331  C  CA    . SER D 4  454  ? 13.680  -13.024 43.816  1.00 67.69  ? 454  SER A CA    1 
ATOM   4332  C  C     . SER D 4  454  ? 14.162  -12.930 42.378  1.00 61.12  ? 454  SER A C     1 
ATOM   4333  O  O     . SER D 4  454  ? 13.783  -11.992 41.671  1.00 64.61  ? 454  SER A O     1 
ATOM   4334  C  CB    . SER D 4  454  ? 14.023  -11.731 44.563  1.00 65.28  ? 454  SER A CB    1 
ATOM   4335  O  OG    . SER D 4  454  ? 13.151  -11.529 45.659  1.00 57.25  ? 454  SER A OG    1 
ATOM   4336  N  N     . MET D 4  455  ? 15.001  -13.872 41.931  1.00 50.47  ? 455  MET A N     1 
ATOM   4337  C  CA    . MET D 4  455  ? 15.484  -13.923 40.561  1.00 53.44  ? 455  MET A CA    1 
ATOM   4338  C  C     . MET D 4  455  ? 15.451  -15.384 40.100  1.00 73.54  ? 455  MET A C     1 
ATOM   4339  O  O     . MET D 4  455  ? 16.477  -16.018 39.859  1.00 90.45  ? 455  MET A O     1 
ATOM   4340  C  CB    . MET D 4  455  ? 16.887  -13.325 40.435  1.00 47.76  ? 455  MET A CB    1 
ATOM   4341  C  CG    . MET D 4  455  ? 16.945  -11.827 40.658  1.00 67.52  ? 455  MET A CG    1 
ATOM   4342  S  SD    . MET D 4  455  ? 17.921  -10.954 39.426  1.00 79.31  ? 455  MET A SD    1 
ATOM   4343  C  CE    . MET D 4  455  ? 19.153  -12.177 39.041  1.00 67.80  ? 455  MET A CE    1 
ATOM   4344  N  N     . MET D 4  456  ? 14.245  -15.923 39.963  1.00 70.06  ? 456  MET A N     1 
ATOM   4345  C  CA    . MET D 4  456  ? 14.037  -17.317 39.603  1.00 65.06  ? 456  MET A CA    1 
ATOM   4346  C  C     . MET D 4  456  ? 13.686  -17.457 38.127  1.00 82.30  ? 456  MET A C     1 
ATOM   4347  O  O     . MET D 4  456  ? 13.146  -16.540 37.505  1.00 78.09  ? 456  MET A O     1 
ATOM   4348  C  CB    . MET D 4  456  ? 12.926  -17.929 40.455  1.00 52.78  ? 456  MET A CB    1 
ATOM   4349  C  CG    . MET D 4  456  ? 13.092  -17.692 41.939  1.00 50.65  ? 456  MET A CG    1 
ATOM   4350  S  SD    . MET D 4  456  ? 11.970  -18.716 42.897  1.00 55.84  ? 456  MET A SD    1 
ATOM   4351  C  CE    . MET D 4  456  ? 10.500  -17.709 42.784  1.00 49.94  ? 456  MET A CE    1 
ATOM   4352  N  N     . ALA D 4  457  ? 13.992  -18.629 37.575  1.00 92.86  ? 457  ALA A N     1 
ATOM   4353  C  CA    . ALA D 4  457  ? 13.680  -18.937 36.188  1.00 64.70  ? 457  ALA A CA    1 
ATOM   4354  C  C     . ALA D 4  457  ? 12.214  -19.315 36.033  1.00 68.93  ? 457  ALA A C     1 
ATOM   4355  O  O     . ALA D 4  457  ? 11.561  -19.767 36.973  1.00 65.27  ? 457  ALA A O     1 
ATOM   4356  C  CB    . ALA D 4  457  ? 14.541  -20.083 35.675  1.00 52.22  ? 457  ALA A CB    1 
ATOM   4357  N  N     . HIS D 4  458  ? 11.707  -19.160 34.814  1.00 67.26  ? 458  HIS A N     1 
ATOM   4358  C  CA    . HIS D 4  458  ? 10.318  -19.472 34.525  1.00 60.42  ? 458  HIS A CA    1 
ATOM   4359  C  C     . HIS D 4  458  ? 10.198  -20.094 33.140  1.00 78.65  ? 458  HIS A C     1 
ATOM   4360  O  O     . HIS D 4  458  ? 11.136  -20.085 32.337  1.00 82.73  ? 458  HIS A O     1 
ATOM   4361  C  CB    . HIS D 4  458  ? 9.429   -18.227 34.599  1.00 53.96  ? 458  HIS A CB    1 
ATOM   4362  C  CG    . HIS D 4  458  ? 8.926   -17.907 35.971  1.00 56.14  ? 458  HIS A CG    1 
ATOM   4363  N  ND1   . HIS D 4  458  ? 7.595   -18.008 36.314  1.00 56.82  ? 458  HIS A ND1   1 
ATOM   4364  C  CD2   . HIS D 4  458  ? 9.562   -17.438 37.070  1.00 49.46  ? 458  HIS A CD2   1 
ATOM   4365  C  CE1   . HIS D 4  458  ? 7.438   -17.643 37.574  1.00 49.48  ? 458  HIS A CE1   1 
ATOM   4366  N  NE2   . HIS D 4  458  ? 8.616   -17.288 38.054  1.00 49.27  ? 458  HIS A NE2   1 
ATOM   4367  N  N     . ARG D 4  459  ? 9.016   -20.642 32.878  1.00 72.19  ? 459  ARG A N     1 
ATOM   4368  C  CA    . ARG D 4  459  ? 8.608   -21.095 31.559  1.00 52.69  ? 459  ARG A CA    1 
ATOM   4369  C  C     . ARG D 4  459  ? 7.748   -20.026 30.904  1.00 51.83  ? 459  ARG A C     1 
ATOM   4370  O  O     . ARG D 4  459  ? 6.858   -19.458 31.540  1.00 57.18  ? 459  ARG A O     1 
ATOM   4371  C  CB    . ARG D 4  459  ? 7.818   -22.403 31.651  1.00 56.33  ? 459  ARG A CB    1 
ATOM   4372  C  CG    . ARG D 4  459  ? 8.654   -23.665 31.745  1.00 57.07  ? 459  ARG A CG    1 
ATOM   4373  C  CD    . ARG D 4  459  ? 7.877   -24.762 32.451  1.00 55.77  ? 459  ARG A CD    1 
ATOM   4374  N  NE    . ARG D 4  459  ? 6.880   -25.409 31.605  1.00 63.00  ? 459  ARG A NE    1 
ATOM   4375  C  CZ    . ARG D 4  459  ? 5.600   -25.545 31.940  1.00 62.44  ? 459  ARG A CZ    1 
ATOM   4376  N  NH1   . ARG D 4  459  ? 5.167   -25.079 33.103  1.00 56.45  ? 459  ARG A NH1   1 
ATOM   4377  N  NH2   . ARG D 4  459  ? 4.752   -26.149 31.119  1.00 67.29  ? 459  ARG A NH2   1 
ATOM   4378  N  N     . VAL D 4  460  ? 8.009   -19.756 29.638  1.00 57.83  ? 460  VAL A N     1 
ATOM   4379  C  CA    . VAL D 4  460  ? 7.259   -18.731 28.926  1.00 51.06  ? 460  VAL A CA    1 
ATOM   4380  C  C     . VAL D 4  460  ? 5.894   -19.274 28.532  1.00 51.51  ? 460  VAL A C     1 
ATOM   4381  O  O     . VAL D 4  460  ? 5.768   -20.404 28.048  1.00 52.51  ? 460  VAL A O     1 
ATOM   4382  C  CB    . VAL D 4  460  ? 8.037   -18.249 27.693  1.00 52.17  ? 460  VAL A CB    1 
ATOM   4383  C  CG1   . VAL D 4  460  ? 7.284   -17.138 26.984  1.00 56.57  ? 460  VAL A CG1   1 
ATOM   4384  C  CG2   . VAL D 4  460  ? 9.398   -17.776 28.096  1.00 50.63  ? 460  VAL A CG2   1 
ATOM   4385  N  N     . LYS D 4  461  ? 4.864   -18.465 28.752  1.00 50.80  ? 461  LYS A N     1 
ATOM   4386  C  CA    . LYS D 4  461  ? 3.514   -18.744 28.274  1.00 51.11  ? 461  LYS A CA    1 
ATOM   4387  C  C     . LYS D 4  461  ? 3.022   -17.451 27.630  1.00 62.65  ? 461  LYS A C     1 
ATOM   4388  O  O     . LYS D 4  461  ? 2.581   -16.534 28.331  1.00 78.58  ? 461  LYS A O     1 
ATOM   4389  C  CB    . LYS D 4  461  ? 2.610   -19.192 29.413  1.00 51.32  ? 461  LYS A CB    1 
ATOM   4390  C  CG    . LYS D 4  461  ? 1.151   -19.384 29.047  1.00 51.61  ? 461  LYS A CG    1 
ATOM   4391  C  CD    . LYS D 4  461  ? 0.909   -20.742 28.422  1.00 70.15  ? 461  LYS A CD    1 
ATOM   4392  C  CE    . LYS D 4  461  ? -0.057  -20.653 27.258  1.00 86.73  ? 461  LYS A CE    1 
ATOM   4393  N  NZ    . LYS D 4  461  ? 0.638   -20.719 25.950  1.00 82.10  ? 461  LYS A NZ    1 
ATOM   4394  N  N     . VAL D 4  462  ? 3.117   -17.374 26.304  1.00 75.27  ? 462  VAL A N     1 
ATOM   4395  C  CA    . VAL D 4  462  ? 2.784   -16.145 25.591  1.00 62.38  ? 462  VAL A CA    1 
ATOM   4396  C  C     . VAL D 4  462  ? 1.277   -15.919 25.654  1.00 52.71  ? 462  VAL A C     1 
ATOM   4397  O  O     . VAL D 4  462  ? 0.490   -16.771 25.228  1.00 56.04  ? 462  VAL A O     1 
ATOM   4398  C  CB    . VAL D 4  462  ? 3.285   -16.199 24.143  1.00 50.00  ? 462  VAL A CB    1 
ATOM   4399  C  CG1   . VAL D 4  462  ? 2.783   -15.001 23.372  1.00 49.32  ? 462  VAL A CG1   1 
ATOM   4400  C  CG2   . VAL D 4  462  ? 4.802   -16.256 24.112  1.00 50.07  ? 462  VAL A CG2   1 
ATOM   4401  N  N     . ILE D 4  463  ? 0.875   -14.769 26.191  1.00 48.91  ? 463  ILE A N     1 
ATOM   4402  C  CA    . ILE D 4  463  ? -0.525  -14.470 26.488  1.00 53.89  ? 463  ILE A CA    1 
ATOM   4403  C  C     . ILE D 4  463  ? -0.939  -13.194 25.755  1.00 57.48  ? 463  ILE A C     1 
ATOM   4404  O  O     . ILE D 4  463  ? -0.065  -12.465 25.262  1.00 60.82  ? 463  ILE A O     1 
ATOM   4405  C  CB    . ILE D 4  463  ? -0.743  -14.397 28.012  1.00 55.41  ? 463  ILE A CB    1 
ATOM   4406  C  CG1   . ILE D 4  463  ? 0.317   -13.543 28.716  1.00 66.09  ? 463  ILE A CG1   1 
ATOM   4407  C  CG2   . ILE D 4  463  ? -0.759  -15.794 28.601  1.00 73.05  ? 463  ILE A CG2   1 
ATOM   4408  C  CD1   . ILE D 4  463  ? 0.075   -12.044 28.743  1.00 80.39  ? 463  ILE A CD1   1 
ATOM   4409  N  N     . PRO D 4  464  ? -2.247  -12.878 25.631  1.00 48.86  ? 464  PRO A N     1 
ATOM   4410  C  CA    . PRO D 4  464  ? -2.627  -11.763 24.757  1.00 70.89  ? 464  PRO A CA    1 
ATOM   4411  C  C     . PRO D 4  464  ? -3.010  -10.450 25.427  1.00 82.50  ? 464  PRO A C     1 
ATOM   4412  O  O     . PRO D 4  464  ? -3.839  -9.730  24.864  1.00 122.73 ? 464  PRO A O     1 
ATOM   4413  C  CB    . PRO D 4  464  ? -3.840  -12.340 24.028  1.00 84.23  ? 464  PRO A CB    1 
ATOM   4414  C  CG    . PRO D 4  464  ? -4.528  -13.013 25.149  1.00 70.04  ? 464  PRO A CG    1 
ATOM   4415  C  CD    . PRO D 4  464  ? -3.397  -13.794 25.784  1.00 62.49  ? 464  PRO A CD    1 
ATOM   4416  N  N     . TYR D 4  465  ? -2.469  -10.103 26.591  1.00 48.13  ? 465  TYR A N     1 
ATOM   4417  C  CA    . TYR D 4  465  ? -2.705  -8.734  27.041  1.00 47.78  ? 465  TYR A CA    1 
ATOM   4418  C  C     . TYR D 4  465  ? -1.396  -8.054  27.419  1.00 53.65  ? 465  TYR A C     1 
ATOM   4419  O  O     . TYR D 4  465  ? -0.326  -8.558  27.084  1.00 65.27  ? 465  TYR A O     1 
ATOM   4420  C  CB    . TYR D 4  465  ? -3.693  -8.688  28.203  1.00 55.93  ? 465  TYR A CB    1 
ATOM   4421  C  CG    . TYR D 4  465  ? -5.138  -8.789  27.767  1.00 58.41  ? 465  TYR A CG    1 
ATOM   4422  C  CD1   . TYR D 4  465  ? -5.689  -10.004 27.385  1.00 58.10  ? 465  TYR A CD1   1 
ATOM   4423  C  CD2   . TYR D 4  465  ? -5.933  -7.655  27.683  1.00 56.85  ? 465  TYR A CD2   1 
ATOM   4424  C  CE1   . TYR D 4  465  ? -6.998  -10.095 26.973  1.00 64.64  ? 465  TYR A CE1   1 
ATOM   4425  C  CE2   . TYR D 4  465  ? -7.245  -7.737  27.277  1.00 53.35  ? 465  TYR A CE2   1 
ATOM   4426  C  CZ    . TYR D 4  465  ? -7.771  -8.959  26.921  1.00 59.36  ? 465  TYR A CZ    1 
ATOM   4427  O  OH    . TYR D 4  465  ? -9.079  -9.048  26.510  1.00 71.83  ? 465  TYR A OH    1 
ATOM   4428  N  N     . SER D 4  466  ? -1.465  -6.916  28.106  1.00 52.17  ? 466  SER A N     1 
ATOM   4429  C  CA    . SER D 4  466  ? -0.298  -6.074  28.329  1.00 66.24  ? 466  SER A CA    1 
ATOM   4430  C  C     . SER D 4  466  ? 0.512   -6.438  29.565  1.00 79.91  ? 466  SER A C     1 
ATOM   4431  O  O     . SER D 4  466  ? 1.651   -5.981  29.687  1.00 67.16  ? 466  SER A O     1 
ATOM   4432  C  CB    . SER D 4  466  ? -0.728  -4.608  28.434  1.00 73.67  ? 466  SER A CB    1 
ATOM   4433  O  OG    . SER D 4  466  ? -1.678  -4.292  27.435  1.00 92.91  ? 466  SER A OG    1 
ATOM   4434  N  N     . THR D 4  467  ? -0.025  -7.242  30.473  1.00 81.61  ? 467  THR A N     1 
ATOM   4435  C  CA    . THR D 4  467  ? 0.601   -7.466  31.767  1.00 49.81  ? 467  THR A CA    1 
ATOM   4436  C  C     . THR D 4  467  ? 1.477   -8.712  31.772  1.00 64.51  ? 467  THR A C     1 
ATOM   4437  O  O     . THR D 4  467  ? 1.405   -9.572  30.891  1.00 61.80  ? 467  THR A O     1 
ATOM   4438  C  CB    . THR D 4  467  ? -0.466  -7.579  32.856  1.00 43.06  ? 467  THR A CB    1 
ATOM   4439  O  OG1   . THR D 4  467  ? -1.450  -8.544  32.461  1.00 62.30  ? 467  THR A OG1   1 
ATOM   4440  C  CG2   . THR D 4  467  ? -1.132  -6.246  33.078  1.00 42.36  ? 467  THR A CG2   1 
ATOM   4441  N  N     . PHE D 4  468  ? 2.327   -8.789  32.794  1.00 53.51  ? 468  PHE A N     1 
ATOM   4442  C  CA    . PHE D 4  468  ? 3.041   -10.007 33.136  1.00 45.01  ? 468  PHE A CA    1 
ATOM   4443  C  C     . PHE D 4  468  ? 2.150   -10.835 34.051  1.00 52.36  ? 468  PHE A C     1 
ATOM   4444  O  O     . PHE D 4  468  ? 1.629   -10.318 35.043  1.00 66.88  ? 468  PHE A O     1 
ATOM   4445  C  CB    . PHE D 4  468  ? 4.359   -9.681  33.836  1.00 44.08  ? 468  PHE A CB    1 
ATOM   4446  C  CG    . PHE D 4  468  ? 5.525   -9.563  32.910  1.00 44.11  ? 468  PHE A CG    1 
ATOM   4447  C  CD1   . PHE D 4  468  ? 6.516   -8.626  33.145  1.00 54.19  ? 468  PHE A CD1   1 
ATOM   4448  C  CD2   . PHE D 4  468  ? 5.630   -10.383 31.802  1.00 45.24  ? 468  PHE A CD2   1 
ATOM   4449  C  CE1   . PHE D 4  468  ? 7.594   -8.509  32.290  1.00 48.30  ? 468  PHE A CE1   1 
ATOM   4450  C  CE2   . PHE D 4  468  ? 6.704   -10.272 30.945  1.00 49.68  ? 468  PHE A CE2   1 
ATOM   4451  C  CZ    . PHE D 4  468  ? 7.687   -9.334  31.189  1.00 44.29  ? 468  PHE A CZ    1 
ATOM   4452  N  N     . ARG D 4  469  ? 1.959   -12.104 33.714  1.00 45.66  ? 469  ARG A N     1 
ATOM   4453  C  CA    . ARG D 4  469  ? 1.139   -12.991 34.522  1.00 66.45  ? 469  ARG A CA    1 
ATOM   4454  C  C     . ARG D 4  469  ? 2.004   -14.046 35.191  1.00 67.91  ? 469  ARG A C     1 
ATOM   4455  O  O     . ARG D 4  469  ? 2.973   -14.537 34.606  1.00 62.19  ? 469  ARG A O     1 
ATOM   4456  C  CB    . ARG D 4  469  ? 0.037   -13.649 33.691  1.00 69.06  ? 469  ARG A CB    1 
ATOM   4457  C  CG    . ARG D 4  469  ? -0.247  -12.970 32.369  1.00 46.48  ? 469  ARG A CG    1 
ATOM   4458  C  CD    . ARG D 4  469  ? -1.280  -11.887 32.568  1.00 45.83  ? 469  ARG A CD    1 
ATOM   4459  N  NE    . ARG D 4  469  ? -2.524  -12.418 33.108  1.00 46.30  ? 469  ARG A NE    1 
ATOM   4460  C  CZ    . ARG D 4  469  ? -3.520  -11.662 33.556  1.00 45.90  ? 469  ARG A CZ    1 
ATOM   4461  N  NH1   . ARG D 4  469  ? -3.411  -10.343 33.535  1.00 45.02  ? 469  ARG A NH1   1 
ATOM   4462  N  NH2   . ARG D 4  469  ? -4.620  -12.224 34.035  1.00 54.81  ? 469  ARG A NH2   1 
ATOM   4463  N  N     . LEU D 4  470  ? 1.646   -14.375 36.427  1.00 60.78  ? 470  LEU A N     1 
ATOM   4464  C  CA    . LEU D 4  470  ? 2.360   -15.367 37.210  1.00 58.75  ? 470  LEU A CA    1 
ATOM   4465  C  C     . LEU D 4  470  ? 1.381   -16.028 38.162  1.00 55.50  ? 470  LEU A C     1 
ATOM   4466  O  O     . LEU D 4  470  ? 0.293   -15.507 38.420  1.00 48.10  ? 470  LEU A O     1 
ATOM   4467  C  CB    . LEU D 4  470  ? 3.542   -14.743 37.963  1.00 51.51  ? 470  LEU A CB    1 
ATOM   4468  C  CG    . LEU D 4  470  ? 3.452   -13.355 38.616  1.00 46.36  ? 470  LEU A CG    1 
ATOM   4469  C  CD1   . LEU D 4  470  ? 2.422   -13.228 39.724  1.00 48.47  ? 470  LEU A CD1   1 
ATOM   4470  C  CD2   . LEU D 4  470  ? 4.802   -13.009 39.169  1.00 46.12  ? 470  LEU A CD2   1 
ATOM   4471  N  N     . ASN D 4  471  ? 1.787   -17.176 38.692  1.00 49.24  ? 471  ASN A N     1 
ATOM   4472  C  CA    . ASN D 4  471  ? 0.933   -17.870 39.636  1.00 50.32  ? 471  ASN A CA    1 
ATOM   4473  C  C     . ASN D 4  471  ? 0.840   -17.089 40.941  1.00 62.57  ? 471  ASN A C     1 
ATOM   4474  O  O     . ASN D 4  471  ? 1.689   -16.260 41.274  1.00 86.17  ? 471  ASN A O     1 
ATOM   4475  C  CB    . ASN D 4  471  ? 1.445   -19.283 39.909  1.00 51.00  ? 471  ASN A CB    1 
ATOM   4476  C  CG    . ASN D 4  471  ? 0.381   -20.179 40.520  1.00 51.89  ? 471  ASN A CG    1 
ATOM   4477  O  OD1   . ASN D 4  471  ? -0.705  -19.716 40.869  1.00 52.33  ? 471  ASN A OD1   1 
ATOM   4478  N  ND2   . ASN D 4  471  ? 0.687   -21.460 40.653  1.00 52.97  ? 471  ASN A ND2   1 
ATOM   4479  N  N     . LEU D 4  472  ? -0.229  -17.370 41.674  1.00 54.09  ? 472  LEU A N     1 
ATOM   4480  C  CA    . LEU D 4  472  ? -0.514  -16.652 42.904  1.00 53.46  ? 472  LEU A CA    1 
ATOM   4481  C  C     . LEU D 4  472  ? 0.473   -17.024 43.995  1.00 57.64  ? 472  LEU A C     1 
ATOM   4482  O  O     . LEU D 4  472  ? 0.888   -16.175 44.791  1.00 49.11  ? 472  LEU A O     1 
ATOM   4483  C  CB    . LEU D 4  472  ? -1.925  -16.991 43.339  1.00 54.47  ? 472  LEU A CB    1 
ATOM   4484  C  CG    . LEU D 4  472  ? -2.809  -15.900 43.873  1.00 49.29  ? 472  LEU A CG    1 
ATOM   4485  C  CD1   . LEU D 4  472  ? -2.516  -14.626 43.121  1.00 48.19  ? 472  LEU A CD1   1 
ATOM   4486  C  CD2   . LEU D 4  472  ? -4.138  -16.438 43.512  1.00 53.59  ? 472  LEU A CD2   1 
ATOM   4487  N  N     . SER D 4  473  ? 0.861   -18.293 44.036  1.00 66.23  ? 473  SER A N     1 
ATOM   4488  C  CA    . SER D 4  473  ? 1.718   -18.838 45.073  1.00 61.38  ? 473  SER A CA    1 
ATOM   4489  C  C     . SER D 4  473  ? 3.192   -18.610 44.798  1.00 61.43  ? 473  SER A C     1 
ATOM   4490  O  O     . SER D 4  473  ? 4.027   -19.331 45.345  1.00 78.24  ? 473  SER A O     1 
ATOM   4491  C  CB    . SER D 4  473  ? 1.436   -20.330 45.240  1.00 75.54  ? 473  SER A CB    1 
ATOM   4492  O  OG    . SER D 4  473  ? 0.202   -20.537 45.903  1.00 94.46  ? 473  SER A OG    1 
ATOM   4493  N  N     . VAL D 4  474  ? 3.535   -17.639 43.954  1.00 49.91  ? 474  VAL A N     1 
ATOM   4494  C  CA    . VAL D 4  474  ? 4.916   -17.232 43.750  1.00 49.53  ? 474  VAL A CA    1 
ATOM   4495  C  C     . VAL D 4  474  ? 5.135   -15.779 44.158  1.00 59.69  ? 474  VAL A C     1 
ATOM   4496  O  O     . VAL D 4  474  ? 6.237   -15.249 44.013  1.00 68.82  ? 474  VAL A O     1 
ATOM   4497  C  CB    . VAL D 4  474  ? 5.356   -17.497 42.293  1.00 49.55  ? 474  VAL A CB    1 
ATOM   4498  C  CG1   . VAL D 4  474  ? 4.928   -16.374 41.350  1.00 48.63  ? 474  VAL A CG1   1 
ATOM   4499  C  CG2   . VAL D 4  474  ? 6.852   -17.797 42.205  1.00 58.75  ? 474  VAL A CG2   1 
ATOM   4500  N  N     . THR D 4  475  ? 4.108   -15.139 44.721  1.00 54.39  ? 475  THR A N     1 
ATOM   4501  C  CA    . THR D 4  475  ? 4.233   -13.752 45.148  1.00 59.35  ? 475  THR A CA    1 
ATOM   4502  C  C     . THR D 4  475  ? 5.155   -13.610 46.352  1.00 68.55  ? 475  THR A C     1 
ATOM   4503  O  O     . THR D 4  475  ? 5.965   -12.679 46.403  1.00 86.78  ? 475  THR A O     1 
ATOM   4504  C  CB    . THR D 4  475  ? 2.859   -13.181 45.480  1.00 58.77  ? 475  THR A CB    1 
ATOM   4505  O  OG1   . THR D 4  475  ? 2.186   -14.057 46.395  1.00 58.15  ? 475  THR A OG1   1 
ATOM   4506  C  CG2   . THR D 4  475  ? 2.031   -13.041 44.221  1.00 56.79  ? 475  THR A CG2   1 
ATOM   4507  N  N     . SER D 4  476  ? 5.048   -14.521 47.321  1.00 48.46  ? 476  SER A N     1 
ATOM   4508  C  CA    . SER D 4  476  ? 5.742   -14.344 48.597  1.00 57.00  ? 476  SER A CA    1 
ATOM   4509  C  C     . SER D 4  476  ? 7.268   -14.304 48.504  1.00 53.33  ? 476  SER A C     1 
ATOM   4510  O  O     . SER D 4  476  ? 7.864   -13.447 49.180  1.00 71.13  ? 476  SER A O     1 
ATOM   4511  C  CB    . SER D 4  476  ? 5.292   -15.426 49.588  1.00 78.24  ? 476  SER A CB    1 
ATOM   4512  O  OG    . SER D 4  476  ? 3.881   -15.513 49.633  1.00 100.72 ? 476  SER A OG    1 
ATOM   4513  N  N     . PRO D 4  477  ? 7.963   -15.160 47.735  1.00 48.61  ? 477  PRO A N     1 
ATOM   4514  C  CA    . PRO D 4  477  ? 9.413   -14.949 47.601  1.00 48.50  ? 477  PRO A CA    1 
ATOM   4515  C  C     . PRO D 4  477  ? 9.752   -13.702 46.815  1.00 47.53  ? 477  PRO A C     1 
ATOM   4516  O  O     . PRO D 4  477  ? 10.799  -13.092 47.059  1.00 69.28  ? 477  PRO A O     1 
ATOM   4517  C  CB    . PRO D 4  477  ? 9.888   -16.217 46.882  1.00 49.31  ? 477  PRO A CB    1 
ATOM   4518  C  CG    . PRO D 4  477  ? 8.704   -16.666 46.134  1.00 50.33  ? 477  PRO A CG    1 
ATOM   4519  C  CD    . PRO D 4  477  ? 7.577   -16.427 47.083  1.00 49.40  ? 477  PRO A CD    1 
ATOM   4520  N  N     . TYR D 4  478  ? 8.894   -13.303 45.882  1.00 64.44  ? 478  TYR A N     1 
ATOM   4521  C  CA    . TYR D 4  478  ? 9.090   -12.057 45.163  1.00 69.14  ? 478  TYR A CA    1 
ATOM   4522  C  C     . TYR D 4  478  ? 8.668   -10.848 45.986  1.00 54.51  ? 478  TYR A C     1 
ATOM   4523  O  O     . TYR D 4  478  ? 9.136   -9.741  45.710  1.00 44.82  ? 478  TYR A O     1 
ATOM   4524  C  CB    . TYR D 4  478  ? 8.310   -12.097 43.847  1.00 53.33  ? 478  TYR A CB    1 
ATOM   4525  C  CG    . TYR D 4  478  ? 8.992   -12.892 42.757  1.00 46.41  ? 478  TYR A CG    1 
ATOM   4526  C  CD1   . TYR D 4  478  ? 8.314   -13.888 42.068  1.00 46.98  ? 478  TYR A CD1   1 
ATOM   4527  C  CD2   . TYR D 4  478  ? 10.309  -12.637 42.409  1.00 46.74  ? 478  TYR A CD2   1 
ATOM   4528  C  CE1   . TYR D 4  478  ? 8.933   -14.615 41.073  1.00 47.45  ? 478  TYR A CE1   1 
ATOM   4529  C  CE2   . TYR D 4  478  ? 10.931  -13.354 41.415  1.00 55.68  ? 478  TYR A CE2   1 
ATOM   4530  C  CZ    . TYR D 4  478  ? 10.243  -14.340 40.751  1.00 54.46  ? 478  TYR A CZ    1 
ATOM   4531  O  OH    . TYR D 4  478  ? 10.880  -15.048 39.762  1.00 56.47  ? 478  TYR A OH    1 
ATOM   4532  N  N     . ASN D 4  479  ? 7.836   -11.058 47.015  1.00 67.66  ? 479  ASN A N     1 
ATOM   4533  C  CA    . ASN D 4  479  ? 7.141   -9.992  47.748  1.00 72.86  ? 479  ASN A CA    1 
ATOM   4534  C  C     . ASN D 4  479  ? 6.399   -9.077  46.780  1.00 63.68  ? 479  ASN A C     1 
ATOM   4535  O  O     . ASN D 4  479  ? 6.457   -7.848  46.866  1.00 57.75  ? 479  ASN A O     1 
ATOM   4536  C  CB    . ASN D 4  479  ? 8.088   -9.200  48.653  1.00 69.66  ? 479  ASN A CB    1 
ATOM   4537  C  CG    . ASN D 4  479  ? 7.346   -8.415  49.721  1.00 60.55  ? 479  ASN A CG    1 
ATOM   4538  O  OD1   . ASN D 4  479  ? 6.156   -8.634  49.954  1.00 63.81  ? 479  ASN A OD1   1 
ATOM   4539  N  ND2   . ASN D 4  479  ? 8.044   -7.491  50.369  1.00 56.58  ? 479  ASN A ND2   1 
ATOM   4540  N  N     . ALA D 4  480  ? 5.703   -9.694  45.837  1.00 63.51  ? 480  ALA A N     1 
ATOM   4541  C  CA    . ALA D 4  480  ? 4.949   -8.965  44.838  1.00 57.08  ? 480  ALA A CA    1 
ATOM   4542  C  C     . ALA D 4  480  ? 3.559   -8.633  45.353  1.00 63.76  ? 480  ALA A C     1 
ATOM   4543  O  O     . ALA D 4  480  ? 3.059   -9.225  46.313  1.00 67.03  ? 480  ALA A O     1 
ATOM   4544  C  CB    . ALA D 4  480  ? 4.831   -9.772  43.551  1.00 44.39  ? 480  ALA A CB    1 
ATOM   4545  N  N     . ASP D 4  481  ? 2.937   -7.671  44.687  1.00 55.00  ? 481  ASP A N     1 
ATOM   4546  C  CA    . ASP D 4  481  ? 1.548   -7.327  44.921  1.00 64.46  ? 481  ASP A CA    1 
ATOM   4547  C  C     . ASP D 4  481  ? 1.031   -6.710  43.634  1.00 66.37  ? 481  ASP A C     1 
ATOM   4548  O  O     . ASP D 4  481  ? 1.791   -6.107  42.875  1.00 77.79  ? 481  ASP A O     1 
ATOM   4549  C  CB    . ASP D 4  481  ? 1.406   -6.367  46.108  1.00 76.14  ? 481  ASP A CB    1 
ATOM   4550  C  CG    . ASP D 4  481  ? 0.036   -6.422  46.742  1.00 94.05  ? 481  ASP A CG    1 
ATOM   4551  O  OD1   . ASP D 4  481  ? -0.958  -6.552  46.005  1.00 100.74 ? 481  ASP A OD1   1 
ATOM   4552  O  OD2   . ASP D 4  481  ? -0.048  -6.349  47.986  1.00 101.91 ? 481  ASP A OD2   1 
ATOM   4553  N  N     . PHE D 4  482  ? -0.253  -6.887  43.367  1.00 49.87  ? 482  PHE A N     1 
ATOM   4554  C  CA    . PHE D 4  482  ? -0.818  -6.335  42.137  1.00 57.78  ? 482  PHE A CA    1 
ATOM   4555  C  C     . PHE D 4  482  ? -1.545  -5.029  42.442  1.00 56.95  ? 482  PHE A C     1 
ATOM   4556  O  O     . PHE D 4  482  ? -2.751  -4.870  42.260  1.00 47.13  ? 482  PHE A O     1 
ATOM   4557  C  CB    . PHE D 4  482  ? -1.721  -7.355  41.455  1.00 65.22  ? 482  PHE A CB    1 
ATOM   4558  C  CG    . PHE D 4  482  ? -1.136  -8.737  41.402  1.00 48.44  ? 482  PHE A CG    1 
ATOM   4559  C  CD1   . PHE D 4  482  ? -1.898  -9.831  41.750  1.00 47.14  ? 482  PHE A CD1   1 
ATOM   4560  C  CD2   . PHE D 4  482  ? 0.175   -8.942  41.010  1.00 43.85  ? 482  PHE A CD2   1 
ATOM   4561  C  CE1   . PHE D 4  482  ? -1.372  -11.097 41.727  1.00 45.43  ? 482  PHE A CE1   1 
ATOM   4562  C  CE2   . PHE D 4  482  ? 0.709   -10.212 40.974  1.00 44.58  ? 482  PHE A CE2   1 
ATOM   4563  C  CZ    . PHE D 4  482  ? -0.068  -11.291 41.334  1.00 45.37  ? 482  PHE A CZ    1 
ATOM   4564  N  N     . ASP D 4  483  ? -0.749  -4.100  42.965  1.00 74.94  ? 483  ASP A N     1 
ATOM   4565  C  CA    . ASP D 4  483  ? -1.151  -2.726  43.211  1.00 75.94  ? 483  ASP A CA    1 
ATOM   4566  C  C     . ASP D 4  483  ? -0.542  -1.744  42.222  1.00 58.01  ? 483  ASP A C     1 
ATOM   4567  O  O     . ASP D 4  483  ? -0.908  -0.566  42.240  1.00 50.20  ? 483  ASP A O     1 
ATOM   4568  C  CB    . ASP D 4  483  ? -0.768  -2.313  44.642  1.00 86.26  ? 483  ASP A CB    1 
ATOM   4569  C  CG    . ASP D 4  483  ? 0.712   -2.531  44.949  1.00 96.44  ? 483  ASP A CG    1 
ATOM   4570  O  OD1   . ASP D 4  483  ? 1.104   -2.328  46.117  1.00 108.32 ? 483  ASP A OD1   1 
ATOM   4571  O  OD2   . ASP D 4  483  ? 1.476   -2.950  44.055  1.00 108.85 ? 483  ASP A OD2   1 
ATOM   4572  N  N     . GLY D 4  484  ? 0.379   -2.198  41.380  1.00 52.72  ? 484  GLY A N     1 
ATOM   4573  C  CA    . GLY D 4  484  ? 1.043   -1.333  40.430  1.00 39.83  ? 484  GLY A CA    1 
ATOM   4574  C  C     . GLY D 4  484  ? 2.485   -1.732  40.214  1.00 47.88  ? 484  GLY A C     1 
ATOM   4575  O  O     . GLY D 4  484  ? 3.226   -1.019  39.532  1.00 58.08  ? 484  GLY A O     1 
ATOM   4576  N  N     . ASP D 4  485  ? 2.891   -2.864  40.790  1.00 50.29  ? 485  ASP A N     1 
ATOM   4577  C  CA    . ASP D 4  485  ? 4.277   -3.303  40.689  1.00 54.02  ? 485  ASP A CA    1 
ATOM   4578  C  C     . ASP D 4  485  ? 4.648   -3.641  39.254  1.00 51.62  ? 485  ASP A C     1 
ATOM   4579  O  O     . ASP D 4  485  ? 3.822   -4.096  38.461  1.00 40.95  ? 485  ASP A O     1 
ATOM   4580  C  CB    . ASP D 4  485  ? 4.538   -4.533  41.560  1.00 83.90  ? 485  ASP A CB    1 
ATOM   4581  C  CG    . ASP D 4  485  ? 4.362   -4.259  43.029  1.00 116.30 ? 485  ASP A CG    1 
ATOM   4582  O  OD1   . ASP D 4  485  ? 4.277   -5.229  43.809  1.00 122.17 ? 485  ASP A OD1   1 
ATOM   4583  O  OD2   . ASP D 4  485  ? 4.321   -3.076  43.408  1.00 131.21 ? 485  ASP A OD2   1 
ATOM   4584  N  N     . GLU D 4  486  ? 5.910   -3.404  38.928  1.00 51.27  ? 486  GLU A N     1 
ATOM   4585  C  CA    . GLU D 4  486  ? 6.500   -3.904  37.703  1.00 48.58  ? 486  GLU A CA    1 
ATOM   4586  C  C     . GLU D 4  486  ? 7.525   -4.966  38.057  1.00 43.84  ? 486  GLU A C     1 
ATOM   4587  O  O     . GLU D 4  486  ? 8.081   -4.985  39.158  1.00 61.72  ? 486  GLU A O     1 
ATOM   4588  C  CB    . GLU D 4  486  ? 7.171   -2.787  36.906  1.00 57.13  ? 486  GLU A CB    1 
ATOM   4589  C  CG    . GLU D 4  486  ? 6.245   -1.660  36.536  1.00 75.02  ? 486  GLU A CG    1 
ATOM   4590  C  CD    . GLU D 4  486  ? 6.894   -0.669  35.607  1.00 81.85  ? 486  GLU A CD    1 
ATOM   4591  O  OE1   . GLU D 4  486  ? 6.367   0.444   35.477  1.00 85.06  ? 486  GLU A OE1   1 
ATOM   4592  O  OE2   . GLU D 4  486  ? 7.912   -1.011  34.976  1.00 80.58  ? 486  GLU A OE2   1 
ATOM   4593  N  N     . MET D 4  487  ? 7.770   -5.854  37.107  1.00 41.99  ? 487  MET A N     1 
ATOM   4594  C  CA    . MET D 4  487  ? 8.745   -6.910  37.288  1.00 42.63  ? 487  MET A CA    1 
ATOM   4595  C  C     . MET D 4  487  ? 9.566   -7.056  36.022  1.00 45.22  ? 487  MET A C     1 
ATOM   4596  O  O     . MET D 4  487  ? 9.077   -6.835  34.910  1.00 68.43  ? 487  MET A O     1 
ATOM   4597  C  CB    . MET D 4  487  ? 8.081   -8.234  37.635  1.00 43.29  ? 487  MET A CB    1 
ATOM   4598  C  CG    . MET D 4  487  ? 7.883   -8.479  39.111  1.00 43.42  ? 487  MET A CG    1 
ATOM   4599  S  SD    . MET D 4  487  ? 8.123   -10.230 39.450  1.00 53.68  ? 487  MET A SD    1 
ATOM   4600  C  CE    . MET D 4  487  ? 6.900   -10.498 40.703  1.00 61.16  ? 487  MET A CE    1 
ATOM   4601  N  N     . ASN D 4  488  ? 10.823  -7.429  36.205  1.00 43.18  ? 488  ASN A N     1 
ATOM   4602  C  CA    . ASN D 4  488  ? 11.767  -7.493  35.103  1.00 47.19  ? 488  ASN A CA    1 
ATOM   4603  C  C     . ASN D 4  488  ? 11.862  -8.915  34.572  1.00 46.67  ? 488  ASN A C     1 
ATOM   4604  O  O     . ASN D 4  488  ? 11.762  -9.882  35.329  1.00 45.46  ? 488  ASN A O     1 
ATOM   4605  C  CB    . ASN D 4  488  ? 13.144  -6.994  35.546  1.00 59.15  ? 488  ASN A CB    1 
ATOM   4606  C  CG    . ASN D 4  488  ? 13.098  -5.587  36.073  1.00 72.51  ? 488  ASN A CG    1 
ATOM   4607  O  OD1   . ASN D 4  488  ? 12.021  -5.032  36.283  1.00 52.99  ? 488  ASN A OD1   1 
ATOM   4608  N  ND2   . ASN D 4  488  ? 14.263  -4.997  36.295  1.00 84.52  ? 488  ASN A ND2   1 
ATOM   4609  N  N     . LEU D 4  489  ? 12.028  -9.039  33.255  1.00 60.98  ? 489  LEU A N     1 
ATOM   4610  C  CA    . LEU D 4  489  ? 12.163  -10.345 32.618  1.00 46.69  ? 489  LEU A CA    1 
ATOM   4611  C  C     . LEU D 4  489  ? 13.461  -10.376 31.822  1.00 45.64  ? 489  LEU A C     1 
ATOM   4612  O  O     . LEU D 4  489  ? 13.879  -9.357  31.278  1.00 45.21  ? 489  LEU A O     1 
ATOM   4613  C  CB    . LEU D 4  489  ? 10.948  -10.660 31.735  1.00 47.16  ? 489  LEU A CB    1 
ATOM   4614  C  CG    . LEU D 4  489  ? 10.884  -12.073 31.146  1.00 46.33  ? 489  LEU A CG    1 
ATOM   4615  C  CD1   . LEU D 4  489  ? 9.479   -12.557 31.162  1.00 49.98  ? 489  LEU A CD1   1 
ATOM   4616  C  CD2   . LEU D 4  489  ? 11.426  -12.149 29.718  1.00 46.67  ? 489  LEU A CD2   1 
ATOM   4617  N  N     . HIS D 4  490  ? 14.076  -11.553 31.755  1.00 46.48  ? 490  HIS A N     1 
ATOM   4618  C  CA    . HIS D 4  490  ? 15.476  -11.742 31.410  1.00 50.85  ? 490  HIS A CA    1 
ATOM   4619  C  C     . HIS D 4  490  ? 15.621  -12.984 30.547  1.00 61.72  ? 490  HIS A C     1 
ATOM   4620  O  O     . HIS D 4  490  ? 15.194  -14.075 30.940  1.00 78.64  ? 490  HIS A O     1 
ATOM   4621  C  CB    . HIS D 4  490  ? 16.304  -11.865 32.706  1.00 66.57  ? 490  HIS A CB    1 
ATOM   4622  C  CG    . HIS D 4  490  ? 16.499  -10.553 33.447  1.00 60.30  ? 490  HIS A CG    1 
ATOM   4623  N  ND1   . HIS D 4  490  ? 16.156  -9.325  32.907  1.00 60.44  ? 490  HIS A ND1   1 
ATOM   4624  C  CD2   . HIS D 4  490  ? 17.016  -10.275 34.686  1.00 87.43  ? 490  HIS A CD2   1 
ATOM   4625  C  CE1   . HIS D 4  490  ? 16.400  -8.364  33.782  1.00 62.96  ? 490  HIS A CE1   1 
ATOM   4626  N  NE2   . HIS D 4  490  ? 16.944  -8.907  34.862  1.00 71.27  ? 490  HIS A NE2   1 
ATOM   4627  N  N     . VAL D 4  491  ? 16.248  -12.811 29.395  1.00 61.95  ? 491  VAL A N     1 
ATOM   4628  C  CA    . VAL D 4  491  ? 16.287  -13.811 28.334  1.00 58.42  ? 491  VAL A CA    1 
ATOM   4629  C  C     . VAL D 4  491  ? 17.727  -14.275 28.179  1.00 53.05  ? 491  VAL A C     1 
ATOM   4630  O  O     . VAL D 4  491  ? 18.626  -13.432 28.031  1.00 50.06  ? 491  VAL A O     1 
ATOM   4631  C  CB    . VAL D 4  491  ? 15.750  -13.249 27.001  1.00 59.52  ? 491  VAL A CB    1 
ATOM   4632  C  CG1   . VAL D 4  491  ? 16.384  -13.958 25.804  1.00 49.68  ? 491  VAL A CG1   1 
ATOM   4633  C  CG2   . VAL D 4  491  ? 14.234  -13.415 26.951  1.00 48.54  ? 491  VAL A CG2   1 
ATOM   4634  N  N     . PRO D 4  492  ? 17.975  -15.578 28.184  1.00 51.47  ? 492  PRO A N     1 
ATOM   4635  C  CA    . PRO D 4  492  ? 19.316  -16.101 27.938  1.00 56.15  ? 492  PRO A CA    1 
ATOM   4636  C  C     . PRO D 4  492  ? 19.621  -16.249 26.456  1.00 60.97  ? 492  PRO A C     1 
ATOM   4637  O  O     . PRO D 4  492  ? 18.730  -16.421 25.619  1.00 64.05  ? 492  PRO A O     1 
ATOM   4638  C  CB    . PRO D 4  492  ? 19.265  -17.470 28.620  1.00 58.38  ? 492  PRO A CB    1 
ATOM   4639  C  CG    . PRO D 4  492  ? 17.849  -17.896 28.457  1.00 61.98  ? 492  PRO A CG    1 
ATOM   4640  C  CD    . PRO D 4  492  ? 17.018  -16.637 28.540  1.00 51.07  ? 492  PRO A CD    1 
ATOM   4641  N  N     . GLN D 4  493  ? 20.919  -16.200 26.137  1.00 66.19  ? 493  GLN A N     1 
ATOM   4642  C  CA    . GLN D 4  493  ? 21.373  -16.200 24.750  1.00 69.82  ? 493  GLN A CA    1 
ATOM   4643  C  C     . GLN D 4  493  ? 22.409  -17.276 24.437  1.00 80.49  ? 493  GLN A C     1 
ATOM   4644  O  O     . GLN D 4  493  ? 23.031  -17.224 23.369  1.00 86.81  ? 493  GLN A O     1 
ATOM   4645  C  CB    . GLN D 4  493  ? 21.941  -14.826 24.373  1.00 70.38  ? 493  GLN A CB    1 
ATOM   4646  C  CG    . GLN D 4  493  ? 21.002  -13.668 24.656  1.00 66.21  ? 493  GLN A CG    1 
ATOM   4647  C  CD    . GLN D 4  493  ? 20.062  -13.411 23.506  1.00 67.56  ? 493  GLN A CD    1 
ATOM   4648  O  OE1   . GLN D 4  493  ? 18.842  -13.450 23.659  1.00 68.95  ? 493  GLN A OE1   1 
ATOM   4649  N  NE2   . GLN D 4  493  ? 20.627  -13.157 22.337  1.00 71.74  ? 493  GLN A NE2   1 
ATOM   4650  N  N     . SER D 4  494  ? 22.615  -18.242 25.327  1.00 90.14  ? 494  SER A N     1 
ATOM   4651  C  CA    . SER D 4  494  ? 23.525  -19.349 25.071  1.00 97.57  ? 494  SER A CA    1 
ATOM   4652  C  C     . SER D 4  494  ? 22.865  -20.628 25.561  1.00 93.56  ? 494  SER A C     1 
ATOM   4653  O  O     . SER D 4  494  ? 21.982  -20.596 26.418  1.00 94.38  ? 494  SER A O     1 
ATOM   4654  C  CB    . SER D 4  494  ? 24.885  -19.140 25.754  1.00 108.69 ? 494  SER A CB    1 
ATOM   4655  O  OG    . SER D 4  494  ? 25.262  -17.773 25.747  1.00 117.98 ? 494  SER A OG    1 
ATOM   4656  N  N     . GLU D 4  495  ? 23.306  -21.763 25.011  1.00 98.52  ? 495  GLU A N     1 
ATOM   4657  C  CA    . GLU D 4  495  ? 22.617  -23.024 25.274  1.00 100.48 ? 495  GLU A CA    1 
ATOM   4658  C  C     . GLU D 4  495  ? 22.840  -23.490 26.708  1.00 110.35 ? 495  GLU A C     1 
ATOM   4659  O  O     . GLU D 4  495  ? 21.897  -23.916 27.386  1.00 114.85 ? 495  GLU A O     1 
ATOM   4660  C  CB    . GLU D 4  495  ? 23.070  -24.095 24.281  1.00 88.19  ? 495  GLU A CB    1 
ATOM   4661  C  CG    . GLU D 4  495  ? 21.972  -24.663 23.361  1.00 97.76  ? 495  GLU A CG    1 
ATOM   4662  C  CD    . GLU D 4  495  ? 20.730  -25.203 24.073  1.00 107.88 ? 495  GLU A CD    1 
ATOM   4663  O  OE1   . GLU D 4  495  ? 19.681  -25.307 23.403  1.00 107.43 ? 495  GLU A OE1   1 
ATOM   4664  O  OE2   . GLU D 4  495  ? 20.801  -25.596 25.258  1.00 107.40 ? 495  GLU A OE2   1 
ATOM   4665  N  N     . GLU D 4  496  ? 24.087  -23.425 27.189  1.00 108.95 ? 496  GLU A N     1 
ATOM   4666  C  CA    . GLU D 4  496  ? 24.350  -23.751 28.587  1.00 90.58  ? 496  GLU A CA    1 
ATOM   4667  C  C     . GLU D 4  496  ? 23.747  -22.712 29.514  1.00 82.04  ? 496  GLU A C     1 
ATOM   4668  O  O     . GLU D 4  496  ? 23.403  -23.023 30.660  1.00 87.68  ? 496  GLU A O     1 
ATOM   4669  C  CB    . GLU D 4  496  ? 25.853  -23.872 28.863  1.00 81.55  ? 496  GLU A CB    1 
ATOM   4670  C  CG    . GLU D 4  496  ? 26.704  -22.647 28.547  1.00 84.51  ? 496  GLU A CG    1 
ATOM   4671  C  CD    . GLU D 4  496  ? 27.019  -22.496 27.076  1.00 96.69  ? 496  GLU A CD    1 
ATOM   4672  O  OE1   . GLU D 4  496  ? 26.109  -22.133 26.302  1.00 108.00 ? 496  GLU A OE1   1 
ATOM   4673  O  OE2   . GLU D 4  496  ? 28.181  -22.739 26.696  1.00 104.09 ? 496  GLU A OE2   1 
ATOM   4674  N  N     . THR D 4  497  ? 23.617  -21.480 29.030  1.00 64.48  ? 497  THR A N     1 
ATOM   4675  C  CA    . THR D 4  497  ? 22.984  -20.435 29.813  1.00 66.62  ? 497  THR A CA    1 
ATOM   4676  C  C     . THR D 4  497  ? 21.502  -20.734 30.020  1.00 68.09  ? 497  THR A C     1 
ATOM   4677  O  O     . THR D 4  497  ? 20.974  -20.531 31.117  1.00 55.63  ? 497  THR A O     1 
ATOM   4678  C  CB    . THR D 4  497  ? 23.203  -19.096 29.115  1.00 71.74  ? 497  THR A CB    1 
ATOM   4679  O  OG1   . THR D 4  497  ? 24.610  -18.836 29.040  1.00 71.81  ? 497  THR A OG1   1 
ATOM   4680  C  CG2   . THR D 4  497  ? 22.583  -17.998 29.890  1.00 70.22  ? 497  THR A CG2   1 
ATOM   4681  N  N     . ARG D 4  498  ? 20.827  -21.252 28.988  1.00 79.48  ? 498  ARG A N     1 
ATOM   4682  C  CA    . ARG D 4  498  ? 19.465  -21.754 29.161  1.00 86.46  ? 498  ARG A CA    1 
ATOM   4683  C  C     . ARG D 4  498  ? 19.421  -22.927 30.129  1.00 82.06  ? 498  ARG A C     1 
ATOM   4684  O  O     . ARG D 4  498  ? 18.485  -23.045 30.929  1.00 73.73  ? 498  ARG A O     1 
ATOM   4685  C  CB    . ARG D 4  498  ? 18.879  -22.187 27.821  1.00 81.70  ? 498  ARG A CB    1 
ATOM   4686  C  CG    . ARG D 4  498  ? 18.860  -21.146 26.745  1.00 78.45  ? 498  ARG A CG    1 
ATOM   4687  C  CD    . ARG D 4  498  ? 18.464  -21.801 25.446  1.00 70.96  ? 498  ARG A CD    1 
ATOM   4688  N  NE    . ARG D 4  498  ? 17.185  -21.319 24.949  1.00 64.29  ? 498  ARG A NE    1 
ATOM   4689  C  CZ    . ARG D 4  498  ? 16.061  -22.024 25.007  1.00 61.16  ? 498  ARG A CZ    1 
ATOM   4690  N  NH1   . ARG D 4  498  ? 16.070  -23.239 25.537  1.00 56.73  ? 498  ARG A NH1   1 
ATOM   4691  N  NH2   . ARG D 4  498  ? 14.932  -21.520 24.533  1.00 77.10  ? 498  ARG A NH2   1 
ATOM   4692  N  N     . ALA D 4  499  ? 20.412  -23.821 30.050  1.00 80.39  ? 499  ALA A N     1 
ATOM   4693  C  CA    . ALA D 4  499  ? 20.466  -24.956 30.966  1.00 87.84  ? 499  ALA A CA    1 
ATOM   4694  C  C     . ALA D 4  499  ? 20.702  -24.504 32.397  1.00 85.61  ? 499  ALA A C     1 
ATOM   4695  O  O     . ALA D 4  499  ? 20.269  -25.173 33.342  1.00 87.77  ? 499  ALA A O     1 
ATOM   4696  C  CB    . ALA D 4  499  ? 21.566  -25.925 30.532  1.00 95.93  ? 499  ALA A CB    1 
ATOM   4697  N  N     . GLU D 4  500  ? 21.378  -23.369 32.570  1.00 76.73  ? 500  GLU A N     1 
ATOM   4698  C  CA    . GLU D 4  500  ? 21.673  -22.844 33.895  1.00 74.90  ? 500  GLU A CA    1 
ATOM   4699  C  C     . GLU D 4  500  ? 20.414  -22.378 34.612  1.00 64.40  ? 500  GLU A C     1 
ATOM   4700  O  O     . GLU D 4  500  ? 20.320  -22.503 35.837  1.00 68.81  ? 500  GLU A O     1 
ATOM   4701  C  CB    . GLU D 4  500  ? 22.667  -21.698 33.759  1.00 64.51  ? 500  GLU A CB    1 
ATOM   4702  C  CG    . GLU D 4  500  ? 24.104  -22.136 33.865  1.00 56.62  ? 500  GLU A CG    1 
ATOM   4703  C  CD    . GLU D 4  500  ? 24.947  -21.142 34.611  1.00 56.05  ? 500  GLU A CD    1 
ATOM   4704  O  OE1   . GLU D 4  500  ? 24.764  -19.930 34.399  1.00 60.52  ? 500  GLU A OE1   1 
ATOM   4705  O  OE2   . GLU D 4  500  ? 25.793  -21.570 35.411  1.00 72.27  ? 500  GLU A OE2   1 
ATOM   4706  N  N     . LEU D 4  501  ? 19.442  -21.841 33.872  1.00 67.02  ? 501  LEU A N     1 
ATOM   4707  C  CA    . LEU D 4  501  ? 18.206  -21.388 34.497  1.00 56.67  ? 501  LEU A CA    1 
ATOM   4708  C  C     . LEU D 4  501  ? 17.328  -22.568 34.886  1.00 66.36  ? 501  LEU A C     1 
ATOM   4709  O  O     . LEU D 4  501  ? 16.738  -22.581 35.971  1.00 60.48  ? 501  LEU A O     1 
ATOM   4710  C  CB    . LEU D 4  501  ? 17.440  -20.460 33.551  1.00 61.62  ? 501  LEU A CB    1 
ATOM   4711  C  CG    . LEU D 4  501  ? 17.736  -18.959 33.467  1.00 61.34  ? 501  LEU A CG    1 
ATOM   4712  C  CD1   . LEU D 4  501  ? 17.547  -18.277 34.804  1.00 75.68  ? 501  LEU A CD1   1 
ATOM   4713  C  CD2   . LEU D 4  501  ? 19.102  -18.681 32.930  1.00 52.42  ? 501  LEU A CD2   1 
ATOM   4714  N  N     . SER D 4  502  ? 17.235  -23.570 34.010  1.00 64.75  ? 502  SER A N     1 
ATOM   4715  C  CA    . SER D 4  502  ? 16.292  -24.664 34.195  1.00 61.28  ? 502  SER A CA    1 
ATOM   4716  C  C     . SER D 4  502  ? 16.787  -25.700 35.194  1.00 70.47  ? 502  SER A C     1 
ATOM   4717  O  O     . SER D 4  502  ? 15.971  -26.375 35.831  1.00 62.94  ? 502  SER A O     1 
ATOM   4718  C  CB    . SER D 4  502  ? 16.014  -25.332 32.850  1.00 70.99  ? 502  SER A CB    1 
ATOM   4719  O  OG    . SER D 4  502  ? 17.182  -25.340 32.044  1.00 87.09  ? 502  SER A OG    1 
ATOM   4720  N  N     . GLN D 4  503  ? 18.101  -25.851 35.342  1.00 72.85  ? 503  GLN A N     1 
ATOM   4721  C  CA    . GLN D 4  503  ? 18.668  -26.862 36.222  1.00 75.01  ? 503  GLN A CA    1 
ATOM   4722  C  C     . GLN D 4  503  ? 19.168  -26.295 37.542  1.00 67.25  ? 503  GLN A C     1 
ATOM   4723  O  O     . GLN D 4  503  ? 19.652  -27.057 38.383  1.00 61.61  ? 503  GLN A O     1 
ATOM   4724  C  CB    . GLN D 4  503  ? 19.810  -27.596 35.512  1.00 75.78  ? 503  GLN A CB    1 
ATOM   4725  C  CG    . GLN D 4  503  ? 19.364  -28.409 34.311  1.00 72.71  ? 503  GLN A CG    1 
ATOM   4726  C  CD    . GLN D 4  503  ? 18.086  -29.181 34.573  1.00 84.54  ? 503  GLN A CD    1 
ATOM   4727  O  OE1   . GLN D 4  503  ? 18.067  -30.121 35.366  1.00 92.70  ? 503  GLN A OE1   1 
ATOM   4728  N  NE2   . GLN D 4  503  ? 17.009  -28.786 33.905  1.00 83.37  ? 503  GLN A NE2   1 
ATOM   4729  N  N     . LEU D 4  504  ? 19.075  -24.981 37.745  1.00 68.03  ? 504  LEU A N     1 
ATOM   4730  C  CA    . LEU D 4  504  ? 19.526  -24.363 38.987  1.00 56.76  ? 504  LEU A CA    1 
ATOM   4731  C  C     . LEU D 4  504  ? 18.529  -23.322 39.482  1.00 57.98  ? 504  LEU A C     1 
ATOM   4732  O  O     . LEU D 4  504  ? 17.996  -23.444 40.589  1.00 76.42  ? 504  LEU A O     1 
ATOM   4733  C  CB    . LEU D 4  504  ? 20.906  -23.721 38.802  1.00 56.57  ? 504  LEU A CB    1 
ATOM   4734  C  CG    . LEU D 4  504  ? 22.080  -24.619 38.401  1.00 57.70  ? 504  LEU A CG    1 
ATOM   4735  C  CD1   . LEU D 4  504  ? 23.308  -23.796 38.067  1.00 65.75  ? 504  LEU A CD1   1 
ATOM   4736  C  CD2   . LEU D 4  504  ? 22.395  -25.602 39.510  1.00 58.65  ? 504  LEU A CD2   1 
ATOM   4737  N  N     . CYS D 4  505  ? 18.263  -22.304 38.667  1.00 54.69  ? 505  CYS A N     1 
ATOM   4738  C  CA    . CYS D 4  505  ? 17.487  -21.143 39.086  1.00 53.56  ? 505  CYS A CA    1 
ATOM   4739  C  C     . CYS D 4  505  ? 15.988  -21.304 38.866  1.00 53.38  ? 505  CYS A C     1 
ATOM   4740  O  O     . CYS D 4  505  ? 15.251  -20.325 39.012  1.00 52.44  ? 505  CYS A O     1 
ATOM   4741  C  CB    . CYS D 4  505  ? 17.973  -19.896 38.348  1.00 52.68  ? 505  CYS A CB    1 
ATOM   4742  S  SG    . CYS D 4  505  ? 19.763  -19.746 38.256  1.00 67.85  ? 505  CYS A SG    1 
ATOM   4743  N  N     . ALA D 4  506  ? 15.522  -22.504 38.523  1.00 54.29  ? 506  ALA A N     1 
ATOM   4744  C  CA    . ALA D 4  506  ? 14.116  -22.714 38.212  1.00 54.23  ? 506  ALA A CA    1 
ATOM   4745  C  C     . ALA D 4  506  ? 13.252  -22.559 39.460  1.00 60.21  ? 506  ALA A C     1 
ATOM   4746  O  O     . ALA D 4  506  ? 13.719  -22.699 40.592  1.00 72.07  ? 506  ALA A O     1 
ATOM   4747  C  CB    . ALA D 4  506  ? 13.901  -24.094 37.597  1.00 55.41  ? 506  ALA A CB    1 
ATOM   4748  N  N     . VAL D 4  507  ? 11.972  -22.253 39.231  1.00 53.87  ? 507  VAL A N     1 
ATOM   4749  C  CA    . VAL D 4  507  ? 11.035  -22.074 40.346  1.00 58.89  ? 507  VAL A CA    1 
ATOM   4750  C  C     . VAL D 4  507  ? 10.842  -23.334 41.187  1.00 61.95  ? 507  VAL A C     1 
ATOM   4751  O  O     . VAL D 4  507  ? 10.923  -23.234 42.422  1.00 84.25  ? 507  VAL A O     1 
ATOM   4752  C  CB    . VAL D 4  507  ? 9.705   -21.491 39.830  1.00 53.96  ? 507  VAL A CB    1 
ATOM   4753  C  CG1   . VAL D 4  507  ? 8.589   -21.740 40.816  1.00 52.93  ? 507  VAL A CG1   1 
ATOM   4754  C  CG2   . VAL D 4  507  ? 9.842   -20.009 39.636  1.00 51.51  ? 507  VAL A CG2   1 
ATOM   4755  N  N     . PRO D 4  508  ? 10.593  -24.532 40.616  1.00 55.48  ? 508  PRO A N     1 
ATOM   4756  C  CA    . PRO D 4  508  ? 10.381  -25.694 41.499  1.00 72.86  ? 508  PRO A CA    1 
ATOM   4757  C  C     . PRO D 4  508  ? 11.613  -26.088 42.288  1.00 60.01  ? 508  PRO A C     1 
ATOM   4758  O  O     . PRO D 4  508  ? 11.482  -26.666 43.373  1.00 62.32  ? 508  PRO A O     1 
ATOM   4759  C  CB    . PRO D 4  508  ? 9.969   -26.806 40.525  1.00 70.59  ? 508  PRO A CB    1 
ATOM   4760  C  CG    . PRO D 4  508  ? 9.457   -26.098 39.350  1.00 67.50  ? 508  PRO A CG    1 
ATOM   4761  C  CD    . PRO D 4  508  ? 10.359  -24.932 39.212  1.00 55.78  ? 508  PRO A CD    1 
ATOM   4762  N  N     . LEU D 4  509  ? 12.805  -25.775 41.781  1.00 57.58  ? 509  LEU A N     1 
ATOM   4763  C  CA    . LEU D 4  509  ? 14.032  -26.096 42.499  1.00 64.93  ? 509  LEU A CA    1 
ATOM   4764  C  C     . LEU D 4  509  ? 14.193  -25.233 43.743  1.00 63.76  ? 509  LEU A C     1 
ATOM   4765  O  O     . LEU D 4  509  ? 14.855  -25.646 44.702  1.00 62.89  ? 509  LEU A O     1 
ATOM   4766  C  CB    . LEU D 4  509  ? 15.230  -25.916 41.569  1.00 67.66  ? 509  LEU A CB    1 
ATOM   4767  C  CG    . LEU D 4  509  ? 15.419  -26.898 40.407  1.00 58.22  ? 509  LEU A CG    1 
ATOM   4768  C  CD1   . LEU D 4  509  ? 16.887  -27.055 40.110  1.00 58.62  ? 509  LEU A CD1   1 
ATOM   4769  C  CD2   . LEU D 4  509  ? 14.803  -28.257 40.692  1.00 59.44  ? 509  LEU A CD2   1 
ATOM   4770  N  N     . GLN D 4  510  ? 13.594  -24.041 43.746  1.00 58.80  ? 510  GLN A N     1 
ATOM   4771  C  CA    . GLN D 4  510  ? 13.710  -23.089 44.841  1.00 57.39  ? 510  GLN A CA    1 
ATOM   4772  C  C     . GLN D 4  510  ? 12.506  -23.105 45.769  1.00 58.68  ? 510  GLN A C     1 
ATOM   4773  O  O     . GLN D 4  510  ? 12.286  -22.125 46.486  1.00 54.41  ? 510  GLN A O     1 
ATOM   4774  C  CB    . GLN D 4  510  ? 13.900  -21.671 44.302  1.00 53.62  ? 510  GLN A CB    1 
ATOM   4775  C  CG    . GLN D 4  510  ? 14.992  -21.512 43.278  1.00 53.55  ? 510  GLN A CG    1 
ATOM   4776  C  CD    . GLN D 4  510  ? 16.362  -21.625 43.889  1.00 69.84  ? 510  GLN A CD    1 
ATOM   4777  O  OE1   . GLN D 4  510  ? 16.548  -21.339 45.069  1.00 87.49  ? 510  GLN A OE1   1 
ATOM   4778  N  NE2   . GLN D 4  510  ? 17.336  -22.035 43.088  1.00 73.41  ? 510  GLN A NE2   1 
ATOM   4779  N  N     . ILE D 4  511  ? 11.717  -24.180 45.762  1.00 62.39  ? 511  ILE A N     1 
ATOM   4780  C  CA    . ILE D 4  511  ? 10.503  -24.198 46.573  1.00 70.50  ? 511  ILE A CA    1 
ATOM   4781  C  C     . ILE D 4  511  ? 10.849  -24.226 48.056  1.00 75.75  ? 511  ILE A C     1 
ATOM   4782  O  O     . ILE D 4  511  ? 10.284  -23.465 48.847  1.00 79.13  ? 511  ILE A O     1 
ATOM   4783  C  CB    . ILE D 4  511  ? 9.601   -25.374 46.162  1.00 73.25  ? 511  ILE A CB    1 
ATOM   4784  C  CG1   . ILE D 4  511  ? 8.973   -25.075 44.798  1.00 56.26  ? 511  ILE A CG1   1 
ATOM   4785  C  CG2   . ILE D 4  511  ? 8.538   -25.636 47.224  1.00 74.71  ? 511  ILE A CG2   1 
ATOM   4786  C  CD1   . ILE D 4  511  ? 7.681   -25.798 44.512  1.00 56.88  ? 511  ILE A CD1   1 
ATOM   4787  N  N     . VAL D 4  512  ? 11.803  -25.059 48.449  1.00 75.50  ? 512  VAL A N     1 
ATOM   4788  C  CA    . VAL D 4  512  ? 12.311  -25.063 49.816  1.00 73.76  ? 512  VAL A CA    1 
ATOM   4789  C  C     . VAL D 4  512  ? 13.534  -24.156 49.895  1.00 74.26  ? 512  VAL A C     1 
ATOM   4790  O  O     . VAL D 4  512  ? 14.471  -24.279 49.095  1.00 71.59  ? 512  VAL A O     1 
ATOM   4791  C  CB    . VAL D 4  512  ? 12.639  -26.491 50.275  1.00 71.57  ? 512  VAL A CB    1 
ATOM   4792  C  CG1   . VAL D 4  512  ? 11.363  -27.217 50.654  1.00 72.64  ? 512  VAL A CG1   1 
ATOM   4793  C  CG2   . VAL D 4  512  ? 13.327  -27.248 49.161  1.00 81.56  ? 512  VAL A CG2   1 
ATOM   4794  N  N     . SER D 4  513  ? 13.522  -23.232 50.856  1.00 71.25  ? 513  SER A N     1 
ATOM   4795  C  CA    . SER D 4  513  ? 14.628  -22.292 50.818  1.00 73.24  ? 513  SER A CA    1 
ATOM   4796  C  C     . SER D 4  513  ? 15.677  -22.641 51.864  1.00 66.88  ? 513  SER A C     1 
ATOM   4797  O  O     . SER D 4  513  ? 15.344  -23.140 52.943  1.00 73.08  ? 513  SER A O     1 
ATOM   4798  C  CB    . SER D 4  513  ? 14.134  -20.861 51.056  1.00 81.42  ? 513  SER A CB    1 
ATOM   4799  O  OG    . SER D 4  513  ? 13.835  -20.639 52.421  1.00 97.08  ? 513  SER A OG    1 
ATOM   4800  N  N     . PRO D 4  514  ? 16.954  -22.408 51.544  1.00 67.99  ? 514  PRO A N     1 
ATOM   4801  C  CA    . PRO D 4  514  ? 17.999  -22.578 52.565  1.00 77.14  ? 514  PRO A CA    1 
ATOM   4802  C  C     . PRO D 4  514  ? 17.844  -21.634 53.740  1.00 92.40  ? 514  PRO A C     1 
ATOM   4803  O  O     . PRO D 4  514  ? 18.040  -22.037 54.893  1.00 94.43  ? 514  PRO A O     1 
ATOM   4804  C  CB    . PRO D 4  514  ? 19.288  -22.307 51.778  1.00 73.76  ? 514  PRO A CB    1 
ATOM   4805  C  CG    . PRO D 4  514  ? 18.951  -22.685 50.389  1.00 80.01  ? 514  PRO A CG    1 
ATOM   4806  C  CD    . PRO D 4  514  ? 17.531  -22.226 50.203  1.00 69.51  ? 514  PRO A CD    1 
ATOM   4807  N  N     . GLN D 4  515  ? 17.513  -20.376 53.466  1.00 104.33 ? 515  GLN A N     1 
ATOM   4808  C  CA    . GLN D 4  515  ? 17.064  -19.471 54.512  1.00 105.00 ? 515  GLN A CA    1 
ATOM   4809  C  C     . GLN D 4  515  ? 15.791  -20.011 55.146  1.00 100.05 ? 515  GLN A C     1 
ATOM   4810  O  O     . GLN D 4  515  ? 14.846  -20.383 54.445  1.00 118.35 ? 515  GLN A O     1 
ATOM   4811  C  CB    . GLN D 4  515  ? 16.831  -18.084 53.925  1.00 101.22 ? 515  GLN A CB    1 
ATOM   4812  C  CG    . GLN D 4  515  ? 15.794  -17.248 54.637  1.00 95.62  ? 515  GLN A CG    1 
ATOM   4813  C  CD    . GLN D 4  515  ? 15.374  -16.073 53.797  1.00 93.39  ? 515  GLN A CD    1 
ATOM   4814  O  OE1   . GLN D 4  515  ? 16.049  -15.729 52.832  1.00 90.89  ? 515  GLN A OE1   1 
ATOM   4815  N  NE2   . GLN D 4  515  ? 14.249  -15.458 54.143  1.00 100.77 ? 515  GLN A NE2   1 
ATOM   4816  N  N     . SER D 4  516  ? 15.798  -20.104 56.477  1.00 56.17  ? 516  SER A N     1 
ATOM   4817  C  CA    . SER D 4  516  ? 14.740  -20.629 57.341  1.00 65.20  ? 516  SER A CA    1 
ATOM   4818  C  C     . SER D 4  516  ? 14.479  -22.126 57.151  1.00 79.40  ? 516  SER A C     1 
ATOM   4819  O  O     . SER D 4  516  ? 13.560  -22.652 57.793  1.00 95.01  ? 516  SER A O     1 
ATOM   4820  C  CB    . SER D 4  516  ? 13.410  -19.872 57.182  1.00 58.59  ? 516  SER A CB    1 
ATOM   4821  O  OG    . SER D 4  516  ? 13.514  -18.541 57.661  1.00 68.47  ? 516  SER A OG    1 
ATOM   4822  N  N     . ASN D 4  517  ? 15.269  -22.818 56.317  1.00 70.30  ? 517  ASN A N     1 
ATOM   4823  C  CA    . ASN D 4  517  ? 15.212  -24.268 56.028  1.00 70.34  ? 517  ASN A CA    1 
ATOM   4824  C  C     . ASN D 4  517  ? 13.786  -24.799 55.868  1.00 66.41  ? 517  ASN A C     1 
ATOM   4825  O  O     . ASN D 4  517  ? 13.412  -25.845 56.403  1.00 59.93  ? 517  ASN A O     1 
ATOM   4826  C  CB    . ASN D 4  517  ? 16.004  -25.078 57.066  1.00 73.72  ? 517  ASN A CB    1 
ATOM   4827  C  CG    . ASN D 4  517  ? 15.455  -24.966 58.479  1.00 66.51  ? 517  ASN A CG    1 
ATOM   4828  O  OD1   . ASN D 4  517  ? 16.020  -24.261 59.304  1.00 73.89  ? 517  ASN A OD1   1 
ATOM   4829  N  ND2   . ASN D 4  517  ? 14.380  -25.690 58.771  1.00 66.42  ? 517  ASN A ND2   1 
ATOM   4830  N  N     . LYS D 4  518  ? 12.994  -24.078 55.087  1.00 67.70  ? 518  LYS A N     1 
ATOM   4831  C  CA    . LYS D 4  518  ? 11.569  -24.351 54.981  1.00 57.97  ? 518  LYS A CA    1 
ATOM   4832  C  C     . LYS D 4  518  ? 11.097  -23.822 53.632  1.00 57.07  ? 518  LYS A C     1 
ATOM   4833  O  O     . LYS D 4  518  ? 11.833  -23.086 52.960  1.00 65.09  ? 518  LYS A O     1 
ATOM   4834  C  CB    . LYS D 4  518  ? 10.806  -23.704 56.155  1.00 57.75  ? 518  LYS A CB    1 
ATOM   4835  C  CG    . LYS D 4  518  ? 10.629  -22.207 56.054  1.00 73.56  ? 518  LYS A CG    1 
ATOM   4836  C  CD    . LYS D 4  518  ? 9.268   -21.812 56.596  1.00 75.37  ? 518  LYS A CD    1 
ATOM   4837  C  CE    . LYS D 4  518  ? 9.025   -20.319 56.481  1.00 64.51  ? 518  LYS A CE    1 
ATOM   4838  N  NZ    . LYS D 4  518  ? 9.678   -19.752 55.269  1.00 68.73  ? 518  LYS A NZ    1 
ATOM   4839  N  N     . PRO D 4  519  ? 9.901   -24.211 53.175  1.00 57.24  ? 519  PRO A N     1 
ATOM   4840  C  CA    . PRO D 4  519  ? 9.421   -23.684 51.894  1.00 56.40  ? 519  PRO A CA    1 
ATOM   4841  C  C     . PRO D 4  519  ? 9.041   -22.213 51.957  1.00 55.12  ? 519  PRO A C     1 
ATOM   4842  O  O     . PRO D 4  519  ? 8.543   -21.711 52.968  1.00 54.97  ? 519  PRO A O     1 
ATOM   4843  C  CB    . PRO D 4  519  ? 8.202   -24.561 51.589  1.00 57.10  ? 519  PRO A CB    1 
ATOM   4844  C  CG    . PRO D 4  519  ? 7.715   -24.966 52.921  1.00 57.84  ? 519  PRO A CG    1 
ATOM   4845  C  CD    . PRO D 4  519  ? 8.987   -25.264 53.663  1.00 58.33  ? 519  PRO A CD    1 
ATOM   4846  N  N     . CYS D 4  520  ? 9.287   -21.520 50.843  1.00 54.26  ? 520  CYS A N     1 
ATOM   4847  C  CA    . CYS D 4  520  ? 8.940   -20.111 50.729  1.00 53.05  ? 520  CYS A CA    1 
ATOM   4848  C  C     . CYS D 4  520  ? 7.590   -19.884 50.067  1.00 52.69  ? 520  CYS A C     1 
ATOM   4849  O  O     . CYS D 4  520  ? 7.036   -18.786 50.188  1.00 70.31  ? 520  CYS A O     1 
ATOM   4850  C  CB    . CYS D 4  520  ? 10.005  -19.349 49.934  1.00 52.30  ? 520  CYS A CB    1 
ATOM   4851  S  SG    . CYS D 4  520  ? 10.714  -20.247 48.549  1.00 52.77  ? 520  CYS A SG    1 
ATOM   4852  N  N     . MET D 4  521  ? 7.054   -20.881 49.372  1.00 53.36  ? 521  MET A N     1 
ATOM   4853  C  CA    . MET D 4  521  ? 5.791   -20.753 48.664  1.00 53.12  ? 521  MET A CA    1 
ATOM   4854  C  C     . MET D 4  521  ? 4.726   -21.619 49.321  1.00 55.72  ? 521  MET A C     1 
ATOM   4855  O  O     . MET D 4  521  ? 5.012   -22.721 49.797  1.00 75.62  ? 521  MET A O     1 
ATOM   4856  C  CB    . MET D 4  521  ? 5.932   -21.153 47.195  1.00 53.17  ? 521  MET A CB    1 
ATOM   4857  C  CG    . MET D 4  521  ? 6.980   -20.381 46.423  1.00 63.47  ? 521  MET A CG    1 
ATOM   4858  S  SD    . MET D 4  521  ? 7.627   -21.362 45.061  1.00 81.04  ? 521  MET A SD    1 
ATOM   4859  C  CE    . MET D 4  521  ? 9.164   -20.514 44.737  1.00 52.28  ? 521  MET A CE    1 
ATOM   4860  N  N     . GLY D 4  522  ? 3.497   -21.114 49.333  1.00 53.70  ? 522  GLY A N     1 
ATOM   4861  C  CA    . GLY D 4  522  ? 2.376   -21.872 49.858  1.00 54.59  ? 522  GLY A CA    1 
ATOM   4862  C  C     . GLY D 4  522  ? 1.087   -21.352 49.267  1.00 57.98  ? 522  GLY A C     1 
ATOM   4863  O  O     . GLY D 4  522  ? 1.065   -20.356 48.541  1.00 70.63  ? 522  GLY A O     1 
ATOM   4864  N  N     . ILE D 4  523  ? -0.000  -22.055 49.584  1.00 56.35  ? 523  ILE A N     1 
ATOM   4865  C  CA    . ILE D 4  523  ? -1.320  -21.638 49.127  1.00 57.67  ? 523  ILE A CA    1 
ATOM   4866  C  C     . ILE D 4  523  ? -1.729  -20.385 49.892  1.00 61.56  ? 523  ILE A C     1 
ATOM   4867  O  O     . ILE D 4  523  ? -1.626  -20.326 51.124  1.00 61.54  ? 523  ILE A O     1 
ATOM   4868  C  CB    . ILE D 4  523  ? -2.337  -22.783 49.289  1.00 67.47  ? 523  ILE A CB    1 
ATOM   4869  C  CG1   . ILE D 4  523  ? -2.472  -23.634 48.015  1.00 56.55  ? 523  ILE A CG1   1 
ATOM   4870  C  CG2   . ILE D 4  523  ? -3.711  -22.271 49.628  1.00 73.30  ? 523  ILE A CG2   1 
ATOM   4871  C  CD1   . ILE D 4  523  ? -1.198  -24.133 47.393  1.00 60.67  ? 523  ILE A CD1   1 
ATOM   4872  N  N     . VAL D 4  524  ? -2.149  -19.353 49.157  1.00 62.25  ? 524  VAL A N     1 
ATOM   4873  C  CA    . VAL D 4  524  ? -2.444  -18.045 49.728  1.00 52.06  ? 524  VAL A CA    1 
ATOM   4874  C  C     . VAL D 4  524  ? -3.838  -17.606 49.303  1.00 51.88  ? 524  VAL A C     1 
ATOM   4875  O  O     . VAL D 4  524  ? -4.467  -18.203 48.427  1.00 66.85  ? 524  VAL A O     1 
ATOM   4876  C  CB    . VAL D 4  524  ? -1.418  -16.974 49.309  1.00 50.93  ? 524  VAL A CB    1 
ATOM   4877  C  CG1   . VAL D 4  524  ? -0.002  -17.409 49.632  1.00 60.18  ? 524  VAL A CG1   1 
ATOM   4878  C  CG2   . VAL D 4  524  ? -1.552  -16.692 47.826  1.00 50.39  ? 524  VAL A CG2   1 
ATOM   4879  N  N     . GLN D 4  525  ? -4.312  -16.544 49.963  1.00 55.21  ? 525  GLN A N     1 
ATOM   4880  C  CA    . GLN D 4  525  ? -5.396  -15.678 49.484  1.00 55.33  ? 525  GLN A CA    1 
ATOM   4881  C  C     . GLN D 4  525  ? -6.692  -16.465 49.330  1.00 64.53  ? 525  GLN A C     1 
ATOM   4882  O  O     . GLN D 4  525  ? -7.154  -17.059 50.320  1.00 64.45  ? 525  GLN A O     1 
ATOM   4883  C  CB    . GLN D 4  525  ? -4.895  -14.970 48.226  1.00 52.78  ? 525  GLN A CB    1 
ATOM   4884  C  CG    . GLN D 4  525  ? -3.853  -13.894 48.476  1.00 65.71  ? 525  GLN A CG    1 
ATOM   4885  C  CD    . GLN D 4  525  ? -4.474  -12.541 48.774  1.00 78.53  ? 525  GLN A CD    1 
ATOM   4886  O  OE1   . GLN D 4  525  ? -5.631  -12.450 49.153  1.00 91.02  ? 525  GLN A OE1   1 
ATOM   4887  N  NE2   . GLN D 4  525  ? -3.695  -11.487 48.620  1.00 73.92  ? 525  GLN A NE2   1 
ATOM   4888  N  N     . ASP D 4  526  ? -7.313  -16.489 48.151  1.00 75.26  ? 526  ASP A N     1 
ATOM   4889  C  CA    . ASP D 4  526  ? -8.604  -17.144 47.990  1.00 74.04  ? 526  ASP A CA    1 
ATOM   4890  C  C     . ASP D 4  526  ? -8.494  -18.651 47.955  1.00 59.09  ? 526  ASP A C     1 
ATOM   4891  O  O     . ASP D 4  526  ? -9.437  -19.344 48.355  1.00 57.66  ? 526  ASP A O     1 
ATOM   4892  C  CB    . ASP D 4  526  ? -9.277  -16.674 46.715  1.00 81.96  ? 526  ASP A CB    1 
ATOM   4893  C  CG    . ASP D 4  526  ? -10.122 -15.474 46.942  1.00 69.64  ? 526  ASP A CG    1 
ATOM   4894  O  OD1   . ASP D 4  526  ? -9.617  -14.337 46.864  1.00 58.94  ? 526  ASP A OD1   1 
ATOM   4895  O  OD2   . ASP D 4  526  ? -11.296 -15.684 47.226  1.00 68.26  ? 526  ASP A OD2   1 
ATOM   4896  N  N     . THR D 4  527  ? -7.376  -19.169 47.451  1.00 54.30  ? 527  THR A N     1 
ATOM   4897  C  CA    . THR D 4  527  ? -7.131  -20.600 47.541  1.00 59.97  ? 527  THR A CA    1 
ATOM   4898  C  C     . THR D 4  527  ? -7.086  -21.052 48.992  1.00 79.04  ? 527  THR A C     1 
ATOM   4899  O  O     . THR D 4  527  ? -7.570  -22.135 49.320  1.00 90.96  ? 527  THR A O     1 
ATOM   4900  C  CB    . THR D 4  527  ? -5.830  -20.953 46.827  1.00 60.05  ? 527  THR A CB    1 
ATOM   4901  O  OG1   . THR D 4  527  ? -5.658  -20.094 45.693  1.00 65.99  ? 527  THR A OG1   1 
ATOM   4902  C  CG2   . THR D 4  527  ? -5.863  -22.392 46.369  1.00 66.18  ? 527  THR A CG2   1 
ATOM   4903  N  N     . LEU D 4  528  ? -6.543  -20.218 49.882  1.00 73.72  ? 528  LEU A N     1 
ATOM   4904  C  CA    . LEU D 4  528  ? -6.448  -20.594 51.288  1.00 66.91  ? 528  LEU A CA    1 
ATOM   4905  C  C     . LEU D 4  528  ? -7.777  -20.391 52.005  1.00 61.80  ? 528  LEU A C     1 
ATOM   4906  O  O     . LEU D 4  528  ? -8.174  -21.221 52.830  1.00 57.11  ? 528  LEU A O     1 
ATOM   4907  C  CB    . LEU D 4  528  ? -5.343  -19.781 51.964  1.00 58.41  ? 528  LEU A CB    1 
ATOM   4908  C  CG    . LEU D 4  528  ? -4.954  -20.009 53.428  1.00 55.32  ? 528  LEU A CG    1 
ATOM   4909  C  CD1   . LEU D 4  528  ? -5.069  -21.476 53.823  1.00 56.76  ? 528  LEU A CD1   1 
ATOM   4910  C  CD2   . LEU D 4  528  ? -3.552  -19.492 53.688  1.00 56.86  ? 528  LEU A CD2   1 
ATOM   4911  N  N     . CYS D 4  529  ? -8.474  -19.292 51.713  1.00 56.89  ? 529  CYS A N     1 
ATOM   4912  C  CA    . CYS D 4  529  ? -9.746  -19.040 52.376  1.00 57.82  ? 529  CYS A CA    1 
ATOM   4913  C  C     . CYS D 4  529  ? -10.821 -20.006 51.895  1.00 65.55  ? 529  CYS A C     1 
ATOM   4914  O  O     . CYS D 4  529  ? -11.702 -20.391 52.672  1.00 65.73  ? 529  CYS A O     1 
ATOM   4915  C  CB    . CYS D 4  529  ? -10.167 -17.592 52.146  1.00 59.59  ? 529  CYS A CB    1 
ATOM   4916  S  SG    . CYS D 4  529  ? -11.857 -17.232 52.629  1.00 70.58  ? 529  CYS A SG    1 
ATOM   4917  N  N     . GLY D 4  530  ? -10.752 -20.427 50.630  1.00 79.52  ? 530  GLY A N     1 
ATOM   4918  C  CA    . GLY D 4  530  ? -11.716 -21.383 50.121  1.00 77.59  ? 530  GLY A CA    1 
ATOM   4919  C  C     . GLY D 4  530  ? -11.420 -22.812 50.510  1.00 82.24  ? 530  GLY A C     1 
ATOM   4920  O  O     . GLY D 4  530  ? -12.350 -23.604 50.692  1.00 86.31  ? 530  GLY A O     1 
ATOM   4921  N  N     . ILE D 4  531  ? -10.139 -23.166 50.661  1.00 82.87  ? 531  ILE A N     1 
ATOM   4922  C  CA    . ILE D 4  531  ? -9.785  -24.531 51.032  1.00 65.87  ? 531  ILE A CA    1 
ATOM   4923  C  C     . ILE D 4  531  ? -10.182 -24.834 52.469  1.00 69.93  ? 531  ILE A C     1 
ATOM   4924  O  O     . ILE D 4  531  ? -10.277 -26.004 52.845  1.00 87.91  ? 531  ILE A O     1 
ATOM   4925  C  CB    . ILE D 4  531  ? -8.278  -24.788 50.814  1.00 59.84  ? 531  ILE A CB    1 
ATOM   4926  C  CG1   . ILE D 4  531  ? -7.990  -26.268 50.626  1.00 61.15  ? 531  ILE A CG1   1 
ATOM   4927  C  CG2   . ILE D 4  531  ? -7.444  -24.255 51.965  1.00 59.41  ? 531  ILE A CG2   1 
ATOM   4928  C  CD1   . ILE D 4  531  ? -6.545  -26.569 50.368  1.00 60.93  ? 531  ILE A CD1   1 
ATOM   4929  N  N     . ARG D 4  532  ? -10.425 -23.811 53.288  1.00 65.57  ? 532  ARG A N     1 
ATOM   4930  C  CA    . ARG D 4  532  ? -10.987 -24.056 54.607  1.00 61.51  ? 532  ARG A CA    1 
ATOM   4931  C  C     . ARG D 4  532  ? -12.493 -24.265 54.525  1.00 62.14  ? 532  ARG A C     1 
ATOM   4932  O  O     . ARG D 4  532  ? -13.031 -25.170 55.172  1.00 63.50  ? 532  ARG A O     1 
ATOM   4933  C  CB    . ARG D 4  532  ? -10.667 -22.893 55.542  1.00 60.48  ? 532  ARG A CB    1 
ATOM   4934  C  CG    . ARG D 4  532  ? -11.127 -23.128 56.964  1.00 61.45  ? 532  ARG A CG    1 
ATOM   4935  C  CD    . ARG D 4  532  ? -11.299 -21.832 57.715  1.00 68.13  ? 532  ARG A CD    1 
ATOM   4936  N  NE    . ARG D 4  532  ? -12.600 -21.806 58.376  1.00 83.20  ? 532  ARG A NE    1 
ATOM   4937  C  CZ    . ARG D 4  532  ? -13.615 -21.038 57.997  1.00 87.71  ? 532  ARG A CZ    1 
ATOM   4938  N  NH1   . ARG D 4  532  ? -13.483 -20.229 56.954  1.00 86.47  ? 532  ARG A NH1   1 
ATOM   4939  N  NH2   . ARG D 4  532  ? -14.763 -21.085 58.655  1.00 79.93  ? 532  ARG A NH2   1 
ATOM   4940  N  N     . LYS D 4  533  ? -13.180 -23.434 53.735  1.00 66.57  ? 533  LYS A N     1 
ATOM   4941  C  CA    . LYS D 4  533  ? -14.623 -23.575 53.562  1.00 62.55  ? 533  LYS A CA    1 
ATOM   4942  C  C     . LYS D 4  533  ? -14.973 -24.891 52.886  1.00 68.56  ? 533  LYS A C     1 
ATOM   4943  O  O     . LYS D 4  533  ? -15.989 -25.517 53.214  1.00 64.49  ? 533  LYS A O     1 
ATOM   4944  C  CB    . LYS D 4  533  ? -15.166 -22.408 52.737  1.00 60.91  ? 533  LYS A CB    1 
ATOM   4945  C  CG    . LYS D 4  533  ? -14.986 -21.035 53.358  1.00 59.77  ? 533  LYS A CG    1 
ATOM   4946  C  CD    . LYS D 4  533  ? -15.906 -20.008 52.697  1.00 59.67  ? 533  LYS A CD    1 
ATOM   4947  C  CE    . LYS D 4  533  ? -17.270 -19.863 53.378  1.00 65.24  ? 533  LYS A CE    1 
ATOM   4948  N  NZ    . LYS D 4  533  ? -18.021 -21.126 53.622  1.00 75.42  ? 533  LYS A NZ    1 
ATOM   4949  N  N     . LEU D 4  534  ? -14.142 -25.322 51.936  1.00 74.05  ? 534  LEU A N     1 
ATOM   4950  C  CA    . LEU D 4  534  ? -14.385 -26.575 51.232  1.00 78.92  ? 534  LEU A CA    1 
ATOM   4951  C  C     . LEU D 4  534  ? -14.213 -27.772 52.155  1.00 90.11  ? 534  LEU A C     1 
ATOM   4952  O  O     . LEU D 4  534  ? -14.947 -28.759 52.032  1.00 102.26 ? 534  LEU A O     1 
ATOM   4953  C  CB    . LEU D 4  534  ? -13.435 -26.675 50.036  1.00 78.89  ? 534  LEU A CB    1 
ATOM   4954  C  CG    . LEU D 4  534  ? -13.293 -28.001 49.289  1.00 71.98  ? 534  LEU A CG    1 
ATOM   4955  C  CD1   . LEU D 4  534  ? -14.606 -28.361 48.638  1.00 71.12  ? 534  LEU A CD1   1 
ATOM   4956  C  CD2   . LEU D 4  534  ? -12.184 -27.927 48.254  1.00 65.01  ? 534  LEU A CD2   1 
ATOM   4957  N  N     . THR D 4  535  ? -13.289 -27.687 53.107  1.00 96.58  ? 535  THR A N     1 
ATOM   4958  C  CA    . THR D 4  535  ? -12.855 -28.830 53.895  1.00 88.61  ? 535  THR A CA    1 
ATOM   4959  C  C     . THR D 4  535  ? -13.588 -28.903 55.240  1.00 79.42  ? 535  THR A C     1 
ATOM   4960  O  O     . THR D 4  535  ? -13.257 -29.737 56.089  1.00 82.38  ? 535  THR A O     1 
ATOM   4961  C  CB    . THR D 4  535  ? -11.331 -28.747 54.067  1.00 98.99  ? 535  THR A CB    1 
ATOM   4962  O  OG1   . THR D 4  535  ? -10.758 -28.452 52.790  1.00 109.89 ? 535  THR A OG1   1 
ATOM   4963  C  CG2   . THR D 4  535  ? -10.713 -30.068 54.463  1.00 112.08 ? 535  THR A CG2   1 
ATOM   4964  N  N     . LEU D 4  536  ? -14.598 -28.058 55.448  1.00 72.81  ? 536  LEU A N     1 
ATOM   4965  C  CA    . LEU D 4  536  ? -15.451 -28.226 56.614  1.00 78.69  ? 536  LEU A CA    1 
ATOM   4966  C  C     . LEU D 4  536  ? -16.199 -29.551 56.535  1.00 81.20  ? 536  LEU A C     1 
ATOM   4967  O  O     . LEU D 4  536  ? -16.489 -30.065 55.451  1.00 91.97  ? 536  LEU A O     1 
ATOM   4968  C  CB    . LEU D 4  536  ? -16.448 -27.070 56.740  1.00 84.14  ? 536  LEU A CB    1 
ATOM   4969  C  CG    . LEU D 4  536  ? -15.975 -25.665 57.123  1.00 83.80  ? 536  LEU A CG    1 
ATOM   4970  C  CD1   . LEU D 4  536  ? -17.059 -24.967 57.926  1.00 88.98  ? 536  LEU A CD1   1 
ATOM   4971  C  CD2   . LEU D 4  536  ? -14.697 -25.713 57.934  1.00 77.12  ? 536  LEU A CD2   1 
ATOM   4972  N  N     . ARG D 4  537  ? -16.480 -30.118 57.712  1.00 88.39  ? 537  ARG A N     1 
ATOM   4973  C  CA    . ARG D 4  537  ? -17.274 -31.340 57.789  1.00 84.85  ? 537  ARG A CA    1 
ATOM   4974  C  C     . ARG D 4  537  ? -18.668 -31.132 57.227  1.00 80.20  ? 537  ARG A C     1 
ATOM   4975  O  O     . ARG D 4  537  ? -19.270 -32.066 56.685  1.00 74.71  ? 537  ARG A O     1 
ATOM   4976  C  CB    . ARG D 4  537  ? -17.369 -31.803 59.239  1.00 97.06  ? 537  ARG A CB    1 
ATOM   4977  C  CG    . ARG D 4  537  ? -16.058 -32.242 59.842  1.00 106.28 ? 537  ARG A CG    1 
ATOM   4978  C  CD    . ARG D 4  537  ? -16.044 -33.736 60.052  1.00 108.18 ? 537  ARG A CD    1 
ATOM   4979  N  NE    . ARG D 4  537  ? -16.344 -34.060 61.441  1.00 104.54 ? 537  ARG A NE    1 
ATOM   4980  C  CZ    . ARG D 4  537  ? -15.425 -34.357 62.352  1.00 89.16  ? 537  ARG A CZ    1 
ATOM   4981  N  NH1   . ARG D 4  537  ? -14.142 -34.375 62.019  1.00 77.16  ? 537  ARG A NH1   1 
ATOM   4982  N  NH2   . ARG D 4  537  ? -15.788 -34.635 63.596  1.00 83.96  ? 537  ARG A NH2   1 
ATOM   4983  N  N     . ASP D 4  538  ? -19.190 -29.914 57.340  1.00 86.77  ? 538  ASP A N     1 
ATOM   4984  C  CA    . ASP D 4  538  ? -20.545 -29.612 56.917  1.00 91.01  ? 538  ASP A CA    1 
ATOM   4985  C  C     . ASP D 4  538  ? -20.653 -29.319 55.429  1.00 91.84  ? 538  ASP A C     1 
ATOM   4986  O  O     . ASP D 4  538  ? -21.772 -29.215 54.915  1.00 93.16  ? 538  ASP A O     1 
ATOM   4987  C  CB    . ASP D 4  538  ? -21.070 -28.416 57.704  1.00 88.04  ? 538  ASP A CB    1 
ATOM   4988  C  CG    . ASP D 4  538  ? -22.469 -28.629 58.180  1.00 97.36  ? 538  ASP A CG    1 
ATOM   4989  O  OD1   . ASP D 4  538  ? -23.011 -29.705 57.867  1.00 103.65 ? 538  ASP A OD1   1 
ATOM   4990  O  OD2   . ASP D 4  538  ? -23.022 -27.735 58.848  1.00 94.00  ? 538  ASP A OD2   1 
ATOM   4991  N  N     . THR D 4  539  ? -19.529 -29.176 54.731  1.00 80.40  ? 539  THR A N     1 
ATOM   4992  C  CA    . THR D 4  539  ? -19.532 -28.841 53.314  1.00 71.86  ? 539  THR A CA    1 
ATOM   4993  C  C     . THR D 4  539  ? -19.676 -30.133 52.519  1.00 77.10  ? 539  THR A C     1 
ATOM   4994  O  O     . THR D 4  539  ? -18.787 -30.991 52.547  1.00 71.60  ? 539  THR A O     1 
ATOM   4995  C  CB    . THR D 4  539  ? -18.259 -28.090 52.930  1.00 68.24  ? 539  THR A CB    1 
ATOM   4996  O  OG1   . THR D 4  539  ? -18.319 -26.755 53.448  1.00 67.05  ? 539  THR A OG1   1 
ATOM   4997  C  CG2   . THR D 4  539  ? -18.122 -28.012 51.417  1.00 67.57  ? 539  THR A CG2   1 
ATOM   4998  N  N     . PHE D 4  540  ? -20.798 -30.275 51.821  1.00 90.93  ? 540  PHE A N     1 
ATOM   4999  C  CA    . PHE D 4  540  ? -21.068 -31.439 50.991  1.00 91.34  ? 540  PHE A CA    1 
ATOM   5000  C  C     . PHE D 4  540  ? -21.338 -30.996 49.561  1.00 81.02  ? 540  PHE A C     1 
ATOM   5001  O  O     . PHE D 4  540  ? -21.939 -29.943 49.332  1.00 90.86  ? 540  PHE A O     1 
ATOM   5002  C  CB    . PHE D 4  540  ? -22.251 -32.250 51.527  1.00 90.00  ? 540  PHE A CB    1 
ATOM   5003  C  CG    . PHE D 4  540  ? -21.918 -33.068 52.741  1.00 92.95  ? 540  PHE A CG    1 
ATOM   5004  C  CD1   . PHE D 4  540  ? -22.852 -33.256 53.744  1.00 104.28 ? 540  PHE A CD1   1 
ATOM   5005  C  CD2   . PHE D 4  540  ? -20.662 -33.634 52.889  1.00 81.99  ? 540  PHE A CD2   1 
ATOM   5006  C  CE1   . PHE D 4  540  ? -22.543 -34.005 54.866  1.00 105.69 ? 540  PHE A CE1   1 
ATOM   5007  C  CE2   . PHE D 4  540  ? -20.347 -34.384 54.006  1.00 91.13  ? 540  PHE A CE2   1 
ATOM   5008  C  CZ    . PHE D 4  540  ? -21.289 -34.569 54.996  1.00 101.34 ? 540  PHE A CZ    1 
ATOM   5009  N  N     . ILE D 4  541  ? -20.882 -31.799 48.602  1.00 72.50  ? 541  ILE A N     1 
ATOM   5010  C  CA    . ILE D 4  541  ? -20.909 -31.430 47.192  1.00 76.17  ? 541  ILE A CA    1 
ATOM   5011  C  C     . ILE D 4  541  ? -21.768 -32.427 46.424  1.00 85.50  ? 541  ILE A C     1 
ATOM   5012  O  O     . ILE D 4  541  ? -21.628 -33.643 46.601  1.00 87.72  ? 541  ILE A O     1 
ATOM   5013  C  CB    . ILE D 4  541  ? -19.493 -31.361 46.595  1.00 70.68  ? 541  ILE A CB    1 
ATOM   5014  C  CG1   . ILE D 4  541  ? -18.536 -30.685 47.577  1.00 69.62  ? 541  ILE A CG1   1 
ATOM   5015  C  CG2   . ILE D 4  541  ? -19.525 -30.587 45.306  1.00 75.50  ? 541  ILE A CG2   1 
ATOM   5016  C  CD1   . ILE D 4  541  ? -17.242 -30.257 46.963  1.00 68.31  ? 541  ILE A CD1   1 
ATOM   5017  N  N     . GLU D 4  542  ? -22.642 -31.906 45.565  1.00 88.00  ? 542  GLU A N     1 
ATOM   5018  C  CA    . GLU D 4  542  ? -23.522 -32.701 44.725  1.00 85.32  ? 542  GLU A CA    1 
ATOM   5019  C  C     . GLU D 4  542  ? -22.775 -33.210 43.496  1.00 86.46  ? 542  GLU A C     1 
ATOM   5020  O  O     . GLU D 4  542  ? -21.677 -32.756 43.180  1.00 84.67  ? 542  GLU A O     1 
ATOM   5021  C  CB    . GLU D 4  542  ? -24.730 -31.877 44.296  1.00 96.30  ? 542  GLU A CB    1 
ATOM   5022  C  CG    . GLU D 4  542  ? -25.540 -31.328 45.447  1.00 94.43  ? 542  GLU A CG    1 
ATOM   5023  C  CD    . GLU D 4  542  ? -26.881 -32.013 45.575  1.00 96.91  ? 542  GLU A CD    1 
ATOM   5024  O  OE1   . GLU D 4  542  ? -27.069 -33.071 44.939  1.00 97.29  ? 542  GLU A OE1   1 
ATOM   5025  O  OE2   . GLU D 4  542  ? -27.748 -31.492 46.305  1.00 100.70 ? 542  GLU A OE2   1 
ATOM   5026  N  N     . LEU D 4  543  ? -23.426 -34.126 42.769  1.00 88.92  ? 543  LEU A N     1 
ATOM   5027  C  CA    . LEU D 4  543  ? -22.772 -34.861 41.685  1.00 80.72  ? 543  LEU A CA    1 
ATOM   5028  C  C     . LEU D 4  543  ? -22.333 -33.941 40.550  1.00 76.32  ? 543  LEU A C     1 
ATOM   5029  O  O     . LEU D 4  543  ? -21.241 -34.110 39.995  1.00 73.76  ? 543  LEU A O     1 
ATOM   5030  C  CB    . LEU D 4  543  ? -23.718 -35.935 41.151  1.00 80.49  ? 543  LEU A CB    1 
ATOM   5031  C  CG    . LEU D 4  543  ? -23.365 -36.622 39.829  1.00 82.04  ? 543  LEU A CG    1 
ATOM   5032  C  CD1   . LEU D 4  543  ? -22.064 -37.397 39.952  1.00 84.61  ? 543  LEU A CD1   1 
ATOM   5033  C  CD2   . LEU D 4  543  ? -24.495 -37.523 39.367  1.00 87.48  ? 543  LEU A CD2   1 
ATOM   5034  N  N     . ASP D 4  544  ? -23.173 -32.965 40.194  1.00 85.19  ? 544  ASP A N     1 
ATOM   5035  C  CA    . ASP D 4  544  ? -22.884 -32.090 39.060  1.00 77.46  ? 544  ASP A CA    1 
ATOM   5036  C  C     . ASP D 4  544  ? -21.645 -31.237 39.303  1.00 76.25  ? 544  ASP A C     1 
ATOM   5037  O  O     . ASP D 4  544  ? -20.800 -31.088 38.412  1.00 80.42  ? 544  ASP A O     1 
ATOM   5038  C  CB    . ASP D 4  544  ? -24.094 -31.203 38.777  1.00 88.22  ? 544  ASP A CB    1 
ATOM   5039  C  CG    . ASP D 4  544  ? -24.705 -30.630 40.044  1.00 105.38 ? 544  ASP A CG    1 
ATOM   5040  O  OD1   . ASP D 4  544  ? -23.978 -29.985 40.828  1.00 104.24 ? 544  ASP A OD1   1 
ATOM   5041  O  OD2   . ASP D 4  544  ? -25.921 -30.824 40.255  1.00 114.16 ? 544  ASP A OD2   1 
ATOM   5042  N  N     . GLN D 4  545  ? -21.538 -30.652 40.497  1.00 82.63  ? 545  GLN A N     1 
ATOM   5043  C  CA    . GLN D 4  545  ? -20.353 -29.885 40.862  1.00 91.86  ? 545  GLN A CA    1 
ATOM   5044  C  C     . GLN D 4  545  ? -19.135 -30.786 40.992  1.00 82.51  ? 545  GLN A C     1 
ATOM   5045  O  O     . GLN D 4  545  ? -18.026 -30.394 40.617  1.00 72.63  ? 545  GLN A O     1 
ATOM   5046  C  CB    . GLN D 4  545  ? -20.592 -29.165 42.181  1.00 96.82  ? 545  GLN A CB    1 
ATOM   5047  C  CG    . GLN D 4  545  ? -20.263 -27.702 42.203  1.00 91.44  ? 545  GLN A CG    1 
ATOM   5048  C  CD    . GLN D 4  545  ? -20.320 -27.143 43.611  1.00 78.84  ? 545  GLN A CD    1 
ATOM   5049  O  OE1   . GLN D 4  545  ? -21.015 -27.678 44.474  1.00 79.72  ? 545  GLN A OE1   1 
ATOM   5050  N  NE2   . GLN D 4  545  ? -19.585 -26.064 43.851  1.00 74.27  ? 545  GLN A NE2   1 
ATOM   5051  N  N     . VAL D 4  546  ? -19.331 -31.978 41.560  1.00 76.41  ? 546  VAL A N     1 
ATOM   5052  C  CA    . VAL D 4  546  ? -18.272 -32.976 41.690  1.00 70.97  ? 546  VAL A CA    1 
ATOM   5053  C  C     . VAL D 4  546  ? -17.636 -33.284 40.348  1.00 71.85  ? 546  VAL A C     1 
ATOM   5054  O  O     . VAL D 4  546  ? -16.438 -33.074 40.191  1.00 75.31  ? 546  VAL A O     1 
ATOM   5055  C  CB    . VAL D 4  546  ? -18.825 -34.220 42.407  1.00 72.86  ? 546  VAL A CB    1 
ATOM   5056  C  CG1   . VAL D 4  546  ? -17.990 -35.397 42.318  1.00 73.83  ? 546  VAL A CG1   1 
ATOM   5057  C  CG2   . VAL D 4  546  ? -18.869 -33.882 43.901  1.00 72.73  ? 546  VAL A CG2   1 
ATOM   5058  N  N     . LEU D 4  547  ? -18.437 -33.696 39.343  1.00 78.73  ? 547  LEU A N     1 
ATOM   5059  C  CA    . LEU D 4  547  ? -17.900 -34.059 38.022  1.00 76.32  ? 547  LEU A CA    1 
ATOM   5060  C  C     . LEU D 4  547  ? -17.106 -32.920 37.382  1.00 87.86  ? 547  LEU A C     1 
ATOM   5061  O  O     . LEU D 4  547  ? -16.050 -33.147 36.775  1.00 85.99  ? 547  LEU A O     1 
ATOM   5062  C  CB    . LEU D 4  547  ? -19.032 -34.499 37.105  1.00 72.75  ? 547  LEU A CB    1 
ATOM   5063  C  CG    . LEU D 4  547  ? -19.794 -35.766 37.500  1.00 74.75  ? 547  LEU A CG    1 
ATOM   5064  C  CD1   . LEU D 4  547  ? -20.541 -36.339 36.311  1.00 79.26  ? 547  LEU A CD1   1 
ATOM   5065  C  CD2   . LEU D 4  547  ? -18.864 -36.807 38.104  1.00 75.58  ? 547  LEU A CD2   1 
ATOM   5066  N  N     . ASN D 4  548  ? -17.603 -31.684 37.500  1.00 95.39  ? 548  ASN A N     1 
ATOM   5067  C  CA    . ASN D 4  548  ? -16.835 -30.524 37.046  1.00 89.30  ? 548  ASN A CA    1 
ATOM   5068  C  C     . ASN D 4  548  ? -15.563 -30.352 37.865  1.00 93.68  ? 548  ASN A C     1 
ATOM   5069  O  O     . ASN D 4  548  ? -14.510 -29.995 37.324  1.00 94.11  ? 548  ASN A O     1 
ATOM   5070  C  CB    . ASN D 4  548  ? -17.696 -29.266 37.132  1.00 79.46  ? 548  ASN A CB    1 
ATOM   5071  C  CG    . ASN D 4  548  ? -18.590 -29.088 35.923  1.00 79.00  ? 548  ASN A CG    1 
ATOM   5072  O  OD1   . ASN D 4  548  ? -18.135 -29.166 34.782  1.00 87.31  ? 548  ASN A OD1   1 
ATOM   5073  N  ND2   . ASN D 4  548  ? -19.872 -28.850 36.166  1.00 69.63  ? 548  ASN A ND2   1 
ATOM   5074  N  N     . MET D 4  549  ? -15.646 -30.600 39.174  1.00 88.54  ? 549  MET A N     1 
ATOM   5075  C  CA    . MET D 4  549  ? -14.467 -30.511 40.030  1.00 74.91  ? 549  MET A CA    1 
ATOM   5076  C  C     . MET D 4  549  ? -13.444 -31.616 39.731  1.00 89.07  ? 549  MET A C     1 
ATOM   5077  O  O     . MET D 4  549  ? -12.239 -31.368 39.825  1.00 88.41  ? 549  MET A O     1 
ATOM   5078  C  CB    . MET D 4  549  ? -14.882 -30.555 41.503  1.00 66.59  ? 549  MET A CB    1 
ATOM   5079  C  CG    . MET D 4  549  ? -14.387 -29.399 42.357  1.00 81.33  ? 549  MET A CG    1 
ATOM   5080  S  SD    . MET D 4  549  ? -15.295 -29.289 43.913  1.00 90.40  ? 549  MET A SD    1 
ATOM   5081  C  CE    . MET D 4  549  ? -16.924 -28.864 43.324  1.00 70.26  ? 549  MET A CE    1 
ATOM   5082  N  N     . LEU D 4  550  ? -13.877 -32.848 39.411  1.00 98.91  ? 550  LEU A N     1 
ATOM   5083  C  CA    . LEU D 4  550  ? -12.909 -33.880 39.007  1.00 96.31  ? 550  LEU A CA    1 
ATOM   5084  C  C     . LEU D 4  550  ? -12.198 -33.541 37.705  1.00 95.11  ? 550  LEU A C     1 
ATOM   5085  O  O     . LEU D 4  550  ? -10.968 -33.658 37.616  1.00 90.23  ? 550  LEU A O     1 
ATOM   5086  C  CB    . LEU D 4  550  ? -13.564 -35.263 38.907  1.00 89.01  ? 550  LEU A CB    1 
ATOM   5087  C  CG    . LEU D 4  550  ? -13.852 -36.272 40.004  1.00 77.85  ? 550  LEU A CG    1 
ATOM   5088  C  CD1   . LEU D 4  550  ? -12.446 -36.658 40.595  1.00 96.82  ? 550  LEU A CD1   1 
ATOM   5089  C  CD2   . LEU D 4  550  ? -14.736 -35.637 41.014  1.00 72.32  ? 550  LEU A CD2   1 
ATOM   5090  N  N     . TYR D 4  551  ? -12.942 -33.124 36.682  1.00 92.39  ? 551  TYR A N     1 
ATOM   5091  C  CA    . TYR D 4  551  ? -12.287 -32.850 35.409  1.00 84.57  ? 551  TYR A CA    1 
ATOM   5092  C  C     . TYR D 4  551  ? -11.351 -31.642 35.507  1.00 82.87  ? 551  TYR A C     1 
ATOM   5093  O  O     . TYR D 4  551  ? -10.408 -31.524 34.717  1.00 84.98  ? 551  TYR A O     1 
ATOM   5094  C  CB    . TYR D 4  551  ? -13.331 -32.626 34.308  1.00 74.14  ? 551  TYR A CB    1 
ATOM   5095  C  CG    . TYR D 4  551  ? -12.743 -32.606 32.918  1.00 87.88  ? 551  TYR A CG    1 
ATOM   5096  C  CD1   . TYR D 4  551  ? -11.577 -33.304 32.631  1.00 97.18  ? 551  TYR A CD1   1 
ATOM   5097  C  CD2   . TYR D 4  551  ? -13.301 -31.825 31.918  1.00 87.56  ? 551  TYR A CD2   1 
ATOM   5098  C  CE1   . TYR D 4  551  ? -11.010 -33.264 31.400  1.00 90.36  ? 551  TYR A CE1   1 
ATOM   5099  C  CE2   . TYR D 4  551  ? -12.735 -31.780 30.665  1.00 73.59  ? 551  TYR A CE2   1 
ATOM   5100  C  CZ    . TYR D 4  551  ? -11.587 -32.506 30.422  1.00 69.86  ? 551  TYR A CZ    1 
ATOM   5101  O  OH    . TYR D 4  551  ? -10.982 -32.487 29.202  1.00 68.28  ? 551  TYR A OH    1 
ATOM   5102  N  N     . TRP D 4  552  ? -11.550 -30.769 36.495  1.00 74.90  ? 552  TRP A N     1 
ATOM   5103  C  CA    . TRP D 4  552  ? -10.708 -29.587 36.597  1.00 72.65  ? 552  TRP A CA    1 
ATOM   5104  C  C     . TRP D 4  552  ? -9.283  -29.916 37.024  1.00 80.54  ? 552  TRP A C     1 
ATOM   5105  O  O     . TRP D 4  552  ? -8.380  -29.113 36.777  1.00 78.47  ? 552  TRP A O     1 
ATOM   5106  C  CB    . TRP D 4  552  ? -11.333 -28.588 37.563  1.00 63.79  ? 552  TRP A CB    1 
ATOM   5107  C  CG    . TRP D 4  552  ? -11.817 -27.368 36.868  1.00 61.44  ? 552  TRP A CG    1 
ATOM   5108  C  CD1   . TRP D 4  552  ? -13.108 -26.953 36.750  1.00 61.50  ? 552  TRP A CD1   1 
ATOM   5109  C  CD2   . TRP D 4  552  ? -11.022 -26.419 36.152  1.00 64.97  ? 552  TRP A CD2   1 
ATOM   5110  N  NE1   . TRP D 4  552  ? -13.164 -25.793 36.020  1.00 60.32  ? 552  TRP A NE1   1 
ATOM   5111  C  CE2   . TRP D 4  552  ? -11.896 -25.444 35.642  1.00 62.19  ? 552  TRP A CE2   1 
ATOM   5112  C  CE3   . TRP D 4  552  ? -9.651  -26.293 35.902  1.00 67.29  ? 552  TRP A CE3   1 
ATOM   5113  C  CZ2   . TRP D 4  552  ? -11.449 -24.361 34.898  1.00 58.26  ? 552  TRP A CZ2   1 
ATOM   5114  C  CZ3   . TRP D 4  552  ? -9.209  -25.220 35.163  1.00 58.71  ? 552  TRP A CZ3   1 
ATOM   5115  C  CH2   . TRP D 4  552  ? -10.104 -24.267 34.671  1.00 57.72  ? 552  TRP A CH2   1 
ATOM   5116  N  N     . VAL D 4  553  ? -9.060  -31.071 37.643  1.00 75.06  ? 553  VAL A N     1 
ATOM   5117  C  CA    . VAL D 4  553  ? -7.712  -31.504 37.990  1.00 64.54  ? 553  VAL A CA    1 
ATOM   5118  C  C     . VAL D 4  553  ? -7.036  -31.941 36.695  1.00 66.01  ? 553  VAL A C     1 
ATOM   5119  O  O     . VAL D 4  553  ? -7.524  -32.875 36.040  1.00 78.49  ? 553  VAL A O     1 
ATOM   5120  C  CB    . VAL D 4  553  ? -7.733  -32.643 39.019  1.00 73.74  ? 553  VAL A CB    1 
ATOM   5121  C  CG1   . VAL D 4  553  ? -6.354  -32.840 39.623  1.00 88.72  ? 553  VAL A CG1   1 
ATOM   5122  C  CG2   . VAL D 4  553  ? -8.776  -32.384 40.088  1.00 66.00  ? 553  VAL A CG2   1 
ATOM   5123  N  N     . PRO D 4  554  ? -5.918  -31.303 36.285  1.00 76.91  ? 554  PRO A N     1 
ATOM   5124  C  CA    . PRO D 4  554  ? -5.354  -31.557 34.949  1.00 86.89  ? 554  PRO A CA    1 
ATOM   5125  C  C     . PRO D 4  554  ? -4.819  -32.968 34.755  1.00 95.67  ? 554  PRO A C     1 
ATOM   5126  O  O     . PRO D 4  554  ? -5.117  -33.599 33.736  1.00 115.91 ? 554  PRO A O     1 
ATOM   5127  C  CB    . PRO D 4  554  ? -4.234  -30.513 34.841  1.00 79.40  ? 554  PRO A CB    1 
ATOM   5128  C  CG    . PRO D 4  554  ? -3.876  -30.206 36.246  1.00 95.22  ? 554  PRO A CG    1 
ATOM   5129  C  CD    . PRO D 4  554  ? -5.173  -30.253 36.997  1.00 88.40  ? 554  PRO A CD    1 
ATOM   5130  N  N     . ASP D 4  555  ? -4.032  -33.478 35.697  1.00 77.94  ? 555  ASP A N     1 
ATOM   5131  C  CA    . ASP D 4  555  ? -3.751  -34.904 35.710  1.00 79.20  ? 555  ASP A CA    1 
ATOM   5132  C  C     . ASP D 4  555  ? -4.884  -35.599 36.450  1.00 72.30  ? 555  ASP A C     1 
ATOM   5133  O  O     . ASP D 4  555  ? -5.318  -35.137 37.509  1.00 101.44 ? 555  ASP A O     1 
ATOM   5134  C  CB    . ASP D 4  555  ? -2.395  -35.208 36.355  1.00 98.06  ? 555  ASP A CB    1 
ATOM   5135  C  CG    . ASP D 4  555  ? -2.199  -34.517 37.695  1.00 107.77 ? 555  ASP A CG    1 
ATOM   5136  O  OD1   . ASP D 4  555  ? -1.378  -33.580 37.763  1.00 106.42 ? 555  ASP A OD1   1 
ATOM   5137  O  OD2   . ASP D 4  555  ? -2.811  -34.944 38.697  1.00 102.02 ? 555  ASP A OD2   1 
ATOM   5138  N  N     . TRP D 4  556  ? -5.398  -36.680 35.870  1.00 71.55  ? 556  TRP A N     1 
ATOM   5139  C  CA    . TRP D 4  556  ? -6.520  -37.374 36.481  1.00 80.05  ? 556  TRP A CA    1 
ATOM   5140  C  C     . TRP D 4  556  ? -6.595  -38.786 35.922  1.00 98.58  ? 556  TRP A C     1 
ATOM   5141  O  O     . TRP D 4  556  ? -6.437  -38.990 34.716  1.00 104.75 ? 556  TRP A O     1 
ATOM   5142  C  CB    . TRP D 4  556  ? -7.839  -36.643 36.226  1.00 77.19  ? 556  TRP A CB    1 
ATOM   5143  C  CG    . TRP D 4  556  ? -8.980  -37.254 36.953  1.00 73.03  ? 556  TRP A CG    1 
ATOM   5144  C  CD1   . TRP D 4  556  ? -8.955  -37.794 38.203  1.00 72.41  ? 556  TRP A CD1   1 
ATOM   5145  C  CD2   . TRP D 4  556  ? -10.318 -37.401 36.476  1.00 83.80  ? 556  TRP A CD2   1 
ATOM   5146  N  NE1   . TRP D 4  556  ? -10.200 -38.265 38.539  1.00 83.97  ? 556  TRP A NE1   1 
ATOM   5147  C  CE2   . TRP D 4  556  ? -11.056 -38.035 37.495  1.00 87.05  ? 556  TRP A CE2   1 
ATOM   5148  C  CE3   . TRP D 4  556  ? -10.967 -37.056 35.288  1.00 80.58  ? 556  TRP A CE3   1 
ATOM   5149  C  CZ2   . TRP D 4  556  ? -12.408 -38.332 37.360  1.00 90.86  ? 556  TRP A CZ2   1 
ATOM   5150  C  CZ3   . TRP D 4  556  ? -12.309 -37.349 35.157  1.00 85.73  ? 556  TRP A CZ3   1 
ATOM   5151  C  CH2   . TRP D 4  556  ? -13.016 -37.980 36.187  1.00 93.02  ? 556  TRP A CH2   1 
ATOM   5152  N  N     . ASP D 4  557  ? -6.857  -39.747 36.805  1.00 107.02 ? 557  ASP A N     1 
ATOM   5153  C  CA    . ASP D 4  557  ? -6.964  -41.147 36.421  1.00 105.19 ? 557  ASP A CA    1 
ATOM   5154  C  C     . ASP D 4  557  ? -8.297  -41.502 35.773  1.00 99.46  ? 557  ASP A C     1 
ATOM   5155  O  O     . ASP D 4  557  ? -8.445  -42.623 35.274  1.00 103.81 ? 557  ASP A O     1 
ATOM   5156  C  CB    . ASP D 4  557  ? -6.712  -42.040 37.645  1.00 111.98 ? 557  ASP A CB    1 
ATOM   5157  C  CG    . ASP D 4  557  ? -7.603  -41.697 38.843  1.00 107.08 ? 557  ASP A CG    1 
ATOM   5158  O  OD1   . ASP D 4  557  ? -8.693  -41.106 38.683  1.00 110.82 ? 557  ASP A OD1   1 
ATOM   5159  O  OD2   . ASP D 4  557  ? -7.196  -42.032 39.973  1.00 101.09 ? 557  ASP A OD2   1 
ATOM   5160  N  N     . GLY D 4  558  ? -9.266  -40.589 35.770  1.00 95.94  ? 558  GLY A N     1 
ATOM   5161  C  CA    . GLY D 4  558  ? -10.573 -40.905 35.235  1.00 100.50 ? 558  GLY A CA    1 
ATOM   5162  C  C     . GLY D 4  558  ? -11.450 -41.720 36.153  1.00 108.61 ? 558  GLY A C     1 
ATOM   5163  O  O     . GLY D 4  558  ? -12.562 -42.088 35.764  1.00 116.40 ? 558  GLY A O     1 
ATOM   5164  N  N     . VAL D 4  559  ? -10.986 -42.012 37.363  1.00 117.10 ? 559  VAL A N     1 
ATOM   5165  C  CA    . VAL D 4  559  ? -11.741 -42.811 38.317  1.00 120.66 ? 559  VAL A CA    1 
ATOM   5166  C  C     . VAL D 4  559  ? -12.573 -41.865 39.170  1.00 104.01 ? 559  VAL A C     1 
ATOM   5167  O  O     . VAL D 4  559  ? -12.031 -41.081 39.954  1.00 108.20 ? 559  VAL A O     1 
ATOM   5168  C  CB    . VAL D 4  559  ? -10.819 -43.672 39.186  1.00 137.92 ? 559  VAL A CB    1 
ATOM   5169  C  CG1   . VAL D 4  559  ? -11.643 -44.563 40.102  1.00 151.13 ? 559  VAL A CG1   1 
ATOM   5170  C  CG2   . VAL D 4  559  ? -9.896  -44.501 38.314  1.00 142.62 ? 559  VAL A CG2   1 
ATOM   5171  N  N     . ILE D 4  560  ? -13.890 -41.929 39.004  1.00 87.52  ? 560  ILE A N     1 
ATOM   5172  C  CA    . ILE D 4  560  ? -14.821 -41.234 39.885  1.00 79.45  ? 560  ILE A CA    1 
ATOM   5173  C  C     . ILE D 4  560  ? -14.664 -41.840 41.274  1.00 80.34  ? 560  ILE A C     1 
ATOM   5174  O  O     . ILE D 4  560  ? -14.781 -43.065 41.423  1.00 83.32  ? 560  ILE A O     1 
ATOM   5175  C  CB    . ILE D 4  560  ? -16.269 -41.363 39.388  1.00 80.29  ? 560  ILE A CB    1 
ATOM   5176  C  CG1   . ILE D 4  560  ? -16.492 -40.516 38.133  1.00 85.90  ? 560  ILE A CG1   1 
ATOM   5177  C  CG2   . ILE D 4  560  ? -17.244 -40.977 40.498  1.00 80.39  ? 560  ILE A CG2   1 
ATOM   5178  C  CD1   . ILE D 4  560  ? -17.952 -40.330 37.769  1.00 79.66  ? 560  ILE A CD1   1 
ATOM   5179  N  N     . PRO D 4  561  ? -14.383 -41.048 42.304  1.00 79.27  ? 561  PRO A N     1 
ATOM   5180  C  CA    . PRO D 4  561  ? -14.297 -41.613 43.651  1.00 80.20  ? 561  PRO A CA    1 
ATOM   5181  C  C     . PRO D 4  561  ? -15.675 -41.955 44.190  1.00 89.03  ? 561  PRO A C     1 
ATOM   5182  O  O     . PRO D 4  561  ? -16.675 -41.305 43.874  1.00 88.95  ? 561  PRO A O     1 
ATOM   5183  C  CB    . PRO D 4  561  ? -13.636 -40.497 44.463  1.00 78.53  ? 561  PRO A CB    1 
ATOM   5184  C  CG    . PRO D 4  561  ? -14.043 -39.250 43.769  1.00 77.13  ? 561  PRO A CG    1 
ATOM   5185  C  CD    . PRO D 4  561  ? -14.174 -39.589 42.301  1.00 85.17  ? 561  PRO A CD    1 
ATOM   5186  N  N     . THR D 4  562  ? -15.713 -43.003 45.002  1.00 95.83  ? 562  THR A N     1 
ATOM   5187  C  CA    . THR D 4  562  ? -16.970 -43.479 45.564  1.00 95.45  ? 562  THR A CA    1 
ATOM   5188  C  C     . THR D 4  562  ? -17.500 -42.461 46.568  1.00 93.22  ? 562  THR A C     1 
ATOM   5189  O  O     . THR D 4  562  ? -16.737 -41.983 47.416  1.00 87.33  ? 562  THR A O     1 
ATOM   5190  C  CB    . THR D 4  562  ? -16.759 -44.839 46.230  1.00 103.85 ? 562  THR A CB    1 
ATOM   5191  O  OG1   . THR D 4  562  ? -16.094 -45.716 45.314  1.00 108.77 ? 562  THR A OG1   1 
ATOM   5192  C  CG2   . THR D 4  562  ? -18.086 -45.463 46.631  1.00 101.07 ? 562  THR A CG2   1 
ATOM   5193  N  N     . PRO D 4  563  ? -18.779 -42.088 46.491  1.00 97.13  ? 563  PRO A N     1 
ATOM   5194  C  CA    . PRO D 4  563  ? -19.303 -41.044 47.376  1.00 94.88  ? 563  PRO A CA    1 
ATOM   5195  C  C     . PRO D 4  563  ? -19.358 -41.479 48.831  1.00 93.73  ? 563  PRO A C     1 
ATOM   5196  O  O     . PRO D 4  563  ? -19.596 -42.645 49.153  1.00 110.07 ? 563  PRO A O     1 
ATOM   5197  C  CB    . PRO D 4  563  ? -20.712 -40.800 46.823  1.00 99.01  ? 563  PRO A CB    1 
ATOM   5198  C  CG    . PRO D 4  563  ? -21.063 -42.084 46.164  1.00 108.55 ? 563  PRO A CG    1 
ATOM   5199  C  CD    . PRO D 4  563  ? -19.786 -42.486 45.497  1.00 107.45 ? 563  PRO A CD    1 
ATOM   5200  N  N     . ALA D 4  564  ? -19.141 -40.505 49.716  1.00 82.70  ? 564  ALA A N     1 
ATOM   5201  C  CA    . ALA D 4  564  ? -19.149 -40.754 51.150  1.00 83.48  ? 564  ALA A CA    1 
ATOM   5202  C  C     . ALA D 4  564  ? -20.551 -40.834 51.730  1.00 84.63  ? 564  ALA A C     1 
ATOM   5203  O  O     . ALA D 4  564  ? -20.693 -41.115 52.923  1.00 85.52  ? 564  ALA A O     1 
ATOM   5204  C  CB    . ALA D 4  564  ? -18.358 -39.666 51.878  1.00 81.80  ? 564  ALA A CB    1 
ATOM   5205  N  N     . ILE D 4  565  ? -21.578 -40.554 50.935  1.00 86.16  ? 565  ILE A N     1 
ATOM   5206  C  CA    . ILE D 4  565  ? -22.969 -40.768 51.308  1.00 96.15  ? 565  ILE A CA    1 
ATOM   5207  C  C     . ILE D 4  565  ? -23.613 -41.488 50.131  1.00 113.77 ? 565  ILE A C     1 
ATOM   5208  O  O     . ILE D 4  565  ? -23.313 -41.172 48.975  1.00 111.24 ? 565  ILE A O     1 
ATOM   5209  C  CB    . ILE D 4  565  ? -23.698 -39.437 51.609  1.00 84.76  ? 565  ILE A CB    1 
ATOM   5210  C  CG1   . ILE D 4  565  ? -23.025 -38.679 52.766  1.00 83.71  ? 565  ILE A CG1   1 
ATOM   5211  C  CG2   . ILE D 4  565  ? -25.169 -39.687 51.918  1.00 86.23  ? 565  ILE A CG2   1 
ATOM   5212  C  CD1   . ILE D 4  565  ? -23.635 -38.885 54.145  1.00 84.92  ? 565  ILE A CD1   1 
ATOM   5213  N  N     . ILE D 4  566  ? -24.463 -42.477 50.410  1.00 119.07 ? 566  ILE A N     1 
ATOM   5214  C  CA    . ILE D 4  566  ? -25.040 -43.260 49.321  1.00 114.67 ? 566  ILE A CA    1 
ATOM   5215  C  C     . ILE D 4  566  ? -26.565 -43.198 49.304  1.00 120.51 ? 566  ILE A C     1 
ATOM   5216  O  O     . ILE D 4  566  ? -27.155 -42.698 48.340  1.00 119.97 ? 566  ILE A O     1 
ATOM   5217  C  CB    . ILE D 4  566  ? -24.570 -44.725 49.380  1.00 103.35 ? 566  ILE A CB    1 
ATOM   5218  C  CG1   . ILE D 4  566  ? -23.043 -44.817 49.237  1.00 105.66 ? 566  ILE A CG1   1 
ATOM   5219  C  CG2   . ILE D 4  566  ? -25.296 -45.563 48.327  1.00 100.17 ? 566  ILE A CG2   1 
ATOM   5220  C  CD1   . ILE D 4  566  ? -22.537 -45.048 47.822  1.00 104.87 ? 566  ILE A CD1   1 
ATOM   5221  N  N     . LYS D 4  567  ? -27.215 -43.704 50.365  1.00 120.12 ? 567  LYS A N     1 
ATOM   5222  C  CA    . LYS D 4  567  ? -28.635 -44.049 50.253  1.00 134.60 ? 567  LYS A CA    1 
ATOM   5223  C  C     . LYS D 4  567  ? -29.571 -42.845 50.130  1.00 131.98 ? 567  LYS A C     1 
ATOM   5224  O  O     . LYS D 4  567  ? -30.386 -42.838 49.191  1.00 147.91 ? 567  LYS A O     1 
ATOM   5225  C  CB    . LYS D 4  567  ? -29.050 -44.976 51.404  1.00 142.07 ? 567  LYS A CB    1 
ATOM   5226  C  CG    . LYS D 4  567  ? -29.928 -46.144 50.971  1.00 139.60 ? 567  LYS A CG    1 
ATOM   5227  C  CD    . LYS D 4  567  ? -31.373 -45.714 50.726  1.00 131.41 ? 567  LYS A CD    1 
ATOM   5228  C  CE    . LYS D 4  567  ? -32.123 -46.716 49.864  1.00 129.77 ? 567  LYS A CE    1 
ATOM   5229  N  NZ    . LYS D 4  567  ? -33.412 -46.171 49.357  1.00 122.66 ? 567  LYS A NZ    1 
ATOM   5230  N  N     . PRO D 4  568  ? -29.560 -41.837 51.021  1.00 108.31 ? 568  PRO A N     1 
ATOM   5231  C  CA    . PRO D 4  568  ? -30.567 -40.770 50.870  1.00 94.98  ? 568  PRO A CA    1 
ATOM   5232  C  C     . PRO D 4  568  ? -30.336 -39.899 49.648  1.00 96.89  ? 568  PRO A C     1 
ATOM   5233  O  O     . PRO D 4  568  ? -31.310 -39.417 49.056  1.00 110.59 ? 568  PRO A O     1 
ATOM   5234  C  CB    . PRO D 4  568  ? -30.435 -39.964 52.172  1.00 98.47  ? 568  PRO A CB    1 
ATOM   5235  C  CG    . PRO D 4  568  ? -29.641 -40.819 53.094  1.00 95.29  ? 568  PRO A CG    1 
ATOM   5236  C  CD    . PRO D 4  568  ? -28.723 -41.580 52.209  1.00 101.81 ? 568  PRO A CD    1 
ATOM   5237  N  N     . LYS D 4  569  ? -29.076 -39.708 49.248  1.00 98.20  ? 569  LYS A N     1 
ATOM   5238  C  CA    . LYS D 4  569  ? -28.619 -39.016 48.047  1.00 101.34 ? 569  LYS A CA    1 
ATOM   5239  C  C     . LYS D 4  569  ? -27.107 -39.182 47.992  1.00 104.19 ? 569  LYS A C     1 
ATOM   5240  O  O     . LYS D 4  569  ? -26.448 -39.075 49.031  1.00 121.90 ? 569  LYS A O     1 
ATOM   5241  C  CB    . LYS D 4  569  ? -28.984 -37.528 48.066  1.00 92.70  ? 569  LYS A CB    1 
ATOM   5242  C  CG    . LYS D 4  569  ? -28.507 -36.752 46.847  1.00 98.83  ? 569  LYS A CG    1 
ATOM   5243  C  CD    . LYS D 4  569  ? -29.083 -35.353 46.808  1.00 109.71 ? 569  LYS A CD    1 
ATOM   5244  C  CE    . LYS D 4  569  ? -28.682 -34.578 48.045  1.00 117.52 ? 569  LYS A CE    1 
ATOM   5245  N  NZ    . LYS D 4  569  ? -29.302 -33.227 48.092  1.00 121.13 ? 569  LYS A NZ    1 
ATOM   5246  N  N     . PRO D 4  570  ? -26.513 -39.451 46.832  1.00 92.34  ? 570  PRO A N     1 
ATOM   5247  C  CA    . PRO D 4  570  ? -25.047 -39.520 46.779  1.00 85.43  ? 570  PRO A CA    1 
ATOM   5248  C  C     . PRO D 4  570  ? -24.368 -38.168 46.952  1.00 95.12  ? 570  PRO A C     1 
ATOM   5249  O  O     . PRO D 4  570  ? -24.084 -37.472 45.973  1.00 91.32  ? 570  PRO A O     1 
ATOM   5250  C  CB    . PRO D 4  570  ? -24.776 -40.122 45.396  1.00 84.66  ? 570  PRO A CB    1 
ATOM   5251  C  CG    . PRO D 4  570  ? -25.964 -39.755 44.587  1.00 85.46  ? 570  PRO A CG    1 
ATOM   5252  C  CD    . PRO D 4  570  ? -27.126 -39.805 45.539  1.00 93.98  ? 570  PRO A CD    1 
ATOM   5253  N  N     . LEU D 4  571  ? -24.103 -37.788 48.200  1.00 98.62  ? 571  LEU A N     1 
ATOM   5254  C  CA    . LEU D 4  571  ? -23.316 -36.596 48.466  1.00 91.45  ? 571  LEU A CA    1 
ATOM   5255  C  C     . LEU D 4  571  ? -21.828 -36.925 48.424  1.00 92.69  ? 571  LEU A C     1 
ATOM   5256  O  O     . LEU D 4  571  ? -21.417 -38.082 48.354  1.00 108.18 ? 571  LEU A O     1 
ATOM   5257  C  CB    . LEU D 4  571  ? -23.656 -35.991 49.828  1.00 90.78  ? 571  LEU A CB    1 
ATOM   5258  C  CG    . LEU D 4  571  ? -24.916 -35.145 50.013  1.00 93.84  ? 571  LEU A CG    1 
ATOM   5259  C  CD1   . LEU D 4  571  ? -25.072 -34.145 48.876  1.00 95.30  ? 571  LEU A CD1   1 
ATOM   5260  C  CD2   . LEU D 4  571  ? -26.147 -36.009 50.174  1.00 88.54  ? 571  LEU A CD2   1 
ATOM   5261  N  N     . TRP D 4  572  ? -21.015 -35.878 48.483  1.00 77.47  ? 572  TRP A N     1 
ATOM   5262  C  CA    . TRP D 4  572  ? -19.570 -36.009 48.545  1.00 82.49  ? 572  TRP A CA    1 
ATOM   5263  C  C     . TRP D 4  572  ? -19.053 -35.099 49.643  1.00 99.99  ? 572  TRP A C     1 
ATOM   5264  O  O     . TRP D 4  572  ? -19.665 -34.078 49.949  1.00 113.95 ? 572  TRP A O     1 
ATOM   5265  C  CB    . TRP D 4  572  ? -18.912 -35.620 47.227  1.00 88.21  ? 572  TRP A CB    1 
ATOM   5266  C  CG    . TRP D 4  572  ? -18.636 -36.762 46.328  1.00 83.95  ? 572  TRP A CG    1 
ATOM   5267  C  CD1   . TRP D 4  572  ? -17.459 -37.433 46.189  1.00 91.33  ? 572  TRP A CD1   1 
ATOM   5268  C  CD2   . TRP D 4  572  ? -19.556 -37.369 45.419  1.00 87.13  ? 572  TRP A CD2   1 
ATOM   5269  N  NE1   . TRP D 4  572  ? -17.590 -38.427 45.251  1.00 91.18  ? 572  TRP A NE1   1 
ATOM   5270  C  CE2   . TRP D 4  572  ? -18.870 -38.408 44.763  1.00 92.87  ? 572  TRP A CE2   1 
ATOM   5271  C  CE3   . TRP D 4  572  ? -20.896 -37.135 45.099  1.00 89.83  ? 572  TRP A CE3   1 
ATOM   5272  C  CZ2   . TRP D 4  572  ? -19.479 -39.212 43.804  1.00 91.97  ? 572  TRP A CZ2   1 
ATOM   5273  C  CZ3   . TRP D 4  572  ? -21.498 -37.934 44.148  1.00 89.68  ? 572  TRP A CZ3   1 
ATOM   5274  C  CH2   . TRP D 4  572  ? -20.791 -38.959 43.512  1.00 90.23  ? 572  TRP A CH2   1 
ATOM   5275  N  N     . SER D 4  573  ? -17.922 -35.459 50.229  1.00 91.64  ? 573  SER A N     1 
ATOM   5276  C  CA    . SER D 4  573  ? -17.299 -34.564 51.186  1.00 88.50  ? 573  SER A CA    1 
ATOM   5277  C  C     . SER D 4  573  ? -16.316 -33.659 50.461  1.00 89.11  ? 573  SER A C     1 
ATOM   5278  O  O     . SER D 4  573  ? -15.722 -34.042 49.450  1.00 91.31  ? 573  SER A O     1 
ATOM   5279  C  CB    . SER D 4  573  ? -16.581 -35.338 52.287  1.00 86.61  ? 573  SER A CB    1 
ATOM   5280  O  OG    . SER D 4  573  ? -15.186 -35.396 52.048  1.00 94.16  ? 573  SER A OG    1 
ATOM   5281  N  N     . GLY D 4  574  ? -16.161 -32.440 50.980  1.00 80.57  ? 574  GLY A N     1 
ATOM   5282  C  CA    . GLY D 4  574  ? -15.168 -31.539 50.423  1.00 70.26  ? 574  GLY A CA    1 
ATOM   5283  C  C     . GLY D 4  574  ? -13.755 -32.032 50.641  1.00 84.02  ? 574  GLY A C     1 
ATOM   5284  O  O     . GLY D 4  574  ? -12.845 -31.694 49.879  1.00 82.81  ? 574  GLY A O     1 
ATOM   5285  N  N     . LYS D 4  575  ? -13.554 -32.833 51.686  1.00 90.71  ? 575  LYS A N     1 
ATOM   5286  C  CA    . LYS D 4  575  ? -12.286 -33.522 51.874  1.00 94.85  ? 575  LYS A CA    1 
ATOM   5287  C  C     . LYS D 4  575  ? -12.075 -34.582 50.798  1.00 90.34  ? 575  LYS A C     1 
ATOM   5288  O  O     . LYS D 4  575  ? -10.962 -34.740 50.284  1.00 82.91  ? 575  LYS A O     1 
ATOM   5289  C  CB    . LYS D 4  575  ? -12.261 -34.130 53.276  1.00 92.39  ? 575  LYS A CB    1 
ATOM   5290  C  CG    . LYS D 4  575  ? -12.578 -33.103 54.345  1.00 90.41  ? 575  LYS A CG    1 
ATOM   5291  C  CD    . LYS D 4  575  ? -12.426 -33.613 55.762  1.00 78.43  ? 575  LYS A CD    1 
ATOM   5292  C  CE    . LYS D 4  575  ? -13.729 -33.449 56.521  1.00 74.73  ? 575  LYS A CE    1 
ATOM   5293  N  NZ    . LYS D 4  575  ? -13.764 -32.165 57.273  1.00 72.16  ? 575  LYS A NZ    1 
ATOM   5294  N  N     . GLN D 4  576  ? -13.149 -35.279 50.417  1.00 94.82  ? 576  GLN A N     1 
ATOM   5295  C  CA    . GLN D 4  576  ? -13.056 -36.387 49.469  1.00 99.75  ? 576  GLN A CA    1 
ATOM   5296  C  C     . GLN D 4  576  ? -12.608 -35.915 48.091  1.00 101.77 ? 576  GLN A C     1 
ATOM   5297  O  O     . GLN D 4  576  ? -11.795 -36.574 47.434  1.00 103.17 ? 576  GLN A O     1 
ATOM   5298  C  CB    . GLN D 4  576  ? -14.417 -37.075 49.378  1.00 88.05  ? 576  GLN A CB    1 
ATOM   5299  C  CG    . GLN D 4  576  ? -14.407 -38.571 49.166  1.00 81.94  ? 576  GLN A CG    1 
ATOM   5300  C  CD    . GLN D 4  576  ? -15.812 -39.133 49.196  1.00 86.25  ? 576  GLN A CD    1 
ATOM   5301  O  OE1   . GLN D 4  576  ? -16.781 -38.383 49.308  1.00 84.50  ? 576  GLN A OE1   1 
ATOM   5302  N  NE2   . GLN D 4  576  ? -15.932 -40.451 49.106  1.00 90.65  ? 576  GLN A NE2   1 
ATOM   5303  N  N     . ILE D 4  577  ? -13.120 -34.769 47.645  1.00 102.57 ? 577  ILE A N     1 
ATOM   5304  C  CA    . ILE D 4  577  ? -12.816 -34.260 46.311  1.00 87.79  ? 577  ILE A CA    1 
ATOM   5305  C  C     . ILE D 4  577  ? -11.448 -33.584 46.276  1.00 81.65  ? 577  ILE A C     1 
ATOM   5306  O  O     . ILE D 4  577  ? -10.711 -33.709 45.292  1.00 68.95  ? 577  ILE A O     1 
ATOM   5307  C  CB    . ILE D 4  577  ? -13.952 -33.315 45.865  1.00 72.74  ? 577  ILE A CB    1 
ATOM   5308  C  CG1   . ILE D 4  577  ? -13.601 -32.538 44.597  1.00 75.33  ? 577  ILE A CG1   1 
ATOM   5309  C  CG2   . ILE D 4  577  ? -14.304 -32.360 46.975  1.00 89.17  ? 577  ILE A CG2   1 
ATOM   5310  C  CD1   . ILE D 4  577  ? -13.309 -33.379 43.417  1.00 103.12 ? 577  ILE A CD1   1 
ATOM   5311  N  N     . LEU D 4  578  ? -11.084 -32.877 47.350  1.00 83.17  ? 578  LEU A N     1 
ATOM   5312  C  CA    . LEU D 4  578  ? -9.809  -32.172 47.396  1.00 68.62  ? 578  LEU A CA    1 
ATOM   5313  C  C     . LEU D 4  578  ? -8.638  -33.142 47.346  1.00 77.80  ? 578  LEU A C     1 
ATOM   5314  O  O     . LEU D 4  578  ? -7.592  -32.834 46.762  1.00 67.52  ? 578  LEU A O     1 
ATOM   5315  C  CB    . LEU D 4  578  ? -9.742  -31.339 48.672  1.00 66.61  ? 578  LEU A CB    1 
ATOM   5316  C  CG    . LEU D 4  578  ? -8.482  -30.589 49.096  1.00 65.43  ? 578  LEU A CG    1 
ATOM   5317  C  CD1   . LEU D 4  578  ? -7.841  -29.798 47.956  1.00 64.08  ? 578  LEU A CD1   1 
ATOM   5318  C  CD2   . LEU D 4  578  ? -8.806  -29.723 50.285  1.00 67.28  ? 578  LEU A CD2   1 
ATOM   5319  N  N     . SER D 4  579  ? -8.815  -34.333 47.921  1.00 70.92  ? 579  SER A N     1 
ATOM   5320  C  CA    . SER D 4  579  ? -7.753  -35.325 48.009  1.00 81.15  ? 579  SER A CA    1 
ATOM   5321  C  C     . SER D 4  579  ? -7.358  -35.903 46.657  1.00 91.93  ? 579  SER A C     1 
ATOM   5322  O  O     . SER D 4  579  ? -6.336  -36.593 46.580  1.00 108.39 ? 579  SER A O     1 
ATOM   5323  C  CB    . SER D 4  579  ? -8.188  -36.441 48.955  1.00 103.33 ? 579  SER A CB    1 
ATOM   5324  O  OG    . SER D 4  579  ? -9.580  -36.678 48.835  1.00 121.67 ? 579  SER A OG    1 
ATOM   5325  N  N     . VAL D 4  580  ? -8.134  -35.646 45.600  1.00 86.22  ? 580  VAL A N     1 
ATOM   5326  C  CA    . VAL D 4  580  ? -7.732  -36.058 44.258  1.00 75.49  ? 580  VAL A CA    1 
ATOM   5327  C  C     . VAL D 4  580  ? -6.479  -35.309 43.824  1.00 69.11  ? 580  VAL A C     1 
ATOM   5328  O  O     . VAL D 4  580  ? -5.624  -35.862 43.122  1.00 69.42  ? 580  VAL A O     1 
ATOM   5329  C  CB    . VAL D 4  580  ? -8.898  -35.851 43.270  1.00 71.09  ? 580  VAL A CB    1 
ATOM   5330  C  CG1   . VAL D 4  580  ? -8.541  -36.378 41.895  1.00 70.82  ? 580  VAL A CG1   1 
ATOM   5331  C  CG2   . VAL D 4  580  ? -10.139 -36.552 43.779  1.00 83.49  ? 580  VAL A CG2   1 
ATOM   5332  N  N     . ALA D 4  581  ? -6.331  -34.055 44.259  1.00 67.66  ? 581  ALA A N     1 
ATOM   5333  C  CA    . ALA D 4  581  ? -5.142  -33.283 43.927  1.00 66.37  ? 581  ALA A CA    1 
ATOM   5334  C  C     . ALA D 4  581  ? -3.908  -33.754 44.684  1.00 70.60  ? 581  ALA A C     1 
ATOM   5335  O  O     . ALA D 4  581  ? -2.787  -33.494 44.234  1.00 68.24  ? 581  ALA A O     1 
ATOM   5336  C  CB    . ALA D 4  581  ? -5.385  -31.800 44.207  1.00 64.81  ? 581  ALA A CB    1 
ATOM   5337  N  N     . ILE D 4  582  ? -4.083  -34.424 45.819  1.00 71.85  ? 582  ILE A N     1 
ATOM   5338  C  CA    . ILE D 4  582  ? -2.955  -34.921 46.602  1.00 75.81  ? 582  ILE A CA    1 
ATOM   5339  C  C     . ILE D 4  582  ? -2.500  -36.255 46.024  1.00 69.52  ? 582  ILE A C     1 
ATOM   5340  O  O     . ILE D 4  582  ? -3.287  -37.212 45.992  1.00 77.07  ? 582  ILE A O     1 
ATOM   5341  C  CB    . ILE D 4  582  ? -3.320  -35.052 48.089  1.00 78.85  ? 582  ILE A CB    1 
ATOM   5342  C  CG1   . ILE D 4  582  ? -4.335  -33.978 48.482  1.00 87.77  ? 582  ILE A CG1   1 
ATOM   5343  C  CG2   . ILE D 4  582  ? -2.071  -34.952 48.952  1.00 74.66  ? 582  ILE A CG2   1 
ATOM   5344  C  CD1   . ILE D 4  582  ? -4.678  -33.964 49.954  1.00 78.88  ? 582  ILE A CD1   1 
ATOM   5345  N  N     . PRO D 4  583  ? -1.252  -36.370 45.573  1.00 69.30  ? 583  PRO A N     1 
ATOM   5346  C  CA    . PRO D 4  583  ? -0.807  -37.619 44.950  1.00 85.53  ? 583  PRO A CA    1 
ATOM   5347  C  C     . PRO D 4  583  ? -0.627  -38.724 45.976  1.00 108.83 ? 583  PRO A C     1 
ATOM   5348  O  O     . PRO D 4  583  ? -0.302  -38.480 47.140  1.00 123.46 ? 583  PRO A O     1 
ATOM   5349  C  CB    . PRO D 4  583  ? 0.531   -37.244 44.296  1.00 75.39  ? 583  PRO A CB    1 
ATOM   5350  C  CG    . PRO D 4  583  ? 0.806   -35.807 44.676  1.00 70.36  ? 583  PRO A CG    1 
ATOM   5351  C  CD    . PRO D 4  583  ? -0.145  -35.421 45.758  1.00 67.99  ? 583  PRO A CD    1 
ATOM   5352  N  N     . ASN D 4  584  ? -0.845  -39.954 45.520  1.00 103.83 ? 584  ASN A N     1 
ATOM   5353  C  CA    . ASN D 4  584  ? -0.868  -41.099 46.417  1.00 112.50 ? 584  ASN A CA    1 
ATOM   5354  C  C     . ASN D 4  584  ? 0.536   -41.437 46.902  1.00 110.91 ? 584  ASN A C     1 
ATOM   5355  O  O     . ASN D 4  584  ? 1.528   -41.218 46.205  1.00 117.18 ? 584  ASN A O     1 
ATOM   5356  C  CB    . ASN D 4  584  ? -1.486  -42.302 45.713  1.00 114.19 ? 584  ASN A CB    1 
ATOM   5357  C  CG    . ASN D 4  584  ? -2.595  -41.907 44.766  1.00 105.63 ? 584  ASN A CG    1 
ATOM   5358  O  OD1   . ASN D 4  584  ? -2.352  -41.254 43.753  1.00 101.44 ? 584  ASN A OD1   1 
ATOM   5359  N  ND2   . ASN D 4  584  ? -3.823  -42.297 45.090  1.00 112.20 ? 584  ASN A ND2   1 
ATOM   5360  N  N     . GLY D 4  585  ? 0.607   -41.984 48.113  1.00 100.00 ? 585  GLY A N     1 
ATOM   5361  C  CA    . GLY D 4  585  ? 1.869   -42.221 48.778  1.00 107.16 ? 585  GLY A CA    1 
ATOM   5362  C  C     . GLY D 4  585  ? 2.317   -41.112 49.700  1.00 103.00 ? 585  GLY A C     1 
ATOM   5363  O  O     . GLY D 4  585  ? 3.493   -41.084 50.076  1.00 101.16 ? 585  GLY A O     1 
ATOM   5364  N  N     . ILE D 4  586  ? 1.425   -40.197 50.068  1.00 97.28  ? 586  ILE A N     1 
ATOM   5365  C  CA    . ILE D 4  586  ? 1.741   -39.081 50.952  1.00 85.30  ? 586  ILE A CA    1 
ATOM   5366  C  C     . ILE D 4  586  ? 1.093   -39.355 52.304  1.00 100.05 ? 586  ILE A C     1 
ATOM   5367  O  O     . ILE D 4  586  ? -0.082  -39.740 52.372  1.00 115.29 ? 586  ILE A O     1 
ATOM   5368  C  CB    . ILE D 4  586  ? 1.278   -37.734 50.353  1.00 71.47  ? 586  ILE A CB    1 
ATOM   5369  C  CG1   . ILE D 4  586  ? 2.409   -37.050 49.574  1.00 70.26  ? 586  ILE A CG1   1 
ATOM   5370  C  CG2   . ILE D 4  586  ? 0.763   -36.767 51.414  1.00 70.67  ? 586  ILE A CG2   1 
ATOM   5371  C  CD1   . ILE D 4  586  ? 2.858   -37.774 48.337  1.00 73.84  ? 586  ILE A CD1   1 
ATOM   5372  N  N     . HIS D 4  587  ? 1.870   -39.192 53.372  1.00 81.21  ? 587  HIS A N     1 
ATOM   5373  C  CA    . HIS D 4  587  ? 1.384   -39.333 54.733  1.00 78.07  ? 587  HIS A CA    1 
ATOM   5374  C  C     . HIS D 4  587  ? 1.636   -38.022 55.457  1.00 82.60  ? 587  HIS A C     1 
ATOM   5375  O  O     . HIS D 4  587  ? 2.695   -37.411 55.295  1.00 96.67  ? 587  HIS A O     1 
ATOM   5376  C  CB    . HIS D 4  587  ? 2.090   -40.474 55.463  1.00 88.38  ? 587  HIS A CB    1 
ATOM   5377  C  CG    . HIS D 4  587  ? 2.538   -41.573 54.556  1.00 98.32  ? 587  HIS A CG    1 
ATOM   5378  N  ND1   . HIS D 4  587  ? 1.666   -42.461 53.968  1.00 101.88 ? 587  HIS A ND1   1 
ATOM   5379  C  CD2   . HIS D 4  587  ? 3.773   -41.912 54.121  1.00 99.16  ? 587  HIS A CD2   1 
ATOM   5380  C  CE1   . HIS D 4  587  ? 2.345   -43.301 53.209  1.00 100.71 ? 587  HIS A CE1   1 
ATOM   5381  N  NE2   . HIS D 4  587  ? 3.626   -42.994 53.290  1.00 102.57 ? 587  HIS A NE2   1 
ATOM   5382  N  N     . LEU D 4  588  ? 0.662   -37.574 56.240  1.00 88.60  ? 588  LEU A N     1 
ATOM   5383  C  CA    . LEU D 4  588  ? 0.806   -36.323 56.977  1.00 86.91  ? 588  LEU A CA    1 
ATOM   5384  C  C     . LEU D 4  588  ? 0.089   -36.459 58.308  1.00 77.34  ? 588  LEU A C     1 
ATOM   5385  O  O     . LEU D 4  588  ? -1.141  -36.543 58.345  1.00 77.82  ? 588  LEU A O     1 
ATOM   5386  C  CB    . LEU D 4  588  ? 0.260   -35.141 56.186  1.00 78.29  ? 588  LEU A CB    1 
ATOM   5387  C  CG    . LEU D 4  588  ? 0.640   -33.812 56.828  1.00 69.01  ? 588  LEU A CG    1 
ATOM   5388  C  CD1   . LEU D 4  588  ? 1.929   -33.305 56.224  1.00 68.01  ? 588  LEU A CD1   1 
ATOM   5389  C  CD2   . LEU D 4  588  ? -0.463  -32.808 56.637  1.00 71.46  ? 588  LEU A CD2   1 
ATOM   5390  N  N     . GLN D 4  589  ? 0.853   -36.475 59.394  1.00 73.10  ? 589  GLN A N     1 
ATOM   5391  C  CA    . GLN D 4  589  ? 0.311   -36.570 60.740  1.00 77.87  ? 589  GLN A CA    1 
ATOM   5392  C  C     . GLN D 4  589  ? 0.550   -35.245 61.442  1.00 72.63  ? 589  GLN A C     1 
ATOM   5393  O  O     . GLN D 4  589  ? 1.676   -34.737 61.438  1.00 75.48  ? 589  GLN A O     1 
ATOM   5394  C  CB    . GLN D 4  589  ? 0.983   -37.690 61.535  1.00 106.06 ? 589  GLN A CB    1 
ATOM   5395  C  CG    . GLN D 4  589  ? 0.023   -38.610 62.266  1.00 119.61 ? 589  GLN A CG    1 
ATOM   5396  C  CD    . GLN D 4  589  ? 0.666   -39.925 62.669  1.00 111.42 ? 589  GLN A CD    1 
ATOM   5397  O  OE1   . GLN D 4  589  ? 1.890   -40.041 62.715  1.00 110.86 ? 589  GLN A OE1   1 
ATOM   5398  N  NE2   . GLN D 4  589  ? -0.158  -40.933 62.926  1.00 104.44 ? 589  GLN A NE2   1 
ATOM   5399  N  N     . ARG D 4  590  ? -0.497  -34.692 62.049  1.00 72.51  ? 590  ARG A N     1 
ATOM   5400  C  CA    . ARG D 4  590  ? -0.346  -33.457 62.806  1.00 73.43  ? 590  ARG A CA    1 
ATOM   5401  C  C     . ARG D 4  590  ? -1.463  -33.352 63.832  1.00 99.62  ? 590  ARG A C     1 
ATOM   5402  O  O     . ARG D 4  590  ? -2.622  -33.644 63.529  1.00 102.42 ? 590  ARG A O     1 
ATOM   5403  C  CB    . ARG D 4  590  ? -0.336  -32.228 61.889  1.00 69.60  ? 590  ARG A CB    1 
ATOM   5404  C  CG    . ARG D 4  590  ? 0.735   -31.210 62.257  1.00 81.12  ? 590  ARG A CG    1 
ATOM   5405  C  CD    . ARG D 4  590  ? 0.316   -29.790 61.902  1.00 98.43  ? 590  ARG A CD    1 
ATOM   5406  N  NE    . ARG D 4  590  ? -1.014  -29.447 62.397  1.00 107.45 ? 590  ARG A NE    1 
ATOM   5407  C  CZ    . ARG D 4  590  ? -2.021  -29.098 61.605  1.00 114.65 ? 590  ARG A CZ    1 
ATOM   5408  N  NH1   . ARG D 4  590  ? -3.209  -28.799 62.111  1.00 117.60 ? 590  ARG A NH1   1 
ATOM   5409  N  NH2   . ARG D 4  590  ? -1.833  -29.040 60.295  1.00 106.59 ? 590  ARG A NH2   1 
ATOM   5410  N  N     . PHE D 4  591  ? -1.101  -32.924 65.039  1.00 95.52  ? 591  PHE A N     1 
ATOM   5411  C  CA    . PHE D 4  591  ? -2.014  -32.857 66.172  1.00 81.36  ? 591  PHE A CA    1 
ATOM   5412  C  C     . PHE D 4  591  ? -1.952  -31.467 66.789  1.00 85.02  ? 591  PHE A C     1 
ATOM   5413  O  O     . PHE D 4  591  ? -0.862  -30.942 67.035  1.00 77.98  ? 591  PHE A O     1 
ATOM   5414  C  CB    . PHE D 4  591  ? -1.677  -33.919 67.233  1.00 83.08  ? 591  PHE A CB    1 
ATOM   5415  C  CG    . PHE D 4  591  ? -1.400  -35.293 66.669  1.00 94.33  ? 591  PHE A CG    1 
ATOM   5416  C  CD1   . PHE D 4  591  ? -0.121  -35.663 66.273  1.00 102.96 ? 591  PHE A CD1   1 
ATOM   5417  C  CD2   . PHE D 4  591  ? -2.424  -36.220 66.547  1.00 97.39  ? 591  PHE A CD2   1 
ATOM   5418  C  CE1   . PHE D 4  591  ? 0.126   -36.923 65.759  1.00 107.90 ? 591  PHE A CE1   1 
ATOM   5419  C  CE2   . PHE D 4  591  ? -2.185  -37.482 66.035  1.00 97.47  ? 591  PHE A CE2   1 
ATOM   5420  C  CZ    . PHE D 4  591  ? -0.909  -37.834 65.642  1.00 104.83 ? 591  PHE A CZ    1 
ATOM   5421  N  N     . ASP D 4  592  ? -3.121  -30.871 67.029  1.00 107.69 ? 592  ASP A N     1 
ATOM   5422  C  CA    . ASP D 4  592  ? -3.234  -29.560 67.660  1.00 119.22 ? 592  ASP A CA    1 
ATOM   5423  C  C     . ASP D 4  592  ? -4.264  -29.630 68.775  1.00 111.88 ? 592  ASP A C     1 
ATOM   5424  O  O     . ASP D 4  592  ? -5.342  -30.204 68.585  1.00 113.76 ? 592  ASP A O     1 
ATOM   5425  C  CB    . ASP D 4  592  ? -3.677  -28.472 66.672  1.00 130.80 ? 592  ASP A CB    1 
ATOM   5426  C  CG    . ASP D 4  592  ? -3.112  -28.659 65.286  1.00 125.02 ? 592  ASP A CG    1 
ATOM   5427  O  OD1   . ASP D 4  592  ? -1.881  -28.811 65.146  1.00 126.89 ? 592  ASP A OD1   1 
ATOM   5428  O  OD2   . ASP D 4  592  ? -3.911  -28.645 64.328  1.00 114.05 ? 592  ASP A OD2   1 
ATOM   5429  N  N     . GLU D 4  593  ? -3.922  -29.043 69.928  1.00 108.64 ? 593  GLU A N     1 
ATOM   5430  C  CA    . GLU D 4  593  ? -4.837  -28.838 71.059  1.00 131.15 ? 593  GLU A CA    1 
ATOM   5431  C  C     . GLU D 4  593  ? -5.353  -30.192 71.530  1.00 143.35 ? 593  GLU A C     1 
ATOM   5432  O  O     . GLU D 4  593  ? -4.532  -31.045 71.909  1.00 159.02 ? 593  GLU A O     1 
ATOM   5433  C  CB    . GLU D 4  593  ? -5.908  -27.827 70.634  1.00 139.14 ? 593  GLU A CB    1 
ATOM   5434  C  CG    . GLU D 4  593  ? -6.313  -26.843 71.709  1.00 154.66 ? 593  GLU A CG    1 
ATOM   5435  C  CD    . GLU D 4  593  ? -7.355  -25.858 71.222  1.00 164.95 ? 593  GLU A CD    1 
ATOM   5436  O  OE1   . GLU D 4  593  ? -8.523  -25.963 71.651  1.00 169.29 ? 593  GLU A OE1   1 
ATOM   5437  O  OE2   . GLU D 4  593  ? -7.006  -24.979 70.406  1.00 166.39 ? 593  GLU A OE2   1 
ATOM   5438  N  N     . GLY D 4  594  ? -6.657  -30.442 71.517  1.00 134.32 ? 594  GLY A N     1 
ATOM   5439  C  CA    . GLY D 4  594  ? -7.179  -31.749 71.857  1.00 117.39 ? 594  GLY A CA    1 
ATOM   5440  C  C     . GLY D 4  594  ? -7.418  -32.590 70.623  1.00 96.02  ? 594  GLY A C     1 
ATOM   5441  O  O     . GLY D 4  594  ? -8.561  -32.754 70.187  1.00 98.24  ? 594  GLY A O     1 
ATOM   5442  N  N     . THR D 4  595  ? -6.344  -33.123 70.043  1.00 90.97  ? 595  THR A N     1 
ATOM   5443  C  CA    . THR D 4  595  ? -6.462  -33.940 68.836  1.00 100.39 ? 595  THR A CA    1 
ATOM   5444  C  C     . THR D 4  595  ? -6.676  -35.399 69.236  1.00 94.59  ? 595  THR A C     1 
ATOM   5445  O  O     . THR D 4  595  ? -5.801  -36.263 69.129  1.00 88.28  ? 595  THR A O     1 
ATOM   5446  C  CB    . THR D 4  595  ? -5.243  -33.769 67.942  1.00 101.68 ? 595  THR A CB    1 
ATOM   5447  O  OG1   . THR D 4  595  ? -4.989  -32.377 67.754  1.00 92.62  ? 595  THR A OG1   1 
ATOM   5448  C  CG2   . THR D 4  595  ? -5.502  -34.373 66.568  1.00 104.01 ? 595  THR A CG2   1 
ATOM   5449  N  N     . THR D 4  596  ? -7.877  -35.650 69.743  1.00 95.80  ? 596  THR A N     1 
ATOM   5450  C  CA    . THR D 4  596  ? -8.383  -37.009 69.806  1.00 88.49  ? 596  THR A CA    1 
ATOM   5451  C  C     . THR D 4  596  ? -8.523  -37.544 68.387  1.00 88.98  ? 596  THR A C     1 
ATOM   5452  O  O     . THR D 4  596  ? -8.721  -36.788 67.434  1.00 107.56 ? 596  THR A O     1 
ATOM   5453  C  CB    . THR D 4  596  ? -9.737  -37.030 70.525  1.00 84.27  ? 596  THR A CB    1 
ATOM   5454  O  OG1   . THR D 4  596  ? -9.691  -36.145 71.650  1.00 94.26  ? 596  THR A OG1   1 
ATOM   5455  C  CG2   . THR D 4  596  ? -10.089 -38.429 71.015  1.00 86.08  ? 596  THR A CG2   1 
ATOM   5456  N  N     . LEU D 4  597  ? -8.406  -38.862 68.233  1.00 94.78  ? 597  LEU A N     1 
ATOM   5457  C  CA    . LEU D 4  597  ? -8.738  -39.432 66.935  1.00 100.57 ? 597  LEU A CA    1 
ATOM   5458  C  C     . LEU D 4  597  ? -10.240 -39.426 66.680  1.00 120.77 ? 597  LEU A C     1 
ATOM   5459  O  O     . LEU D 4  597  ? -10.664 -39.708 65.554  1.00 124.84 ? 597  LEU A O     1 
ATOM   5460  C  CB    . LEU D 4  597  ? -8.160  -40.845 66.817  1.00 95.85  ? 597  LEU A CB    1 
ATOM   5461  C  CG    . LEU D 4  597  ? -6.628  -40.980 66.733  1.00 85.54  ? 597  LEU A CG    1 
ATOM   5462  C  CD1   . LEU D 4  597  ? -6.242  -42.169 65.875  1.00 85.62  ? 597  LEU A CD1   1 
ATOM   5463  C  CD2   . LEU D 4  597  ? -5.944  -39.721 66.199  1.00 82.48  ? 597  LEU A CD2   1 
ATOM   5464  N  N     . LEU D 4  598  ? -11.045 -39.128 67.706  1.00 134.06 ? 598  LEU A N     1 
ATOM   5465  C  CA    . LEU D 4  598  ? -12.427 -38.713 67.497  1.00 137.85 ? 598  LEU A CA    1 
ATOM   5466  C  C     . LEU D 4  598  ? -12.493 -37.328 66.869  1.00 120.37 ? 598  LEU A C     1 
ATOM   5467  O  O     . LEU D 4  598  ? -13.375 -37.060 66.046  1.00 107.35 ? 598  LEU A O     1 
ATOM   5468  C  CB    . LEU D 4  598  ? -13.179 -38.717 68.826  1.00 142.59 ? 598  LEU A CB    1 
ATOM   5469  C  CG    . LEU D 4  598  ? -14.244 -39.776 69.097  1.00 138.99 ? 598  LEU A CG    1 
ATOM   5470  C  CD1   . LEU D 4  598  ? -15.198 -39.253 70.154  1.00 133.81 ? 598  LEU A CD1   1 
ATOM   5471  C  CD2   . LEU D 4  598  ? -14.993 -40.142 67.826  1.00 132.21 ? 598  LEU A CD2   1 
ATOM   5472  N  N     . SER D 4  599  ? -11.585 -36.429 67.279  1.00 113.76 ? 599  SER A N     1 
ATOM   5473  C  CA    . SER D 4  599  ? -11.392 -35.074 66.767  1.00 93.11  ? 599  SER A CA    1 
ATOM   5474  C  C     . SER D 4  599  ? -12.694 -34.284 66.740  1.00 102.06 ? 599  SER A C     1 
ATOM   5475  O  O     . SER D 4  599  ? -13.238 -34.035 65.657  1.00 110.63 ? 599  SER A O     1 
ATOM   5476  C  CB    . SER D 4  599  ? -10.783 -35.130 65.370  1.00 83.70  ? 599  SER A CB    1 
ATOM   5477  O  OG    . SER D 4  599  ? -10.302 -33.862 64.971  1.00 91.04  ? 599  SER A OG    1 
ATOM   5478  N  N     . PRO D 4  600  ? -13.217 -33.877 67.902  1.00 117.48 ? 600  PRO A N     1 
ATOM   5479  C  CA    . PRO D 4  600  ? -14.588 -33.338 67.938  1.00 132.13 ? 600  PRO A CA    1 
ATOM   5480  C  C     . PRO D 4  600  ? -14.741 -32.007 67.228  1.00 127.58 ? 600  PRO A C     1 
ATOM   5481  O  O     . PRO D 4  600  ? -15.827 -31.718 66.710  1.00 132.43 ? 600  PRO A O     1 
ATOM   5482  C  CB    . PRO D 4  600  ? -14.880 -33.206 69.441  1.00 140.29 ? 600  PRO A CB    1 
ATOM   5483  C  CG    . PRO D 4  600  ? -13.802 -33.975 70.141  1.00 139.28 ? 600  PRO A CG    1 
ATOM   5484  C  CD    . PRO D 4  600  ? -12.613 -33.955 69.241  1.00 130.27 ? 600  PRO A CD    1 
ATOM   5485  N  N     . LYS D 4  601  ? -13.691 -31.194 67.182  1.00 118.04 ? 601  LYS A N     1 
ATOM   5486  C  CA    . LYS D 4  601  ? -13.717 -29.922 66.478  1.00 124.45 ? 601  LYS A CA    1 
ATOM   5487  C  C     . LYS D 4  601  ? -13.001 -29.997 65.137  1.00 116.89 ? 601  LYS A C     1 
ATOM   5488  O  O     . LYS D 4  601  ? -12.789 -28.960 64.499  1.00 110.16 ? 601  LYS A O     1 
ATOM   5489  C  CB    . LYS D 4  601  ? -13.100 -28.835 67.356  1.00 125.16 ? 601  LYS A CB    1 
ATOM   5490  C  CG    . LYS D 4  601  ? -13.231 -29.121 68.846  1.00 118.76 ? 601  LYS A CG    1 
ATOM   5491  C  CD    . LYS D 4  601  ? -12.534 -28.065 69.686  1.00 126.65 ? 601  LYS A CD    1 
ATOM   5492  C  CE    . LYS D 4  601  ? -13.471 -26.922 70.028  1.00 131.03 ? 601  LYS A CE    1 
ATOM   5493  N  NZ    . LYS D 4  601  ? -12.746 -25.795 70.675  1.00 127.70 ? 601  LYS A NZ    1 
ATOM   5494  N  N     . ASP D 4  602  ? -12.626 -31.211 64.712  1.00 100.83 ? 602  ASP A N     1 
ATOM   5495  C  CA    . ASP D 4  602  ? -11.934 -31.485 63.448  1.00 85.86  ? 602  ASP A CA    1 
ATOM   5496  C  C     . ASP D 4  602  ? -10.616 -30.713 63.353  1.00 85.54  ? 602  ASP A C     1 
ATOM   5497  O  O     . ASP D 4  602  ? -10.322 -30.053 62.354  1.00 95.31  ? 602  ASP A O     1 
ATOM   5498  C  CB    . ASP D 4  602  ? -12.838 -31.202 62.243  1.00 91.60  ? 602  ASP A CB    1 
ATOM   5499  C  CG    . ASP D 4  602  ? -12.387 -31.927 60.989  1.00 85.70  ? 602  ASP A CG    1 
ATOM   5500  O  OD1   . ASP D 4  602  ? -12.199 -33.159 61.048  1.00 80.96  ? 602  ASP A OD1   1 
ATOM   5501  O  OD2   . ASP D 4  602  ? -12.239 -31.272 59.940  1.00 75.16  ? 602  ASP A OD2   1 
ATOM   5502  N  N     . ASN D 4  603  ? -9.818  -30.798 64.415  1.00 98.01  ? 603  ASN A N     1 
ATOM   5503  C  CA    . ASN D 4  603  ? -8.503  -30.180 64.425  1.00 98.24  ? 603  ASN A CA    1 
ATOM   5504  C  C     . ASN D 4  603  ? -7.480  -31.144 63.835  1.00 86.21  ? 603  ASN A C     1 
ATOM   5505  O  O     . ASN D 4  603  ? -7.790  -32.288 63.495  1.00 86.78  ? 603  ASN A O     1 
ATOM   5506  C  CB    . ASN D 4  603  ? -8.093  -29.778 65.840  1.00 99.97  ? 603  ASN A CB    1 
ATOM   5507  C  CG    . ASN D 4  603  ? -9.258  -29.297 66.668  1.00 108.95 ? 603  ASN A CG    1 
ATOM   5508  O  OD1   . ASN D 4  603  ? -10.167 -30.064 66.975  1.00 109.62 ? 603  ASN A OD1   1 
ATOM   5509  N  ND2   . ASN D 4  603  ? -9.244  -28.018 67.030  1.00 109.57 ? 603  ASN A ND2   1 
ATOM   5510  N  N     . GLY D 4  604  ? -6.240  -30.679 63.725  1.00 76.60  ? 604  GLY A N     1 
ATOM   5511  C  CA    . GLY D 4  604  ? -5.156  -31.515 63.258  1.00 81.85  ? 604  GLY A CA    1 
ATOM   5512  C  C     . GLY D 4  604  ? -5.303  -31.898 61.795  1.00 87.50  ? 604  GLY A C     1 
ATOM   5513  O  O     . GLY D 4  604  ? -6.133  -31.371 61.053  1.00 94.95  ? 604  GLY A O     1 
ATOM   5514  N  N     . MET D 4  605  ? -4.468  -32.850 61.389  1.00 86.51  ? 605  MET A N     1 
ATOM   5515  C  CA    . MET D 4  605  ? -4.513  -33.339 60.018  1.00 80.70  ? 605  MET A CA    1 
ATOM   5516  C  C     . MET D 4  605  ? -3.950  -34.747 59.951  1.00 86.24  ? 605  MET A C     1 
ATOM   5517  O  O     . MET D 4  605  ? -2.838  -34.998 60.424  1.00 91.14  ? 605  MET A O     1 
ATOM   5518  C  CB    . MET D 4  605  ? -3.734  -32.423 59.074  1.00 74.63  ? 605  MET A CB    1 
ATOM   5519  C  CG    . MET D 4  605  ? -3.965  -32.751 57.619  1.00 75.24  ? 605  MET A CG    1 
ATOM   5520  S  SD    . MET D 4  605  ? -5.713  -32.732 57.221  1.00 83.39  ? 605  MET A SD    1 
ATOM   5521  C  CE    . MET D 4  605  ? -6.049  -30.999 57.474  1.00 84.51  ? 605  MET A CE    1 
ATOM   5522  N  N     . LEU D 4  606  ? -4.719  -35.654 59.358  1.00 88.33  ? 606  LEU A N     1 
ATOM   5523  C  CA    . LEU D 4  606  ? -4.244  -36.993 59.033  1.00 87.11  ? 606  LEU A CA    1 
ATOM   5524  C  C     . LEU D 4  606  ? -4.531  -37.238 57.560  1.00 88.28  ? 606  LEU A C     1 
ATOM   5525  O  O     . LEU D 4  606  ? -5.695  -37.334 57.158  1.00 83.86  ? 606  LEU A O     1 
ATOM   5526  C  CB    . LEU D 4  606  ? -4.906  -38.052 59.908  1.00 93.50  ? 606  LEU A CB    1 
ATOM   5527  C  CG    . LEU D 4  606  ? -4.617  -39.516 59.586  1.00 93.89  ? 606  LEU A CG    1 
ATOM   5528  C  CD1   . LEU D 4  606  ? -3.152  -39.842 59.819  1.00 93.10  ? 606  LEU A CD1   1 
ATOM   5529  C  CD2   . LEU D 4  606  ? -5.493  -40.393 60.444  1.00 94.56  ? 606  LEU A CD2   1 
ATOM   5530  N  N     . ILE D 4  607  ? -3.475  -37.310 56.758  1.00 87.27  ? 607  ILE A N     1 
ATOM   5531  C  CA    . ILE D 4  607  ? -3.570  -37.641 55.343  1.00 96.99  ? 607  ILE A CA    1 
ATOM   5532  C  C     . ILE D 4  607  ? -2.839  -38.960 55.142  1.00 100.22 ? 607  ILE A C     1 
ATOM   5533  O  O     . ILE D 4  607  ? -1.705  -39.118 55.606  1.00 98.05  ? 607  ILE A O     1 
ATOM   5534  C  CB    . ILE D 4  607  ? -2.980  -36.523 54.460  1.00 92.87  ? 607  ILE A CB    1 
ATOM   5535  C  CG1   . ILE D 4  607  ? -4.004  -35.404 54.267  1.00 74.79  ? 607  ILE A CG1   1 
ATOM   5536  C  CG2   . ILE D 4  607  ? -2.552  -37.055 53.103  1.00 95.80  ? 607  ILE A CG2   1 
ATOM   5537  C  CD1   . ILE D 4  607  ? -3.393  -34.024 54.213  1.00 69.25  ? 607  ILE A CD1   1 
ATOM   5538  N  N     . ILE D 4  608  ? -3.494  -39.915 54.483  1.00 107.47 ? 608  ILE A N     1 
ATOM   5539  C  CA    . ILE D 4  608  ? -2.969  -41.268 54.341  1.00 110.41 ? 608  ILE A CA    1 
ATOM   5540  C  C     . ILE D 4  608  ? -3.061  -41.668 52.874  1.00 111.41 ? 608  ILE A C     1 
ATOM   5541  O  O     . ILE D 4  608  ? -4.159  -41.681 52.302  1.00 110.41 ? 608  ILE A O     1 
ATOM   5542  C  CB    . ILE D 4  608  ? -3.728  -42.271 55.231  1.00 115.75 ? 608  ILE A CB    1 
ATOM   5543  C  CG1   . ILE D 4  608  ? -3.213  -42.208 56.670  1.00 113.61 ? 608  ILE A CG1   1 
ATOM   5544  C  CG2   . ILE D 4  608  ? -3.569  -43.699 54.718  1.00 115.28 ? 608  ILE A CG2   1 
ATOM   5545  C  CD1   . ILE D 4  608  ? -1.726  -42.431 56.805  1.00 111.35 ? 608  ILE A CD1   1 
ATOM   5546  N  N     . ASP D 4  609  ? -1.902  -41.967 52.269  1.00 102.77 ? 609  ASP A N     1 
ATOM   5547  C  CA    . ASP D 4  609  ? -1.791  -42.537 50.920  1.00 95.58  ? 609  ASP A CA    1 
ATOM   5548  C  C     . ASP D 4  609  ? -2.455  -41.611 49.891  1.00 112.25 ? 609  ASP A C     1 
ATOM   5549  O  O     . ASP D 4  609  ? -3.280  -42.018 49.070  1.00 127.34 ? 609  ASP A O     1 
ATOM   5550  C  CB    . ASP D 4  609  ? -2.362  -43.968 50.900  1.00 94.49  ? 609  ASP A CB    1 
ATOM   5551  C  CG    . ASP D 4  609  ? -2.244  -44.656 49.543  1.00 91.14  ? 609  ASP A CG    1 
ATOM   5552  O  OD1   . ASP D 4  609  ? -1.227  -44.439 48.854  1.00 86.54  ? 609  ASP A OD1   1 
ATOM   5553  O  OD2   . ASP D 4  609  ? -3.176  -45.402 49.169  1.00 86.77  ? 609  ASP A OD2   1 
ATOM   5554  N  N     . GLY D 4  610  ? -2.119  -40.326 49.979  1.00 119.69 ? 610  GLY A N     1 
ATOM   5555  C  CA    . GLY D 4  610  ? -2.747  -39.337 49.116  1.00 124.36 ? 610  GLY A CA    1 
ATOM   5556  C  C     . GLY D 4  610  ? -4.234  -39.180 49.334  1.00 115.44 ? 610  GLY A C     1 
ATOM   5557  O  O     . GLY D 4  610  ? -4.953  -38.780 48.412  1.00 114.28 ? 610  GLY A O     1 
ATOM   5558  N  N     . GLN D 4  611  ? -4.720  -39.512 50.526  1.00 101.74 ? 611  GLN A N     1 
ATOM   5559  C  CA    . GLN D 4  611  ? -6.124  -39.365 50.868  1.00 95.44  ? 611  GLN A CA    1 
ATOM   5560  C  C     . GLN D 4  611  ? -6.221  -38.783 52.266  1.00 101.77 ? 611  GLN A C     1 
ATOM   5561  O  O     . GLN D 4  611  ? -5.486  -39.189 53.169  1.00 113.62 ? 611  GLN A O     1 
ATOM   5562  C  CB    . GLN D 4  611  ? -6.874  -40.701 50.800  1.00 94.54  ? 611  GLN A CB    1 
ATOM   5563  C  CG    . GLN D 4  611  ? -7.218  -41.147 49.393  1.00 98.92  ? 611  GLN A CG    1 
ATOM   5564  C  CD    . GLN D 4  611  ? -8.222  -40.229 48.730  1.00 89.06  ? 611  GLN A CD    1 
ATOM   5565  O  OE1   . GLN D 4  611  ? -9.280  -39.941 49.289  1.00 88.88  ? 611  GLN A OE1   1 
ATOM   5566  N  NE2   . GLN D 4  611  ? -7.892  -39.757 47.533  1.00 75.81  ? 611  GLN A NE2   1 
ATOM   5567  N  N     . ILE D 4  612  ? -7.119  -37.840 52.431  1.00 99.30  ? 612  ILE A N     1 
ATOM   5568  C  CA    . ILE D 4  612  ? -7.321  -37.160 53.702  1.00 92.85  ? 612  ILE A CA    1 
ATOM   5569  C  C     . ILE D 4  612  ? -8.302  -37.965 54.546  1.00 96.92  ? 612  ILE A C     1 
ATOM   5570  O  O     . ILE D 4  612  ? -9.242  -38.584 54.026  1.00 105.18 ? 612  ILE A O     1 
ATOM   5571  C  CB    . ILE D 4  612  ? -7.799  -35.715 53.451  1.00 92.67  ? 612  ILE A CB    1 
ATOM   5572  C  CG1   . ILE D 4  612  ? -7.882  -34.901 54.744  1.00 89.86  ? 612  ILE A CG1   1 
ATOM   5573  C  CG2   . ILE D 4  612  ? -9.087  -35.707 52.679  1.00 109.33 ? 612  ILE A CG2   1 
ATOM   5574  C  CD1   . ILE D 4  612  ? -8.449  -33.515 54.534  1.00 84.86  ? 612  ILE A CD1   1 
ATOM   5575  N  N     . ILE D 4  613  ? -8.058  -37.998 55.852  1.00 96.40  ? 613  ILE A N     1 
ATOM   5576  C  CA    . ILE D 4  613  ? -8.819  -38.819 56.785  1.00 94.04  ? 613  ILE A CA    1 
ATOM   5577  C  C     . ILE D 4  613  ? -9.654  -37.965 57.732  1.00 83.24  ? 613  ILE A C     1 
ATOM   5578  O  O     . ILE D 4  613  ? -10.863 -38.167 57.861  1.00 81.43  ? 613  ILE A O     1 
ATOM   5579  C  CB    . ILE D 4  613  ? -7.884  -39.769 57.567  1.00 92.13  ? 613  ILE A CB    1 
ATOM   5580  C  CG1   . ILE D 4  613  ? -6.836  -40.376 56.626  1.00 85.85  ? 613  ILE A CG1   1 
ATOM   5581  C  CG2   . ILE D 4  613  ? -8.680  -40.833 58.293  1.00 95.32  ? 613  ILE A CG2   1 
ATOM   5582  C  CD1   . ILE D 4  613  ? -7.328  -41.585 55.850  1.00 80.51  ? 613  ILE A CD1   1 
ATOM   5583  N  N     . PHE D 4  614  ? -9.022  -37.011 58.412  1.00 76.33  ? 614  PHE A N     1 
ATOM   5584  C  CA    . PHE D 4  614  ? -9.745  -36.076 59.263  1.00 75.86  ? 614  PHE A CA    1 
ATOM   5585  C  C     . PHE D 4  614  ? -8.948  -34.786 59.382  1.00 74.04  ? 614  PHE A C     1 
ATOM   5586  O  O     . PHE D 4  614  ? -7.716  -34.791 59.323  1.00 73.54  ? 614  PHE A O     1 
ATOM   5587  C  CB    . PHE D 4  614  ? -10.056 -36.688 60.644  1.00 86.00  ? 614  PHE A CB    1 
ATOM   5588  C  CG    . PHE D 4  614  ? -8.921  -36.617 61.644  1.00 100.27 ? 614  PHE A CG    1 
ATOM   5589  C  CD1   . PHE D 4  614  ? -8.002  -37.649 61.732  1.00 97.04  ? 614  PHE A CD1   1 
ATOM   5590  C  CD2   . PHE D 4  614  ? -8.805  -35.553 62.531  1.00 91.07  ? 614  PHE A CD2   1 
ATOM   5591  C  CE1   . PHE D 4  614  ? -6.976  -37.606 62.660  1.00 83.49  ? 614  PHE A CE1   1 
ATOM   5592  C  CE2   . PHE D 4  614  ? -7.773  -35.505 63.453  1.00 77.14  ? 614  PHE A CE2   1 
ATOM   5593  C  CZ    . PHE D 4  614  ? -6.858  -36.534 63.514  1.00 80.50  ? 614  PHE A CZ    1 
ATOM   5594  N  N     . GLY D 4  615  ? -9.673  -33.682 59.544  1.00 75.12  ? 615  GLY A N     1 
ATOM   5595  C  CA    . GLY D 4  615  ? -9.041  -32.381 59.773  1.00 77.30  ? 615  GLY A CA    1 
ATOM   5596  C  C     . GLY D 4  615  ? -9.379  -31.342 58.721  1.00 80.80  ? 615  GLY A C     1 
ATOM   5597  O  O     . GLY D 4  615  ? -9.333  -31.592 57.515  1.00 101.20 ? 615  GLY A O     1 
ATOM   5598  N  N     . VAL D 4  616  ? -9.722  -30.144 59.196  1.00 68.97  ? 616  VAL A N     1 
ATOM   5599  C  CA    . VAL D 4  616  ? -9.926  -29.004 58.312  1.00 67.44  ? 616  VAL A CA    1 
ATOM   5600  C  C     . VAL D 4  616  ? -8.575  -28.533 57.788  1.00 66.20  ? 616  VAL A C     1 
ATOM   5601  O  O     . VAL D 4  616  ? -7.635  -28.312 58.563  1.00 80.63  ? 616  VAL A O     1 
ATOM   5602  C  CB    . VAL D 4  616  ? -10.658 -27.878 59.061  1.00 66.87  ? 616  VAL A CB    1 
ATOM   5603  C  CG1   . VAL D 4  616  ? -10.402 -26.527 58.410  1.00 65.09  ? 616  VAL A CG1   1 
ATOM   5604  C  CG2   . VAL D 4  616  ? -12.146 -28.151 59.123  1.00 67.82  ? 616  VAL A CG2   1 
ATOM   5605  N  N     . VAL D 4  617  ? -8.462  -28.397 56.468  1.00 65.48  ? 617  VAL A N     1 
ATOM   5606  C  CA    . VAL D 4  617  ? -7.256  -27.827 55.873  1.00 76.78  ? 617  VAL A CA    1 
ATOM   5607  C  C     . VAL D 4  617  ? -7.265  -26.314 56.047  1.00 81.13  ? 617  VAL A C     1 
ATOM   5608  O  O     . VAL D 4  617  ? -8.249  -25.639 55.720  1.00 65.71  ? 617  VAL A O     1 
ATOM   5609  C  CB    . VAL D 4  617  ? -7.126  -28.209 54.390  1.00 66.66  ? 617  VAL A CB    1 
ATOM   5610  C  CG1   . VAL D 4  617  ? -5.809  -27.702 53.843  1.00 62.93  ? 617  VAL A CG1   1 
ATOM   5611  C  CG2   . VAL D 4  617  ? -7.157  -29.706 54.227  1.00 65.58  ? 617  VAL A CG2   1 
ATOM   5612  N  N     . GLU D 4  618  ? -6.163  -25.782 56.573  1.00 82.91  ? 618  GLU A N     1 
ATOM   5613  C  CA    . GLU D 4  618  ? -5.964  -24.347 56.713  1.00 84.74  ? 618  GLU A CA    1 
ATOM   5614  C  C     . GLU D 4  618  ? -4.500  -23.991 56.480  1.00 83.61  ? 618  GLU A C     1 
ATOM   5615  O  O     . GLU D 4  618  ? -3.804  -24.688 55.735  1.00 85.83  ? 618  GLU A O     1 
ATOM   5616  C  CB    . GLU D 4  618  ? -6.457  -23.872 58.085  1.00 92.49  ? 618  GLU A CB    1 
ATOM   5617  C  CG    . GLU D 4  618  ? -6.156  -24.811 59.248  1.00 91.59  ? 618  GLU A CG    1 
ATOM   5618  C  CD    . GLU D 4  618  ? -4.682  -24.953 59.533  1.00 101.81 ? 618  GLU A CD    1 
ATOM   5619  O  OE1   . GLU D 4  618  ? -4.000  -23.915 59.651  1.00 102.79 ? 618  GLU A OE1   1 
ATOM   5620  O  OE2   . GLU D 4  618  ? -4.207  -26.103 59.616  1.00 114.02 ? 618  GLU A OE2   1 
ATOM   5621  N  N     . LYS D 4  619  ? -4.016  -22.931 57.134  1.00 80.87  ? 619  LYS A N     1 
ATOM   5622  C  CA    . LYS D 4  619  ? -2.689  -22.403 56.819  1.00 67.67  ? 619  LYS A CA    1 
ATOM   5623  C  C     . LYS D 4  619  ? -1.578  -23.330 57.305  1.00 75.71  ? 619  LYS A C     1 
ATOM   5624  O  O     . LYS D 4  619  ? -0.543  -23.458 56.640  1.00 70.91  ? 619  LYS A O     1 
ATOM   5625  C  CB    . LYS D 4  619  ? -2.524  -21.006 57.422  1.00 63.06  ? 619  LYS A CB    1 
ATOM   5626  C  CG    . LYS D 4  619  ? -1.153  -20.386 57.186  1.00 65.71  ? 619  LYS A CG    1 
ATOM   5627  C  CD    . LYS D 4  619  ? -1.133  -18.896 57.463  1.00 64.42  ? 619  LYS A CD    1 
ATOM   5628  C  CE    . LYS D 4  619  ? 0.292   -18.367 57.418  1.00 59.84  ? 619  LYS A CE    1 
ATOM   5629  N  NZ    . LYS D 4  619  ? 0.370   -16.921 57.758  1.00 56.20  ? 619  LYS A NZ    1 
ATOM   5630  N  N     . LYS D 4  620  ? -1.772  -23.988 58.455  1.00 90.65  ? 620  LYS A N     1 
ATOM   5631  C  CA    . LYS D 4  620  ? -0.726  -24.852 59.005  1.00 99.24  ? 620  LYS A CA    1 
ATOM   5632  C  C     . LYS D 4  620  ? -0.440  -26.029 58.083  1.00 84.73  ? 620  LYS A C     1 
ATOM   5633  O  O     . LYS D 4  620  ? 0.708   -26.473 57.960  1.00 83.99  ? 620  LYS A O     1 
ATOM   5634  C  CB    . LYS D 4  620  ? -1.123  -25.377 60.385  1.00 106.85 ? 620  LYS A CB    1 
ATOM   5635  C  CG    . LYS D 4  620  ? -1.312  -24.338 61.473  1.00 104.72 ? 620  LYS A CG    1 
ATOM   5636  C  CD    . LYS D 4  620  ? -1.998  -24.980 62.673  1.00 103.16 ? 620  LYS A CD    1 
ATOM   5637  C  CE    . LYS D 4  620  ? -2.538  -23.951 63.648  1.00 102.31 ? 620  LYS A CE    1 
ATOM   5638  N  NZ    . LYS D 4  620  ? -4.024  -24.001 63.709  1.00 98.39  ? 620  LYS A NZ    1 
ATOM   5639  N  N     . THR D 4  621  ? -1.475  -26.536 57.418  1.00 75.91  ? 621  THR A N     1 
ATOM   5640  C  CA    . THR D 4  621  ? -1.331  -27.697 56.553  1.00 71.55  ? 621  THR A CA    1 
ATOM   5641  C  C     . THR D 4  621  ? -0.754  -27.324 55.194  1.00 70.68  ? 621  THR A C     1 
ATOM   5642  O  O     . THR D 4  621  ? 0.169   -27.982 54.703  1.00 62.60  ? 621  THR A O     1 
ATOM   5643  C  CB    . THR D 4  621  ? -2.687  -28.377 56.374  1.00 70.53  ? 621  THR A CB    1 
ATOM   5644  O  OG1   . THR D 4  621  ? -3.416  -28.333 57.608  1.00 80.43  ? 621  THR A OG1   1 
ATOM   5645  C  CG2   . THR D 4  621  ? -2.509  -29.812 55.934  1.00 66.83  ? 621  THR A CG2   1 
ATOM   5646  N  N     . VAL D 4  622  ? -1.289  -26.273 54.576  1.00 80.74  ? 622  VAL A N     1 
ATOM   5647  C  CA    . VAL D 4  622  ? -1.060  -25.991 53.165  1.00 73.40  ? 622  VAL A CA    1 
ATOM   5648  C  C     . VAL D 4  622  ? -0.342  -24.667 52.936  1.00 77.97  ? 622  VAL A C     1 
ATOM   5649  O  O     . VAL D 4  622  ? -0.119  -24.284 51.783  1.00 89.68  ? 622  VAL A O     1 
ATOM   5650  C  CB    . VAL D 4  622  ? -2.391  -26.037 52.382  1.00 60.82  ? 622  VAL A CB    1 
ATOM   5651  C  CG1   . VAL D 4  622  ? -3.198  -24.744 52.553  1.00 58.89  ? 622  VAL A CG1   1 
ATOM   5652  C  CG2   . VAL D 4  622  ? -2.202  -26.453 50.915  1.00 62.66  ? 622  VAL A CG2   1 
ATOM   5653  N  N     . GLY D 4  623  ? 0.058   -23.970 53.988  1.00 63.11  ? 623  GLY A N     1 
ATOM   5654  C  CA    . GLY D 4  623  ? 0.869   -22.784 53.830  1.00 58.44  ? 623  GLY A CA    1 
ATOM   5655  C  C     . GLY D 4  623  ? 2.327   -23.137 53.629  1.00 69.96  ? 623  GLY A C     1 
ATOM   5656  O  O     . GLY D 4  623  ? 2.688   -24.263 53.280  1.00 78.36  ? 623  GLY A O     1 
ATOM   5657  N  N     . SER D 4  624  ? 3.186   -22.150 53.881  1.00 76.26  ? 624  SER A N     1 
ATOM   5658  C  CA    . SER D 4  624  ? 4.623   -22.350 53.742  1.00 81.61  ? 624  SER A CA    1 
ATOM   5659  C  C     . SER D 4  624  ? 5.218   -22.847 55.053  1.00 82.41  ? 624  SER A C     1 
ATOM   5660  O  O     . SER D 4  624  ? 6.392   -22.597 55.341  1.00 101.23 ? 624  SER A O     1 
ATOM   5661  C  CB    . SER D 4  624  ? 5.305   -21.051 53.308  1.00 87.10  ? 624  SER A CB    1 
ATOM   5662  O  OG    . SER D 4  624  ? 5.160   -20.043 54.294  1.00 92.31  ? 624  SER A OG    1 
ATOM   5663  N  N     . SER D 4  625  ? 4.418   -23.554 55.845  1.00 67.32  ? 625  SER A N     1 
ATOM   5664  C  CA    . SER D 4  625  ? 4.824   -23.981 57.174  1.00 78.89  ? 625  SER A CA    1 
ATOM   5665  C  C     . SER D 4  625  ? 5.909   -25.050 57.096  1.00 88.27  ? 625  SER A C     1 
ATOM   5666  O  O     . SER D 4  625  ? 6.045   -25.771 56.103  1.00 71.53  ? 625  SER A O     1 
ATOM   5667  C  CB    . SER D 4  625  ? 3.624   -24.520 57.950  1.00 75.97  ? 625  SER A CB    1 
ATOM   5668  O  OG    . SER D 4  625  ? 3.077   -25.662 57.313  1.00 63.49  ? 625  SER A OG    1 
ATOM   5669  N  N     . ASN D 4  626  ? 6.695   -25.134 58.166  1.00 97.56  ? 626  ASN A N     1 
ATOM   5670  C  CA    . ASN D 4  626  ? 7.644   -26.228 58.312  1.00 107.10 ? 626  ASN A CA    1 
ATOM   5671  C  C     . ASN D 4  626  ? 6.894   -27.525 58.574  1.00 99.34  ? 626  ASN A C     1 
ATOM   5672  O  O     . ASN D 4  626  ? 5.956   -27.567 59.375  1.00 110.84 ? 626  ASN A O     1 
ATOM   5673  C  CB    . ASN D 4  626  ? 8.621   -25.945 59.452  1.00 114.61 ? 626  ASN A CB    1 
ATOM   5674  C  CG    . ASN D 4  626  ? 9.906   -26.747 59.335  1.00 122.18 ? 626  ASN A CG    1 
ATOM   5675  O  OD1   . ASN D 4  626  ? 9.997   -27.683 58.541  1.00 125.43 ? 626  ASN A OD1   1 
ATOM   5676  N  ND2   . ASN D 4  626  ? 10.905  -26.384 60.131  1.00 109.25 ? 626  ASN A ND2   1 
ATOM   5677  N  N     . GLY D 4  627  ? 7.311   -28.587 57.892  1.00 63.00  ? 627  GLY A N     1 
ATOM   5678  C  CA    . GLY D 4  627  ? 6.592   -29.844 57.993  1.00 64.36  ? 627  GLY A CA    1 
ATOM   5679  C  C     . GLY D 4  627  ? 5.202   -29.789 57.407  1.00 85.37  ? 627  GLY A C     1 
ATOM   5680  O  O     . GLY D 4  627  ? 4.310   -30.511 57.866  1.00 78.32  ? 627  GLY A O     1 
ATOM   5681  N  N     . GLY D 4  628  ? 4.986   -28.928 56.411  1.00 99.19  ? 628  GLY A N     1 
ATOM   5682  C  CA    . GLY D 4  628  ? 3.709   -28.838 55.739  1.00 101.80 ? 628  GLY A CA    1 
ATOM   5683  C  C     . GLY D 4  628  ? 3.631   -29.771 54.545  1.00 94.84  ? 628  GLY A C     1 
ATOM   5684  O  O     . GLY D 4  628  ? 4.558   -30.521 54.243  1.00 103.47 ? 628  GLY A O     1 
ATOM   5685  N  N     . LEU D 4  629  ? 2.489   -29.705 53.857  1.00 81.32  ? 629  LEU A N     1 
ATOM   5686  C  CA    . LEU D 4  629  ? 2.235   -30.601 52.733  1.00 69.68  ? 629  LEU A CA    1 
ATOM   5687  C  C     . LEU D 4  629  ? 3.185   -30.310 51.575  1.00 77.41  ? 629  LEU A C     1 
ATOM   5688  O  O     . LEU D 4  629  ? 3.609   -31.229 50.865  1.00 75.84  ? 629  LEU A O     1 
ATOM   5689  C  CB    . LEU D 4  629  ? 0.772   -30.469 52.302  1.00 69.00  ? 629  LEU A CB    1 
ATOM   5690  C  CG    . LEU D 4  629  ? -0.040  -31.642 51.740  1.00 70.79  ? 629  LEU A CG    1 
ATOM   5691  C  CD1   . LEU D 4  629  ? -1.495  -31.227 51.596  1.00 83.66  ? 629  LEU A CD1   1 
ATOM   5692  C  CD2   . LEU D 4  629  ? 0.481   -32.141 50.410  1.00 65.13  ? 629  LEU A CD2   1 
ATOM   5693  N  N     . ILE D 4  630  ? 3.538   -29.039 51.383  1.00 80.46  ? 630  ILE A N     1 
ATOM   5694  C  CA    . ILE D 4  630  ? 4.514   -28.669 50.361  1.00 80.52  ? 630  ILE A CA    1 
ATOM   5695  C  C     . ILE D 4  630  ? 5.908   -29.143 50.758  1.00 84.41  ? 630  ILE A C     1 
ATOM   5696  O  O     . ILE D 4  630  ? 6.697   -29.576 49.908  1.00 83.05  ? 630  ILE A O     1 
ATOM   5697  C  CB    . ILE D 4  630  ? 4.465   -27.148 50.101  1.00 76.99  ? 630  ILE A CB    1 
ATOM   5698  C  CG1   . ILE D 4  630  ? 3.090   -26.721 49.576  1.00 72.06  ? 630  ILE A CG1   1 
ATOM   5699  C  CG2   . ILE D 4  630  ? 5.551   -26.696 49.145  1.00 68.79  ? 630  ILE A CG2   1 
ATOM   5700  C  CD1   . ILE D 4  630  ? 2.152   -26.203 50.618  1.00 85.78  ? 630  ILE A CD1   1 
ATOM   5701  N  N     . HIS D 4  631  ? 6.225   -29.097 52.054  1.00 86.51  ? 631  HIS A N     1 
ATOM   5702  C  CA    . HIS D 4  631  ? 7.511   -29.604 52.522  1.00 85.93  ? 631  HIS A CA    1 
ATOM   5703  C  C     . HIS D 4  631  ? 7.610   -31.114 52.337  1.00 84.93  ? 631  HIS A C     1 
ATOM   5704  O  O     . HIS D 4  631  ? 8.701   -31.640 52.097  1.00 96.19  ? 631  HIS A O     1 
ATOM   5705  C  CB    . HIS D 4  631  ? 7.705   -29.226 53.992  1.00 90.00  ? 631  HIS A CB    1 
ATOM   5706  C  CG    . HIS D 4  631  ? 9.133   -29.224 54.442  1.00 96.35  ? 631  HIS A CG    1 
ATOM   5707  N  ND1   . HIS D 4  631  ? 9.526   -28.697 55.654  1.00 95.08  ? 631  HIS A ND1   1 
ATOM   5708  C  CD2   . HIS D 4  631  ? 10.264  -29.663 53.840  1.00 91.50  ? 631  HIS A CD2   1 
ATOM   5709  C  CE1   . HIS D 4  631  ? 10.835  -28.819 55.782  1.00 90.57  ? 631  HIS A CE1   1 
ATOM   5710  N  NE2   . HIS D 4  631  ? 11.307  -29.404 54.696  1.00 94.89  ? 631  HIS A NE2   1 
ATOM   5711  N  N     . VAL D 4  632  ? 6.480   -31.815 52.417  1.00 73.67  ? 632  VAL A N     1 
ATOM   5712  C  CA    . VAL D 4  632  ? 6.476   -33.262 52.227  1.00 66.12  ? 632  VAL A CA    1 
ATOM   5713  C  C     . VAL D 4  632  ? 6.696   -33.609 50.761  1.00 74.65  ? 632  VAL A C     1 
ATOM   5714  O  O     . VAL D 4  632  ? 7.623   -34.350 50.411  1.00 88.79  ? 632  VAL A O     1 
ATOM   5715  C  CB    . VAL D 4  632  ? 5.161   -33.870 52.745  1.00 67.05  ? 632  VAL A CB    1 
ATOM   5716  C  CG1   . VAL D 4  632  ? 5.045   -35.320 52.316  1.00 70.54  ? 632  VAL A CG1   1 
ATOM   5717  C  CG2   . VAL D 4  632  ? 5.086   -33.763 54.254  1.00 67.40  ? 632  VAL A CG2   1 
ATOM   5718  N  N     . VAL D 4  633  ? 5.845   -33.066 49.885  1.00 69.58  ? 633  VAL A N     1 
ATOM   5719  C  CA    . VAL D 4  633  ? 5.771   -33.504 48.493  1.00 68.15  ? 633  VAL A CA    1 
ATOM   5720  C  C     . VAL D 4  633  ? 7.039   -33.135 47.728  1.00 70.57  ? 633  VAL A C     1 
ATOM   5721  O  O     . VAL D 4  633  ? 7.482   -33.883 46.847  1.00 77.19  ? 633  VAL A O     1 
ATOM   5722  C  CB    . VAL D 4  633  ? 4.497   -32.914 47.855  1.00 64.86  ? 633  VAL A CB    1 
ATOM   5723  C  CG1   . VAL D 4  633  ? 4.479   -33.095 46.350  1.00 64.78  ? 633  VAL A CG1   1 
ATOM   5724  C  CG2   . VAL D 4  633  ? 3.271   -33.555 48.471  1.00 65.83  ? 633  VAL A CG2   1 
ATOM   5725  N  N     . THR D 4  634  ? 7.672   -32.015 48.080  1.00 74.17  ? 634  THR A N     1 
ATOM   5726  C  CA    . THR D 4  634  ? 8.940   -31.644 47.466  1.00 78.07  ? 634  THR A CA    1 
ATOM   5727  C  C     . THR D 4  634  ? 10.059  -32.625 47.809  1.00 70.71  ? 634  THR A C     1 
ATOM   5728  O  O     . THR D 4  634  ? 11.031  -32.730 47.053  1.00 64.33  ? 634  THR A O     1 
ATOM   5729  C  CB    . THR D 4  634  ? 9.324   -30.230 47.903  1.00 81.56  ? 634  THR A CB    1 
ATOM   5730  O  OG1   . THR D 4  634  ? 8.149   -29.413 47.958  1.00 93.19  ? 634  THR A OG1   1 
ATOM   5731  C  CG2   . THR D 4  634  ? 10.299  -29.609 46.915  1.00 77.87  ? 634  THR A CG2   1 
ATOM   5732  N  N     . ARG D 4  635  ? 9.934   -33.353 48.920  1.00 72.07  ? 635  ARG A N     1 
ATOM   5733  C  CA    . ARG D 4  635  ? 10.880  -34.389 49.308  1.00 67.70  ? 635  ARG A CA    1 
ATOM   5734  C  C     . ARG D 4  635  ? 10.438  -35.773 48.852  1.00 76.95  ? 635  ARG A C     1 
ATOM   5735  O  O     . ARG D 4  635  ? 11.232  -36.525 48.279  1.00 75.82  ? 635  ARG A O     1 
ATOM   5736  C  CB    . ARG D 4  635  ? 11.055  -34.398 50.832  1.00 66.93  ? 635  ARG A CB    1 
ATOM   5737  C  CG    . ARG D 4  635  ? 11.744  -33.171 51.389  1.00 65.73  ? 635  ARG A CG    1 
ATOM   5738  C  CD    . ARG D 4  635  ? 13.220  -33.176 51.073  1.00 66.36  ? 635  ARG A CD    1 
ATOM   5739  N  NE    . ARG D 4  635  ? 13.692  -31.823 50.803  1.00 89.16  ? 635  ARG A NE    1 
ATOM   5740  C  CZ    . ARG D 4  635  ? 14.320  -31.460 49.690  1.00 112.00 ? 635  ARG A CZ    1 
ATOM   5741  N  NH1   . ARG D 4  635  ? 14.557  -32.352 48.736  1.00 131.97 ? 635  ARG A NH1   1 
ATOM   5742  N  NH2   . ARG D 4  635  ? 14.716  -30.210 49.532  1.00 108.18 ? 635  ARG A NH2   1 
ATOM   5743  N  N     . GLU D 4  636  ? 9.169   -36.117 49.098  1.00 77.57  ? 636  GLU A N     1 
ATOM   5744  C  CA    . GLU D 4  636  ? 8.686   -37.472 48.853  1.00 95.81  ? 636  GLU A CA    1 
ATOM   5745  C  C     . GLU D 4  636  ? 8.597   -37.769 47.361  1.00 106.10 ? 636  GLU A C     1 
ATOM   5746  O  O     . GLU D 4  636  ? 9.076   -38.808 46.896  1.00 106.37 ? 636  GLU A O     1 
ATOM   5747  C  CB    . GLU D 4  636  ? 7.324   -37.656 49.522  1.00 102.14 ? 636  GLU A CB    1 
ATOM   5748  C  CG    . GLU D 4  636  ? 7.047   -39.064 50.018  1.00 103.61 ? 636  GLU A CG    1 
ATOM   5749  C  CD    . GLU D 4  636  ? 7.376   -39.230 51.488  1.00 101.69 ? 636  GLU A CD    1 
ATOM   5750  O  OE1   . GLU D 4  636  ? 6.480   -38.997 52.325  1.00 99.31  ? 636  GLU A OE1   1 
ATOM   5751  O  OE2   . GLU D 4  636  ? 8.529   -39.583 51.809  1.00 103.23 ? 636  GLU A OE2   1 
ATOM   5752  N  N     . LYS D 4  637  ? 7.985   -36.865 46.595  1.00 110.14 ? 637  LYS A N     1 
ATOM   5753  C  CA    . LYS D 4  637  ? 7.829   -37.043 45.155  1.00 100.79 ? 637  LYS A CA    1 
ATOM   5754  C  C     . LYS D 4  637  ? 8.903   -36.296 44.373  1.00 96.71  ? 637  LYS A C     1 
ATOM   5755  O  O     . LYS D 4  637  ? 9.640   -36.902 43.590  1.00 105.61 ? 637  LYS A O     1 
ATOM   5756  C  CB    . LYS D 4  637  ? 6.428   -36.597 44.721  1.00 83.21  ? 637  LYS A CB    1 
ATOM   5757  C  CG    . LYS D 4  637  ? 5.319   -37.371 45.397  1.00 89.88  ? 637  LYS A CG    1 
ATOM   5758  C  CD    . LYS D 4  637  ? 5.468   -38.853 45.107  1.00 98.07  ? 637  LYS A CD    1 
ATOM   5759  C  CE    . LYS D 4  637  ? 4.216   -39.616 45.463  1.00 98.32  ? 637  LYS A CE    1 
ATOM   5760  N  NZ    . LYS D 4  637  ? 4.447   -41.086 45.493  1.00 105.12 ? 637  LYS A NZ    1 
ATOM   5761  N  N     . GLY D 4  638  ? 9.005   -34.987 44.570  1.00 95.16  ? 638  GLY A N     1 
ATOM   5762  C  CA    . GLY D 4  638  ? 10.004  -34.200 43.893  1.00 94.56  ? 638  GLY A CA    1 
ATOM   5763  C  C     . GLY D 4  638  ? 9.581   -32.759 43.716  1.00 92.26  ? 638  GLY A C     1 
ATOM   5764  O  O     . GLY D 4  638  ? 8.514   -32.338 44.176  1.00 106.91 ? 638  GLY A O     1 
ATOM   5765  N  N     . PRO D 4  639  ? 10.424  -31.962 43.051  1.00 74.79  ? 639  PRO A N     1 
ATOM   5766  C  CA    . PRO D 4  639  ? 10.068  -30.562 42.787  1.00 73.61  ? 639  PRO A CA    1 
ATOM   5767  C  C     . PRO D 4  639  ? 8.960   -30.409 41.754  1.00 72.77  ? 639  PRO A C     1 
ATOM   5768  O  O     . PRO D 4  639  ? 8.005   -29.658 41.979  1.00 63.63  ? 639  PRO A O     1 
ATOM   5769  C  CB    . PRO D 4  639  ? 11.386  -29.954 42.287  1.00 63.35  ? 639  PRO A CB    1 
ATOM   5770  C  CG    . PRO D 4  639  ? 12.175  -31.119 41.775  1.00 62.08  ? 639  PRO A CG    1 
ATOM   5771  C  CD    . PRO D 4  639  ? 11.815  -32.263 42.667  1.00 65.52  ? 639  PRO A CD    1 
ATOM   5772  N  N     . GLN D 4  640  ? 9.077   -31.120 40.627  1.00 68.68  ? 640  GLN A N     1 
ATOM   5773  C  CA    . GLN D 4  640  ? 8.123   -30.970 39.531  1.00 81.83  ? 640  GLN A CA    1 
ATOM   5774  C  C     . GLN D 4  640  ? 6.733   -31.463 39.913  1.00 83.18  ? 640  GLN A C     1 
ATOM   5775  O  O     . GLN D 4  640  ? 5.734   -30.964 39.384  1.00 74.47  ? 640  GLN A O     1 
ATOM   5776  C  CB    . GLN D 4  640  ? 8.622   -31.722 38.296  1.00 100.80 ? 640  GLN A CB    1 
ATOM   5777  C  CG    . GLN D 4  640  ? 9.653   -30.975 37.452  1.00 105.25 ? 640  GLN A CG    1 
ATOM   5778  C  CD    . GLN D 4  640  ? 9.121   -29.693 36.823  1.00 104.07 ? 640  GLN A CD    1 
ATOM   5779  O  OE1   . GLN D 4  640  ? 7.914   -29.520 36.638  1.00 99.43  ? 640  GLN A OE1   1 
ATOM   5780  N  NE2   . GLN D 4  640  ? 10.031  -28.787 36.484  1.00 106.36 ? 640  GLN A NE2   1 
ATOM   5781  N  N     . VAL D 4  641  ? 6.648   -32.434 40.819  1.00 75.54  ? 641  VAL A N     1 
ATOM   5782  C  CA    . VAL D 4  641  ? 5.347   -32.901 41.275  1.00 64.72  ? 641  VAL A CA    1 
ATOM   5783  C  C     . VAL D 4  641  ? 4.768   -31.942 42.308  1.00 69.02  ? 641  VAL A C     1 
ATOM   5784  O  O     . VAL D 4  641  ? 3.544   -31.830 42.443  1.00 81.30  ? 641  VAL A O     1 
ATOM   5785  C  CB    . VAL D 4  641  ? 5.473   -34.330 41.825  1.00 65.53  ? 641  VAL A CB    1 
ATOM   5786  C  CG1   . VAL D 4  641  ? 4.103   -34.965 42.014  1.00 69.38  ? 641  VAL A CG1   1 
ATOM   5787  C  CG2   . VAL D 4  641  ? 6.329   -35.167 40.892  1.00 66.37  ? 641  VAL A CG2   1 
ATOM   5788  N  N     . CYS D 4  642  ? 5.624   -31.231 43.041  1.00 62.22  ? 642  CYS A N     1 
ATOM   5789  C  CA    . CYS D 4  642  ? 5.136   -30.223 43.971  1.00 61.82  ? 642  CYS A CA    1 
ATOM   5790  C  C     . CYS D 4  642  ? 4.715   -28.956 43.242  1.00 72.96  ? 642  CYS A C     1 
ATOM   5791  O  O     . CYS D 4  642  ? 3.743   -28.307 43.640  1.00 90.98  ? 642  CYS A O     1 
ATOM   5792  C  CB    . CYS D 4  642  ? 6.204   -29.905 45.015  1.00 79.03  ? 642  CYS A CB    1 
ATOM   5793  S  SG    . CYS D 4  642  ? 5.543   -29.179 46.525  1.00 92.78  ? 642  CYS A SG    1 
ATOM   5794  N  N     . ALA D 4  643  ? 5.443   -28.586 42.185  1.00 74.47  ? 643  ALA A N     1 
ATOM   5795  C  CA    . ALA D 4  643  ? 5.057   -27.428 41.387  1.00 64.57  ? 643  ALA A CA    1 
ATOM   5796  C  C     . ALA D 4  643  ? 3.737   -27.671 40.675  1.00 77.00  ? 643  ALA A C     1 
ATOM   5797  O  O     . ALA D 4  643  ? 2.879   -26.782 40.616  1.00 95.37  ? 643  ALA A O     1 
ATOM   5798  C  CB    . ALA D 4  643  ? 6.151   -27.096 40.380  1.00 57.77  ? 643  ALA A CB    1 
ATOM   5799  N  N     . LYS D 4  644  ? 3.552   -28.877 40.133  1.00 79.52  ? 644  LYS A N     1 
ATOM   5800  C  CA    . LYS D 4  644  ? 2.263   -29.251 39.570  1.00 86.57  ? 644  LYS A CA    1 
ATOM   5801  C  C     . LYS D 4  644  ? 1.187   -29.382 40.635  1.00 80.36  ? 644  LYS A C     1 
ATOM   5802  O  O     . LYS D 4  644  ? 0.001   -29.296 40.305  1.00 75.27  ? 644  LYS A O     1 
ATOM   5803  C  CB    . LYS D 4  644  ? 2.381   -30.565 38.799  1.00 98.73  ? 644  LYS A CB    1 
ATOM   5804  C  CG    . LYS D 4  644  ? 2.577   -30.395 37.306  1.00 99.32  ? 644  LYS A CG    1 
ATOM   5805  C  CD    . LYS D 4  644  ? 1.547   -31.206 36.540  1.00 108.09 ? 644  LYS A CD    1 
ATOM   5806  C  CE    . LYS D 4  644  ? 1.647   -32.683 36.889  1.00 113.88 ? 644  LYS A CE    1 
ATOM   5807  N  NZ    . LYS D 4  644  ? 0.689   -33.510 36.106  1.00 118.40 ? 644  LYS A NZ    1 
ATOM   5808  N  N     . LEU D 4  645  ? 1.570   -29.585 41.898  1.00 86.35  ? 645  LEU A N     1 
ATOM   5809  C  CA    . LEU D 4  645  ? 0.577   -29.712 42.957  1.00 79.75  ? 645  LEU A CA    1 
ATOM   5810  C  C     . LEU D 4  645  ? -0.088  -28.375 43.255  1.00 66.94  ? 645  LEU A C     1 
ATOM   5811  O  O     . LEU D 4  645  ? -1.266  -28.351 43.623  1.00 67.32  ? 645  LEU A O     1 
ATOM   5812  C  CB    . LEU D 4  645  ? 1.231   -30.297 44.213  1.00 61.79  ? 645  LEU A CB    1 
ATOM   5813  C  CG    . LEU D 4  645  ? 0.656   -30.059 45.610  1.00 61.84  ? 645  LEU A CG    1 
ATOM   5814  C  CD1   . LEU D 4  645  ? -0.644  -30.824 45.788  1.00 62.91  ? 645  LEU A CD1   1 
ATOM   5815  C  CD2   . LEU D 4  645  ? 1.661   -30.463 46.672  1.00 65.50  ? 645  LEU A CD2   1 
ATOM   5816  N  N     . PHE D 4  646  ? 0.634   -27.264 43.070  1.00 63.20  ? 646  PHE A N     1 
ATOM   5817  C  CA    . PHE D 4  646  ? 0.092   -25.939 43.378  1.00 66.04  ? 646  PHE A CA    1 
ATOM   5818  C  C     . PHE D 4  646  ? -1.130  -25.618 42.530  1.00 76.35  ? 646  PHE A C     1 
ATOM   5819  O  O     . PHE D 4  646  ? -2.135  -25.109 43.040  1.00 70.53  ? 646  PHE A O     1 
ATOM   5820  C  CB    . PHE D 4  646  ? 1.156   -24.864 43.165  1.00 59.81  ? 646  PHE A CB    1 
ATOM   5821  C  CG    . PHE D 4  646  ? 2.117   -24.723 44.301  1.00 58.31  ? 646  PHE A CG    1 
ATOM   5822  C  CD1   . PHE D 4  646  ? 3.377   -25.281 44.233  1.00 64.19  ? 646  PHE A CD1   1 
ATOM   5823  C  CD2   . PHE D 4  646  ? 1.765   -24.008 45.431  1.00 66.07  ? 646  PHE A CD2   1 
ATOM   5824  C  CE1   . PHE D 4  646  ? 4.264   -25.143 45.277  1.00 76.26  ? 646  PHE A CE1   1 
ATOM   5825  C  CE2   . PHE D 4  646  ? 2.648   -23.865 46.480  1.00 79.46  ? 646  PHE A CE2   1 
ATOM   5826  C  CZ    . PHE D 4  646  ? 3.902   -24.435 46.402  1.00 85.28  ? 646  PHE A CZ    1 
ATOM   5827  N  N     . GLY D 4  647  ? -1.052  -25.894 41.227  1.00 67.60  ? 647  GLY A N     1 
ATOM   5828  C  CA    . GLY D 4  647  ? -2.170  -25.593 40.351  1.00 74.37  ? 647  GLY A CA    1 
ATOM   5829  C  C     . GLY D 4  647  ? -3.392  -26.438 40.651  1.00 66.22  ? 647  GLY A C     1 
ATOM   5830  O  O     . GLY D 4  647  ? -4.516  -25.933 40.664  1.00 74.55  ? 647  GLY A O     1 
ATOM   5831  N  N     . ASN D 4  648  ? -3.187  -27.726 40.935  1.00 59.53  ? 648  ASN A N     1 
ATOM   5832  C  CA    . ASN D 4  648  ? -4.317  -28.627 41.130  1.00 60.73  ? 648  ASN A CA    1 
ATOM   5833  C  C     . ASN D 4  648  ? -5.094  -28.308 42.401  1.00 69.29  ? 648  ASN A C     1 
ATOM   5834  O  O     . ASN D 4  648  ? -6.313  -28.498 42.436  1.00 74.07  ? 648  ASN A O     1 
ATOM   5835  C  CB    . ASN D 4  648  ? -3.832  -30.071 41.145  1.00 71.27  ? 648  ASN A CB    1 
ATOM   5836  C  CG    . ASN D 4  648  ? -2.841  -30.347 40.046  1.00 77.26  ? 648  ASN A CG    1 
ATOM   5837  O  OD1   . ASN D 4  648  ? -2.669  -29.533 39.141  1.00 85.64  ? 648  ASN A OD1   1 
ATOM   5838  N  ND2   . ASN D 4  648  ? -2.184  -31.497 40.110  1.00 75.07  ? 648  ASN A ND2   1 
ATOM   5839  N  N     . ILE D 4  649  ? -4.421  -27.822 43.446  1.00 69.01  ? 649  ILE A N     1 
ATOM   5840  C  CA    . ILE D 4  649  ? -5.151  -27.244 44.570  1.00 70.82  ? 649  ILE A CA    1 
ATOM   5841  C  C     . ILE D 4  649  ? -5.819  -25.943 44.151  1.00 70.41  ? 649  ILE A C     1 
ATOM   5842  O  O     . ILE D 4  649  ? -6.956  -25.660 44.545  1.00 64.24  ? 649  ILE A O     1 
ATOM   5843  C  CB    . ILE D 4  649  ? -4.227  -27.032 45.784  1.00 73.37  ? 649  ILE A CB    1 
ATOM   5844  C  CG1   . ILE D 4  649  ? -3.321  -28.245 46.012  1.00 65.23  ? 649  ILE A CG1   1 
ATOM   5845  C  CG2   . ILE D 4  649  ? -5.036  -26.680 47.022  1.00 75.09  ? 649  ILE A CG2   1 
ATOM   5846  C  CD1   . ILE D 4  649  ? -3.941  -29.342 46.853  1.00 67.45  ? 649  ILE A CD1   1 
ATOM   5847  N  N     . GLN D 4  650  ? -5.129  -25.137 43.341  1.00 69.70  ? 650  GLN A N     1 
ATOM   5848  C  CA    . GLN D 4  650  ? -5.668  -23.842 42.939  1.00 70.31  ? 650  GLN A CA    1 
ATOM   5849  C  C     . GLN D 4  650  ? -6.863  -23.994 42.007  1.00 79.24  ? 650  GLN A C     1 
ATOM   5850  O  O     . GLN D 4  650  ? -7.873  -23.308 42.181  1.00 60.30  ? 650  GLN A O     1 
ATOM   5851  C  CB    . GLN D 4  650  ? -4.577  -23.007 42.273  1.00 56.41  ? 650  GLN A CB    1 
ATOM   5852  C  CG    . GLN D 4  650  ? -3.745  -22.184 43.236  1.00 54.59  ? 650  GLN A CG    1 
ATOM   5853  C  CD    . GLN D 4  650  ? -2.600  -21.480 42.545  1.00 66.26  ? 650  GLN A CD    1 
ATOM   5854  O  OE1   . GLN D 4  650  ? -1.508  -22.031 42.414  1.00 70.30  ? 650  GLN A OE1   1 
ATOM   5855  N  NE2   . GLN D 4  650  ? -2.846  -20.258 42.087  1.00 75.83  ? 650  GLN A NE2   1 
ATOM   5856  N  N     . LYS D 4  651  ? -6.776  -24.892 41.023  1.00 82.48  ? 651  LYS A N     1 
ATOM   5857  C  CA    . LYS D 4  651  ? -7.850  -25.024 40.041  1.00 76.01  ? 651  LYS A CA    1 
ATOM   5858  C  C     . LYS D 4  651  ? -9.123  -25.595 40.653  1.00 70.35  ? 651  LYS A C     1 
ATOM   5859  O  O     . LYS D 4  651  ? -10.223 -25.288 40.183  1.00 79.06  ? 651  LYS A O     1 
ATOM   5860  C  CB    . LYS D 4  651  ? -7.392  -25.905 38.880  1.00 62.26  ? 651  LYS A CB    1 
ATOM   5861  C  CG    . LYS D 4  651  ? -6.235  -25.334 38.084  1.00 57.68  ? 651  LYS A CG    1 
ATOM   5862  C  CD    . LYS D 4  651  ? -5.806  -26.288 36.993  1.00 58.48  ? 651  LYS A CD    1 
ATOM   5863  C  CE    . LYS D 4  651  ? -4.295  -26.383 36.936  1.00 58.22  ? 651  LYS A CE    1 
ATOM   5864  N  NZ    . LYS D 4  651  ? -3.684  -25.400 36.001  1.00 69.57  ? 651  LYS A NZ    1 
ATOM   5865  N  N     . VAL D 4  652  ? -9.001  -26.414 41.696  1.00 64.48  ? 652  VAL A N     1 
ATOM   5866  C  CA    . VAL D 4  652  ? -10.180 -26.992 42.332  1.00 61.83  ? 652  VAL A CA    1 
ATOM   5867  C  C     . VAL D 4  652  ? -10.811 -26.008 43.303  1.00 76.92  ? 652  VAL A C     1 
ATOM   5868  O  O     . VAL D 4  652  ? -12.023 -25.770 43.264  1.00 76.66  ? 652  VAL A O     1 
ATOM   5869  C  CB    . VAL D 4  652  ? -9.813  -28.311 43.033  1.00 62.24  ? 652  VAL A CB    1 
ATOM   5870  C  CG1   . VAL D 4  652  ? -10.985 -28.818 43.855  1.00 63.33  ? 652  VAL A CG1   1 
ATOM   5871  C  CG2   . VAL D 4  652  ? -9.422  -29.347 42.010  1.00 63.07  ? 652  VAL A CG2   1 
ATOM   5872  N  N     . VAL D 4  653  ? -9.997  -25.424 44.186  1.00 65.24  ? 653  VAL A N     1 
ATOM   5873  C  CA    . VAL D 4  653  ? -10.526 -24.585 45.256  1.00 67.09  ? 653  VAL A CA    1 
ATOM   5874  C  C     . VAL D 4  653  ? -11.088 -23.284 44.697  1.00 85.09  ? 653  VAL A C     1 
ATOM   5875  O  O     . VAL D 4  653  ? -12.145 -22.813 45.139  1.00 92.68  ? 653  VAL A O     1 
ATOM   5876  C  CB    . VAL D 4  653  ? -9.437  -24.337 46.315  1.00 75.22  ? 653  VAL A CB    1 
ATOM   5877  C  CG1   . VAL D 4  653  ? -9.877  -23.284 47.313  1.00 70.22  ? 653  VAL A CG1   1 
ATOM   5878  C  CG2   . VAL D 4  653  ? -9.103  -25.632 47.033  1.00 85.82  ? 653  VAL A CG2   1 
ATOM   5879  N  N     . ASN D 4  654  ? -10.406 -22.696 43.706  1.00 83.96  ? 654  ASN A N     1 
ATOM   5880  C  CA    . ASN D 4  654  ? -10.931 -21.497 43.058  1.00 63.98  ? 654  ASN A CA    1 
ATOM   5881  C  C     . ASN D 4  654  ? -12.263 -21.779 42.380  1.00 68.56  ? 654  ASN A C     1 
ATOM   5882  O  O     . ASN D 4  654  ? -13.172 -20.946 42.426  1.00 80.65  ? 654  ASN A O     1 
ATOM   5883  C  CB    . ASN D 4  654  ? -9.939  -20.951 42.032  1.00 55.00  ? 654  ASN A CB    1 
ATOM   5884  C  CG    . ASN D 4  654  ? -8.722  -20.319 42.671  1.00 54.14  ? 654  ASN A CG    1 
ATOM   5885  O  OD1   . ASN D 4  654  ? -8.837  -19.461 43.544  1.00 57.16  ? 654  ASN A OD1   1 
ATOM   5886  N  ND2   . ASN D 4  654  ? -7.541  -20.743 42.234  1.00 54.11  ? 654  ASN A ND2   1 
ATOM   5887  N  N     . PHE D 4  655  ? -12.402 -22.958 41.763  1.00 63.67  ? 655  PHE A N     1 
ATOM   5888  C  CA    . PHE D 4  655  ? -13.665 -23.313 41.123  1.00 61.94  ? 655  PHE A CA    1 
ATOM   5889  C  C     . PHE D 4  655  ? -14.775 -23.496 42.147  1.00 67.68  ? 655  PHE A C     1 
ATOM   5890  O  O     . PHE D 4  655  ? -15.906 -23.052 41.918  1.00 72.11  ? 655  PHE A O     1 
ATOM   5891  C  CB    . PHE D 4  655  ? -13.495 -24.579 40.276  1.00 59.50  ? 655  PHE A CB    1 
ATOM   5892  C  CG    . PHE D 4  655  ? -14.766 -25.037 39.594  1.00 60.41  ? 655  PHE A CG    1 
ATOM   5893  C  CD1   . PHE D 4  655  ? -15.064 -24.605 38.315  1.00 60.01  ? 655  PHE A CD1   1 
ATOM   5894  C  CD2   . PHE D 4  655  ? -15.625 -25.948 40.202  1.00 61.98  ? 655  PHE A CD2   1 
ATOM   5895  C  CE1   . PHE D 4  655  ? -16.215 -25.024 37.675  1.00 65.14  ? 655  PHE A CE1   1 
ATOM   5896  C  CE2   . PHE D 4  655  ? -16.777 -26.367 39.569  1.00 66.45  ? 655  PHE A CE2   1 
ATOM   5897  C  CZ    . PHE D 4  655  ? -17.071 -25.908 38.303  1.00 66.57  ? 655  PHE A CZ    1 
ATOM   5898  N  N     . TRP D 4  656  ? -14.486 -24.174 43.260  1.00 67.33  ? 656  TRP A N     1 
ATOM   5899  C  CA    . TRP D 4  656  ? -15.497 -24.323 44.300  1.00 64.29  ? 656  TRP A CA    1 
ATOM   5900  C  C     . TRP D 4  656  ? -15.857 -22.975 44.902  1.00 80.43  ? 656  TRP A C     1 
ATOM   5901  O  O     . TRP D 4  656  ? -17.026 -22.711 45.201  1.00 93.57  ? 656  TRP A O     1 
ATOM   5902  C  CB    . TRP D 4  656  ? -15.013 -25.271 45.394  1.00 61.61  ? 656  TRP A CB    1 
ATOM   5903  C  CG    . TRP D 4  656  ? -16.092 -25.571 46.385  1.00 62.62  ? 656  TRP A CG    1 
ATOM   5904  C  CD1   . TRP D 4  656  ? -17.036 -26.548 46.295  1.00 80.04  ? 656  TRP A CD1   1 
ATOM   5905  C  CD2   . TRP D 4  656  ? -16.374 -24.849 47.590  1.00 62.32  ? 656  TRP A CD2   1 
ATOM   5906  N  NE1   . TRP D 4  656  ? -17.873 -26.499 47.383  1.00 72.11  ? 656  TRP A NE1   1 
ATOM   5907  C  CE2   . TRP D 4  656  ? -17.489 -25.462 48.191  1.00 63.64  ? 656  TRP A CE2   1 
ATOM   5908  C  CE3   . TRP D 4  656  ? -15.785 -23.751 48.224  1.00 61.12  ? 656  TRP A CE3   1 
ATOM   5909  C  CZ2   . TRP D 4  656  ? -18.027 -25.015 49.394  1.00 63.79  ? 656  TRP A CZ2   1 
ATOM   5910  C  CZ3   . TRP D 4  656  ? -16.322 -23.307 49.417  1.00 61.49  ? 656  TRP A CZ3   1 
ATOM   5911  C  CH2   . TRP D 4  656  ? -17.429 -23.940 49.991  1.00 64.81  ? 656  TRP A CH2   1 
ATOM   5912  N  N     . LEU D 4  657  ? -14.862 -22.104 45.074  1.00 70.35  ? 657  LEU A N     1 
ATOM   5913  C  CA    . LEU D 4  657  ? -15.118 -20.793 45.651  1.00 65.72  ? 657  LEU A CA    1 
ATOM   5914  C  C     . LEU D 4  657  ? -15.811 -19.870 44.659  1.00 71.21  ? 657  LEU A C     1 
ATOM   5915  O  O     . LEU D 4  657  ? -16.575 -18.987 45.069  1.00 85.82  ? 657  LEU A O     1 
ATOM   5916  C  CB    . LEU D 4  657  ? -13.805 -20.184 46.133  1.00 60.25  ? 657  LEU A CB    1 
ATOM   5917  C  CG    . LEU D 4  657  ? -13.874 -18.920 46.975  1.00 55.55  ? 657  LEU A CG    1 
ATOM   5918  C  CD1   . LEU D 4  657  ? -14.789 -19.125 48.161  1.00 56.41  ? 657  LEU A CD1   1 
ATOM   5919  C  CD2   . LEU D 4  657  ? -12.488 -18.618 47.447  1.00 54.86  ? 657  LEU A CD2   1 
ATOM   5920  N  N     . LEU D 4  658  ? -15.558 -20.064 43.360  1.00 68.06  ? 658  LEU A N     1 
ATOM   5921  C  CA    . LEU D 4  658  ? -16.208 -19.259 42.328  1.00 82.58  ? 658  LEU A CA    1 
ATOM   5922  C  C     . LEU D 4  658  ? -17.716 -19.463 42.349  1.00 86.81  ? 658  LEU A C     1 
ATOM   5923  O  O     . LEU D 4  658  ? -18.485 -18.520 42.133  1.00 93.15  ? 658  LEU A O     1 
ATOM   5924  C  CB    . LEU D 4  658  ? -15.637 -19.629 40.956  1.00 77.14  ? 658  LEU A CB    1 
ATOM   5925  C  CG    . LEU D 4  658  ? -16.118 -19.113 39.595  1.00 65.27  ? 658  LEU A CG    1 
ATOM   5926  C  CD1   . LEU D 4  658  ? -16.562 -17.658 39.622  1.00 66.24  ? 658  LEU A CD1   1 
ATOM   5927  C  CD2   . LEU D 4  658  ? -15.019 -19.324 38.563  1.00 55.10  ? 658  LEU A CD2   1 
ATOM   5928  N  N     . HIS D 4  659  ? -18.155 -20.685 42.633  1.00 78.73  ? 659  HIS A N     1 
ATOM   5929  C  CA    . HIS D 4  659  ? -19.571 -21.005 42.645  1.00 83.02  ? 659  HIS A CA    1 
ATOM   5930  C  C     . HIS D 4  659  ? -20.167 -20.985 44.046  1.00 90.53  ? 659  HIS A C     1 
ATOM   5931  O  O     . HIS D 4  659  ? -21.382 -21.147 44.187  1.00 98.01  ? 659  HIS A O     1 
ATOM   5932  C  CB    . HIS D 4  659  ? -19.788 -22.371 41.989  1.00 84.68  ? 659  HIS A CB    1 
ATOM   5933  C  CG    . HIS D 4  659  ? -19.415 -22.394 40.539  1.00 85.20  ? 659  HIS A CG    1 
ATOM   5934  N  ND1   . HIS D 4  659  ? -20.197 -21.824 39.558  1.00 84.17  ? 659  HIS A ND1   1 
ATOM   5935  C  CD2   . HIS D 4  659  ? -18.323 -22.888 39.908  1.00 88.51  ? 659  HIS A CD2   1 
ATOM   5936  C  CE1   . HIS D 4  659  ? -19.609 -21.977 38.385  1.00 86.71  ? 659  HIS A CE1   1 
ATOM   5937  N  NE2   . HIS D 4  659  ? -18.472 -22.621 38.569  1.00 90.10  ? 659  HIS A NE2   1 
ATOM   5938  N  N     . ASN D 4  660  ? -19.345 -20.779 45.077  1.00 87.48  ? 660  ASN A N     1 
ATOM   5939  C  CA    . ASN D 4  660  ? -19.820 -20.587 46.444  1.00 84.09  ? 660  ASN A CA    1 
ATOM   5940  C  C     . ASN D 4  660  ? -19.876 -19.107 46.808  1.00 72.99  ? 660  ASN A C     1 
ATOM   5941  O  O     . ASN D 4  660  ? -20.935 -18.597 47.187  1.00 62.31  ? 660  ASN A O     1 
ATOM   5942  C  CB    . ASN D 4  660  ? -18.926 -21.356 47.427  1.00 97.56  ? 660  ASN A CB    1 
ATOM   5943  C  CG    . ASN D 4  660  ? -19.580 -21.560 48.778  1.00 95.13  ? 660  ASN A CG    1 
ATOM   5944  O  OD1   . ASN D 4  660  ? -19.490 -20.706 49.661  1.00 88.22  ? 660  ASN A OD1   1 
ATOM   5945  N  ND2   . ASN D 4  660  ? -20.256 -22.691 48.942  1.00 100.68 ? 660  ASN A ND2   1 
ATOM   5946  N  N     . GLY D 4  661  ? -18.750 -18.408 46.700  1.00 71.41  ? 661  GLY A N     1 
ATOM   5947  C  CA    . GLY D 4  661  ? -18.688 -16.977 46.914  1.00 79.62  ? 661  GLY A CA    1 
ATOM   5948  C  C     . GLY D 4  661  ? -18.224 -16.610 48.314  1.00 68.28  ? 661  GLY A C     1 
ATOM   5949  O  O     . GLY D 4  661  ? -18.195 -17.428 49.236  1.00 75.51  ? 661  GLY A O     1 
ATOM   5950  N  N     . PHE D 4  662  ? -17.875 -15.332 48.464  1.00 65.83  ? 662  PHE A N     1 
ATOM   5951  C  CA    . PHE D 4  662  ? -17.371 -14.774 49.716  1.00 72.26  ? 662  PHE A CA    1 
ATOM   5952  C  C     . PHE D 4  662  ? -17.369 -13.254 49.627  1.00 91.56  ? 662  PHE A C     1 
ATOM   5953  O  O     . PHE D 4  662  ? -17.280 -12.692 48.533  1.00 92.79  ? 662  PHE A O     1 
ATOM   5954  C  CB    . PHE D 4  662  ? -15.958 -15.273 50.014  1.00 67.76  ? 662  PHE A CB    1 
ATOM   5955  C  CG    . PHE D 4  662  ? -15.557 -15.129 51.436  1.00 61.11  ? 662  PHE A CG    1 
ATOM   5956  C  CD1   . PHE D 4  662  ? -16.468 -15.357 52.449  1.00 63.87  ? 662  PHE A CD1   1 
ATOM   5957  C  CD2   . PHE D 4  662  ? -14.284 -14.703 51.762  1.00 54.88  ? 662  PHE A CD2   1 
ATOM   5958  C  CE1   . PHE D 4  662  ? -16.099 -15.218 53.764  1.00 71.27  ? 662  PHE A CE1   1 
ATOM   5959  C  CE2   . PHE D 4  662  ? -13.915 -14.542 53.075  1.00 55.89  ? 662  PHE A CE2   1 
ATOM   5960  C  CZ    . PHE D 4  662  ? -14.817 -14.810 54.076  1.00 71.64  ? 662  PHE A CZ    1 
ATOM   5961  N  N     . SER D 4  663  ? -17.435 -12.599 50.783  1.00 100.49 ? 663  SER A N     1 
ATOM   5962  C  CA    . SER D 4  663  ? -17.487 -11.135 50.859  1.00 107.92 ? 663  SER A CA    1 
ATOM   5963  C  C     . SER D 4  663  ? -16.971 -10.696 52.231  1.00 114.33 ? 663  SER A C     1 
ATOM   5964  O  O     . SER D 4  663  ? -16.275 -11.455 52.913  1.00 126.38 ? 663  SER A O     1 
ATOM   5965  C  CB    . SER D 4  663  ? -18.917 -10.643 50.576  1.00 112.32 ? 663  SER A CB    1 
ATOM   5966  O  OG    . SER D 4  663  ? -19.088 -9.307  51.010  1.00 121.18 ? 663  SER A OG    1 
ATOM   5967  N  N     . THR D 4  664  ? -17.294 -9.456  52.631  1.00 107.50 ? 664  THR A N     1 
ATOM   5968  C  CA    . THR D 4  664  ? -17.043 -8.982  53.995  1.00 95.53  ? 664  THR A CA    1 
ATOM   5969  C  C     . THR D 4  664  ? -18.100 -7.964  54.432  1.00 92.66  ? 664  THR A C     1 
ATOM   5970  O  O     . THR D 4  664  ? -19.070 -8.341  55.087  1.00 91.94  ? 664  THR A O     1 
ATOM   5971  C  CB    . THR D 4  664  ? -15.632 -8.393  54.138  1.00 82.17  ? 664  THR A CB    1 
ATOM   5972  O  OG1   . THR D 4  664  ? -14.674 -9.420  53.891  1.00 80.43  ? 664  THR A OG1   1 
ATOM   5973  C  CG2   . THR D 4  664  ? -15.381 -7.911  55.570  1.00 85.66  ? 664  THR A CG2   1 
ATOM   5974  N  N     . GLY D 4  665  ? -17.947 -6.684  54.096  1.00 93.74  ? 665  GLY A N     1 
ATOM   5975  C  CA    . GLY D 4  665  ? -18.894 -5.672  54.521  1.00 95.37  ? 665  GLY A CA    1 
ATOM   5976  C  C     . GLY D 4  665  ? -18.744 -5.257  55.979  1.00 80.11  ? 665  GLY A C     1 
ATOM   5977  O  O     . GLY D 4  665  ? -18.009 -5.856  56.767  1.00 84.06  ? 665  GLY A O     1 
ATOM   5978  N  N     . ILE D 4  666  ? -19.466 -4.186  56.337  1.00 70.42  ? 666  ILE A N     1 
ATOM   5979  C  CA    . ILE D 4  666  ? -19.413 -3.650  57.699  1.00 73.00  ? 666  ILE A CA    1 
ATOM   5980  C  C     . ILE D 4  666  ? -20.031 -4.580  58.726  1.00 78.42  ? 666  ILE A C     1 
ATOM   5981  O  O     . ILE D 4  666  ? -19.726 -4.454  59.917  1.00 87.50  ? 666  ILE A O     1 
ATOM   5982  C  CB    . ILE D 4  666  ? -20.111 -2.277  57.818  1.00 58.12  ? 666  ILE A CB    1 
ATOM   5983  C  CG1   . ILE D 4  666  ? -21.575 -2.339  57.371  1.00 72.92  ? 666  ILE A CG1   1 
ATOM   5984  C  CG2   . ILE D 4  666  ? -19.329 -1.185  57.145  1.00 49.46  ? 666  ILE A CG2   1 
ATOM   5985  C  CD1   . ILE D 4  666  ? -22.515 -2.985  58.361  1.00 84.50  ? 666  ILE A CD1   1 
ATOM   5986  N  N     . GLY D 4  667  ? -20.918 -5.482  58.305  1.00 66.42  ? 667  GLY A N     1 
ATOM   5987  C  CA    . GLY D 4  667  ? -21.644 -6.295  59.263  1.00 75.38  ? 667  GLY A CA    1 
ATOM   5988  C  C     . GLY D 4  667  ? -20.753 -7.221  60.064  1.00 85.82  ? 667  GLY A C     1 
ATOM   5989  O  O     . GLY D 4  667  ? -21.096 -7.604  61.185  1.00 99.26  ? 667  GLY A O     1 
ATOM   5990  N  N     . ASP D 4  668  ? -19.604 -7.592  59.509  1.00 83.06  ? 668  ASP A N     1 
ATOM   5991  C  CA    . ASP D 4  668  ? -18.618 -8.377  60.230  1.00 91.49  ? 668  ASP A CA    1 
ATOM   5992  C  C     . ASP D 4  668  ? -17.684 -7.518  61.069  1.00 75.50  ? 668  ASP A C     1 
ATOM   5993  O  O     . ASP D 4  668  ? -16.655 -8.015  61.535  1.00 68.03  ? 668  ASP A O     1 
ATOM   5994  C  CB    . ASP D 4  668  ? -17.807 -9.225  59.258  1.00 100.86 ? 668  ASP A CB    1 
ATOM   5995  C  CG    . ASP D 4  668  ? -18.652 -9.822  58.172  1.00 95.00  ? 668  ASP A CG    1 
ATOM   5996  O  OD1   . ASP D 4  668  ? -19.835 -10.127 58.420  1.00 81.62  ? 668  ASP A OD1   1 
ATOM   5997  O  OD2   . ASP D 4  668  ? -18.125 -9.980  57.063  1.00 97.15  ? 668  ASP A OD2   1 
ATOM   5998  N  N     . THR D 4  669  ? -18.006 -6.241  61.248  1.00 64.45  ? 669  THR A N     1 
ATOM   5999  C  CA    . THR D 4  669  ? -17.360 -5.410  62.248  1.00 57.82  ? 669  THR A CA    1 
ATOM   6000  C  C     . THR D 4  669  ? -18.301 -5.026  63.375  1.00 68.45  ? 669  THR A C     1 
ATOM   6001  O  O     . THR D 4  669  ? -17.850 -4.446  64.368  1.00 90.80  ? 669  THR A O     1 
ATOM   6002  C  CB    . THR D 4  669  ? -16.798 -4.134  61.606  1.00 55.75  ? 669  THR A CB    1 
ATOM   6003  O  OG1   . THR D 4  669  ? -17.751 -3.602  60.680  1.00 77.06  ? 669  THR A OG1   1 
ATOM   6004  C  CG2   . THR D 4  669  ? -15.507 -4.444  60.870  1.00 51.13  ? 669  THR A CG2   1 
ATOM   6005  N  N     . ILE D 4  670  ? -19.585 -5.336  63.249  1.00 62.07  ? 670  ILE A N     1 
ATOM   6006  C  CA    . ILE D 4  670  ? -20.571 -5.015  64.271  1.00 65.73  ? 670  ILE A CA    1 
ATOM   6007  C  C     . ILE D 4  670  ? -20.637 -6.179  65.251  1.00 70.93  ? 670  ILE A C     1 
ATOM   6008  O  O     . ILE D 4  670  ? -20.872 -7.326  64.855  1.00 78.79  ? 670  ILE A O     1 
ATOM   6009  C  CB    . ILE D 4  670  ? -21.947 -4.734  63.645  1.00 68.28  ? 670  ILE A CB    1 
ATOM   6010  C  CG1   . ILE D 4  670  ? -21.997 -3.297  63.122  1.00 68.05  ? 670  ILE A CG1   1 
ATOM   6011  C  CG2   . ILE D 4  670  ? -23.073 -4.985  64.651  1.00 57.40  ? 670  ILE A CG2   1 
ATOM   6012  C  CD1   . ILE D 4  670  ? -23.382 -2.816  62.763  1.00 67.03  ? 670  ILE A CD1   1 
ATOM   6013  N  N     . ALA D 4  671  ? -20.394 -5.890  66.524  1.00 58.28  ? 671  ALA A N     1 
ATOM   6014  C  CA    . ALA D 4  671  ? -20.610 -6.844  67.598  1.00 58.91  ? 671  ALA A CA    1 
ATOM   6015  C  C     . ALA D 4  671  ? -21.930 -6.532  68.295  1.00 69.02  ? 671  ALA A C     1 
ATOM   6016  O  O     . ALA D 4  671  ? -22.601 -5.544  67.985  1.00 81.29  ? 671  ALA A O     1 
ATOM   6017  C  CB    . ALA D 4  671  ? -19.445 -6.821  68.591  1.00 68.83  ? 671  ALA A CB    1 
ATOM   6018  N  N     . ASP D 4  672  ? -22.296 -7.393  69.246  1.00 67.49  ? 672  ASP A N     1 
ATOM   6019  C  CA    . ASP D 4  672  ? -23.608 -7.319  69.878  1.00 78.76  ? 672  ASP A CA    1 
ATOM   6020  C  C     . ASP D 4  672  ? -23.767 -6.033  70.679  1.00 99.37  ? 672  ASP A C     1 
ATOM   6021  O  O     . ASP D 4  672  ? -22.791 -5.432  71.136  1.00 98.71  ? 672  ASP A O     1 
ATOM   6022  C  CB    . ASP D 4  672  ? -23.828 -8.507  70.813  1.00 78.93  ? 672  ASP A CB    1 
ATOM   6023  C  CG    . ASP D 4  672  ? -24.392 -9.717  70.107  1.00 86.72  ? 672  ASP A CG    1 
ATOM   6024  O  OD1   . ASP D 4  672  ? -23.858 -10.086 69.043  1.00 101.27 ? 672  ASP A OD1   1 
ATOM   6025  O  OD2   . ASP D 4  672  ? -25.362 -10.307 70.627  1.00 86.35  ? 672  ASP A OD2   1 
ATOM   6026  N  N     . GLY D 4  673  ? -25.019 -5.611  70.827  1.00 114.61 ? 673  GLY A N     1 
ATOM   6027  C  CA    . GLY D 4  673  ? -25.384 -4.549  71.735  1.00 120.64 ? 673  GLY A CA    1 
ATOM   6028  C  C     . GLY D 4  673  ? -24.933 -4.803  73.162  1.00 109.31 ? 673  GLY A C     1 
ATOM   6029  O  O     . GLY D 4  673  ? -24.268 -3.960  73.774  1.00 115.19 ? 673  GLY A O     1 
ATOM   6030  N  N     . PRO D 4  674  ? -25.304 -5.959  73.732  1.00 88.48  ? 674  PRO A N     1 
ATOM   6031  C  CA    . PRO D 4  674  ? -24.739 -6.329  75.043  1.00 84.13  ? 674  PRO A CA    1 
ATOM   6032  C  C     . PRO D 4  674  ? -23.227 -6.477  75.046  1.00 86.09  ? 674  PRO A C     1 
ATOM   6033  O  O     . PRO D 4  674  ? -22.587 -6.145  76.051  1.00 99.48  ? 674  PRO A O     1 
ATOM   6034  C  CB    . PRO D 4  674  ? -25.439 -7.657  75.356  1.00 74.43  ? 674  PRO A CB    1 
ATOM   6035  C  CG    . PRO D 4  674  ? -26.736 -7.554  74.667  1.00 82.70  ? 674  PRO A CG    1 
ATOM   6036  C  CD    . PRO D 4  674  ? -26.493 -6.772  73.410  1.00 85.31  ? 674  PRO A CD    1 
ATOM   6037  N  N     . THR D 4  675  ? -22.633 -6.970  73.959  1.00 71.39  ? 675  THR A N     1 
ATOM   6038  C  CA    . THR D 4  675  ? -21.177 -7.024  73.901  1.00 73.30  ? 675  THR A CA    1 
ATOM   6039  C  C     . THR D 4  675  ? -20.572 -5.628  73.817  1.00 86.73  ? 675  THR A C     1 
ATOM   6040  O  O     . THR D 4  675  ? -19.519 -5.380  74.413  1.00 83.97  ? 675  THR A O     1 
ATOM   6041  C  CB    . THR D 4  675  ? -20.731 -7.891  72.724  1.00 69.65  ? 675  THR A CB    1 
ATOM   6042  O  OG1   . THR D 4  675  ? -21.362 -9.172  72.823  1.00 95.10  ? 675  THR A OG1   1 
ATOM   6043  C  CG2   . THR D 4  675  ? -19.221 -8.088  72.731  1.00 62.45  ? 675  THR A CG2   1 
ATOM   6044  N  N     . MET D 4  676  ? -21.234 -4.699  73.123  1.00 95.87  ? 676  MET A N     1 
ATOM   6045  C  CA    . MET D 4  676  ? -20.787 -3.309  73.142  1.00 100.81 ? 676  MET A CA    1 
ATOM   6046  C  C     . MET D 4  676  ? -20.917 -2.708  74.534  1.00 98.84  ? 676  MET A C     1 
ATOM   6047  O  O     . MET D 4  676  ? -20.083 -1.890  74.943  1.00 100.81 ? 676  MET A O     1 
ATOM   6048  C  CB    . MET D 4  676  ? -21.584 -2.481  72.135  1.00 92.68  ? 676  MET A CB    1 
ATOM   6049  C  CG    . MET D 4  676  ? -21.126 -2.626  70.696  1.00 93.26  ? 676  MET A CG    1 
ATOM   6050  S  SD    . MET D 4  676  ? -19.401 -3.120  70.543  1.00 95.44  ? 676  MET A SD    1 
ATOM   6051  C  CE    . MET D 4  676  ? -18.583 -1.537  70.726  1.00 79.71  ? 676  MET A CE    1 
ATOM   6052  N  N     . ARG D 4  677  ? -21.964 -3.094  75.270  1.00 90.52  ? 677  ARG A N     1 
ATOM   6053  C  CA    . ARG D 4  677  ? -22.100 -2.666  76.658  1.00 86.71  ? 677  ARG A CA    1 
ATOM   6054  C  C     . ARG D 4  677  ? -20.948 -3.180  77.507  1.00 85.45  ? 677  ARG A C     1 
ATOM   6055  O  O     . ARG D 4  677  ? -20.397 -2.439  78.327  1.00 94.20  ? 677  ARG A O     1 
ATOM   6056  C  CB    . ARG D 4  677  ? -23.430 -3.152  77.233  1.00 82.15  ? 677  ARG A CB    1 
ATOM   6057  C  CG    . ARG D 4  677  ? -24.319 -2.058  77.793  1.00 84.54  ? 677  ARG A CG    1 
ATOM   6058  C  CD    . ARG D 4  677  ? -25.723 -2.583  78.037  1.00 95.52  ? 677  ARG A CD    1 
ATOM   6059  N  NE    . ARG D 4  677  ? -26.655 -1.517  78.390  1.00 111.03 ? 677  ARG A NE    1 
ATOM   6060  C  CZ    . ARG D 4  677  ? -27.769 -1.702  79.089  1.00 120.77 ? 677  ARG A CZ    1 
ATOM   6061  N  NH1   . ARG D 4  677  ? -28.098 -2.916  79.509  1.00 123.33 ? 677  ARG A NH1   1 
ATOM   6062  N  NH2   . ARG D 4  677  ? -28.558 -0.673  79.368  1.00 119.06 ? 677  ARG A NH2   1 
ATOM   6063  N  N     . GLU D 4  678  ? -20.563 -4.444  77.310  1.00 86.05  ? 678  GLU A N     1 
ATOM   6064  C  CA    . GLU D 4  678  ? -19.485 -5.033  78.096  1.00 68.14  ? 678  GLU A CA    1 
ATOM   6065  C  C     . GLU D 4  678  ? -18.133 -4.422  77.754  1.00 76.80  ? 678  GLU A C     1 
ATOM   6066  O  O     . GLU D 4  678  ? -17.241 -4.386  78.607  1.00 89.90  ? 678  GLU A O     1 
ATOM   6067  C  CB    . GLU D 4  678  ? -19.449 -6.545  77.883  1.00 67.20  ? 678  GLU A CB    1 
ATOM   6068  C  CG    . GLU D 4  678  ? -20.116 -7.351  78.982  1.00 83.90  ? 678  GLU A CG    1 
ATOM   6069  C  CD    . GLU D 4  678  ? -20.344 -8.794  78.582  1.00 106.06 ? 678  GLU A CD    1 
ATOM   6070  O  OE1   . GLU D 4  678  ? -19.532 -9.656  78.977  1.00 114.02 ? 678  GLU A OE1   1 
ATOM   6071  O  OE2   . GLU D 4  678  ? -21.335 -9.067  77.873  1.00 106.39 ? 678  GLU A OE2   1 
ATOM   6072  N  N     . ILE D 4  679  ? -17.963 -3.941  76.524  1.00 85.22  ? 679  ILE A N     1 
ATOM   6073  C  CA    . ILE D 4  679  ? -16.725 -3.269  76.145  1.00 86.87  ? 679  ILE A CA    1 
ATOM   6074  C  C     . ILE D 4  679  ? -16.681 -1.858  76.713  1.00 96.41  ? 679  ILE A C     1 
ATOM   6075  O  O     . ILE D 4  679  ? -15.677 -1.438  77.299  1.00 93.00  ? 679  ILE A O     1 
ATOM   6076  C  CB    . ILE D 4  679  ? -16.574 -3.266  74.613  1.00 73.10  ? 679  ILE A CB    1 
ATOM   6077  C  CG1   . ILE D 4  679  ? -16.445 -4.703  74.095  1.00 81.91  ? 679  ILE A CG1   1 
ATOM   6078  C  CG2   . ILE D 4  679  ? -15.405 -2.382  74.189  1.00 70.30  ? 679  ILE A CG2   1 
ATOM   6079  C  CD1   . ILE D 4  679  ? -15.767 -4.843  72.766  1.00 82.85  ? 679  ILE A CD1   1 
ATOM   6080  N  N     . THR D 4  680  ? -17.775 -1.109  76.558  1.00 104.28 ? 680  THR A N     1 
ATOM   6081  C  CA    . THR D 4  680  ? -17.787 0.278   77.002  1.00 110.50 ? 680  THR A CA    1 
ATOM   6082  C  C     . THR D 4  680  ? -17.824 0.409   78.523  1.00 117.31 ? 680  THR A C     1 
ATOM   6083  O  O     . THR D 4  680  ? -17.546 1.495   79.041  1.00 123.57 ? 680  THR A O     1 
ATOM   6084  C  CB    . THR D 4  680  ? -18.963 1.022   76.365  1.00 107.38 ? 680  THR A CB    1 
ATOM   6085  O  OG1   . THR D 4  680  ? -18.665 2.422   76.304  1.00 116.14 ? 680  THR A OG1   1 
ATOM   6086  C  CG2   . THR D 4  680  ? -20.251 0.805   77.153  1.00 100.70 ? 680  THR A CG2   1 
ATOM   6087  N  N     . GLU D 4  681  ? -18.150 -0.663  79.250  1.00 112.47 ? 681  GLU A N     1 
ATOM   6088  C  CA    . GLU D 4  681  ? -17.988 -0.678  80.698  1.00 102.49 ? 681  GLU A CA    1 
ATOM   6089  C  C     . GLU D 4  681  ? -16.628 -1.214  81.119  1.00 96.43  ? 681  GLU A C     1 
ATOM   6090  O  O     . GLU D 4  681  ? -16.165 -0.898  82.221  1.00 107.77 ? 681  GLU A O     1 
ATOM   6091  C  CB    . GLU D 4  681  ? -19.097 -1.509  81.360  1.00 108.09 ? 681  GLU A CB    1 
ATOM   6092  C  CG    . GLU D 4  681  ? -18.988 -3.013  81.140  1.00 117.80 ? 681  GLU A CG    1 
ATOM   6093  C  CD    . GLU D 4  681  ? -19.691 -3.823  82.208  1.00 134.22 ? 681  GLU A CD    1 
ATOM   6094  O  OE1   . GLU D 4  681  ? -20.864 -3.518  82.508  1.00 138.40 ? 681  GLU A OE1   1 
ATOM   6095  O  OE2   . GLU D 4  681  ? -19.074 -4.770  82.739  1.00 140.72 ? 681  GLU A OE2   1 
ATOM   6096  N  N     . THR D 4  682  ? -15.981 -2.009  80.263  1.00 86.88  ? 682  THR A N     1 
ATOM   6097  C  CA    . THR D 4  682  ? -14.619 -2.456  80.531  1.00 86.80  ? 682  THR A CA    1 
ATOM   6098  C  C     . THR D 4  682  ? -13.649 -1.284  80.492  1.00 100.78 ? 682  THR A C     1 
ATOM   6099  O  O     . THR D 4  682  ? -12.771 -1.161  81.356  1.00 101.45 ? 682  THR A O     1 
ATOM   6100  C  CB    . THR D 4  682  ? -14.226 -3.533  79.514  1.00 76.17  ? 682  THR A CB    1 
ATOM   6101  O  OG1   . THR D 4  682  ? -14.794 -4.790  79.905  1.00 87.02  ? 682  THR A OG1   1 
ATOM   6102  C  CG2   . THR D 4  682  ? -12.716 -3.681  79.392  1.00 64.17  ? 682  THR A CG2   1 
ATOM   6103  N  N     . ILE D 4  683  ? -13.817 -0.395  79.513  1.00 102.48 ? 683  ILE A N     1 
ATOM   6104  C  CA    . ILE D 4  683  ? -12.957 0.777   79.404  1.00 106.97 ? 683  ILE A CA    1 
ATOM   6105  C  C     . ILE D 4  683  ? -13.240 1.748   80.546  1.00 110.28 ? 683  ILE A C     1 
ATOM   6106  O  O     . ILE D 4  683  ? -12.326 2.398   81.070  1.00 113.29 ? 683  ILE A O     1 
ATOM   6107  C  CB    . ILE D 4  683  ? -13.151 1.424   78.017  1.00 101.49 ? 683  ILE A CB    1 
ATOM   6108  C  CG1   . ILE D 4  683  ? -12.541 0.550   76.914  1.00 93.77  ? 683  ILE A CG1   1 
ATOM   6109  C  CG2   . ILE D 4  683  ? -12.531 2.811   77.946  1.00 97.82  ? 683  ILE A CG2   1 
ATOM   6110  C  CD1   . ILE D 4  683  ? -11.260 -0.170  77.292  1.00 90.91  ? 683  ILE A CD1   1 
ATOM   6111  N  N     . ALA D 4  684  ? -14.503 1.826   80.979  1.00 112.63 ? 684  ALA A N     1 
ATOM   6112  C  CA    . ALA D 4  684  ? -14.869 2.724   82.071  1.00 110.12 ? 684  ALA A CA    1 
ATOM   6113  C  C     . ALA D 4  684  ? -14.232 2.295   83.386  1.00 103.20 ? 684  ALA A C     1 
ATOM   6114  O  O     . ALA D 4  684  ? -13.788 3.140   84.173  1.00 92.91  ? 684  ALA A O     1 
ATOM   6115  C  CB    . ALA D 4  684  ? -16.389 2.788   82.213  1.00 109.10 ? 684  ALA A CB    1 
ATOM   6116  N  N     . GLU D 4  685  ? -14.171 0.986   83.645  1.00 95.01  ? 685  GLU A N     1 
ATOM   6117  C  CA    . GLU D 4  685  ? -13.494 0.523   84.849  1.00 91.52  ? 685  GLU A CA    1 
ATOM   6118  C  C     . GLU D 4  685  ? -11.980 0.586   84.706  1.00 80.55  ? 685  GLU A C     1 
ATOM   6119  O  O     . GLU D 4  685  ? -11.273 0.542   85.718  1.00 102.22 ? 685  GLU A O     1 
ATOM   6120  C  CB    . GLU D 4  685  ? -13.937 -0.898  85.212  1.00 105.86 ? 685  GLU A CB    1 
ATOM   6121  C  CG    . GLU D 4  685  ? -13.160 -2.013  84.533  1.00 116.20 ? 685  GLU A CG    1 
ATOM   6122  C  CD    . GLU D 4  685  ? -13.839 -3.363  84.673  1.00 118.32 ? 685  GLU A CD    1 
ATOM   6123  O  OE1   . GLU D 4  685  ? -14.956 -3.412  85.230  1.00 117.83 ? 685  GLU A OE1   1 
ATOM   6124  O  OE2   . GLU D 4  685  ? -13.260 -4.373  84.222  1.00 113.14 ? 685  GLU A OE2   1 
ATOM   6125  N  N     . ALA D 4  686  ? -11.468 0.684   83.478  1.00 70.55  ? 686  ALA A N     1 
ATOM   6126  C  CA    . ALA D 4  686  ? -10.063 1.013   83.291  1.00 77.97  ? 686  ALA A CA    1 
ATOM   6127  C  C     . ALA D 4  686  ? -9.815  2.499   83.492  1.00 75.57  ? 686  ALA A C     1 
ATOM   6128  O  O     . ALA D 4  686  ? -8.710  2.894   83.879  1.00 61.50  ? 686  ALA A O     1 
ATOM   6129  C  CB    . ALA D 4  686  ? -9.597  0.587   81.900  1.00 76.02  ? 686  ALA A CB    1 
ATOM   6130  N  N     . LYS D 4  687  ? -10.827 3.327   83.226  1.00 102.54 ? 687  LYS A N     1 
ATOM   6131  C  CA    . LYS D 4  687  ? -10.734 4.748   83.535  1.00 115.73 ? 687  LYS A CA    1 
ATOM   6132  C  C     . LYS D 4  687  ? -10.770 4.990   85.037  1.00 113.53 ? 687  LYS A C     1 
ATOM   6133  O  O     . LYS D 4  687  ? -10.234 5.996   85.515  1.00 116.05 ? 687  LYS A O     1 
ATOM   6134  C  CB    . LYS D 4  687  ? -11.869 5.502   82.847  1.00 109.61 ? 687  LYS A CB    1 
ATOM   6135  C  CG    . LYS D 4  687  ? -11.566 5.938   81.424  1.00 89.81  ? 687  LYS A CG    1 
ATOM   6136  C  CD    . LYS D 4  687  ? -12.824 6.431   80.734  1.00 88.73  ? 687  LYS A CD    1 
ATOM   6137  C  CE    . LYS D 4  687  ? -12.502 7.141   79.432  1.00 94.88  ? 687  LYS A CE    1 
ATOM   6138  N  NZ    . LYS D 4  687  ? -11.521 8.242   79.625  1.00 95.18  ? 687  LYS A NZ    1 
ATOM   6139  N  N     . LYS D 4  688  ? -11.402 4.088   85.791  1.00 103.99 ? 688  LYS A N     1 
ATOM   6140  C  CA    . LYS D 4  688  ? -11.413 4.191   87.244  1.00 97.93  ? 688  LYS A CA    1 
ATOM   6141  C  C     . LYS D 4  688  ? -10.098 3.707   87.840  1.00 80.16  ? 688  LYS A C     1 
ATOM   6142  O  O     . LYS D 4  688  ? -9.640  4.242   88.855  1.00 84.77  ? 688  LYS A O     1 
ATOM   6143  C  CB    . LYS D 4  688  ? -12.577 3.383   87.816  1.00 99.38  ? 688  LYS A CB    1 
ATOM   6144  C  CG    . LYS D 4  688  ? -13.364 4.096   88.902  1.00 98.87  ? 688  LYS A CG    1 
ATOM   6145  C  CD    . LYS D 4  688  ? -14.392 5.041   88.296  1.00 106.27 ? 688  LYS A CD    1 
ATOM   6146  C  CE    . LYS D 4  688  ? -15.256 4.340   87.253  1.00 101.92 ? 688  LYS A CE    1 
ATOM   6147  N  NZ    . LYS D 4  688  ? -16.048 5.302   86.436  1.00 95.72  ? 688  LYS A NZ    1 
ATOM   6148  N  N     . LYS D 4  689  ? -9.485  2.696   87.219  1.00 69.12  ? 689  LYS A N     1 
ATOM   6149  C  CA    . LYS D 4  689  ? -8.238  2.144   87.733  1.00 74.34  ? 689  LYS A CA    1 
ATOM   6150  C  C     . LYS D 4  689  ? -7.073  3.104   87.543  1.00 70.85  ? 689  LYS A C     1 
ATOM   6151  O  O     . LYS D 4  689  ? -6.090  3.034   88.287  1.00 97.09  ? 689  LYS A O     1 
ATOM   6152  C  CB    . LYS D 4  689  ? -7.941  0.811   87.049  1.00 83.25  ? 689  LYS A CB    1 
ATOM   6153  C  CG    . LYS D 4  689  ? -7.901  -0.383  87.989  1.00 95.11  ? 689  LYS A CG    1 
ATOM   6154  C  CD    . LYS D 4  689  ? -7.584  -1.658  87.227  1.00 98.63  ? 689  LYS A CD    1 
ATOM   6155  C  CE    . LYS D 4  689  ? -7.516  -2.863  88.149  1.00 110.61 ? 689  LYS A CE    1 
ATOM   6156  N  NZ    . LYS D 4  689  ? -6.743  -3.981  87.536  1.00 109.17 ? 689  LYS A NZ    1 
ATOM   6157  N  N     . VAL D 4  690  ? -7.158  3.997   86.560  1.00 63.14  ? 690  VAL A N     1 
ATOM   6158  C  CA    . VAL D 4  690  ? -6.090  4.967   86.346  1.00 65.76  ? 690  VAL A CA    1 
ATOM   6159  C  C     . VAL D 4  690  ? -6.266  6.173   87.259  1.00 75.54  ? 690  VAL A C     1 
ATOM   6160  O  O     . VAL D 4  690  ? -5.287  6.699   87.801  1.00 86.95  ? 690  VAL A O     1 
ATOM   6161  C  CB    . VAL D 4  690  ? -6.044  5.366   84.859  1.00 60.76  ? 690  VAL A CB    1 
ATOM   6162  C  CG1   . VAL D 4  690  ? -5.062  6.499   84.625  1.00 59.95  ? 690  VAL A CG1   1 
ATOM   6163  C  CG2   . VAL D 4  690  ? -5.657  4.168   84.013  1.00 60.25  ? 690  VAL A CG2   1 
ATOM   6164  N  N     . LEU D 4  691  ? -7.515  6.606   87.463  1.00 74.18  ? 691  LEU A N     1 
ATOM   6165  C  CA    . LEU D 4  691  ? -7.796  7.739   88.342  1.00 80.42  ? 691  LEU A CA    1 
ATOM   6166  C  C     . LEU D 4  691  ? -7.398  7.425   89.779  1.00 81.29  ? 691  LEU A C     1 
ATOM   6167  O  O     . LEU D 4  691  ? -6.813  8.271   90.467  1.00 81.43  ? 691  LEU A O     1 
ATOM   6168  C  CB    . LEU D 4  691  ? -9.287  8.091   88.252  1.00 79.63  ? 691  LEU A CB    1 
ATOM   6169  C  CG    . LEU D 4  691  ? -9.969  9.414   88.653  1.00 81.08  ? 691  LEU A CG    1 
ATOM   6170  C  CD1   . LEU D 4  691  ? -11.479 9.247   88.530  1.00 80.34  ? 691  LEU A CD1   1 
ATOM   6171  C  CD2   . LEU D 4  691  ? -9.628  9.958   90.037  1.00 95.62  ? 691  LEU A CD2   1 
ATOM   6172  N  N     . ASP D 4  692  ? -7.701  6.211   90.243  1.00 80.77  ? 692  ASP A N     1 
ATOM   6173  C  CA    . ASP D 4  692  ? -7.401  5.838   91.621  1.00 69.62  ? 692  ASP A CA    1 
ATOM   6174  C  C     . ASP D 4  692  ? -5.900  5.727   91.848  1.00 73.10  ? 692  ASP A C     1 
ATOM   6175  O  O     . ASP D 4  692  ? -5.397  6.109   92.912  1.00 86.12  ? 692  ASP A O     1 
ATOM   6176  C  CB    . ASP D 4  692  ? -8.097  4.521   91.958  1.00 68.78  ? 692  ASP A CB    1 
ATOM   6177  C  CG    . ASP D 4  692  ? -9.594  4.684   92.135  1.00 75.73  ? 692  ASP A CG    1 
ATOM   6178  O  OD1   . ASP D 4  692  ? -10.065 5.838   92.204  1.00 79.58  ? 692  ASP A OD1   1 
ATOM   6179  O  OD2   . ASP D 4  692  ? -10.301 3.656   92.188  1.00 81.50  ? 692  ASP A OD2   1 
ATOM   6180  N  N     . VAL D 4  693  ? -5.170  5.212   90.858  1.00 66.49  ? 693  VAL A N     1 
ATOM   6181  C  CA    . VAL D 4  693  ? -3.714  5.161   90.945  1.00 66.21  ? 693  VAL A CA    1 
ATOM   6182  C  C     . VAL D 4  693  ? -3.128  6.565   90.883  1.00 65.61  ? 693  VAL A C     1 
ATOM   6183  O  O     . VAL D 4  693  ? -2.175  6.889   91.605  1.00 84.20  ? 693  VAL A O     1 
ATOM   6184  C  CB    . VAL D 4  693  ? -3.159  4.249   89.834  1.00 65.22  ? 693  VAL A CB    1 
ATOM   6185  C  CG1   . VAL D 4  693  ? -1.670  4.472   89.618  1.00 64.59  ? 693  VAL A CG1   1 
ATOM   6186  C  CG2   . VAL D 4  693  ? -3.416  2.798   90.185  1.00 82.99  ? 693  VAL A CG2   1 
ATOM   6187  N  N     . THR D 4  694  ? -3.710  7.431   90.047  1.00 67.62  ? 694  THR A N     1 
ATOM   6188  C  CA    . THR D 4  694  ? -3.214  8.798   89.919  1.00 75.79  ? 694  THR A CA    1 
ATOM   6189  C  C     . THR D 4  694  ? -3.406  9.584   91.210  1.00 74.26  ? 694  THR A C     1 
ATOM   6190  O  O     . THR D 4  694  ? -2.520  10.343  91.618  1.00 85.03  ? 694  THR A O     1 
ATOM   6191  C  CB    . THR D 4  694  ? -3.915  9.503   88.758  1.00 71.93  ? 694  THR A CB    1 
ATOM   6192  O  OG1   . THR D 4  694  ? -3.849  8.678   87.588  1.00 76.20  ? 694  THR A OG1   1 
ATOM   6193  C  CG2   . THR D 4  694  ? -3.251  10.836  88.463  1.00 71.98  ? 694  THR A CG2   1 
ATOM   6194  N  N     . LYS D 4  695  ? -4.550  9.401   91.875  1.00 69.77  ? 695  LYS A N     1 
ATOM   6195  C  CA    . LYS D 4  695  ? -4.775  10.054  93.159  1.00 75.45  ? 695  LYS A CA    1 
ATOM   6196  C  C     . LYS D 4  695  ? -3.865  9.486   94.241  1.00 84.36  ? 695  LYS A C     1 
ATOM   6197  O  O     . LYS D 4  695  ? -3.519  10.194  95.194  1.00 69.53  ? 695  LYS A O     1 
ATOM   6198  C  CB    . LYS D 4  695  ? -6.241  9.910   93.565  1.00 86.56  ? 695  LYS A CB    1 
ATOM   6199  C  CG    . LYS D 4  695  ? -7.120  11.074  93.139  1.00 91.23  ? 695  LYS A CG    1 
ATOM   6200  C  CD    . LYS D 4  695  ? -8.403  11.130  93.952  1.00 99.09  ? 695  LYS A CD    1 
ATOM   6201  C  CE    . LYS D 4  695  ? -9.231  9.871   93.755  1.00 101.34 ? 695  LYS A CE    1 
ATOM   6202  N  NZ    . LYS D 4  695  ? -10.693 10.153  93.782  1.00 101.93 ? 695  LYS A NZ    1 
ATOM   6203  N  N     . GLU D 4  696  ? -3.471  8.216   94.107  1.00 89.52  ? 696  GLU A N     1 
ATOM   6204  C  CA    . GLU D 4  696  ? -2.536  7.615   95.051  1.00 84.40  ? 696  GLU A CA    1 
ATOM   6205  C  C     . GLU D 4  696  ? -1.155  8.249   94.935  1.00 85.63  ? 696  GLU A C     1 
ATOM   6206  O  O     . GLU D 4  696  ? -0.511  8.537   95.951  1.00 106.26 ? 696  GLU A O     1 
ATOM   6207  C  CB    . GLU D 4  696  ? -2.472  6.104   94.817  1.00 79.21  ? 696  GLU A CB    1 
ATOM   6208  C  CG    . GLU D 4  696  ? -1.149  5.443   95.168  1.00 87.05  ? 696  GLU A CG    1 
ATOM   6209  C  CD    . GLU D 4  696  ? -1.196  3.936   95.013  1.00 94.13  ? 696  GLU A CD    1 
ATOM   6210  O  OE1   . GLU D 4  696  ? -2.310  3.373   95.018  1.00 101.44 ? 696  GLU A OE1   1 
ATOM   6211  O  OE2   . GLU D 4  696  ? -0.120  3.314   94.881  1.00 98.06  ? 696  GLU A OE2   1 
ATOM   6212  N  N     . ALA D 4  697  ? -0.690  8.493   93.706  1.00 67.63  ? 697  ALA A N     1 
ATOM   6213  C  CA    . ALA D 4  697  ? 0.576   9.188   93.514  1.00 67.06  ? 697  ALA A CA    1 
ATOM   6214  C  C     . ALA D 4  697  ? 0.468   10.675  93.818  1.00 78.62  ? 697  ALA A C     1 
ATOM   6215  O  O     . ALA D 4  697  ? 1.485   11.305  94.121  1.00 76.38  ? 697  ALA A O     1 
ATOM   6216  C  CB    . ALA D 4  697  ? 1.079   8.989   92.084  1.00 65.50  ? 697  ALA A CB    1 
ATOM   6217  N  N     . GLN D 4  698  ? -0.735  11.248  93.730  1.00 77.88  ? 698  GLN A N     1 
ATOM   6218  C  CA    . GLN D 4  698  ? -0.928  12.647  94.088  1.00 86.21  ? 698  GLN A CA    1 
ATOM   6219  C  C     . GLN D 4  698  ? -0.795  12.885  95.585  1.00 83.23  ? 698  GLN A C     1 
ATOM   6220  O  O     . GLN D 4  698  ? -0.525  14.016  95.996  1.00 91.17  ? 698  GLN A O     1 
ATOM   6221  C  CB    . GLN D 4  698  ? -2.299  13.131  93.614  1.00 93.61  ? 698  GLN A CB    1 
ATOM   6222  C  CG    . GLN D 4  698  ? -2.358  13.556  92.156  1.00 88.06  ? 698  GLN A CG    1 
ATOM   6223  C  CD    . GLN D 4  698  ? -3.762  13.911  91.715  1.00 85.14  ? 698  GLN A CD    1 
ATOM   6224  O  OE1   . GLN D 4  698  ? -4.654  14.105  92.541  1.00 76.95  ? 698  GLN A OE1   1 
ATOM   6225  N  NE2   . GLN D 4  698  ? -3.969  13.987  90.406  1.00 81.99  ? 698  GLN A NE2   1 
ATOM   6226  N  N     . ALA D 4  699  ? -0.985  11.852  96.404  1.00 82.34  ? 699  ALA A N     1 
ATOM   6227  C  CA    . ALA D 4  699  ? -0.877  11.968  97.851  1.00 86.84  ? 699  ALA A CA    1 
ATOM   6228  C  C     . ALA D 4  699  ? 0.400   11.341  98.392  1.00 86.89  ? 699  ALA A C     1 
ATOM   6229  O  O     . ALA D 4  699  ? 0.499   11.118  99.603  1.00 96.60  ? 699  ALA A O     1 
ATOM   6230  C  CB    . ALA D 4  699  ? -2.099  11.343  98.521  1.00 82.39  ? 699  ALA A CB    1 
ATOM   6231  N  N     . ASN D 4  700  ? 1.359   11.028  97.513  1.00 86.53  ? 700  ASN A N     1 
ATOM   6232  C  CA    . ASN D 4  700  ? 2.710   10.589  97.872  1.00 80.58  ? 700  ASN A CA    1 
ATOM   6233  C  C     . ASN D 4  700  ? 2.711   9.265   98.636  1.00 103.03 ? 700  ASN A C     1 
ATOM   6234  O  O     . ASN D 4  700  ? 3.642   8.971   99.388  1.00 107.36 ? 700  ASN A O     1 
ATOM   6235  C  CB    . ASN D 4  700  ? 3.453   11.670  98.668  1.00 72.06  ? 700  ASN A CB    1 
ATOM   6236  C  CG    . ASN D 4  700  ? 4.937   11.679  98.392  1.00 71.60  ? 700  ASN A CG    1 
ATOM   6237  O  OD1   . ASN D 4  700  ? 5.491   10.710  97.877  1.00 80.77  ? 700  ASN A OD1   1 
ATOM   6238  N  ND2   . ASN D 4  700  ? 5.591   12.782  98.731  1.00 71.82  ? 700  ASN A ND2   1 
ATOM   6239  N  N     . LEU D 4  701  ? 1.676   8.450   98.449  1.00 113.30 ? 701  LEU A N     1 
ATOM   6240  C  CA    . LEU D 4  701  ? 1.601   7.137   99.091  1.00 121.72 ? 701  LEU A CA    1 
ATOM   6241  C  C     . LEU D 4  701  ? 2.176   6.046   98.183  1.00 126.73 ? 701  LEU A C     1 
ATOM   6242  O  O     . LEU D 4  701  ? 1.488   5.115   97.788  1.00 109.92 ? 701  LEU A O     1 
ATOM   6243  C  CB    . LEU D 4  701  ? 0.156   6.824   99.470  1.00 109.07 ? 701  LEU A CB    1 
ATOM   6244  C  CG    . LEU D 4  701  ? -0.667  7.906   100.172 1.00 94.19  ? 701  LEU A CG    1 
ATOM   6245  C  CD1   . LEU D 4  701  ? -2.011  7.356   100.595 1.00 93.01  ? 701  LEU A CD1   1 
ATOM   6246  C  CD2   . LEU D 4  701  ? 0.085   8.409   101.388 1.00 85.00  ? 701  LEU A CD2   1 
ATOM   6247  N  N     . LEU D 4  702  ? 3.451   6.167   97.835  1.00 137.26 ? 702  LEU A N     1 
ATOM   6248  C  CA    . LEU D 4  702  ? 4.028   5.328   96.797  1.00 137.49 ? 702  LEU A CA    1 
ATOM   6249  C  C     . LEU D 4  702  ? 5.139   4.518   97.443  1.00 157.19 ? 702  LEU A C     1 
ATOM   6250  O  O     . LEU D 4  702  ? 5.913   5.040   98.255  1.00 154.13 ? 702  LEU A O     1 
ATOM   6251  C  CB    . LEU D 4  702  ? 4.522   6.174   95.608  1.00 128.33 ? 702  LEU A CB    1 
ATOM   6252  C  CG    . LEU D 4  702  ? 5.126   5.662   94.276  1.00 130.73 ? 702  LEU A CG    1 
ATOM   6253  C  CD1   . LEU D 4  702  ? 6.469   4.851   94.250  1.00 120.92 ? 702  LEU A CD1   1 
ATOM   6254  C  CD2   . LEU D 4  702  ? 4.018   4.914   93.566  1.00 140.02 ? 702  LEU A CD2   1 
ATOM   6255  N  N     . THR D 4  703  ? 5.165   3.231   97.131  1.00 178.32 ? 703  THR A N     1 
ATOM   6256  C  CA    . THR D 4  703  ? 6.241   2.339   97.558  1.00 186.50 ? 703  THR A CA    1 
ATOM   6257  C  C     . THR D 4  703  ? 7.415   2.472   96.605  1.00 183.22 ? 703  THR A C     1 
ATOM   6258  O  O     . THR D 4  703  ? 7.422   1.863   95.534  1.00 191.48 ? 703  THR A O     1 
ATOM   6259  C  CB    . THR D 4  703  ? 5.770   0.894   97.596  1.00 191.27 ? 703  THR A CB    1 
ATOM   6260  O  OG1   . THR D 4  703  ? 4.403   0.835   98.011  1.00 194.85 ? 703  THR A OG1   1 
ATOM   6261  C  CG2   . THR D 4  703  ? 6.626   0.044   98.537  1.00 190.33 ? 703  THR A CG2   1 
ATOM   6262  N  N     . ALA D 4  704  ? 8.385   3.319   96.962  1.00 162.15 ? 704  ALA A N     1 
ATOM   6263  C  CA    . ALA D 4  704  ? 9.495   3.652   96.069  1.00 134.32 ? 704  ALA A CA    1 
ATOM   6264  C  C     . ALA D 4  704  ? 10.313  2.418   95.706  1.00 133.59 ? 704  ALA A C     1 
ATOM   6265  O  O     . ALA D 4  704  ? 11.333  2.128   96.342  1.00 123.44 ? 704  ALA A O     1 
ATOM   6266  C  CB    . ALA D 4  704  ? 10.392  4.713   96.703  1.00 110.57 ? 704  ALA A CB    1 
ATOM   6267  N  N     . LYS D 4  705  ? 9.860   1.690   94.687  1.00 143.31 ? 705  LYS A N     1 
ATOM   6268  C  CA    . LYS D 4  705  ? 10.524  0.461   94.295  1.00 140.16 ? 705  LYS A CA    1 
ATOM   6269  C  C     . LYS D 4  705  ? 11.877  0.774   93.671  1.00 137.20 ? 705  LYS A C     1 
ATOM   6270  O  O     . LYS D 4  705  ? 12.112  1.865   93.141  1.00 143.17 ? 705  LYS A O     1 
ATOM   6271  C  CB    . LYS D 4  705  ? 9.642   -0.341  93.334  1.00 137.12 ? 705  LYS A CB    1 
ATOM   6272  C  CG    . LYS D 4  705  ? 9.975   -0.189  91.860  1.00 142.65 ? 705  LYS A CG    1 
ATOM   6273  C  CD    . LYS D 4  705  ? 8.890   -0.788  90.977  1.00 148.07 ? 705  LYS A CD    1 
ATOM   6274  C  CE    . LYS D 4  705  ? 7.634   0.067   90.985  1.00 148.20 ? 705  LYS A CE    1 
ATOM   6275  N  NZ    . LYS D 4  705  ? 6.763   -0.199  89.806  1.00 138.15 ? 705  LYS A NZ    1 
ATOM   6276  N  N     . HIS D 4  706  ? 12.781  -0.192  93.767  1.00 121.69 ? 706  HIS A N     1 
ATOM   6277  C  CA    . HIS D 4  706  ? 14.174  0.050   93.442  1.00 105.46 ? 706  HIS A CA    1 
ATOM   6278  C  C     . HIS D 4  706  ? 14.375  0.066   91.935  1.00 88.09  ? 706  HIS A C     1 
ATOM   6279  O  O     . HIS D 4  706  ? 13.742  -0.696  91.199  1.00 100.77 ? 706  HIS A O     1 
ATOM   6280  C  CB    . HIS D 4  706  ? 15.058  -1.018  94.084  1.00 101.36 ? 706  HIS A CB    1 
ATOM   6281  C  CG    . HIS D 4  706  ? 16.515  -0.857  93.787  1.00 95.05  ? 706  HIS A CG    1 
ATOM   6282  N  ND1   . HIS D 4  706  ? 17.374  -0.203  94.642  1.00 95.05  ? 706  HIS A ND1   1 
ATOM   6283  C  CD2   . HIS D 4  706  ? 17.269  -1.274  92.742  1.00 91.06  ? 706  HIS A CD2   1 
ATOM   6284  C  CE1   . HIS D 4  706  ? 18.591  -0.213  94.131  1.00 93.28  ? 706  HIS A CE1   1 
ATOM   6285  N  NE2   . HIS D 4  706  ? 18.556  -0.857  92.979  1.00 92.99  ? 706  HIS A NE2   1 
ATOM   6286  N  N     . GLY D 4  707  ? 15.254  0.955   91.477  1.00 75.43  ? 707  GLY A N     1 
ATOM   6287  C  CA    . GLY D 4  707  ? 15.673  0.986   90.098  1.00 71.15  ? 707  GLY A CA    1 
ATOM   6288  C  C     . GLY D 4  707  ? 14.926  1.961   89.214  1.00 77.39  ? 707  GLY A C     1 
ATOM   6289  O  O     . GLY D 4  707  ? 15.432  2.317   88.148  1.00 69.88  ? 707  GLY A O     1 
ATOM   6290  N  N     . MET D 4  708  ? 13.738  2.404   89.610  1.00 95.89  ? 708  MET A N     1 
ATOM   6291  C  CA    . MET D 4  708  ? 12.977  3.318   88.774  1.00 109.78 ? 708  MET A CA    1 
ATOM   6292  C  C     . MET D 4  708  ? 12.369  4.421   89.624  1.00 106.78 ? 708  MET A C     1 
ATOM   6293  O  O     . MET D 4  708  ? 12.140  4.253   90.825  1.00 98.40  ? 708  MET A O     1 
ATOM   6294  C  CB    . MET D 4  708  ? 11.888  2.582   87.981  1.00 110.04 ? 708  MET A CB    1 
ATOM   6295  C  CG    . MET D 4  708  ? 10.973  1.707   88.815  1.00 118.36 ? 708  MET A CG    1 
ATOM   6296  S  SD    . MET D 4  708  ? 9.763   0.819   87.811  1.00 125.16 ? 708  MET A SD    1 
ATOM   6297  C  CE    . MET D 4  708  ? 10.669  0.581   86.283  1.00 124.02 ? 708  MET A CE    1 
ATOM   6298  N  N     . THR D 4  709  ? 12.104  5.551   88.973  1.00 101.83 ? 709  THR A N     1 
ATOM   6299  C  CA    . THR D 4  709  ? 11.619  6.739   89.652  1.00 101.52 ? 709  THR A CA    1 
ATOM   6300  C  C     . THR D 4  709  ? 10.169  6.562   90.080  1.00 94.33  ? 709  THR A C     1 
ATOM   6301  O  O     . THR D 4  709  ? 9.542   5.512   89.900  1.00 99.06  ? 709  THR A O     1 
ATOM   6302  C  CB    . THR D 4  709  ? 11.733  7.965   88.753  1.00 108.10 ? 709  THR A CB    1 
ATOM   6303  O  OG1   . THR D 4  709  ? 10.537  8.089   87.971  1.00 103.89 ? 709  THR A OG1   1 
ATOM   6304  C  CG2   . THR D 4  709  ? 12.932  7.843   87.826  1.00 103.62 ? 709  THR A CG2   1 
ATOM   6305  N  N     . LEU D 4  710  ? 9.636   7.629   90.655  1.00 87.67  ? 710  LEU A N     1 
ATOM   6306  C  CA    . LEU D 4  710  ? 8.249   7.625   91.089  1.00 91.60  ? 710  LEU A CA    1 
ATOM   6307  C  C     . LEU D 4  710  ? 7.336   7.844   89.892  1.00 97.13  ? 710  LEU A C     1 
ATOM   6308  O  O     . LEU D 4  710  ? 6.245   7.262   89.804  1.00 100.30 ? 710  LEU A O     1 
ATOM   6309  C  CB    . LEU D 4  710  ? 8.037   8.712   92.149  1.00 91.36  ? 710  LEU A CB    1 
ATOM   6310  C  CG    . LEU D 4  710  ? 8.793   8.766   93.502  1.00 96.87  ? 710  LEU A CG    1 
ATOM   6311  C  CD1   . LEU D 4  710  ? 8.778   7.479   94.302  1.00 94.57  ? 710  LEU A CD1   1 
ATOM   6312  C  CD2   . LEU D 4  710  ? 10.232  9.337   93.367  1.00 100.94 ? 710  LEU A CD2   1 
ATOM   6313  N  N     . ARG D 4  711  ? 7.804   8.676   88.957  1.00 98.53  ? 711  ARG A N     1 
ATOM   6314  C  CA    . ARG D 4  711  ? 7.090   8.931   87.715  1.00 93.94  ? 711  ARG A CA    1 
ATOM   6315  C  C     . ARG D 4  711  ? 7.142   7.725   86.794  1.00 93.95  ? 711  ARG A C     1 
ATOM   6316  O  O     . ARG D 4  711  ? 6.159   7.425   86.111  1.00 97.97  ? 711  ARG A O     1 
ATOM   6317  C  CB    . ARG D 4  711  ? 7.691   10.147  87.011  1.00 97.22  ? 711  ARG A CB    1 
ATOM   6318  C  CG    . ARG D 4  711  ? 7.288   11.482  87.594  1.00 101.65 ? 711  ARG A CG    1 
ATOM   6319  C  CD    . ARG D 4  711  ? 6.955   12.487  86.499  1.00 99.19  ? 711  ARG A CD    1 
ATOM   6320  N  NE    . ARG D 4  711  ? 6.070   13.538  86.996  1.00 95.97  ? 711  ARG A NE    1 
ATOM   6321  C  CZ    . ARG D 4  711  ? 6.475   14.592  87.697  1.00 96.88  ? 711  ARG A CZ    1 
ATOM   6322  N  NH1   . ARG D 4  711  ? 7.760   14.749  87.990  1.00 79.71  ? 711  ARG A NH1   1 
ATOM   6323  N  NH2   . ARG D 4  711  ? 5.594   15.492  88.106  1.00 109.13 ? 711  ARG A NH2   1 
ATOM   6324  N  N     . GLU D 4  712  ? 8.292   7.044   86.744  1.00 85.03  ? 712  GLU A N     1 
ATOM   6325  C  CA    . GLU D 4  712  ? 8.460   5.901   85.854  1.00 73.05  ? 712  GLU A CA    1 
ATOM   6326  C  C     . GLU D 4  712  ? 7.575   4.735   86.268  1.00 71.72  ? 712  GLU A C     1 
ATOM   6327  O  O     . GLU D 4  712  ? 7.114   3.976   85.409  1.00 64.63  ? 712  GLU A O     1 
ATOM   6328  C  CB    . GLU D 4  712  ? 9.924   5.471   85.841  1.00 76.91  ? 712  GLU A CB    1 
ATOM   6329  C  CG    . GLU D 4  712  ? 10.760  6.139   84.770  1.00 81.88  ? 712  GLU A CG    1 
ATOM   6330  C  CD    . GLU D 4  712  ? 12.228  5.795   84.893  1.00 99.55  ? 712  GLU A CD    1 
ATOM   6331  O  OE1   . GLU D 4  712  ? 12.606  5.157   85.897  1.00 95.76  ? 712  GLU A OE1   1 
ATOM   6332  O  OE2   . GLU D 4  712  ? 13.004  6.166   83.988  1.00 105.30 ? 712  GLU A OE2   1 
ATOM   6333  N  N     . SER D 4  713  ? 7.330   4.575   87.569  1.00 79.90  ? 713  SER A N     1 
ATOM   6334  C  CA    . SER D 4  713  ? 6.378   3.585   88.046  1.00 94.91  ? 713  SER A CA    1 
ATOM   6335  C  C     . SER D 4  713  ? 4.936   4.000   87.803  1.00 91.20  ? 713  SER A C     1 
ATOM   6336  O  O     . SER D 4  713  ? 4.066   3.130   87.708  1.00 84.33  ? 713  SER A O     1 
ATOM   6337  C  CB    . SER D 4  713  ? 6.599   3.327   89.535  1.00 109.67 ? 713  SER A CB    1 
ATOM   6338  O  OG    . SER D 4  713  ? 7.979   3.148   89.810  1.00 115.72 ? 713  SER A OG    1 
ATOM   6339  N  N     . PHE D 4  714  ? 4.662   5.302   87.711  1.00 91.23  ? 714  PHE A N     1 
ATOM   6340  C  CA    . PHE D 4  714  ? 3.328   5.754   87.335  1.00 79.05  ? 714  PHE A CA    1 
ATOM   6341  C  C     . PHE D 4  714  ? 3.072   5.515   85.853  1.00 76.05  ? 714  PHE A C     1 
ATOM   6342  O  O     . PHE D 4  714  ? 2.007   5.021   85.469  1.00 73.92  ? 714  PHE A O     1 
ATOM   6343  C  CB    . PHE D 4  714  ? 3.167   7.236   87.675  1.00 61.43  ? 714  PHE A CB    1 
ATOM   6344  C  CG    . PHE D 4  714  ? 1.841   7.814   87.270  1.00 61.34  ? 714  PHE A CG    1 
ATOM   6345  C  CD1   . PHE D 4  714  ? 0.699   7.531   87.999  1.00 65.58  ? 714  PHE A CD1   1 
ATOM   6346  C  CD2   . PHE D 4  714  ? 1.736   8.641   86.161  1.00 66.50  ? 714  PHE A CD2   1 
ATOM   6347  C  CE1   . PHE D 4  714  ? -0.521  8.060   87.633  1.00 64.47  ? 714  PHE A CE1   1 
ATOM   6348  C  CE2   . PHE D 4  714  ? 0.516   9.172   85.789  1.00 64.80  ? 714  PHE A CE2   1 
ATOM   6349  C  CZ    . PHE D 4  714  ? -0.614  8.881   86.528  1.00 60.23  ? 714  PHE A CZ    1 
ATOM   6350  N  N     . GLU D 4  715  ? 4.047   5.865   85.010  1.00 75.83  ? 715  GLU A N     1 
ATOM   6351  C  CA    . GLU D 4  715  ? 3.882   5.755   83.564  1.00 75.65  ? 715  GLU A CA    1 
ATOM   6352  C  C     . GLU D 4  715  ? 3.756   4.303   83.123  1.00 77.87  ? 715  GLU A C     1 
ATOM   6353  O  O     . GLU D 4  715  ? 2.959   3.987   82.233  1.00 74.25  ? 715  GLU A O     1 
ATOM   6354  C  CB    . GLU D 4  715  ? 5.061   6.426   82.864  1.00 70.64  ? 715  GLU A CB    1 
ATOM   6355  C  CG    . GLU D 4  715  ? 4.823   7.882   82.519  1.00 89.22  ? 715  GLU A CG    1 
ATOM   6356  C  CD    . GLU D 4  715  ? 3.506   8.095   81.811  1.00 87.50  ? 715  GLU A CD    1 
ATOM   6357  O  OE1   . GLU D 4  715  ? 3.389   7.628   80.663  1.00 80.70  ? 715  GLU A OE1   1 
ATOM   6358  O  OE2   . GLU D 4  715  ? 2.591   8.714   82.396  1.00 82.62  ? 715  GLU A OE2   1 
ATOM   6359  N  N     . ASP D 4  716  ? 4.536   3.409   83.735  1.00 80.24  ? 716  ASP A N     1 
ATOM   6360  C  CA    . ASP D 4  716  ? 4.428   1.991   83.417  1.00 70.98  ? 716  ASP A CA    1 
ATOM   6361  C  C     . ASP D 4  716  ? 3.096   1.412   83.867  1.00 59.40  ? 716  ASP A C     1 
ATOM   6362  O  O     . ASP D 4  716  ? 2.564   0.517   83.210  1.00 59.21  ? 716  ASP A O     1 
ATOM   6363  C  CB    . ASP D 4  716  ? 5.574   1.219   84.065  1.00 79.32  ? 716  ASP A CB    1 
ATOM   6364  C  CG    . ASP D 4  716  ? 6.860   1.325   83.285  1.00 92.44  ? 716  ASP A CG    1 
ATOM   6365  O  OD1   . ASP D 4  716  ? 6.888   2.065   82.280  1.00 94.48  ? 716  ASP A OD1   1 
ATOM   6366  O  OD2   . ASP D 4  716  ? 7.844   0.670   83.684  1.00 96.22  ? 716  ASP A OD2   1 
ATOM   6367  N  N     . ASN D 4  717  ? 2.542   1.909   84.970  1.00 65.17  ? 717  ASN A N     1 
ATOM   6368  C  CA    . ASN D 4  717  ? 1.304   1.359   85.500  1.00 70.86  ? 717  ASN A CA    1 
ATOM   6369  C  C     . ASN D 4  717  ? 0.055   1.881   84.808  1.00 61.94  ? 717  ASN A C     1 
ATOM   6370  O  O     . ASN D 4  717  ? -1.018  1.321   85.019  1.00 61.10  ? 717  ASN A O     1 
ATOM   6371  C  CB    . ASN D 4  717  ? 1.213   1.635   87.002  1.00 69.25  ? 717  ASN A CB    1 
ATOM   6372  C  CG    . ASN D 4  717  ? 2.005   0.641   87.823  1.00 63.49  ? 717  ASN A CG    1 
ATOM   6373  O  OD1   . ASN D 4  717  ? 2.533   -0.336  87.295  1.00 63.30  ? 717  ASN A OD1   1 
ATOM   6374  N  ND2   . ASN D 4  717  ? 2.098   0.890   89.122  1.00 64.66  ? 717  ASN A ND2   1 
ATOM   6375  N  N     . VAL D 4  718  ? 0.158   2.931   84.002  1.00 59.39  ? 718  VAL A N     1 
ATOM   6376  C  CA    . VAL D 4  718  ? -0.954  3.412   83.191  1.00 61.61  ? 718  VAL A CA    1 
ATOM   6377  C  C     . VAL D 4  718  ? -0.877  2.894   81.762  1.00 62.97  ? 718  VAL A C     1 
ATOM   6378  O  O     . VAL D 4  718  ? -1.905  2.576   81.166  1.00 63.64  ? 718  VAL A O     1 
ATOM   6379  C  CB    . VAL D 4  718  ? -1.009  4.954   83.225  1.00 58.71  ? 718  VAL A CB    1 
ATOM   6380  C  CG1   . VAL D 4  718  ? -2.224  5.483   82.473  1.00 64.73  ? 718  VAL A CG1   1 
ATOM   6381  C  CG2   . VAL D 4  718  ? -1.086  5.445   84.657  1.00 59.41  ? 718  VAL A CG2   1 
ATOM   6382  N  N     . VAL D 4  719  ? 0.333   2.797   81.210  1.00 64.51  ? 719  VAL A N     1 
ATOM   6383  C  CA    . VAL D 4  719  ? 0.512   2.181   79.897  1.00 56.06  ? 719  VAL A CA    1 
ATOM   6384  C  C     . VAL D 4  719  ? 0.090   0.716   79.937  1.00 71.37  ? 719  VAL A C     1 
ATOM   6385  O  O     . VAL D 4  719  ? -0.588  0.223   79.025  1.00 73.15  ? 719  VAL A O     1 
ATOM   6386  C  CB    . VAL D 4  719  ? 1.973   2.353   79.435  1.00 55.43  ? 719  VAL A CB    1 
ATOM   6387  C  CG1   . VAL D 4  719  ? 2.409   1.229   78.498  1.00 73.19  ? 719  VAL A CG1   1 
ATOM   6388  C  CG2   . VAL D 4  719  ? 2.164   3.704   78.766  1.00 54.43  ? 719  VAL A CG2   1 
ATOM   6389  N  N     . ARG D 4  720  ? 0.443   0.013   81.016  1.00 69.57  ? 720  ARG A N     1 
ATOM   6390  C  CA    . ARG D 4  720  ? 0.084   -1.396  81.144  1.00 67.11  ? 720  ARG A CA    1 
ATOM   6391  C  C     . ARG D 4  720  ? -1.406  -1.573  81.408  1.00 77.54  ? 720  ARG A C     1 
ATOM   6392  O  O     . ARG D 4  720  ? -2.012  -2.535  80.925  1.00 96.36  ? 720  ARG A O     1 
ATOM   6393  C  CB    . ARG D 4  720  ? 0.909   -2.041  82.257  1.00 80.10  ? 720  ARG A CB    1 
ATOM   6394  C  CG    . ARG D 4  720  ? 1.138   -3.531  82.115  1.00 88.85  ? 720  ARG A CG    1 
ATOM   6395  C  CD    . ARG D 4  720  ? 1.232   -4.183  83.485  1.00 98.41  ? 720  ARG A CD    1 
ATOM   6396  N  NE    . ARG D 4  720  ? -0.077  -4.515  84.037  1.00 111.23 ? 720  ARG A NE    1 
ATOM   6397  C  CZ    . ARG D 4  720  ? -0.534  -4.066  85.202  1.00 111.77 ? 720  ARG A CZ    1 
ATOM   6398  N  NH1   . ARG D 4  720  ? 0.210   -3.257  85.946  1.00 103.52 ? 720  ARG A NH1   1 
ATOM   6399  N  NH2   . ARG D 4  720  ? -1.738  -4.429  85.624  1.00 108.61 ? 720  ARG A NH2   1 
ATOM   6400  N  N     . PHE D 4  721  ? -2.012  -0.660  82.175  1.00 71.06  ? 721  PHE A N     1 
ATOM   6401  C  CA    . PHE D 4  721  ? -3.449  -0.728  82.433  1.00 69.34  ? 721  PHE A CA    1 
ATOM   6402  C  C     . PHE D 4  721  ? -4.266  -0.533  81.165  1.00 70.08  ? 721  PHE A C     1 
ATOM   6403  O  O     . PHE D 4  721  ? -5.341  -1.128  81.027  1.00 73.78  ? 721  PHE A O     1 
ATOM   6404  C  CB    . PHE D 4  721  ? -3.855  0.331   83.458  1.00 75.92  ? 721  PHE A CB    1 
ATOM   6405  C  CG    . PHE D 4  721  ? -3.741  -0.114  84.889  1.00 83.39  ? 721  PHE A CG    1 
ATOM   6406  C  CD1   . PHE D 4  721  ? -4.510  0.494   85.867  1.00 71.51  ? 721  PHE A CD1   1 
ATOM   6407  C  CD2   . PHE D 4  721  ? -2.890  -1.142  85.258  1.00 97.12  ? 721  PHE A CD2   1 
ATOM   6408  C  CE1   . PHE D 4  721  ? -4.418  0.102   87.184  1.00 70.80  ? 721  PHE A CE1   1 
ATOM   6409  C  CE2   . PHE D 4  721  ? -2.793  -1.538  86.578  1.00 103.87 ? 721  PHE A CE2   1 
ATOM   6410  C  CZ    . PHE D 4  721  ? -3.562  -0.917  87.541  1.00 96.34  ? 721  PHE A CZ    1 
ATOM   6411  N  N     . LEU D 4  722  ? -3.781  0.291   80.239  1.00 66.41  ? 722  LEU A N     1 
ATOM   6412  C  CA    . LEU D 4  722  ? -4.526  0.619   79.033  1.00 62.20  ? 722  LEU A CA    1 
ATOM   6413  C  C     . LEU D 4  722  ? -4.305  -0.394  77.921  1.00 64.05  ? 722  LEU A C     1 
ATOM   6414  O  O     . LEU D 4  722  ? -5.195  -0.594  77.088  1.00 73.86  ? 722  LEU A O     1 
ATOM   6415  C  CB    . LEU D 4  722  ? -4.138  2.021   78.555  1.00 64.45  ? 722  LEU A CB    1 
ATOM   6416  C  CG    . LEU D 4  722  ? -4.657  3.130   79.482  1.00 56.40  ? 722  LEU A CG    1 
ATOM   6417  C  CD1   . LEU D 4  722  ? -4.078  4.486   79.120  1.00 55.51  ? 722  LEU A CD1   1 
ATOM   6418  C  CD2   . LEU D 4  722  ? -6.176  3.178   79.518  1.00 56.80  ? 722  LEU A CD2   1 
ATOM   6419  N  N     . ASN D 4  723  ? -3.135  -1.037  77.890  1.00 63.01  ? 723  ASN A N     1 
ATOM   6420  C  CA    . ASN D 4  723  ? -2.925  -2.142  76.964  1.00 72.08  ? 723  ASN A CA    1 
ATOM   6421  C  C     . ASN D 4  723  ? -3.703  -3.380  77.388  1.00 74.96  ? 723  ASN A C     1 
ATOM   6422  O  O     . ASN D 4  723  ? -4.159  -4.145  76.531  1.00 77.00  ? 723  ASN A O     1 
ATOM   6423  C  CB    . ASN D 4  723  ? -1.436  -2.460  76.862  1.00 78.63  ? 723  ASN A CB    1 
ATOM   6424  C  CG    . ASN D 4  723  ? -0.646  -1.336  76.233  1.00 85.36  ? 723  ASN A CG    1 
ATOM   6425  O  OD1   . ASN D 4  723  ? -1.136  -0.215  76.107  1.00 83.60  ? 723  ASN A OD1   1 
ATOM   6426  N  ND2   . ASN D 4  723  ? 0.588   -1.626  75.839  1.00 97.40  ? 723  ASN A ND2   1 
ATOM   6427  N  N     . GLU D 4  724  ? -3.845  -3.598  78.700  1.00 81.38  ? 724  GLU A N     1 
ATOM   6428  C  CA    . GLU D 4  724  ? -4.714  -4.660  79.203  1.00 88.41  ? 724  GLU A CA    1 
ATOM   6429  C  C     . GLU D 4  724  ? -6.161  -4.433  78.791  1.00 85.39  ? 724  GLU A C     1 
ATOM   6430  O  O     . GLU D 4  724  ? -6.880  -5.386  78.469  1.00 105.86 ? 724  GLU A O     1 
ATOM   6431  C  CB    . GLU D 4  724  ? -4.627  -4.733  80.728  1.00 89.18  ? 724  GLU A CB    1 
ATOM   6432  C  CG    . GLU D 4  724  ? -3.406  -5.417  81.304  1.00 81.90  ? 724  GLU A CG    1 
ATOM   6433  C  CD    . GLU D 4  724  ? -3.460  -5.463  82.819  1.00 86.10  ? 724  GLU A CD    1 
ATOM   6434  O  OE1   . GLU D 4  724  ? -4.494  -5.052  83.389  1.00 84.83  ? 724  GLU A OE1   1 
ATOM   6435  O  OE2   . GLU D 4  724  ? -2.470  -5.899  83.441  1.00 92.63  ? 724  GLU A OE2   1 
ATOM   6436  N  N     . ALA D 4  725  ? -6.608  -3.176  78.810  1.00 61.51  ? 725  ALA A N     1 
ATOM   6437  C  CA    . ALA D 4  725  ? -8.009  -2.866  78.561  1.00 64.89  ? 725  ALA A CA    1 
ATOM   6438  C  C     . ALA D 4  725  ? -8.358  -2.909  77.081  1.00 83.11  ? 725  ALA A C     1 
ATOM   6439  O  O     . ALA D 4  725  ? -9.501  -3.225  76.730  1.00 87.04  ? 725  ALA A O     1 
ATOM   6440  C  CB    . ALA D 4  725  ? -8.344  -1.493  79.136  1.00 73.75  ? 725  ALA A CB    1 
ATOM   6441  N  N     . ARG D 4  726  ? -7.406  -2.575  76.208  1.00 88.13  ? 726  ARG A N     1 
ATOM   6442  C  CA    . ARG D 4  726  ? -7.624  -2.737  74.776  1.00 77.63  ? 726  ARG A CA    1 
ATOM   6443  C  C     . ARG D 4  726  ? -7.729  -4.210  74.412  1.00 78.32  ? 726  ARG A C     1 
ATOM   6444  O  O     . ARG D 4  726  ? -8.612  -4.611  73.644  1.00 89.92  ? 726  ARG A O     1 
ATOM   6445  C  CB    . ARG D 4  726  ? -6.490  -2.080  73.995  1.00 54.75  ? 726  ARG A CB    1 
ATOM   6446  C  CG    . ARG D 4  726  ? -6.511  -2.381  72.507  1.00 53.83  ? 726  ARG A CG    1 
ATOM   6447  C  CD    . ARG D 4  726  ? -5.193  -2.989  72.079  1.00 53.48  ? 726  ARG A CD    1 
ATOM   6448  N  NE    . ARG D 4  726  ? -4.078  -2.062  72.219  1.00 64.11  ? 726  ARG A NE    1 
ATOM   6449  C  CZ    . ARG D 4  726  ? -2.802  -2.425  72.166  1.00 75.33  ? 726  ARG A CZ    1 
ATOM   6450  N  NH1   . ARG D 4  726  ? -1.848  -1.516  72.301  1.00 82.67  ? 726  ARG A NH1   1 
ATOM   6451  N  NH2   . ARG D 4  726  ? -2.480  -3.698  71.985  1.00 71.53  ? 726  ARG A NH2   1 
ATOM   6452  N  N     . ASP D 4  727  ? -6.825  -5.031  74.956  1.00 72.75  ? 727  ASP A N     1 
ATOM   6453  C  CA    . ASP D 4  727  ? -6.854  -6.462  74.678  1.00 57.61  ? 727  ASP A CA    1 
ATOM   6454  C  C     . ASP D 4  727  ? -8.108  -7.113  75.245  1.00 59.10  ? 727  ASP A C     1 
ATOM   6455  O  O     . ASP D 4  727  ? -8.740  -7.925  74.566  1.00 73.37  ? 727  ASP A O     1 
ATOM   6456  C  CB    . ASP D 4  727  ? -5.602  -7.135  75.236  1.00 58.04  ? 727  ASP A CB    1 
ATOM   6457  C  CG    . ASP D 4  727  ? -4.331  -6.594  74.622  1.00 65.80  ? 727  ASP A CG    1 
ATOM   6458  O  OD1   . ASP D 4  727  ? -4.399  -5.582  73.897  1.00 58.70  ? 727  ASP A OD1   1 
ATOM   6459  O  OD2   . ASP D 4  727  ? -3.260  -7.188  74.863  1.00 81.35  ? 727  ASP A OD2   1 
ATOM   6460  N  N     . LYS D 4  728  ? -8.498  -6.748  76.473  1.00 62.80  ? 728  LYS A N     1 
ATOM   6461  C  CA    . LYS D 4  728  ? -9.703  -7.320  77.072  1.00 84.89  ? 728  LYS A CA    1 
ATOM   6462  C  C     . LYS D 4  728  ? -10.957 -6.951  76.290  1.00 92.37  ? 728  LYS A C     1 
ATOM   6463  O  O     . LYS D 4  728  ? -11.934 -7.707  76.298  1.00 104.29 ? 728  LYS A O     1 
ATOM   6464  C  CB    . LYS D 4  728  ? -9.846  -6.867  78.526  1.00 84.38  ? 728  LYS A CB    1 
ATOM   6465  C  CG    . LYS D 4  728  ? -10.689 -7.807  79.376  1.00 88.20  ? 728  LYS A CG    1 
ATOM   6466  C  CD    . LYS D 4  728  ? -11.461 -7.053  80.447  1.00 98.36  ? 728  LYS A CD    1 
ATOM   6467  C  CE    . LYS D 4  728  ? -12.761 -7.761  80.797  1.00 106.80 ? 728  LYS A CE    1 
ATOM   6468  N  NZ    . LYS D 4  728  ? -12.527 -8.997  81.591  1.00 115.45 ? 728  LYS A NZ    1 
ATOM   6469  N  N     . ALA D 4  729  ? -10.950 -5.806  75.607  1.00 86.46  ? 729  ALA A N     1 
ATOM   6470  C  CA    . ALA D 4  729  ? -12.065 -5.454  74.737  1.00 85.19  ? 729  ALA A CA    1 
ATOM   6471  C  C     . ALA D 4  729  ? -12.034 -6.257  73.443  1.00 89.68  ? 729  ALA A C     1 
ATOM   6472  O  O     . ALA D 4  729  ? -13.082 -6.699  72.960  1.00 86.64  ? 729  ALA A O     1 
ATOM   6473  C  CB    . ALA D 4  729  ? -12.042 -3.957  74.436  1.00 77.58  ? 729  ALA A CB    1 
ATOM   6474  N  N     . GLY D 4  730  ? -10.844 -6.452  72.872  1.00 83.32  ? 730  GLY A N     1 
ATOM   6475  C  CA    . GLY D 4  730  ? -10.740 -7.228  71.648  1.00 64.35  ? 730  GLY A CA    1 
ATOM   6476  C  C     . GLY D 4  730  ? -11.059 -8.696  71.856  1.00 77.39  ? 730  GLY A C     1 
ATOM   6477  O  O     . GLY D 4  730  ? -11.713 -9.321  71.017  1.00 91.12  ? 730  GLY A O     1 
ATOM   6478  N  N     . ARG D 4  731  ? -10.584 -9.271  72.967  1.00 86.36  ? 731  ARG A N     1 
ATOM   6479  C  CA    . ARG D 4  731  ? -10.957 -10.641 73.307  1.00 95.06  ? 731  ARG A CA    1 
ATOM   6480  C  C     . ARG D 4  731  ? -12.446 -10.738 73.600  1.00 101.18 ? 731  ARG A C     1 
ATOM   6481  O  O     . ARG D 4  731  ? -13.067 -11.771 73.333  1.00 115.25 ? 731  ARG A O     1 
ATOM   6482  C  CB    . ARG D 4  731  ? -10.149 -11.126 74.511  1.00 102.52 ? 731  ARG A CB    1 
ATOM   6483  C  CG    . ARG D 4  731  ? -8.645  -11.063 74.316  1.00 111.23 ? 731  ARG A CG    1 
ATOM   6484  C  CD    . ARG D 4  731  ? -7.984  -12.389 73.975  1.00 120.13 ? 731  ARG A CD    1 
ATOM   6485  N  NE    . ARG D 4  731  ? -6.575  -12.215 73.603  1.00 125.38 ? 731  ARG A NE    1 
ATOM   6486  C  CZ    . ARG D 4  731  ? -5.590  -11.837 74.422  1.00 124.63 ? 731  ARG A CZ    1 
ATOM   6487  N  NH1   . ARG D 4  731  ? -5.806  -11.605 75.713  1.00 108.55 ? 731  ARG A NH1   1 
ATOM   6488  N  NH2   . ARG D 4  731  ? -4.359  -11.713 73.944  1.00 124.83 ? 731  ARG A NH2   1 
ATOM   6489  N  N     . LEU D 4  732  ? -13.035 -9.667  74.139  1.00 95.42  ? 732  LEU A N     1 
ATOM   6490  C  CA    . LEU D 4  732  ? -14.482 -9.592  74.286  1.00 89.88  ? 732  LEU A CA    1 
ATOM   6491  C  C     . LEU D 4  732  ? -15.186 -9.459  72.943  1.00 80.71  ? 732  LEU A C     1 
ATOM   6492  O  O     . LEU D 4  732  ? -16.369 -9.797  72.847  1.00 82.91  ? 732  LEU A O     1 
ATOM   6493  C  CB    . LEU D 4  732  ? -14.861 -8.414  75.185  1.00 96.71  ? 732  LEU A CB    1 
ATOM   6494  C  CG    . LEU D 4  732  ? -15.605 -8.718  76.485  1.00 89.80  ? 732  LEU A CG    1 
ATOM   6495  C  CD1   . LEU D 4  732  ? -15.942 -7.425  77.201  1.00 63.77  ? 732  LEU A CD1   1 
ATOM   6496  C  CD2   . LEU D 4  732  ? -16.862 -9.519  76.204  1.00 89.64  ? 732  LEU A CD2   1 
ATOM   6497  N  N     . ALA D 4  733  ? -14.493 -8.968  71.914  1.00 78.85  ? 733  ALA A N     1 
ATOM   6498  C  CA    . ALA D 4  733  ? -15.069 -8.830  70.582  1.00 72.34  ? 733  ALA A CA    1 
ATOM   6499  C  C     . ALA D 4  733  ? -14.934 -10.101 69.754  1.00 70.20  ? 733  ALA A C     1 
ATOM   6500  O  O     . ALA D 4  733  ? -15.870 -10.468 69.036  1.00 67.19  ? 733  ALA A O     1 
ATOM   6501  C  CB    . ALA D 4  733  ? -14.411 -7.662  69.841  1.00 57.76  ? 733  ALA A CB    1 
ATOM   6502  N  N     . GLU D 4  734  ? -13.783 -10.777 69.846  1.00 69.54  ? 734  GLU A N     1 
ATOM   6503  C  CA    . GLU D 4  734  ? -13.556 -12.005 69.089  1.00 64.97  ? 734  GLU A CA    1 
ATOM   6504  C  C     . GLU D 4  734  ? -14.504 -13.117 69.522  1.00 78.59  ? 734  GLU A C     1 
ATOM   6505  O  O     . GLU D 4  734  ? -14.851 -13.990 68.718  1.00 79.39  ? 734  GLU A O     1 
ATOM   6506  C  CB    . GLU D 4  734  ? -12.099 -12.442 69.259  1.00 66.75  ? 734  GLU A CB    1 
ATOM   6507  C  CG    . GLU D 4  734  ? -11.656 -13.622 68.404  1.00 87.13  ? 734  GLU A CG    1 
ATOM   6508  C  CD    . GLU D 4  734  ? -10.146 -13.769 68.361  1.00 98.53  ? 734  GLU A CD    1 
ATOM   6509  O  OE1   . GLU D 4  734  ? -9.512  -13.679 69.433  1.00 103.05 ? 734  GLU A OE1   1 
ATOM   6510  O  OE2   . GLU D 4  734  ? -9.593  -13.977 67.261  1.00 102.58 ? 734  GLU A OE2   1 
ATOM   6511  N  N     . VAL D 4  735  ? -14.947 -13.089 70.780  1.00 91.55  ? 735  VAL A N     1 
ATOM   6512  C  CA    . VAL D 4  735  ? -15.836 -14.127 71.287  1.00 90.98  ? 735  VAL A CA    1 
ATOM   6513  C  C     . VAL D 4  735  ? -17.240 -13.957 70.714  1.00 89.24  ? 735  VAL A C     1 
ATOM   6514  O  O     . VAL D 4  735  ? -17.920 -14.941 70.393  1.00 96.80  ? 735  VAL A O     1 
ATOM   6515  C  CB    . VAL D 4  735  ? -15.817 -14.105 72.829  1.00 88.93  ? 735  VAL A CB    1 
ATOM   6516  C  CG1   . VAL D 4  735  ? -17.040 -14.786 73.429  1.00 94.76  ? 735  VAL A CG1   1 
ATOM   6517  C  CG2   . VAL D 4  735  ? -14.542 -14.756 73.340  1.00 87.44  ? 735  VAL A CG2   1 
ATOM   6518  N  N     . ASN D 4  736  ? -17.677 -12.710 70.525  1.00 81.74  ? 736  ASN A N     1 
ATOM   6519  C  CA    . ASN D 4  736  ? -19.017 -12.464 70.004  1.00 83.64  ? 736  ASN A CA    1 
ATOM   6520  C  C     . ASN D 4  736  ? -19.133 -12.756 68.513  1.00 96.16  ? 736  ASN A C     1 
ATOM   6521  O  O     . ASN D 4  736  ? -20.253 -12.876 68.006  1.00 96.95  ? 736  ASN A O     1 
ATOM   6522  C  CB    . ASN D 4  736  ? -19.431 -11.020 70.284  1.00 68.38  ? 736  ASN A CB    1 
ATOM   6523  C  CG    . ASN D 4  736  ? -20.928 -10.815 70.180  1.00 73.80  ? 736  ASN A CG    1 
ATOM   6524  O  OD1   . ASN D 4  736  ? -21.635 -10.841 71.187  1.00 86.03  ? 736  ASN A OD1   1 
ATOM   6525  N  ND2   . ASN D 4  736  ? -21.418 -10.597 68.966  1.00 83.06  ? 736  ASN A ND2   1 
ATOM   6526  N  N     . LEU D 4  737  ? -18.014 -12.872 67.803  1.00 94.27  ? 737  LEU A N     1 
ATOM   6527  C  CA    . LEU D 4  737  ? -18.065 -13.130 66.371  1.00 72.75  ? 737  LEU A CA    1 
ATOM   6528  C  C     . LEU D 4  737  ? -18.517 -14.557 66.116  1.00 83.59  ? 737  LEU A C     1 
ATOM   6529  O  O     . LEU D 4  737  ? -17.925 -15.508 66.636  1.00 80.09  ? 737  LEU A O     1 
ATOM   6530  C  CB    . LEU D 4  737  ? -16.705 -12.893 65.731  1.00 59.77  ? 737  LEU A CB    1 
ATOM   6531  C  CG    . LEU D 4  737  ? -16.068 -11.524 65.901  1.00 61.55  ? 737  LEU A CG    1 
ATOM   6532  C  CD1   . LEU D 4  737  ? -14.806 -11.512 65.086  1.00 57.75  ? 737  LEU A CD1   1 
ATOM   6533  C  CD2   . LEU D 4  737  ? -17.015 -10.425 65.468  1.00 58.02  ? 737  LEU A CD2   1 
ATOM   6534  N  N     . LYS D 4  738  ? -19.557 -14.706 65.305  1.00 95.12  ? 738  LYS A N     1 
ATOM   6535  C  CA    . LYS D 4  738  ? -20.084 -16.018 64.992  1.00 86.19  ? 738  LYS A CA    1 
ATOM   6536  C  C     . LYS D 4  738  ? -19.204 -16.715 63.962  1.00 83.52  ? 738  LYS A C     1 
ATOM   6537  O  O     . LYS D 4  738  ? -18.219 -16.168 63.459  1.00 61.90  ? 738  LYS A O     1 
ATOM   6538  C  CB    . LYS D 4  738  ? -21.521 -15.905 64.503  1.00 67.72  ? 738  LYS A CB    1 
ATOM   6539  C  CG    . LYS D 4  738  ? -22.216 -14.676 65.015  1.00 70.14  ? 738  LYS A CG    1 
ATOM   6540  C  CD    . LYS D 4  738  ? -23.642 -14.648 64.565  1.00 64.36  ? 738  LYS A CD    1 
ATOM   6541  C  CE    . LYS D 4  738  ? -24.375 -13.543 65.264  1.00 68.65  ? 738  LYS A CE    1 
ATOM   6542  N  NZ    . LYS D 4  738  ? -25.481 -13.103 64.413  1.00 72.02  ? 738  LYS A NZ    1 
ATOM   6543  N  N     . ASP D 4  739  ? -19.585 -17.948 63.639  1.00 97.02  ? 739  ASP A N     1 
ATOM   6544  C  CA    . ASP D 4  739  ? -18.793 -18.801 62.769  1.00 104.48 ? 739  ASP A CA    1 
ATOM   6545  C  C     . ASP D 4  739  ? -18.829 -18.336 61.320  1.00 102.91 ? 739  ASP A C     1 
ATOM   6546  O  O     . ASP D 4  739  ? -17.940 -18.694 60.541  1.00 114.23 ? 739  ASP A O     1 
ATOM   6547  C  CB    . ASP D 4  739  ? -19.322 -20.225 62.897  1.00 114.88 ? 739  ASP A CB    1 
ATOM   6548  C  CG    . ASP D 4  739  ? -19.539 -20.623 64.345  1.00 121.01 ? 739  ASP A CG    1 
ATOM   6549  O  OD1   . ASP D 4  739  ? -20.154 -19.827 65.086  1.00 122.18 ? 739  ASP A OD1   1 
ATOM   6550  O  OD2   . ASP D 4  739  ? -19.107 -21.721 64.743  1.00 129.95 ? 739  ASP A OD2   1 
ATOM   6551  N  N     . LEU D 4  740  ? -19.832 -17.538 60.953  1.00 77.05  ? 740  LEU A N     1 
ATOM   6552  C  CA    . LEU D 4  740  ? -20.020 -17.032 59.603  1.00 61.47  ? 740  LEU A CA    1 
ATOM   6553  C  C     . LEU D 4  740  ? -19.420 -15.650 59.392  1.00 65.48  ? 740  LEU A C     1 
ATOM   6554  O  O     . LEU D 4  740  ? -19.475 -15.140 58.268  1.00 73.45  ? 740  LEU A O     1 
ATOM   6555  C  CB    . LEU D 4  740  ? -21.516 -17.008 59.280  1.00 64.71  ? 740  LEU A CB    1 
ATOM   6556  C  CG    . LEU D 4  740  ? -22.402 -16.327 60.332  1.00 67.63  ? 740  LEU A CG    1 
ATOM   6557  C  CD1   . LEU D 4  740  ? -22.691 -14.851 60.039  1.00 61.46  ? 740  LEU A CD1   1 
ATOM   6558  C  CD2   . LEU D 4  740  ? -23.682 -17.112 60.515  1.00 73.88  ? 740  LEU A CD2   1 
ATOM   6559  N  N     . ASN D 4  741  ? -18.881 -15.033 60.444  1.00 76.29  ? 741  ASN A N     1 
ATOM   6560  C  CA    . ASN D 4  741  ? -18.251 -13.722 60.332  1.00 62.56  ? 741  ASN A CA    1 
ATOM   6561  C  C     . ASN D 4  741  ? -17.047 -13.828 59.409  1.00 57.26  ? 741  ASN A C     1 
ATOM   6562  O  O     . ASN D 4  741  ? -16.126 -14.605 59.669  1.00 61.65  ? 741  ASN A O     1 
ATOM   6563  C  CB    . ASN D 4  741  ? -17.852 -13.231 61.728  1.00 77.30  ? 741  ASN A CB    1 
ATOM   6564  C  CG    . ASN D 4  741  ? -16.928 -12.012 61.712  1.00 74.77  ? 741  ASN A CG    1 
ATOM   6565  O  OD1   . ASN D 4  741  ? -15.747 -12.090 61.367  1.00 71.58  ? 741  ASN A OD1   1 
ATOM   6566  N  ND2   . ASN D 4  741  ? -17.471 -10.878 62.126  1.00 60.63  ? 741  ASN A ND2   1 
ATOM   6567  N  N     . ASN D 4  742  ? -17.059 -13.041 58.333  1.00 59.62  ? 742  ASN A N     1 
ATOM   6568  C  CA    . ASN D 4  742  ? -16.093 -13.244 57.259  1.00 74.45  ? 742  ASN A CA    1 
ATOM   6569  C  C     . ASN D 4  742  ? -14.683 -12.830 57.660  1.00 72.78  ? 742  ASN A C     1 
ATOM   6570  O  O     . ASN D 4  742  ? -13.711 -13.416 57.171  1.00 75.00  ? 742  ASN A O     1 
ATOM   6571  C  CB    . ASN D 4  742  ? -16.546 -12.492 56.011  1.00 77.58  ? 742  ASN A CB    1 
ATOM   6572  C  CG    . ASN D 4  742  ? -18.012 -12.731 55.687  1.00 74.38  ? 742  ASN A CG    1 
ATOM   6573  O  OD1   . ASN D 4  742  ? -18.860 -12.760 56.580  1.00 73.66  ? 742  ASN A OD1   1 
ATOM   6574  N  ND2   . ASN D 4  742  ? -18.317 -12.894 54.406  1.00 79.70  ? 742  ASN A ND2   1 
ATOM   6575  N  N     . VAL D 4  743  ? -14.544 -11.842 58.547  1.00 70.28  ? 743  VAL A N     1 
ATOM   6576  C  CA    . VAL D 4  743  ? -13.215 -11.491 59.042  1.00 74.93  ? 743  VAL A CA    1 
ATOM   6577  C  C     . VAL D 4  743  ? -12.668 -12.605 59.923  1.00 68.11  ? 743  VAL A C     1 
ATOM   6578  O  O     . VAL D 4  743  ? -11.462 -12.879 59.925  1.00 72.75  ? 743  VAL A O     1 
ATOM   6579  C  CB    . VAL D 4  743  ? -13.247 -10.149 59.791  1.00 71.81  ? 743  VAL A CB    1 
ATOM   6580  C  CG1   . VAL D 4  743  ? -11.855 -9.563  59.854  1.00 67.18  ? 743  VAL A CG1   1 
ATOM   6581  C  CG2   . VAL D 4  743  ? -14.179 -9.184  59.103  1.00 82.34  ? 743  VAL A CG2   1 
ATOM   6582  N  N     . LYS D 4  744  ? -13.547 -13.259 60.686  1.00 65.08  ? 744  LYS A N     1 
ATOM   6583  C  CA    . LYS D 4  744  ? -13.143 -14.428 61.459  1.00 57.90  ? 744  LYS A CA    1 
ATOM   6584  C  C     . LYS D 4  744  ? -12.751 -15.577 60.540  1.00 74.87  ? 744  LYS A C     1 
ATOM   6585  O  O     . LYS D 4  744  ? -11.794 -16.307 60.822  1.00 85.05  ? 744  LYS A O     1 
ATOM   6586  C  CB    . LYS D 4  744  ? -14.278 -14.858 62.388  1.00 58.24  ? 744  LYS A CB    1 
ATOM   6587  C  CG    . LYS D 4  744  ? -13.882 -15.840 63.476  1.00 86.92  ? 744  LYS A CG    1 
ATOM   6588  C  CD    . LYS D 4  744  ? -14.932 -15.872 64.579  1.00 102.28 ? 744  LYS A CD    1 
ATOM   6589  C  CE    . LYS D 4  744  ? -14.468 -16.641 65.807  1.00 90.64  ? 744  LYS A CE    1 
ATOM   6590  N  NZ    . LYS D 4  744  ? -13.006 -16.922 65.787  1.00 84.44  ? 744  LYS A NZ    1 
ATOM   6591  N  N     . GLN D 4  745  ? -13.477 -15.742 59.429  1.00 77.86  ? 745  GLN A N     1 
ATOM   6592  C  CA    . GLN D 4  745  ? -13.182 -16.814 58.484  1.00 77.60  ? 745  GLN A CA    1 
ATOM   6593  C  C     . GLN D 4  745  ? -11.835 -16.603 57.810  1.00 67.20  ? 745  GLN A C     1 
ATOM   6594  O  O     . GLN D 4  745  ? -11.125 -17.571 57.512  1.00 75.31  ? 745  GLN A O     1 
ATOM   6595  C  CB    . GLN D 4  745  ? -14.285 -16.902 57.433  1.00 73.39  ? 745  GLN A CB    1 
ATOM   6596  C  CG    . GLN D 4  745  ? -15.639 -17.301 57.973  1.00 84.09  ? 745  GLN A CG    1 
ATOM   6597  C  CD    . GLN D 4  745  ? -16.535 -17.865 56.901  1.00 96.34  ? 745  GLN A CD    1 
ATOM   6598  O  OE1   . GLN D 4  745  ? -16.156 -18.796 56.195  1.00 98.92  ? 745  GLN A OE1   1 
ATOM   6599  N  NE2   . GLN D 4  745  ? -17.727 -17.298 56.762  1.00 100.12 ? 745  GLN A NE2   1 
ATOM   6600  N  N     . MET D 4  746  ? -11.471 -15.347 57.550  1.00 59.61  ? 746  MET A N     1 
ATOM   6601  C  CA    . MET D 4  746  ? -10.160 -15.071 56.980  1.00 71.16  ? 746  MET A CA    1 
ATOM   6602  C  C     . MET D 4  746  ? -9.060  -15.269 58.010  1.00 77.31  ? 746  MET A C     1 
ATOM   6603  O  O     . MET D 4  746  ? -7.940  -15.652 57.656  1.00 67.18  ? 746  MET A O     1 
ATOM   6604  C  CB    . MET D 4  746  ? -10.117 -13.649 56.423  1.00 64.78  ? 746  MET A CB    1 
ATOM   6605  C  CG    . MET D 4  746  ? -10.580 -13.543 54.989  1.00 52.45  ? 746  MET A CG    1 
ATOM   6606  S  SD    . MET D 4  746  ? -10.710 -11.852 54.394  1.00 57.65  ? 746  MET A SD    1 
ATOM   6607  C  CE    . MET D 4  746  ? -12.338 -11.423 54.986  1.00 54.05  ? 746  MET A CE    1 
ATOM   6608  N  N     . VAL D 4  747  ? -9.365  -15.018 59.283  1.00 90.37  ? 747  VAL A N     1 
ATOM   6609  C  CA    . VAL D 4  747  ? -8.406  -15.266 60.353  1.00 93.76  ? 747  VAL A CA    1 
ATOM   6610  C  C     . VAL D 4  747  ? -8.218  -16.765 60.556  1.00 87.21  ? 747  VAL A C     1 
ATOM   6611  O  O     . VAL D 4  747  ? -7.090  -17.246 60.726  1.00 94.38  ? 747  VAL A O     1 
ATOM   6612  C  CB    . VAL D 4  747  ? -8.875  -14.556 61.639  1.00 91.17  ? 747  VAL A CB    1 
ATOM   6613  C  CG1   . VAL D 4  747  ? -8.372  -15.262 62.895  1.00 96.29  ? 747  VAL A CG1   1 
ATOM   6614  C  CG2   . VAL D 4  747  ? -8.439  -13.100 61.630  1.00 94.63  ? 747  VAL A CG2   1 
ATOM   6615  N  N     . MET D 4  748  ? -9.317  -17.526 60.509  1.00 70.72  ? 748  MET A N     1 
ATOM   6616  C  CA    . MET D 4  748  ? -9.256  -18.968 60.732  1.00 61.76  ? 748  MET A CA    1 
ATOM   6617  C  C     . MET D 4  748  ? -8.500  -19.680 59.622  1.00 74.60  ? 748  MET A C     1 
ATOM   6618  O  O     . MET D 4  748  ? -7.740  -20.618 59.887  1.00 87.17  ? 748  MET A O     1 
ATOM   6619  C  CB    . MET D 4  748  ? -10.664 -19.537 60.847  1.00 59.77  ? 748  MET A CB    1 
ATOM   6620  C  CG    . MET D 4  748  ? -11.317 -19.207 62.147  1.00 71.58  ? 748  MET A CG    1 
ATOM   6621  S  SD    . MET D 4  748  ? -12.387 -20.515 62.723  1.00 109.14 ? 748  MET A SD    1 
ATOM   6622  C  CE    . MET D 4  748  ? -13.463 -19.519 63.720  1.00 102.38 ? 748  MET A CE    1 
ATOM   6623  N  N     . ALA D 4  749  ? -8.709  -19.266 58.373  1.00 75.11  ? 749  ALA A N     1 
ATOM   6624  C  CA    . ALA D 4  749  ? -7.960  -19.851 57.273  1.00 71.84  ? 749  ALA A CA    1 
ATOM   6625  C  C     . ALA D 4  749  ? -6.507  -19.408 57.273  1.00 62.60  ? 749  ALA A C     1 
ATOM   6626  O  O     . ALA D 4  749  ? -5.654  -20.124 56.742  1.00 60.13  ? 749  ALA A O     1 
ATOM   6627  C  CB    . ALA D 4  749  ? -8.612  -19.491 55.940  1.00 78.15  ? 749  ALA A CB    1 
ATOM   6628  N  N     . GLY D 4  750  ? -6.204  -18.256 57.865  1.00 55.85  ? 750  GLY A N     1 
ATOM   6629  C  CA    . GLY D 4  750  ? -4.864  -17.717 57.778  1.00 60.80  ? 750  GLY A CA    1 
ATOM   6630  C  C     . GLY D 4  750  ? -4.612  -16.914 56.528  1.00 64.93  ? 750  GLY A C     1 
ATOM   6631  O  O     . GLY D 4  750  ? -3.453  -16.676 56.179  1.00 64.75  ? 750  GLY A O     1 
ATOM   6632  N  N     . SER D 4  751  ? -5.670  -16.487 55.840  1.00 81.80  ? 751  SER A N     1 
ATOM   6633  C  CA    . SER D 4  751  ? -5.513  -15.756 54.589  1.00 88.67  ? 751  SER A CA    1 
ATOM   6634  C  C     . SER D 4  751  ? -5.134  -14.304 54.842  1.00 83.10  ? 751  SER A C     1 
ATOM   6635  O  O     . SER D 4  751  ? -4.141  -13.812 54.297  1.00 103.87 ? 751  SER A O     1 
ATOM   6636  C  CB    . SER D 4  751  ? -6.801  -15.837 53.772  1.00 97.79  ? 751  SER A CB    1 
ATOM   6637  O  OG    . SER D 4  751  ? -7.916  -15.458 54.557  1.00 104.88 ? 751  SER A OG    1 
ATOM   6638  N  N     . LYS D 4  752  ? -5.918  -13.604 55.658  1.00 65.87  ? 752  LYS A N     1 
ATOM   6639  C  CA    . LYS D 4  752  ? -5.594  -12.237 56.032  1.00 64.89  ? 752  LYS A CA    1 
ATOM   6640  C  C     . LYS D 4  752  ? -6.266  -11.927 57.359  1.00 68.44  ? 752  LYS A C     1 
ATOM   6641  O  O     . LYS D 4  752  ? -7.396  -12.356 57.602  1.00 65.16  ? 752  LYS A O     1 
ATOM   6642  C  CB    . LYS D 4  752  ? -6.045  -11.232 54.968  1.00 56.70  ? 752  LYS A CB    1 
ATOM   6643  C  CG    . LYS D 4  752  ? -5.103  -10.060 54.818  1.00 48.41  ? 752  LYS A CG    1 
ATOM   6644  C  CD    . LYS D 4  752  ? -3.829  -10.509 54.132  1.00 49.08  ? 752  LYS A CD    1 
ATOM   6645  C  CE    . LYS D 4  752  ? -3.329  -9.466  53.156  1.00 71.92  ? 752  LYS A CE    1 
ATOM   6646  N  NZ    . LYS D 4  752  ? -1.843  -9.408  53.165  1.00 93.60  ? 752  LYS A NZ    1 
ATOM   6647  N  N     . GLY D 4  753  ? -5.566  -11.186 58.211  1.00 59.47  ? 753  GLY A N     1 
ATOM   6648  C  CA    . GLY D 4  753  ? -6.140  -10.815 59.485  1.00 72.98  ? 753  GLY A CA    1 
ATOM   6649  C  C     . GLY D 4  753  ? -5.329  -11.255 60.679  1.00 90.18  ? 753  GLY A C     1 
ATOM   6650  O  O     . GLY D 4  753  ? -4.521  -12.184 60.596  1.00 106.59 ? 753  GLY A O     1 
ATOM   6651  N  N     . SER D 4  754  ? -5.543  -10.575 61.797  1.00 83.41  ? 754  SER A N     1 
ATOM   6652  C  CA    . SER D 4  754  ? -4.873  -10.878 63.049  1.00 80.39  ? 754  SER A CA    1 
ATOM   6653  C  C     . SER D 4  754  ? -5.837  -10.513 64.165  1.00 88.89  ? 754  SER A C     1 
ATOM   6654  O  O     . SER D 4  754  ? -6.950  -10.051 63.908  1.00 88.57  ? 754  SER A O     1 
ATOM   6655  C  CB    . SER D 4  754  ? -3.548  -10.122 63.159  1.00 81.61  ? 754  SER A CB    1 
ATOM   6656  O  OG    . SER D 4  754  ? -2.627  -10.583 62.188  1.00 85.01  ? 754  SER A OG    1 
ATOM   6657  N  N     . PHE D 4  755  ? -5.411  -10.715 65.413  1.00 84.08  ? 755  PHE A N     1 
ATOM   6658  C  CA    . PHE D 4  755  ? -6.278  -10.381 66.540  1.00 84.27  ? 755  PHE A CA    1 
ATOM   6659  C  C     . PHE D 4  755  ? -6.498  -8.879  66.640  1.00 79.19  ? 755  PHE A C     1 
ATOM   6660  O  O     . PHE D 4  755  ? -7.633  -8.420  66.825  1.00 79.10  ? 755  PHE A O     1 
ATOM   6661  C  CB    . PHE D 4  755  ? -5.686  -10.893 67.849  1.00 90.07  ? 755  PHE A CB    1 
ATOM   6662  C  CG    . PHE D 4  755  ? -6.371  -10.342 69.070  1.00 80.33  ? 755  PHE A CG    1 
ATOM   6663  C  CD1   . PHE D 4  755  ? -7.743  -10.474 69.236  1.00 79.29  ? 755  PHE A CD1   1 
ATOM   6664  C  CD2   . PHE D 4  755  ? -5.653  -9.635  70.019  1.00 67.91  ? 755  PHE A CD2   1 
ATOM   6665  C  CE1   . PHE D 4  755  ? -8.372  -9.951  70.341  1.00 74.50  ? 755  PHE A CE1   1 
ATOM   6666  C  CE2   . PHE D 4  755  ? -6.280  -9.106  71.130  1.00 65.48  ? 755  PHE A CE2   1 
ATOM   6667  C  CZ    . PHE D 4  755  ? -7.642  -9.264  71.291  1.00 67.27  ? 755  PHE A CZ    1 
ATOM   6668  N  N     . ILE D 4  756  ? -5.417  -8.100  66.535  1.00 70.32  ? 756  ILE A N     1 
ATOM   6669  C  CA    . ILE D 4  756  ? -5.493  -6.665  66.787  1.00 63.65  ? 756  ILE A CA    1 
ATOM   6670  C  C     . ILE D 4  756  ? -6.370  -5.979  65.749  1.00 79.47  ? 756  ILE A C     1 
ATOM   6671  O  O     . ILE D 4  756  ? -7.070  -5.012  66.066  1.00 79.52  ? 756  ILE A O     1 
ATOM   6672  C  CB    . ILE D 4  756  ? -4.069  -6.066  66.855  1.00 67.45  ? 756  ILE A CB    1 
ATOM   6673  C  CG1   . ILE D 4  756  ? -4.104  -4.610  67.321  1.00 80.53  ? 756  ILE A CG1   1 
ATOM   6674  C  CG2   . ILE D 4  756  ? -3.330  -6.206  65.526  1.00 50.63  ? 756  ILE A CG2   1 
ATOM   6675  C  CD1   . ILE D 4  756  ? -3.059  -4.276  68.365  1.00 77.51  ? 756  ILE A CD1   1 
ATOM   6676  N  N     . ASN D 4  757  ? -6.413  -6.507  64.521  1.00 85.79  ? 757  ASN A N     1 
ATOM   6677  C  CA    . ASN D 4  757  ? -7.278  -5.934  63.495  1.00 56.23  ? 757  ASN A CA    1 
ATOM   6678  C  C     . ASN D 4  757  ? -8.750  -6.100  63.840  1.00 56.80  ? 757  ASN A C     1 
ATOM   6679  O  O     . ASN D 4  757  ? -9.557  -5.221  63.523  1.00 74.71  ? 757  ASN A O     1 
ATOM   6680  C  CB    . ASN D 4  757  ? -6.971  -6.569  62.142  1.00 49.92  ? 757  ASN A CB    1 
ATOM   6681  C  CG    . ASN D 4  757  ? -5.496  -6.545  61.816  1.00 54.00  ? 757  ASN A CG    1 
ATOM   6682  O  OD1   . ASN D 4  757  ? -4.921  -7.550  61.400  1.00 69.27  ? 757  ASN A OD1   1 
ATOM   6683  N  ND2   . ASN D 4  757  ? -4.873  -5.388  61.996  1.00 48.67  ? 757  ASN A ND2   1 
ATOM   6684  N  N     . ILE D 4  758  ? -9.117  -7.199  64.502  1.00 55.90  ? 758  ILE A N     1 
ATOM   6685  C  CA    . ILE D 4  758  ? -10.476 -7.323  65.019  1.00 55.70  ? 758  ILE A CA    1 
ATOM   6686  C  C     . ILE D 4  758  ? -10.701 -6.334  66.151  1.00 56.80  ? 758  ILE A C     1 
ATOM   6687  O  O     . ILE D 4  758  ? -11.790 -5.767  66.293  1.00 56.74  ? 758  ILE A O     1 
ATOM   6688  C  CB    . ILE D 4  758  ? -10.768 -8.758  65.493  1.00 54.80  ? 758  ILE A CB    1 
ATOM   6689  C  CG1   . ILE D 4  758  ? -10.022 -9.810  64.669  1.00 54.19  ? 758  ILE A CG1   1 
ATOM   6690  C  CG2   . ILE D 4  758  ? -12.251 -9.009  65.465  1.00 54.96  ? 758  ILE A CG2   1 
ATOM   6691  C  CD1   . ILE D 4  758  ? -10.468 -9.925  63.233  1.00 53.64  ? 758  ILE A CD1   1 
ATOM   6692  N  N     . ALA D 4  759  ? -9.677  -6.124  66.980  1.00 57.03  ? 759  ALA A N     1 
ATOM   6693  C  CA    . ALA D 4  759  ? -9.832  -5.302  68.174  1.00 64.29  ? 759  ALA A CA    1 
ATOM   6694  C  C     . ALA D 4  759  ? -9.964  -3.828  67.819  1.00 74.39  ? 759  ALA A C     1 
ATOM   6695  O  O     . ALA D 4  759  ? -10.852 -3.135  68.327  1.00 68.19  ? 759  ALA A O     1 
ATOM   6696  C  CB    . ALA D 4  759  ? -8.647  -5.522  69.113  1.00 56.61  ? 759  ALA A CB    1 
ATOM   6697  N  N     . GLN D 4  760  ? -9.087  -3.330  66.947  1.00 74.78  ? 760  GLN A N     1 
ATOM   6698  C  CA    . GLN D 4  760  ? -9.096  -1.905  66.635  1.00 68.68  ? 760  GLN A CA    1 
ATOM   6699  C  C     . GLN D 4  760  ? -10.320 -1.526  65.809  1.00 86.78  ? 760  GLN A C     1 
ATOM   6700  O  O     . GLN D 4  760  ? -10.889 -0.445  65.996  1.00 99.24  ? 760  GLN A O     1 
ATOM   6701  C  CB    . GLN D 4  760  ? -7.804  -1.517  65.912  1.00 65.32  ? 760  GLN A CB    1 
ATOM   6702  C  CG    . GLN D 4  760  ? -6.537  -1.984  66.624  1.00 49.88  ? 760  GLN A CG    1 
ATOM   6703  C  CD    . GLN D 4  760  ? -5.287  -1.219  66.237  1.00 48.99  ? 760  GLN A CD    1 
ATOM   6704  O  OE1   . GLN D 4  760  ? -4.594  -1.589  65.289  1.00 61.96  ? 760  GLN A OE1   1 
ATOM   6705  N  NE2   . GLN D 4  760  ? -4.941  -0.210  67.020  1.00 48.93  ? 760  GLN A NE2   1 
ATOM   6706  N  N     . MET D 4  761  ? -10.750 -2.411  64.906  1.00 82.30  ? 761  MET A N     1 
ATOM   6707  C  CA    . MET D 4  761  ? -11.896 -2.104  64.057  1.00 78.81  ? 761  MET A CA    1 
ATOM   6708  C  C     . MET D 4  761  ? -13.207 -2.129  64.827  1.00 69.65  ? 761  MET A C     1 
ATOM   6709  O  O     . MET D 4  761  ? -14.104 -1.333  64.534  1.00 90.38  ? 761  MET A O     1 
ATOM   6710  C  CB    . MET D 4  761  ? -11.969 -3.086  62.889  1.00 70.07  ? 761  MET A CB    1 
ATOM   6711  C  CG    . MET D 4  761  ? -10.978 -2.805  61.781  1.00 54.29  ? 761  MET A CG    1 
ATOM   6712  S  SD    . MET D 4  761  ? -11.415 -3.572  60.211  1.00 66.64  ? 761  MET A SD    1 
ATOM   6713  C  CE    . MET D 4  761  ? -10.730 -5.209  60.430  1.00 53.43  ? 761  MET A CE    1 
ATOM   6714  N  N     . SER D 4  762  ? -13.342 -3.013  65.809  1.00 52.16  ? 762  SER A N     1 
ATOM   6715  C  CA    . SER D 4  762  ? -14.635 -3.271  66.426  1.00 59.64  ? 762  SER A CA    1 
ATOM   6716  C  C     . SER D 4  762  ? -14.697 -2.977  67.916  1.00 72.50  ? 762  SER A C     1 
ATOM   6717  O  O     . SER D 4  762  ? -15.783 -2.685  68.420  1.00 78.91  ? 762  SER A O     1 
ATOM   6718  C  CB    . SER D 4  762  ? -15.045 -4.734  66.200  1.00 65.53  ? 762  SER A CB    1 
ATOM   6719  O  OG    . SER D 4  762  ? -16.455 -4.862  66.179  1.00 84.48  ? 762  SER A OG    1 
ATOM   6720  N  N     . ALA D 4  763  ? -13.580 -3.053  68.635  1.00 69.92  ? 763  ALA A N     1 
ATOM   6721  C  CA    . ALA D 4  763  ? -13.607 -2.868  70.080  1.00 64.16  ? 763  ALA A CA    1 
ATOM   6722  C  C     . ALA D 4  763  ? -13.047 -1.510  70.474  1.00 58.24  ? 763  ALA A C     1 
ATOM   6723  O  O     . ALA D 4  763  ? -13.798 -0.593  70.823  1.00 72.14  ? 763  ALA A O     1 
ATOM   6724  C  CB    . ALA D 4  763  ? -12.819 -3.980  70.773  1.00 81.71  ? 763  ALA A CB    1 
ATOM   6725  N  N     . CYS D 4  764  ? -11.724 -1.382  70.429  1.00 53.98  ? 764  CYS A N     1 
ATOM   6726  C  CA    . CYS D 4  764  ? -11.048 -0.149  70.823  1.00 63.05  ? 764  CYS A CA    1 
ATOM   6727  C  C     . CYS D 4  764  ? -9.688  -0.141  70.147  1.00 55.28  ? 764  CYS A C     1 
ATOM   6728  O  O     . CYS D 4  764  ? -8.906  -1.079  70.334  1.00 71.00  ? 764  CYS A O     1 
ATOM   6729  C  CB    . CYS D 4  764  ? -10.912 -0.067  72.347  1.00 72.44  ? 764  CYS A CB    1 
ATOM   6730  S  SG    . CYS D 4  764  ? -9.541  0.937   72.951  1.00 83.63  ? 764  CYS A SG    1 
ATOM   6731  N  N     . VAL D 4  765  ? -9.415  0.897   69.352  1.00 51.13  ? 765  VAL A N     1 
ATOM   6732  C  CA    . VAL D 4  765  ? -8.160  0.958   68.607  1.00 56.12  ? 765  VAL A CA    1 
ATOM   6733  C  C     . VAL D 4  765  ? -6.971  1.099   69.552  1.00 59.97  ? 765  VAL A C     1 
ATOM   6734  O  O     . VAL D 4  765  ? -5.892  0.551   69.288  1.00 66.32  ? 765  VAL A O     1 
ATOM   6735  C  CB    . VAL D 4  765  ? -8.253  2.073   67.541  1.00 56.45  ? 765  VAL A CB    1 
ATOM   6736  C  CG1   . VAL D 4  765  ? -8.786  3.304   68.137  1.00 49.24  ? 765  VAL A CG1   1 
ATOM   6737  C  CG2   . VAL D 4  765  ? -6.914  2.383   66.905  1.00 48.31  ? 765  VAL A CG2   1 
ATOM   6738  N  N     . GLY D 4  766  ? -7.155  1.760   70.688  1.00 68.24  ? 766  GLY A N     1 
ATOM   6739  C  CA    . GLY D 4  766  ? -6.176  1.631   71.746  1.00 74.57  ? 766  GLY A CA    1 
ATOM   6740  C  C     . GLY D 4  766  ? -5.411  2.883   72.105  1.00 70.58  ? 766  GLY A C     1 
ATOM   6741  O  O     . GLY D 4  766  ? -5.968  3.983   72.144  1.00 71.67  ? 766  GLY A O     1 
ATOM   6742  N  N     . GLN D 4  767  ? -4.121  2.714   72.369  1.00 70.86  ? 767  GLN A N     1 
ATOM   6743  C  CA    . GLN D 4  767  ? -3.285  3.757   72.939  1.00 77.46  ? 767  GLN A CA    1 
ATOM   6744  C  C     . GLN D 4  767  ? -2.161  4.080   71.967  1.00 64.81  ? 767  GLN A C     1 
ATOM   6745  O  O     . GLN D 4  767  ? -1.427  3.182   71.542  1.00 56.97  ? 767  GLN A O     1 
ATOM   6746  C  CB    . GLN D 4  767  ? -2.721  3.311   74.289  1.00 69.23  ? 767  GLN A CB    1 
ATOM   6747  C  CG    . GLN D 4  767  ? -1.502  4.082   74.729  1.00 51.74  ? 767  GLN A CG    1 
ATOM   6748  C  CD    . GLN D 4  767  ? -1.872  5.421   75.321  1.00 51.83  ? 767  GLN A CD    1 
ATOM   6749  O  OE1   . GLN D 4  767  ? -2.927  5.567   75.938  1.00 52.44  ? 767  GLN A OE1   1 
ATOM   6750  N  NE2   . GLN D 4  767  ? -1.024  6.415   75.111  1.00 63.84  ? 767  GLN A NE2   1 
ATOM   6751  N  N     . GLN D 4  768  ? -2.031  5.354   71.619  1.00 57.62  ? 768  GLN A N     1 
ATOM   6752  C  CA    . GLN D 4  768  ? -1.011  5.792   70.683  1.00 59.03  ? 768  GLN A CA    1 
ATOM   6753  C  C     . GLN D 4  768  ? 0.287   6.098   71.419  1.00 48.60  ? 768  GLN A C     1 
ATOM   6754  O  O     . GLN D 4  768  ? 0.304   6.339   72.628  1.00 64.74  ? 768  GLN A O     1 
ATOM   6755  C  CB    . GLN D 4  768  ? -1.489  7.018   69.907  1.00 59.52  ? 768  GLN A CB    1 
ATOM   6756  C  CG    . GLN D 4  768  ? -2.855  6.847   69.245  1.00 55.24  ? 768  GLN A CG    1 
ATOM   6757  C  CD    . GLN D 4  768  ? -2.960  5.605   68.369  1.00 62.67  ? 768  GLN A CD    1 
ATOM   6758  O  OE1   . GLN D 4  768  ? -3.960  4.888   68.410  1.00 82.89  ? 768  GLN A OE1   1 
ATOM   6759  N  NE2   . GLN D 4  768  ? -1.944  5.369   67.543  1.00 56.41  ? 768  GLN A NE2   1 
ATOM   6760  N  N     . SER D 4  769  ? 1.387   6.082   70.671  1.00 48.00  ? 769  SER A N     1 
ATOM   6761  C  CA    . SER D 4  769  ? 2.708   6.193   71.279  1.00 49.47  ? 769  SER A CA    1 
ATOM   6762  C  C     . SER D 4  769  ? 3.670   6.835   70.294  1.00 54.17  ? 769  SER A C     1 
ATOM   6763  O  O     . SER D 4  769  ? 3.830   6.345   69.172  1.00 63.77  ? 769  SER A O     1 
ATOM   6764  C  CB    . SER D 4  769  ? 3.219   4.818   71.709  1.00 63.48  ? 769  SER A CB    1 
ATOM   6765  O  OG    . SER D 4  769  ? 4.098   4.282   70.737  1.00 74.48  ? 769  SER A OG    1 
ATOM   6766  N  N     . VAL D 4  770  ? 4.304   7.924   70.717  1.00 62.51  ? 770  VAL A N     1 
ATOM   6767  C  CA    . VAL D 4  770  ? 5.372   8.576   69.967  1.00 65.77  ? 770  VAL A CA    1 
ATOM   6768  C  C     . VAL D 4  770  ? 6.666   8.398   70.745  1.00 68.93  ? 770  VAL A C     1 
ATOM   6769  O  O     . VAL D 4  770  ? 6.691   8.595   71.967  1.00 64.29  ? 770  VAL A O     1 
ATOM   6770  C  CB    . VAL D 4  770  ? 5.075   10.067  69.735  1.00 55.48  ? 770  VAL A CB    1 
ATOM   6771  C  CG1   . VAL D 4  770  ? 6.122   10.679  68.813  1.00 50.20  ? 770  VAL A CG1   1 
ATOM   6772  C  CG2   . VAL D 4  770  ? 3.694   10.238  69.152  1.00 55.28  ? 770  VAL A CG2   1 
ATOM   6773  N  N     . GLU D 4  771  ? 7.727   7.990   70.045  1.00 60.91  ? 771  GLU A N     1 
ATOM   6774  C  CA    . GLU D 4  771  ? 9.082   7.814   70.567  1.00 51.91  ? 771  GLU A CA    1 
ATOM   6775  C  C     . GLU D 4  771  ? 9.169   6.767   71.675  1.00 60.32  ? 771  GLU A C     1 
ATOM   6776  O  O     . GLU D 4  771  ? 10.193  6.687   72.365  1.00 64.94  ? 771  GLU A O     1 
ATOM   6777  C  CB    . GLU D 4  771  ? 9.671   9.147   71.059  1.00 47.52  ? 771  GLU A CB    1 
ATOM   6778  C  CG    . GLU D 4  771  ? 11.156  9.343   70.791  1.00 61.75  ? 771  GLU A CG    1 
ATOM   6779  C  CD    . GLU D 4  771  ? 11.523  10.803  70.627  1.00 83.59  ? 771  GLU A CD    1 
ATOM   6780  O  OE1   . GLU D 4  771  ? 10.602  11.642  70.558  1.00 79.83  ? 771  GLU A OE1   1 
ATOM   6781  O  OE2   . GLU D 4  771  ? 12.731  11.115  70.601  1.00 90.62  ? 771  GLU A OE2   1 
ATOM   6782  N  N     . GLY D 4  772  ? 8.131   5.951   71.863  1.00 69.38  ? 772  GLY A N     1 
ATOM   6783  C  CA    . GLY D 4  772  ? 8.099   4.923   72.872  1.00 73.36  ? 772  GLY A CA    1 
ATOM   6784  C  C     . GLY D 4  772  ? 7.262   5.268   74.088  1.00 69.92  ? 772  GLY A C     1 
ATOM   6785  O  O     . GLY D 4  772  ? 6.768   4.360   74.767  1.00 84.45  ? 772  GLY A O     1 
ATOM   6786  N  N     . LYS D 4  773  ? 7.084   6.552   74.371  1.00 53.46  ? 773  LYS A N     1 
ATOM   6787  C  CA    . LYS D 4  773  ? 6.400   6.988   75.581  1.00 65.58  ? 773  LYS A CA    1 
ATOM   6788  C  C     . LYS D 4  773  ? 4.900   7.088   75.301  1.00 67.34  ? 773  LYS A C     1 
ATOM   6789  O  O     . LYS D 4  773  ? 4.377   6.446   74.387  1.00 70.27  ? 773  LYS A O     1 
ATOM   6790  C  CB    . LYS D 4  773  ? 6.999   8.313   76.064  1.00 58.04  ? 773  LYS A CB    1 
ATOM   6791  C  CG    . LYS D 4  773  ? 8.508   8.273   76.280  1.00 51.16  ? 773  LYS A CG    1 
ATOM   6792  C  CD    . LYS D 4  773  ? 8.998   9.427   77.147  1.00 51.61  ? 773  LYS A CD    1 
ATOM   6793  C  CE    . LYS D 4  773  ? 8.175   9.565   78.424  1.00 79.18  ? 773  LYS A CE    1 
ATOM   6794  N  NZ    . LYS D 4  773  ? 8.422   10.868  79.103  1.00 83.13  ? 773  LYS A NZ    1 
ATOM   6795  N  N     . ARG D 4  774  ? 4.188   7.881   76.093  1.00 69.99  ? 774  ARG A N     1 
ATOM   6796  C  CA    . ARG D 4  774  ? 2.811   8.241   75.801  1.00 66.42  ? 774  ARG A CA    1 
ATOM   6797  C  C     . ARG D 4  774  ? 2.828   9.463   74.882  1.00 59.42  ? 774  ARG A C     1 
ATOM   6798  O  O     . ARG D 4  774  ? 3.864   9.818   74.315  1.00 76.44  ? 774  ARG A O     1 
ATOM   6799  C  CB    . ARG D 4  774  ? 2.048   8.477   77.104  1.00 73.47  ? 774  ARG A CB    1 
ATOM   6800  C  CG    . ARG D 4  774  ? 1.063   7.372   77.473  1.00 56.42  ? 774  ARG A CG    1 
ATOM   6801  C  CD    . ARG D 4  774  ? 0.732   7.391   78.955  1.00 53.73  ? 774  ARG A CD    1 
ATOM   6802  N  NE    . ARG D 4  774  ? -0.547  8.007   79.287  1.00 54.02  ? 774  ARG A NE    1 
ATOM   6803  C  CZ    . ARG D 4  774  ? -0.838  8.486   80.492  1.00 54.95  ? 774  ARG A CZ    1 
ATOM   6804  N  NH1   . ARG D 4  774  ? 0.064   8.420   81.463  1.00 55.66  ? 774  ARG A NH1   1 
ATOM   6805  N  NH2   . ARG D 4  774  ? -2.022  9.032   80.732  1.00 55.24  ? 774  ARG A NH2   1 
ATOM   6806  N  N     . ILE D 4  775  ? 1.683   10.123  74.714  1.00 49.83  ? 775  ILE A N     1 
ATOM   6807  C  CA    . ILE D 4  775  ? 1.657   11.346  73.920  1.00 57.49  ? 775  ILE A CA    1 
ATOM   6808  C  C     . ILE D 4  775  ? 2.348   12.456  74.699  1.00 63.42  ? 775  ILE A C     1 
ATOM   6809  O  O     . ILE D 4  775  ? 2.025   12.713  75.865  1.00 65.24  ? 775  ILE A O     1 
ATOM   6810  C  CB    . ILE D 4  775  ? 0.215   11.718  73.548  1.00 70.23  ? 775  ILE A CB    1 
ATOM   6811  C  CG1   . ILE D 4  775  ? -0.255  10.887  72.355  1.00 67.94  ? 775  ILE A CG1   1 
ATOM   6812  C  CG2   . ILE D 4  775  ? 0.104   13.189  73.205  1.00 83.45  ? 775  ILE A CG2   1 
ATOM   6813  C  CD1   . ILE D 4  775  ? 0.645   10.981  71.148  1.00 54.44  ? 775  ILE A CD1   1 
ATOM   6814  N  N     . ALA D 4  776  ? 3.316   13.110  74.060  1.00 60.00  ? 776  ALA A N     1 
ATOM   6815  C  CA    . ALA D 4  776  ? 4.176   14.056  74.752  1.00 52.28  ? 776  ALA A CA    1 
ATOM   6816  C  C     . ALA D 4  776  ? 3.442   15.366  75.036  1.00 57.79  ? 776  ALA A C     1 
ATOM   6817  O  O     . ALA D 4  776  ? 2.350   15.630  74.527  1.00 58.06  ? 776  ALA A O     1 
ATOM   6818  C  CB    . ALA D 4  776  ? 5.436   14.327  73.932  1.00 48.97  ? 776  ALA A CB    1 
ATOM   6819  N  N     . PHE D 4  777  ? 4.069   16.193  75.875  1.00 80.10  ? 777  PHE A N     1 
ATOM   6820  C  CA    . PHE D 4  777  ? 3.584   17.543  76.159  1.00 82.82  ? 777  PHE A CA    1 
ATOM   6821  C  C     . PHE D 4  777  ? 4.248   18.504  75.176  1.00 81.98  ? 777  PHE A C     1 
ATOM   6822  O  O     . PHE D 4  777  ? 5.223   19.193  75.485  1.00 63.13  ? 777  PHE A O     1 
ATOM   6823  C  CB    . PHE D 4  777  ? 3.874   17.932  77.604  1.00 77.42  ? 777  PHE A CB    1 
ATOM   6824  C  CG    . PHE D 4  777  ? 2.846   17.448  78.591  1.00 69.55  ? 777  PHE A CG    1 
ATOM   6825  C  CD1   . PHE D 4  777  ? 3.186   17.246  79.918  1.00 73.42  ? 777  PHE A CD1   1 
ATOM   6826  C  CD2   . PHE D 4  777  ? 1.543   17.204  78.197  1.00 69.42  ? 777  PHE A CD2   1 
ATOM   6827  C  CE1   . PHE D 4  777  ? 2.243   16.810  80.833  1.00 70.04  ? 777  PHE A CE1   1 
ATOM   6828  C  CE2   . PHE D 4  777  ? 0.594   16.769  79.106  1.00 67.06  ? 777  PHE A CE2   1 
ATOM   6829  C  CZ    . PHE D 4  777  ? 0.946   16.571  80.425  1.00 59.09  ? 777  PHE A CZ    1 
ATOM   6830  N  N     . GLY D 4  778  ? 3.704   18.536  73.958  1.00 96.25  ? 778  GLY A N     1 
ATOM   6831  C  CA    . GLY D 4  778  ? 4.233   19.440  72.948  1.00 95.84  ? 778  GLY A CA    1 
ATOM   6832  C  C     . GLY D 4  778  ? 3.915   20.891  73.249  1.00 80.90  ? 778  GLY A C     1 
ATOM   6833  O  O     . GLY D 4  778  ? 4.746   21.777  73.036  1.00 71.37  ? 778  GLY A O     1 
ATOM   6834  N  N     . PHE D 4  779  ? 2.708   21.154  73.734  1.00 73.64  ? 779  PHE A N     1 
ATOM   6835  C  CA    . PHE D 4  779  ? 2.390   22.442  74.320  1.00 73.98  ? 779  PHE A CA    1 
ATOM   6836  C  C     . PHE D 4  779  ? 2.917   22.501  75.749  1.00 84.91  ? 779  PHE A C     1 
ATOM   6837  O  O     . PHE D 4  779  ? 3.372   21.501  76.313  1.00 96.49  ? 779  PHE A O     1 
ATOM   6838  C  CB    . PHE D 4  779  ? 0.886   22.684  74.275  1.00 82.19  ? 779  PHE A CB    1 
ATOM   6839  C  CG    . PHE D 4  779  ? 0.386   23.095  72.925  1.00 83.42  ? 779  PHE A CG    1 
ATOM   6840  C  CD1   . PHE D 4  779  ? -0.944  22.959  72.590  1.00 72.77  ? 779  PHE A CD1   1 
ATOM   6841  C  CD2   . PHE D 4  779  ? 1.245   23.665  72.003  1.00 73.68  ? 779  PHE A CD2   1 
ATOM   6842  C  CE1   . PHE D 4  779  ? -1.394  23.346  71.346  1.00 55.91  ? 779  PHE A CE1   1 
ATOM   6843  C  CE2   . PHE D 4  779  ? 0.786   24.064  70.770  1.00 65.49  ? 779  PHE A CE2   1 
ATOM   6844  C  CZ    . PHE D 4  779  ? -0.531  23.900  70.439  1.00 60.36  ? 779  PHE A CZ    1 
ATOM   6845  N  N     . VAL D 4  780  ? 2.868   23.695  76.335  1.00 80.19  ? 780  VAL A N     1 
ATOM   6846  C  CA    . VAL D 4  780  ? 3.398   23.876  77.682  1.00 62.03  ? 780  VAL A CA    1 
ATOM   6847  C  C     . VAL D 4  780  ? 2.426   23.196  78.644  1.00 65.17  ? 780  VAL A C     1 
ATOM   6848  O  O     . VAL D 4  780  ? 1.272   23.614  78.782  1.00 73.72  ? 780  VAL A O     1 
ATOM   6849  C  CB    . VAL D 4  780  ? 3.612   25.361  78.015  1.00 58.33  ? 780  VAL A CB    1 
ATOM   6850  C  CG1   . VAL D 4  780  ? 3.534   25.636  79.521  1.00 53.34  ? 780  VAL A CG1   1 
ATOM   6851  C  CG2   . VAL D 4  780  ? 4.945   25.832  77.461  1.00 65.34  ? 780  VAL A CG2   1 
ATOM   6852  N  N     . ASP D 4  781  ? 2.872   22.080  79.226  1.00 60.91  ? 781  ASP A N     1 
ATOM   6853  C  CA    . ASP D 4  781  ? 2.136   21.264  80.194  1.00 66.38  ? 781  ASP A CA    1 
ATOM   6854  C  C     . ASP D 4  781  ? 0.781   20.774  79.679  1.00 66.44  ? 781  ASP A C     1 
ATOM   6855  O  O     . ASP D 4  781  ? -0.102  20.443  80.475  1.00 59.11  ? 781  ASP A O     1 
ATOM   6856  C  CB    . ASP D 4  781  ? 1.961   22.005  81.524  1.00 71.31  ? 781  ASP A CB    1 
ATOM   6857  C  CG    . ASP D 4  781  ? 3.267   22.177  82.269  1.00 80.74  ? 781  ASP A CG    1 
ATOM   6858  O  OD1   . ASP D 4  781  ? 4.286   21.611  81.821  1.00 72.63  ? 781  ASP A OD1   1 
ATOM   6859  O  OD2   . ASP D 4  781  ? 3.274   22.874  83.305  1.00 85.63  ? 781  ASP A OD2   1 
ATOM   6860  N  N     . ARG D 4  782  ? 0.589   20.711  78.363  1.00 73.14  ? 782  ARG A N     1 
ATOM   6861  C  CA    . ARG D 4  782  ? -0.584  20.060  77.801  1.00 73.57  ? 782  ARG A CA    1 
ATOM   6862  C  C     . ARG D 4  782  ? -0.223  19.482  76.441  1.00 70.97  ? 782  ARG A C     1 
ATOM   6863  O  O     . ARG D 4  782  ? 0.826   19.784  75.867  1.00 64.15  ? 782  ARG A O     1 
ATOM   6864  C  CB    . ARG D 4  782  ? -1.777  21.012  77.669  1.00 60.71  ? 782  ARG A CB    1 
ATOM   6865  C  CG    . ARG D 4  782  ? -1.433  22.443  77.334  1.00 53.89  ? 782  ARG A CG    1 
ATOM   6866  C  CD    . ARG D 4  782  ? -2.579  23.344  77.735  1.00 52.06  ? 782  ARG A CD    1 
ATOM   6867  N  NE    . ARG D 4  782  ? -2.558  24.618  77.029  1.00 51.65  ? 782  ARG A NE    1 
ATOM   6868  C  CZ    . ARG D 4  782  ? -3.615  25.410  76.908  1.00 52.41  ? 782  ARG A CZ    1 
ATOM   6869  N  NH1   . ARG D 4  782  ? -4.773  25.049  77.441  1.00 52.36  ? 782  ARG A NH1   1 
ATOM   6870  N  NH2   . ARG D 4  782  ? -3.520  26.554  76.247  1.00 61.19  ? 782  ARG A NH2   1 
ATOM   6871  N  N     . THR D 4  783  ? -1.113  18.632  75.935  1.00 74.70  ? 783  THR A N     1 
ATOM   6872  C  CA    . THR D 4  783  ? -0.947  17.995  74.636  1.00 78.81  ? 783  THR A CA    1 
ATOM   6873  C  C     . THR D 4  783  ? -1.659  18.733  73.515  1.00 79.48  ? 783  THR A C     1 
ATOM   6874  O  O     . THR D 4  783  ? -1.183  18.721  72.376  1.00 54.14  ? 783  THR A O     1 
ATOM   6875  C  CB    . THR D 4  783  ? -1.473  16.561  74.700  1.00 74.43  ? 783  THR A CB    1 
ATOM   6876  O  OG1   . THR D 4  783  ? -2.841  16.575  75.124  1.00 70.86  ? 783  THR A OG1   1 
ATOM   6877  C  CG2   . THR D 4  783  ? -0.678  15.779  75.716  1.00 85.40  ? 783  THR A CG2   1 
ATOM   6878  N  N     . LEU D 4  784  ? -2.782  19.375  73.826  1.00 80.60  ? 784  LEU A N     1 
ATOM   6879  C  CA    . LEU D 4  784  ? -3.632  20.121  72.912  1.00 63.88  ? 784  LEU A CA    1 
ATOM   6880  C  C     . LEU D 4  784  ? -4.217  21.278  73.708  1.00 60.81  ? 784  LEU A C     1 
ATOM   6881  O  O     . LEU D 4  784  ? -4.376  21.151  74.927  1.00 68.89  ? 784  LEU A O     1 
ATOM   6882  C  CB    . LEU D 4  784  ? -4.749  19.228  72.342  1.00 64.16  ? 784  LEU A CB    1 
ATOM   6883  C  CG    . LEU D 4  784  ? -4.393  18.158  71.308  1.00 47.45  ? 784  LEU A CG    1 
ATOM   6884  C  CD1   . LEU D 4  784  ? -5.657  17.540  70.760  1.00 47.33  ? 784  LEU A CD1   1 
ATOM   6885  C  CD2   . LEU D 4  784  ? -3.580  18.751  70.176  1.00 58.33  ? 784  LEU A CD2   1 
ATOM   6886  N  N     . PRO D 4  785  ? -4.568  22.414  73.061  1.00 58.89  ? 785  PRO A N     1 
ATOM   6887  C  CA    . PRO D 4  785  ? -4.986  23.582  73.846  1.00 49.52  ? 785  PRO A CA    1 
ATOM   6888  C  C     . PRO D 4  785  ? -6.460  23.547  74.212  1.00 50.31  ? 785  PRO A C     1 
ATOM   6889  O  O     . PRO D 4  785  ? -7.062  24.578  74.527  1.00 54.96  ? 785  PRO A O     1 
ATOM   6890  C  CB    . PRO D 4  785  ? -4.670  24.753  72.914  1.00 50.30  ? 785  PRO A CB    1 
ATOM   6891  C  CG    . PRO D 4  785  ? -4.839  24.181  71.535  1.00 61.87  ? 785  PRO A CG    1 
ATOM   6892  C  CD    . PRO D 4  785  ? -4.752  22.669  71.621  1.00 69.61  ? 785  PRO A CD    1 
ATOM   6893  N  N     . HIS D 4  786  ? -7.051  22.358  74.151  1.00 50.05  ? 786  HIS A N     1 
ATOM   6894  C  CA    . HIS D 4  786  ? -8.397  22.112  74.635  1.00 61.67  ? 786  HIS A CA    1 
ATOM   6895  C  C     . HIS D 4  786  ? -8.388  21.398  75.976  1.00 76.95  ? 786  HIS A C     1 
ATOM   6896  O  O     . HIS D 4  786  ? -9.456  21.088  76.511  1.00 88.00  ? 786  HIS A O     1 
ATOM   6897  C  CB    . HIS D 4  786  ? -9.185  21.296  73.608  1.00 57.13  ? 786  HIS A CB    1 
ATOM   6898  C  CG    . HIS D 4  786  ? -8.787  21.571  72.192  1.00 63.17  ? 786  HIS A CG    1 
ATOM   6899  N  ND1   . HIS D 4  786  ? -9.475  22.448  71.383  1.00 69.89  ? 786  HIS A ND1   1 
ATOM   6900  C  CD2   . HIS D 4  786  ? -7.791  21.059  71.430  1.00 67.06  ? 786  HIS A CD2   1 
ATOM   6901  C  CE1   . HIS D 4  786  ? -8.904  22.486  70.192  1.00 78.81  ? 786  HIS A CE1   1 
ATOM   6902  N  NE2   . HIS D 4  786  ? -7.879  21.652  70.195  1.00 71.37  ? 786  HIS A NE2   1 
ATOM   6903  N  N     . PHE D 4  787  ? -7.207  21.129  76.519  1.00 69.11  ? 787  PHE A N     1 
ATOM   6904  C  CA    . PHE D 4  787  ? -7.038  20.501  77.817  1.00 58.98  ? 787  PHE A CA    1 
ATOM   6905  C  C     . PHE D 4  787  ? -6.425  21.496  78.790  1.00 73.12  ? 787  PHE A C     1 
ATOM   6906  O  O     . PHE D 4  787  ? -5.661  22.383  78.399  1.00 53.04  ? 787  PHE A O     1 
ATOM   6907  C  CB    . PHE D 4  787  ? -6.140  19.265  77.714  1.00 53.94  ? 787  PHE A CB    1 
ATOM   6908  C  CG    . PHE D 4  787  ? -6.715  18.171  76.868  1.00 54.20  ? 787  PHE A CG    1 
ATOM   6909  C  CD1   . PHE D 4  787  ? -5.901  17.415  76.041  1.00 53.69  ? 787  PHE A CD1   1 
ATOM   6910  C  CD2   . PHE D 4  787  ? -8.071  17.895  76.905  1.00 52.33  ? 787  PHE A CD2   1 
ATOM   6911  C  CE1   . PHE D 4  787  ? -6.432  16.407  75.260  1.00 54.86  ? 787  PHE A CE1   1 
ATOM   6912  C  CE2   . PHE D 4  787  ? -8.609  16.888  76.130  1.00 51.92  ? 787  PHE A CE2   1 
ATOM   6913  C  CZ    . PHE D 4  787  ? -7.788  16.142  75.306  1.00 58.29  ? 787  PHE A CZ    1 
ATOM   6914  N  N     . SER D 4  788  ? -6.771  21.347  80.064  1.00 64.47  ? 788  SER A N     1 
ATOM   6915  C  CA    . SER D 4  788  ? -6.107  22.125  81.093  1.00 55.37  ? 788  SER A CA    1 
ATOM   6916  C  C     . SER D 4  788  ? -4.685  21.613  81.290  1.00 55.22  ? 788  SER A C     1 
ATOM   6917  O  O     . SER D 4  788  ? -4.340  20.493  80.900  1.00 54.77  ? 788  SER A O     1 
ATOM   6918  C  CB    . SER D 4  788  ? -6.884  22.055  82.405  1.00 62.53  ? 788  SER A CB    1 
ATOM   6919  O  OG    . SER D 4  788  ? -8.222  22.482  82.223  1.00 72.79  ? 788  SER A OG    1 
ATOM   6920  N  N     . LYS D 4  789  ? -3.850  22.450  81.899  1.00 55.64  ? 789  LYS A N     1 
ATOM   6921  C  CA    . LYS D 4  789  ? -2.468  22.064  82.137  1.00 58.59  ? 789  LYS A CA    1 
ATOM   6922  C  C     . LYS D 4  789  ? -2.391  20.977  83.203  1.00 69.97  ? 789  LYS A C     1 
ATOM   6923  O  O     . LYS D 4  789  ? -3.246  20.887  84.088  1.00 57.40  ? 789  LYS A O     1 
ATOM   6924  C  CB    . LYS D 4  789  ? -1.637  23.270  82.564  1.00 55.96  ? 789  LYS A CB    1 
ATOM   6925  C  CG    . LYS D 4  789  ? -1.011  24.032  81.413  1.00 54.97  ? 789  LYS A CG    1 
ATOM   6926  C  CD    . LYS D 4  789  ? -0.791  25.482  81.776  1.00 55.45  ? 789  LYS A CD    1 
ATOM   6927  C  CE    . LYS D 4  789  ? -0.036  26.216  80.686  1.00 54.57  ? 789  LYS A CE    1 
ATOM   6928  N  NZ    . LYS D 4  789  ? 0.988   27.128  81.262  1.00 68.73  ? 789  LYS A NZ    1 
ATOM   6929  N  N     . ASP D 4  790  ? -1.347  20.151  83.100  1.00 78.76  ? 790  ASP A N     1 
ATOM   6930  C  CA    . ASP D 4  790  ? -1.089  19.015  83.991  1.00 65.13  ? 790  ASP A CA    1 
ATOM   6931  C  C     . ASP D 4  790  ? -2.288  18.062  84.026  1.00 64.25  ? 790  ASP A C     1 
ATOM   6932  O  O     . ASP D 4  790  ? -2.995  17.929  85.024  1.00 58.18  ? 790  ASP A O     1 
ATOM   6933  C  CB    . ASP D 4  790  ? -0.716  19.490  85.401  1.00 64.39  ? 790  ASP A CB    1 
ATOM   6934  C  CG    . ASP D 4  790  ? 0.666   20.114  85.463  1.00 78.04  ? 790  ASP A CG    1 
ATOM   6935  O  OD1   . ASP D 4  790  ? 0.754   21.353  85.595  1.00 81.61  ? 790  ASP A OD1   1 
ATOM   6936  O  OD2   . ASP D 4  790  ? 1.666   19.369  85.386  1.00 81.73  ? 790  ASP A OD2   1 
ATOM   6937  N  N     . ASP D 4  791  ? -2.502  17.404  82.889  1.00 70.59  ? 791  ASP A N     1 
ATOM   6938  C  CA    . ASP D 4  791  ? -3.601  16.452  82.727  1.00 59.64  ? 791  ASP A CA    1 
ATOM   6939  C  C     . ASP D 4  791  ? -2.980  15.170  82.182  1.00 68.34  ? 791  ASP A C     1 
ATOM   6940  O  O     . ASP D 4  791  ? -2.654  15.088  80.995  1.00 66.54  ? 791  ASP A O     1 
ATOM   6941  C  CB    . ASP D 4  791  ? -4.683  17.001  81.799  1.00 55.64  ? 791  ASP A CB    1 
ATOM   6942  C  CG    . ASP D 4  791  ? -5.927  16.127  81.755  1.00 55.93  ? 791  ASP A CG    1 
ATOM   6943  O  OD1   . ASP D 4  791  ? -5.959  15.088  82.447  1.00 56.63  ? 791  ASP A OD1   1 
ATOM   6944  O  OD2   . ASP D 4  791  ? -6.878  16.475  81.029  1.00 56.69  ? 791  ASP A OD2   1 
ATOM   6945  N  N     . TYR D 4  792  ? -2.821  14.170  83.050  1.00 81.19  ? 792  TYR A N     1 
ATOM   6946  C  CA    . TYR D 4  792  ? -2.217  12.897  82.685  1.00 69.33  ? 792  TYR A CA    1 
ATOM   6947  C  C     . TYR D 4  792  ? -3.263  11.814  82.446  1.00 70.85  ? 792  TYR A C     1 
ATOM   6948  O  O     . TYR D 4  792  ? -2.945  10.622  82.529  1.00 56.73  ? 792  TYR A O     1 
ATOM   6949  C  CB    . TYR D 4  792  ? -1.227  12.454  83.764  1.00 61.67  ? 792  TYR A CB    1 
ATOM   6950  C  CG    . TYR D 4  792  ? 0.002   13.331  83.875  1.00 60.27  ? 792  TYR A CG    1 
ATOM   6951  C  CD1   . TYR D 4  792  ? -0.036  14.537  84.566  1.00 59.89  ? 792  TYR A CD1   1 
ATOM   6952  C  CD2   . TYR D 4  792  ? 1.198   12.959  83.278  1.00 67.66  ? 792  TYR A CD2   1 
ATOM   6953  C  CE1   . TYR D 4  792  ? 1.083   15.340  84.666  1.00 64.74  ? 792  TYR A CE1   1 
ATOM   6954  C  CE2   . TYR D 4  792  ? 2.323   13.756  83.371  1.00 60.13  ? 792  TYR A CE2   1 
ATOM   6955  C  CZ    . TYR D 4  792  ? 2.258   14.945  84.066  1.00 66.66  ? 792  TYR A CZ    1 
ATOM   6956  O  OH    . TYR D 4  792  ? 3.373   15.744  84.164  1.00 66.93  ? 792  TYR A OH    1 
ATOM   6957  N  N     . SER D 4  793  ? -4.502  12.215  82.146  1.00 79.22  ? 793  SER A N     1 
ATOM   6958  C  CA    . SER D 4  793  ? -5.605  11.294  81.915  1.00 81.31  ? 793  SER A CA    1 
ATOM   6959  C  C     . SER D 4  793  ? -5.348  10.454  80.662  1.00 89.93  ? 793  SER A C     1 
ATOM   6960  O  O     . SER D 4  793  ? -4.511  10.815  79.830  1.00 108.25 ? 793  SER A O     1 
ATOM   6961  C  CB    . SER D 4  793  ? -6.907  12.093  81.790  1.00 79.39  ? 793  SER A CB    1 
ATOM   6962  O  OG    . SER D 4  793  ? -7.872  11.455  80.979  1.00 78.38  ? 793  SER A OG    1 
ATOM   6963  N  N     . PRO D 4  794  ? -6.021  9.299   80.532  1.00 87.14  ? 794  PRO A N     1 
ATOM   6964  C  CA    . PRO D 4  794  ? -5.905  8.534   79.275  1.00 88.70  ? 794  PRO A CA    1 
ATOM   6965  C  C     . PRO D 4  794  ? -6.318  9.315   78.035  1.00 88.88  ? 794  PRO A C     1 
ATOM   6966  O  O     . PRO D 4  794  ? -5.562  9.344   77.057  1.00 88.03  ? 794  PRO A O     1 
ATOM   6967  C  CB    . PRO D 4  794  ? -6.818  7.321   79.528  1.00 86.82  ? 794  PRO A CB    1 
ATOM   6968  C  CG    . PRO D 4  794  ? -7.694  7.729   80.688  1.00 90.33  ? 794  PRO A CG    1 
ATOM   6969  C  CD    . PRO D 4  794  ? -6.770  8.530   81.540  1.00 93.38  ? 794  PRO A CD    1 
ATOM   6970  N  N     . GLU D 4  795  ? -7.477  9.979   78.058  1.00 83.26  ? 795  GLU A N     1 
ATOM   6971  C  CA    . GLU D 4  795  ? -7.948  10.685  76.870  1.00 70.37  ? 795  GLU A CA    1 
ATOM   6972  C  C     . GLU D 4  795  ? -7.105  11.911  76.542  1.00 57.09  ? 795  GLU A C     1 
ATOM   6973  O  O     . GLU D 4  795  ? -7.164  12.401  75.410  1.00 88.25  ? 795  GLU A O     1 
ATOM   6974  C  CB    . GLU D 4  795  ? -9.414  11.096  77.035  1.00 82.91  ? 795  GLU A CB    1 
ATOM   6975  C  CG    . GLU D 4  795  ? -9.639  12.412  77.765  1.00 104.82 ? 795  GLU A CG    1 
ATOM   6976  C  CD    . GLU D 4  795  ? -10.175 12.220  79.168  1.00 127.53 ? 795  GLU A CD    1 
ATOM   6977  O  OE1   . GLU D 4  795  ? -10.688 13.201  79.746  1.00 131.44 ? 795  GLU A OE1   1 
ATOM   6978  O  OE2   . GLU D 4  795  ? -10.076 11.093  79.699  1.00 129.89 ? 795  GLU A OE2   1 
ATOM   6979  N  N     . SER D 4  796  ? -6.325  12.412  77.493  1.00 52.88  ? 796  SER A N     1 
ATOM   6980  C  CA    . SER D 4  796  ? -5.452  13.545  77.246  1.00 52.32  ? 796  SER A CA    1 
ATOM   6981  C  C     . SER D 4  796  ? -4.075  13.134  76.751  1.00 51.70  ? 796  SER A C     1 
ATOM   6982  O  O     . SER D 4  796  ? -3.323  13.994  76.287  1.00 51.10  ? 796  SER A O     1 
ATOM   6983  C  CB    . SER D 4  796  ? -5.303  14.385  78.517  1.00 63.98  ? 796  SER A CB    1 
ATOM   6984  O  OG    . SER D 4  796  ? -4.022  14.990  78.576  1.00 57.07  ? 796  SER A OG    1 
ATOM   6985  N  N     . LYS D 4  797  ? -3.725  11.852  76.833  1.00 55.82  ? 797  LYS A N     1 
ATOM   6986  C  CA    . LYS D 4  797  ? -2.392  11.397  76.462  1.00 80.21  ? 797  LYS A CA    1 
ATOM   6987  C  C     . LYS D 4  797  ? -2.442  10.342  75.363  1.00 87.04  ? 797  LYS A C     1 
ATOM   6988  O  O     . LYS D 4  797  ? -1.565  9.481   75.280  1.00 91.67  ? 797  LYS A O     1 
ATOM   6989  C  CB    . LYS D 4  797  ? -1.648  10.864  77.684  1.00 99.12  ? 797  LYS A CB    1 
ATOM   6990  C  CG    . LYS D 4  797  ? -1.321  11.933  78.713  1.00 98.55  ? 797  LYS A CG    1 
ATOM   6991  C  CD    . LYS D 4  797  ? 0.002   12.618  78.421  1.00 86.41  ? 797  LYS A CD    1 
ATOM   6992  C  CE    . LYS D 4  797  ? 1.085   12.196  79.398  1.00 60.62  ? 797  LYS A CE    1 
ATOM   6993  N  NZ    . LYS D 4  797  ? 2.440   12.262  78.785  1.00 52.53  ? 797  LYS A NZ    1 
ATOM   6994  N  N     . GLY D 4  798  ? -3.464  10.394  74.518  1.00 72.74  ? 798  GLY A N     1 
ATOM   6995  C  CA    . GLY D 4  798  ? -3.493  9.594   73.315  1.00 59.42  ? 798  GLY A CA    1 
ATOM   6996  C  C     . GLY D 4  798  ? -4.226  8.278   73.387  1.00 53.40  ? 798  GLY A C     1 
ATOM   6997  O  O     . GLY D 4  798  ? -4.185  7.522   72.411  1.00 49.61  ? 798  GLY A O     1 
ATOM   6998  N  N     . PHE D 4  799  ? -4.887  7.968   74.498  1.00 64.89  ? 799  PHE A N     1 
ATOM   6999  C  CA    . PHE D 4  799  ? -5.723  6.777   74.516  1.00 65.20  ? 799  PHE A CA    1 
ATOM   7000  C  C     . PHE D 4  799  ? -6.975  7.025   73.694  1.00 67.65  ? 799  PHE A C     1 
ATOM   7001  O  O     . PHE D 4  799  ? -7.698  8.001   73.916  1.00 72.36  ? 799  PHE A O     1 
ATOM   7002  C  CB    . PHE D 4  799  ? -6.111  6.380   75.935  1.00 52.92  ? 799  PHE A CB    1 
ATOM   7003  C  CG    . PHE D 4  799  ? -6.769  5.032   76.015  1.00 53.55  ? 799  PHE A CG    1 
ATOM   7004  C  CD1   . PHE D 4  799  ? -6.071  3.887   75.667  1.00 53.47  ? 799  PHE A CD1   1 
ATOM   7005  C  CD2   . PHE D 4  799  ? -8.091  4.913   76.409  1.00 54.27  ? 799  PHE A CD2   1 
ATOM   7006  C  CE1   . PHE D 4  799  ? -6.672  2.645   75.732  1.00 54.12  ? 799  PHE A CE1   1 
ATOM   7007  C  CE2   . PHE D 4  799  ? -8.699  3.674   76.475  1.00 54.92  ? 799  PHE A CE2   1 
ATOM   7008  C  CZ    . PHE D 4  799  ? -7.989  2.539   76.137  1.00 54.85  ? 799  PHE A CZ    1 
ATOM   7009  N  N     . VAL D 4  800  ? -7.226  6.140   72.743  1.00 69.64  ? 800  VAL A N     1 
ATOM   7010  C  CA    . VAL D 4  800  ? -8.364  6.248   71.846  1.00 52.99  ? 800  VAL A CA    1 
ATOM   7011  C  C     . VAL D 4  800  ? -9.390  5.221   72.307  1.00 51.54  ? 800  VAL A C     1 
ATOM   7012  O  O     . VAL D 4  800  ? -9.253  4.025   72.038  1.00 57.78  ? 800  VAL A O     1 
ATOM   7013  C  CB    . VAL D 4  800  ? -7.953  6.029   70.392  1.00 49.56  ? 800  VAL A CB    1 
ATOM   7014  C  CG1   . VAL D 4  800  ? -8.975  6.626   69.485  1.00 49.96  ? 800  VAL A CG1   1 
ATOM   7015  C  CG2   . VAL D 4  800  ? -6.580  6.629   70.126  1.00 48.85  ? 800  VAL A CG2   1 
ATOM   7016  N  N     . GLU D 4  801  ? -10.417 5.690   73.018  1.00 52.23  ? 801  GLU A N     1 
ATOM   7017  C  CA    . GLU D 4  801  ? -11.452 4.790   73.516  1.00 61.53  ? 801  GLU A CA    1 
ATOM   7018  C  C     . GLU D 4  801  ? -12.315 4.263   72.378  1.00 83.69  ? 801  GLU A C     1 
ATOM   7019  O  O     . GLU D 4  801  ? -12.606 3.062   72.306  1.00 90.83  ? 801  GLU A O     1 
ATOM   7020  C  CB    . GLU D 4  801  ? -12.313 5.514   74.552  1.00 62.99  ? 801  GLU A CB    1 
ATOM   7021  C  CG    . GLU D 4  801  ? -13.652 4.850   74.819  1.00 65.04  ? 801  GLU A CG    1 
ATOM   7022  C  CD    . GLU D 4  801  ? -14.340 5.400   76.048  1.00 84.03  ? 801  GLU A CD    1 
ATOM   7023  O  OE1   . GLU D 4  801  ? -15.298 4.759   76.529  1.00 86.50  ? 801  GLU A OE1   1 
ATOM   7024  O  OE2   . GLU D 4  801  ? -13.930 6.476   76.530  1.00 93.52  ? 801  GLU A OE2   1 
ATOM   7025  N  N     . ASN D 4  802  ? -12.729 5.152   71.479  1.00 91.20  ? 802  ASN A N     1 
ATOM   7026  C  CA    . ASN D 4  802  ? -13.595 4.796   70.369  1.00 72.51  ? 802  ASN A CA    1 
ATOM   7027  C  C     . ASN D 4  802  ? -12.868 3.875   69.398  1.00 68.50  ? 802  ASN A C     1 
ATOM   7028  O  O     . ASN D 4  802  ? -11.641 3.800   69.376  1.00 60.38  ? 802  ASN A O     1 
ATOM   7029  C  CB    . ASN D 4  802  ? -14.063 6.051   69.642  1.00 65.51  ? 802  ASN A CB    1 
ATOM   7030  C  CG    . ASN D 4  802  ? -15.047 6.852   70.453  1.00 70.41  ? 802  ASN A CG    1 
ATOM   7031  O  OD1   . ASN D 4  802  ? -16.193 6.448   70.617  1.00 83.35  ? 802  ASN A OD1   1 
ATOM   7032  N  ND2   . ASN D 4  802  ? -14.609 7.998   70.965  1.00 59.72  ? 802  ASN A ND2   1 
ATOM   7033  N  N     . SER D 4  803  ? -13.642 3.163   68.593  1.00 63.19  ? 803  SER A N     1 
ATOM   7034  C  CA    . SER D 4  803  ? -13.092 2.253   67.603  1.00 57.81  ? 803  SER A CA    1 
ATOM   7035  C  C     . SER D 4  803  ? -13.266 2.845   66.209  1.00 65.74  ? 803  SER A C     1 
ATOM   7036  O  O     . SER D 4  803  ? -13.863 3.910   66.025  1.00 81.77  ? 803  SER A O     1 
ATOM   7037  C  CB    . SER D 4  803  ? -13.750 0.877   67.704  1.00 68.39  ? 803  SER A CB    1 
ATOM   7038  O  OG    . SER D 4  803  ? -15.143 0.952   67.463  1.00 67.55  ? 803  SER A OG    1 
ATOM   7039  N  N     . TYR D 4  804  ? -12.724 2.133   65.220  1.00 56.47  ? 804  TYR A N     1 
ATOM   7040  C  CA    . TYR D 4  804  ? -12.911 2.531   63.831  1.00 48.64  ? 804  TYR A CA    1 
ATOM   7041  C  C     . TYR D 4  804  ? -14.370 2.409   63.416  1.00 52.09  ? 804  TYR A C     1 
ATOM   7042  O  O     . TYR D 4  804  ? -14.850 3.205   62.605  1.00 73.37  ? 804  TYR A O     1 
ATOM   7043  C  CB    . TYR D 4  804  ? -12.022 1.680   62.927  1.00 47.91  ? 804  TYR A CB    1 
ATOM   7044  C  CG    . TYR D 4  804  ? -10.546 1.975   63.067  1.00 47.37  ? 804  TYR A CG    1 
ATOM   7045  C  CD1   . TYR D 4  804  ? -9.595  1.030   62.713  1.00 61.29  ? 804  TYR A CD1   1 
ATOM   7046  C  CD2   . TYR D 4  804  ? -10.103 3.193   63.557  1.00 47.03  ? 804  TYR A CD2   1 
ATOM   7047  C  CE1   . TYR D 4  804  ? -8.247  1.290   62.842  1.00 55.39  ? 804  TYR A CE1   1 
ATOM   7048  C  CE2   . TYR D 4  804  ? -8.756  3.463   63.690  1.00 57.56  ? 804  TYR A CE2   1 
ATOM   7049  C  CZ    . TYR D 4  804  ? -7.832  2.508   63.330  1.00 51.26  ? 804  TYR A CZ    1 
ATOM   7050  O  OH    . TYR D 4  804  ? -6.489  2.769   63.458  1.00 49.55  ? 804  TYR A OH    1 
ATOM   7051  N  N     . LEU D 4  805  ? -15.087 1.428   63.970  1.00 49.76  ? 805  LEU A N     1 
ATOM   7052  C  CA    . LEU D 4  805  ? -16.525 1.333   63.742  1.00 53.42  ? 805  LEU A CA    1 
ATOM   7053  C  C     . LEU D 4  805  ? -17.253 2.497   64.402  1.00 73.67  ? 805  LEU A C     1 
ATOM   7054  O  O     . LEU D 4  805  ? -18.145 3.106   63.797  1.00 76.55  ? 805  LEU A O     1 
ATOM   7055  C  CB    . LEU D 4  805  ? -17.042 -0.012  64.265  1.00 51.41  ? 805  LEU A CB    1 
ATOM   7056  C  CG    . LEU D 4  805  ? -18.446 -0.533  63.939  1.00 52.13  ? 805  LEU A CG    1 
ATOM   7057  C  CD1   . LEU D 4  805  ? -19.504 -0.047  64.925  1.00 53.87  ? 805  LEU A CD1   1 
ATOM   7058  C  CD2   . LEU D 4  805  ? -18.830 -0.154  62.522  1.00 62.52  ? 805  LEU A CD2   1 
ATOM   7059  N  N     . ARG D 4  806  ? -16.893 2.812   65.648  1.00 84.12  ? 806  ARG A N     1 
ATOM   7060  C  CA    . ARG D 4  806  ? -17.475 3.943   66.362  1.00 86.14  ? 806  ARG A CA    1 
ATOM   7061  C  C     . ARG D 4  806  ? -17.081 5.259   65.705  1.00 69.34  ? 806  ARG A C     1 
ATOM   7062  O  O     . ARG D 4  806  ? -17.936 5.969   65.166  1.00 67.84  ? 806  ARG A O     1 
ATOM   7063  C  CB    . ARG D 4  806  ? -17.047 3.944   67.833  1.00 92.79  ? 806  ARG A CB    1 
ATOM   7064  C  CG    . ARG D 4  806  ? -17.547 2.769   68.661  1.00 90.73  ? 806  ARG A CG    1 
ATOM   7065  C  CD    . ARG D 4  806  ? -17.285 3.013   70.153  1.00 96.60  ? 806  ARG A CD    1 
ATOM   7066  N  NE    . ARG D 4  806  ? -18.289 2.438   71.053  1.00 97.29  ? 806  ARG A NE    1 
ATOM   7067  C  CZ    . ARG D 4  806  ? -19.559 2.830   71.155  1.00 99.98  ? 806  ARG A CZ    1 
ATOM   7068  N  NH1   . ARG D 4  806  ? -20.365 2.222   72.014  1.00 90.36  ? 806  ARG A NH1   1 
ATOM   7069  N  NH2   . ARG D 4  806  ? -20.026 3.843   70.436  1.00 110.13 ? 806  ARG A NH2   1 
ATOM   7070  N  N     . GLY D 4  807  ? -15.793 5.591   65.742  1.00 57.35  ? 807  GLY A N     1 
ATOM   7071  C  CA    . GLY D 4  807  ? -15.324 6.828   65.153  1.00 48.58  ? 807  GLY A CA    1 
ATOM   7072  C  C     . GLY D 4  807  ? -14.510 7.679   66.103  1.00 48.57  ? 807  GLY A C     1 
ATOM   7073  O  O     . GLY D 4  807  ? -14.969 8.010   67.200  1.00 60.93  ? 807  GLY A O     1 
ATOM   7074  N  N     . LEU D 4  808  ? -13.306 8.055   65.682  1.00 47.80  ? 808  LEU A N     1 
ATOM   7075  C  CA    . LEU D 4  808  ? -12.392 8.789   66.547  1.00 47.76  ? 808  LEU A CA    1 
ATOM   7076  C  C     . LEU D 4  808  ? -12.828 10.241  66.705  1.00 58.08  ? 808  LEU A C     1 
ATOM   7077  O  O     . LEU D 4  808  ? -13.321 10.865  65.764  1.00 54.34  ? 808  LEU A O     1 
ATOM   7078  C  CB    . LEU D 4  808  ? -10.969 8.733   65.985  1.00 46.97  ? 808  LEU A CB    1 
ATOM   7079  C  CG    . LEU D 4  808  ? -10.102 7.475   66.129  1.00 47.11  ? 808  LEU A CG    1 
ATOM   7080  C  CD1   . LEU D 4  808  ? -10.583 6.283   65.321  1.00 47.13  ? 808  LEU A CD1   1 
ATOM   7081  C  CD2   . LEU D 4  808  ? -8.657  7.795   65.781  1.00 46.40  ? 808  LEU A CD2   1 
ATOM   7082  N  N     . THR D 4  809  ? -12.646 10.777  67.910  1.00 69.96  ? 809  THR A N     1 
ATOM   7083  C  CA    . THR D 4  809  ? -12.897 12.185  68.174  1.00 65.44  ? 809  THR A CA    1 
ATOM   7084  C  C     . THR D 4  809  ? -11.750 13.009  67.585  1.00 60.53  ? 809  THR A C     1 
ATOM   7085  O  O     . THR D 4  809  ? -10.702 12.452  67.246  1.00 55.30  ? 809  THR A O     1 
ATOM   7086  C  CB    . THR D 4  809  ? -13.040 12.413  69.681  1.00 62.76  ? 809  THR A CB    1 
ATOM   7087  O  OG1   . THR D 4  809  ? -11.780 12.215  70.328  1.00 66.67  ? 809  THR A OG1   1 
ATOM   7088  C  CG2   . THR D 4  809  ? -14.059 11.454  70.260  1.00 72.31  ? 809  THR A CG2   1 
ATOM   7089  N  N     . PRO D 4  810  ? -11.929 14.332  67.401  1.00 48.77  ? 810  PRO A N     1 
ATOM   7090  C  CA    . PRO D 4  810  ? -10.861 15.107  66.736  1.00 46.25  ? 810  PRO A CA    1 
ATOM   7091  C  C     . PRO D 4  810  ? -9.542  15.143  67.491  1.00 53.03  ? 810  PRO A C     1 
ATOM   7092  O  O     . PRO D 4  810  ? -8.482  15.171  66.854  1.00 49.84  ? 810  PRO A O     1 
ATOM   7093  C  CB    . PRO D 4  810  ? -11.468 16.507  66.600  1.00 46.22  ? 810  PRO A CB    1 
ATOM   7094  C  CG    . PRO D 4  810  ? -12.910 16.333  66.729  1.00 46.77  ? 810  PRO A CG    1 
ATOM   7095  C  CD    . PRO D 4  810  ? -13.161 15.134  67.552  1.00 47.48  ? 810  PRO A CD    1 
ATOM   7096  N  N     . GLN D 4  811  ? -9.566  15.142  68.825  1.00 66.77  ? 811  GLN A N     1 
ATOM   7097  C  CA    . GLN D 4  811  ? -8.320  14.971  69.565  1.00 56.55  ? 811  GLN A CA    1 
ATOM   7098  C  C     . GLN D 4  811  ? -7.747  13.576  69.345  1.00 53.18  ? 811  GLN A C     1 
ATOM   7099  O  O     . GLN D 4  811  ? -6.535  13.417  69.161  1.00 51.60  ? 811  GLN A O     1 
ATOM   7100  C  CB    . GLN D 4  811  ? -8.543  15.228  71.055  1.00 48.35  ? 811  GLN A CB    1 
ATOM   7101  C  CG    . GLN D 4  811  ? -9.331  16.487  71.374  1.00 48.67  ? 811  GLN A CG    1 
ATOM   7102  C  CD    . GLN D 4  811  ? -10.811 16.221  71.563  1.00 60.72  ? 811  GLN A CD    1 
ATOM   7103  O  OE1   . GLN D 4  811  ? -11.301 15.128  71.279  1.00 78.14  ? 811  GLN A OE1   1 
ATOM   7104  N  NE2   . GLN D 4  811  ? -11.528 17.218  72.064  1.00 51.08  ? 811  GLN A NE2   1 
ATOM   7105  N  N     . GLU D 4  812  ? -8.616  12.562  69.337  1.00 57.23  ? 812  GLU A N     1 
ATOM   7106  C  CA    . GLU D 4  812  ? -8.188  11.185  69.116  1.00 63.01  ? 812  GLU A CA    1 
ATOM   7107  C  C     . GLU D 4  812  ? -7.614  10.986  67.718  1.00 73.14  ? 812  GLU A C     1 
ATOM   7108  O  O     . GLU D 4  812  ? -6.725  10.147  67.529  1.00 74.36  ? 812  GLU A O     1 
ATOM   7109  C  CB    . GLU D 4  812  ? -9.371  10.247  69.345  1.00 55.50  ? 812  GLU A CB    1 
ATOM   7110  C  CG    . GLU D 4  812  ? -9.659  9.919   70.805  1.00 75.08  ? 812  GLU A CG    1 
ATOM   7111  C  CD    . GLU D 4  812  ? -10.977 9.180   70.972  1.00 76.46  ? 812  GLU A CD    1 
ATOM   7112  O  OE1   . GLU D 4  812  ? -11.500 8.658   69.965  1.00 73.16  ? 812  GLU A OE1   1 
ATOM   7113  O  OE2   . GLU D 4  812  ? -11.491 9.117   72.108  1.00 72.92  ? 812  GLU A OE2   1 
ATOM   7114  N  N     . PHE D 4  813  ? -8.118  11.736  66.732  1.00 53.01  ? 813  PHE A N     1 
ATOM   7115  C  CA    . PHE D 4  813  ? -7.542  11.716  65.390  1.00 45.51  ? 813  PHE A CA    1 
ATOM   7116  C  C     . PHE D 4  813  ? -6.091  12.186  65.433  1.00 48.02  ? 813  PHE A C     1 
ATOM   7117  O  O     . PHE D 4  813  ? -5.191  11.497  64.940  1.00 63.31  ? 813  PHE A O     1 
ATOM   7118  C  CB    . PHE D 4  813  ? -8.388  12.608  64.468  1.00 60.88  ? 813  PHE A CB    1 
ATOM   7119  C  CG    . PHE D 4  813  ? -8.091  12.493  62.965  1.00 64.00  ? 813  PHE A CG    1 
ATOM   7120  C  CD1   . PHE D 4  813  ? -8.939  13.116  62.067  1.00 63.65  ? 813  PHE A CD1   1 
ATOM   7121  C  CD2   . PHE D 4  813  ? -7.036  11.744  62.447  1.00 69.96  ? 813  PHE A CD2   1 
ATOM   7122  C  CE1   . PHE D 4  813  ? -8.718  13.041  60.704  1.00 79.45  ? 813  PHE A CE1   1 
ATOM   7123  C  CE2   . PHE D 4  813  ? -6.810  11.668  61.085  1.00 70.17  ? 813  PHE A CE2   1 
ATOM   7124  C  CZ    . PHE D 4  813  ? -7.656  12.314  60.214  1.00 70.98  ? 813  PHE A CZ    1 
ATOM   7125  N  N     . PHE D 4  814  ? -5.850  13.357  66.029  1.00 48.63  ? 814  PHE A N     1 
ATOM   7126  C  CA    . PHE D 4  814  ? -4.533  13.978  65.945  1.00 52.15  ? 814  PHE A CA    1 
ATOM   7127  C  C     . PHE D 4  814  ? -3.478  13.163  66.681  1.00 72.23  ? 814  PHE A C     1 
ATOM   7128  O  O     . PHE D 4  814  ? -2.320  13.103  66.251  1.00 75.38  ? 814  PHE A O     1 
ATOM   7129  C  CB    . PHE D 4  814  ? -4.582  15.399  66.496  1.00 44.61  ? 814  PHE A CB    1 
ATOM   7130  C  CG    . PHE D 4  814  ? -3.440  16.253  66.046  1.00 44.11  ? 814  PHE A CG    1 
ATOM   7131  C  CD1   . PHE D 4  814  ? -3.489  16.904  64.825  1.00 43.40  ? 814  PHE A CD1   1 
ATOM   7132  C  CD2   . PHE D 4  814  ? -2.305  16.380  66.822  1.00 44.40  ? 814  PHE A CD2   1 
ATOM   7133  C  CE1   . PHE D 4  814  ? -2.435  17.686  64.402  1.00 50.30  ? 814  PHE A CE1   1 
ATOM   7134  C  CE2   . PHE D 4  814  ? -1.245  17.157  66.403  1.00 58.90  ? 814  PHE A CE2   1 
ATOM   7135  C  CZ    . PHE D 4  814  ? -1.311  17.813  65.191  1.00 56.91  ? 814  PHE A CZ    1 
ATOM   7136  N  N     . PHE D 4  815  ? -3.859  12.524  67.787  1.00 69.52  ? 815  PHE A N     1 
ATOM   7137  C  CA    . PHE D 4  815  ? -2.922  11.651  68.482  1.00 64.24  ? 815  PHE A CA    1 
ATOM   7138  C  C     . PHE D 4  815  ? -2.644  10.396  67.666  1.00 60.84  ? 815  PHE A C     1 
ATOM   7139  O  O     . PHE D 4  815  ? -1.511  9.902   67.638  1.00 69.19  ? 815  PHE A O     1 
ATOM   7140  C  CB    . PHE D 4  815  ? -3.468  11.290  69.861  1.00 67.00  ? 815  PHE A CB    1 
ATOM   7141  C  CG    . PHE D 4  815  ? -3.689  12.477  70.754  1.00 51.98  ? 815  PHE A CG    1 
ATOM   7142  C  CD1   . PHE D 4  815  ? -4.784  12.525  71.598  1.00 48.18  ? 815  PHE A CD1   1 
ATOM   7143  C  CD2   . PHE D 4  815  ? -2.808  13.545  70.745  1.00 47.13  ? 815  PHE A CD2   1 
ATOM   7144  C  CE1   . PHE D 4  815  ? -4.997  13.614  72.417  1.00 48.64  ? 815  PHE A CE1   1 
ATOM   7145  C  CE2   . PHE D 4  815  ? -3.014  14.640  71.564  1.00 47.60  ? 815  PHE A CE2   1 
ATOM   7146  C  CZ    . PHE D 4  815  ? -4.110  14.672  72.402  1.00 48.61  ? 815  PHE A CZ    1 
ATOM   7147  N  N     . HIS D 4  816  ? -3.667  9.877   66.984  1.00 52.18  ? 816  HIS A N     1 
ATOM   7148  C  CA    . HIS D 4  816  ? -3.473  8.739   66.093  1.00 59.22  ? 816  HIS A CA    1 
ATOM   7149  C  C     . HIS D 4  816  ? -2.628  9.133   64.888  1.00 70.58  ? 816  HIS A C     1 
ATOM   7150  O  O     . HIS D 4  816  ? -1.762  8.364   64.454  1.00 83.14  ? 816  HIS A O     1 
ATOM   7151  C  CB    . HIS D 4  816  ? -4.833  8.196   65.652  1.00 48.32  ? 816  HIS A CB    1 
ATOM   7152  C  CG    . HIS D 4  816  ? -4.778  6.870   64.957  1.00 45.27  ? 816  HIS A CG    1 
ATOM   7153  N  ND1   . HIS D 4  816  ? -3.599  6.236   64.627  1.00 45.04  ? 816  HIS A ND1   1 
ATOM   7154  C  CD2   . HIS D 4  816  ? -5.772  6.060   64.522  1.00 45.46  ? 816  HIS A CD2   1 
ATOM   7155  C  CE1   . HIS D 4  816  ? -3.869  5.093   64.022  1.00 45.10  ? 816  HIS A CE1   1 
ATOM   7156  N  NE2   . HIS D 4  816  ? -5.181  4.962   63.946  1.00 47.01  ? 816  HIS A NE2   1 
ATOM   7157  N  N     . ALA D 4  817  ? -2.874  10.323  64.329  1.00 62.47  ? 817  ALA A N     1 
ATOM   7158  C  CA    . ALA D 4  817  ? -2.050  10.813  63.230  1.00 59.32  ? 817  ALA A CA    1 
ATOM   7159  C  C     . ALA D 4  817  ? -0.619  11.063  63.682  1.00 58.31  ? 817  ALA A C     1 
ATOM   7160  O  O     . ALA D 4  817  ? 0.319   10.896  62.894  1.00 44.25  ? 817  ALA A O     1 
ATOM   7161  C  CB    . ALA D 4  817  ? -2.656  12.088  62.647  1.00 55.39  ? 817  ALA A CB    1 
ATOM   7162  N  N     . MET D 4  818  ? -0.440  11.464  64.942  1.00 64.05  ? 818  MET A N     1 
ATOM   7163  C  CA    . MET D 4  818  ? 0.895   11.555  65.522  1.00 58.36  ? 818  MET A CA    1 
ATOM   7164  C  C     . MET D 4  818  ? 1.566   10.192  65.597  1.00 59.29  ? 818  MET A C     1 
ATOM   7165  O  O     . MET D 4  818  ? 2.770   10.069  65.341  1.00 56.83  ? 818  MET A O     1 
ATOM   7166  C  CB    . MET D 4  818  ? 0.813   12.184  66.911  1.00 44.53  ? 818  MET A CB    1 
ATOM   7167  C  CG    . MET D 4  818  ? 1.990   13.065  67.241  1.00 47.46  ? 818  MET A CG    1 
ATOM   7168  S  SD    . MET D 4  818  ? 1.758   14.183  68.635  1.00 64.14  ? 818  MET A SD    1 
ATOM   7169  C  CE    . MET D 4  818  ? -0.023  14.297  68.693  1.00 45.42  ? 818  MET A CE    1 
ATOM   7170  N  N     . GLY D 4  819  ? 0.804   9.156   65.947  1.00 54.75  ? 819  GLY A N     1 
ATOM   7171  C  CA    . GLY D 4  819  ? 1.393   7.834   66.074  1.00 70.96  ? 819  GLY A CA    1 
ATOM   7172  C  C     . GLY D 4  819  ? 1.747   7.217   64.735  1.00 72.38  ? 819  GLY A C     1 
ATOM   7173  O  O     . GLY D 4  819  ? 2.820   6.628   64.579  1.00 64.69  ? 819  GLY A O     1 
ATOM   7174  N  N     . GLY D 4  820  ? 0.858   7.355   63.749  1.00 71.74  ? 820  GLY A N     1 
ATOM   7175  C  CA    . GLY D 4  820  ? 1.093   6.739   62.455  1.00 66.45  ? 820  GLY A CA    1 
ATOM   7176  C  C     . GLY D 4  820  ? 2.221   7.380   61.676  1.00 67.87  ? 820  GLY A C     1 
ATOM   7177  O  O     . GLY D 4  820  ? 2.863   6.716   60.856  1.00 69.59  ? 820  GLY A O     1 
ATOM   7178  N  N     . ARG D 4  821  ? 2.475   8.671   61.916  1.00 57.35  ? 821  ARG A N     1 
ATOM   7179  C  CA    . ARG D 4  821  ? 3.592   9.351   61.266  1.00 57.86  ? 821  ARG A CA    1 
ATOM   7180  C  C     . ARG D 4  821  ? 4.921   8.728   61.665  1.00 63.88  ? 821  ARG A C     1 
ATOM   7181  O  O     . ARG D 4  821  ? 5.815   8.574   60.825  1.00 52.85  ? 821  ARG A O     1 
ATOM   7182  C  CB    . ARG D 4  821  ? 3.578   10.838  61.617  1.00 61.36  ? 821  ARG A CB    1 
ATOM   7183  C  CG    . ARG D 4  821  ? 4.493   11.699  60.758  1.00 64.39  ? 821  ARG A CG    1 
ATOM   7184  C  CD    . ARG D 4  821  ? 3.850   12.043  59.426  1.00 74.17  ? 821  ARG A CD    1 
ATOM   7185  N  NE    . ARG D 4  821  ? 4.125   13.426  59.046  1.00 73.92  ? 821  ARG A NE    1 
ATOM   7186  C  CZ    . ARG D 4  821  ? 3.269   14.427  59.219  1.00 73.50  ? 821  ARG A CZ    1 
ATOM   7187  N  NH1   . ARG D 4  821  ? 2.082   14.196  59.763  1.00 81.94  ? 821  ARG A NH1   1 
ATOM   7188  N  NH2   . ARG D 4  821  ? 3.596   15.657  58.848  1.00 64.60  ? 821  ARG A NH2   1 
ATOM   7189  N  N     . GLU D 4  822  ? 5.060   8.355   62.942  1.00 71.23  ? 822  GLU A N     1 
ATOM   7190  C  CA    . GLU D 4  822  ? 6.259   7.664   63.409  1.00 74.54  ? 822  GLU A CA    1 
ATOM   7191  C  C     . GLU D 4  822  ? 6.469   6.352   62.666  1.00 75.08  ? 822  GLU A C     1 
ATOM   7192  O  O     . GLU D 4  822  ? 7.605   5.994   62.336  1.00 66.74  ? 822  GLU A O     1 
ATOM   7193  C  CB    . GLU D 4  822  ? 6.162   7.409   64.912  1.00 77.99  ? 822  GLU A CB    1 
ATOM   7194  C  CG    . GLU D 4  822  ? 7.452   7.627   65.680  1.00 76.02  ? 822  GLU A CG    1 
ATOM   7195  C  CD    . GLU D 4  822  ? 7.504   6.802   66.950  1.00 81.71  ? 822  GLU A CD    1 
ATOM   7196  O  OE1   . GLU D 4  822  ? 6.432   6.540   67.531  1.00 80.43  ? 822  GLU A OE1   1 
ATOM   7197  O  OE2   . GLU D 4  822  ? 8.614   6.402   67.358  1.00 91.84  ? 822  GLU A OE2   1 
ATOM   7198  N  N     . GLY D 4  823  ? 5.384   5.630   62.382  1.00 83.86  ? 823  GLY A N     1 
ATOM   7199  C  CA    . GLY D 4  823  ? 5.494   4.425   61.580  1.00 84.99  ? 823  GLY A CA    1 
ATOM   7200  C  C     . GLY D 4  823  ? 5.826   4.704   60.130  1.00 77.31  ? 823  GLY A C     1 
ATOM   7201  O  O     . GLY D 4  823  ? 6.487   3.891   59.478  1.00 94.61  ? 823  GLY A O     1 
ATOM   7202  N  N     . LEU D 4  824  ? 5.380   5.848   59.606  1.00 64.69  ? 824  LEU A N     1 
ATOM   7203  C  CA    . LEU D 4  824  ? 5.731   6.219   58.240  1.00 59.13  ? 824  LEU A CA    1 
ATOM   7204  C  C     . LEU D 4  824  ? 7.193   6.625   58.142  1.00 63.02  ? 824  LEU A C     1 
ATOM   7205  O  O     . LEU D 4  824  ? 7.855   6.348   57.136  1.00 45.53  ? 824  LEU A O     1 
ATOM   7206  C  CB    . LEU D 4  824  ? 4.830   7.354   57.758  1.00 42.93  ? 824  LEU A CB    1 
ATOM   7207  C  CG    . LEU D 4  824  ? 3.344   7.091   57.507  1.00 44.70  ? 824  LEU A CG    1 
ATOM   7208  C  CD1   . LEU D 4  824  ? 2.895   7.963   56.374  1.00 40.22  ? 824  LEU A CD1   1 
ATOM   7209  C  CD2   . LEU D 4  824  ? 3.059   5.636   57.175  1.00 53.35  ? 824  LEU A CD2   1 
ATOM   7210  N  N     . ILE D 4  825  ? 7.709   7.293   59.174  1.00 65.39  ? 825  ILE A N     1 
ATOM   7211  C  CA    . ILE D 4  825  ? 9.125   7.638   59.194  1.00 55.95  ? 825  ILE A CA    1 
ATOM   7212  C  C     . ILE D 4  825  ? 9.966   6.399   59.463  1.00 61.65  ? 825  ILE A C     1 
ATOM   7213  O  O     . ILE D 4  825  ? 11.033  6.221   58.864  1.00 60.40  ? 825  ILE A O     1 
ATOM   7214  C  CB    . ILE D 4  825  ? 9.387   8.745   60.230  1.00 62.19  ? 825  ILE A CB    1 
ATOM   7215  C  CG1   . ILE D 4  825  ? 8.557   9.984   59.906  1.00 63.93  ? 825  ILE A CG1   1 
ATOM   7216  C  CG2   . ILE D 4  825  ? 10.858  9.124   60.259  1.00 62.95  ? 825  ILE A CG2   1 
ATOM   7217  C  CD1   . ILE D 4  825  ? 8.166   10.766  61.130  1.00 68.37  ? 825  ILE A CD1   1 
ATOM   7218  N  N     . ASP D 4  826  ? 9.495   5.517   60.355  1.00 73.08  ? 826  ASP A N     1 
ATOM   7219  C  CA    . ASP D 4  826  ? 10.215  4.277   60.635  1.00 93.34  ? 826  ASP A CA    1 
ATOM   7220  C  C     . ASP D 4  826  ? 10.313  3.402   59.395  1.00 87.12  ? 826  ASP A C     1 
ATOM   7221  O  O     . ASP D 4  826  ? 11.375  2.840   59.114  1.00 89.04  ? 826  ASP A O     1 
ATOM   7222  C  CB    . ASP D 4  826  ? 9.536   3.506   61.767  1.00 108.18 ? 826  ASP A CB    1 
ATOM   7223  C  CG    . ASP D 4  826  ? 10.322  3.555   63.063  1.00 118.94 ? 826  ASP A CG    1 
ATOM   7224  O  OD1   . ASP D 4  826  ? 11.417  4.155   63.080  1.00 122.86 ? 826  ASP A OD1   1 
ATOM   7225  O  OD2   . ASP D 4  826  ? 9.841   2.987   64.067  1.00 123.94 ? 826  ASP A OD2   1 
ATOM   7226  N  N     . THR D 4  827  ? 9.221   3.288   58.636  1.00 84.53  ? 827  THR A N     1 
ATOM   7227  C  CA    . THR D 4  827  ? 9.276   2.590   57.355  1.00 74.54  ? 827  THR A CA    1 
ATOM   7228  C  C     . THR D 4  827  ? 10.244  3.273   56.397  1.00 67.90  ? 827  THR A C     1 
ATOM   7229  O  O     . THR D 4  827  ? 10.971  2.602   55.656  1.00 73.70  ? 827  THR A O     1 
ATOM   7230  C  CB    . THR D 4  827  ? 7.880   2.522   56.734  1.00 66.82  ? 827  THR A CB    1 
ATOM   7231  O  OG1   . THR D 4  827  ? 6.907   2.296   57.762  1.00 77.91  ? 827  THR A OG1   1 
ATOM   7232  C  CG2   . THR D 4  827  ? 7.806   1.409   55.705  1.00 65.64  ? 827  THR A CG2   1 
ATOM   7233  N  N     . ALA D 4  828  ? 10.283  4.606   56.418  1.00 63.36  ? 828  ALA A N     1 
ATOM   7234  C  CA    . ALA D 4  828  ? 11.140  5.355   55.510  1.00 63.18  ? 828  ALA A CA    1 
ATOM   7235  C  C     . ALA D 4  828  ? 12.601  5.357   55.942  1.00 81.49  ? 828  ALA A C     1 
ATOM   7236  O  O     . ALA D 4  828  ? 13.492  5.418   55.087  1.00 80.02  ? 828  ALA A O     1 
ATOM   7237  C  CB    . ALA D 4  828  ? 10.638  6.793   55.394  1.00 47.25  ? 828  ALA A CB    1 
ATOM   7238  N  N     . VAL D 4  829  ? 12.871  5.309   57.243  1.00 91.03  ? 829  VAL A N     1 
ATOM   7239  C  CA    . VAL D 4  829  ? 14.248  5.352   57.732  1.00 102.01 ? 829  VAL A CA    1 
ATOM   7240  C  C     . VAL D 4  829  ? 14.877  3.966   57.753  1.00 111.74 ? 829  VAL A C     1 
ATOM   7241  O  O     . VAL D 4  829  ? 16.034  3.805   57.353  1.00 114.67 ? 829  VAL A O     1 
ATOM   7242  C  CB    . VAL D 4  829  ? 14.283  6.022   59.124  1.00 100.25 ? 829  VAL A CB    1 
ATOM   7243  C  CG1   . VAL D 4  829  ? 15.612  5.777   59.828  1.00 99.76  ? 829  VAL A CG1   1 
ATOM   7244  C  CG2   . VAL D 4  829  ? 14.038  7.516   58.992  1.00 105.65 ? 829  VAL A CG2   1 
ATOM   7245  N  N     . LYS D 4  830  ? 14.120  2.952   58.190  1.00 116.90 ? 830  LYS A N     1 
ATOM   7246  C  CA    . LYS D 4  830  ? 14.653  1.594   58.276  1.00 121.10 ? 830  LYS A CA    1 
ATOM   7247  C  C     . LYS D 4  830  ? 15.016  1.044   56.906  1.00 104.47 ? 830  LYS A C     1 
ATOM   7248  O  O     . LYS D 4  830  ? 15.937  0.232   56.791  1.00 101.43 ? 830  LYS A O     1 
ATOM   7249  C  CB    . LYS D 4  830  ? 13.638  0.663   58.940  1.00 135.71 ? 830  LYS A CB    1 
ATOM   7250  C  CG    . LYS D 4  830  ? 13.547  0.780   60.455  1.00 144.28 ? 830  LYS A CG    1 
ATOM   7251  C  CD    . LYS D 4  830  ? 12.553  -0.228  61.021  1.00 142.45 ? 830  LYS A CD    1 
ATOM   7252  C  CE    . LYS D 4  830  ? 12.970  -0.717  62.398  1.00 134.08 ? 830  LYS A CE    1 
ATOM   7253  N  NZ    . LYS D 4  830  ? 13.741  0.322   63.133  1.00 125.83 ? 830  LYS A NZ    1 
ATOM   7254  N  N     . THR D 4  831  ? 14.312  1.485   55.860  1.00 97.27  ? 831  THR A N     1 
ATOM   7255  C  CA    . THR D 4  831  ? 14.536  0.946   54.525  1.00 84.21  ? 831  THR A CA    1 
ATOM   7256  C  C     . THR D 4  831  ? 15.910  1.325   53.989  1.00 76.94  ? 831  THR A C     1 
ATOM   7257  O  O     . THR D 4  831  ? 16.581  0.503   53.355  1.00 76.50  ? 831  THR A O     1 
ATOM   7258  C  CB    . THR D 4  831  ? 13.444  1.436   53.579  1.00 83.87  ? 831  THR A CB    1 
ATOM   7259  O  OG1   . THR D 4  831  ? 12.174  1.345   54.232  1.00 96.11  ? 831  THR A OG1   1 
ATOM   7260  C  CG2   . THR D 4  831  ? 13.414  0.578   52.339  1.00 78.63  ? 831  THR A CG2   1 
ATOM   7261  N  N     . ALA D 4  832  ? 16.349  2.561   54.233  1.00 74.41  ? 832  ALA A N     1 
ATOM   7262  C  CA    . ALA D 4  832  ? 17.670  2.975   53.780  1.00 82.59  ? 832  ALA A CA    1 
ATOM   7263  C  C     . ALA D 4  832  ? 18.776  2.448   54.683  1.00 92.26  ? 832  ALA A C     1 
ATOM   7264  O  O     . ALA D 4  832  ? 19.903  2.247   54.217  1.00 99.76  ? 832  ALA A O     1 
ATOM   7265  C  CB    . ALA D 4  832  ? 17.745  4.499   53.695  1.00 97.10  ? 832  ALA A CB    1 
ATOM   7266  N  N     . GLU D 4  833  ? 18.483  2.237   55.968  1.00 80.76  ? 833  GLU A N     1 
ATOM   7267  C  CA    . GLU D 4  833  ? 19.462  1.622   56.857  1.00 79.97  ? 833  GLU A CA    1 
ATOM   7268  C  C     . GLU D 4  833  ? 19.659  0.152   56.526  1.00 64.78  ? 833  GLU A C     1 
ATOM   7269  O  O     . GLU D 4  833  ? 20.795  -0.333  56.481  1.00 52.09  ? 833  GLU A O     1 
ATOM   7270  C  CB    . GLU D 4  833  ? 19.025  1.780   58.313  1.00 88.80  ? 833  GLU A CB    1 
ATOM   7271  C  CG    . GLU D 4  833  ? 19.088  3.196   58.851  1.00 91.48  ? 833  GLU A CG    1 
ATOM   7272  C  CD    . GLU D 4  833  ? 20.055  3.326   60.011  1.00 93.05  ? 833  GLU A CD    1 
ATOM   7273  O  OE1   . GLU D 4  833  ? 19.674  2.958   61.142  1.00 94.76  ? 833  GLU A OE1   1 
ATOM   7274  O  OE2   . GLU D 4  833  ? 21.195  3.788   59.794  1.00 92.41  ? 833  GLU A OE2   1 
ATOM   7275  N  N     . THR D 4  834  ? 18.564  -0.570  56.283  1.00 71.08  ? 834  THR A N     1 
ATOM   7276  C  CA    . THR D 4  834  ? 18.664  -2.008  56.074  1.00 69.10  ? 834  THR A CA    1 
ATOM   7277  C  C     . THR D 4  834  ? 19.271  -2.341  54.719  1.00 67.65  ? 834  THR A C     1 
ATOM   7278  O  O     . THR D 4  834  ? 19.864  -3.412  54.555  1.00 76.98  ? 834  THR A O     1 
ATOM   7279  C  CB    . THR D 4  834  ? 17.289  -2.653  56.208  1.00 60.83  ? 834  THR A CB    1 
ATOM   7280  O  OG1   . THR D 4  834  ? 16.545  -1.976  57.229  1.00 54.32  ? 834  THR A OG1   1 
ATOM   7281  C  CG2   . THR D 4  834  ? 17.448  -4.083  56.617  1.00 59.10  ? 834  THR A CG2   1 
ATOM   7282  N  N     . GLY D 4  835  ? 19.131  -1.447  53.739  1.00 51.44  ? 835  GLY A N     1 
ATOM   7283  C  CA    . GLY D 4  835  ? 19.786  -1.659  52.463  1.00 59.13  ? 835  GLY A CA    1 
ATOM   7284  C  C     . GLY D 4  835  ? 21.287  -1.485  52.536  1.00 55.96  ? 835  GLY A C     1 
ATOM   7285  O  O     . GLY D 4  835  ? 22.027  -2.137  51.795  1.00 71.65  ? 835  GLY A O     1 
ATOM   7286  N  N     . TYR D 4  836  ? 21.761  -0.611  53.426  1.00 51.91  ? 836  TYR A N     1 
ATOM   7287  C  CA    . TYR D 4  836  ? 23.197  -0.460  53.611  1.00 66.32  ? 836  TYR A CA    1 
ATOM   7288  C  C     . TYR D 4  836  ? 23.768  -1.603  54.441  1.00 97.72  ? 836  TYR A C     1 
ATOM   7289  O  O     . TYR D 4  836  ? 24.925  -1.990  54.241  1.00 120.64 ? 836  TYR A O     1 
ATOM   7290  C  CB    . TYR D 4  836  ? 23.497  0.884   54.278  1.00 63.82  ? 836  TYR A CB    1 
ATOM   7291  C  CG    . TYR D 4  836  ? 24.955  1.300   54.252  1.00 58.31  ? 836  TYR A CG    1 
ATOM   7292  C  CD1   . TYR D 4  836  ? 25.826  0.814   53.285  1.00 60.95  ? 836  TYR A CD1   1 
ATOM   7293  C  CD2   . TYR D 4  836  ? 25.462  2.172   55.207  1.00 47.64  ? 836  TYR A CD2   1 
ATOM   7294  C  CE1   . TYR D 4  836  ? 27.154  1.187   53.263  1.00 59.64  ? 836  TYR A CE1   1 
ATOM   7295  C  CE2   . TYR D 4  836  ? 26.788  2.549   55.193  1.00 50.32  ? 836  TYR A CE2   1 
ATOM   7296  C  CZ    . TYR D 4  836  ? 27.628  2.054   54.220  1.00 56.54  ? 836  TYR A CZ    1 
ATOM   7297  O  OH    . TYR D 4  836  ? 28.948  2.428   54.201  1.00 68.21  ? 836  TYR A OH    1 
ATOM   7298  N  N     . ILE D 4  837  ? 22.975  -2.150  55.367  1.00 89.78  ? 837  ILE A N     1 
ATOM   7299  C  CA    . ILE D 4  837  ? 23.410  -3.309  56.146  1.00 74.78  ? 837  ILE A CA    1 
ATOM   7300  C  C     . ILE D 4  837  ? 23.623  -4.509  55.234  1.00 69.07  ? 837  ILE A C     1 
ATOM   7301  O  O     . ILE D 4  837  ? 24.675  -5.158  55.268  1.00 57.51  ? 837  ILE A O     1 
ATOM   7302  C  CB    . ILE D 4  837  ? 22.391  -3.627  57.257  1.00 53.08  ? 837  ILE A CB    1 
ATOM   7303  C  CG1   . ILE D 4  837  ? 22.542  -2.661  58.432  1.00 55.09  ? 837  ILE A CG1   1 
ATOM   7304  C  CG2   . ILE D 4  837  ? 22.530  -5.066  57.737  1.00 48.08  ? 837  ILE A CG2   1 
ATOM   7305  C  CD1   . ILE D 4  837  ? 21.587  -2.951  59.568  1.00 62.87  ? 837  ILE A CD1   1 
ATOM   7306  N  N     . GLN D 4  838  ? 22.625  -4.815  54.397  1.00 56.93  ? 838  GLN A N     1 
ATOM   7307  C  CA    . GLN D 4  838  ? 22.689  -6.008  53.563  1.00 59.43  ? 838  GLN A CA    1 
ATOM   7308  C  C     . GLN D 4  838  ? 23.781  -5.912  52.510  1.00 64.29  ? 838  GLN A C     1 
ATOM   7309  O  O     . GLN D 4  838  ? 24.388  -6.929  52.160  1.00 67.69  ? 838  GLN A O     1 
ATOM   7310  C  CB    . GLN D 4  838  ? 21.344  -6.258  52.888  1.00 52.86  ? 838  GLN A CB    1 
ATOM   7311  C  CG    . GLN D 4  838  ? 21.226  -7.650  52.304  1.00 63.96  ? 838  GLN A CG    1 
ATOM   7312  C  CD    . GLN D 4  838  ? 20.637  -7.657  50.916  1.00 75.08  ? 838  GLN A CD    1 
ATOM   7313  O  OE1   . GLN D 4  838  ? 19.424  -7.592  50.752  1.00 95.51  ? 838  GLN A OE1   1 
ATOM   7314  N  NE2   . GLN D 4  838  ? 21.495  -7.737  49.904  1.00 73.38  ? 838  GLN A NE2   1 
ATOM   7315  N  N     . ARG D 4  839  ? 24.054  -4.710  52.005  1.00 70.74  ? 839  ARG A N     1 
ATOM   7316  C  CA    . ARG D 4  839  ? 25.126  -4.564  51.031  1.00 65.00  ? 839  ARG A CA    1 
ATOM   7317  C  C     . ARG D 4  839  ? 26.485  -4.812  51.669  1.00 66.24  ? 839  ARG A C     1 
ATOM   7318  O  O     . ARG D 4  839  ? 27.347  -5.470  51.074  1.00 55.32  ? 839  ARG A O     1 
ATOM   7319  C  CB    . ARG D 4  839  ? 25.096  -3.176  50.411  1.00 60.53  ? 839  ARG A CB    1 
ATOM   7320  C  CG    . ARG D 4  839  ? 26.143  -3.055  49.359  1.00 64.27  ? 839  ARG A CG    1 
ATOM   7321  C  CD    . ARG D 4  839  ? 26.471  -1.638  49.003  1.00 59.78  ? 839  ARG A CD    1 
ATOM   7322  N  NE    . ARG D 4  839  ? 27.878  -1.496  48.621  1.00 71.57  ? 839  ARG A NE    1 
ATOM   7323  C  CZ    . ARG D 4  839  ? 28.443  -2.027  47.535  1.00 83.95  ? 839  ARG A CZ    1 
ATOM   7324  N  NH1   . ARG D 4  839  ? 27.739  -2.716  46.643  1.00 85.50  ? 839  ARG A NH1   1 
ATOM   7325  N  NH2   . ARG D 4  839  ? 29.722  -1.819  47.307  1.00 91.21  ? 839  ARG A NH2   1 
ATOM   7326  N  N     . ARG D 4  840  ? 26.688  -4.290  52.882  1.00 77.93  ? 840  ARG A N     1 
ATOM   7327  C  CA    . ARG D 4  840  ? 27.922  -4.544  53.616  1.00 64.40  ? 840  ARG A CA    1 
ATOM   7328  C  C     . ARG D 4  840  ? 28.070  -6.021  53.946  1.00 70.00  ? 840  ARG A C     1 
ATOM   7329  O  O     . ARG D 4  840  ? 29.191  -6.536  54.001  1.00 79.02  ? 840  ARG A O     1 
ATOM   7330  C  CB    . ARG D 4  840  ? 27.934  -3.730  54.907  1.00 50.21  ? 840  ARG A CB    1 
ATOM   7331  C  CG    . ARG D 4  840  ? 28.223  -2.252  54.741  1.00 56.73  ? 840  ARG A CG    1 
ATOM   7332  C  CD    . ARG D 4  840  ? 28.503  -1.646  56.095  1.00 77.14  ? 840  ARG A CD    1 
ATOM   7333  N  NE    . ARG D 4  840  ? 27.489  -2.058  57.057  1.00 79.25  ? 840  ARG A NE    1 
ATOM   7334  C  CZ    . ARG D 4  840  ? 26.645  -1.231  57.660  1.00 83.55  ? 840  ARG A CZ    1 
ATOM   7335  N  NH1   . ARG D 4  840  ? 26.690  0.066   57.404  1.00 102.83 ? 840  ARG A NH1   1 
ATOM   7336  N  NH2   . ARG D 4  840  ? 25.756  -1.704  58.519  1.00 69.04  ? 840  ARG A NH2   1 
ATOM   7337  N  N     . LEU D 4  841  ? 26.950  -6.708  54.171  1.00 58.74  ? 841  LEU A N     1 
ATOM   7338  C  CA    . LEU D 4  841  ? 26.987  -8.141  54.429  1.00 50.11  ? 841  LEU A CA    1 
ATOM   7339  C  C     . LEU D 4  841  ? 27.427  -8.909  53.191  1.00 64.70  ? 841  LEU A C     1 
ATOM   7340  O  O     . LEU D 4  841  ? 28.307  -9.775  53.267  1.00 66.68  ? 841  LEU A O     1 
ATOM   7341  C  CB    . LEU D 4  841  ? 25.613  -8.616  54.898  1.00 49.93  ? 841  LEU A CB    1 
ATOM   7342  C  CG    . LEU D 4  841  ? 25.213  -8.377  56.350  1.00 50.09  ? 841  LEU A CG    1 
ATOM   7343  C  CD1   . LEU D 4  841  ? 23.708  -8.457  56.498  1.00 49.64  ? 841  LEU A CD1   1 
ATOM   7344  C  CD2   . LEU D 4  841  ? 25.882  -9.404  57.233  1.00 65.28  ? 841  LEU A CD2   1 
ATOM   7345  N  N     . VAL D 4  842  ? 26.821  -8.606  52.039  1.00 63.80  ? 842  VAL A N     1 
ATOM   7346  C  CA    . VAL D 4  842  ? 27.136  -9.342  50.818  1.00 51.35  ? 842  VAL A CA    1 
ATOM   7347  C  C     . VAL D 4  842  ? 28.555  -9.036  50.362  1.00 54.59  ? 842  VAL A C     1 
ATOM   7348  O  O     . VAL D 4  842  ? 29.294  -9.934  49.945  1.00 66.43  ? 842  VAL A O     1 
ATOM   7349  C  CB    . VAL D 4  842  ? 26.110  -9.028  49.715  1.00 49.15  ? 842  VAL A CB    1 
ATOM   7350  C  CG1   . VAL D 4  842  ? 26.485  -9.752  48.443  1.00 49.47  ? 842  VAL A CG1   1 
ATOM   7351  C  CG2   . VAL D 4  842  ? 24.718  -9.433  50.142  1.00 48.90  ? 842  VAL A CG2   1 
ATOM   7352  N  N     . LYS D 4  843  ? 28.975  -7.776  50.471  1.00 53.81  ? 843  LYS A N     1 
ATOM   7353  C  CA    . LYS D 4  843  ? 30.314  -7.409  50.030  1.00 57.97  ? 843  LYS A CA    1 
ATOM   7354  C  C     . LYS D 4  843  ? 31.411  -7.921  50.954  1.00 55.88  ? 843  LYS A C     1 
ATOM   7355  O  O     . LYS D 4  843  ? 32.584  -7.870  50.570  1.00 61.33  ? 843  LYS A O     1 
ATOM   7356  C  CB    . LYS D 4  843  ? 30.426  -5.895  49.887  1.00 55.16  ? 843  LYS A CB    1 
ATOM   7357  C  CG    . LYS D 4  843  ? 29.997  -5.400  48.528  1.00 48.98  ? 843  LYS A CG    1 
ATOM   7358  C  CD    . LYS D 4  843  ? 31.189  -5.385  47.597  1.00 58.55  ? 843  LYS A CD    1 
ATOM   7359  C  CE    . LYS D 4  843  ? 30.853  -6.021  46.264  1.00 70.45  ? 843  LYS A CE    1 
ATOM   7360  N  NZ    . LYS D 4  843  ? 32.066  -6.633  45.661  1.00 91.76  ? 843  LYS A NZ    1 
ATOM   7361  N  N     . ALA D 4  844  ? 31.071  -8.407  52.148  1.00 61.59  ? 844  ALA A N     1 
ATOM   7362  C  CA    . ALA D 4  844  ? 32.065  -8.993  53.037  1.00 64.34  ? 844  ALA A CA    1 
ATOM   7363  C  C     . ALA D 4  844  ? 32.230  -10.489 52.812  1.00 58.28  ? 844  ALA A C     1 
ATOM   7364  O  O     . ALA D 4  844  ? 33.348  -11.008 52.900  1.00 67.23  ? 844  ALA A O     1 
ATOM   7365  C  CB    . ALA D 4  844  ? 31.687  -8.731  54.497  1.00 63.50  ? 844  ALA A CB    1 
ATOM   7366  N  N     . LEU D 4  845  ? 31.141  -11.193 52.511  1.00 59.93  ? 845  LEU A N     1 
ATOM   7367  C  CA    . LEU D 4  845  ? 31.140  -12.647 52.437  1.00 60.05  ? 845  LEU A CA    1 
ATOM   7368  C  C     . LEU D 4  845  ? 30.956  -13.157 51.011  1.00 71.38  ? 845  LEU A C     1 
ATOM   7369  O  O     . LEU D 4  845  ? 30.366  -14.216 50.807  1.00 72.06  ? 845  LEU A O     1 
ATOM   7370  C  CB    . LEU D 4  845  ? 30.036  -13.219 53.326  1.00 59.87  ? 845  LEU A CB    1 
ATOM   7371  C  CG    . LEU D 4  845  ? 29.728  -12.557 54.668  1.00 59.79  ? 845  LEU A CG    1 
ATOM   7372  C  CD1   . LEU D 4  845  ? 28.366  -13.004 55.174  1.00 59.65  ? 845  LEU A CD1   1 
ATOM   7373  C  CD2   . LEU D 4  845  ? 30.799  -12.889 55.675  1.00 81.27  ? 845  LEU A CD2   1 
ATOM   7374  N  N     . GLU D 4  846  ? 31.448  -12.434 50.008  1.00 70.61  ? 846  GLU A N     1 
ATOM   7375  C  CA    . GLU D 4  846  ? 31.015  -12.763 48.655  1.00 68.97  ? 846  GLU A CA    1 
ATOM   7376  C  C     . GLU D 4  846  ? 31.790  -13.911 48.015  1.00 79.37  ? 846  GLU A C     1 
ATOM   7377  O  O     . GLU D 4  846  ? 31.265  -14.543 47.093  1.00 92.33  ? 846  GLU A O     1 
ATOM   7378  C  CB    . GLU D 4  846  ? 31.056  -11.525 47.756  1.00 66.70  ? 846  GLU A CB    1 
ATOM   7379  C  CG    . GLU D 4  846  ? 32.419  -11.045 47.354  1.00 88.35  ? 846  GLU A CG    1 
ATOM   7380  C  CD    . GLU D 4  846  ? 32.354  -9.815  46.481  1.00 93.48  ? 846  GLU A CD    1 
ATOM   7381  O  OE1   . GLU D 4  846  ? 31.235  -9.316  46.248  1.00 94.02  ? 846  GLU A OE1   1 
ATOM   7382  O  OE2   . GLU D 4  846  ? 33.418  -9.346  46.027  1.00 95.31  ? 846  GLU A OE2   1 
ATOM   7383  N  N     . ASP D 4  847  ? 33.002  -14.220 48.478  1.00 79.29  ? 847  ASP A N     1 
ATOM   7384  C  CA    . ASP D 4  847  ? 33.736  -15.367 47.954  1.00 80.88  ? 847  ASP A CA    1 
ATOM   7385  C  C     . ASP D 4  847  ? 33.585  -16.612 48.800  1.00 82.22  ? 847  ASP A C     1 
ATOM   7386  O  O     . ASP D 4  847  ? 34.351  -17.566 48.626  1.00 85.36  ? 847  ASP A O     1 
ATOM   7387  C  CB    . ASP D 4  847  ? 35.220  -15.064 47.807  1.00 95.28  ? 847  ASP A CB    1 
ATOM   7388  C  CG    . ASP D 4  847  ? 35.477  -13.931 46.893  1.00 118.30 ? 847  ASP A CG    1 
ATOM   7389  O  OD1   . ASP D 4  847  ? 35.030  -12.804 47.162  1.00 131.91 ? 847  ASP A OD1   1 
ATOM   7390  O  OD2   . ASP D 4  847  ? 36.055  -14.209 45.839  1.00 127.38 ? 847  ASP A OD2   1 
ATOM   7391  N  N     . ILE D 4  848  ? 32.631  -16.627 49.721  1.00 76.97  ? 848  ILE A N     1 
ATOM   7392  C  CA    . ILE D 4  848  ? 32.523  -17.743 50.646  1.00 71.57  ? 848  ILE A CA    1 
ATOM   7393  C  C     . ILE D 4  848  ? 31.832  -18.882 49.906  1.00 67.75  ? 848  ILE A C     1 
ATOM   7394  O  O     . ILE D 4  848  ? 30.630  -18.826 49.630  1.00 76.50  ? 848  ILE A O     1 
ATOM   7395  C  CB    . ILE D 4  848  ? 31.757  -17.353 51.909  1.00 90.06  ? 848  ILE A CB    1 
ATOM   7396  C  CG1   . ILE D 4  848  ? 32.561  -16.386 52.789  1.00 87.39  ? 848  ILE A CG1   1 
ATOM   7397  C  CG2   . ILE D 4  848  ? 31.432  -18.588 52.686  1.00 100.85 ? 848  ILE A CG2   1 
ATOM   7398  C  CD1   . ILE D 4  848  ? 34.054  -16.612 52.820  1.00 80.56  ? 848  ILE A CD1   1 
ATOM   7399  N  N     . MET D 4  849  ? 32.599  -19.911 49.566  1.00 62.18  ? 849  MET A N     1 
ATOM   7400  C  CA    . MET D 4  849  ? 32.106  -21.033 48.784  1.00 71.35  ? 849  MET A CA    1 
ATOM   7401  C  C     . MET D 4  849  ? 32.621  -22.320 49.400  1.00 74.95  ? 849  MET A C     1 
ATOM   7402  O  O     . MET D 4  849  ? 33.804  -22.415 49.742  1.00 73.79  ? 849  MET A O     1 
ATOM   7403  C  CB    . MET D 4  849  ? 32.559  -20.931 47.324  1.00 78.35  ? 849  MET A CB    1 
ATOM   7404  C  CG    . MET D 4  849  ? 32.466  -22.232 46.533  1.00 81.14  ? 849  MET A CG    1 
ATOM   7405  S  SD    . MET D 4  849  ? 33.154  -22.129 44.869  1.00 88.65  ? 849  MET A SD    1 
ATOM   7406  C  CE    . MET D 4  849  ? 34.389  -20.850 45.081  1.00 86.22  ? 849  MET A CE    1 
ATOM   7407  N  N     . VAL D 4  850  ? 31.726  -23.295 49.558  1.00 69.35  ? 850  VAL A N     1 
ATOM   7408  C  CA    . VAL D 4  850  ? 32.141  -24.631 49.955  1.00 63.68  ? 850  VAL A CA    1 
ATOM   7409  C  C     . VAL D 4  850  ? 33.043  -25.198 48.871  1.00 64.45  ? 850  VAL A C     1 
ATOM   7410  O  O     . VAL D 4  850  ? 32.610  -25.417 47.732  1.00 77.41  ? 850  VAL A O     1 
ATOM   7411  C  CB    . VAL D 4  850  ? 30.923  -25.526 50.194  1.00 63.67  ? 850  VAL A CB    1 
ATOM   7412  C  CG1   . VAL D 4  850  ? 31.374  -26.922 50.559  1.00 64.35  ? 850  VAL A CG1   1 
ATOM   7413  C  CG2   . VAL D 4  850  ? 30.029  -24.938 51.279  1.00 63.01  ? 850  VAL A CG2   1 
ATOM   7414  N  N     . HIS D 4  851  ? 34.310  -25.421 49.209  1.00 64.95  ? 851  HIS A N     1 
ATOM   7415  C  CA    . HIS D 4  851  ? 35.234  -25.978 48.239  1.00 65.83  ? 851  HIS A CA    1 
ATOM   7416  C  C     . HIS D 4  851  ? 35.028  -27.488 48.133  1.00 68.28  ? 851  HIS A C     1 
ATOM   7417  O  O     . HIS D 4  851  ? 34.143  -28.070 48.765  1.00 66.27  ? 851  HIS A O     1 
ATOM   7418  C  CB    . HIS D 4  851  ? 36.672  -25.640 48.617  1.00 66.26  ? 851  HIS A CB    1 
ATOM   7419  C  CG    . HIS D 4  851  ? 37.131  -24.310 48.108  1.00 73.75  ? 851  HIS A CG    1 
ATOM   7420  N  ND1   . HIS D 4  851  ? 38.364  -24.120 47.526  1.00 81.24  ? 851  HIS A ND1   1 
ATOM   7421  C  CD2   . HIS D 4  851  ? 36.525  -23.099 48.106  1.00 66.62  ? 851  HIS A CD2   1 
ATOM   7422  C  CE1   . HIS D 4  851  ? 38.496  -22.852 47.181  1.00 76.49  ? 851  HIS A CE1   1 
ATOM   7423  N  NE2   . HIS D 4  851  ? 37.394  -22.210 47.524  1.00 74.47  ? 851  HIS A NE2   1 
ATOM   7424  N  N     . TYR D 4  852  ? 35.863  -28.139 47.327  1.00 67.47  ? 852  TYR A N     1 
ATOM   7425  C  CA    . TYR D 4  852  ? 35.639  -29.547 47.033  1.00 72.44  ? 852  TYR A CA    1 
ATOM   7426  C  C     . TYR D 4  852  ? 36.082  -30.472 48.160  1.00 76.85  ? 852  TYR A C     1 
ATOM   7427  O  O     . TYR D 4  852  ? 35.716  -31.652 48.151  1.00 96.94  ? 852  TYR A O     1 
ATOM   7428  C  CB    . TYR D 4  852  ? 36.337  -29.911 45.724  1.00 96.39  ? 852  TYR A CB    1 
ATOM   7429  C  CG    . TYR D 4  852  ? 35.384  -29.850 44.555  1.00 99.47  ? 852  TYR A CG    1 
ATOM   7430  C  CD1   . TYR D 4  852  ? 35.518  -28.875 43.576  1.00 99.78  ? 852  TYR A CD1   1 
ATOM   7431  C  CD2   . TYR D 4  852  ? 34.340  -30.756 44.441  1.00 99.60  ? 852  TYR A CD2   1 
ATOM   7432  C  CE1   . TYR D 4  852  ? 34.639  -28.804 42.515  1.00 109.09 ? 852  TYR A CE1   1 
ATOM   7433  C  CE2   . TYR D 4  852  ? 33.450  -30.690 43.389  1.00 103.46 ? 852  TYR A CE2   1 
ATOM   7434  C  CZ    . TYR D 4  852  ? 33.607  -29.717 42.426  1.00 110.57 ? 852  TYR A CZ    1 
ATOM   7435  O  OH    . TYR D 4  852  ? 32.727  -29.661 41.372  1.00 110.64 ? 852  TYR A OH    1 
ATOM   7436  N  N     . ASP D 4  853  ? 36.845  -29.966 49.130  1.00 78.31  ? 853  ASP A N     1 
ATOM   7437  C  CA    . ASP D 4  853  ? 37.145  -30.680 50.363  1.00 75.29  ? 853  ASP A CA    1 
ATOM   7438  C  C     . ASP D 4  853  ? 36.158  -30.369 51.486  1.00 67.75  ? 853  ASP A C     1 
ATOM   7439  O  O     . ASP D 4  853  ? 36.464  -30.627 52.657  1.00 67.81  ? 853  ASP A O     1 
ATOM   7440  C  CB    . ASP D 4  853  ? 38.588  -30.394 50.797  1.00 87.70  ? 853  ASP A CB    1 
ATOM   7441  C  CG    . ASP D 4  853  ? 38.901  -28.901 50.923  1.00 84.83  ? 853  ASP A CG    1 
ATOM   7442  O  OD1   . ASP D 4  853  ? 38.008  -28.084 51.224  1.00 73.63  ? 853  ASP A OD1   1 
ATOM   7443  O  OD2   . ASP D 4  853  ? 40.080  -28.543 50.735  1.00 88.49  ? 853  ASP A OD2   1 
ATOM   7444  N  N     . ASN D 4  854  ? 35.002  -29.793 51.149  1.00 66.97  ? 854  ASN A N     1 
ATOM   7445  C  CA    . ASN D 4  854  ? 33.914  -29.421 52.054  1.00 66.14  ? 854  ASN A CA    1 
ATOM   7446  C  C     . ASN D 4  854  ? 34.313  -28.369 53.087  1.00 65.60  ? 854  ASN A C     1 
ATOM   7447  O  O     . ASN D 4  854  ? 33.529  -28.083 53.999  1.00 65.03  ? 854  ASN A O     1 
ATOM   7448  C  CB    . ASN D 4  854  ? 33.320  -30.646 52.768  1.00 66.43  ? 854  ASN A CB    1 
ATOM   7449  C  CG    . ASN D 4  854  ? 31.819  -30.733 52.623  1.00 74.44  ? 854  ASN A CG    1 
ATOM   7450  O  OD1   . ASN D 4  854  ? 31.280  -30.619 51.522  1.00 91.12  ? 854  ASN A OD1   1 
ATOM   7451  N  ND2   . ASN D 4  854  ? 31.132  -30.929 53.739  1.00 87.84  ? 854  ASN A ND2   1 
ATOM   7452  N  N     . THR D 4  855  ? 35.491  -27.761 52.967  1.00 65.83  ? 855  THR A N     1 
ATOM   7453  C  CA    . THR D 4  855  ? 35.945  -26.746 53.911  1.00 69.03  ? 855  THR A CA    1 
ATOM   7454  C  C     . THR D 4  855  ? 35.595  -25.372 53.355  1.00 64.77  ? 855  THR A C     1 
ATOM   7455  O  O     . THR D 4  855  ? 36.115  -24.961 52.312  1.00 71.16  ? 855  THR A O     1 
ATOM   7456  C  CB    . THR D 4  855  ? 37.444  -26.860 54.178  1.00 80.32  ? 855  THR A CB    1 
ATOM   7457  O  OG1   . THR D 4  855  ? 38.167  -26.546 52.982  1.00 78.53  ? 855  THR A OG1   1 
ATOM   7458  C  CG2   . THR D 4  855  ? 37.798  -28.267 54.615  1.00 91.74  ? 855  THR A CG2   1 
ATOM   7459  N  N     . THR D 4  856  ? 34.716  -24.667 54.061  1.00 64.04  ? 856  THR A N     1 
ATOM   7460  C  CA    . THR D 4  856  ? 34.296  -23.315 53.714  1.00 63.40  ? 856  THR A CA    1 
ATOM   7461  C  C     . THR D 4  856  ? 35.463  -22.333 53.725  1.00 63.55  ? 856  THR A C     1 
ATOM   7462  O  O     . THR D 4  856  ? 36.028  -22.044 54.785  1.00 68.63  ? 856  THR A O     1 
ATOM   7463  C  CB    . THR D 4  856  ? 33.206  -22.869 54.687  1.00 62.78  ? 856  THR A CB    1 
ATOM   7464  O  OG1   . THR D 4  856  ? 32.127  -23.816 54.672  1.00 66.86  ? 856  THR A OG1   1 
ATOM   7465  C  CG2   . THR D 4  856  ? 32.686  -21.521 54.324  1.00 62.20  ? 856  THR A CG2   1 
ATOM   7466  N  N     . ARG D 4  857  ? 35.825  -21.810 52.556  1.00 63.64  ? 857  ARG A N     1 
ATOM   7467  C  CA    . ARG D 4  857  ? 37.004  -20.964 52.416  1.00 66.69  ? 857  ARG A CA    1 
ATOM   7468  C  C     . ARG D 4  857  ? 36.600  -19.691 51.673  1.00 76.03  ? 857  ARG A C     1 
ATOM   7469  O  O     . ARG D 4  857  ? 35.430  -19.290 51.646  1.00 91.70  ? 857  ARG A O     1 
ATOM   7470  C  CB    . ARG D 4  857  ? 38.116  -21.710 51.680  1.00 78.09  ? 857  ARG A CB    1 
ATOM   7471  C  CG    . ARG D 4  857  ? 38.734  -22.857 52.445  1.00 79.25  ? 857  ARG A CG    1 
ATOM   7472  C  CD    . ARG D 4  857  ? 39.193  -23.879 51.431  1.00 85.61  ? 857  ARG A CD    1 
ATOM   7473  N  NE    . ARG D 4  857  ? 39.975  -24.965 52.003  1.00 81.92  ? 857  ARG A NE    1 
ATOM   7474  C  CZ    . ARG D 4  857  ? 41.291  -24.939 52.155  1.00 71.73  ? 857  ARG A CZ    1 
ATOM   7475  N  NH1   . ARG D 4  857  ? 41.983  -23.867 51.801  1.00 68.08  ? 857  ARG A NH1   1 
ATOM   7476  N  NH2   . ARG D 4  857  ? 41.908  -25.990 52.672  1.00 71.48  ? 857  ARG A NH2   1 
ATOM   7477  N  N     . ASN D 4  858  ? 37.570  -19.047 51.033  1.00 80.90  ? 858  ASN A N     1 
ATOM   7478  C  CA    . ASN D 4  858  ? 37.315  -17.792 50.332  1.00 81.19  ? 858  ASN A CA    1 
ATOM   7479  C  C     . ASN D 4  858  ? 38.198  -17.715 49.088  1.00 97.16  ? 858  ASN A C     1 
ATOM   7480  O  O     . ASN D 4  858  ? 38.680  -18.727 48.567  1.00 104.95 ? 858  ASN A O     1 
ATOM   7481  C  CB    . ASN D 4  858  ? 37.469  -16.601 51.305  1.00 63.11  ? 858  ASN A CB    1 
ATOM   7482  C  CG    . ASN D 4  858  ? 38.913  -16.368 51.791  1.00 70.79  ? 858  ASN A CG    1 
ATOM   7483  O  OD1   . ASN D 4  858  ? 39.887  -16.926 51.285  1.00 86.57  ? 858  ASN A OD1   1 
ATOM   7484  N  ND2   . ASN D 4  858  ? 39.039  -15.495 52.782  1.00 69.99  ? 858  ASN A ND2   1 
ATOM   7485  N  N     . SER D 4  859  ? 38.418  -16.485 48.613  1.00 100.64 ? 859  SER A N     1 
ATOM   7486  C  CA    . SER D 4  859  ? 39.245  -16.258 47.433  1.00 107.29 ? 859  SER A CA    1 
ATOM   7487  C  C     . SER D 4  859  ? 40.723  -16.469 47.729  1.00 110.37 ? 859  SER A C     1 
ATOM   7488  O  O     . SER D 4  859  ? 41.472  -16.906 46.849  1.00 114.34 ? 859  SER A O     1 
ATOM   7489  C  CB    . SER D 4  859  ? 39.029  -14.839 46.911  1.00 99.29  ? 859  SER A CB    1 
ATOM   7490  O  OG    . SER D 4  859  ? 38.903  -13.917 47.983  1.00 79.91  ? 859  SER A OG    1 
ATOM   7491  N  N     . LEU D 4  860  ? 41.163  -16.147 48.944  1.00 100.07 ? 860  LEU A N     1 
ATOM   7492  C  CA    . LEU D 4  860  ? 42.558  -16.331 49.314  1.00 93.61  ? 860  LEU A CA    1 
ATOM   7493  C  C     . LEU D 4  860  ? 42.878  -17.774 49.668  1.00 93.80  ? 860  LEU A C     1 
ATOM   7494  O  O     . LEU D 4  860  ? 44.045  -18.175 49.596  1.00 93.23  ? 860  LEU A O     1 
ATOM   7495  C  CB    . LEU D 4  860  ? 42.910  -15.422 50.492  1.00 81.38  ? 860  LEU A CB    1 
ATOM   7496  C  CG    . LEU D 4  860  ? 43.169  -13.962 50.112  1.00 83.35  ? 860  LEU A CG    1 
ATOM   7497  C  CD1   . LEU D 4  860  ? 42.960  -13.056 51.308  1.00 82.73  ? 860  LEU A CD1   1 
ATOM   7498  C  CD2   . LEU D 4  860  ? 44.564  -13.789 49.532  1.00 90.09  ? 860  LEU A CD2   1 
ATOM   7499  N  N     . GLY D 4  861  ? 41.871  -18.562 50.034  1.00 80.45  ? 861  GLY A N     1 
ATOM   7500  C  CA    . GLY D 4  861  ? 42.077  -19.926 50.463  1.00 70.06  ? 861  GLY A CA    1 
ATOM   7501  C  C     . GLY D 4  861  ? 42.071  -20.121 51.960  1.00 82.40  ? 861  GLY A C     1 
ATOM   7502  O  O     . GLY D 4  861  ? 42.220  -21.261 52.416  1.00 95.41  ? 861  GLY A O     1 
ATOM   7503  N  N     . ASN D 4  862  ? 41.914  -19.050 52.734  1.00 91.57  ? 862  ASN A N     1 
ATOM   7504  C  CA    . ASN D 4  862  ? 41.878  -19.173 54.182  1.00 103.17 ? 862  ASN A CA    1 
ATOM   7505  C  C     . ASN D 4  862  ? 40.613  -19.893 54.627  1.00 94.76  ? 862  ASN A C     1 
ATOM   7506  O  O     . ASN D 4  862  ? 39.521  -19.648 54.108  1.00 85.93  ? 862  ASN A O     1 
ATOM   7507  C  CB    . ASN D 4  862  ? 41.952  -17.798 54.847  1.00 105.38 ? 862  ASN A CB    1 
ATOM   7508  C  CG    . ASN D 4  862  ? 43.080  -16.944 54.306  1.00 97.87  ? 862  ASN A CG    1 
ATOM   7509  O  OD1   . ASN D 4  862  ? 43.892  -17.399 53.502  1.00 104.45 ? 862  ASN A OD1   1 
ATOM   7510  N  ND2   . ASN D 4  862  ? 43.141  -15.697 54.758  1.00 85.79  ? 862  ASN A ND2   1 
ATOM   7511  N  N     . VAL D 4  863  ? 40.773  -20.795 55.595  1.00 77.54  ? 863  VAL A N     1 
ATOM   7512  C  CA    . VAL D 4  863  ? 39.641  -21.542 56.117  1.00 65.37  ? 863  VAL A CA    1 
ATOM   7513  C  C     . VAL D 4  863  ? 38.762  -20.623 56.952  1.00 64.59  ? 863  VAL A C     1 
ATOM   7514  O  O     . VAL D 4  863  ? 39.253  -19.797 57.734  1.00 81.44  ? 863  VAL A O     1 
ATOM   7515  C  CB    . VAL D 4  863  ? 40.123  -22.745 56.943  1.00 66.03  ? 863  VAL A CB    1 
ATOM   7516  C  CG1   . VAL D 4  863  ? 38.979  -23.724 57.177  1.00 65.66  ? 863  VAL A CG1   1 
ATOM   7517  C  CG2   . VAL D 4  863  ? 41.278  -23.428 56.246  1.00 67.03  ? 863  VAL A CG2   1 
ATOM   7518  N  N     . ILE D 4  864  ? 37.456  -20.754 56.771  1.00 63.92  ? 864  ILE A N     1 
ATOM   7519  C  CA    . ILE D 4  864  ? 36.465  -20.030 57.551  1.00 63.27  ? 864  ILE A CA    1 
ATOM   7520  C  C     . ILE D 4  864  ? 35.670  -20.985 58.428  1.00 66.34  ? 864  ILE A C     1 
ATOM   7521  O  O     . ILE D 4  864  ? 35.505  -20.760 59.629  1.00 76.67  ? 864  ILE A O     1 
ATOM   7522  C  CB    . ILE D 4  864  ? 35.533  -19.221 56.625  1.00 62.63  ? 864  ILE A CB    1 
ATOM   7523  C  CG1   . ILE D 4  864  ? 36.346  -18.189 55.825  1.00 62.75  ? 864  ILE A CG1   1 
ATOM   7524  C  CG2   . ILE D 4  864  ? 34.386  -18.610 57.416  1.00 62.06  ? 864  ILE A CG2   1 
ATOM   7525  C  CD1   . ILE D 4  864  ? 36.388  -16.800 56.419  1.00 62.51  ? 864  ILE A CD1   1 
ATOM   7526  N  N     . GLN D 4  865  ? 35.166  -22.058 57.833  1.00 74.80  ? 865  GLN A N     1 
ATOM   7527  C  CA    . GLN D 4  865  ? 34.636  -23.208 58.540  1.00 72.23  ? 865  GLN A CA    1 
ATOM   7528  C  C     . GLN D 4  865  ? 35.334  -24.435 57.977  1.00 81.54  ? 865  GLN A C     1 
ATOM   7529  O  O     . GLN D 4  865  ? 35.722  -24.456 56.806  1.00 99.26  ? 865  GLN A O     1 
ATOM   7530  C  CB    . GLN D 4  865  ? 33.114  -23.324 58.362  1.00 75.27  ? 865  GLN A CB    1 
ATOM   7531  C  CG    . GLN D 4  865  ? 32.328  -22.127 58.881  1.00 85.10  ? 865  GLN A CG    1 
ATOM   7532  C  CD    . GLN D 4  865  ? 30.832  -22.381 58.925  1.00 94.02  ? 865  GLN A CD    1 
ATOM   7533  O  OE1   . GLN D 4  865  ? 30.271  -23.018 58.033  1.00 82.96  ? 865  GLN A OE1   1 
ATOM   7534  N  NE2   . GLN D 4  865  ? 30.175  -21.870 59.960  1.00 105.23 ? 865  GLN A NE2   1 
ATOM   7535  N  N     . PHE D 4  866  ? 35.529  -25.449 58.812  1.00 83.41  ? 866  PHE A N     1 
ATOM   7536  C  CA    . PHE D 4  866  ? 36.128  -26.678 58.310  1.00 75.76  ? 866  PHE A CA    1 
ATOM   7537  C  C     . PHE D 4  866  ? 35.079  -27.615 57.752  1.00 81.62  ? 866  PHE A C     1 
ATOM   7538  O  O     . PHE D 4  866  ? 35.349  -28.346 56.791  1.00 75.75  ? 866  PHE A O     1 
ATOM   7539  C  CB    . PHE D 4  866  ? 36.918  -27.380 59.414  1.00 65.92  ? 866  PHE A CB    1 
ATOM   7540  C  CG    . PHE D 4  866  ? 38.178  -26.666 59.789  1.00 66.45  ? 866  PHE A CG    1 
ATOM   7541  C  CD1   . PHE D 4  866  ? 38.153  -25.613 60.690  1.00 74.92  ? 866  PHE A CD1   1 
ATOM   7542  C  CD2   . PHE D 4  866  ? 39.385  -27.023 59.215  1.00 67.14  ? 866  PHE A CD2   1 
ATOM   7543  C  CE1   . PHE D 4  866  ? 39.311  -24.945 61.028  1.00 68.63  ? 866  PHE A CE1   1 
ATOM   7544  C  CE2   . PHE D 4  866  ? 40.548  -26.359 59.547  1.00 67.61  ? 866  PHE A CE2   1 
ATOM   7545  C  CZ    . PHE D 4  866  ? 40.511  -25.317 60.455  1.00 67.25  ? 866  PHE A CZ    1 
ATOM   7546  N  N     . ILE D 4  867  ? 33.890  -27.609 58.341  1.00 88.94  ? 867  ILE A N     1 
ATOM   7547  C  CA    . ILE D 4  867  ? 32.724  -28.252 57.764  1.00 81.86  ? 867  ILE A CA    1 
ATOM   7548  C  C     . ILE D 4  867  ? 31.673  -27.154 57.644  1.00 77.61  ? 867  ILE A C     1 
ATOM   7549  O  O     . ILE D 4  867  ? 31.487  -26.372 58.585  1.00 87.43  ? 867  ILE A O     1 
ATOM   7550  C  CB    . ILE D 4  867  ? 32.222  -29.420 58.636  1.00 84.44  ? 867  ILE A CB    1 
ATOM   7551  C  CG1   . ILE D 4  867  ? 33.386  -30.218 59.219  1.00 114.87 ? 867  ILE A CG1   1 
ATOM   7552  C  CG2   . ILE D 4  867  ? 31.550  -30.448 57.760  1.00 65.79  ? 867  ILE A CG2   1 
ATOM   7553  C  CD1   . ILE D 4  867  ? 33.022  -30.958 60.489  1.00 113.78 ? 867  ILE A CD1   1 
ATOM   7554  N  N     . TYR D 4  868  ? 31.034  -27.050 56.478  1.00 63.78  ? 868  TYR A N     1 
ATOM   7555  C  CA    . TYR D 4  868  ? 30.030  -26.006 56.313  1.00 71.37  ? 868  TYR A CA    1 
ATOM   7556  C  C     . TYR D 4  868  ? 28.838  -26.252 57.227  1.00 62.76  ? 868  TYR A C     1 
ATOM   7557  O  O     . TYR D 4  868  ? 28.240  -27.331 57.228  1.00 63.09  ? 868  TYR A O     1 
ATOM   7558  C  CB    . TYR D 4  868  ? 29.558  -25.875 54.863  1.00 85.21  ? 868  TYR A CB    1 
ATOM   7559  C  CG    . TYR D 4  868  ? 28.279  -25.072 54.818  1.00 74.73  ? 868  TYR A CG    1 
ATOM   7560  C  CD1   . TYR D 4  868  ? 28.279  -23.728 55.171  1.00 82.06  ? 868  TYR A CD1   1 
ATOM   7561  C  CD2   . TYR D 4  868  ? 27.085  -25.639 54.401  1.00 64.64  ? 868  TYR A CD2   1 
ATOM   7562  C  CE1   . TYR D 4  868  ? 27.125  -23.002 55.172  1.00 77.17  ? 868  TYR A CE1   1 
ATOM   7563  C  CE2   . TYR D 4  868  ? 25.923  -24.902 54.372  1.00 64.83  ? 868  TYR A CE2   1 
ATOM   7564  C  CZ    . TYR D 4  868  ? 25.951  -23.586 54.758  1.00 68.46  ? 868  TYR A CZ    1 
ATOM   7565  O  OH    . TYR D 4  868  ? 24.797  -22.846 54.728  1.00 70.45  ? 868  TYR A OH    1 
ATOM   7566  N  N     . GLY D 4  869  ? 28.515  -25.239 58.029  1.00 62.34  ? 869  GLY A N     1 
ATOM   7567  C  CA    . GLY D 4  869  ? 27.453  -25.338 59.004  1.00 62.26  ? 869  GLY A CA    1 
ATOM   7568  C  C     . GLY D 4  869  ? 27.847  -26.258 60.137  1.00 62.67  ? 869  GLY A C     1 
ATOM   7569  O  O     . GLY D 4  869  ? 26.996  -26.684 60.920  1.00 62.78  ? 869  GLY A O     1 
ATOM   7570  N  N     . GLU D 4  870  ? 29.141  -26.581 60.210  1.00 62.99  ? 870  GLU A N     1 
ATOM   7571  C  CA    . GLU D 4  870  ? 29.762  -27.517 61.142  1.00 63.51  ? 870  GLU A CA    1 
ATOM   7572  C  C     . GLU D 4  870  ? 29.244  -28.950 60.994  1.00 64.42  ? 870  GLU A C     1 
ATOM   7573  O  O     . GLU D 4  870  ? 29.607  -29.815 61.795  1.00 93.62  ? 870  GLU A O     1 
ATOM   7574  C  CB    . GLU D 4  870  ? 29.625  -27.027 62.593  1.00 67.87  ? 870  GLU A CB    1 
ATOM   7575  C  CG    . GLU D 4  870  ? 29.977  -25.546 62.732  1.00 75.95  ? 870  GLU A CG    1 
ATOM   7576  C  CD    . GLU D 4  870  ? 29.681  -24.979 64.105  1.00 86.69  ? 870  GLU A CD    1 
ATOM   7577  O  OE1   . GLU D 4  870  ? 28.984  -25.644 64.899  1.00 94.47  ? 870  GLU A OE1   1 
ATOM   7578  O  OE2   . GLU D 4  870  ? 30.145  -23.854 64.387  1.00 86.71  ? 870  GLU A OE2   1 
ATOM   7579  N  N     . ASP D 4  871  ? 28.436  -29.237 59.969  1.00 66.06  ? 871  ASP A N     1 
ATOM   7580  C  CA    . ASP D 4  871  ? 28.009  -30.597 59.652  1.00 76.73  ? 871  ASP A CA    1 
ATOM   7581  C  C     . ASP D 4  871  ? 28.062  -30.951 58.170  1.00 71.96  ? 871  ASP A C     1 
ATOM   7582  O  O     . ASP D 4  871  ? 27.907  -32.131 57.841  1.00 74.98  ? 871  ASP A O     1 
ATOM   7583  C  CB    . ASP D 4  871  ? 26.588  -30.857 60.186  1.00 76.89  ? 871  ASP A CB    1 
ATOM   7584  C  CG    . ASP D 4  871  ? 25.537  -29.950 59.568  1.00 67.13  ? 871  ASP A CG    1 
ATOM   7585  O  OD1   . ASP D 4  871  ? 25.867  -29.075 58.736  1.00 63.55  ? 871  ASP A OD1   1 
ATOM   7586  O  OD2   . ASP D 4  871  ? 24.352  -30.118 59.915  1.00 63.98  ? 871  ASP A OD2   1 
ATOM   7587  N  N     . GLY D 4  872  ? 28.263  -29.993 57.273  1.00 67.40  ? 872  GLY A N     1 
ATOM   7588  C  CA    . GLY D 4  872  ? 28.467  -30.319 55.873  1.00 64.54  ? 872  GLY A CA    1 
ATOM   7589  C  C     . GLY D 4  872  ? 27.189  -30.612 55.131  1.00 71.70  ? 872  GLY A C     1 
ATOM   7590  O  O     . GLY D 4  872  ? 27.148  -31.535 54.310  1.00 89.91  ? 872  GLY A O     1 
ATOM   7591  N  N     . MET D 4  873  ? 26.149  -29.837 55.391  1.00 82.93  ? 873  MET A N     1 
ATOM   7592  C  CA    . MET D 4  873  ? 24.817  -30.110 54.893  1.00 64.21  ? 873  MET A CA    1 
ATOM   7593  C  C     . MET D 4  873  ? 24.349  -28.919 54.080  1.00 63.74  ? 873  MET A C     1 
ATOM   7594  O  O     . MET D 4  873  ? 24.784  -27.790 54.308  1.00 65.69  ? 873  MET A O     1 
ATOM   7595  C  CB    . MET D 4  873  ? 23.848  -30.356 56.049  1.00 64.22  ? 873  MET A CB    1 
ATOM   7596  C  CG    . MET D 4  873  ? 23.812  -31.778 56.532  1.00 64.88  ? 873  MET A CG    1 
ATOM   7597  S  SD    . MET D 4  873  ? 24.066  -32.910 55.174  1.00 80.22  ? 873  MET A SD    1 
ATOM   7598  C  CE    . MET D 4  873  ? 23.753  -34.475 55.948  1.00 78.49  ? 873  MET A CE    1 
ATOM   7599  N  N     . ASP D 4  874  ? 23.478  -29.172 53.115  1.00 64.01  ? 874  ASP A N     1 
ATOM   7600  C  CA    . ASP D 4  874  ? 22.758  -28.074 52.498  1.00 63.63  ? 874  ASP A CA    1 
ATOM   7601  C  C     . ASP D 4  874  ? 21.603  -27.714 53.422  1.00 63.46  ? 874  ASP A C     1 
ATOM   7602  O  O     . ASP D 4  874  ? 21.062  -28.567 54.128  1.00 66.10  ? 874  ASP A O     1 
ATOM   7603  C  CB    . ASP D 4  874  ? 22.287  -28.462 51.091  1.00 68.42  ? 874  ASP A CB    1 
ATOM   7604  C  CG    . ASP D 4  874  ? 21.421  -27.399 50.420  1.00 75.11  ? 874  ASP A CG    1 
ATOM   7605  O  OD1   . ASP D 4  874  ? 20.283  -27.133 50.859  1.00 77.35  ? 874  ASP A OD1   1 
ATOM   7606  O  OD2   . ASP D 4  874  ? 21.901  -26.809 49.432  1.00 84.77  ? 874  ASP A OD2   1 
ATOM   7607  N  N     . ALA D 4  875  ? 21.251  -26.427 53.443  1.00 64.15  ? 875  ALA A N     1 
ATOM   7608  C  CA    . ALA D 4  875  ? 20.276  -25.961 54.422  1.00 62.85  ? 875  ALA A CA    1 
ATOM   7609  C  C     . ALA D 4  875  ? 18.864  -26.403 54.072  1.00 75.59  ? 875  ALA A C     1 
ATOM   7610  O  O     . ALA D 4  875  ? 18.044  -26.617 54.970  1.00 65.77  ? 875  ALA A O     1 
ATOM   7611  C  CB    . ALA D 4  875  ? 20.350  -24.447 54.552  1.00 62.28  ? 875  ALA A CB    1 
ATOM   7612  N  N     . ALA D 4  876  ? 18.556  -26.535 52.786  1.00 82.30  ? 876  ALA A N     1 
ATOM   7613  C  CA    . ALA D 4  876  ? 17.347  -27.239 52.406  1.00 66.15  ? 876  ALA A CA    1 
ATOM   7614  C  C     . ALA D 4  876  ? 17.540  -28.735 52.641  1.00 81.45  ? 876  ALA A C     1 
ATOM   7615  O  O     . ALA D 4  876  ? 18.663  -29.219 52.815  1.00 73.07  ? 876  ALA A O     1 
ATOM   7616  C  CB    . ALA D 4  876  ? 16.988  -26.958 50.950  1.00 64.51  ? 876  ALA A CB    1 
ATOM   7617  N  N     . HIS D 4  877  ? 16.432  -29.474 52.569  1.00 93.93  ? 877  HIS A N     1 
ATOM   7618  C  CA    . HIS D 4  877  ? 16.294  -30.833 53.112  1.00 112.44 ? 877  HIS A CA    1 
ATOM   7619  C  C     . HIS D 4  877  ? 16.992  -30.973 54.466  1.00 88.91  ? 877  HIS A C     1 
ATOM   7620  O  O     . HIS D 4  877  ? 17.844  -31.835 54.687  1.00 65.99  ? 877  HIS A O     1 
ATOM   7621  C  CB    . HIS D 4  877  ? 16.745  -31.929 52.125  1.00 132.78 ? 877  HIS A CB    1 
ATOM   7622  C  CG    . HIS D 4  877  ? 17.769  -31.499 51.120  1.00 130.24 ? 877  HIS A CG    1 
ATOM   7623  N  ND1   . HIS D 4  877  ? 19.087  -31.270 51.446  1.00 130.07 ? 877  HIS A ND1   1 
ATOM   7624  C  CD2   . HIS D 4  877  ? 17.670  -31.285 49.786  1.00 121.27 ? 877  HIS A CD2   1 
ATOM   7625  C  CE1   . HIS D 4  877  ? 19.752  -30.916 50.362  1.00 125.05 ? 877  HIS A CE1   1 
ATOM   7626  N  NE2   . HIS D 4  877  ? 18.916  -30.919 49.340  1.00 120.81 ? 877  HIS A NE2   1 
ATOM   7627  N  N     . ILE D 4  878  ? 16.609  -30.071 55.369  1.00 95.29  ? 878  ILE A N     1 
ATOM   7628  C  CA    . ILE D 4  878  ? 16.944  -30.137 56.787  1.00 65.94  ? 878  ILE A CA    1 
ATOM   7629  C  C     . ILE D 4  878  ? 15.701  -29.678 57.536  1.00 65.99  ? 878  ILE A C     1 
ATOM   7630  O  O     . ILE D 4  878  ? 15.235  -28.549 57.339  1.00 91.93  ? 878  ILE A O     1 
ATOM   7631  C  CB    . ILE D 4  878  ? 18.157  -29.264 57.155  1.00 64.49  ? 878  ILE A CB    1 
ATOM   7632  C  CG1   . ILE D 4  878  ? 19.458  -30.023 56.909  1.00 64.53  ? 878  ILE A CG1   1 
ATOM   7633  C  CG2   . ILE D 4  878  ? 18.115  -28.861 58.625  1.00 65.01  ? 878  ILE A CG2   1 
ATOM   7634  C  CD1   . ILE D 4  878  ? 20.680  -29.302 57.431  1.00 63.96  ? 878  ILE A CD1   1 
ATOM   7635  N  N     . GLU D 4  879  ? 15.132  -30.562 58.348  1.00 66.01  ? 879  GLU A N     1 
ATOM   7636  C  CA    . GLU D 4  879  ? 13.881  -30.289 59.037  1.00 66.41  ? 879  GLU A CA    1 
ATOM   7637  C  C     . GLU D 4  879  ? 14.069  -30.515 60.528  1.00 76.73  ? 879  GLU A C     1 
ATOM   7638  O  O     . GLU D 4  879  ? 14.943  -31.273 60.955  1.00 66.43  ? 879  GLU A O     1 
ATOM   7639  C  CB    . GLU D 4  879  ? 12.743  -31.179 58.519  1.00 67.33  ? 879  GLU A CB    1 
ATOM   7640  C  CG    . GLU D 4  879  ? 12.900  -31.616 57.073  1.00 67.51  ? 879  GLU A CG    1 
ATOM   7641  C  CD    . GLU D 4  879  ? 11.967  -32.744 56.695  1.00 80.99  ? 879  GLU A CD    1 
ATOM   7642  O  OE1   . GLU D 4  879  ? 12.138  -33.309 55.594  1.00 86.99  ? 879  GLU A OE1   1 
ATOM   7643  O  OE2   . GLU D 4  879  ? 11.062  -33.066 57.492  1.00 87.32  ? 879  GLU A OE2   1 
ATOM   7644  N  N     . LYS D 4  880  ? 13.235  -29.855 61.326  1.00 71.16  ? 880  LYS A N     1 
ATOM   7645  C  CA    . LYS D 4  880  ? 13.289  -30.076 62.760  1.00 76.35  ? 880  LYS A CA    1 
ATOM   7646  C  C     . LYS D 4  880  ? 12.507  -31.334 63.114  1.00 74.27  ? 880  LYS A C     1 
ATOM   7647  O  O     . LYS D 4  880  ? 11.449  -31.621 62.543  1.00 68.32  ? 880  LYS A O     1 
ATOM   7648  C  CB    . LYS D 4  880  ? 12.786  -28.849 63.537  1.00 87.12  ? 880  LYS A CB    1 
ATOM   7649  C  CG    . LYS D 4  880  ? 11.378  -28.910 64.120  1.00 85.93  ? 880  LYS A CG    1 
ATOM   7650  C  CD    . LYS D 4  880  ? 11.017  -27.612 64.832  1.00 67.44  ? 880  LYS A CD    1 
ATOM   7651  C  CE    . LYS D 4  880  ? 11.236  -26.403 63.940  1.00 66.82  ? 880  LYS A CE    1 
ATOM   7652  N  NZ    . LYS D 4  880  ? 10.734  -25.148 64.561  1.00 66.90  ? 880  LYS A NZ    1 
ATOM   7653  N  N     . GLN D 4  881  ? 13.086  -32.125 64.011  1.00 88.36  ? 881  GLN A N     1 
ATOM   7654  C  CA    . GLN D 4  881  ? 12.501  -33.374 64.465  1.00 83.20  ? 881  GLN A CA    1 
ATOM   7655  C  C     . GLN D 4  881  ? 13.041  -33.652 65.855  1.00 80.06  ? 881  GLN A C     1 
ATOM   7656  O  O     . GLN D 4  881  ? 14.241  -33.499 66.101  1.00 78.99  ? 881  GLN A O     1 
ATOM   7657  C  CB    . GLN D 4  881  ? 12.828  -34.535 63.522  1.00 74.33  ? 881  GLN A CB    1 
ATOM   7658  C  CG    . GLN D 4  881  ? 14.189  -34.428 62.873  1.00 69.46  ? 881  GLN A CG    1 
ATOM   7659  C  CD    . GLN D 4  881  ? 14.457  -35.560 61.914  1.00 68.71  ? 881  GLN A CD    1 
ATOM   7660  O  OE1   . GLN D 4  881  ? 13.687  -36.517 61.832  1.00 69.55  ? 881  GLN A OE1   1 
ATOM   7661  N  NE2   . GLN D 4  881  ? 15.556  -35.460 61.180  1.00 68.22  ? 881  GLN A NE2   1 
ATOM   7662  N  N     . SER D 4  882  ? 12.150  -34.058 66.754  1.00 87.67  ? 882  SER A N     1 
ATOM   7663  C  CA    . SER D 4  882  ? 12.504  -34.179 68.160  1.00 80.05  ? 882  SER A CA    1 
ATOM   7664  C  C     . SER D 4  882  ? 13.449  -35.351 68.384  1.00 72.05  ? 882  SER A C     1 
ATOM   7665  O  O     . SER D 4  882  ? 13.236  -36.446 67.855  1.00 70.28  ? 882  SER A O     1 
ATOM   7666  C  CB    . SER D 4  882  ? 11.247  -34.351 69.006  1.00 73.67  ? 882  SER A CB    1 
ATOM   7667  O  OG    . SER D 4  882  ? 10.713  -35.655 68.864  1.00 78.75  ? 882  SER A OG    1 
ATOM   7668  N  N     . LEU D 4  883  ? 14.505  -35.112 69.157  1.00 69.36  ? 883  LEU A N     1 
ATOM   7669  C  CA    . LEU D 4  883  ? 15.331  -36.199 69.666  1.00 75.53  ? 883  LEU A CA    1 
ATOM   7670  C  C     . LEU D 4  883  ? 14.613  -36.802 70.863  1.00 84.52  ? 883  LEU A C     1 
ATOM   7671  O  O     . LEU D 4  883  ? 14.430  -36.138 71.888  1.00 81.61  ? 883  LEU A O     1 
ATOM   7672  C  CB    . LEU D 4  883  ? 16.725  -35.706 70.039  1.00 69.00  ? 883  LEU A CB    1 
ATOM   7673  C  CG    . LEU D 4  883  ? 17.534  -35.113 68.885  1.00 68.23  ? 883  LEU A CG    1 
ATOM   7674  C  CD1   . LEU D 4  883  ? 17.577  -33.595 68.941  1.00 67.57  ? 883  LEU A CD1   1 
ATOM   7675  C  CD2   . LEU D 4  883  ? 18.925  -35.702 68.850  1.00 68.14  ? 883  LEU A CD2   1 
ATOM   7676  N  N     . ASP D 4  884  ? 14.193  -38.058 70.728  1.00 86.81  ? 884  ASP A N     1 
ATOM   7677  C  CA    . ASP D 4  884  ? 13.338  -38.676 71.730  1.00 102.46 ? 884  ASP A CA    1 
ATOM   7678  C  C     . ASP D 4  884  ? 14.105  -39.147 72.959  1.00 103.38 ? 884  ASP A C     1 
ATOM   7679  O  O     . ASP D 4  884  ? 13.492  -39.352 74.012  1.00 95.70  ? 884  ASP A O     1 
ATOM   7680  C  CB    . ASP D 4  884  ? 12.582  -39.849 71.104  1.00 104.00 ? 884  ASP A CB    1 
ATOM   7681  C  CG    . ASP D 4  884  ? 11.115  -39.542 70.878  1.00 107.80 ? 884  ASP A CG    1 
ATOM   7682  O  OD1   . ASP D 4  884  ? 10.535  -38.780 71.678  1.00 111.98 ? 884  ASP A OD1   1 
ATOM   7683  O  OD2   . ASP D 4  884  ? 10.545  -40.059 69.895  1.00 107.31 ? 884  ASP A OD2   1 
ATOM   7684  N  N     . THR D 4  885  ? 15.426  -39.313 72.854  1.00 95.03  ? 885  THR A N     1 
ATOM   7685  C  CA    . THR D 4  885  ? 16.200  -39.792 73.994  1.00 82.35  ? 885  THR A CA    1 
ATOM   7686  C  C     . THR D 4  885  ? 16.366  -38.706 75.054  1.00 89.50  ? 885  THR A C     1 
ATOM   7687  O  O     . THR D 4  885  ? 16.299  -38.996 76.253  1.00 109.63 ? 885  THR A O     1 
ATOM   7688  C  CB    . THR D 4  885  ? 17.555  -40.320 73.522  1.00 82.11  ? 885  THR A CB    1 
ATOM   7689  O  OG1   . THR D 4  885  ? 18.436  -40.476 74.641  1.00 79.46  ? 885  THR A OG1   1 
ATOM   7690  C  CG2   . THR D 4  885  ? 18.178  -39.384 72.498  1.00 98.07  ? 885  THR A CG2   1 
ATOM   7691  N  N     . ILE D 4  886  ? 16.579  -37.452 74.640  1.00 83.71  ? 886  ILE A N     1 
ATOM   7692  C  CA    . ILE D 4  886  ? 16.610  -36.360 75.608  1.00 85.40  ? 886  ILE A CA    1 
ATOM   7693  C  C     . ILE D 4  886  ? 15.208  -36.124 76.164  1.00 86.92  ? 886  ILE A C     1 
ATOM   7694  O  O     . ILE D 4  886  ? 14.194  -36.493 75.562  1.00 104.05 ? 886  ILE A O     1 
ATOM   7695  C  CB    . ILE D 4  886  ? 17.192  -35.077 74.988  1.00 70.08  ? 886  ILE A CB    1 
ATOM   7696  C  CG1   . ILE D 4  886  ? 18.039  -34.326 76.013  1.00 69.93  ? 886  ILE A CG1   1 
ATOM   7697  C  CG2   . ILE D 4  886  ? 16.105  -34.174 74.419  1.00 69.89  ? 886  ILE A CG2   1 
ATOM   7698  C  CD1   . ILE D 4  886  ? 18.736  -33.120 75.447  1.00 69.10  ? 886  ILE A CD1   1 
ATOM   7699  N  N     . GLY D 4  887  ? 15.157  -35.532 77.356  1.00 71.91  ? 887  GLY A N     1 
ATOM   7700  C  CA    . GLY D 4  887  ? 13.888  -35.268 77.999  1.00 72.63  ? 887  GLY A CA    1 
ATOM   7701  C  C     . GLY D 4  887  ? 13.214  -36.518 78.522  1.00 73.64  ? 887  GLY A C     1 
ATOM   7702  O  O     . GLY D 4  887  ? 13.629  -37.636 78.207  1.00 73.75  ? 887  GLY A O     1 
ATOM   7703  N  N     . GLY D 4  888  ? 12.175  -36.343 79.327  1.00 78.59  ? 888  GLY A N     1 
ATOM   7704  C  CA    . GLY D 4  888  ? 11.504  -37.477 79.926  1.00 90.01  ? 888  GLY A CA    1 
ATOM   7705  C  C     . GLY D 4  888  ? 12.244  -38.035 81.124  1.00 104.52 ? 888  GLY A C     1 
ATOM   7706  O  O     . GLY D 4  888  ? 13.461  -37.870 81.241  1.00 108.54 ? 888  GLY A O     1 
ATOM   7707  N  N     . SER D 4  889  ? 11.515  -38.696 82.018  1.00 103.22 ? 889  SER A N     1 
ATOM   7708  C  CA    . SER D 4  889  ? 12.094  -39.229 83.239  1.00 99.96  ? 889  SER A CA    1 
ATOM   7709  C  C     . SER D 4  889  ? 13.055  -40.379 82.941  1.00 93.24  ? 889  SER A C     1 
ATOM   7710  O  O     . SER D 4  889  ? 12.989  -41.026 81.893  1.00 91.04  ? 889  SER A O     1 
ATOM   7711  C  CB    . SER D 4  889  ? 10.987  -39.705 84.179  1.00 105.26 ? 889  SER A CB    1 
ATOM   7712  O  OG    . SER D 4  889  ? 10.559  -41.010 83.831  1.00 111.73 ? 889  SER A OG    1 
ATOM   7713  N  N     . ASP D 4  890  ? 13.972  -40.621 83.886  1.00 95.05  ? 890  ASP A N     1 
ATOM   7714  C  CA    . ASP D 4  890  ? 14.841  -41.791 83.793  1.00 101.68 ? 890  ASP A CA    1 
ATOM   7715  C  C     . ASP D 4  890  ? 14.046  -43.086 83.891  1.00 97.70  ? 890  ASP A C     1 
ATOM   7716  O  O     . ASP D 4  890  ? 14.462  -44.108 83.335  1.00 85.35  ? 890  ASP A O     1 
ATOM   7717  C  CB    . ASP D 4  890  ? 15.908  -41.748 84.887  1.00 99.73  ? 890  ASP A CB    1 
ATOM   7718  C  CG    . ASP D 4  890  ? 17.177  -41.054 84.439  1.00 104.41 ? 890  ASP A CG    1 
ATOM   7719  O  OD1   . ASP D 4  890  ? 17.299  -39.832 84.651  1.00 100.06 ? 890  ASP A OD1   1 
ATOM   7720  O  OD2   . ASP D 4  890  ? 18.059  -41.737 83.879  1.00 108.28 ? 890  ASP A OD2   1 
ATOM   7721  N  N     . ALA D 4  891  ? 12.908  -43.059 84.590  1.00 99.23  ? 891  ALA A N     1 
ATOM   7722  C  CA    . ALA D 4  891  ? 12.045  -44.232 84.661  1.00 96.62  ? 891  ALA A CA    1 
ATOM   7723  C  C     . ALA D 4  891  ? 11.407  -44.524 83.310  1.00 95.67  ? 891  ALA A C     1 
ATOM   7724  O  O     . ALA D 4  891  ? 11.494  -45.648 82.803  1.00 108.87 ? 891  ALA A O     1 
ATOM   7725  C  CB    . ALA D 4  891  ? 10.973  -44.028 85.731  1.00 102.77 ? 891  ALA A CB    1 
ATOM   7726  N  N     . ALA D 4  892  ? 10.764  -43.519 82.710  1.00 90.18  ? 892  ALA A N     1 
ATOM   7727  C  CA    . ALA D 4  892  ? 10.111  -43.712 81.421  1.00 97.29  ? 892  ALA A CA    1 
ATOM   7728  C  C     . ALA D 4  892  ? 11.105  -43.881 80.279  1.00 94.95  ? 892  ALA A C     1 
ATOM   7729  O  O     . ALA D 4  892  ? 10.733  -44.425 79.235  1.00 101.17 ? 892  ALA A O     1 
ATOM   7730  C  CB    . ALA D 4  892  ? 9.172   -42.543 81.126  1.00 92.08  ? 892  ALA A CB    1 
ATOM   7731  N  N     . PHE D 4  893  ? 12.346  -43.417 80.442  1.00 78.05  ? 893  PHE A N     1 
ATOM   7732  C  CA    . PHE D 4  893  ? 13.369  -43.696 79.440  1.00 77.30  ? 893  PHE A CA    1 
ATOM   7733  C  C     . PHE D 4  893  ? 13.708  -45.178 79.411  1.00 77.98  ? 893  PHE A C     1 
ATOM   7734  O  O     . PHE D 4  893  ? 13.951  -45.744 78.340  1.00 79.25  ? 893  PHE A O     1 
ATOM   7735  C  CB    . PHE D 4  893  ? 14.619  -42.862 79.729  1.00 76.43  ? 893  PHE A CB    1 
ATOM   7736  C  CG    . PHE D 4  893  ? 15.849  -43.308 78.977  1.00 75.91  ? 893  PHE A CG    1 
ATOM   7737  C  CD1   . PHE D 4  893  ? 16.057  -42.908 77.670  1.00 75.12  ? 893  PHE A CD1   1 
ATOM   7738  C  CD2   . PHE D 4  893  ? 16.819  -44.089 79.595  1.00 76.26  ? 893  PHE A CD2   1 
ATOM   7739  C  CE1   . PHE D 4  893  ? 17.188  -43.301 76.980  1.00 77.57  ? 893  PHE A CE1   1 
ATOM   7740  C  CE2   . PHE D 4  893  ? 17.949  -44.486 78.909  1.00 75.91  ? 893  PHE A CE2   1 
ATOM   7741  C  CZ    . PHE D 4  893  ? 18.136  -44.091 77.602  1.00 75.15  ? 893  PHE A CZ    1 
ATOM   7742  N  N     . GLU D 4  894  ? 13.732  -45.816 80.580  1.00 83.32  ? 894  GLU A N     1 
ATOM   7743  C  CA    . GLU D 4  894  ? 14.131  -47.214 80.670  1.00 80.28  ? 894  GLU A CA    1 
ATOM   7744  C  C     . GLU D 4  894  ? 13.027  -48.139 80.175  1.00 80.40  ? 894  GLU A C     1 
ATOM   7745  O  O     . GLU D 4  894  ? 13.294  -49.069 79.411  1.00 80.97  ? 894  GLU A O     1 
ATOM   7746  C  CB    . GLU D 4  894  ? 14.516  -47.547 82.112  1.00 82.10  ? 894  GLU A CB    1 
ATOM   7747  C  CG    . GLU D 4  894  ? 14.828  -49.013 82.361  1.00 87.10  ? 894  GLU A CG    1 
ATOM   7748  C  CD    . GLU D 4  894  ? 15.440  -49.259 83.725  1.00 95.43  ? 894  GLU A CD    1 
ATOM   7749  O  OE1   . GLU D 4  894  ? 14.709  -49.698 84.637  1.00 105.25 ? 894  GLU A OE1   1 
ATOM   7750  O  OE2   . GLU D 4  894  ? 16.653  -49.008 83.886  1.00 95.60  ? 894  GLU A OE2   1 
ATOM   7751  N  N     . LYS D 4  895  ? 11.780  -47.881 80.585  1.00 81.00  ? 895  LYS A N     1 
ATOM   7752  C  CA    . LYS D 4  895  ? 10.663  -48.757 80.230  1.00 82.93  ? 895  LYS A CA    1 
ATOM   7753  C  C     . LYS D 4  895  ? 10.478  -48.850 78.719  1.00 88.03  ? 895  LYS A C     1 
ATOM   7754  O  O     . LYS D 4  895  ? 10.170  -49.923 78.185  1.00 98.81  ? 895  LYS A O     1 
ATOM   7755  C  CB    . LYS D 4  895  ? 9.385   -48.251 80.904  1.00 83.47  ? 895  LYS A CB    1 
ATOM   7756  C  CG    . LYS D 4  895  ? 8.089   -48.623 80.196  1.00 83.49  ? 895  LYS A CG    1 
ATOM   7757  C  CD    . LYS D 4  895  ? 6.881   -48.033 80.897  1.00 88.29  ? 895  LYS A CD    1 
ATOM   7758  C  CE    . LYS D 4  895  ? 6.202   -49.063 81.784  1.00 87.18  ? 895  LYS A CE    1 
ATOM   7759  N  NZ    . LYS D 4  895  ? 5.476   -48.432 82.921  1.00 86.37  ? 895  LYS A NZ    1 
ATOM   7760  N  N     . ARG D 4  896  ? 10.721  -47.754 78.011  1.00 98.54  ? 896  ARG A N     1 
ATOM   7761  C  CA    . ARG D 4  896  ? 10.516  -47.714 76.574  1.00 112.71 ? 896  ARG A CA    1 
ATOM   7762  C  C     . ARG D 4  896  ? 11.743  -48.133 75.773  1.00 100.04 ? 896  ARG A C     1 
ATOM   7763  O  O     . ARG D 4  896  ? 11.605  -48.467 74.591  1.00 107.24 ? 896  ARG A O     1 
ATOM   7764  C  CB    . ARG D 4  896  ? 10.094  -46.303 76.158  1.00 127.97 ? 896  ARG A CB    1 
ATOM   7765  C  CG    . ARG D 4  896  ? 8.614   -46.006 76.310  1.00 138.18 ? 896  ARG A CG    1 
ATOM   7766  C  CD    . ARG D 4  896  ? 8.096   -45.265 75.091  1.00 145.05 ? 896  ARG A CD    1 
ATOM   7767  N  NE    . ARG D 4  896  ? 9.139   -44.438 74.488  1.00 147.75 ? 896  ARG A NE    1 
ATOM   7768  C  CZ    . ARG D 4  896  ? 8.964   -43.672 73.416  1.00 148.05 ? 896  ARG A CZ    1 
ATOM   7769  N  NH1   . ARG D 4  896  ? 7.781   -43.620 72.820  1.00 146.46 ? 896  ARG A NH1   1 
ATOM   7770  N  NH2   . ARG D 4  896  ? 9.974   -42.955 72.941  1.00 143.21 ? 896  ARG A NH2   1 
ATOM   7771  N  N     . TYR D 4  897  ? 12.940  -48.111 76.369  1.00 84.62  ? 897  TYR A N     1 
ATOM   7772  C  CA    . TYR D 4  897  ? 14.161  -48.349 75.604  1.00 80.98  ? 897  TYR A CA    1 
ATOM   7773  C  C     . TYR D 4  897  ? 15.058  -49.454 76.149  1.00 93.47  ? 897  TYR A C     1 
ATOM   7774  O  O     . TYR D 4  897  ? 16.035  -49.801 75.478  1.00 92.88  ? 897  TYR A O     1 
ATOM   7775  C  CB    . TYR D 4  897  ? 15.009  -47.065 75.487  1.00 77.36  ? 897  TYR A CB    1 
ATOM   7776  C  CG    . TYR D 4  897  ? 14.416  -45.928 74.663  1.00 93.66  ? 897  TYR A CG    1 
ATOM   7777  C  CD1   . TYR D 4  897  ? 13.242  -45.290 75.044  1.00 109.49 ? 897  TYR A CD1   1 
ATOM   7778  C  CD2   . TYR D 4  897  ? 15.029  -45.507 73.492  1.00 94.01  ? 897  TYR A CD2   1 
ATOM   7779  C  CE1   . TYR D 4  897  ? 12.700  -44.271 74.300  1.00 112.00 ? 897  TYR A CE1   1 
ATOM   7780  C  CE2   . TYR D 4  897  ? 14.492  -44.480 72.738  1.00 104.55 ? 897  TYR A CE2   1 
ATOM   7781  C  CZ    . TYR D 4  897  ? 13.327  -43.868 73.149  1.00 110.20 ? 897  TYR A CZ    1 
ATOM   7782  O  OH    . TYR D 4  897  ? 12.778  -42.847 72.413  1.00 115.16 ? 897  TYR A OH    1 
ATOM   7783  N  N     . ARG D 4  898  ? 14.778  -50.009 77.327  1.00 102.99 ? 898  ARG A N     1 
ATOM   7784  C  CA    . ARG D 4  898  ? 15.568  -51.102 77.885  1.00 103.14 ? 898  ARG A CA    1 
ATOM   7785  C  C     . ARG D 4  898  ? 14.861  -52.424 77.636  1.00 87.85  ? 898  ARG A C     1 
ATOM   7786  O  O     . ARG D 4  898  ? 13.651  -52.537 77.852  1.00 82.65  ? 898  ARG A O     1 
ATOM   7787  C  CB    . ARG D 4  898  ? 15.798  -50.920 79.389  1.00 99.79  ? 898  ARG A CB    1 
ATOM   7788  C  CG    . ARG D 4  898  ? 16.370  -52.122 80.131  1.00 101.94 ? 898  ARG A CG    1 
ATOM   7789  C  CD    . ARG D 4  898  ? 17.819  -52.379 79.764  1.00 110.94 ? 898  ARG A CD    1 
ATOM   7790  N  NE    . ARG D 4  898  ? 18.474  -53.245 80.741  1.00 114.69 ? 898  ARG A NE    1 
ATOM   7791  C  CZ    . ARG D 4  898  ? 19.702  -53.733 80.603  1.00 108.61 ? 898  ARG A CZ    1 
ATOM   7792  N  NH1   . ARG D 4  898  ? 20.415  -53.437 79.527  1.00 110.79 ? 898  ARG A NH1   1 
ATOM   7793  N  NH2   . ARG D 4  898  ? 20.219  -54.513 81.542  1.00 107.62 ? 898  ARG A NH2   1 
ATOM   7794  N  N     . VAL D 4  899  ? 15.618  -53.419 77.186  1.00 86.78  ? 899  VAL A N     1 
ATOM   7795  C  CA    . VAL D 4  899  ? 15.139  -54.789 77.112  1.00 96.81  ? 899  VAL A CA    1 
ATOM   7796  C  C     . VAL D 4  899  ? 16.179  -55.709 77.741  1.00 89.54  ? 899  VAL A C     1 
ATOM   7797  O  O     . VAL D 4  899  ? 17.377  -55.600 77.454  1.00 84.46  ? 899  VAL A O     1 
ATOM   7798  C  CB    . VAL D 4  899  ? 14.785  -55.199 75.667  1.00 87.48  ? 899  VAL A CB    1 
ATOM   7799  C  CG1   . VAL D 4  899  ? 15.957  -55.040 74.712  1.00 83.05  ? 899  VAL A CG1   1 
ATOM   7800  C  CG2   . VAL D 4  899  ? 14.266  -56.617 75.657  1.00 90.63  ? 899  VAL A CG2   1 
ATOM   7801  N  N     . ASP D 4  900  ? 15.726  -56.572 78.646  1.00 85.29  ? 900  ASP A N     1 
ATOM   7802  C  CA    . ASP D 4  900  ? 16.593  -57.489 79.375  1.00 100.31 ? 900  ASP A CA    1 
ATOM   7803  C  C     . ASP D 4  900  ? 16.273  -58.905 78.920  1.00 99.83  ? 900  ASP A C     1 
ATOM   7804  O  O     . ASP D 4  900  ? 15.168  -59.405 79.156  1.00 108.63 ? 900  ASP A O     1 
ATOM   7805  C  CB    . ASP D 4  900  ? 16.411  -57.341 80.883  1.00 123.37 ? 900  ASP A CB    1 
ATOM   7806  C  CG    . ASP D 4  900  ? 17.594  -57.879 81.674  1.00 119.54 ? 900  ASP A CG    1 
ATOM   7807  O  OD1   . ASP D 4  900  ? 18.582  -58.328 81.055  1.00 115.56 ? 900  ASP A OD1   1 
ATOM   7808  O  OD2   . ASP D 4  900  ? 17.534  -57.854 82.920  1.00 111.97 ? 900  ASP A OD2   1 
ATOM   7809  N  N     . LEU D 4  901  ? 17.248  -59.558 78.286  1.00 93.91  ? 901  LEU A N     1 
ATOM   7810  C  CA    . LEU D 4  901  ? 17.086  -60.940 77.856  1.00 88.80  ? 901  LEU A CA    1 
ATOM   7811  C  C     . LEU D 4  901  ? 17.121  -61.922 79.019  1.00 99.69  ? 901  LEU A C     1 
ATOM   7812  O  O     . LEU D 4  901  ? 16.885  -63.115 78.808  1.00 109.15 ? 901  LEU A O     1 
ATOM   7813  C  CB    . LEU D 4  901  ? 18.181  -61.298 76.852  1.00 88.73  ? 901  LEU A CB    1 
ATOM   7814  C  CG    . LEU D 4  901  ? 18.050  -60.691 75.456  1.00 87.94  ? 901  LEU A CG    1 
ATOM   7815  C  CD1   . LEU D 4  901  ? 19.091  -61.271 74.523  1.00 88.23  ? 901  LEU A CD1   1 
ATOM   7816  C  CD2   . LEU D 4  901  ? 16.663  -60.901 74.903  1.00 88.43  ? 901  LEU A CD2   1 
ATOM   7817  N  N     . LEU D 4  902  ? 17.410  -61.452 80.227  1.00 103.03 ? 902  LEU A N     1 
ATOM   7818  C  CA    . LEU D 4  902  ? 17.580  -62.277 81.413  1.00 97.88  ? 902  LEU A CA    1 
ATOM   7819  C  C     . LEU D 4  902  ? 16.551  -61.921 82.479  1.00 110.05 ? 902  LEU A C     1 
ATOM   7820  O  O     . LEU D 4  902  ? 16.875  -61.787 83.661  1.00 130.80 ? 902  LEU A O     1 
ATOM   7821  C  CB    . LEU D 4  902  ? 18.999  -62.134 81.961  1.00 90.99  ? 902  LEU A CB    1 
ATOM   7822  C  CG    . LEU D 4  902  ? 20.136  -61.898 80.964  1.00 89.85  ? 902  LEU A CG    1 
ATOM   7823  C  CD1   . LEU D 4  902  ? 21.430  -61.602 81.694  1.00 90.81  ? 902  LEU A CD1   1 
ATOM   7824  C  CD2   . LEU D 4  902  ? 20.319  -63.113 80.078  1.00 90.84  ? 902  LEU A CD2   1 
ATOM   7825  N  N     . ASN D 4  903  ? 15.292  -61.773 82.074  1.00 99.33  ? 903  ASN A N     1 
ATOM   7826  C  CA    . ASN D 4  903  ? 14.249  -61.326 82.986  1.00 99.12  ? 903  ASN A CA    1 
ATOM   7827  C  C     . ASN D 4  903  ? 12.907  -61.767 82.419  1.00 104.41 ? 903  ASN A C     1 
ATOM   7828  O  O     . ASN D 4  903  ? 12.691  -61.687 81.211  1.00 116.70 ? 903  ASN A O     1 
ATOM   7829  C  CB    . ASN D 4  903  ? 14.317  -59.801 83.170  1.00 95.83  ? 903  ASN A CB    1 
ATOM   7830  C  CG    . ASN D 4  903  ? 13.218  -59.258 84.057  1.00 98.86  ? 903  ASN A CG    1 
ATOM   7831  O  OD1   . ASN D 4  903  ? 12.059  -59.190 83.661  1.00 109.77 ? 903  ASN A OD1   1 
ATOM   7832  N  ND2   . ASN D 4  903  ? 13.584  -58.855 85.268  1.00 90.24  ? 903  ASN A ND2   1 
ATOM   7833  N  N     . THR D 4  904  ? 12.008  -62.226 83.297  1.00 113.51 ? 904  THR A N     1 
ATOM   7834  C  CA    . THR D 4  904  ? 10.747  -62.790 82.817  1.00 125.41 ? 904  THR A CA    1 
ATOM   7835  C  C     . THR D 4  904  ? 9.817   -61.718 82.265  1.00 128.45 ? 904  THR A C     1 
ATOM   7836  O  O     . THR D 4  904  ? 9.106   -61.958 81.282  1.00 136.97 ? 904  THR A O     1 
ATOM   7837  C  CB    . THR D 4  904  ? 10.038  -63.570 83.926  1.00 132.15 ? 904  THR A CB    1 
ATOM   7838  O  OG1   . THR D 4  904  ? 9.222   -62.681 84.701  1.00 140.00 ? 904  THR A OG1   1 
ATOM   7839  C  CG2   . THR D 4  904  ? 11.031  -64.283 84.825  1.00 128.96 ? 904  THR A CG2   1 
ATOM   7840  N  N     . ASP D 4  905  ? 9.793   -60.536 82.876  1.00 118.93 ? 905  ASP A N     1 
ATOM   7841  C  CA    . ASP D 4  905  ? 8.845   -59.500 82.480  1.00 123.97 ? 905  ASP A CA    1 
ATOM   7842  C  C     . ASP D 4  905  ? 9.539   -58.229 81.999  1.00 114.21 ? 905  ASP A C     1 
ATOM   7843  O  O     . ASP D 4  905  ? 8.967   -57.140 82.066  1.00 118.08 ? 905  ASP A O     1 
ATOM   7844  C  CB    . ASP D 4  905  ? 7.862   -59.196 83.612  1.00 130.64 ? 905  ASP A CB    1 
ATOM   7845  C  CG    . ASP D 4  905  ? 8.530   -59.103 84.979  1.00 136.11 ? 905  ASP A CG    1 
ATOM   7846  O  OD1   . ASP D 4  905  ? 9.715   -58.725 85.058  1.00 137.01 ? 905  ASP A OD1   1 
ATOM   7847  O  OD2   . ASP D 4  905  ? 7.861   -59.415 85.987  1.00 136.69 ? 905  ASP A OD2   1 
ATOM   7848  N  N     . HIS D 4  906  ? 10.781  -58.345 81.517  1.00 110.92 ? 906  HIS A N     1 
ATOM   7849  C  CA    . HIS D 4  906  ? 11.473  -57.235 80.865  1.00 115.05 ? 906  HIS A CA    1 
ATOM   7850  C  C     . HIS D 4  906  ? 12.190  -57.690 79.598  1.00 102.43 ? 906  HIS A C     1 
ATOM   7851  O  O     . HIS D 4  906  ? 13.270  -57.182 79.275  1.00 90.63  ? 906  HIS A O     1 
ATOM   7852  C  CB    . HIS D 4  906  ? 12.478  -56.556 81.800  1.00 119.95 ? 906  HIS A CB    1 
ATOM   7853  C  CG    . HIS D 4  906  ? 11.864  -55.618 82.794  1.00 114.21 ? 906  HIS A CG    1 
ATOM   7854  N  ND1   . HIS D 4  906  ? 10.505  -55.516 82.998  1.00 113.06 ? 906  HIS A ND1   1 
ATOM   7855  C  CD2   . HIS D 4  906  ? 12.437  -54.745 83.656  1.00 111.59 ? 906  HIS A CD2   1 
ATOM   7856  C  CE1   . HIS D 4  906  ? 10.266  -54.615 83.933  1.00 113.53 ? 906  HIS A CE1   1 
ATOM   7857  N  NE2   . HIS D 4  906  ? 11.423  -54.133 84.351  1.00 111.65 ? 906  HIS A NE2   1 
ATOM   7858  N  N     . THR D 4  907  ? 11.604  -58.639 78.871  1.00 105.07 ? 907  THR A N     1 
ATOM   7859  C  CA    . THR D 4  907  ? 12.165  -59.178 77.642  1.00 106.44 ? 907  THR A CA    1 
ATOM   7860  C  C     . THR D 4  907  ? 11.197  -58.900 76.499  1.00 112.25 ? 907  THR A C     1 
ATOM   7861  O  O     . THR D 4  907  ? 10.030  -58.564 76.722  1.00 125.11 ? 907  THR A O     1 
ATOM   7862  C  CB    . THR D 4  907  ? 12.414  -60.693 77.771  1.00 101.75 ? 907  THR A CB    1 
ATOM   7863  O  OG1   . THR D 4  907  ? 12.839  -60.991 79.104  1.00 121.03 ? 907  THR A OG1   1 
ATOM   7864  C  CG2   . THR D 4  907  ? 13.497  -61.173 76.810  1.00 90.03  ? 907  THR A CG2   1 
ATOM   7865  N  N     . LEU D 4  908  ? 11.698  -59.024 75.267  1.00 107.65 ? 908  LEU A N     1 
ATOM   7866  C  CA    . LEU D 4  908  ? 10.840  -58.998 74.090  1.00 88.74  ? 908  LEU A CA    1 
ATOM   7867  C  C     . LEU D 4  908  ? 9.864   -60.157 74.179  1.00 92.37  ? 908  LEU A C     1 
ATOM   7868  O  O     . LEU D 4  908  ? 10.268  -61.321 74.072  1.00 91.35  ? 908  LEU A O     1 
ATOM   7869  C  CB    . LEU D 4  908  ? 11.653  -59.102 72.800  1.00 88.31  ? 908  LEU A CB    1 
ATOM   7870  C  CG    . LEU D 4  908  ? 12.880  -58.203 72.690  1.00 86.86  ? 908  LEU A CG    1 
ATOM   7871  C  CD1   . LEU D 4  908  ? 14.121  -59.036 72.906  1.00 87.19  ? 908  LEU A CD1   1 
ATOM   7872  C  CD2   . LEU D 4  908  ? 12.944  -57.476 71.367  1.00 90.79  ? 908  LEU A CD2   1 
ATOM   7873  N  N     . ASP D 4  909  ? 8.597   -59.842 74.427  1.00 97.98  ? 909  ASP A N     1 
ATOM   7874  C  CA    . ASP D 4  909  ? 7.564   -60.861 74.487  1.00 110.17 ? 909  ASP A CA    1 
ATOM   7875  C  C     . ASP D 4  909  ? 7.483   -61.562 73.132  1.00 113.79 ? 909  ASP A C     1 
ATOM   7876  O  O     . ASP D 4  909  ? 7.640   -60.914 72.091  1.00 116.24 ? 909  ASP A O     1 
ATOM   7877  C  CB    . ASP D 4  909  ? 6.224   -60.212 74.862  1.00 119.71 ? 909  ASP A CB    1 
ATOM   7878  C  CG    . ASP D 4  909  ? 5.067   -61.204 74.947  1.00 131.24 ? 909  ASP A CG    1 
ATOM   7879  O  OD1   . ASP D 4  909  ? 4.643   -61.773 73.920  1.00 139.60 ? 909  ASP A OD1   1 
ATOM   7880  O  OD2   . ASP D 4  909  ? 4.567   -61.412 76.070  1.00 134.77 ? 909  ASP A OD2   1 
ATOM   7881  N  N     . PRO D 4  910  ? 7.265   -62.881 73.106  1.00 113.61 ? 910  PRO A N     1 
ATOM   7882  C  CA    . PRO D 4  910  ? 7.233   -63.604 71.821  1.00 123.64 ? 910  PRO A CA    1 
ATOM   7883  C  C     . PRO D 4  910  ? 6.097   -63.198 70.885  1.00 127.47 ? 910  PRO A C     1 
ATOM   7884  O  O     . PRO D 4  910  ? 6.060   -63.689 69.749  1.00 132.92 ? 910  PRO A O     1 
ATOM   7885  C  CB    . PRO D 4  910  ? 7.105   -65.072 72.254  1.00 127.79 ? 910  PRO A CB    1 
ATOM   7886  C  CG    . PRO D 4  910  ? 6.529   -64.996 73.644  1.00 123.07 ? 910  PRO A CG    1 
ATOM   7887  C  CD    . PRO D 4  910  ? 7.244   -63.822 74.236  1.00 114.06 ? 910  PRO A CD    1 
ATOM   7888  N  N     . SER D 4  911  ? 5.175   -62.337 71.318  1.00 121.84 ? 911  SER A N     1 
ATOM   7889  C  CA    . SER D 4  911  ? 4.265   -61.700 70.376  1.00 119.54 ? 911  SER A CA    1 
ATOM   7890  C  C     . SER D 4  911  ? 4.999   -60.727 69.462  1.00 108.93 ? 911  SER A C     1 
ATOM   7891  O  O     . SER D 4  911  ? 4.589   -60.530 68.314  1.00 118.96 ? 911  SER A O     1 
ATOM   7892  C  CB    . SER D 4  911  ? 3.151   -60.975 71.129  1.00 125.74 ? 911  SER A CB    1 
ATOM   7893  O  OG    . SER D 4  911  ? 2.721   -59.829 70.418  1.00 138.30 ? 911  SER A OG    1 
ATOM   7894  N  N     . LEU D 4  912  ? 6.079   -60.117 69.945  1.00 95.52  ? 912  LEU A N     1 
ATOM   7895  C  CA    . LEU D 4  912  ? 6.805   -59.105 69.191  1.00 90.98  ? 912  LEU A CA    1 
ATOM   7896  C  C     . LEU D 4  912  ? 7.941   -59.677 68.354  1.00 93.51  ? 912  LEU A C     1 
ATOM   7897  O  O     . LEU D 4  912  ? 8.611   -58.916 67.650  1.00 116.57 ? 912  LEU A O     1 
ATOM   7898  C  CB    . LEU D 4  912  ? 7.371   -58.036 70.136  1.00 89.56  ? 912  LEU A CB    1 
ATOM   7899  C  CG    . LEU D 4  912  ? 6.560   -57.563 71.346  1.00 89.70  ? 912  LEU A CG    1 
ATOM   7900  C  CD1   . LEU D 4  912  ? 7.305   -56.452 72.061  1.00 88.22  ? 912  LEU A CD1   1 
ATOM   7901  C  CD2   . LEU D 4  912  ? 5.175   -57.080 70.947  1.00 91.89  ? 912  LEU A CD2   1 
ATOM   7902  N  N     . LEU D 4  913  ? 8.182   -60.984 68.414  1.00 92.40  ? 913  LEU A N     1 
ATOM   7903  C  CA    . LEU D 4  913  ? 9.294   -61.567 67.678  1.00 97.24  ? 913  LEU A CA    1 
ATOM   7904  C  C     . LEU D 4  913  ? 9.058   -63.052 67.469  1.00 115.48 ? 913  LEU A C     1 
ATOM   7905  O  O     . LEU D 4  913  ? 8.582   -63.742 68.373  1.00 124.66 ? 913  LEU A O     1 
ATOM   7906  C  CB    . LEU D 4  913  ? 10.625  -61.361 68.408  1.00 103.54 ? 913  LEU A CB    1 
ATOM   7907  C  CG    . LEU D 4  913  ? 11.665  -60.546 67.645  1.00 93.91  ? 913  LEU A CG    1 
ATOM   7908  C  CD1   . LEU D 4  913  ? 13.034  -60.674 68.294  1.00 89.24  ? 913  LEU A CD1   1 
ATOM   7909  C  CD2   . LEU D 4  913  ? 11.708  -60.969 66.191  1.00 92.00  ? 913  LEU A CD2   1 
ATOM   7910  N  N     . GLU D 4  914  ? 9.399   -63.532 66.270  1.00 117.74 ? 914  GLU A N     1 
ATOM   7911  C  CA    . GLU D 4  914  ? 9.406   -64.968 66.021  1.00 113.39 ? 914  GLU A CA    1 
ATOM   7912  C  C     . GLU D 4  914  ? 10.444  -65.671 66.883  1.00 122.11 ? 914  GLU A C     1 
ATOM   7913  O  O     . GLU D 4  914  ? 10.230  -66.811 67.309  1.00 138.28 ? 914  GLU A O     1 
ATOM   7914  C  CB    . GLU D 4  914  ? 9.681   -65.246 64.543  1.00 115.06 ? 914  GLU A CB    1 
ATOM   7915  C  CG    . GLU D 4  914  ? 8.436   -65.375 63.685  1.00 114.58 ? 914  GLU A CG    1 
ATOM   7916  C  CD    . GLU D 4  914  ? 8.745   -65.324 62.201  1.00 111.09 ? 914  GLU A CD    1 
ATOM   7917  O  OE1   . GLU D 4  914  ? 9.910   -65.569 61.823  1.00 110.61 ? 914  GLU A OE1   1 
ATOM   7918  O  OE2   . GLU D 4  914  ? 7.820   -65.042 61.412  1.00 106.18 ? 914  GLU A OE2   1 
ATOM   7919  N  N     . SER D 4  915  ? 11.560  -65.002 67.163  1.00 112.56 ? 915  SER A N     1 
ATOM   7920  C  CA    . SER D 4  915  ? 12.612  -65.519 68.024  1.00 115.72 ? 915  SER A CA    1 
ATOM   7921  C  C     . SER D 4  915  ? 12.305  -65.363 69.504  1.00 117.79 ? 915  SER A C     1 
ATOM   7922  O  O     . SER D 4  915  ? 13.192  -65.625 70.313  1.00 119.89 ? 915  SER A O     1 
ATOM   7923  C  CB    . SER D 4  915  ? 13.938  -64.819 67.712  1.00 111.59 ? 915  SER A CB    1 
ATOM   7924  O  OG    . SER D 4  915  ? 14.551  -65.358 66.555  1.00 125.77 ? 915  SER A OG    1 
ATOM   7925  N  N     . GLY D 4  916  ? 11.086  -64.961 69.869  1.00 118.80 ? 916  GLY A N     1 
ATOM   7926  C  CA    . GLY D 4  916  ? 10.716  -64.588 71.224  1.00 114.58 ? 916  GLY A CA    1 
ATOM   7927  C  C     . GLY D 4  916  ? 11.019  -65.558 72.346  1.00 126.47 ? 916  GLY A C     1 
ATOM   7928  O  O     . GLY D 4  916  ? 11.797  -65.231 73.248  1.00 135.39 ? 916  GLY A O     1 
ATOM   7929  N  N     . SER D 4  917  ? 10.407  -66.744 72.317  1.00 122.15 ? 917  SER A N     1 
ATOM   7930  C  CA    . SER D 4  917  ? 10.711  -67.757 73.323  1.00 106.11 ? 917  SER A CA    1 
ATOM   7931  C  C     . SER D 4  917  ? 12.129  -68.298 73.170  1.00 98.17  ? 917  SER A C     1 
ATOM   7932  O  O     . SER D 4  917  ? 12.764  -68.670 74.165  1.00 98.36  ? 917  SER A O     1 
ATOM   7933  C  CB    . SER D 4  917  ? 9.696   -68.895 73.234  1.00 112.08 ? 917  SER A CB    1 
ATOM   7934  O  OG    . SER D 4  917  ? 10.151  -69.903 72.347  1.00 111.93 ? 917  SER A OG    1 
ATOM   7935  N  N     . GLU D 4  918  ? 12.642  -68.332 71.941  1.00 98.01  ? 918  GLU A N     1 
ATOM   7936  C  CA    . GLU D 4  918  ? 13.974  -68.861 71.676  1.00 98.15  ? 918  GLU A CA    1 
ATOM   7937  C  C     . GLU D 4  918  ? 15.072  -67.924 72.179  1.00 96.61  ? 918  GLU A C     1 
ATOM   7938  O  O     . GLU D 4  918  ? 16.202  -68.371 72.405  1.00 96.82  ? 918  GLU A O     1 
ATOM   7939  C  CB    . GLU D 4  918  ? 14.087  -69.142 70.167  1.00 103.74 ? 918  GLU A CB    1 
ATOM   7940  C  CG    . GLU D 4  918  ? 15.446  -69.564 69.609  1.00 111.90 ? 918  GLU A CG    1 
ATOM   7941  C  CD    . GLU D 4  918  ? 15.443  -69.652 68.091  1.00 110.55 ? 918  GLU A CD    1 
ATOM   7942  O  OE1   . GLU D 4  918  ? 16.537  -69.738 67.494  1.00 108.28 ? 918  GLU A OE1   1 
ATOM   7943  O  OE2   . GLU D 4  918  ? 14.343  -69.644 67.495  1.00 99.45  ? 918  GLU A OE2   1 
ATOM   7944  N  N     . ILE D 4  919  ? 14.748  -66.651 72.432  1.00 95.40  ? 919  ILE A N     1 
ATOM   7945  C  CA    . ILE D 4  919  ? 15.773  -65.654 72.734  1.00 104.50 ? 919  ILE A CA    1 
ATOM   7946  C  C     . ILE D 4  919  ? 16.087  -65.532 74.221  1.00 110.20 ? 919  ILE A C     1 
ATOM   7947  O  O     . ILE D 4  919  ? 17.105  -64.910 74.571  1.00 100.94 ? 919  ILE A O     1 
ATOM   7948  C  CB    . ILE D 4  919  ? 15.353  -64.278 72.171  1.00 99.18  ? 919  ILE A CB    1 
ATOM   7949  C  CG1   . ILE D 4  919  ? 16.558  -63.555 71.588  1.00 91.10  ? 919  ILE A CG1   1 
ATOM   7950  C  CG2   . ILE D 4  919  ? 14.606  -63.432 73.201  1.00 105.20 ? 919  ILE A CG2   1 
ATOM   7951  C  CD1   . ILE D 4  919  ? 17.135  -64.316 70.431  1.00 92.66  ? 919  ILE A CD1   1 
ATOM   7952  N  N     . LEU D 4  920  ? 15.262  -66.113 75.097  1.00 105.36 ? 920  LEU A N     1 
ATOM   7953  C  CA    . LEU D 4  920  ? 15.399  -65.919 76.538  1.00 98.04  ? 920  LEU A CA    1 
ATOM   7954  C  C     . LEU D 4  920  ? 16.735  -66.451 77.042  1.00 96.06  ? 920  LEU A C     1 
ATOM   7955  O  O     . LEU D 4  920  ? 17.287  -67.418 76.511  1.00 105.10 ? 920  LEU A O     1 
ATOM   7956  C  CB    . LEU D 4  920  ? 14.255  -66.609 77.283  1.00 95.60  ? 920  LEU A CB    1 
ATOM   7957  C  CG    . LEU D 4  920  ? 13.298  -65.733 78.095  1.00 95.10  ? 920  LEU A CG    1 
ATOM   7958  C  CD1   . LEU D 4  920  ? 12.249  -66.594 78.775  1.00 96.60  ? 920  LEU A CD1   1 
ATOM   7959  C  CD2   . LEU D 4  920  ? 14.055  -64.910 79.118  1.00 94.09  ? 920  LEU A CD2   1 
ATOM   7960  N  N     . GLY D 4  921  ? 17.258  -65.802 78.078  1.00 102.01 ? 921  GLY A N     1 
ATOM   7961  C  CA    . GLY D 4  921  ? 18.625  -66.042 78.484  1.00 109.99 ? 921  GLY A CA    1 
ATOM   7962  C  C     . GLY D 4  921  ? 19.566  -65.504 77.430  1.00 111.96 ? 921  GLY A C     1 
ATOM   7963  O  O     . GLY D 4  921  ? 19.521  -64.310 77.117  1.00 120.88 ? 921  GLY A O     1 
ATOM   7964  N  N     . ASP D 4  922  ? 20.405  -66.385 76.878  1.00 104.20 ? 922  ASP A N     1 
ATOM   7965  C  CA    . ASP D 4  922  ? 21.273  -66.120 75.732  1.00 107.42 ? 922  ASP A CA    1 
ATOM   7966  C  C     . ASP D 4  922  ? 22.226  -64.971 76.049  1.00 107.62 ? 922  ASP A C     1 
ATOM   7967  O  O     . ASP D 4  922  ? 21.961  -63.821 75.687  1.00 110.59 ? 922  ASP A O     1 
ATOM   7968  C  CB    . ASP D 4  922  ? 20.428  -65.825 74.484  1.00 99.44  ? 922  ASP A CB    1 
ATOM   7969  C  CG    . ASP D 4  922  ? 21.226  -65.892 73.188  1.00 102.63 ? 922  ASP A CG    1 
ATOM   7970  O  OD1   . ASP D 4  922  ? 22.470  -65.781 73.203  1.00 105.92 ? 922  ASP A OD1   1 
ATOM   7971  O  OD2   . ASP D 4  922  ? 20.585  -66.070 72.133  1.00 109.18 ? 922  ASP A OD2   1 
ATOM   7972  N  N     . LEU D 4  923  ? 23.340  -65.277 76.719  1.00 102.71 ? 923  LEU A N     1 
ATOM   7973  C  CA    . LEU D 4  923  ? 24.278  -64.238 77.129  1.00 97.43  ? 923  LEU A CA    1 
ATOM   7974  C  C     . LEU D 4  923  ? 25.045  -63.645 75.954  1.00 93.62  ? 923  LEU A C     1 
ATOM   7975  O  O     . LEU D 4  923  ? 25.609  -62.557 76.093  1.00 97.91  ? 923  LEU A O     1 
ATOM   7976  C  CB    . LEU D 4  923  ? 25.266  -64.791 78.160  1.00 92.20  ? 923  LEU A CB    1 
ATOM   7977  C  CG    . LEU D 4  923  ? 24.748  -65.743 79.244  1.00 93.44  ? 923  LEU A CG    1 
ATOM   7978  C  CD1   . LEU D 4  923  ? 25.880  -66.136 80.175  1.00 96.16  ? 923  LEU A CD1   1 
ATOM   7979  C  CD2   . LEU D 4  923  ? 23.606  -65.119 80.034  1.00 99.25  ? 923  LEU A CD2   1 
ATOM   7980  N  N     . LYS D 4  924  ? 25.088  -64.335 74.811  1.00 91.31  ? 924  LYS A N     1 
ATOM   7981  C  CA    . LYS D 4  924  ? 25.788  -63.826 73.638  1.00 90.74  ? 924  LYS A CA    1 
ATOM   7982  C  C     . LYS D 4  924  ? 25.019  -62.732 72.919  1.00 89.42  ? 924  LYS A C     1 
ATOM   7983  O  O     . LYS D 4  924  ? 25.607  -62.010 72.107  1.00 88.66  ? 924  LYS A O     1 
ATOM   7984  C  CB    . LYS D 4  924  ? 26.060  -64.955 72.649  1.00 92.04  ? 924  LYS A CB    1 
ATOM   7985  C  CG    . LYS D 4  924  ? 27.278  -65.791 72.964  1.00 93.21  ? 924  LYS A CG    1 
ATOM   7986  C  CD    . LYS D 4  924  ? 27.264  -67.100 72.189  1.00 95.86  ? 924  LYS A CD    1 
ATOM   7987  C  CE    . LYS D 4  924  ? 25.869  -67.723 72.143  1.00 98.87  ? 924  LYS A CE    1 
ATOM   7988  N  NZ    . LYS D 4  924  ? 25.884  -69.127 71.655  1.00 98.50  ? 924  LYS A NZ    1 
ATOM   7989  N  N     . LEU D 4  925  ? 23.718  -62.612 73.170  1.00 89.23  ? 925  LEU A N     1 
ATOM   7990  C  CA    . LEU D 4  925  ? 22.923  -61.542 72.592  1.00 88.04  ? 925  LEU A CA    1 
ATOM   7991  C  C     . LEU D 4  925  ? 22.607  -60.443 73.586  1.00 86.95  ? 925  LEU A C     1 
ATOM   7992  O  O     . LEU D 4  925  ? 22.363  -59.303 73.179  1.00 91.91  ? 925  LEU A O     1 
ATOM   7993  C  CB    . LEU D 4  925  ? 21.611  -62.102 72.026  1.00 88.68  ? 925  LEU A CB    1 
ATOM   7994  C  CG    . LEU D 4  925  ? 21.708  -62.801 70.667  1.00 89.44  ? 925  LEU A CG    1 
ATOM   7995  C  CD1   . LEU D 4  925  ? 20.373  -62.787 69.966  1.00 89.55  ? 925  LEU A CD1   1 
ATOM   7996  C  CD2   . LEU D 4  925  ? 22.786  -62.199 69.782  1.00 88.76  ? 925  LEU A CD2   1 
ATOM   7997  N  N     . GLN D 4  926  ? 22.614  -60.762 74.882  1.00 87.40  ? 926  GLN A N     1 
ATOM   7998  C  CA    . GLN D 4  926  ? 22.368  -59.756 75.905  1.00 86.51  ? 926  GLN A CA    1 
ATOM   7999  C  C     . GLN D 4  926  ? 23.554  -58.814 76.075  1.00 85.59  ? 926  GLN A C     1 
ATOM   8000  O  O     . GLN D 4  926  ? 23.380  -57.697 76.573  1.00 84.61  ? 926  GLN A O     1 
ATOM   8001  C  CB    . GLN D 4  926  ? 22.016  -60.454 77.223  1.00 87.43  ? 926  GLN A CB    1 
ATOM   8002  C  CG    . GLN D 4  926  ? 21.644  -59.569 78.421  1.00 92.89  ? 926  GLN A CG    1 
ATOM   8003  C  CD    . GLN D 4  926  ? 20.640  -58.477 78.093  1.00 90.22  ? 926  GLN A CD    1 
ATOM   8004  O  OE1   . GLN D 4  926  ? 19.448  -58.642 78.327  1.00 87.35  ? 926  GLN A OE1   1 
ATOM   8005  N  NE2   . GLN D 4  926  ? 21.127  -57.321 77.652  1.00 99.57  ? 926  GLN A NE2   1 
ATOM   8006  N  N     . VAL D 4  927  ? 24.751  -59.229 75.656  1.00 89.35  ? 927  VAL A N     1 
ATOM   8007  C  CA    . VAL D 4  927  ? 25.889  -58.317 75.668  1.00 108.25 ? 927  VAL A CA    1 
ATOM   8008  C  C     . VAL D 4  927  ? 25.687  -57.203 74.645  1.00 113.74 ? 927  VAL A C     1 
ATOM   8009  O  O     . VAL D 4  927  ? 26.019  -56.038 74.898  1.00 117.61 ? 927  VAL A O     1 
ATOM   8010  C  CB    . VAL D 4  927  ? 27.197  -59.102 75.435  1.00 112.76 ? 927  VAL A CB    1 
ATOM   8011  C  CG1   . VAL D 4  927  ? 27.052  -60.066 74.277  1.00 113.23 ? 927  VAL A CG1   1 
ATOM   8012  C  CG2   . VAL D 4  927  ? 28.374  -58.166 75.199  1.00 116.31 ? 927  VAL A CG2   1 
ATOM   8013  N  N     . LEU D 4  928  ? 25.085  -57.531 73.498  1.00 110.59 ? 928  LEU A N     1 
ATOM   8014  C  CA    . LEU D 4  928  ? 24.913  -56.540 72.441  1.00 95.62  ? 928  LEU A CA    1 
ATOM   8015  C  C     . LEU D 4  928  ? 23.825  -55.533 72.793  1.00 89.04  ? 928  LEU A C     1 
ATOM   8016  O  O     . LEU D 4  928  ? 23.950  -54.345 72.479  1.00 99.41  ? 928  LEU A O     1 
ATOM   8017  C  CB    . LEU D 4  928  ? 24.595  -57.238 71.120  1.00 86.34  ? 928  LEU A CB    1 
ATOM   8018  C  CG    . LEU D 4  928  ? 25.793  -57.685 70.279  1.00 98.07  ? 928  LEU A CG    1 
ATOM   8019  C  CD1   . LEU D 4  928  ? 25.385  -57.907 68.832  1.00 98.41  ? 928  LEU A CD1   1 
ATOM   8020  C  CD2   . LEU D 4  928  ? 26.939  -56.686 70.365  1.00 99.14  ? 928  LEU A CD2   1 
ATOM   8021  N  N     . LEU D 4  929  ? 22.751  -55.989 73.442  1.00 82.56  ? 929  LEU A N     1 
ATOM   8022  C  CA    . LEU D 4  929  ? 21.719  -55.067 73.907  1.00 81.83  ? 929  LEU A CA    1 
ATOM   8023  C  C     . LEU D 4  929  ? 22.231  -54.182 75.033  1.00 97.76  ? 929  LEU A C     1 
ATOM   8024  O  O     . LEU D 4  929  ? 21.780  -53.040 75.175  1.00 107.17 ? 929  LEU A O     1 
ATOM   8025  C  CB    . LEU D 4  929  ? 20.482  -55.843 74.361  1.00 82.72  ? 929  LEU A CB    1 
ATOM   8026  C  CG    . LEU D 4  929  ? 19.961  -56.947 73.440  1.00 83.70  ? 929  LEU A CG    1 
ATOM   8027  C  CD1   . LEU D 4  929  ? 18.601  -57.390 73.887  1.00 84.40  ? 929  LEU A CD1   1 
ATOM   8028  C  CD2   . LEU D 4  929  ? 19.849  -56.417 72.024  1.00 83.08  ? 929  LEU A CD2   1 
ATOM   8029  N  N     . ASP D 4  930  ? 23.162  -54.689 75.839  1.00 100.83 ? 930  ASP A N     1 
ATOM   8030  C  CA    . ASP D 4  930  ? 23.803  -53.863 76.852  1.00 103.75 ? 930  ASP A CA    1 
ATOM   8031  C  C     . ASP D 4  930  ? 24.837  -52.928 76.237  1.00 109.74 ? 930  ASP A C     1 
ATOM   8032  O  O     . ASP D 4  930  ? 25.053  -51.827 76.753  1.00 108.93 ? 930  ASP A O     1 
ATOM   8033  C  CB    . ASP D 4  930  ? 24.449  -54.753 77.914  1.00 106.47 ? 930  ASP A CB    1 
ATOM   8034  C  CG    . ASP D 4  930  ? 23.467  -55.193 78.983  1.00 93.17  ? 930  ASP A CG    1 
ATOM   8035  O  OD1   . ASP D 4  930  ? 22.304  -54.740 78.943  1.00 85.83  ? 930  ASP A OD1   1 
ATOM   8036  O  OD2   . ASP D 4  930  ? 23.853  -56.001 79.853  1.00 83.83  ? 930  ASP A OD2   1 
ATOM   8037  N  N     . GLU D 4  931  ? 25.479  -53.351 75.144  1.00 107.45 ? 931  GLU A N     1 
ATOM   8038  C  CA    . GLU D 4  931  ? 26.349  -52.453 74.392  1.00 99.90  ? 931  GLU A CA    1 
ATOM   8039  C  C     . GLU D 4  931  ? 25.544  -51.331 73.748  1.00 91.49  ? 931  GLU A C     1 
ATOM   8040  O  O     . GLU D 4  931  ? 25.987  -50.176 73.724  1.00 101.64 ? 931  GLU A O     1 
ATOM   8041  C  CB    . GLU D 4  931  ? 27.126  -53.251 73.341  1.00 107.59 ? 931  GLU A CB    1 
ATOM   8042  C  CG    . GLU D 4  931  ? 27.496  -52.478 72.080  1.00 121.16 ? 931  GLU A CG    1 
ATOM   8043  C  CD    . GLU D 4  931  ? 28.398  -53.264 71.150  1.00 136.52 ? 931  GLU A CD    1 
ATOM   8044  O  OE1   . GLU D 4  931  ? 29.484  -53.694 71.593  1.00 139.14 ? 931  GLU A OE1   1 
ATOM   8045  O  OE2   . GLU D 4  931  ? 28.022  -53.447 69.973  1.00 142.51 ? 931  GLU A OE2   1 
ATOM   8046  N  N     . GLU D 4  932  ? 24.353  -51.655 73.234  1.00 83.85  ? 932  GLU A N     1 
ATOM   8047  C  CA    . GLU D 4  932  ? 23.463  -50.634 72.690  1.00 85.26  ? 932  GLU A CA    1 
ATOM   8048  C  C     . GLU D 4  932  ? 23.002  -49.672 73.777  1.00 91.15  ? 932  GLU A C     1 
ATOM   8049  O  O     . GLU D 4  932  ? 23.001  -48.452 73.575  1.00 96.05  ? 932  GLU A O     1 
ATOM   8050  C  CB    . GLU D 4  932  ? 22.263  -51.302 72.011  1.00 78.29  ? 932  GLU A CB    1 
ATOM   8051  C  CG    . GLU D 4  932  ? 20.940  -50.553 72.152  1.00 82.19  ? 932  GLU A CG    1 
ATOM   8052  C  CD    . GLU D 4  932  ? 19.833  -51.139 71.303  1.00 93.29  ? 932  GLU A CD    1 
ATOM   8053  O  OE1   . GLU D 4  932  ? 20.068  -51.397 70.104  1.00 94.87  ? 932  GLU A OE1   1 
ATOM   8054  O  OE2   . GLU D 4  932  ? 18.721  -51.335 71.837  1.00 91.70  ? 932  GLU A OE2   1 
ATOM   8055  N  N     . TYR D 4  933  ? 22.634  -50.202 74.947  1.00 89.63  ? 933  TYR A N     1 
ATOM   8056  C  CA    . TYR D 4  933  ? 22.153  -49.359 76.035  1.00 91.84  ? 933  TYR A CA    1 
ATOM   8057  C  C     . TYR D 4  933  ? 23.249  -48.459 76.582  1.00 93.68  ? 933  TYR A C     1 
ATOM   8058  O  O     . TYR D 4  933  ? 22.955  -47.372 77.093  1.00 88.82  ? 933  TYR A O     1 
ATOM   8059  C  CB    . TYR D 4  933  ? 21.582  -50.230 77.148  1.00 92.09  ? 933  TYR A CB    1 
ATOM   8060  C  CG    . TYR D 4  933  ? 20.554  -49.540 78.002  1.00 79.25  ? 933  TYR A CG    1 
ATOM   8061  C  CD1   . TYR D 4  933  ? 19.255  -49.381 77.552  1.00 79.28  ? 933  TYR A CD1   1 
ATOM   8062  C  CD2   . TYR D 4  933  ? 20.872  -49.075 79.270  1.00 78.41  ? 933  TYR A CD2   1 
ATOM   8063  C  CE1   . TYR D 4  933  ? 18.308  -48.755 78.326  1.00 78.34  ? 933  TYR A CE1   1 
ATOM   8064  C  CE2   . TYR D 4  933  ? 19.926  -48.454 80.058  1.00 83.11  ? 933  TYR A CE2   1 
ATOM   8065  C  CZ    . TYR D 4  933  ? 18.644  -48.300 79.581  1.00 78.98  ? 933  TYR A CZ    1 
ATOM   8066  O  OH    . TYR D 4  933  ? 17.691  -47.683 80.355  1.00 81.60  ? 933  TYR A OH    1 
ATOM   8067  N  N     . LYS D 4  934  ? 24.508  -48.894 76.486  1.00 99.69  ? 934  LYS A N     1 
ATOM   8068  C  CA    . LYS D 4  934  ? 25.620  -48.049 76.907  1.00 101.47 ? 934  LYS A CA    1 
ATOM   8069  C  C     . LYS D 4  934  ? 25.738  -46.819 76.019  1.00 92.58  ? 934  LYS A C     1 
ATOM   8070  O  O     . LYS D 4  934  ? 25.993  -45.713 76.508  1.00 99.50  ? 934  LYS A O     1 
ATOM   8071  C  CB    . LYS D 4  934  ? 26.922  -48.848 76.886  1.00 97.70  ? 934  LYS A CB    1 
ATOM   8072  C  CG    . LYS D 4  934  ? 27.450  -49.244 78.260  1.00 98.01  ? 934  LYS A CG    1 
ATOM   8073  C  CD    . LYS D 4  934  ? 26.387  -49.952 79.088  1.00 108.16 ? 934  LYS A CD    1 
ATOM   8074  C  CE    . LYS D 4  934  ? 26.917  -51.244 79.697  1.00 99.18  ? 934  LYS A CE    1 
ATOM   8075  N  NZ    . LYS D 4  934  ? 25.944  -51.859 80.644  1.00 82.35  ? 934  LYS A NZ    1 
ATOM   8076  N  N     . GLN D 4  935  ? 25.549  -46.990 74.708  1.00 75.48  ? 935  GLN A N     1 
ATOM   8077  C  CA    . GLN D 4  935  ? 25.606  -45.850 73.804  1.00 77.22  ? 935  GLN A CA    1 
ATOM   8078  C  C     . GLN D 4  935  ? 24.340  -45.008 73.863  1.00 76.79  ? 935  GLN A C     1 
ATOM   8079  O  O     . GLN D 4  935  ? 24.412  -43.793 73.664  1.00 73.06  ? 935  GLN A O     1 
ATOM   8080  C  CB    . GLN D 4  935  ? 25.861  -46.313 72.371  1.00 74.54  ? 935  GLN A CB    1 
ATOM   8081  C  CG    . GLN D 4  935  ? 26.456  -45.229 71.487  1.00 79.80  ? 935  GLN A CG    1 
ATOM   8082  C  CD    . GLN D 4  935  ? 27.918  -44.971 71.779  1.00 81.71  ? 935  GLN A CD    1 
ATOM   8083  O  OE1   . GLN D 4  935  ? 28.635  -45.854 72.251  1.00 83.17  ? 935  GLN A OE1   1 
ATOM   8084  N  NE2   . GLN D 4  935  ? 28.368  -43.752 71.507  1.00 72.94  ? 935  GLN A NE2   1 
ATOM   8085  N  N     . LEU D 4  936  ? 23.181  -45.621 74.133  1.00 75.72  ? 936  LEU A N     1 
ATOM   8086  C  CA    . LEU D 4  936  ? 21.964  -44.832 74.310  1.00 77.85  ? 936  LEU A CA    1 
ATOM   8087  C  C     . LEU D 4  936  ? 22.012  -44.012 75.592  1.00 78.23  ? 936  LEU A C     1 
ATOM   8088  O  O     . LEU D 4  936  ? 21.337  -42.982 75.690  1.00 73.28  ? 936  LEU A O     1 
ATOM   8089  C  CB    . LEU D 4  936  ? 20.719  -45.728 74.317  1.00 75.91  ? 936  LEU A CB    1 
ATOM   8090  C  CG    . LEU D 4  936  ? 20.306  -46.646 73.157  1.00 75.14  ? 936  LEU A CG    1 
ATOM   8091  C  CD1   . LEU D 4  936  ? 18.788  -46.724 73.074  1.00 75.45  ? 936  LEU A CD1   1 
ATOM   8092  C  CD2   . LEU D 4  936  ? 20.878  -46.198 71.824  1.00 74.49  ? 936  LEU A CD2   1 
ATOM   8093  N  N     . VAL D 4  937  ? 22.787  -44.454 76.582  1.00 89.51  ? 937  VAL A N     1 
ATOM   8094  C  CA    . VAL D 4  937  ? 22.941  -43.684 77.811  1.00 86.84  ? 937  VAL A CA    1 
ATOM   8095  C  C     . VAL D 4  937  ? 23.998  -42.602 77.633  1.00 83.83  ? 937  VAL A C     1 
ATOM   8096  O  O     . VAL D 4  937  ? 23.807  -41.457 78.059  1.00 90.34  ? 937  VAL A O     1 
ATOM   8097  C  CB    . VAL D 4  937  ? 23.268  -44.636 78.979  1.00 75.22  ? 937  VAL A CB    1 
ATOM   8098  C  CG1   . VAL D 4  937  ? 24.090  -43.944 80.063  1.00 75.21  ? 937  VAL A CG1   1 
ATOM   8099  C  CG2   . VAL D 4  937  ? 21.988  -45.204 79.564  1.00 75.86  ? 937  VAL A CG2   1 
ATOM   8100  N  N     . LYS D 4  938  ? 25.113  -42.946 76.979  1.00 80.42  ? 938  LYS A N     1 
ATOM   8101  C  CA    . LYS D 4  938  ? 26.154  -41.966 76.686  1.00 82.77  ? 938  LYS A CA    1 
ATOM   8102  C  C     . LYS D 4  938  ? 25.643  -40.878 75.747  1.00 97.17  ? 938  LYS A C     1 
ATOM   8103  O  O     . LYS D 4  938  ? 26.061  -39.718 75.856  1.00 100.24 ? 938  LYS A O     1 
ATOM   8104  C  CB    . LYS D 4  938  ? 27.376  -42.685 76.100  1.00 83.33  ? 938  LYS A CB    1 
ATOM   8105  C  CG    . LYS D 4  938  ? 28.381  -41.810 75.357  1.00 88.60  ? 938  LYS A CG    1 
ATOM   8106  C  CD    . LYS D 4  938  ? 29.655  -42.574 75.024  1.00 92.63  ? 938  LYS A CD    1 
ATOM   8107  C  CE    . LYS D 4  938  ? 30.327  -42.022 73.775  1.00 90.32  ? 938  LYS A CE    1 
ATOM   8108  N  NZ    . LYS D 4  938  ? 31.790  -42.305 73.748  1.00 96.72  ? 938  LYS A NZ    1 
ATOM   8109  N  N     . ASP D 4  939  ? 24.707  -41.221 74.856  1.00 103.46 ? 939  ASP A N     1 
ATOM   8110  C  CA    . ASP D 4  939  ? 24.100  -40.221 73.983  1.00 96.56  ? 939  ASP A CA    1 
ATOM   8111  C  C     . ASP D 4  939  ? 23.256  -39.232 74.773  1.00 87.64  ? 939  ASP A C     1 
ATOM   8112  O  O     . ASP D 4  939  ? 23.380  -38.016 74.586  1.00 86.10  ? 939  ASP A O     1 
ATOM   8113  C  CB    . ASP D 4  939  ? 23.243  -40.897 72.914  1.00 87.93  ? 939  ASP A CB    1 
ATOM   8114  C  CG    . ASP D 4  939  ? 24.049  -41.357 71.724  1.00 77.44  ? 939  ASP A CG    1 
ATOM   8115  O  OD1   . ASP D 4  939  ? 25.250  -41.025 71.648  1.00 74.04  ? 939  ASP A OD1   1 
ATOM   8116  O  OD2   . ASP D 4  939  ? 23.480  -42.059 70.863  1.00 71.39  ? 939  ASP A OD2   1 
ATOM   8117  N  N     . ARG D 4  940  ? 22.382  -39.739 75.654  1.00 77.70  ? 940  ARG A N     1 
ATOM   8118  C  CA    . ARG D 4  940  ? 21.454  -38.871 76.376  1.00 71.30  ? 940  ARG A CA    1 
ATOM   8119  C  C     . ARG D 4  940  ? 22.193  -37.901 77.287  1.00 71.11  ? 940  ARG A C     1 
ATOM   8120  O  O     . ARG D 4  940  ? 21.790  -36.740 77.415  1.00 70.70  ? 940  ARG A O     1 
ATOM   8121  C  CB    . ARG D 4  940  ? 20.455  -39.712 77.179  1.00 72.15  ? 940  ARG A CB    1 
ATOM   8122  C  CG    . ARG D 4  940  ? 19.554  -38.893 78.096  1.00 72.52  ? 940  ARG A CG    1 
ATOM   8123  C  CD    . ARG D 4  940  ? 18.829  -39.725 79.134  1.00 75.20  ? 940  ARG A CD    1 
ATOM   8124  N  NE    . ARG D 4  940  ? 17.421  -39.347 79.212  1.00 88.15  ? 940  ARG A NE    1 
ATOM   8125  C  CZ    . ARG D 4  940  ? 16.686  -39.405 80.316  1.00 89.07  ? 940  ARG A CZ    1 
ATOM   8126  N  NH1   . ARG D 4  940  ? 17.223  -39.828 81.450  1.00 87.65  ? 940  ARG A NH1   1 
ATOM   8127  N  NH2   . ARG D 4  940  ? 15.414  -39.033 80.288  1.00 88.70  ? 940  ARG A NH2   1 
ATOM   8128  N  N     . LYS D 4  941  ? 23.302  -38.334 77.883  1.00 82.39  ? 941  LYS A N     1 
ATOM   8129  C  CA    . LYS D 4  941  ? 24.117  -37.410 78.651  1.00 90.60  ? 941  LYS A CA    1 
ATOM   8130  C  C     . LYS D 4  941  ? 24.946  -36.490 77.760  1.00 91.65  ? 941  LYS A C     1 
ATOM   8131  O  O     . LYS D 4  941  ? 25.349  -35.415 78.213  1.00 109.53 ? 941  LYS A O     1 
ATOM   8132  C  CB    . LYS D 4  941  ? 25.029  -38.184 79.609  1.00 98.92  ? 941  LYS A CB    1 
ATOM   8133  C  CG    . LYS D 4  941  ? 25.495  -37.403 80.850  1.00 116.26 ? 941  LYS A CG    1 
ATOM   8134  C  CD    . LYS D 4  941  ? 24.524  -36.297 81.286  1.00 124.20 ? 941  LYS A CD    1 
ATOM   8135  C  CE    . LYS D 4  941  ? 23.359  -36.839 82.115  1.00 121.48 ? 941  LYS A CE    1 
ATOM   8136  N  NZ    . LYS D 4  941  ? 22.307  -35.806 82.323  1.00 108.98 ? 941  LYS A NZ    1 
ATOM   8137  N  N     . PHE D 4  942  ? 25.205  -36.879 76.508  1.00 75.05  ? 942  PHE A N     1 
ATOM   8138  C  CA    . PHE D 4  942  ? 25.887  -35.982 75.582  1.00 75.30  ? 942  PHE A CA    1 
ATOM   8139  C  C     . PHE D 4  942  ? 24.932  -34.916 75.061  1.00 78.06  ? 942  PHE A C     1 
ATOM   8140  O  O     . PHE D 4  942  ? 25.341  -33.772 74.836  1.00 76.31  ? 942  PHE A O     1 
ATOM   8141  C  CB    . PHE D 4  942  ? 26.509  -36.805 74.442  1.00 82.47  ? 942  PHE A CB    1 
ATOM   8142  C  CG    . PHE D 4  942  ? 27.004  -35.990 73.263  1.00 81.71  ? 942  PHE A CG    1 
ATOM   8143  C  CD1   . PHE D 4  942  ? 28.338  -35.627 73.189  1.00 68.83  ? 942  PHE A CD1   1 
ATOM   8144  C  CD2   . PHE D 4  942  ? 26.176  -35.687 72.181  1.00 74.32  ? 942  PHE A CD2   1 
ATOM   8145  C  CE1   . PHE D 4  942  ? 28.821  -34.907 72.118  1.00 68.27  ? 942  PHE A CE1   1 
ATOM   8146  C  CE2   . PHE D 4  942  ? 26.656  -34.965 71.108  1.00 67.75  ? 942  PHE A CE2   1 
ATOM   8147  C  CZ    . PHE D 4  942  ? 27.981  -34.580 71.075  1.00 67.71  ? 942  PHE A CZ    1 
ATOM   8148  N  N     . LEU D 4  943  ? 23.668  -35.282 74.849  1.00 77.27  ? 943  LEU A N     1 
ATOM   8149  C  CA    . LEU D 4  943  ? 22.683  -34.317 74.377  1.00 69.14  ? 943  LEU A CA    1 
ATOM   8150  C  C     . LEU D 4  943  ? 22.273  -33.364 75.487  1.00 68.57  ? 943  LEU A C     1 
ATOM   8151  O  O     . LEU D 4  943  ? 22.127  -32.159 75.256  1.00 68.08  ? 943  LEU A O     1 
ATOM   8152  C  CB    . LEU D 4  943  ? 21.461  -35.052 73.835  1.00 68.71  ? 943  LEU A CB    1 
ATOM   8153  C  CG    . LEU D 4  943  ? 21.679  -36.000 72.660  1.00 71.92  ? 943  LEU A CG    1 
ATOM   8154  C  CD1   . LEU D 4  943  ? 20.345  -36.448 72.130  1.00 80.36  ? 943  LEU A CD1   1 
ATOM   8155  C  CD2   . LEU D 4  943  ? 22.500  -35.342 71.568  1.00 81.74  ? 943  LEU A CD2   1 
ATOM   8156  N  N     . ARG D 4  944  ? 22.077  -33.895 76.698  1.00 69.27  ? 944  ARG A N     1 
ATOM   8157  C  CA    . ARG D 4  944  ? 21.680  -33.069 77.833  1.00 69.53  ? 944  ARG A CA    1 
ATOM   8158  C  C     . ARG D 4  944  ? 22.775  -32.087 78.214  1.00 69.28  ? 944  ARG A C     1 
ATOM   8159  O  O     . ARG D 4  944  ? 22.494  -31.036 78.798  1.00 69.29  ? 944  ARG A O     1 
ATOM   8160  C  CB    . ARG D 4  944  ? 21.337  -33.961 79.020  1.00 71.11  ? 944  ARG A CB    1 
ATOM   8161  C  CG    . ARG D 4  944  ? 19.863  -34.106 79.258  1.00 70.85  ? 944  ARG A CG    1 
ATOM   8162  C  CD    . ARG D 4  944  ? 19.543  -35.396 79.960  1.00 71.70  ? 944  ARG A CD    1 
ATOM   8163  N  NE    . ARG D 4  944  ? 18.104  -35.568 80.071  1.00 76.02  ? 944  ARG A NE    1 
ATOM   8164  C  CZ    . ARG D 4  944  ? 17.448  -35.562 81.224  1.00 88.42  ? 944  ARG A CZ    1 
ATOM   8165  N  NH1   . ARG D 4  944  ? 18.109  -35.397 82.362  1.00 97.02  ? 944  ARG A NH1   1 
ATOM   8166  N  NH2   . ARG D 4  944  ? 16.133  -35.720 81.242  1.00 91.16  ? 944  ARG A NH2   1 
ATOM   8167  N  N     . GLU D 4  945  ? 24.025  -32.419 77.899  1.00 69.15  ? 945  GLU A N     1 
ATOM   8168  C  CA    . GLU D 4  945  ? 25.133  -31.498 78.075  1.00 79.16  ? 945  GLU A CA    1 
ATOM   8169  C  C     . GLU D 4  945  ? 25.201  -30.466 76.956  1.00 81.76  ? 945  GLU A C     1 
ATOM   8170  O  O     . GLU D 4  945  ? 25.678  -29.350 77.190  1.00 96.11  ? 945  GLU A O     1 
ATOM   8171  C  CB    . GLU D 4  945  ? 26.428  -32.315 78.205  1.00 91.57  ? 945  GLU A CB    1 
ATOM   8172  C  CG    . GLU D 4  945  ? 27.680  -31.785 77.534  1.00 99.32  ? 945  GLU A CG    1 
ATOM   8173  C  CD    . GLU D 4  945  ? 28.834  -32.764 77.645  1.00 106.46 ? 945  GLU A CD    1 
ATOM   8174  O  OE1   . GLU D 4  945  ? 29.867  -32.555 76.977  1.00 111.10 ? 945  GLU A OE1   1 
ATOM   8175  O  OE2   . GLU D 4  945  ? 28.705  -33.743 78.410  1.00 92.34  ? 945  GLU A OE2   1 
ATOM   8176  N  N     . VAL D 4  946  ? 24.679  -30.784 75.775  1.00 88.64  ? 946  VAL A N     1 
ATOM   8177  C  CA    . VAL D 4  946  ? 24.674  -29.837 74.660  1.00 85.64  ? 946  VAL A CA    1 
ATOM   8178  C  C     . VAL D 4  946  ? 23.433  -28.953 74.685  1.00 70.57  ? 946  VAL A C     1 
ATOM   8179  O  O     . VAL D 4  946  ? 23.530  -27.726 74.628  1.00 66.45  ? 946  VAL A O     1 
ATOM   8180  C  CB    . VAL D 4  946  ? 24.815  -30.597 73.320  1.00 83.24  ? 946  VAL A CB    1 
ATOM   8181  C  CG1   . VAL D 4  946  ? 24.172  -29.829 72.159  1.00 74.31  ? 946  VAL A CG1   1 
ATOM   8182  C  CG2   . VAL D 4  946  ? 26.276  -30.879 73.024  1.00 95.03  ? 946  VAL A CG2   1 
ATOM   8183  N  N     . PHE D 4  947  ? 22.248  -29.551 74.789  1.00 68.63  ? 947  PHE A N     1 
ATOM   8184  C  CA    . PHE D 4  947  ? 21.003  -28.791 74.782  1.00 76.90  ? 947  PHE A CA    1 
ATOM   8185  C  C     . PHE D 4  947  ? 20.540  -28.680 76.230  1.00 75.28  ? 947  PHE A C     1 
ATOM   8186  O  O     . PHE D 4  947  ? 19.687  -29.430 76.709  1.00 78.99  ? 947  PHE A O     1 
ATOM   8187  C  CB    . PHE D 4  947  ? 19.978  -29.452 73.866  1.00 81.29  ? 947  PHE A CB    1 
ATOM   8188  C  CG    . PHE D 4  947  ? 20.430  -29.522 72.434  1.00 78.96  ? 947  PHE A CG    1 
ATOM   8189  C  CD1   . PHE D 4  947  ? 20.625  -30.742 71.809  1.00 86.43  ? 947  PHE A CD1   1 
ATOM   8190  C  CD2   . PHE D 4  947  ? 20.711  -28.363 71.730  1.00 90.40  ? 947  PHE A CD2   1 
ATOM   8191  C  CE1   . PHE D 4  947  ? 21.058  -30.803 70.495  1.00 99.99  ? 947  PHE A CE1   1 
ATOM   8192  C  CE2   . PHE D 4  947  ? 21.145  -28.416 70.417  1.00 97.72  ? 947  PHE A CE2   1 
ATOM   8193  C  CZ    . PHE D 4  947  ? 21.319  -29.638 69.799  1.00 95.42  ? 947  PHE A CZ    1 
ATOM   8194  N  N     . VAL D 4  948  ? 21.132  -27.701 76.922  1.00 77.82  ? 948  VAL A N     1 
ATOM   8195  C  CA    . VAL D 4  948  ? 21.073  -27.619 78.381  1.00 73.13  ? 948  VAL A CA    1 
ATOM   8196  C  C     . VAL D 4  948  ? 19.649  -27.362 78.854  1.00 74.83  ? 948  VAL A C     1 
ATOM   8197  O  O     . VAL D 4  948  ? 19.197  -27.936 79.854  1.00 75.06  ? 948  VAL A O     1 
ATOM   8198  C  CB    . VAL D 4  948  ? 22.050  -26.532 78.874  1.00 68.42  ? 948  VAL A CB    1 
ATOM   8199  C  CG1   . VAL D 4  948  ? 21.839  -26.218 80.347  1.00 69.24  ? 948  VAL A CG1   1 
ATOM   8200  C  CG2   . VAL D 4  948  ? 23.488  -26.953 78.611  1.00 68.20  ? 948  VAL A CG2   1 
ATOM   8201  N  N     . ASP D 4  949  ? 18.901  -26.538 78.119  1.00 84.29  ? 949  ASP A N     1 
ATOM   8202  C  CA    . ASP D 4  949  ? 17.502  -26.295 78.452  1.00 93.53  ? 949  ASP A CA    1 
ATOM   8203  C  C     . ASP D 4  949  ? 16.615  -27.506 78.198  1.00 98.80  ? 949  ASP A C     1 
ATOM   8204  O  O     . ASP D 4  949  ? 15.444  -27.486 78.596  1.00 107.41 ? 949  ASP A O     1 
ATOM   8205  C  CB    . ASP D 4  949  ? 16.970  -25.101 77.661  1.00 95.44  ? 949  ASP A CB    1 
ATOM   8206  C  CG    . ASP D 4  949  ? 17.391  -25.132 76.207  1.00 107.12 ? 949  ASP A CG    1 
ATOM   8207  O  OD1   . ASP D 4  949  ? 18.586  -25.376 75.938  1.00 112.89 ? 949  ASP A OD1   1 
ATOM   8208  O  OD2   . ASP D 4  949  ? 16.527  -24.915 75.332  1.00 113.96 ? 949  ASP A OD2   1 
ATOM   8209  N  N     . GLY D 4  950  ? 17.131  -28.546 77.554  1.00 89.61  ? 950  GLY A N     1 
ATOM   8210  C  CA    . GLY D 4  950  ? 16.340  -29.733 77.293  1.00 92.25  ? 950  GLY A CA    1 
ATOM   8211  C  C     . GLY D 4  950  ? 15.341  -29.551 76.173  1.00 102.74 ? 950  GLY A C     1 
ATOM   8212  O  O     . GLY D 4  950  ? 14.229  -30.090 76.246  1.00 105.11 ? 950  GLY A O     1 
ATOM   8213  N  N     . GLU D 4  951  ? 15.702  -28.788 75.145  1.00 100.40 ? 951  GLU A N     1 
ATOM   8214  C  CA    . GLU D 4  951  ? 14.831  -28.624 73.990  1.00 94.98  ? 951  GLU A CA    1 
ATOM   8215  C  C     . GLU D 4  951  ? 15.013  -29.830 73.081  1.00 94.65  ? 951  GLU A C     1 
ATOM   8216  O  O     . GLU D 4  951  ? 16.136  -30.136 72.667  1.00 101.11 ? 951  GLU A O     1 
ATOM   8217  C  CB    . GLU D 4  951  ? 15.147  -27.327 73.247  1.00 76.22  ? 951  GLU A CB    1 
ATOM   8218  C  CG    . GLU D 4  951  ? 14.316  -27.076 71.985  1.00 67.88  ? 951  GLU A CG    1 
ATOM   8219  C  CD    . GLU D 4  951  ? 12.811  -27.129 72.229  1.00 83.42  ? 951  GLU A CD    1 
ATOM   8220  O  OE1   . GLU D 4  951  ? 12.208  -26.053 72.424  1.00 88.08  ? 951  GLU A OE1   1 
ATOM   8221  O  OE2   . GLU D 4  951  ? 12.216  -28.228 72.178  1.00 87.97  ? 951  GLU A OE2   1 
ATOM   8222  N  N     . ALA D 4  952  ? 13.916  -30.529 72.791  1.00 80.75  ? 952  ALA A N     1 
ATOM   8223  C  CA    . ALA D 4  952  ? 14.012  -31.773 72.040  1.00 87.37  ? 952  ALA A CA    1 
ATOM   8224  C  C     . ALA D 4  952  ? 14.031  -31.547 70.534  1.00 103.34 ? 952  ALA A C     1 
ATOM   8225  O  O     . ALA D 4  952  ? 14.667  -32.317 69.808  1.00 117.22 ? 952  ALA A O     1 
ATOM   8226  C  CB    . ALA D 4  952  ? 12.852  -32.697 72.413  1.00 89.55  ? 952  ALA A CB    1 
ATOM   8227  N  N     . ASN D 4  953  ? 13.359  -30.507 70.053  1.00 91.57  ? 953  ASN A N     1 
ATOM   8228  C  CA    . ASN D 4  953  ? 13.141  -30.311 68.626  1.00 72.43  ? 953  ASN A CA    1 
ATOM   8229  C  C     . ASN D 4  953  ? 14.281  -29.484 68.044  1.00 67.06  ? 953  ASN A C     1 
ATOM   8230  O  O     . ASN D 4  953  ? 14.500  -28.343 68.462  1.00 66.73  ? 953  ASN A O     1 
ATOM   8231  C  CB    . ASN D 4  953  ? 11.795  -29.629 68.402  1.00 75.98  ? 953  ASN A CB    1 
ATOM   8232  C  CG    . ASN D 4  953  ? 10.751  -30.074 69.407  1.00 74.11  ? 953  ASN A CG    1 
ATOM   8233  O  OD1   . ASN D 4  953  ? 10.757  -31.221 69.852  1.00 69.89  ? 953  ASN A OD1   1 
ATOM   8234  N  ND2   . ASN D 4  953  ? 9.854   -29.167 69.777  1.00 81.39  ? 953  ASN A ND2   1 
ATOM   8235  N  N     . TRP D 4  954  ? 14.996  -30.050 67.072  1.00 66.72  ? 954  TRP A N     1 
ATOM   8236  C  CA    . TRP D 4  954  ? 16.179  -29.407 66.519  1.00 65.94  ? 954  TRP A CA    1 
ATOM   8237  C  C     . TRP D 4  954  ? 16.322  -29.827 65.063  1.00 80.23  ? 954  TRP A C     1 
ATOM   8238  O  O     . TRP D 4  954  ? 15.929  -30.946 64.713  1.00 95.92  ? 954  TRP A O     1 
ATOM   8239  C  CB    . TRP D 4  954  ? 17.429  -29.793 67.327  1.00 65.82  ? 954  TRP A CB    1 
ATOM   8240  C  CG    . TRP D 4  954  ? 17.513  -29.055 68.621  1.00 86.34  ? 954  TRP A CG    1 
ATOM   8241  C  CD1   . TRP D 4  954  ? 17.134  -29.518 69.843  1.00 95.16  ? 954  TRP A CD1   1 
ATOM   8242  C  CD2   . TRP D 4  954  ? 17.938  -27.704 68.818  1.00 93.04  ? 954  TRP A CD2   1 
ATOM   8243  N  NE1   . TRP D 4  954  ? 17.329  -28.552 70.799  1.00 90.53  ? 954  TRP A NE1   1 
ATOM   8244  C  CE2   . TRP D 4  954  ? 17.819  -27.426 70.194  1.00 83.55  ? 954  TRP A CE2   1 
ATOM   8245  C  CE3   . TRP D 4  954  ? 18.422  -26.707 67.969  1.00 99.45  ? 954  TRP A CE3   1 
ATOM   8246  C  CZ2   . TRP D 4  954  ? 18.166  -26.195 70.738  1.00 91.30  ? 954  TRP A CZ2   1 
ATOM   8247  C  CZ3   . TRP D 4  954  ? 18.761  -25.485 68.512  1.00 98.02  ? 954  TRP A CZ3   1 
ATOM   8248  C  CH2   . TRP D 4  954  ? 18.638  -25.241 69.883  1.00 95.00  ? 954  TRP A CH2   1 
ATOM   8249  N  N     . PRO D 4  955  ? 16.874  -28.970 64.194  1.00 71.97  ? 955  PRO A N     1 
ATOM   8250  C  CA    . PRO D 4  955  ? 16.897  -29.292 62.757  1.00 65.63  ? 955  PRO A CA    1 
ATOM   8251  C  C     . PRO D 4  955  ? 17.946  -30.341 62.409  1.00 76.19  ? 955  PRO A C     1 
ATOM   8252  O  O     . PRO D 4  955  ? 19.117  -30.218 62.776  1.00 73.66  ? 955  PRO A O     1 
ATOM   8253  C  CB    . PRO D 4  955  ? 17.208  -27.945 62.097  1.00 64.42  ? 955  PRO A CB    1 
ATOM   8254  C  CG    . PRO D 4  955  ? 17.995  -27.204 63.109  1.00 70.38  ? 955  PRO A CG    1 
ATOM   8255  C  CD    . PRO D 4  955  ? 17.553  -27.690 64.473  1.00 83.62  ? 955  PRO A CD    1 
ATOM   8256  N  N     . LEU D 4  956  ? 17.520  -31.371 61.674  1.00 91.57  ? 956  LEU A N     1 
ATOM   8257  C  CA    . LEU D 4  956  ? 18.362  -32.520 61.372  1.00 80.32  ? 956  LEU A CA    1 
ATOM   8258  C  C     . LEU D 4  956  ? 18.032  -33.034 59.976  1.00 79.58  ? 956  LEU A C     1 
ATOM   8259  O  O     . LEU D 4  956  ? 16.876  -32.947 59.547  1.00 85.35  ? 956  LEU A O     1 
ATOM   8260  C  CB    . LEU D 4  956  ? 18.179  -33.623 62.425  1.00 71.76  ? 956  LEU A CB    1 
ATOM   8261  C  CG    . LEU D 4  956  ? 19.105  -33.462 63.633  1.00 66.29  ? 956  LEU A CG    1 
ATOM   8262  C  CD1   . LEU D 4  956  ? 18.533  -34.157 64.858  1.00 81.16  ? 956  LEU A CD1   1 
ATOM   8263  C  CD2   . LEU D 4  956  ? 20.506  -33.966 63.326  1.00 66.24  ? 956  LEU A CD2   1 
ATOM   8264  N  N     . PRO D 4  957  ? 19.020  -33.582 59.254  1.00 81.74  ? 957  PRO A N     1 
ATOM   8265  C  CA    . PRO D 4  957  ? 18.882  -33.725 57.791  1.00 78.40  ? 957  PRO A CA    1 
ATOM   8266  C  C     . PRO D 4  957  ? 17.838  -34.723 57.294  1.00 94.03  ? 957  PRO A C     1 
ATOM   8267  O  O     . PRO D 4  957  ? 17.340  -34.543 56.176  1.00 127.22 ? 957  PRO A O     1 
ATOM   8268  C  CB    . PRO D 4  957  ? 20.286  -34.165 57.367  1.00 66.41  ? 957  PRO A CB    1 
ATOM   8269  C  CG    . PRO D 4  957  ? 21.169  -33.510 58.342  1.00 75.34  ? 957  PRO A CG    1 
ATOM   8270  C  CD    . PRO D 4  957  ? 20.439  -33.534 59.652  1.00 85.22  ? 957  PRO A CD    1 
ATOM   8271  N  N     . VAL D 4  958  ? 17.514  -35.778 58.035  1.00 72.23  ? 958  VAL A N     1 
ATOM   8272  C  CA    . VAL D 4  958  ? 16.664  -36.852 57.521  1.00 75.87  ? 958  VAL A CA    1 
ATOM   8273  C  C     . VAL D 4  958  ? 15.471  -37.028 58.450  1.00 85.07  ? 958  VAL A C     1 
ATOM   8274  O  O     . VAL D 4  958  ? 15.645  -37.276 59.649  1.00 109.61 ? 958  VAL A O     1 
ATOM   8275  C  CB    . VAL D 4  958  ? 17.429  -38.174 57.382  1.00 70.95  ? 958  VAL A CB    1 
ATOM   8276  C  CG1   . VAL D 4  958  ? 16.474  -39.317 57.067  1.00 70.82  ? 958  VAL A CG1   1 
ATOM   8277  C  CG2   . VAL D 4  958  ? 18.492  -38.067 56.317  1.00 69.23  ? 958  VAL A CG2   1 
ATOM   8278  N  N     . ASN D 4  959  ? 14.264  -36.933 57.893  1.00 69.69  ? 959  ASN A N     1 
ATOM   8279  C  CA    . ASN D 4  959  ? 13.037  -37.113 58.667  1.00 70.26  ? 959  ASN A CA    1 
ATOM   8280  C  C     . ASN D 4  959  ? 12.797  -38.611 58.799  1.00 76.18  ? 959  ASN A C     1 
ATOM   8281  O  O     . ASN D 4  959  ? 12.144  -39.239 57.966  1.00 98.44  ? 959  ASN A O     1 
ATOM   8282  C  CB    . ASN D 4  959  ? 11.870  -36.393 58.001  1.00 70.46  ? 959  ASN A CB    1 
ATOM   8283  C  CG    . ASN D 4  959  ? 10.629  -36.316 58.890  1.00 72.50  ? 959  ASN A CG    1 
ATOM   8284  O  OD1   . ASN D 4  959  ? 10.152  -37.323 59.415  1.00 74.73  ? 959  ASN A OD1   1 
ATOM   8285  N  ND2   . ASN D 4  959  ? 10.106  -35.109 59.063  1.00 76.38  ? 959  ASN A ND2   1 
ATOM   8286  N  N     . ILE D 4  960  ? 13.348  -39.189 59.872  1.00 74.20  ? 960  ILE A N     1 
ATOM   8287  C  CA    . ILE D 4  960  ? 13.162  -40.609 60.158  1.00 80.10  ? 960  ILE A CA    1 
ATOM   8288  C  C     . ILE D 4  960  ? 11.706  -40.894 60.513  1.00 89.84  ? 960  ILE A C     1 
ATOM   8289  O  O     . ILE D 4  960  ? 11.178  -41.968 60.195  1.00 96.88  ? 960  ILE A O     1 
ATOM   8290  C  CB    . ILE D 4  960  ? 14.151  -41.021 61.268  1.00 72.08  ? 960  ILE A CB    1 
ATOM   8291  C  CG1   . ILE D 4  960  ? 15.531  -41.279 60.672  1.00 71.76  ? 960  ILE A CG1   1 
ATOM   8292  C  CG2   . ILE D 4  960  ? 13.710  -42.275 62.003  1.00 73.08  ? 960  ILE A CG2   1 
ATOM   8293  C  CD1   . ILE D 4  960  ? 16.660  -40.857 61.569  1.00 71.07  ? 960  ILE A CD1   1 
ATOM   8294  N  N     . ARG D 4  961  ? 11.024  -39.915 61.119  1.00 83.42  ? 961  ARG A N     1 
ATOM   8295  C  CA    . ARG D 4  961  ? 9.610   -40.045 61.464  1.00 78.37  ? 961  ARG A CA    1 
ATOM   8296  C  C     . ARG D 4  961  ? 8.733   -40.315 60.244  1.00 78.30  ? 961  ARG A C     1 
ATOM   8297  O  O     . ARG D 4  961  ? 7.691   -40.969 60.367  1.00 79.15  ? 961  ARG A O     1 
ATOM   8298  C  CB    . ARG D 4  961  ? 9.142   -38.769 62.165  1.00 82.69  ? 961  ARG A CB    1 
ATOM   8299  C  CG    . ARG D 4  961  ? 7.893   -38.891 63.018  1.00 87.67  ? 961  ARG A CG    1 
ATOM   8300  C  CD    . ARG D 4  961  ? 8.125   -38.322 64.415  1.00 107.08 ? 961  ARG A CD    1 
ATOM   8301  N  NE    . ARG D 4  961  ? 8.114   -36.858 64.427  1.00 115.07 ? 961  ARG A NE    1 
ATOM   8302  C  CZ    . ARG D 4  961  ? 9.205   -36.096 64.424  1.00 89.12  ? 961  ARG A CZ    1 
ATOM   8303  N  NH1   . ARG D 4  961  ? 10.407  -36.654 64.431  1.00 71.41  ? 961  ARG A NH1   1 
ATOM   8304  N  NH2   . ARG D 4  961  ? 9.095   -34.774 64.430  1.00 75.98  ? 961  ARG A NH2   1 
ATOM   8305  N  N     . ARG D 4  962  ? 9.132   -39.831 59.066  1.00 86.02  ? 962  ARG A N     1 
ATOM   8306  C  CA    . ARG D 4  962  ? 8.341   -40.036 57.860  1.00 92.32  ? 962  ARG A CA    1 
ATOM   8307  C  C     . ARG D 4  962  ? 8.732   -41.291 57.094  1.00 93.38  ? 962  ARG A C     1 
ATOM   8308  O  O     . ARG D 4  962  ? 7.872   -41.895 56.443  1.00 98.09  ? 962  ARG A O     1 
ATOM   8309  C  CB    . ARG D 4  962  ? 8.458   -38.828 56.923  1.00 88.91  ? 962  ARG A CB    1 
ATOM   8310  C  CG    . ARG D 4  962  ? 7.128   -38.123 56.675  1.00 90.23  ? 962  ARG A CG    1 
ATOM   8311  C  CD    . ARG D 4  962  ? 7.169   -37.159 55.492  1.00 85.11  ? 962  ARG A CD    1 
ATOM   8312  N  NE    . ARG D 4  962  ? 8.066   -36.026 55.686  1.00 82.43  ? 962  ARG A NE    1 
ATOM   8313  C  CZ    . ARG D 4  962  ? 9.268   -35.921 55.130  1.00 81.41  ? 962  ARG A CZ    1 
ATOM   8314  N  NH1   . ARG D 4  962  ? 9.719   -36.885 54.340  1.00 77.29  ? 962  ARG A NH1   1 
ATOM   8315  N  NH2   . ARG D 4  962  ? 10.017  -34.852 55.357  1.00 70.88  ? 962  ARG A NH2   1 
ATOM   8316  N  N     . ILE D 4  963  ? 10.006  -41.692 57.148  1.00 87.96  ? 963  ILE A N     1 
ATOM   8317  C  CA    . ILE D 4  963  ? 10.430  -42.928 56.493  1.00 75.75  ? 963  ILE A CA    1 
ATOM   8318  C  C     . ILE D 4  963  ? 9.768   -44.136 57.146  1.00 76.92  ? 963  ILE A C     1 
ATOM   8319  O  O     . ILE D 4  963  ? 9.453   -45.122 56.470  1.00 85.57  ? 963  ILE A O     1 
ATOM   8320  C  CB    . ILE D 4  963  ? 11.968  -43.036 56.524  1.00 75.02  ? 963  ILE A CB    1 
ATOM   8321  C  CG1   . ILE D 4  963  ? 12.599  -41.782 55.912  1.00 74.59  ? 963  ILE A CG1   1 
ATOM   8322  C  CG2   . ILE D 4  963  ? 12.440  -44.280 55.781  1.00 75.91  ? 963  ILE A CG2   1 
ATOM   8323  C  CD1   . ILE D 4  963  ? 14.051  -41.940 55.514  1.00 73.47  ? 963  ILE A CD1   1 
ATOM   8324  N  N     . ILE D 4  964  ? 9.527   -44.072 58.455  1.00 79.39  ? 964  ILE A N     1 
ATOM   8325  C  CA    . ILE D 4  964  ? 8.877   -45.176 59.152  1.00 88.30  ? 964  ILE A CA    1 
ATOM   8326  C  C     . ILE D 4  964  ? 7.418   -45.281 58.721  1.00 98.13  ? 964  ILE A C     1 
ATOM   8327  O  O     . ILE D 4  964  ? 6.892   -46.383 58.516  1.00 107.92 ? 964  ILE A O     1 
ATOM   8328  C  CB    . ILE D 4  964  ? 9.035   -44.997 60.678  1.00 83.34  ? 964  ILE A CB    1 
ATOM   8329  C  CG1   . ILE D 4  964  ? 10.272  -45.734 61.220  1.00 77.33  ? 964  ILE A CG1   1 
ATOM   8330  C  CG2   . ILE D 4  964  ? 7.802   -45.443 61.442  1.00 78.60  ? 964  ILE A CG2   1 
ATOM   8331  C  CD1   . ILE D 4  964  ? 11.599  -45.397 60.566  1.00 76.43  ? 964  ILE A CD1   1 
ATOM   8332  N  N     . GLN D 4  965  ? 6.754   -44.138 58.537  1.00 82.39  ? 965  GLN A N     1 
ATOM   8333  C  CA    . GLN D 4  965  ? 5.394   -44.151 58.009  1.00 82.38  ? 965  GLN A CA    1 
ATOM   8334  C  C     . GLN D 4  965  ? 5.365   -44.516 56.536  1.00 81.64  ? 965  GLN A C     1 
ATOM   8335  O  O     . GLN D 4  965  ? 4.353   -45.040 56.053  1.00 87.67  ? 965  GLN A O     1 
ATOM   8336  C  CB    . GLN D 4  965  ? 4.733   -42.798 58.222  1.00 96.44  ? 965  GLN A CB    1 
ATOM   8337  C  CG    . GLN D 4  965  ? 4.751   -42.323 59.645  1.00 109.98 ? 965  GLN A CG    1 
ATOM   8338  C  CD    . GLN D 4  965  ? 3.999   -41.027 59.802  1.00 118.99 ? 965  GLN A CD    1 
ATOM   8339  O  OE1   . GLN D 4  965  ? 2.847   -41.022 60.221  1.00 123.16 ? 965  GLN A OE1   1 
ATOM   8340  N  NE2   . GLN D 4  965  ? 4.658   -39.914 59.497  1.00 117.65 ? 965  GLN A NE2   1 
ATOM   8341  N  N     . ASN D 4  966  ? 6.446   -44.225 55.808  1.00 88.89  ? 966  ASN A N     1 
ATOM   8342  C  CA    . ASN D 4  966  ? 6.572   -44.706 54.437  1.00 93.54  ? 966  ASN A CA    1 
ATOM   8343  C  C     . ASN D 4  966  ? 6.579   -46.230 54.391  1.00 97.71  ? 966  ASN A C     1 
ATOM   8344  O  O     . ASN D 4  966  ? 5.926   -46.833 53.534  1.00 103.34 ? 966  ASN A O     1 
ATOM   8345  C  CB    . ASN D 4  966  ? 7.849   -44.157 53.800  1.00 91.55  ? 966  ASN A CB    1 
ATOM   8346  C  CG    . ASN D 4  966  ? 7.703   -42.738 53.297  1.00 97.63  ? 966  ASN A CG    1 
ATOM   8347  O  OD1   . ASN D 4  966  ? 6.697   -42.081 53.530  1.00 90.95  ? 966  ASN A OD1   1 
ATOM   8348  N  ND2   . ASN D 4  966  ? 8.718   -42.262 52.589  1.00 101.75 ? 966  ASN A ND2   1 
ATOM   8349  N  N     . ALA D 4  967  ? 7.303   -46.868 55.318  1.00 96.60  ? 967  ALA A N     1 
ATOM   8350  C  CA    . ALA D 4  967  ? 7.380   -48.324 55.356  1.00 82.57  ? 967  ALA A CA    1 
ATOM   8351  C  C     . ALA D 4  967  ? 6.163   -48.953 56.021  1.00 85.02  ? 967  ALA A C     1 
ATOM   8352  O  O     . ALA D 4  967  ? 5.807   -50.090 55.690  1.00 88.18  ? 967  ALA A O     1 
ATOM   8353  C  CB    . ALA D 4  967  ? 8.652   -48.767 56.080  1.00 81.65  ? 967  ALA A CB    1 
ATOM   8354  N  N     . GLN D 4  968  ? 5.522   -48.243 56.955  1.00 89.05  ? 968  GLN A N     1 
ATOM   8355  C  CA    . GLN D 4  968  ? 4.273   -48.715 57.544  1.00 99.72  ? 968  GLN A CA    1 
ATOM   8356  C  C     . GLN D 4  968  ? 3.142   -48.787 56.528  1.00 106.93 ? 968  GLN A C     1 
ATOM   8357  O  O     . GLN D 4  968  ? 2.146   -49.471 56.780  1.00 114.97 ? 968  GLN A O     1 
ATOM   8358  C  CB    . GLN D 4  968  ? 3.847   -47.805 58.698  1.00 109.64 ? 968  GLN A CB    1 
ATOM   8359  C  CG    . GLN D 4  968  ? 4.083   -48.381 60.081  1.00 113.01 ? 968  GLN A CG    1 
ATOM   8360  C  CD    . GLN D 4  968  ? 3.880   -47.357 61.177  1.00 103.16 ? 968  GLN A CD    1 
ATOM   8361  O  OE1   . GLN D 4  968  ? 4.779   -46.583 61.484  1.00 81.65  ? 968  GLN A OE1   1 
ATOM   8362  N  NE2   . GLN D 4  968  ? 2.694   -47.351 61.774  1.00 107.35 ? 968  GLN A NE2   1 
ATOM   8363  N  N     . GLN D 4  969  ? 3.269   -48.093 55.399  1.00 105.79 ? 969  GLN A N     1 
ATOM   8364  C  CA    . GLN D 4  969  ? 2.250   -48.054 54.362  1.00 106.22 ? 969  GLN A CA    1 
ATOM   8365  C  C     . GLN D 4  969  ? 2.644   -48.794 53.098  1.00 96.88  ? 969  GLN A C     1 
ATOM   8366  O  O     . GLN D 4  969  ? 1.784   -49.393 52.450  1.00 104.54 ? 969  GLN A O     1 
ATOM   8367  C  CB    . GLN D 4  969  ? 1.931   -46.602 54.008  1.00 106.74 ? 969  GLN A CB    1 
ATOM   8368  C  CG    . GLN D 4  969  ? 0.833   -46.002 54.862  1.00 119.10 ? 969  GLN A CG    1 
ATOM   8369  C  CD    . GLN D 4  969  ? -0.369  -46.911 54.975  1.00 140.22 ? 969  GLN A CD    1 
ATOM   8370  O  OE1   . GLN D 4  969  ? -1.031  -47.215 53.982  1.00 147.72 ? 969  GLN A OE1   1 
ATOM   8371  N  NE2   . GLN D 4  969  ? -0.646  -47.371 56.189  1.00 145.04 ? 969  GLN A NE2   1 
ATOM   8372  N  N     . THR D 4  970  ? 3.928   -48.759 52.726  1.00 85.96  ? 970  THR A N     1 
ATOM   8373  C  CA    . THR D 4  970  ? 4.386   -49.504 51.558  1.00 86.69  ? 970  THR A CA    1 
ATOM   8374  C  C     . THR D 4  970  ? 4.258   -51.005 51.778  1.00 91.29  ? 970  THR A C     1 
ATOM   8375  O  O     . THR D 4  970  ? 3.861   -51.744 50.869  1.00 102.65 ? 970  THR A O     1 
ATOM   8376  C  CB    . THR D 4  970  ? 5.839   -49.138 51.240  1.00 85.37  ? 970  THR A CB    1 
ATOM   8377  O  OG1   . THR D 4  970  ? 5.939   -47.726 51.014  1.00 84.08  ? 970  THR A OG1   1 
ATOM   8378  C  CG2   . THR D 4  970  ? 6.335   -49.874 50.005  1.00 86.21  ? 970  THR A CG2   1 
ATOM   8379  N  N     . PHE D 4  971  ? 4.557   -51.469 52.986  1.00 94.84  ? 971  PHE A N     1 
ATOM   8380  C  CA    . PHE D 4  971  ? 4.634   -52.894 53.260  1.00 97.11  ? 971  PHE A CA    1 
ATOM   8381  C  C     . PHE D 4  971  ? 3.416   -53.430 53.995  1.00 116.51 ? 971  PHE A C     1 
ATOM   8382  O  O     . PHE D 4  971  ? 3.392   -54.621 54.323  1.00 118.87 ? 971  PHE A O     1 
ATOM   8383  C  CB    . PHE D 4  971  ? 5.907   -53.199 54.051  1.00 88.28  ? 971  PHE A CB    1 
ATOM   8384  C  CG    . PHE D 4  971  ? 7.163   -52.880 53.297  1.00 87.35  ? 971  PHE A CG    1 
ATOM   8385  C  CD1   . PHE D 4  971  ? 7.758   -51.632 53.402  1.00 90.94  ? 971  PHE A CD1   1 
ATOM   8386  C  CD2   . PHE D 4  971  ? 7.723   -53.812 52.444  1.00 88.27  ? 971  PHE A CD2   1 
ATOM   8387  C  CE1   . PHE D 4  971  ? 8.907   -51.335 52.695  1.00 89.52  ? 971  PHE A CE1   1 
ATOM   8388  C  CE2   . PHE D 4  971  ? 8.868   -53.519 51.731  1.00 87.55  ? 971  PHE A CE2   1 
ATOM   8389  C  CZ    . PHE D 4  971  ? 9.462   -52.281 51.859  1.00 86.19  ? 971  PHE A CZ    1 
ATOM   8390  N  N     . HIS D 4  972  ? 2.416   -52.579 54.251  1.00 125.60 ? 972  HIS A N     1 
ATOM   8391  C  CA    . HIS D 4  972  ? 1.114   -52.961 54.808  1.00 125.45 ? 972  HIS A CA    1 
ATOM   8392  C  C     . HIS D 4  972  ? 1.269   -53.695 56.142  1.00 127.00 ? 972  HIS A C     1 
ATOM   8393  O  O     . HIS D 4  972  ? 0.937   -54.874 56.280  1.00 139.93 ? 972  HIS A O     1 
ATOM   8394  C  CB    . HIS D 4  972  ? 0.313   -53.796 53.802  1.00 126.26 ? 972  HIS A CB    1 
ATOM   8395  C  CG    . HIS D 4  972  ? -0.380  -52.979 52.756  1.00 131.99 ? 972  HIS A CG    1 
ATOM   8396  N  ND1   . HIS D 4  972  ? 0.247   -52.560 51.602  1.00 133.85 ? 972  HIS A ND1   1 
ATOM   8397  C  CD2   . HIS D 4  972  ? -1.649  -52.511 52.684  1.00 133.97 ? 972  HIS A CD2   1 
ATOM   8398  C  CE1   . HIS D 4  972  ? -0.603  -51.865 50.868  1.00 131.07 ? 972  HIS A CE1   1 
ATOM   8399  N  NE2   . HIS D 4  972  ? -1.761  -51.821 51.501  1.00 132.26 ? 972  HIS A NE2   1 
ATOM   8400  N  N     . ILE D 4  973  ? 1.806   -52.963 57.122  1.00 130.92 ? 973  ILE A N     1 
ATOM   8401  C  CA    . ILE D 4  973  ? 2.040   -53.520 58.451  1.00 133.40 ? 973  ILE A CA    1 
ATOM   8402  C  C     . ILE D 4  973  ? 0.700   -53.855 59.093  1.00 155.65 ? 973  ILE A C     1 
ATOM   8403  O  O     . ILE D 4  973  ? -0.255  -53.071 59.028  1.00 161.65 ? 973  ILE A O     1 
ATOM   8404  C  CB    . ILE D 4  973  ? 2.872   -52.536 59.296  1.00 116.65 ? 973  ILE A CB    1 
ATOM   8405  C  CG1   . ILE D 4  973  ? 4.380   -52.834 59.211  1.00 99.97  ? 973  ILE A CG1   1 
ATOM   8406  C  CG2   . ILE D 4  973  ? 2.440   -52.522 60.757  1.00 122.98 ? 973  ILE A CG2   1 
ATOM   8407  C  CD1   . ILE D 4  973  ? 4.982   -52.883 57.823  1.00 88.17  ? 973  ILE A CD1   1 
ATOM   8408  N  N     . ASP D 4  974  ? 0.611   -55.049 59.685  1.00 170.58 ? 974  ASP A N     1 
ATOM   8409  C  CA    . ASP D 4  974  ? -0.642  -55.531 60.247  1.00 187.75 ? 974  ASP A CA    1 
ATOM   8410  C  C     . ASP D 4  974  ? -0.670  -55.554 61.769  1.00 192.32 ? 974  ASP A C     1 
ATOM   8411  O  O     . ASP D 4  974  ? -1.725  -55.853 62.338  1.00 205.56 ? 974  ASP A O     1 
ATOM   8412  C  CB    . ASP D 4  974  ? -0.955  -56.938 59.715  1.00 190.75 ? 974  ASP A CB    1 
ATOM   8413  C  CG    . ASP D 4  974  ? 0.111   -57.947 60.076  1.00 186.56 ? 974  ASP A CG    1 
ATOM   8414  O  OD1   . ASP D 4  974  ? 1.310   -57.606 59.995  1.00 185.45 ? 974  ASP A OD1   1 
ATOM   8415  O  OD2   . ASP D 4  974  ? -0.254  -59.079 60.452  1.00 185.04 ? 974  ASP A OD2   1 
ATOM   8416  N  N     . HIS D 4  975  ? 0.456   -55.279 62.435  1.00 178.44 ? 975  HIS A N     1 
ATOM   8417  C  CA    . HIS D 4  975  ? 0.578   -55.052 63.877  1.00 166.66 ? 975  HIS A CA    1 
ATOM   8418  C  C     . HIS D 4  975  ? 0.240   -56.261 64.746  1.00 157.59 ? 975  HIS A C     1 
ATOM   8419  O  O     . HIS D 4  975  ? 0.157   -56.115 65.971  1.00 149.70 ? 975  HIS A O     1 
ATOM   8420  C  CB    . HIS D 4  975  ? -0.281  -53.867 64.340  1.00 163.78 ? 975  HIS A CB    1 
ATOM   8421  C  CG    . HIS D 4  975  ? 0.414   -52.543 64.263  1.00 159.33 ? 975  HIS A CG    1 
ATOM   8422  N  ND1   . HIS D 4  975  ? 1.774   -52.423 64.080  1.00 158.17 ? 975  HIS A ND1   1 
ATOM   8423  C  CD2   . HIS D 4  975  ? -0.068  -51.280 64.336  1.00 157.12 ? 975  HIS A CD2   1 
ATOM   8424  C  CE1   . HIS D 4  975  ? 2.101   -51.144 64.049  1.00 152.70 ? 975  HIS A CE1   1 
ATOM   8425  N  NE2   . HIS D 4  975  ? 1.001   -50.429 64.201  1.00 153.17 ? 975  HIS A NE2   1 
ATOM   8426  N  N     . THR D 4  976  ? 0.028   -57.446 64.167  1.00 158.52 ? 976  THR A N     1 
ATOM   8427  C  CA    . THR D 4  976  ? -0.190  -58.653 64.959  1.00 160.50 ? 976  THR A CA    1 
ATOM   8428  C  C     . THR D 4  976  ? 0.840   -59.743 64.717  1.00 151.97 ? 976  THR A C     1 
ATOM   8429  O  O     . THR D 4  976  ? 1.113   -60.520 65.636  1.00 146.68 ? 976  THR A O     1 
ATOM   8430  C  CB    . THR D 4  976  ? -1.586  -59.256 64.705  1.00 169.00 ? 976  THR A CB    1 
ATOM   8431  O  OG1   . THR D 4  976  ? -1.529  -60.161 63.595  1.00 172.68 ? 976  THR A OG1   1 
ATOM   8432  C  CG2   . THR D 4  976  ? -2.629  -58.180 64.448  1.00 170.05 ? 976  THR A CG2   1 
ATOM   8433  N  N     . LYS D 4  977  ? 1.400   -59.836 63.514  1.00 147.59 ? 977  LYS A N     1 
ATOM   8434  C  CA    . LYS D 4  977  ? 2.437   -60.823 63.263  1.00 142.57 ? 977  LYS A CA    1 
ATOM   8435  C  C     . LYS D 4  977  ? 3.700   -60.462 64.037  1.00 135.08 ? 977  LYS A C     1 
ATOM   8436  O  O     . LYS D 4  977  ? 4.058   -59.285 64.134  1.00 139.29 ? 977  LYS A O     1 
ATOM   8437  C  CB    . LYS D 4  977  ? 2.772   -60.915 61.774  1.00 146.77 ? 977  LYS A CB    1 
ATOM   8438  C  CG    . LYS D 4  977  ? 1.829   -61.768 60.949  1.00 155.67 ? 977  LYS A CG    1 
ATOM   8439  C  CD    . LYS D 4  977  ? 1.882   -61.357 59.485  1.00 160.02 ? 977  LYS A CD    1 
ATOM   8440  C  CE    . LYS D 4  977  ? 0.625   -61.780 58.745  1.00 160.17 ? 977  LYS A CE    1 
ATOM   8441  N  NZ    . LYS D 4  977  ? -0.106  -60.610 58.185  1.00 153.58 ? 977  LYS A NZ    1 
ATOM   8442  N  N     . PRO D 4  978  ? 4.383   -61.444 64.616  1.00 115.32 ? 978  PRO A N     1 
ATOM   8443  C  CA    . PRO D 4  978  ? 5.723   -61.184 65.141  1.00 102.89 ? 978  PRO A CA    1 
ATOM   8444  C  C     . PRO D 4  978  ? 6.709   -61.014 63.998  1.00 94.14  ? 978  PRO A C     1 
ATOM   8445  O  O     . PRO D 4  978  ? 6.642   -61.719 62.988  1.00 101.39 ? 978  PRO A O     1 
ATOM   8446  C  CB    . PRO D 4  978  ? 6.032   -62.434 65.975  1.00 96.20  ? 978  PRO A CB    1 
ATOM   8447  C  CG    . PRO D 4  978  ? 4.731   -63.163 66.114  1.00 97.01  ? 978  PRO A CG    1 
ATOM   8448  C  CD    . PRO D 4  978  ? 3.935   -62.814 64.905  1.00 97.90  ? 978  PRO A CD    1 
ATOM   8449  N  N     . SER D 4  979  ? 7.619   -60.059 64.166  1.00 91.83  ? 979  SER A N     1 
ATOM   8450  C  CA    . SER D 4  979  ? 8.577   -59.718 63.127  1.00 91.04  ? 979  SER A CA    1 
ATOM   8451  C  C     . SER D 4  979  ? 9.532   -60.877 62.857  1.00 91.82  ? 979  SER A C     1 
ATOM   8452  O  O     . SER D 4  979  ? 9.692   -61.793 63.666  1.00 112.94 ? 979  SER A O     1 
ATOM   8453  C  CB    . SER D 4  979  ? 9.375   -58.483 63.530  1.00 91.83  ? 979  SER A CB    1 
ATOM   8454  O  OG    . SER D 4  979  ? 10.661  -58.514 62.943  1.00 95.71  ? 979  SER A OG    1 
ATOM   8455  N  N     . ASP D 4  980  ? 10.170  -60.832 61.693  1.00 91.66  ? 980  ASP A N     1 
ATOM   8456  C  CA    . ASP D 4  980  ? 11.161  -61.827 61.300  1.00 99.06  ? 980  ASP A CA    1 
ATOM   8457  C  C     . ASP D 4  980  ? 12.565  -61.235 61.332  1.00 92.23  ? 980  ASP A C     1 
ATOM   8458  O  O     . ASP D 4  980  ? 13.416  -61.552 60.501  1.00 96.52  ? 980  ASP A O     1 
ATOM   8459  C  CB    . ASP D 4  980  ? 10.851  -62.398 59.920  1.00 105.18 ? 980  ASP A CB    1 
ATOM   8460  C  CG    . ASP D 4  980  ? 10.616  -61.325 58.876  1.00 101.45 ? 980  ASP A CG    1 
ATOM   8461  O  OD1   . ASP D 4  980  ? 9.534   -60.702 58.890  1.00 106.09 ? 980  ASP A OD1   1 
ATOM   8462  O  OD2   . ASP D 4  980  ? 11.509  -61.118 58.029  1.00 98.38  ? 980  ASP A OD2   1 
ATOM   8463  N  N     . LEU D 4  981  ? 12.816  -60.361 62.300  1.00 89.75  ? 981  LEU A N     1 
ATOM   8464  C  CA    . LEU D 4  981  ? 14.105  -59.701 62.448  1.00 88.48  ? 981  LEU A CA    1 
ATOM   8465  C  C     . LEU D 4  981  ? 14.939  -60.410 63.503  1.00 102.31 ? 981  LEU A C     1 
ATOM   8466  O  O     . LEU D 4  981  ? 14.484  -60.610 64.631  1.00 93.35  ? 981  LEU A O     1 
ATOM   8467  C  CB    . LEU D 4  981  ? 13.937  -58.231 62.833  1.00 86.88  ? 981  LEU A CB    1 
ATOM   8468  C  CG    . LEU D 4  981  ? 13.683  -57.232 61.706  1.00 86.12  ? 981  LEU A CG    1 
ATOM   8469  C  CD1   . LEU D 4  981  ? 12.813  -56.083 62.178  1.00 85.20  ? 981  LEU A CD1   1 
ATOM   8470  C  CD2   . LEU D 4  981  ? 15.007  -56.722 61.177  1.00 85.21  ? 981  LEU A CD2   1 
ATOM   8471  N  N     . THR D 4  982  ? 16.156  -60.782 63.133  1.00 100.55 ? 982  THR A N     1 
ATOM   8472  C  CA    . THR D 4  982  ? 17.130  -61.173 64.136  1.00 88.90  ? 982  THR A CA    1 
ATOM   8473  C  C     . THR D 4  982  ? 17.507  -59.943 64.951  1.00 88.84  ? 982  THR A C     1 
ATOM   8474  O  O     . THR D 4  982  ? 17.559  -58.827 64.425  1.00 89.74  ? 982  THR A O     1 
ATOM   8475  C  CB    . THR D 4  982  ? 18.367  -61.784 63.474  1.00 89.46  ? 982  THR A CB    1 
ATOM   8476  O  OG1   . THR D 4  982  ? 17.958  -62.774 62.523  1.00 94.32  ? 982  THR A OG1   1 
ATOM   8477  C  CG2   . THR D 4  982  ? 19.270  -62.455 64.504  1.00 100.27 ? 982  THR A CG2   1 
ATOM   8478  N  N     . ILE D 4  983  ? 17.724  -60.143 66.251  1.00 87.74  ? 983  ILE A N     1 
ATOM   8479  C  CA    . ILE D 4  983  ? 18.276  -59.085 67.093  1.00 86.01  ? 983  ILE A CA    1 
ATOM   8480  C  C     . ILE D 4  983  ? 19.636  -58.644 66.562  1.00 85.35  ? 983  ILE A C     1 
ATOM   8481  O  O     . ILE D 4  983  ? 19.976  -57.453 66.584  1.00 97.97  ? 983  ILE A O     1 
ATOM   8482  C  CB    . ILE D 4  983  ? 18.340  -59.575 68.553  1.00 86.43  ? 983  ILE A CB    1 
ATOM   8483  C  CG1   . ILE D 4  983  ? 16.960  -59.440 69.206  1.00 86.58  ? 983  ILE A CG1   1 
ATOM   8484  C  CG2   . ILE D 4  983  ? 19.435  -58.875 69.347  1.00 85.48  ? 983  ILE A CG2   1 
ATOM   8485  C  CD1   . ILE D 4  983  ? 16.984  -59.521 70.705  1.00 86.66  ? 983  ILE A CD1   1 
ATOM   8486  N  N     . LYS D 4  984  ? 20.409  -59.592 66.026  1.00 87.58  ? 984  LYS A N     1 
ATOM   8487  C  CA    . LYS D 4  984  ? 21.667  -59.264 65.365  1.00 89.02  ? 984  LYS A CA    1 
ATOM   8488  C  C     . LYS D 4  984  ? 21.452  -58.438 64.102  1.00 96.66  ? 984  LYS A C     1 
ATOM   8489  O  O     . LYS D 4  984  ? 22.337  -57.667 63.719  1.00 103.16 ? 984  LYS A O     1 
ATOM   8490  C  CB    . LYS D 4  984  ? 22.420  -60.548 65.021  1.00 89.27  ? 984  LYS A CB    1 
ATOM   8491  C  CG    . LYS D 4  984  ? 22.876  -61.352 66.222  1.00 88.10  ? 984  LYS A CG    1 
ATOM   8492  C  CD    . LYS D 4  984  ? 24.178  -62.081 65.941  1.00 89.00  ? 984  LYS A CD    1 
ATOM   8493  C  CE    . LYS D 4  984  ? 23.913  -63.449 65.334  1.00 90.68  ? 984  LYS A CE    1 
ATOM   8494  N  NZ    . LYS D 4  984  ? 22.862  -64.190 66.083  1.00 91.42  ? 984  LYS A NZ    1 
ATOM   8495  N  N     . ASP D 4  985  ? 20.303  -58.591 63.435  1.00 101.02 ? 985  ASP A N     1 
ATOM   8496  C  CA    . ASP D 4  985  ? 20.056  -57.837 62.207  1.00 107.46 ? 985  ASP A CA    1 
ATOM   8497  C  C     . ASP D 4  985  ? 19.882  -56.352 62.499  1.00 99.59  ? 985  ASP A C     1 
ATOM   8498  O  O     . ASP D 4  985  ? 20.427  -55.503 61.785  1.00 108.68 ? 985  ASP A O     1 
ATOM   8499  C  CB    . ASP D 4  985  ? 18.822  -58.379 61.481  1.00 114.08 ? 985  ASP A CB    1 
ATOM   8500  C  CG    . ASP D 4  985  ? 19.099  -59.660 60.720  1.00 114.31 ? 985  ASP A CG    1 
ATOM   8501  O  OD1   . ASP D 4  985  ? 20.275  -59.923 60.394  1.00 115.23 ? 985  ASP A OD1   1 
ATOM   8502  O  OD2   . ASP D 4  985  ? 18.132  -60.399 60.438  1.00 111.62 ? 985  ASP A OD2   1 
ATOM   8503  N  N     . ILE D 4  986  ? 19.126  -56.024 63.547  1.00 92.44  ? 986  ILE A N     1 
ATOM   8504  C  CA    . ILE D 4  986  ? 18.879  -54.626 63.891  1.00 82.21  ? 986  ILE A CA    1 
ATOM   8505  C  C     . ILE D 4  986  ? 20.152  -53.967 64.400  1.00 80.76  ? 986  ILE A C     1 
ATOM   8506  O  O     . ILE D 4  986  ? 20.618  -52.966 63.843  1.00 79.80  ? 986  ILE A O     1 
ATOM   8507  C  CB    . ILE D 4  986  ? 17.756  -54.516 64.935  1.00 81.68  ? 986  ILE A CB    1 
ATOM   8508  C  CG1   . ILE D 4  986  ? 16.490  -55.220 64.450  1.00 82.73  ? 986  ILE A CG1   1 
ATOM   8509  C  CG2   . ILE D 4  986  ? 17.493  -53.058 65.272  1.00 80.34  ? 986  ILE A CG2   1 
ATOM   8510  C  CD1   . ILE D 4  986  ? 15.312  -55.022 65.369  1.00 82.82  ? 986  ILE A CD1   1 
ATOM   8511  N  N     . VAL D 4  987  ? 20.726  -54.528 65.467  1.00 81.14  ? 987  VAL A N     1 
ATOM   8512  C  CA    . VAL D 4  987  ? 21.794  -53.857 66.205  1.00 91.34  ? 987  VAL A CA    1 
ATOM   8513  C  C     . VAL D 4  987  ? 23.047  -53.729 65.346  1.00 107.80 ? 987  VAL A C     1 
ATOM   8514  O  O     . VAL D 4  987  ? 23.650  -52.653 65.260  1.00 105.47 ? 987  VAL A O     1 
ATOM   8515  C  CB    . VAL D 4  987  ? 22.072  -54.609 67.519  1.00 81.01  ? 987  VAL A CB    1 
ATOM   8516  C  CG1   . VAL D 4  987  ? 23.497  -54.374 68.007  1.00 80.74  ? 987  VAL A CG1   1 
ATOM   8517  C  CG2   . VAL D 4  987  ? 21.069  -54.199 68.575  1.00 80.70  ? 987  VAL A CG2   1 
ATOM   8518  N  N     . LEU D 4  988  ? 23.441  -54.812 64.676  1.00 100.33 ? 988  LEU A N     1 
ATOM   8519  C  CA    . LEU D 4  988  ? 24.593  -54.732 63.791  1.00 91.18  ? 988  LEU A CA    1 
ATOM   8520  C  C     . LEU D 4  988  ? 24.272  -54.021 62.484  1.00 87.66  ? 988  LEU A C     1 
ATOM   8521  O  O     . LEU D 4  988  ? 25.197  -53.584 61.796  1.00 84.27  ? 988  LEU A O     1 
ATOM   8522  C  CB    . LEU D 4  988  ? 25.143  -56.127 63.496  1.00 83.79  ? 988  LEU A CB    1 
ATOM   8523  C  CG    . LEU D 4  988  ? 26.669  -56.235 63.489  1.00 87.00  ? 988  LEU A CG    1 
ATOM   8524  C  CD1   . LEU D 4  988  ? 27.221  -56.028 64.886  1.00 85.42  ? 988  LEU A CD1   1 
ATOM   8525  C  CD2   . LEU D 4  988  ? 27.115  -57.574 62.927  1.00 88.24  ? 988  LEU A CD2   1 
ATOM   8526  N  N     . GLY D 4  989  ? 22.993  -53.892 62.134  1.00 94.52  ? 989  GLY A N     1 
ATOM   8527  C  CA    . GLY D 4  989  ? 22.584  -53.198 60.925  1.00 99.68  ? 989  GLY A CA    1 
ATOM   8528  C  C     . GLY D 4  989  ? 22.552  -51.695 61.086  1.00 95.74  ? 989  GLY A C     1 
ATOM   8529  O  O     . GLY D 4  989  ? 22.976  -50.961 60.190  1.00 111.46 ? 989  GLY A O     1 
ATOM   8530  N  N     . VAL D 4  990  ? 22.038  -51.230 62.227  1.00 82.86  ? 990  VAL A N     1 
ATOM   8531  C  CA    . VAL D 4  990  ? 22.085  -49.806 62.541  1.00 76.92  ? 990  VAL A CA    1 
ATOM   8532  C  C     . VAL D 4  990  ? 23.528  -49.353 62.693  1.00 76.46  ? 990  VAL A C     1 
ATOM   8533  O  O     . VAL D 4  990  ? 23.927  -48.297 62.182  1.00 75.60  ? 990  VAL A O     1 
ATOM   8534  C  CB    . VAL D 4  990  ? 21.262  -49.521 63.811  1.00 76.63  ? 990  VAL A CB    1 
ATOM   8535  C  CG1   . VAL D 4  990  ? 21.483  -48.098 64.297  1.00 75.38  ? 990  VAL A CG1   1 
ATOM   8536  C  CG2   . VAL D 4  990  ? 19.797  -49.789 63.561  1.00 77.06  ? 990  VAL A CG2   1 
ATOM   8537  N  N     . LYS D 4  991  ? 24.340  -50.166 63.372  1.00 81.50  ? 991  LYS A N     1 
ATOM   8538  C  CA    . LYS D 4  991  ? 25.767  -49.896 63.507  1.00 95.17  ? 991  LYS A CA    1 
ATOM   8539  C  C     . LYS D 4  991  ? 26.475  -49.945 62.160  1.00 91.37  ? 991  LYS A C     1 
ATOM   8540  O  O     . LYS D 4  991  ? 27.505  -49.289 61.975  1.00 83.74  ? 991  LYS A O     1 
ATOM   8541  C  CB    . LYS D 4  991  ? 26.373  -50.913 64.475  1.00 96.39  ? 991  LYS A CB    1 
ATOM   8542  C  CG    . LYS D 4  991  ? 27.307  -50.345 65.529  1.00 93.81  ? 991  LYS A CG    1 
ATOM   8543  C  CD    . LYS D 4  991  ? 27.445  -51.340 66.675  1.00 99.08  ? 991  LYS A CD    1 
ATOM   8544  C  CE    . LYS D 4  991  ? 28.744  -51.170 67.442  1.00 98.54  ? 991  LYS A CE    1 
ATOM   8545  N  NZ    . LYS D 4  991  ? 29.189  -52.461 68.041  1.00 91.45  ? 991  LYS A NZ    1 
ATOM   8546  N  N     . ASP D 4  992  ? 25.939  -50.715 61.210  1.00 105.44 ? 992  ASP A N     1 
ATOM   8547  C  CA    . ASP D 4  992  ? 26.479  -50.729 59.855  1.00 117.13 ? 992  ASP A CA    1 
ATOM   8548  C  C     . ASP D 4  992  ? 26.088  -49.458 59.108  1.00 114.72 ? 992  ASP A C     1 
ATOM   8549  O  O     . ASP D 4  992  ? 26.888  -48.914 58.339  1.00 122.61 ? 992  ASP A O     1 
ATOM   8550  C  CB    . ASP D 4  992  ? 25.977  -51.987 59.133  1.00 115.81 ? 992  ASP A CB    1 
ATOM   8551  C  CG    . ASP D 4  992  ? 25.955  -51.857 57.615  1.00 113.91 ? 992  ASP A CG    1 
ATOM   8552  O  OD1   . ASP D 4  992  ? 24.974  -52.337 57.011  1.00 112.13 ? 992  ASP A OD1   1 
ATOM   8553  O  OD2   . ASP D 4  992  ? 26.946  -51.391 57.011  1.00 113.97 ? 992  ASP A OD2   1 
ATOM   8554  N  N     . LEU D 4  993  ? 24.863  -48.971 59.338  1.00 102.32 ? 993  LEU A N     1 
ATOM   8555  C  CA    . LEU D 4  993  ? 24.351  -47.809 58.616  1.00 87.51  ? 993  LEU A CA    1 
ATOM   8556  C  C     . LEU D 4  993  ? 25.152  -46.553 58.934  1.00 101.72 ? 993  LEU A C     1 
ATOM   8557  O  O     . LEU D 4  993  ? 25.445  -45.752 58.037  1.00 100.26 ? 993  LEU A O     1 
ATOM   8558  C  CB    . LEU D 4  993  ? 22.876  -47.600 58.966  1.00 75.46  ? 993  LEU A CB    1 
ATOM   8559  C  CG    . LEU D 4  993  ? 22.149  -46.340 58.492  1.00 74.50  ? 993  LEU A CG    1 
ATOM   8560  C  CD1   . LEU D 4  993  ? 22.274  -46.138 56.987  1.00 74.84  ? 993  LEU A CD1   1 
ATOM   8561  C  CD2   . LEU D 4  993  ? 20.692  -46.378 58.923  1.00 74.59  ? 993  LEU A CD2   1 
ATOM   8562  N  N     . GLN D 4  994  ? 25.520  -46.372 60.209  1.00 92.71  ? 994  GLN A N     1 
ATOM   8563  C  CA    . GLN D 4  994  ? 26.302  -45.212 60.631  1.00 76.81  ? 994  GLN A CA    1 
ATOM   8564  C  C     . GLN D 4  994  ? 27.661  -45.166 59.952  1.00 73.58  ? 994  GLN A C     1 
ATOM   8565  O  O     . GLN D 4  994  ? 28.225  -44.083 59.758  1.00 72.84  ? 994  GLN A O     1 
ATOM   8566  C  CB    . GLN D 4  994  ? 26.505  -45.245 62.141  1.00 82.72  ? 994  GLN A CB    1 
ATOM   8567  C  CG    . GLN D 4  994  ? 25.246  -45.391 62.951  1.00 94.66  ? 994  GLN A CG    1 
ATOM   8568  C  CD    . GLN D 4  994  ? 25.545  -45.527 64.426  1.00 86.13  ? 994  GLN A CD    1 
ATOM   8569  O  OE1   . GLN D 4  994  ? 24.640  -45.536 65.253  1.00 81.55  ? 994  GLN A OE1   1 
ATOM   8570  N  NE2   . GLN D 4  994  ? 26.825  -45.651 64.762  1.00 80.76  ? 994  GLN A NE2   1 
ATOM   8571  N  N     . GLU D 4  995  ? 28.205  -46.332 59.599  1.00 80.71  ? 995  GLU A N     1 
ATOM   8572  C  CA    . GLU D 4  995  ? 29.483  -46.396 58.911  1.00 81.66  ? 995  GLU A CA    1 
ATOM   8573  C  C     . GLU D 4  995  ? 29.386  -45.866 57.489  1.00 93.67  ? 995  GLU A C     1 
ATOM   8574  O  O     . GLU D 4  995  ? 30.412  -45.502 56.906  1.00 92.41  ? 995  GLU A O     1 
ATOM   8575  C  CB    . GLU D 4  995  ? 29.984  -47.838 58.890  1.00 90.09  ? 995  GLU A CB    1 
ATOM   8576  C  CG    . GLU D 4  995  ? 30.637  -48.280 60.183  1.00 104.64 ? 995  GLU A CG    1 
ATOM   8577  C  CD    . GLU D 4  995  ? 31.843  -47.445 60.544  1.00 120.89 ? 995  GLU A CD    1 
ATOM   8578  O  OE1   . GLU D 4  995  ? 32.731  -47.278 59.684  1.00 126.41 ? 995  GLU A OE1   1 
ATOM   8579  O  OE2   . GLU D 4  995  ? 31.899  -46.952 61.691  1.00 123.08 ? 995  GLU A OE2   1 
ATOM   8580  N  N     . ASN D 4  996  ? 28.178  -45.814 56.924  1.00 103.47 ? 996  ASN A N     1 
ATOM   8581  C  CA    . ASN D 4  996  ? 27.974  -45.391 55.550  1.00 103.84 ? 996  ASN A CA    1 
ATOM   8582  C  C     . ASN D 4  996  ? 27.356  -44.007 55.420  1.00 95.22  ? 996  ASN A C     1 
ATOM   8583  O  O     . ASN D 4  996  ? 27.224  -43.513 54.296  1.00 96.69  ? 996  ASN A O     1 
ATOM   8584  C  CB    . ASN D 4  996  ? 27.105  -46.418 54.813  1.00 98.23  ? 996  ASN A CB    1 
ATOM   8585  C  CG    . ASN D 4  996  ? 27.879  -47.665 54.446  1.00 99.66  ? 996  ASN A CG    1 
ATOM   8586  O  OD1   . ASN D 4  996  ? 29.037  -47.591 54.035  1.00 94.66  ? 996  ASN A OD1   1 
ATOM   8587  N  ND2   . ASN D 4  996  ? 27.251  -48.822 54.610  1.00 116.59 ? 996  ASN A ND2   1 
ATOM   8588  N  N     . LEU D 4  997  ? 26.987  -43.365 56.529  1.00 74.06  ? 997  LEU A N     1 
ATOM   8589  C  CA    . LEU D 4  997  ? 26.548  -41.969 56.516  1.00 71.47  ? 997  LEU A CA    1 
ATOM   8590  C  C     . LEU D 4  997  ? 27.783  -41.087 56.363  1.00 74.42  ? 997  LEU A C     1 
ATOM   8591  O  O     . LEU D 4  997  ? 28.287  -40.489 57.316  1.00 94.75  ? 997  LEU A O     1 
ATOM   8592  C  CB    . LEU D 4  997  ? 25.771  -41.638 57.784  1.00 70.94  ? 997  LEU A CB    1 
ATOM   8593  C  CG    . LEU D 4  997  ? 24.522  -42.475 58.058  1.00 75.28  ? 997  LEU A CG    1 
ATOM   8594  C  CD1   . LEU D 4  997  ? 23.689  -41.829 59.137  1.00 70.82  ? 997  LEU A CD1   1 
ATOM   8595  C  CD2   . LEU D 4  997  ? 23.694  -42.632 56.796  1.00 71.78  ? 997  LEU A CD2   1 
ATOM   8596  N  N     . LEU D 4  998  ? 28.274  -41.012 55.130  1.00 79.10  ? 998  LEU A N     1 
ATOM   8597  C  CA    . LEU D 4  998  ? 29.514  -40.320 54.814  1.00 87.78  ? 998  LEU A CA    1 
ATOM   8598  C  C     . LEU D 4  998  ? 29.250  -38.841 54.566  1.00 100.60 ? 998  LEU A C     1 
ATOM   8599  O  O     . LEU D 4  998  ? 28.220  -38.469 53.997  1.00 107.31 ? 998  LEU A O     1 
ATOM   8600  C  CB    . LEU D 4  998  ? 30.167  -40.936 53.574  1.00 81.38  ? 998  LEU A CB    1 
ATOM   8601  C  CG    . LEU D 4  998  ? 31.155  -42.110 53.602  1.00 74.72  ? 998  LEU A CG    1 
ATOM   8602  C  CD1   . LEU D 4  998  ? 32.531  -41.675 54.027  1.00 78.44  ? 998  LEU A CD1   1 
ATOM   8603  C  CD2   . LEU D 4  998  ? 30.686  -43.219 54.500  1.00 84.96  ? 998  LEU A CD2   1 
ATOM   8604  N  N     . VAL D 4  999  ? 30.194  -38.000 54.982  1.00 92.86  ? 999  VAL A N     1 
ATOM   8605  C  CA    . VAL D 4  999  ? 30.146  -36.573 54.685  1.00 79.71  ? 999  VAL A CA    1 
ATOM   8606  C  C     . VAL D 4  999  ? 31.515  -36.173 54.153  1.00 78.52  ? 999  VAL A C     1 
ATOM   8607  O  O     . VAL D 4  999  ? 31.625  -35.489 53.129  1.00 84.87  ? 999  VAL A O     1 
ATOM   8608  C  CB    . VAL D 4  999  ? 29.737  -35.752 55.924  1.00 68.05  ? 999  VAL A CB    1 
ATOM   8609  C  CG1   . VAL D 4  999  ? 30.313  -34.346 55.872  1.00 70.40  ? 999  VAL A CG1   1 
ATOM   8610  C  CG2   . VAL D 4  999  ? 28.226  -35.692 56.034  1.00 67.46  ? 999  VAL A CG2   1 
ATOM   8611  N  N     . LEU D 4  1000 ? 32.567  -36.613 54.833  1.00 69.36  ? 1000 LEU A N     1 
ATOM   8612  C  CA    . LEU D 4  1000 ? 33.926  -36.529 54.325  1.00 69.92  ? 1000 LEU A CA    1 
ATOM   8613  C  C     . LEU D 4  1000 ? 34.442  -37.932 54.048  1.00 71.16  ? 1000 LEU A C     1 
ATOM   8614  O  O     . LEU D 4  1000 ? 34.001  -38.906 54.659  1.00 75.38  ? 1000 LEU A O     1 
ATOM   8615  C  CB    . LEU D 4  1000 ? 34.847  -35.809 55.313  1.00 69.66  ? 1000 LEU A CB    1 
ATOM   8616  C  CG    . LEU D 4  1000 ? 34.754  -34.286 55.337  1.00 76.96  ? 1000 LEU A CG    1 
ATOM   8617  C  CD1   . LEU D 4  1000 ? 33.970  -33.822 56.552  1.00 76.58  ? 1000 LEU A CD1   1 
ATOM   8618  C  CD2   . LEU D 4  1000 ? 36.140  -33.668 55.310  1.00 87.40  ? 1000 LEU A CD2   1 
ATOM   8619  N  N     . ARG D 4  1001 ? 35.394  -38.030 53.119  1.00 71.88  ? 1001 ARG A N     1 
ATOM   8620  C  CA    . ARG D 4  1001 ? 35.791  -39.324 52.583  1.00 91.31  ? 1001 ARG A CA    1 
ATOM   8621  C  C     . ARG D 4  1001 ? 37.286  -39.606 52.621  1.00 101.82 ? 1001 ARG A C     1 
ATOM   8622  O  O     . ARG D 4  1001 ? 37.710  -40.637 52.086  1.00 126.22 ? 1001 ARG A O     1 
ATOM   8623  C  CB    . ARG D 4  1001 ? 35.303  -39.468 51.136  1.00 89.31  ? 1001 ARG A CB    1 
ATOM   8624  C  CG    . ARG D 4  1001 ? 34.294  -40.574 50.910  1.00 77.67  ? 1001 ARG A CG    1 
ATOM   8625  C  CD    . ARG D 4  1001 ? 33.548  -40.326 49.618  1.00 81.48  ? 1001 ARG A CD    1 
ATOM   8626  N  NE    . ARG D 4  1001 ? 32.492  -39.335 49.798  1.00 90.28  ? 1001 ARG A NE    1 
ATOM   8627  C  CZ    . ARG D 4  1001 ? 31.244  -39.631 50.140  1.00 81.93  ? 1001 ARG A CZ    1 
ATOM   8628  N  NH1   . ARG D 4  1001 ? 30.890  -40.896 50.318  1.00 77.45  ? 1001 ARG A NH1   1 
ATOM   8629  N  NH2   . ARG D 4  1001 ? 30.347  -38.668 50.289  1.00 71.50  ? 1001 ARG A NH2   1 
ATOM   8630  N  N     . GLY D 4  1002 ? 38.095  -38.731 53.214  1.00 85.17  ? 1002 GLY A N     1 
ATOM   8631  C  CA    . GLY D 4  1002 ? 39.515  -39.005 53.318  1.00 94.28  ? 1002 GLY A CA    1 
ATOM   8632  C  C     . GLY D 4  1002 ? 39.798  -40.170 54.248  1.00 113.66 ? 1002 GLY A C     1 
ATOM   8633  O  O     . GLY D 4  1002 ? 39.029  -40.473 55.161  1.00 120.20 ? 1002 GLY A O     1 
ATOM   8634  N  N     . LYS D 4  1003 ? 40.916  -40.848 54.000  1.00 119.61 ? 1003 LYS A N     1 
ATOM   8635  C  CA    . LYS D 4  1003 ? 41.321  -42.005 54.794  1.00 122.98 ? 1003 LYS A CA    1 
ATOM   8636  C  C     . LYS D 4  1003 ? 42.557  -41.619 55.602  1.00 126.56 ? 1003 LYS A C     1 
ATOM   8637  O  O     . LYS D 4  1003 ? 43.695  -41.934 55.249  1.00 126.49 ? 1003 LYS A O     1 
ATOM   8638  C  CB    . LYS D 4  1003 ? 41.555  -43.225 53.915  1.00 112.50 ? 1003 LYS A CB    1 
ATOM   8639  C  CG    . LYS D 4  1003 ? 40.581  -44.352 54.221  1.00 103.20 ? 1003 LYS A CG    1 
ATOM   8640  C  CD    . LYS D 4  1003 ? 39.946  -44.924 52.965  1.00 113.72 ? 1003 LYS A CD    1 
ATOM   8641  C  CE    . LYS D 4  1003 ? 40.983  -45.514 52.029  1.00 117.06 ? 1003 LYS A CE    1 
ATOM   8642  N  NZ    . LYS D 4  1003 ? 40.338  -46.220 50.888  1.00 115.02 ? 1003 LYS A NZ    1 
ATOM   8643  N  N     . ASN D 4  1004 ? 42.308  -40.914 56.701  1.00 124.93 ? 1004 ASN A N     1 
ATOM   8644  C  CA    . ASN D 4  1004 ? 43.319  -40.557 57.682  1.00 122.38 ? 1004 ASN A CA    1 
ATOM   8645  C  C     . ASN D 4  1004 ? 42.623  -40.434 59.028  1.00 115.63 ? 1004 ASN A C     1 
ATOM   8646  O  O     . ASN D 4  1004 ? 41.397  -40.496 59.113  1.00 108.13 ? 1004 ASN A O     1 
ATOM   8647  C  CB    . ASN D 4  1004 ? 44.106  -39.307 57.219  1.00 121.14 ? 1004 ASN A CB    1 
ATOM   8648  C  CG    . ASN D 4  1004 ? 43.333  -37.963 57.332  1.00 119.59 ? 1004 ASN A CG    1 
ATOM   8649  O  OD1   . ASN D 4  1004 ? 42.394  -37.789 58.095  1.00 123.15 ? 1004 ASN A OD1   1 
ATOM   8650  N  ND2   . ASN D 4  1004 ? 43.751  -37.008 56.515  1.00 116.93 ? 1004 ASN A ND2   1 
ATOM   8651  N  N     . GLU D 4  1005 ? 43.399  -40.221 60.084  1.00 119.54 ? 1005 GLU A N     1 
ATOM   8652  C  CA    . GLU D 4  1005 ? 42.749  -40.098 61.380  1.00 121.74 ? 1005 GLU A CA    1 
ATOM   8653  C  C     . GLU D 4  1005 ? 42.205  -38.700 61.641  1.00 107.91 ? 1005 GLU A C     1 
ATOM   8654  O  O     . GLU D 4  1005 ? 41.369  -38.542 62.535  1.00 115.99 ? 1005 GLU A O     1 
ATOM   8655  C  CB    . GLU D 4  1005 ? 43.696  -40.513 62.503  1.00 132.49 ? 1005 GLU A CB    1 
ATOM   8656  C  CG    . GLU D 4  1005 ? 43.365  -41.891 63.060  1.00 142.18 ? 1005 GLU A CG    1 
ATOM   8657  C  CD    . GLU D 4  1005 ? 41.893  -42.035 63.421  1.00 145.87 ? 1005 GLU A CD    1 
ATOM   8658  O  OE1   . GLU D 4  1005 ? 41.219  -42.918 62.845  1.00 145.15 ? 1005 GLU A OE1   1 
ATOM   8659  O  OE2   . GLU D 4  1005 ? 41.408  -41.268 64.277  1.00 145.99 ? 1005 GLU A OE2   1 
ATOM   8660  N  N     . ILE D 4  1006 ? 42.638  -37.690 60.885  1.00 94.14  ? 1006 ILE A N     1 
ATOM   8661  C  CA    . ILE D 4  1006 ? 42.041  -36.362 61.011  1.00 85.38  ? 1006 ILE A CA    1 
ATOM   8662  C  C     . ILE D 4  1006 ? 40.641  -36.352 60.411  1.00 94.99  ? 1006 ILE A C     1 
ATOM   8663  O  O     . ILE D 4  1006 ? 39.664  -35.977 61.070  1.00 96.00  ? 1006 ILE A O     1 
ATOM   8664  C  CB    . ILE D 4  1006 ? 42.921  -35.293 60.341  1.00 75.06  ? 1006 ILE A CB    1 
ATOM   8665  C  CG1   . ILE D 4  1006 ? 44.403  -35.509 60.652  1.00 90.16  ? 1006 ILE A CG1   1 
ATOM   8666  C  CG2   . ILE D 4  1006 ? 42.449  -33.905 60.746  1.00 72.52  ? 1006 ILE A CG2   1 
ATOM   8667  C  CD1   . ILE D 4  1006 ? 45.263  -34.311 60.301  1.00 90.85  ? 1006 ILE A CD1   1 
ATOM   8668  N  N     . ILE D 4  1007 ? 40.535  -36.754 59.142  1.00 97.10  ? 1007 ILE A N     1 
ATOM   8669  C  CA    . ILE D 4  1007 ? 39.284  -36.629 58.402  1.00 86.58  ? 1007 ILE A CA    1 
ATOM   8670  C  C     . ILE D 4  1007 ? 38.239  -37.601 58.938  1.00 86.86  ? 1007 ILE A C     1 
ATOM   8671  O  O     . ILE D 4  1007 ? 37.056  -37.256 59.055  1.00 74.62  ? 1007 ILE A O     1 
ATOM   8672  C  CB    . ILE D 4  1007 ? 39.548  -36.839 56.898  1.00 75.05  ? 1007 ILE A CB    1 
ATOM   8673  C  CG1   . ILE D 4  1007 ? 40.503  -35.767 56.364  1.00 72.62  ? 1007 ILE A CG1   1 
ATOM   8674  C  CG2   . ILE D 4  1007 ? 38.264  -36.818 56.110  1.00 83.63  ? 1007 ILE A CG2   1 
ATOM   8675  C  CD1   . ILE D 4  1007 ? 40.035  -34.350 56.595  1.00 71.39  ? 1007 ILE A CD1   1 
ATOM   8676  N  N     . GLN D 4  1008 ? 38.658  -38.822 59.292  1.00 98.25  ? 1008 GLN A N     1 
ATOM   8677  C  CA    . GLN D 4  1008 ? 37.721  -39.785 59.866  1.00 100.26 ? 1008 GLN A CA    1 
ATOM   8678  C  C     . GLN D 4  1008 ? 37.239  -39.340 61.241  1.00 100.94 ? 1008 GLN A C     1 
ATOM   8679  O  O     . GLN D 4  1008 ? 36.114  -39.666 61.635  1.00 106.08 ? 1008 GLN A O     1 
ATOM   8680  C  CB    . GLN D 4  1008 ? 38.359  -41.172 59.955  1.00 98.18  ? 1008 GLN A CB    1 
ATOM   8681  C  CG    . GLN D 4  1008 ? 38.563  -41.890 58.616  1.00 99.66  ? 1008 GLN A CG    1 
ATOM   8682  C  CD    . GLN D 4  1008 ? 37.302  -42.002 57.783  1.00 102.49 ? 1008 GLN A CD    1 
ATOM   8683  O  OE1   . GLN D 4  1008 ? 36.234  -42.341 58.290  1.00 106.26 ? 1008 GLN A OE1   1 
ATOM   8684  N  NE2   . GLN D 4  1008 ? 37.425  -41.724 56.490  1.00 98.88  ? 1008 GLN A NE2   1 
ATOM   8685  N  N     . ASN D 4  1009 ? 38.069  -38.603 61.985  1.00 98.54  ? 1009 ASN A N     1 
ATOM   8686  C  CA    . ASN D 4  1009 ? 37.584  -37.968 63.206  1.00 100.15 ? 1009 ASN A CA    1 
ATOM   8687  C  C     . ASN D 4  1009 ? 36.632  -36.826 62.883  1.00 83.05  ? 1009 ASN A C     1 
ATOM   8688  O  O     . ASN D 4  1009 ? 35.605  -36.662 63.551  1.00 76.71  ? 1009 ASN A O     1 
ATOM   8689  C  CB    . ASN D 4  1009 ? 38.751  -37.455 64.048  1.00 111.34 ? 1009 ASN A CB    1 
ATOM   8690  C  CG    . ASN D 4  1009 ? 39.179  -38.440 65.117  1.00 126.80 ? 1009 ASN A CG    1 
ATOM   8691  O  OD1   . ASN D 4  1009 ? 40.364  -38.738 65.261  1.00 134.06 ? 1009 ASN A OD1   1 
ATOM   8692  N  ND2   . ASN D 4  1009 ? 38.216  -38.946 65.878  1.00 123.14 ? 1009 ASN A ND2   1 
ATOM   8693  N  N     . ALA D 4  1010 ? 36.963  -36.027 61.864  1.00 76.70  ? 1010 ALA A N     1 
ATOM   8694  C  CA    . ALA D 4  1010 ? 36.078  -34.947 61.442  1.00 75.35  ? 1010 ALA A CA    1 
ATOM   8695  C  C     . ALA D 4  1010 ? 34.764  -35.494 60.905  1.00 69.83  ? 1010 ALA A C     1 
ATOM   8696  O  O     . ALA D 4  1010 ? 33.703  -34.890 61.099  1.00 68.12  ? 1010 ALA A O     1 
ATOM   8697  C  CB    . ALA D 4  1010 ? 36.768  -34.083 60.387  1.00 85.72  ? 1010 ALA A CB    1 
ATOM   8698  N  N     . GLN D 4  1011 ? 34.820  -36.643 60.228  1.00 77.07  ? 1011 GLN A N     1 
ATOM   8699  C  CA    . GLN D 4  1011 ? 33.601  -37.312 59.789  1.00 76.15  ? 1011 GLN A CA    1 
ATOM   8700  C  C     . GLN D 4  1011 ? 32.799  -37.823 60.978  1.00 84.04  ? 1011 GLN A C     1 
ATOM   8701  O  O     . GLN D 4  1011 ? 31.569  -37.687 61.010  1.00 71.06  ? 1011 GLN A O     1 
ATOM   8702  C  CB    . GLN D 4  1011 ? 33.957  -38.451 58.833  1.00 70.54  ? 1011 GLN A CB    1 
ATOM   8703  C  CG    . GLN D 4  1011 ? 32.990  -39.619 58.840  1.00 71.71  ? 1011 GLN A CG    1 
ATOM   8704  C  CD    . GLN D 4  1011 ? 31.736  -39.341 58.042  1.00 74.27  ? 1011 GLN A CD    1 
ATOM   8705  O  OE1   . GLN D 4  1011 ? 31.765  -38.613 57.050  1.00 82.64  ? 1011 GLN A OE1   1 
ATOM   8706  N  NE2   . GLN D 4  1011 ? 30.624  -39.926 58.469  1.00 70.46  ? 1011 GLN A NE2   1 
ATOM   8707  N  N     . ARG D 4  1012 ? 33.483  -38.393 61.975  1.00 87.91  ? 1012 ARG A N     1 
ATOM   8708  C  CA    . ARG D 4  1012 ? 32.805  -38.867 63.175  1.00 90.98  ? 1012 ARG A CA    1 
ATOM   8709  C  C     . ARG D 4  1012 ? 32.241  -37.708 63.986  1.00 96.49  ? 1012 ARG A C     1 
ATOM   8710  O  O     . ARG D 4  1012 ? 31.182  -37.848 64.607  1.00 110.07 ? 1012 ARG A O     1 
ATOM   8711  C  CB    . ARG D 4  1012 ? 33.775  -39.694 64.020  1.00 105.29 ? 1012 ARG A CB    1 
ATOM   8712  C  CG    . ARG D 4  1012 ? 33.154  -40.386 65.226  1.00 111.79 ? 1012 ARG A CG    1 
ATOM   8713  C  CD    . ARG D 4  1012 ? 33.904  -41.669 65.576  1.00 113.27 ? 1012 ARG A CD    1 
ATOM   8714  N  NE    . ARG D 4  1012 ? 34.049  -42.567 64.431  1.00 118.86 ? 1012 ARG A NE    1 
ATOM   8715  C  CZ    . ARG D 4  1012 ? 35.203  -42.819 63.819  1.00 109.55 ? 1012 ARG A CZ    1 
ATOM   8716  N  NH1   . ARG D 4  1012 ? 36.319  -42.239 64.243  1.00 102.36 ? 1012 ARG A NH1   1 
ATOM   8717  N  NH2   . ARG D 4  1012 ? 35.243  -43.645 62.783  1.00 98.22  ? 1012 ARG A NH2   1 
ATOM   8718  N  N     . ASP D 4  1013 ? 32.924  -36.558 63.980  1.00 88.96  ? 1013 ASP A N     1 
ATOM   8719  C  CA    . ASP D 4  1013 ? 32.401  -35.378 64.661  1.00 91.85  ? 1013 ASP A CA    1 
ATOM   8720  C  C     . ASP D 4  1013 ? 31.160  -34.837 63.961  1.00 94.01  ? 1013 ASP A C     1 
ATOM   8721  O  O     . ASP D 4  1013 ? 30.207  -34.412 64.623  1.00 94.23  ? 1013 ASP A O     1 
ATOM   8722  C  CB    . ASP D 4  1013 ? 33.473  -34.289 64.740  1.00 98.21  ? 1013 ASP A CB    1 
ATOM   8723  C  CG    . ASP D 4  1013 ? 34.586  -34.627 65.710  1.00 95.72  ? 1013 ASP A CG    1 
ATOM   8724  O  OD1   . ASP D 4  1013 ? 34.280  -35.048 66.844  1.00 99.25  ? 1013 ASP A OD1   1 
ATOM   8725  O  OD2   . ASP D 4  1013 ? 35.767  -34.443 65.346  1.00 88.39  ? 1013 ASP A OD2   1 
ATOM   8726  N  N     . ALA D 4  1014 ? 31.151  -34.853 62.624  1.00 100.09 ? 1014 ALA A N     1 
ATOM   8727  C  CA    . ALA D 4  1014 ? 30.120  -34.143 61.871  1.00 93.47  ? 1014 ALA A CA    1 
ATOM   8728  C  C     . ALA D 4  1014 ? 28.766  -34.837 61.928  1.00 84.38  ? 1014 ALA A C     1 
ATOM   8729  O  O     . ALA D 4  1014 ? 27.729  -34.168 61.876  1.00 66.17  ? 1014 ALA A O     1 
ATOM   8730  C  CB    . ALA D 4  1014 ? 30.564  -33.969 60.419  1.00 87.93  ? 1014 ALA A CB    1 
ATOM   8731  N  N     . VAL D 4  1015 ? 28.745  -36.170 62.018  1.00 95.80  ? 1015 VAL A N     1 
ATOM   8732  C  CA    . VAL D 4  1015 ? 27.485  -36.907 62.047  1.00 86.65  ? 1015 VAL A CA    1 
ATOM   8733  C  C     . VAL D 4  1015 ? 27.021  -37.223 63.459  1.00 90.39  ? 1015 VAL A C     1 
ATOM   8734  O  O     . VAL D 4  1015 ? 25.999  -37.908 63.622  1.00 73.33  ? 1015 VAL A O     1 
ATOM   8735  C  CB    . VAL D 4  1015 ? 27.619  -38.204 61.222  1.00 70.67  ? 1015 VAL A CB    1 
ATOM   8736  C  CG1   . VAL D 4  1015 ? 28.334  -37.914 59.924  1.00 69.12  ? 1015 VAL A CG1   1 
ATOM   8737  C  CG2   . VAL D 4  1015 ? 28.399  -39.249 62.005  1.00 69.25  ? 1015 VAL A CG2   1 
ATOM   8738  N  N     . THR D 4  1016 ? 27.705  -36.698 64.480  1.00 86.60  ? 1016 THR A N     1 
ATOM   8739  C  CA    . THR D 4  1016 ? 27.535  -37.185 65.846  1.00 70.57  ? 1016 THR A CA    1 
ATOM   8740  C  C     . THR D 4  1016 ? 26.146  -36.883 66.397  1.00 68.57  ? 1016 THR A C     1 
ATOM   8741  O  O     . THR D 4  1016 ? 25.550  -37.731 67.067  1.00 68.28  ? 1016 THR A O     1 
ATOM   8742  C  CB    . THR D 4  1016 ? 28.612  -36.584 66.749  1.00 67.96  ? 1016 THR A CB    1 
ATOM   8743  O  OG1   . THR D 4  1016 ? 29.897  -36.804 66.160  1.00 69.09  ? 1016 THR A OG1   1 
ATOM   8744  C  CG2   . THR D 4  1016 ? 28.591  -37.239 68.115  1.00 68.50  ? 1016 THR A CG2   1 
ATOM   8745  N  N     . LEU D 4  1017 ? 25.606  -35.692 66.120  1.00 73.28  ? 1017 LEU A N     1 
ATOM   8746  C  CA    . LEU D 4  1017 ? 24.250  -35.394 66.571  1.00 73.76  ? 1017 LEU A CA    1 
ATOM   8747  C  C     . LEU D 4  1017 ? 23.230  -36.227 65.804  1.00 75.81  ? 1017 LEU A C     1 
ATOM   8748  O  O     . LEU D 4  1017 ? 22.228  -36.669 66.378  1.00 78.08  ? 1017 LEU A O     1 
ATOM   8749  C  CB    . LEU D 4  1017 ? 23.955  -33.898 66.421  1.00 66.23  ? 1017 LEU A CB    1 
ATOM   8750  C  CG    . LEU D 4  1017 ? 23.031  -33.166 67.413  1.00 69.25  ? 1017 LEU A CG    1 
ATOM   8751  C  CD1   . LEU D 4  1017 ? 23.030  -31.675 67.132  1.00 94.76  ? 1017 LEU A CD1   1 
ATOM   8752  C  CD2   . LEU D 4  1017 ? 21.599  -33.665 67.407  1.00 66.46  ? 1017 LEU A CD2   1 
ATOM   8753  N  N     . PHE D 4  1018 ? 23.476  -36.462 64.512  1.00 83.25  ? 1018 PHE A N     1 
ATOM   8754  C  CA    . PHE D 4  1018 ? 22.534  -37.234 63.707  1.00 92.65  ? 1018 PHE A CA    1 
ATOM   8755  C  C     . PHE D 4  1018 ? 22.447  -38.678 64.177  1.00 93.11  ? 1018 PHE A C     1 
ATOM   8756  O  O     . PHE D 4  1018 ? 21.362  -39.272 64.180  1.00 98.95  ? 1018 PHE A O     1 
ATOM   8757  C  CB    . PHE D 4  1018 ? 22.931  -37.201 62.235  1.00 82.44  ? 1018 PHE A CB    1 
ATOM   8758  C  CG    . PHE D 4  1018 ? 21.899  -37.801 61.329  1.00 71.97  ? 1018 PHE A CG    1 
ATOM   8759  C  CD1   . PHE D 4  1018 ? 20.550  -37.582 61.555  1.00 78.30  ? 1018 PHE A CD1   1 
ATOM   8760  C  CD2   . PHE D 4  1018 ? 22.272  -38.630 60.289  1.00 68.61  ? 1018 PHE A CD2   1 
ATOM   8761  C  CE1   . PHE D 4  1018 ? 19.598  -38.147 60.732  1.00 87.13  ? 1018 PHE A CE1   1 
ATOM   8762  C  CE2   . PHE D 4  1018 ? 21.321  -39.200 59.471  1.00 80.01  ? 1018 PHE A CE2   1 
ATOM   8763  C  CZ    . PHE D 4  1018 ? 19.988  -38.959 59.692  1.00 87.18  ? 1018 PHE A CZ    1 
ATOM   8764  N  N     . CYS D 4  1019 ? 23.581  -39.261 64.571  1.00 68.93  ? 1019 CYS A N     1 
ATOM   8765  C  CA    . CYS D 4  1019 ? 23.570  -40.644 65.028  1.00 71.61  ? 1019 CYS A CA    1 
ATOM   8766  C  C     . CYS D 4  1019 ? 22.820  -40.792 66.344  1.00 84.25  ? 1019 CYS A C     1 
ATOM   8767  O  O     . CYS D 4  1019 ? 22.241  -41.852 66.600  1.00 101.42 ? 1019 CYS A O     1 
ATOM   8768  C  CB    . CYS D 4  1019 ? 24.999  -41.165 65.162  1.00 90.40  ? 1019 CYS A CB    1 
ATOM   8769  S  SG    . CYS D 4  1019 ? 25.831  -41.439 63.584  1.00 86.42  ? 1019 CYS A SG    1 
ATOM   8770  N  N     . CYS D 4  1020 ? 22.806  -39.749 67.181  1.00 76.50  ? 1020 CYS A N     1 
ATOM   8771  C  CA    . CYS D 4  1020 ? 21.977  -39.790 68.382  1.00 76.81  ? 1020 CYS A CA    1 
ATOM   8772  C  C     . CYS D 4  1020 ? 20.499  -39.836 68.026  1.00 74.83  ? 1020 CYS A C     1 
ATOM   8773  O  O     . CYS D 4  1020 ? 19.702  -40.461 68.735  1.00 80.85  ? 1020 CYS A O     1 
ATOM   8774  C  CB    . CYS D 4  1020 ? 22.265  -38.592 69.287  1.00 75.65  ? 1020 CYS A CB    1 
ATOM   8775  S  SG    . CYS D 4  1020 ? 23.990  -38.345 69.734  1.00 86.74  ? 1020 CYS A SG    1 
ATOM   8776  N  N     . LEU D 4  1021 ? 20.112  -39.182 66.930  1.00 70.58  ? 1021 LEU A N     1 
ATOM   8777  C  CA    . LEU D 4  1021 ? 18.733  -39.294 66.467  1.00 69.71  ? 1021 LEU A CA    1 
ATOM   8778  C  C     . LEU D 4  1021 ? 18.479  -40.671 65.870  1.00 74.75  ? 1021 LEU A C     1 
ATOM   8779  O  O     . LEU D 4  1021 ? 17.388  -41.232 66.024  1.00 83.25  ? 1021 LEU A O     1 
ATOM   8780  C  CB    . LEU D 4  1021 ? 18.430  -38.193 65.452  1.00 70.03  ? 1021 LEU A CB    1 
ATOM   8781  C  CG    . LEU D 4  1021 ? 17.130  -38.312 64.652  1.00 79.07  ? 1021 LEU A CG    1 
ATOM   8782  C  CD1   . LEU D 4  1021 ? 15.948  -37.852 65.487  1.00 88.75  ? 1021 LEU A CD1   1 
ATOM   8783  C  CD2   . LEU D 4  1021 ? 17.214  -37.522 63.364  1.00 80.13  ? 1021 LEU A CD2   1 
ATOM   8784  N  N     . LEU D 4  1022 ? 19.493  -41.244 65.217  1.00 75.68  ? 1022 LEU A N     1 
ATOM   8785  C  CA    . LEU D 4  1022 ? 19.338  -42.530 64.545  1.00 76.24  ? 1022 LEU A CA    1 
ATOM   8786  C  C     . LEU D 4  1022 ? 19.146  -43.662 65.548  1.00 74.47  ? 1022 LEU A C     1 
ATOM   8787  O  O     . LEU D 4  1022 ? 18.183  -44.431 65.453  1.00 74.97  ? 1022 LEU A O     1 
ATOM   8788  C  CB    . LEU D 4  1022 ? 20.560  -42.794 63.664  1.00 77.73  ? 1022 LEU A CB    1 
ATOM   8789  C  CG    . LEU D 4  1022 ? 20.463  -43.833 62.547  1.00 78.23  ? 1022 LEU A CG    1 
ATOM   8790  C  CD1   . LEU D 4  1022 ? 19.212  -43.619 61.717  1.00 73.50  ? 1022 LEU A CD1   1 
ATOM   8791  C  CD2   . LEU D 4  1022 ? 21.703  -43.784 61.676  1.00 83.08  ? 1022 LEU A CD2   1 
ATOM   8792  N  N     . ARG D 4  1023 ? 20.055  -43.772 66.524  1.00 72.31  ? 1023 ARG A N     1 
ATOM   8793  C  CA    . ARG D 4  1023 ? 20.011  -44.863 67.496  1.00 73.30  ? 1023 ARG A CA    1 
ATOM   8794  C  C     . ARG D 4  1023 ? 18.789  -44.779 68.398  1.00 73.39  ? 1023 ARG A C     1 
ATOM   8795  O  O     . ARG D 4  1023 ? 18.244  -45.814 68.797  1.00 75.23  ? 1023 ARG A O     1 
ATOM   8796  C  CB    . ARG D 4  1023 ? 21.263  -44.843 68.368  1.00 73.03  ? 1023 ARG A CB    1 
ATOM   8797  C  CG    . ARG D 4  1023 ? 22.565  -44.882 67.616  1.00 72.88  ? 1023 ARG A CG    1 
ATOM   8798  C  CD    . ARG D 4  1023 ? 23.685  -44.416 68.521  1.00 72.59  ? 1023 ARG A CD    1 
ATOM   8799  N  NE    . ARG D 4  1023 ? 24.938  -44.190 67.808  1.00 83.23  ? 1023 ARG A NE    1 
ATOM   8800  C  CZ    . ARG D 4  1023 ? 25.863  -43.323 68.205  1.00 96.00  ? 1023 ARG A CZ    1 
ATOM   8801  N  NH1   . ARG D 4  1023 ? 25.662  -42.604 69.300  1.00 87.17  ? 1023 ARG A NH1   1 
ATOM   8802  N  NH2   . ARG D 4  1023 ? 26.979  -43.163 67.510  1.00 106.23 ? 1023 ARG A NH2   1 
ATOM   8803  N  N     . SER D 4  1024 ? 18.358  -43.562 68.744  1.00 72.70  ? 1024 SER A N     1 
ATOM   8804  C  CA    . SER D 4  1024 ? 17.211  -43.390 69.623  1.00 73.01  ? 1024 SER A CA    1 
ATOM   8805  C  C     . SER D 4  1024 ? 15.909  -43.796 68.954  1.00 83.44  ? 1024 SER A C     1 
ATOM   8806  O  O     . SER D 4  1024 ? 14.936  -44.098 69.652  1.00 87.65  ? 1024 SER A O     1 
ATOM   8807  C  CB    . SER D 4  1024 ? 17.114  -41.936 70.080  1.00 81.88  ? 1024 SER A CB    1 
ATOM   8808  O  OG    . SER D 4  1024 ? 17.378  -41.050 69.004  1.00 86.70  ? 1024 SER A OG    1 
ATOM   8809  N  N     . ARG D 4  1025 ? 15.863  -43.798 67.626  1.00 89.73  ? 1025 ARG A N     1 
ATOM   8810  C  CA    . ARG D 4  1025 ? 14.676  -44.212 66.896  1.00 81.64  ? 1025 ARG A CA    1 
ATOM   8811  C  C     . ARG D 4  1025 ? 14.795  -45.596 66.286  1.00 80.17  ? 1025 ARG A C     1 
ATOM   8812  O  O     . ARG D 4  1025 ? 13.805  -46.324 66.243  1.00 98.66  ? 1025 ARG A O     1 
ATOM   8813  C  CB    . ARG D 4  1025 ? 14.363  -43.197 65.790  1.00 74.42  ? 1025 ARG A CB    1 
ATOM   8814  C  CG    . ARG D 4  1025 ? 14.242  -41.778 66.326  1.00 85.96  ? 1025 ARG A CG    1 
ATOM   8815  C  CD    . ARG D 4  1025 ? 13.539  -40.841 65.371  1.00 95.07  ? 1025 ARG A CD    1 
ATOM   8816  N  NE    . ARG D 4  1025 ? 12.181  -40.536 65.809  1.00 97.02  ? 1025 ARG A NE    1 
ATOM   8817  C  CZ    . ARG D 4  1025 ? 11.802  -39.343 66.255  1.00 93.13  ? 1025 ARG A CZ    1 
ATOM   8818  N  NH1   . ARG D 4  1025 ? 12.679  -38.351 66.320  1.00 91.76  ? 1025 ARG A NH1   1 
ATOM   8819  N  NH2   . ARG D 4  1025 ? 10.550  -39.139 66.637  1.00 93.17  ? 1025 ARG A NH2   1 
ATOM   8820  N  N     . LEU D 4  1026 ? 15.985  -45.990 65.848  1.00 74.86  ? 1026 LEU A N     1 
ATOM   8821  C  CA    . LEU D 4  1026 ? 16.211  -47.355 65.378  1.00 75.83  ? 1026 LEU A CA    1 
ATOM   8822  C  C     . LEU D 4  1026 ? 16.728  -48.245 66.505  1.00 78.59  ? 1026 LEU A C     1 
ATOM   8823  O  O     . LEU D 4  1026 ? 17.702  -48.982 66.359  1.00 76.71  ? 1026 LEU A O     1 
ATOM   8824  C  CB    . LEU D 4  1026 ? 17.164  -47.342 64.189  1.00 75.56  ? 1026 LEU A CB    1 
ATOM   8825  C  CG    . LEU D 4  1026 ? 16.583  -46.713 62.917  1.00 79.10  ? 1026 LEU A CG    1 
ATOM   8826  C  CD1   . LEU D 4  1026 ? 17.504  -46.920 61.726  1.00 82.67  ? 1026 LEU A CD1   1 
ATOM   8827  C  CD2   . LEU D 4  1026 ? 15.189  -47.251 62.619  1.00 76.18  ? 1026 LEU A CD2   1 
ATOM   8828  N  N     . ALA D 4  1027 ? 16.057  -48.160 67.653  1.00 92.56  ? 1027 ALA A N     1 
ATOM   8829  C  CA    . ALA D 4  1027 ? 16.382  -48.948 68.833  1.00 77.15  ? 1027 ALA A CA    1 
ATOM   8830  C  C     . ALA D 4  1027 ? 15.563  -50.231 68.851  1.00 78.44  ? 1027 ALA A C     1 
ATOM   8831  O  O     . ALA D 4  1027 ? 14.447  -50.283 68.330  1.00 89.79  ? 1027 ALA A O     1 
ATOM   8832  C  CB    . ALA D 4  1027 ? 16.125  -48.147 70.109  1.00 76.73  ? 1027 ALA A CB    1 
ATOM   8833  N  N     . THR D 4  1028 ? 16.114  -51.257 69.506  1.00 79.15  ? 1028 THR A N     1 
ATOM   8834  C  CA    . THR D 4  1028 ? 15.663  -52.626 69.266  1.00 80.45  ? 1028 THR A CA    1 
ATOM   8835  C  C     . THR D 4  1028 ? 14.275  -52.892 69.844  1.00 81.79  ? 1028 THR A C     1 
ATOM   8836  O  O     . THR D 4  1028 ? 13.447  -53.532 69.187  1.00 83.21  ? 1028 THR A O     1 
ATOM   8837  C  CB    . THR D 4  1028 ? 16.687  -53.608 69.827  1.00 81.03  ? 1028 THR A CB    1 
ATOM   8838  O  OG1   . THR D 4  1028 ? 17.975  -53.294 69.287  1.00 80.40  ? 1028 THR A OG1   1 
ATOM   8839  C  CG2   . THR D 4  1028 ? 16.331  -55.026 69.426  1.00 82.41  ? 1028 THR A CG2   1 
ATOM   8840  N  N     . ARG D 4  1029 ? 13.996  -52.425 71.064  1.00 81.02  ? 1029 ARG A N     1 
ATOM   8841  C  CA    . ARG D 4  1029 ? 12.619  -52.480 71.551  1.00 81.70  ? 1029 ARG A CA    1 
ATOM   8842  C  C     . ARG D 4  1029 ? 11.715  -51.593 70.707  1.00 81.30  ? 1029 ARG A C     1 
ATOM   8843  O  O     . ARG D 4  1029 ? 10.585  -51.975 70.375  1.00 90.50  ? 1029 ARG A O     1 
ATOM   8844  C  CB    . ARG D 4  1029 ? 12.544  -52.069 73.024  1.00 81.59  ? 1029 ARG A CB    1 
ATOM   8845  C  CG    . ARG D 4  1029 ? 11.117  -51.762 73.491  1.00 87.25  ? 1029 ARG A CG    1 
ATOM   8846  C  CD    . ARG D 4  1029 ? 10.922  -51.767 74.997  1.00 105.47 ? 1029 ARG A CD    1 
ATOM   8847  N  NE    . ARG D 4  1029 ? 10.057  -52.861 75.429  1.00 105.84 ? 1029 ARG A NE    1 
ATOM   8848  C  CZ    . ARG D 4  1029 ? 10.479  -53.950 76.060  1.00 98.52  ? 1029 ARG A CZ    1 
ATOM   8849  N  NH1   . ARG D 4  1029 ? 11.759  -54.083 76.365  1.00 84.25  ? 1029 ARG A NH1   1 
ATOM   8850  N  NH2   . ARG D 4  1029 ? 9.618   -54.896 76.410  1.00 110.04 ? 1029 ARG A NH2   1 
ATOM   8851  N  N     . ARG D 4  1030 ? 12.220  -50.424 70.309  1.00 80.07  ? 1030 ARG A N     1 
ATOM   8852  C  CA    . ARG D 4  1030 ? 11.409  -49.450 69.588  1.00 79.63  ? 1030 ARG A CA    1 
ATOM   8853  C  C     . ARG D 4  1030 ? 11.047  -49.941 68.193  1.00 81.11  ? 1030 ARG A C     1 
ATOM   8854  O  O     . ARG D 4  1030 ? 9.901   -49.796 67.752  1.00 80.60  ? 1030 ARG A O     1 
ATOM   8855  C  CB    . ARG D 4  1030 ? 12.153  -48.121 69.506  1.00 78.24  ? 1030 ARG A CB    1 
ATOM   8856  C  CG    . ARG D 4  1030 ? 11.343  -46.962 70.010  1.00 77.85  ? 1030 ARG A CG    1 
ATOM   8857  C  CD    . ARG D 4  1030 ? 11.831  -45.650 69.451  1.00 76.61  ? 1030 ARG A CD    1 
ATOM   8858  N  NE    . ARG D 4  1030 ? 10.968  -44.555 69.876  1.00 79.92  ? 1030 ARG A NE    1 
ATOM   8859  C  CZ    . ARG D 4  1030 ? 10.983  -43.343 69.337  1.00 95.96  ? 1030 ARG A CZ    1 
ATOM   8860  N  NH1   . ARG D 4  1030 ? 11.813  -43.068 68.343  1.00 105.71 ? 1030 ARG A NH1   1 
ATOM   8861  N  NH2   . ARG D 4  1030 ? 10.156  -42.410 69.785  1.00 106.84 ? 1030 ARG A NH2   1 
ATOM   8862  N  N     . VAL D 4  1031 ? 12.019  -50.513 67.478  1.00 82.65  ? 1031 VAL A N     1 
ATOM   8863  C  CA    . VAL D 4  1031 ? 11.757  -51.047 66.144  1.00 80.62  ? 1031 VAL A CA    1 
ATOM   8864  C  C     . VAL D 4  1031 ? 10.758  -52.195 66.217  1.00 82.13  ? 1031 VAL A C     1 
ATOM   8865  O  O     . VAL D 4  1031 ? 9.877   -52.330 65.361  1.00 87.21  ? 1031 VAL A O     1 
ATOM   8866  C  CB    . VAL D 4  1031 ? 13.080  -51.475 65.477  1.00 80.40  ? 1031 VAL A CB    1 
ATOM   8867  C  CG1   . VAL D 4  1031 ? 12.833  -52.292 64.224  1.00 81.31  ? 1031 VAL A CG1   1 
ATOM   8868  C  CG2   . VAL D 4  1031 ? 13.899  -50.256 65.126  1.00 79.02  ? 1031 VAL A CG2   1 
ATOM   8869  N  N     . LEU D 4  1032 ? 10.835  -53.002 67.268  1.00 82.79  ? 1032 LEU A N     1 
ATOM   8870  C  CA    . LEU D 4  1032 ? 9.990   -54.183 67.341  1.00 88.06  ? 1032 LEU A CA    1 
ATOM   8871  C  C     . LEU D 4  1032 ? 8.667   -53.950 68.054  1.00 94.51  ? 1032 LEU A C     1 
ATOM   8872  O  O     . LEU D 4  1032 ? 7.671   -54.585 67.692  1.00 114.10 ? 1032 LEU A O     1 
ATOM   8873  C  CB    . LEU D 4  1032 ? 10.761  -55.326 68.006  1.00 84.94  ? 1032 LEU A CB    1 
ATOM   8874  C  CG    . LEU D 4  1032 ? 12.027  -55.715 67.233  1.00 84.70  ? 1032 LEU A CG    1 
ATOM   8875  C  CD1   . LEU D 4  1032 ? 12.608  -56.997 67.754  1.00 88.44  ? 1032 LEU A CD1   1 
ATOM   8876  C  CD2   . LEU D 4  1032 ? 11.725  -55.866 65.750  1.00 85.06  ? 1032 LEU A CD2   1 
ATOM   8877  N  N     . GLN D 4  1033 ? 8.607   -53.063 69.046  1.00 84.15  ? 1033 GLN A N     1 
ATOM   8878  C  CA    . GLN D 4  1033 ? 7.339   -52.849 69.737  1.00 84.82  ? 1033 GLN A CA    1 
ATOM   8879  C  C     . GLN D 4  1033 ? 6.617   -51.582 69.297  1.00 84.23  ? 1033 GLN A C     1 
ATOM   8880  O  O     . GLN D 4  1033 ? 5.390   -51.600 69.158  1.00 108.20 ? 1033 GLN A O     1 
ATOM   8881  C  CB    . GLN D 4  1033 ? 7.539   -52.812 71.256  1.00 96.75  ? 1033 GLN A CB    1 
ATOM   8882  C  CG    . GLN D 4  1033 ? 6.222   -52.868 72.034  1.00 110.70 ? 1033 GLN A CG    1 
ATOM   8883  C  CD    . GLN D 4  1033 ? 6.409   -52.901 73.539  1.00 113.50 ? 1033 GLN A CD    1 
ATOM   8884  O  OE1   . GLN D 4  1033 ? 7.532   -52.850 74.042  1.00 118.92 ? 1033 GLN A OE1   1 
ATOM   8885  N  NE2   . GLN D 4  1033 ? 5.301   -52.975 74.268  1.00 108.88 ? 1033 GLN A NE2   1 
ATOM   8886  N  N     . GLU D 4  1034 ? 7.334   -50.481 69.066  1.00 82.82  ? 1034 GLU A N     1 
ATOM   8887  C  CA    . GLU D 4  1034 ? 6.645   -49.224 68.787  1.00 82.29  ? 1034 GLU A CA    1 
ATOM   8888  C  C     . GLU D 4  1034 ? 6.107   -49.177 67.359  1.00 82.55  ? 1034 GLU A C     1 
ATOM   8889  O  O     . GLU D 4  1034 ? 4.938   -48.842 67.145  1.00 83.16  ? 1034 GLU A O     1 
ATOM   8890  C  CB    . GLU D 4  1034 ? 7.566   -48.033 69.068  1.00 82.56  ? 1034 GLU A CB    1 
ATOM   8891  C  CG    . GLU D 4  1034 ? 7.833   -47.797 70.551  1.00 88.30  ? 1034 GLU A CG    1 
ATOM   8892  C  CD    . GLU D 4  1034 ? 7.643   -46.346 70.961  1.00 105.24 ? 1034 GLU A CD    1 
ATOM   8893  O  OE1   . GLU D 4  1034 ? 8.502   -45.507 70.622  1.00 110.38 ? 1034 GLU A OE1   1 
ATOM   8894  O  OE2   . GLU D 4  1034 ? 6.630   -46.044 71.625  1.00 112.24 ? 1034 GLU A OE2   1 
ATOM   8895  N  N     . TYR D 4  1035 ? 6.932   -49.519 66.367  1.00 82.21  ? 1035 TYR A N     1 
ATOM   8896  C  CA    . TYR D 4  1035 ? 6.478   -49.610 64.975  1.00 92.94  ? 1035 TYR A CA    1 
ATOM   8897  C  C     . TYR D 4  1035 ? 6.976   -50.921 64.374  1.00 88.68  ? 1035 TYR A C     1 
ATOM   8898  O  O     . TYR D 4  1035 ? 8.056   -50.967 63.781  1.00 95.20  ? 1035 TYR A O     1 
ATOM   8899  C  CB    . TYR D 4  1035 ? 6.919   -48.395 64.151  1.00 106.28 ? 1035 TYR A CB    1 
ATOM   8900  C  CG    . TYR D 4  1035 ? 8.223   -47.733 64.548  1.00 100.56 ? 1035 TYR A CG    1 
ATOM   8901  C  CD1   . TYR D 4  1035 ? 9.439   -48.158 64.024  1.00 90.10  ? 1035 TYR A CD1   1 
ATOM   8902  C  CD2   . TYR D 4  1035 ? 8.230   -46.649 65.416  1.00 95.28  ? 1035 TYR A CD2   1 
ATOM   8903  C  CE1   . TYR D 4  1035 ? 10.623  -47.535 64.372  1.00 78.37  ? 1035 TYR A CE1   1 
ATOM   8904  C  CE2   . TYR D 4  1035 ? 9.404   -46.023 65.769  1.00 85.24  ? 1035 TYR A CE2   1 
ATOM   8905  C  CZ    . TYR D 4  1035 ? 10.594  -46.469 65.245  1.00 77.56  ? 1035 TYR A CZ    1 
ATOM   8906  O  OH    . TYR D 4  1035 ? 11.758  -45.842 65.596  1.00 83.32  ? 1035 TYR A OH    1 
ATOM   8907  N  N     . ARG D 4  1036 ? 6.146   -51.963 64.488  1.00 84.86  ? 1036 ARG A N     1 
ATOM   8908  C  CA    . ARG D 4  1036 ? 6.505   -53.357 64.236  1.00 85.87  ? 1036 ARG A CA    1 
ATOM   8909  C  C     . ARG D 4  1036 ? 7.051   -53.618 62.836  1.00 85.88  ? 1036 ARG A C     1 
ATOM   8910  O  O     . ARG D 4  1036 ? 6.357   -54.190 61.991  1.00 87.01  ? 1036 ARG A O     1 
ATOM   8911  C  CB    . ARG D 4  1036 ? 5.284   -54.244 64.479  1.00 91.71  ? 1036 ARG A CB    1 
ATOM   8912  C  CG    . ARG D 4  1036 ? 4.969   -54.439 65.944  1.00 110.61 ? 1036 ARG A CG    1 
ATOM   8913  C  CD    . ARG D 4  1036 ? 4.577   -55.867 66.276  1.00 122.24 ? 1036 ARG A CD    1 
ATOM   8914  N  NE    . ARG D 4  1036 ? 3.161   -55.979 66.615  1.00 133.53 ? 1036 ARG A NE    1 
ATOM   8915  C  CZ    . ARG D 4  1036 ? 2.642   -55.650 67.796  1.00 134.24 ? 1036 ARG A CZ    1 
ATOM   8916  N  NH1   . ARG D 4  1036 ? 3.417   -55.183 68.765  1.00 119.47 ? 1036 ARG A NH1   1 
ATOM   8917  N  NH2   . ARG D 4  1036 ? 1.341   -55.788 68.009  1.00 145.38 ? 1036 ARG A NH2   1 
ATOM   8918  N  N     . LEU D 4  1037 ? 8.299   -53.221 62.597  1.00 84.73  ? 1037 LEU A N     1 
ATOM   8919  C  CA    . LEU D 4  1037 ? 8.927   -53.432 61.300  1.00 86.19  ? 1037 LEU A CA    1 
ATOM   8920  C  C     . LEU D 4  1037 ? 9.214   -54.908 61.070  1.00 86.03  ? 1037 LEU A C     1 
ATOM   8921  O  O     . LEU D 4  1037 ? 9.553   -55.643 61.999  1.00 86.41  ? 1037 LEU A O     1 
ATOM   8922  C  CB    . LEU D 4  1037 ? 10.233  -52.642 61.207  1.00 83.25  ? 1037 LEU A CB    1 
ATOM   8923  C  CG    . LEU D 4  1037 ? 10.229  -51.113 61.192  1.00 81.85  ? 1037 LEU A CG    1 
ATOM   8924  C  CD1   . LEU D 4  1037 ? 11.424  -50.611 60.407  1.00 83.96  ? 1037 LEU A CD1   1 
ATOM   8925  C  CD2   . LEU D 4  1037 ? 8.948   -50.570 60.591  1.00 82.18  ? 1037 LEU A CD2   1 
ATOM   8926  N  N     . THR D 4  1038 ? 9.072   -55.341 59.820  1.00 86.79  ? 1038 THR A N     1 
ATOM   8927  C  CA    . THR D 4  1038 ? 9.612   -56.618 59.390  1.00 87.90  ? 1038 THR A CA    1 
ATOM   8928  C  C     . THR D 4  1038 ? 11.067  -56.417 58.974  1.00 91.13  ? 1038 THR A C     1 
ATOM   8929  O  O     . THR D 4  1038 ? 11.593  -55.303 58.991  1.00 102.49 ? 1038 THR A O     1 
ATOM   8930  C  CB    . THR D 4  1038 ? 8.792   -57.202 58.242  1.00 89.28  ? 1038 THR A CB    1 
ATOM   8931  O  OG1   . THR D 4  1038 ? 9.311   -56.720 56.995  1.00 96.66  ? 1038 THR A OG1   1 
ATOM   8932  C  CG2   . THR D 4  1038 ? 7.327   -56.806 58.367  1.00 89.73  ? 1038 THR A CG2   1 
ATOM   8933  N  N     . LYS D 4  1039 ? 11.737  -57.506 58.594  1.00 87.96  ? 1039 LYS A N     1 
ATOM   8934  C  CA    . LYS D 4  1039 ? 13.082  -57.380 58.043  1.00 87.39  ? 1039 LYS A CA    1 
ATOM   8935  C  C     . LYS D 4  1039 ? 13.046  -56.707 56.678  1.00 90.86  ? 1039 LYS A C     1 
ATOM   8936  O  O     . LYS D 4  1039 ? 13.964  -55.954 56.329  1.00 86.02  ? 1039 LYS A O     1 
ATOM   8937  C  CB    . LYS D 4  1039 ? 13.736  -58.765 57.974  1.00 88.69  ? 1039 LYS A CB    1 
ATOM   8938  C  CG    . LYS D 4  1039 ? 14.842  -58.927 56.949  1.00 88.80  ? 1039 LYS A CG    1 
ATOM   8939  C  CD    . LYS D 4  1039 ? 16.191  -58.634 57.569  1.00 90.52  ? 1039 LYS A CD    1 
ATOM   8940  C  CE    . LYS D 4  1039 ? 17.315  -59.250 56.760  1.00 98.02  ? 1039 LYS A CE    1 
ATOM   8941  N  NZ    . LYS D 4  1039 ? 18.423  -58.277 56.567  1.00 100.32 ? 1039 LYS A NZ    1 
ATOM   8942  N  N     . GLN D 4  1040 ? 11.971  -56.939 55.924  1.00 100.32 ? 1040 GLN A N     1 
ATOM   8943  C  CA    . GLN D 4  1040 ? 11.800  -56.321 54.614  1.00 104.84 ? 1040 GLN A CA    1 
ATOM   8944  C  C     . GLN D 4  1040 ? 11.687  -54.806 54.730  1.00 99.91  ? 1040 GLN A C     1 
ATOM   8945  O  O     . GLN D 4  1040 ? 12.336  -54.063 53.986  1.00 112.25 ? 1040 GLN A O     1 
ATOM   8946  C  CB    . GLN D 4  1040 ? 10.555  -56.905 53.948  1.00 112.49 ? 1040 GLN A CB    1 
ATOM   8947  C  CG    . GLN D 4  1040 ? 10.403  -56.610 52.475  1.00 101.66 ? 1040 GLN A CG    1 
ATOM   8948  C  CD    . GLN D 4  1040 ? 9.116   -57.183 51.918  1.00 99.78  ? 1040 GLN A CD    1 
ATOM   8949  O  OE1   . GLN D 4  1040 ? 8.050   -57.037 52.518  1.00 97.63  ? 1040 GLN A OE1   1 
ATOM   8950  N  NE2   . GLN D 4  1040 ? 9.205   -57.838 50.768  1.00 114.05 ? 1040 GLN A NE2   1 
ATOM   8951  N  N     . ALA D 4  1041 ? 10.866  -54.331 55.670  1.00 91.31  ? 1041 ALA A N     1 
ATOM   8952  C  CA    . ALA D 4  1041 ? 10.701  -52.893 55.847  1.00 87.42  ? 1041 ALA A CA    1 
ATOM   8953  C  C     . ALA D 4  1041 ? 11.946  -52.263 56.458  1.00 90.17  ? 1041 ALA A C     1 
ATOM   8954  O  O     . ALA D 4  1041 ? 12.325  -51.147 56.085  1.00 97.96  ? 1041 ALA A O     1 
ATOM   8955  C  CB    . ALA D 4  1041 ? 9.474   -52.609 56.712  1.00 84.59  ? 1041 ALA A CB    1 
ATOM   8956  N  N     . PHE D 4  1042 ? 12.603  -52.974 57.381  1.00 90.52  ? 1042 PHE A N     1 
ATOM   8957  C  CA    . PHE D 4  1042 ? 13.768  -52.425 58.072  1.00 89.29  ? 1042 PHE A CA    1 
ATOM   8958  C  C     . PHE D 4  1042 ? 14.933  -52.211 57.116  1.00 88.77  ? 1042 PHE A C     1 
ATOM   8959  O  O     . PHE D 4  1042 ? 15.666  -51.222 57.232  1.00 96.84  ? 1042 PHE A O     1 
ATOM   8960  C  CB    . PHE D 4  1042 ? 14.165  -53.352 59.227  1.00 82.49  ? 1042 PHE A CB    1 
ATOM   8961  C  CG    . PHE D 4  1042 ? 15.388  -52.909 59.989  1.00 81.47  ? 1042 PHE A CG    1 
ATOM   8962  C  CD1   . PHE D 4  1042 ? 15.264  -52.070 61.083  1.00 80.52  ? 1042 PHE A CD1   1 
ATOM   8963  C  CD2   . PHE D 4  1042 ? 16.650  -53.386 59.657  1.00 81.63  ? 1042 PHE A CD2   1 
ATOM   8964  C  CE1   . PHE D 4  1042 ? 16.378  -51.671 61.799  1.00 79.70  ? 1042 PHE A CE1   1 
ATOM   8965  C  CE2   . PHE D 4  1042 ? 17.767  -52.991 60.368  1.00 80.82  ? 1042 PHE A CE2   1 
ATOM   8966  C  CZ    . PHE D 4  1042 ? 17.631  -52.135 61.441  1.00 79.85  ? 1042 PHE A CZ    1 
ATOM   8967  N  N     . ASP D 4  1043 ? 15.125  -53.128 56.168  1.00 82.71  ? 1043 ASP A N     1 
ATOM   8968  C  CA    . ASP D 4  1043 ? 16.191  -52.954 55.193  1.00 85.90  ? 1043 ASP A CA    1 
ATOM   8969  C  C     . ASP D 4  1043 ? 15.869  -51.859 54.187  1.00 86.01  ? 1043 ASP A C     1 
ATOM   8970  O  O     . ASP D 4  1043 ? 16.790  -51.291 53.592  1.00 82.74  ? 1043 ASP A O     1 
ATOM   8971  C  CB    . ASP D 4  1043 ? 16.460  -54.273 54.475  1.00 110.60 ? 1043 ASP A CB    1 
ATOM   8972  C  CG    . ASP D 4  1043 ? 17.483  -55.120 55.194  1.00 116.84 ? 1043 ASP A CG    1 
ATOM   8973  O  OD1   . ASP D 4  1043 ? 17.075  -55.930 56.046  1.00 114.60 ? 1043 ASP A OD1   1 
ATOM   8974  O  OD2   . ASP D 4  1043 ? 18.691  -54.976 54.910  1.00 119.85 ? 1043 ASP A OD2   1 
ATOM   8975  N  N     . TRP D 4  1044 ? 14.585  -51.552 53.987  1.00 85.96  ? 1044 TRP A N     1 
ATOM   8976  C  CA    . TRP D 4  1044 ? 14.221  -50.413 53.154  1.00 92.36  ? 1044 TRP A CA    1 
ATOM   8977  C  C     . TRP D 4  1044 ? 14.532  -49.099 53.855  1.00 89.84  ? 1044 TRP A C     1 
ATOM   8978  O  O     . TRP D 4  1044 ? 15.025  -48.155 53.224  1.00 101.67 ? 1044 TRP A O     1 
ATOM   8979  C  CB    . TRP D 4  1044 ? 12.740  -50.485 52.788  1.00 101.66 ? 1044 TRP A CB    1 
ATOM   8980  C  CG    . TRP D 4  1044 ? 12.324  -49.465 51.776  1.00 105.06 ? 1044 TRP A CG    1 
ATOM   8981  C  CD1   . TRP D 4  1044 ? 12.835  -49.291 50.524  1.00 88.15  ? 1044 TRP A CD1   1 
ATOM   8982  C  CD2   . TRP D 4  1044 ? 11.323  -48.457 51.944  1.00 98.05  ? 1044 TRP A CD2   1 
ATOM   8983  N  NE1   . TRP D 4  1044 ? 12.202  -48.247 49.896  1.00 81.29  ? 1044 TRP A NE1   1 
ATOM   8984  C  CE2   . TRP D 4  1044 ? 11.270  -47.717 50.749  1.00 89.58  ? 1044 TRP A CE2   1 
ATOM   8985  C  CE3   . TRP D 4  1044 ? 10.461  -48.114 52.989  1.00 92.64  ? 1044 TRP A CE3   1 
ATOM   8986  C  CZ2   . TRP D 4  1044 ? 10.393  -46.653 50.570  1.00 104.29 ? 1044 TRP A CZ2   1 
ATOM   8987  C  CZ3   . TRP D 4  1044 ? 9.593   -47.062 52.809  1.00 80.51  ? 1044 TRP A CZ3   1 
ATOM   8988  C  CH2   . TRP D 4  1044 ? 9.563   -46.343 51.609  1.00 93.05  ? 1044 TRP A CH2   1 
ATOM   8989  N  N     . VAL D 4  1045 ? 14.244  -49.023 55.158  1.00 80.11  ? 1045 VAL A N     1 
ATOM   8990  C  CA    . VAL D 4  1045 ? 14.508  -47.816 55.937  1.00 79.65  ? 1045 VAL A CA    1 
ATOM   8991  C  C     . VAL D 4  1045 ? 16.002  -47.527 55.998  1.00 82.57  ? 1045 VAL A C     1 
ATOM   8992  O  O     . VAL D 4  1045 ? 16.419  -46.361 55.970  1.00 88.72  ? 1045 VAL A O     1 
ATOM   8993  C  CB    . VAL D 4  1045 ? 13.889  -47.967 57.344  1.00 78.01  ? 1045 VAL A CB    1 
ATOM   8994  C  CG1   . VAL D 4  1045 ? 14.222  -46.782 58.229  1.00 76.70  ? 1045 VAL A CG1   1 
ATOM   8995  C  CG2   . VAL D 4  1045 ? 12.387  -48.116 57.237  1.00 79.00  ? 1045 VAL A CG2   1 
ATOM   8996  N  N     . LEU D 4  1046 ? 16.832  -48.573 56.036  1.00 79.47  ? 1046 LEU A N     1 
ATOM   8997  C  CA    . LEU D 4  1046 ? 18.277  -48.392 56.012  1.00 83.23  ? 1046 LEU A CA    1 
ATOM   8998  C  C     . LEU D 4  1046 ? 18.784  -47.854 54.678  1.00 91.78  ? 1046 LEU A C     1 
ATOM   8999  O  O     . LEU D 4  1046 ? 19.868  -47.265 54.643  1.00 96.22  ? 1046 LEU A O     1 
ATOM   9000  C  CB    . LEU D 4  1046 ? 18.979  -49.714 56.325  1.00 80.97  ? 1046 LEU A CB    1 
ATOM   9001  C  CG    . LEU D 4  1046 ? 19.667  -49.817 57.686  1.00 81.50  ? 1046 LEU A CG    1 
ATOM   9002  C  CD1   . LEU D 4  1046 ? 18.640  -49.804 58.794  1.00 80.20  ? 1046 LEU A CD1   1 
ATOM   9003  C  CD2   . LEU D 4  1046 ? 20.519  -51.070 57.752  1.00 85.29  ? 1046 LEU A CD2   1 
ATOM   9004  N  N     . SER D 4  1047 ? 18.041  -48.046 53.587  1.00 92.98  ? 1047 SER A N     1 
ATOM   9005  C  CA    . SER D 4  1047 ? 18.445  -47.561 52.272  1.00 94.21  ? 1047 SER A CA    1 
ATOM   9006  C  C     . SER D 4  1047 ? 17.886  -46.187 51.929  1.00 89.11  ? 1047 SER A C     1 
ATOM   9007  O  O     . SER D 4  1047 ? 18.531  -45.441 51.186  1.00 86.20  ? 1047 SER A O     1 
ATOM   9008  C  CB    . SER D 4  1047 ? 18.014  -48.557 51.189  1.00 108.19 ? 1047 SER A CB    1 
ATOM   9009  O  OG    . SER D 4  1047 ? 16.767  -49.152 51.511  1.00 124.07 ? 1047 SER A OG    1 
ATOM   9010  N  N     . ASN D 4  1048 ? 16.702  -45.835 52.439  1.00 84.26  ? 1048 ASN A N     1 
ATOM   9011  C  CA    . ASN D 4  1048 ? 16.198  -44.474 52.266  1.00 85.58  ? 1048 ASN A CA    1 
ATOM   9012  C  C     . ASN D 4  1048 ? 17.021  -43.486 53.077  1.00 91.45  ? 1048 ASN A C     1 
ATOM   9013  O  O     . ASN D 4  1048 ? 17.359  -42.399 52.592  1.00 105.05 ? 1048 ASN A O     1 
ATOM   9014  C  CB    . ASN D 4  1048 ? 14.727  -44.383 52.679  1.00 93.78  ? 1048 ASN A CB    1 
ATOM   9015  C  CG    . ASN D 4  1048 ? 13.784  -44.966 51.650  1.00 99.32  ? 1048 ASN A CG    1 
ATOM   9016  O  OD1   . ASN D 4  1048 ? 12.858  -44.295 51.197  1.00 100.61 ? 1048 ASN A OD1   1 
ATOM   9017  N  ND2   . ASN D 4  1048 ? 14.004  -46.220 51.282  1.00 103.89 ? 1048 ASN A ND2   1 
ATOM   9018  N  N     . ILE D 4  1049 ? 17.336  -43.853 54.323  1.00 81.23  ? 1049 ILE A N     1 
ATOM   9019  C  CA    . ILE D 4  1049 ? 18.103  -42.985 55.212  1.00 73.04  ? 1049 ILE A CA    1 
ATOM   9020  C  C     . ILE D 4  1049 ? 19.476  -42.699 54.623  1.00 72.67  ? 1049 ILE A C     1 
ATOM   9021  O  O     . ILE D 4  1049 ? 19.928  -41.550 54.611  1.00 73.51  ? 1049 ILE A O     1 
ATOM   9022  C  CB    . ILE D 4  1049 ? 18.200  -43.621 56.613  1.00 73.22  ? 1049 ILE A CB    1 
ATOM   9023  C  CG1   . ILE D 4  1049 ? 16.971  -43.272 57.447  1.00 73.11  ? 1049 ILE A CG1   1 
ATOM   9024  C  CG2   . ILE D 4  1049 ? 19.459  -43.182 57.348  1.00 72.49  ? 1049 ILE A CG2   1 
ATOM   9025  C  CD1   . ILE D 4  1049 ? 16.833  -44.124 58.677  1.00 73.62  ? 1049 ILE A CD1   1 
ATOM   9026  N  N     . GLU D 4  1050 ? 20.137  -43.726 54.083  1.00 73.52  ? 1050 GLU A N     1 
ATOM   9027  C  CA    . GLU D 4  1050 ? 21.451  -43.530 53.481  1.00 73.36  ? 1050 GLU A CA    1 
ATOM   9028  C  C     . GLU D 4  1050 ? 21.369  -42.674 52.220  1.00 78.82  ? 1050 GLU A C     1 
ATOM   9029  O  O     . GLU D 4  1050 ? 22.298  -41.913 51.930  1.00 77.04  ? 1050 GLU A O     1 
ATOM   9030  C  CB    . GLU D 4  1050 ? 22.085  -44.891 53.183  1.00 74.54  ? 1050 GLU A CB    1 
ATOM   9031  C  CG    . GLU D 4  1050 ? 23.474  -44.842 52.565  1.00 74.64  ? 1050 GLU A CG    1 
ATOM   9032  C  CD    . GLU D 4  1050 ? 24.085  -46.218 52.399  1.00 78.67  ? 1050 GLU A CD    1 
ATOM   9033  O  OE1   . GLU D 4  1050 ? 23.466  -47.200 52.856  1.00 81.21  ? 1050 GLU A OE1   1 
ATOM   9034  O  OE2   . GLU D 4  1050 ? 25.186  -46.316 51.818  1.00 84.65  ? 1050 GLU A OE2   1 
ATOM   9035  N  N     . ALA D 4  1051 ? 20.257  -42.752 51.484  1.00 87.80  ? 1051 ALA A N     1 
ATOM   9036  C  CA    . ALA D 4  1051 ? 20.082  -41.914 50.303  1.00 83.36  ? 1051 ALA A CA    1 
ATOM   9037  C  C     . ALA D 4  1051 ? 19.700  -40.488 50.682  1.00 88.15  ? 1051 ALA A C     1 
ATOM   9038  O  O     . ALA D 4  1051 ? 20.350  -39.535 50.243  1.00 101.35 ? 1051 ALA A O     1 
ATOM   9039  C  CB    . ALA D 4  1051 ? 19.028  -42.521 49.378  1.00 93.53  ? 1051 ALA A CB    1 
ATOM   9040  N  N     . GLN D 4  1052 ? 18.647  -40.332 51.501  1.00 82.71  ? 1052 GLN A N     1 
ATOM   9041  C  CA    . GLN D 4  1052 ? 18.169  -39.012 51.916  1.00 80.09  ? 1052 GLN A CA    1 
ATOM   9042  C  C     . GLN D 4  1052 ? 19.249  -38.206 52.630  1.00 85.13  ? 1052 GLN A C     1 
ATOM   9043  O  O     . GLN D 4  1052 ? 19.269  -36.974 52.532  1.00 86.60  ? 1052 GLN A O     1 
ATOM   9044  C  CB    . GLN D 4  1052 ? 16.952  -39.164 52.832  1.00 77.34  ? 1052 GLN A CB    1 
ATOM   9045  C  CG    . GLN D 4  1052 ? 15.600  -39.146 52.135  1.00 74.30  ? 1052 GLN A CG    1 
ATOM   9046  C  CD    . GLN D 4  1052 ? 14.565  -38.340 52.901  1.00 78.31  ? 1052 GLN A CD    1 
ATOM   9047  O  OE1   . GLN D 4  1052 ? 14.773  -37.165 53.205  1.00 96.36  ? 1052 GLN A OE1   1 
ATOM   9048  N  NE2   . GLN D 4  1052 ? 13.447  -38.976 53.230  1.00 72.09  ? 1052 GLN A NE2   1 
ATOM   9049  N  N     . PHE D 4  1053 ? 20.147  -38.882 53.348  1.00 82.56  ? 1053 PHE A N     1 
ATOM   9050  C  CA    . PHE D 4  1053 ? 21.288  -38.214 53.962  1.00 71.47  ? 1053 PHE A CA    1 
ATOM   9051  C  C     . PHE D 4  1053 ? 22.302  -37.800 52.906  1.00 76.01  ? 1053 PHE A C     1 
ATOM   9052  O  O     . PHE D 4  1053 ? 22.727  -36.640 52.862  1.00 87.55  ? 1053 PHE A O     1 
ATOM   9053  C  CB    . PHE D 4  1053 ? 21.905  -39.152 55.006  1.00 69.64  ? 1053 PHE A CB    1 
ATOM   9054  C  CG    . PHE D 4  1053 ? 23.172  -38.656 55.650  1.00 69.11  ? 1053 PHE A CG    1 
ATOM   9055