data_6UXW
# 
_entry.id   6UXW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.324 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6UXW         
WWPDB D_1000244266 
EMDB  EMD-20934    
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB 'SWI/SNF nucleosome complex with ADP-BeFx'    EMD-20934 'associated EM volume' 
EMDB 'SWI/SNF body'                                EMD-20933 'other EM volume'      
EMDB 'SWI/SNF nucleosome complex with ATP-gamma-S' EMD-20935 'other EM volume'      
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6UXW 
_pdbx_database_status.recvd_initial_deposition_date   2019-11-08 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'He, Y.'  1 ? 
'Han, Y.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            579 
_citation.language                  ? 
_citation.page_first                452 
_citation.page_last                 455 
_citation.title                     'Cryo-EM structure of SWI/SNF complex bound to a nucleosome.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41586-020-2087-1 
_citation.pdbx_database_id_PubMed   32188938 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Han, Y.'     1 ? 
primary 'Reyes, A.A.' 2 ? 
primary 'Malik, S.'   3 ? 
primary 'He, Y.'      4 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6UXW 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6UXW 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Histone H3.2'                                                 15303.930  2  ?       ? ? ? 
2  polymer     man 'Histone H4'                                                   11263.231  2  ?       ? ? ? 
3  polymer     man 'Histone H2A type 1'                                           13978.241  2  ?       ? ? ? 
4  polymer     man 'Histone H2B 1.1'                                              13524.752  2  ?       ? ? 
'RESIDUES 597-653 AND 765-780 OF CHAIN F, AND RESIDUES 609-655 AND 763-779 OF CHAIN G ARE NOT CONFIDENTLY ASSIGNED' 
5  polymer     syn '601 sequence bottom strand'                                   56943.293  1  ?       ? ? ? 
6  polymer     syn '601 sequence top strand'                                      61785.359  1  ?       ? ? ? 
7  polymer     nat 'Actin-related protein 7'                                      53863.016  1  ?       ? ? ? 
8  polymer     nat 'Actin-like protein ARP9'                                      53131.930  1  ?       ? ? ? 
9  polymer     nat 'Regulator of Ty1 transposition protein 102'                   17817.615  1  ?       ? ? ? 
10 polymer     nat 'Transcription regulatory protein SNF2'                        194315.094 1  3.6.4.- ? ? ? 
11 polymer     nat 'SWI/SNF chromatin-remodeling complex subunit SWI1'            148065.188 1  ?       ? ? ? 
12 polymer     nat 'SWI/SNF chromatin-remodeling complex subunit SNF5'            102642.172 1  ?       ? ? ? 
13 polymer     nat 'SWI/SNF complex subunit SWI3'                                 93034.164  4  ?       ? ? ? 
14 polymer     nat 'Transcription regulatory protein SNF12'                       63947.633  1  ?       ? ? ? 
15 polymer     nat 'Transcription regulatory protein SNF6'                        19565.189  1  ?       ? ? ? 
16 polymer     nat 'Unknown protein'                                              5720.042   5  ?       ? ? ? 
17 polymer     nat 'SWI/SNF global transcription activator complex subunit SWP82' 7081.720   1  ?       ? ? ? 
18 non-polymer syn 'PHOSPHATE ION'                                                94.971     12 ?       ? ? ? 
19 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"                                     427.201    1  ?       ? ? ? 
20 non-polymer syn 'BERYLLIUM TRIFLUORIDE ION'                                    66.007     1  ?       ? ? ? 
21 non-polymer syn 'MAGNESIUM ION'                                                24.305     1  ?       ? ? ? 
22 water       nat water                                                          18.015     86 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
4  H2B1.1 
7  'Actin-like protein ARP7,Chromatin structure-remodeling complex protein ARP7,SWI/SNF complex component ARP7' 
8  'Chromatin structure-remodeling complex protein ARP9,SWI/SNF complex component ARP9' 
10 
;ATP-dependent helicase SNF2,Regulatory protein GAM1,Regulatory protein SWI2,SWI/SNF complex component SNF2,Transcription factor TYE3
;
11 
'Regulatory protein GAM3,SWI/SNF complex subunit SWI1,Transcription regulatory protein ADR6,Transcription regulatory protein SWI1' 
12 'SWI/SNF complex subunit SNF5,Transcription factor TYE4,Transcription regulatory protein SNF5' 
13 'Transcription factor TYE2,Transcription regulatory protein SWI3' 
14 'SWI/SNF complex component SWP73' 
15 'SWI/SNF complex component SNF6' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
R,V       ? 
2  'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
S,W       ? 
3  'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
T,X       ? 
4  'polypeptide(L)'        no no 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
U,Y       ? 
5  polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)(DG)
(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)(DA)
(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)(DA)
(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)(DC)
(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)(DG)
(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)(DG)
(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)(DA)
(DT)(DC)(DG)(DA)(DT)(DT)(DA)(DA)(DC)(DG)(DA)(DT)(DG)(DC)(DT)(DG)(DG)(DG)(DC)(DA)
(DT)(DA)(DA)(DG)(DC)(DG)(DT)(DG)(DG)(DT)(DT)(DC)(DA)(DA)(DT)(DA)(DC)(DC)(DG)(DG)
(DC)(DG)(DC)(DA)(DT)
;
;ATCAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCC
CGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCGATTAACGATGCTGGGCA
TAAGCGTGGTTCAATACCGGCGCAT
;
a         ? 
6  polydeoxyribonucleotide no no 
;(DA)(DC)(DC)(DT)(DC)(DC)(DC)(DA)(DC)(DT)(DA)(DT)(DT)(DT)(DT)(DA)(DT)(DG)(DC)(DG)
(DC)(DC)(DG)(DG)(DT)(DA)(DT)(DT)(DG)(DA)(DA)(DC)(DC)(DA)(DC)(DG)(DC)(DT)(DT)(DA)
(DT)(DG)(DC)(DC)(DC)(DA)(DG)(DC)(DA)(DT)(DC)(DG)(DT)(DT)(DA)(DA)(DT)(DC)(DG)(DA)
(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)(DA)(DC)(DG)(DT)(DG)(DC)
(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)(DG)(DT)(DA)(DA)(DT)(DC)
(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)(DA)(DA)(DC)(DG)(DC)(DG)
(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)(DC)(DG)(DT)(DG)(DC)(DG)
(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)(DG)(DA)(DG)(DC)(DT)(DG)
(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)(DA)(DG)(DC)(DG)(DG)(DC)
(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)(DT)(DC)(DT)(DG)(DA)(DT)
;
;ACCTCCCACTATTTTATGCGCCGGTATTGAACCACGCTTATGCCCAGCATCGTTAATCGATGTATATATCTGACACGTGC
CTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTG
TCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTGAT
;
b         ? 
7  'polypeptide(L)'        no no 
;MTLNRKCVVIHNGSHRTVAGFSNVELPQCIIPSSYIKRTDEGGEAEFIFGTYNMIDAAAEKRNGDEVYTLVDSQGLPYNW
DALEMQWRYLYDTQLKVSPEELPLVITMPATNGKPDMAILERYYELAFDKLNVPVFQIVIEPLAIALSMGKSSAFVIDIG
ASGCNVTPIIDGIVVKNAVVRSKFGGDFLDFQVHERLAPLIKEENDMENMADEQKRSTDVWYEASTWIQQFKSTMLQVSE
KDLFELERYYKEQADIYAKQQEQLKQMDQQLQYTALTGSPNNPLVQKKNFLFKPLNKTLTLDLKECYQFAEYLFKPQLIS
DKFSPEDGLGPLMAKSVKKAGASINSMKANTSTNPNGLGTSHINTNVGDNNSTASSSNISPEQVYSLLLTNVIITGSTSL
IEGMEQRIIKELSIRFPQYKLTTFANQVMMDRKIQGWLGALTMANLPSWSLGKWYSKEDYETLKRDRKQSQATNATN
;
;MTLNRKCVVIHNGSHRTVAGFSNVELPQCIIPSSYIKRTDEGGEAEFIFGTYNMIDAAAEKRNGDEVYTLVDSQGLPYNW
DALEMQWRYLYDTQLKVSPEELPLVITMPATNGKPDMAILERYYELAFDKLNVPVFQIVIEPLAIALSMGKSSAFVIDIG
ASGCNVTPIIDGIVVKNAVVRSKFGGDFLDFQVHERLAPLIKEENDMENMADEQKRSTDVWYEASTWIQQFKSTMLQVSE
KDLFELERYYKEQADIYAKQQEQLKQMDQQLQYTALTGSPNNPLVQKKNFLFKPLNKTLTLDLKECYQFAEYLFKPQLIS
DKFSPEDGLGPLMAKSVKKAGASINSMKANTSTNPNGLGTSHINTNVGDNNSTASSSNISPEQVYSLLLTNVIITGSTSL
IEGMEQRIIKELSIRFPQYKLTTFANQVMMDRKIQGWLGALTMANLPSWSLGKWYSKEDYETLKRDRKQSQATNATN
;
P         ? 
8  'polypeptide(L)'        no no 
;MAPFRQDSILIIYPRSQTTLVQFGLNEETFTVPELEIPTQIYRTTRQDGSYTYHSTNKDNKAELIKPIQNGEIIDISAFT
QFLRLIFVSILSDRANKNQDAFEAELSNIPLLLITHHSWSQSDLEIITQYVFESLEINNLIQLPASLAATYSMISLQNCC
IIDVGTHHTDIIPIVDYAQLDHLVSSIPMGGQSINDSLKKLLPQWDDDQIESLKKSPIFEVLSDDAKKLSSFDFGNENED
EDEGTLNVAEIITSGRDTREVLEERERGQKVKNVKNSDLEFNTFWDEKGNEIKVGKQRFQGCNNLIKNISNRVGLTLDNI
DDINKAKAVWENIIIVGGTTSISGFKEALLGQLLKDHLIIEPEEEKSKREEEAKSVLPAATKKKSKFMTNSTAFVPTIEY
VQCPTVIKLAKYPDYFPEWKKSGYSEIIFLGAQIVSKQIFTHPKDTFYITREKYNMKGPAALWDVQF
;
;MAPFRQDSILIIYPRSQTTLVQFGLNEETFTVPELEIPTQIYRTTRQDGSYTYHSTNKDNKAELIKPIQNGEIIDISAFT
QFLRLIFVSILSDRANKNQDAFEAELSNIPLLLITHHSWSQSDLEIITQYVFESLEINNLIQLPASLAATYSMISLQNCC
IIDVGTHHTDIIPIVDYAQLDHLVSSIPMGGQSINDSLKKLLPQWDDDQIESLKKSPIFEVLSDDAKKLSSFDFGNENED
EDEGTLNVAEIITSGRDTREVLEERERGQKVKNVKNSDLEFNTFWDEKGNEIKVGKQRFQGCNNLIKNISNRVGLTLDNI
DDINKAKAVWENIIIVGGTTSISGFKEALLGQLLKDHLIIEPEEEKSKREEEAKSVLPAATKKKSKFMTNSTAFVPTIEY
VQCPTVIKLAKYPDYFPEWKKSGYSEIIFLGAQIVSKQIFTHPKDTFYITREKYNMKGPAALWDVQF
;
Q         ? 
9  'polypeptide(L)'        no no 
;MDPQTLITKANKVSYYGNPTSKESWRYDWYQPSKVSSNVQQPQQQLGDMENNLEKYPFRYKTWLRNQEDEKNLQRESCED
ILDLKEFDRRILKKSLMTSHTKGDTSKATGAPSANQGDEALSVDDIRGAVGNSEAIPGLSAGVNNDNTKESKDVKMN
;
;MDPQTLITKANKVSYYGNPTSKESWRYDWYQPSKVSSNVQQPQQQLGDMENNLEKYPFRYKTWLRNQEDEKNLQRESCED
ILDLKEFDRRILKKSLMTSHTKGDTSKATGAPSANQGDEALSVDDIRGAVGNSEAIPGLSAGVNNDNTKESKDVKMN
;
Z         ? 
10 'polypeptide(L)'        no no 
;MNIPQRQFSNEEVNRCYLRWQHLRNEHGMNAPSVPEFIYLTKVLQFAAKQRQELQMQRQQQGISGSQQNIVPNSSDQAEL
PNNASSHISASASPHLAPNMQLNGNETFSTSAHQSPIMQTQMPLNSNGGNNMLPQRQSSVGSLNATNFSPTPANNGENAA
EKPDNSNHNNLNLNNSELQPQNRSLQEHNIQDSNVMPGSQINSPMPQQAQMQQAQFQAQQAQQAQQAQQAQQAQARLQQG
RRLPMTMFTAEQSELLKAQITSLKCLVNRKPIPFEFQAVIQKSINHPPDFKRMLLSLSEFARRRQPTDQNNQSNLNGGNN
TQQPGTNSHYNNTNTDNVSGLTRNAPLDSKDENFASVSPAGPSSVHNAKNGTLDKNSQTVSGTPITQTESKKEENETISN
VAKTAPNSNKTHTEQNNPPKPQKPVPLNVLQDQYKEGIKVVDIDDPDMMVDSFTMPNISHSNIDYQTLLANSDHAKFTIE
PGVLPVGIDTHTATDIYQTLIALNLDTTVNDCLDKLLNDECTESTRENALYDYYALQLLPLQKAVRGHVLQFEWHQNSLL
TNTHPNFLSKIRNINVQDALLTNQLYKNHELLKLERKKTEAVARLKSMNKSAINQYNRRQDKKNKRLKFGHRLIATHTNL
ERDEQKRAEKKAKERLQALKANDEEAYIKLLDQTKDTRITHLLRQTNAFLDSLTRAVKDQQKYTKEMIDSHIKEASEEVD
DLSMVPKMKDEEYDDDDDNSNVDYYNVAHRIKEDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTI
QTISLLTYLYEMKNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKER
ALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPF
ANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNK
KMVGLRGFNNQIMQLKKICNHPFVFEEVEDQINPTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIME
DFLRYINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRI
GQKNEVRILRLITTNSVEEVILERAYKKLDIDGKVIQAGKFDNKSTSEEQEALLRSLLDAEEERRKKRESGVEEEEELKD
SEINEILARNDEEMAVLTRMDEDRSKKEEELGVKSRLLEKSELPDIYSRDIGAELKREESESAAVYNGRGARERKTATYN
DNMSEEQWLRQFEVSDDEKNDKQARKQRTKKEDKSEAIDGNGEIKGENIDADNDGPRINNISAEDRADTDLAMNDDDFLS
KKRKAGRPRGRPKKVKLEGSENSEPPALESSPVTGDNSPSEDFMDIPKPRTAGKTSVKSARTSTRGRGRGRGRGRGRGRG
RGRPPKARNGLDYVRTPAAATSPIDIREKVAKQALDLYHFALNYENEAGRKLSDIFLSKPSKALYPDYYMIIKYPVAFDN
INTHIETLAYNSLKETLQDFHLIFSNARIYNTEGSVVYEDSLELEKVVTKKYCEIMGDNSQLDFTEFDEQYGTRPLVLPP
VVTSSVAESFTDEADSSMTEASV
;
;MNIPQRQFSNEEVNRCYLRWQHLRNEHGMNAPSVPEFIYLTKVLQFAAKQRQELQMQRQQQGISGSQQNIVPNSSDQAEL
PNNASSHISASASPHLAPNMQLNGNETFSTSAHQSPIMQTQMPLNSNGGNNMLPQRQSSVGSLNATNFSPTPANNGENAA
EKPDNSNHNNLNLNNSELQPQNRSLQEHNIQDSNVMPGSQINSPMPQQAQMQQAQFQAQQAQQAQQAQQAQQAQARLQQG
RRLPMTMFTAEQSELLKAQITSLKCLVNRKPIPFEFQAVIQKSINHPPDFKRMLLSLSEFARRRQPTDQNNQSNLNGGNN
TQQPGTNSHYNNTNTDNVSGLTRNAPLDSKDENFASVSPAGPSSVHNAKNGTLDKNSQTVSGTPITQTESKKEENETISN
VAKTAPNSNKTHTEQNNPPKPQKPVPLNVLQDQYKEGIKVVDIDDPDMMVDSFTMPNISHSNIDYQTLLANSDHAKFTIE
PGVLPVGIDTHTATDIYQTLIALNLDTTVNDCLDKLLNDECTESTRENALYDYYALQLLPLQKAVRGHVLQFEWHQNSLL
TNTHPNFLSKIRNINVQDALLTNQLYKNHELLKLERKKTEAVARLKSMNKSAINQYNRRQDKKNKRLKFGHRLIATHTNL
ERDEQKRAEKKAKERLQALKANDEEAYIKLLDQTKDTRITHLLRQTNAFLDSLTRAVKDQQKYTKEMIDSHIKEASEEVD
DLSMVPKMKDEEYDDDDDNSNVDYYNVAHRIKEDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTI
QTISLLTYLYEMKNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKER
ALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPF
ANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNK
KMVGLRGFNNQIMQLKKICNHPFVFEEVEDQINPTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIME
DFLRYINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRI
GQKNEVRILRLITTNSVEEVILERAYKKLDIDGKVIQAGKFDNKSTSEEQEALLRSLLDAEEERRKKRESGVEEEEELKD
SEINEILARNDEEMAVLTRMDEDRSKKEEELGVKSRLLEKSELPDIYSRDIGAELKREESESAAVYNGRGARERKTATYN
DNMSEEQWLRQFEVSDDEKNDKQARKQRTKKEDKSEAIDGNGEIKGENIDADNDGPRINNISAEDRADTDLAMNDDDFLS
KKRKAGRPRGRPKKVKLEGSENSEPPALESSPVTGDNSPSEDFMDIPKPRTAGKTSVKSARTSTRGRGRGRGRGRGRGRG
RGRPPKARNGLDYVRTPAAATSPIDIREKVAKQALDLYHFALNYENEAGRKLSDIFLSKPSKALYPDYYMIIKYPVAFDN
INTHIETLAYNSLKETLQDFHLIFSNARIYNTEGSVVYEDSLELEKVVTKKYCEIMGDNSQLDFTEFDEQYGTRPLVLPP
VVTSSVAESFTDEADSSMTEASV
;
A         ? 
11 'polypeptide(L)'        no no 
;MDFFNLNNNNNNNNTTTTTTTTNNNNTNNNNTNNNNNPANNTNNNNSTGHSSNTNNNTNNNNTNTGASGVDDFQNFFDPK
PFDQNLDSNNNNSNSNNNDNNNSNTVASSTNFTSPTAVVNNAAPANVTGGKAANFIQNQSPQFNSPYDSNNSNTNLNSLS
PQAILAKNSIIDSSNLPLQAQQQLYGGNNNNNSTGIANDNVITPHFITNVQSISQNSSSSTPNTNSNSTPNANQQFLPFN
NSASNNGNLTSNQLISNYAASNSMDRSSSASNEFVPNTSDNNNNSNNHNMRNNSNNKTSNNNNVTAVPAATPANTNNSTS
NANTVFSERAAMFAALQQKQQQRFQALQQQQQQQQNQQQQNQQPQQQQQQQQNPKFLQSQRQQQQRSILQSLNPALQEKI
STELNNKQYELFMKSLIENCKKRNMPLQSIPEIGNRKINLFYLYMLVQKFGGADQVTRTQQWSMVAQRLQISDYQQLESI
YFRILLPYERHMISQEGIKETQAKRIFLQQFLQELLKKVQQQQQAAALANANNNINSASSAPTPAAPGASVPATAAPGTE
AGIVPVSANTPKSLNSNININVNNNNIGQQQVKKPRKQRVKKKTKKELELERKEREDFQKRQQKLLEDQQRQQKLLLETK
LRQQYEIELKKLPKVYKRSIVRNYKPLINRLKHYNGYDINYISKIGEKIDSNKPIFLFAPELGAINLHALSMSLQSKNLG
EINTALNTLLVTSADSNLKISLVKYPELLDSLAILGMNLLSNLSQNVVPYHRNTSDYYYEDAGSNQYYVTQHDKMVDKIF
EKVNNNATLTPNDSNDEKVTILVDSLTGNQLPTPTPTEMEPDLDTECFISMQSTSPAVKQWDLLPEPIRFLPNQFPLKIH
RTPYLTSLKKIKDEIDDPFTKINTRGAEDPKVLINDQLSTISMILRNISFSDNNSRIMSRNFYLKRFISDLLWLVLIHPE
NFTCNRKILNFKKDLVIVLSNISHLLEIASSIDCLLILILVISFGQPKLNPMASSSSFGSESLTFNEFQLQWGKYQTFGV
DILAKLFSLEKPNLNYFKSILLNKNTGNNLYDRNSNNNHKDKKLLRRLLNLYNDNNKNNNNRHNLLNDVVSFLFSAIPLQ
QVLSQSADPSLLIDQFSPVISQSLTSILVIVQKILPLSNEVFEISENNSDSNSNNNGNKDSSFNFNKNLPFVWLSSEENI
GSGLLKLSEIILNINNSTSKNTLLQQQNYSKVLLPSINISCVQLIKCLVEKSICFENCLNNDPEILKKIASIPNLFPTDL
EIFQLFTNPSVDIQIINQYQLLYNLKNDILTNLE
;
;MDFFNLNNNNNNNNTTTTTTTTNNNNTNNNNTNNNNNPANNTNNNNSTGHSSNTNNNTNNNNTNTGASGVDDFQNFFDPK
PFDQNLDSNNNNSNSNNNDNNNSNTVASSTNFTSPTAVVNNAAPANVTGGKAANFIQNQSPQFNSPYDSNNSNTNLNSLS
PQAILAKNSIIDSSNLPLQAQQQLYGGNNNNNSTGIANDNVITPHFITNVQSISQNSSSSTPNTNSNSTPNANQQFLPFN
NSASNNGNLTSNQLISNYAASNSMDRSSSASNEFVPNTSDNNNNSNNHNMRNNSNNKTSNNNNVTAVPAATPANTNNSTS
NANTVFSERAAMFAALQQKQQQRFQALQQQQQQQQNQQQQNQQPQQQQQQQQNPKFLQSQRQQQQRSILQSLNPALQEKI
STELNNKQYELFMKSLIENCKKRNMPLQSIPEIGNRKINLFYLYMLVQKFGGADQVTRTQQWSMVAQRLQISDYQQLESI
YFRILLPYERHMISQEGIKETQAKRIFLQQFLQELLKKVQQQQQAAALANANNNINSASSAPTPAAPGASVPATAAPGTE
AGIVPVSANTPKSLNSNININVNNNNIGQQQVKKPRKQRVKKKTKKELELERKEREDFQKRQQKLLEDQQRQQKLLLETK
LRQQYEIELKKLPKVYKRSIVRNYKPLINRLKHYNGYDINYISKIGEKIDSNKPIFLFAPELGAINLHALSMSLQSKNLG
EINTALNTLLVTSADSNLKISLVKYPELLDSLAILGMNLLSNLSQNVVPYHRNTSDYYYEDAGSNQYYVTQHDKMVDKIF
EKVNNNATLTPNDSNDEKVTILVDSLTGNQLPTPTPTEMEPDLDTECFISMQSTSPAVKQWDLLPEPIRFLPNQFPLKIH
RTPYLTSLKKIKDEIDDPFTKINTRGAEDPKVLINDQLSTISMILRNISFSDNNSRIMSRNFYLKRFISDLLWLVLIHPE
NFTCNRKILNFKKDLVIVLSNISHLLEIASSIDCLLILILVISFGQPKLNPMASSSSFGSESLTFNEFQLQWGKYQTFGV
DILAKLFSLEKPNLNYFKSILLNKNTGNNLYDRNSNNNHKDKKLLRRLLNLYNDNNKNNNNRHNLLNDVVSFLFSAIPLQ
QVLSQSADPSLLIDQFSPVISQSLTSILVIVQKILPLSNEVFEISENNSDSNSNNNGNKDSSFNFNKNLPFVWLSSEENI
GSGLLKLSEIILNINNSTSKNTLLQQQNYSKVLLPSINISCVQLIKCLVEKSICFENCLNNDPEILKKIASIPNLFPTDL
EIFQLFTNPSVDIQIINQYQLLYNLKNDILTNLE
;
B         ? 
12 'polypeptide(L)'        no no 
;MNNQPQGTNSVPNSIGNIFSNIGTPSFNMAQIPQQLYQSLTPQQLQMIQQRHQQLLRSRLQQQQQQQQQTSPPPQTHQSP
PPPPQQSQPIANQSATSTPPPPPAPHNLHPQIGQVPLAPAPINLPPQIAQLPLATQQQVLNKLRQQAIAKNNPQVVNAIT
VAQQQVQRQIEQQKGQQTAQTQLEQQRQLLVQQQQQQQLRNQIQRQQQQQFRHHVQIQQQQQKQQQQQQQHQQQQQQQQQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQQGQIPQSQQVPQVRSMSGQPPTNVQPTIGQLPQLPKLNLPKYQTIQYDPPETK
LPYPTYWSDKKADTDTLLYEQIIQRDKINKYSLIRETNGYDPFSIYGFSNKEYISRLWHTLKYYQDLKNTRMKSITSTSQ
KIPSASIWGNGYSGYGNGITNTTTRVIPQVEVGNRKHYLEDKLKVYKQAMNETSEQLVPIRLEFDQDRDRFFLRDTLLWN
KNDKLIKIEDFVDDMLRDYRFEDATREQHIDTICQSIQEQIQEFQGNPYIELNQDRLGGDDLRIRIKLDIVVGQNQLIDQ
FEWDISNSDNCPEEFAESMCQELELPGEFVTAIAHSIREQVHMYHKSLALLGYNFDGSAIEDDDIRSRMLPTITLDDVYR
PAAESKIFTPNLLQISAAELERLDKDKDRDTRRKRRQGRSNRRGMLALSGTSASNTSMNGVHNTVAAGNASSLPPGEILL
PDIADIPRTFRTPVPSTLMPGGVDVGPSVESYELRNTTTYKSRPDRPKPVSPPCYIIDHIPGHSLLLSIKLPGKVNTKEE
FAAAPNDTSSGTNAMLPSPESLKTKLNSNIRAGVTIPSIPNPIANHTVTNSPNPTLQPVIPGGAASKSVPTPSLPIAPPV
APHDSEATLLTNSNNGSSNNNTQNT
;
;MNNQPQGTNSVPNSIGNIFSNIGTPSFNMAQIPQQLYQSLTPQQLQMIQQRHQQLLRSRLQQQQQQQQQTSPPPQTHQSP
PPPPQQSQPIANQSATSTPPPPPAPHNLHPQIGQVPLAPAPINLPPQIAQLPLATQQQVLNKLRQQAIAKNNPQVVNAIT
VAQQQVQRQIEQQKGQQTAQTQLEQQRQLLVQQQQQQQLRNQIQRQQQQQFRHHVQIQQQQQKQQQQQQQHQQQQQQQQQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQQGQIPQSQQVPQVRSMSGQPPTNVQPTIGQLPQLPKLNLPKYQTIQYDPPETK
LPYPTYWSDKKADTDTLLYEQIIQRDKINKYSLIRETNGYDPFSIYGFSNKEYISRLWHTLKYYQDLKNTRMKSITSTSQ
KIPSASIWGNGYSGYGNGITNTTTRVIPQVEVGNRKHYLEDKLKVYKQAMNETSEQLVPIRLEFDQDRDRFFLRDTLLWN
KNDKLIKIEDFVDDMLRDYRFEDATREQHIDTICQSIQEQIQEFQGNPYIELNQDRLGGDDLRIRIKLDIVVGQNQLIDQ
FEWDISNSDNCPEEFAESMCQELELPGEFVTAIAHSIREQVHMYHKSLALLGYNFDGSAIEDDDIRSRMLPTITLDDVYR
PAAESKIFTPNLLQISAAELERLDKDKDRDTRRKRRQGRSNRRGMLALSGTSASNTSMNGVHNTVAAGNASSLPPGEILL
PDIADIPRTFRTPVPSTLMPGGVDVGPSVESYELRNTTTYKSRPDRPKPVSPPCYIIDHIPGHSLLLSIKLPGKVNTKEE
FAAAPNDTSSGTNAMLPSPESLKTKLNSNIRAGVTIPSIPNPIANHTVTNSPNPTLQPVIPGGAASKSVPTPSLPIAPPV
APHDSEATLLTNSNNGSSNNNTQNT
;
C         ? 
13 'polypeptide(L)'        no no 
;MENTLGEGSTVNASVDVDQHGNDNNSDSNANAAVAGVANTDTAGEESQQQDESLKDEATVPNTRDAESEAITVTAKQQPT
MQANKLDSQETPSTEESRAQNVFGQDNEDSDNLFGETESSVSNNEANTPSIPTNPVDNENNKPAIKEDSTIQDSNGDVKN
MEDVKIQKEEEPENNTVIEGVKEESQPDENTKEMDEVEEDDEDDDQPMISPDNSIFGDTKSESKQLGNTSSVANTPSEIP
DAHKAEQEDIIEKTESVDKKVDSGEERNEQEREIMNDHSKSANPKKTTITRVEPETFEIPQAHEIVIPSYSKWFNLEKIH
SIEVQSLPEFFTNRIPSKTPEVYMRYRNFMVNSYRLNPNEYFSVTTARRNVSGDAAALFRLHKFLTKWGLINYQVDSKLL
PKNIEPPLTSQYSTRHDAPRGLFPFESYKPSVQLPDMAKLKKMMNTSDSESTLYKYLKESKRKYDEITHPPSTTDDENGD
KNDNGGKMNNEVSTSTSMTGDANLLEEGETSRPLKKVKILEQIDENWSKEDLQKLLKGIQEFGADWYKVAKNVGNKSPEQ
CILRFLQLPIEDKFLYGDGNGKGDNDNGLGPLKYAPHLPFSKSENPVLSTIAFLVGLVNPKTVQSMTQRAIQSAESIKSQ
KEEISDQKPIEHIKEGSEIAISSLGYRSHIFATNEERQMNFLTNELIRLQMEKLDAKLNHLKKLEKFMELERKTLERQQE
NLLIQRLNFNQNSSKIVNVLSKCLNLISDSNINNSSVAEKEEIRSQIDHFKSMLSKPETLSIGKNPFNKPNIETGENHNG
QSISNENDVKPISIEAPQFYRYWSA
;
;MENTLGEGSTVNASVDVDQHGNDNNSDSNANAAVAGVANTDTAGEESQQQDESLKDEATVPNTRDAESEAITVTAKQQPT
MQANKLDSQETPSTEESRAQNVFGQDNEDSDNLFGETESSVSNNEANTPSIPTNPVDNENNKPAIKEDSTIQDSNGDVKN
MEDVKIQKEEEPENNTVIEGVKEESQPDENTKEMDEVEEDDEDDDQPMISPDNSIFGDTKSESKQLGNTSSVANTPSEIP
DAHKAEQEDIIEKTESVDKKVDSGEERNEQEREIMNDHSKSANPKKTTITRVEPETFEIPQAHEIVIPSYSKWFNLEKIH
SIEVQSLPEFFTNRIPSKTPEVYMRYRNFMVNSYRLNPNEYFSVTTARRNVSGDAAALFRLHKFLTKWGLINYQVDSKLL
PKNIEPPLTSQYSTRHDAPRGLFPFESYKPSVQLPDMAKLKKMMNTSDSESTLYKYLKESKRKYDEITHPPSTTDDENGD
KNDNGGKMNNEVSTSTSMTGDANLLEEGETSRPLKKVKILEQIDENWSKEDLQKLLKGIQEFGADWYKVAKNVGNKSPEQ
CILRFLQLPIEDKFLYGDGNGKGDNDNGLGPLKYAPHLPFSKSENPVLSTIAFLVGLVNPKTVQSMTQRAIQSAESIKSQ
KEEISDQKPIEHIKEGSEIAISSLGYRSHIFATNEERQMNFLTNELIRLQMEKLDAKLNHLKKLEKFMELERKTLERQQE
NLLIQRLNFNQNSSKIVNVLSKCLNLISDSNINNSSVAEKEEIRSQIDHFKSMLSKPETLSIGKNPFNKPNIETGENHNG
QSISNENDVKPISIEAPQFYRYWSA
;
D,E,F,G   ? 
14 'polypeptide(L)'        no no 
;MSKVMKPSNGKGSRKSSKAATPDTKNFFHAKKKDPVNQDKANNASQITPTVPHSHPSDMVIPDHLAELIPELYSFQQLVD
SEKRLDHFIHLRNLHMKRMVAQWERSKLSQEFLYPHLNFPNVKFLRIFISNVSENQPWQMDTNNEADLMALENATWTMRI
EGRLLDNVQANDPAREKFSSFIESIVVDFKNKENDNVPSTKFNAAPEENATEGPSDKKLNLNLPLQFSLPNGDNSTTTNT
DQNNATMGEETAKKDMSSTTPKLESVKWQYDPNNPVDFDGLDIKRVGSENVECTISILRKSSPEEPFMSYSPQLTAIIGL
KSGTSHDAIFSIYKYIHLNELLTNDESAFENLMGNRNNHNSNTSTSKMLDAASSQVSIVKLDTQLITLLPSSLKESSPDT
MKLTDLLSLINSTHLLPLQPIEIDYTVRVDKASTYGELVLDIEVPDVNALKFNNTQRESQIGAAELNENARELEQIKPKI
ALQDKEITSVLSNLHESNKRYRFFKKISEDPVKALNECIASTSNALKVLSGDEGYNEDMVRRANFYKENEAMLRENIEVI
LSNGRM
;
;MSKVMKPSNGKGSRKSSKAATPDTKNFFHAKKKDPVNQDKANNASQITPTVPHSHPSDMVIPDHLAELIPELYSFQQLVD
SEKRLDHFIHLRNLHMKRMVAQWERSKLSQEFLYPHLNFPNVKFLRIFISNVSENQPWQMDTNNEADLMALENATWTMRI
EGRLLDNVQANDPAREKFSSFIESIVVDFKNKENDNVPSTKFNAAPEENATEGPSDKKLNLNLPLQFSLPNGDNSTTTNT
DQNNATMGEETAKKDMSSTTPKLESVKWQYDPNNPVDFDGLDIKRVGSENVECTISILRKSSPEEPFMSYSPQLTAIIGL
KSGTSHDAIFSIYKYIHLNELLTNDESAFENLMGNRNNHNSNTSTSKMLDAASSQVSIVKLDTQLITLLPSSLKESSPDT
MKLTDLLSLINSTHLLPLQPIEIDYTVRVDKASTYGELVLDIEVPDVNALKFNNTQRESQIGAAELNENARELEQIKPKI
ALQDKEITSVLSNLHESNKRYRFFKKISEDPVKALNECIASTSNALKVLSGDEGYNEDMVRRANFYKENEAMLRENIEVI
LSNGRM
;
H         ? 
15 'polypeptide(L)'        no no 
;MGVIKKKRSHHGKASRQQYYSGVQVGGVGSMGAINNNIPSLTSFAEENNYQYGYSGSSAGMNGRSLTYAQQQLNKQRQDF
ERVRLRPEQLSNIIHDESDTISFRSNLLKNFISSNDAFNMLSLTTVPCDRIEKSRLFSEKTIRYLMQKQH(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
;
;MGVIKKKRSHHGKASRQQYYSGVQVGGVGSMGAINNNIPSLTSFAEENNYQYGYSGSSAGMNGRSLTYAQQQLNKQRQDF
ERVRLRPEQLSNIIHDESDTISFRSNLLKNFISSNDAFNMLSLTTVPCDRIEKSRLFSEKTIRYLMQKQHXXXXXXXXXX
XXXXXXXXXXXXXXXXXXX
;
I         ? 
16 'polypeptide(L)'        no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)
;
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX J,K,L,N,O ? 
17 'polypeptide(L)'        no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)
;
;XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXX
;
M         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    ALA n 
1  2    ARG n 
1  3    THR n 
1  4    LYS n 
1  5    GLN n 
1  6    THR n 
1  7    ALA n 
1  8    ARG n 
1  9    LYS n 
1  10   SER n 
1  11   THR n 
1  12   GLY n 
1  13   GLY n 
1  14   LYS n 
1  15   ALA n 
1  16   PRO n 
1  17   ARG n 
1  18   LYS n 
1  19   GLN n 
1  20   LEU n 
1  21   ALA n 
1  22   THR n 
1  23   LYS n 
1  24   ALA n 
1  25   ALA n 
1  26   ARG n 
1  27   LYS n 
1  28   SER n 
1  29   ALA n 
1  30   PRO n 
1  31   ALA n 
1  32   THR n 
1  33   GLY n 
1  34   GLY n 
1  35   VAL n 
1  36   LYS n 
1  37   LYS n 
1  38   PRO n 
1  39   HIS n 
1  40   ARG n 
1  41   TYR n 
1  42   ARG n 
1  43   PRO n 
1  44   GLY n 
1  45   THR n 
1  46   VAL n 
1  47   ALA n 
1  48   LEU n 
1  49   ARG n 
1  50   GLU n 
1  51   ILE n 
1  52   ARG n 
1  53   ARG n 
1  54   TYR n 
1  55   GLN n 
1  56   LYS n 
1  57   SER n 
1  58   THR n 
1  59   GLU n 
1  60   LEU n 
1  61   LEU n 
1  62   ILE n 
1  63   ARG n 
1  64   LYS n 
1  65   LEU n 
1  66   PRO n 
1  67   PHE n 
1  68   GLN n 
1  69   ARG n 
1  70   LEU n 
1  71   VAL n 
1  72   ARG n 
1  73   GLU n 
1  74   ILE n 
1  75   ALA n 
1  76   GLN n 
1  77   ASP n 
1  78   PHE n 
1  79   LYS n 
1  80   THR n 
1  81   ASP n 
1  82   LEU n 
1  83   ARG n 
1  84   PHE n 
1  85   GLN n 
1  86   SER n 
1  87   SER n 
1  88   ALA n 
1  89   VAL n 
1  90   MET n 
1  91   ALA n 
1  92   LEU n 
1  93   GLN n 
1  94   GLU n 
1  95   ALA n 
1  96   SER n 
1  97   GLU n 
1  98   ALA n 
1  99   TYR n 
1  100  LEU n 
1  101  VAL n 
1  102  ALA n 
1  103  LEU n 
1  104  PHE n 
1  105  GLU n 
1  106  ASP n 
1  107  THR n 
1  108  ASN n 
1  109  LEU n 
1  110  CYS n 
1  111  ALA n 
1  112  ILE n 
1  113  HIS n 
1  114  ALA n 
1  115  LYS n 
1  116  ARG n 
1  117  VAL n 
1  118  THR n 
1  119  ILE n 
1  120  MET n 
1  121  PRO n 
1  122  LYS n 
1  123  ASP n 
1  124  ILE n 
1  125  GLN n 
1  126  LEU n 
1  127  ALA n 
1  128  ARG n 
1  129  ARG n 
1  130  ILE n 
1  131  ARG n 
1  132  GLY n 
1  133  GLU n 
1  134  ARG n 
1  135  ALA n 
2  1    SER n 
2  2    GLY n 
2  3    ARG n 
2  4    GLY n 
2  5    LYS n 
2  6    GLY n 
2  7    GLY n 
2  8    LYS n 
2  9    GLY n 
2  10   LEU n 
2  11   GLY n 
2  12   LYS n 
2  13   GLY n 
2  14   GLY n 
2  15   ALA n 
2  16   LYS n 
2  17   ARG n 
2  18   HIS n 
2  19   ARG n 
2  20   LYS n 
2  21   VAL n 
2  22   LEU n 
2  23   ARG n 
2  24   ASP n 
2  25   ASN n 
2  26   ILE n 
2  27   GLN n 
2  28   GLY n 
2  29   ILE n 
2  30   THR n 
2  31   LYS n 
2  32   PRO n 
2  33   ALA n 
2  34   ILE n 
2  35   ARG n 
2  36   ARG n 
2  37   LEU n 
2  38   ALA n 
2  39   ARG n 
2  40   ARG n 
2  41   GLY n 
2  42   GLY n 
2  43   VAL n 
2  44   LYS n 
2  45   ARG n 
2  46   ILE n 
2  47   SER n 
2  48   GLY n 
2  49   LEU n 
2  50   ILE n 
2  51   TYR n 
2  52   GLU n 
2  53   GLU n 
2  54   THR n 
2  55   ARG n 
2  56   GLY n 
2  57   VAL n 
2  58   LEU n 
2  59   LYS n 
2  60   VAL n 
2  61   PHE n 
2  62   LEU n 
2  63   GLU n 
2  64   ASN n 
2  65   VAL n 
2  66   ILE n 
2  67   ARG n 
2  68   ASP n 
2  69   ALA n 
2  70   VAL n 
2  71   THR n 
2  72   TYR n 
2  73   THR n 
2  74   GLU n 
2  75   HIS n 
2  76   ALA n 
2  77   LYS n 
2  78   ARG n 
2  79   LYS n 
2  80   THR n 
2  81   VAL n 
2  82   THR n 
2  83   ALA n 
2  84   MET n 
2  85   ASP n 
2  86   VAL n 
2  87   VAL n 
2  88   TYR n 
2  89   ALA n 
2  90   LEU n 
2  91   LYS n 
2  92   ARG n 
2  93   GLN n 
2  94   GLY n 
2  95   ARG n 
2  96   THR n 
2  97   LEU n 
2  98   TYR n 
2  99   GLY n 
2  100  PHE n 
2  101  GLY n 
2  102  GLY n 
3  1    SER n 
3  2    GLY n 
3  3    ARG n 
3  4    GLY n 
3  5    LYS n 
3  6    GLN n 
3  7    GLY n 
3  8    GLY n 
3  9    LYS n 
3  10   THR n 
3  11   ARG n 
3  12   ALA n 
3  13   LYS n 
3  14   ALA n 
3  15   LYS n 
3  16   THR n 
3  17   ARG n 
3  18   SER n 
3  19   SER n 
3  20   ARG n 
3  21   ALA n 
3  22   GLY n 
3  23   LEU n 
3  24   GLN n 
3  25   PHE n 
3  26   PRO n 
3  27   VAL n 
3  28   GLY n 
3  29   ARG n 
3  30   VAL n 
3  31   HIS n 
3  32   ARG n 
3  33   LEU n 
3  34   LEU n 
3  35   ARG n 
3  36   LYS n 
3  37   GLY n 
3  38   ASN n 
3  39   TYR n 
3  40   ALA n 
3  41   GLU n 
3  42   ARG n 
3  43   VAL n 
3  44   GLY n 
3  45   ALA n 
3  46   GLY n 
3  47   ALA n 
3  48   PRO n 
3  49   VAL n 
3  50   TYR n 
3  51   LEU n 
3  52   ALA n 
3  53   ALA n 
3  54   VAL n 
3  55   LEU n 
3  56   GLU n 
3  57   TYR n 
3  58   LEU n 
3  59   THR n 
3  60   ALA n 
3  61   GLU n 
3  62   ILE n 
3  63   LEU n 
3  64   GLU n 
3  65   LEU n 
3  66   ALA n 
3  67   GLY n 
3  68   ASN n 
3  69   ALA n 
3  70   ALA n 
3  71   ARG n 
3  72   ASP n 
3  73   ASN n 
3  74   LYS n 
3  75   LYS n 
3  76   THR n 
3  77   ARG n 
3  78   ILE n 
3  79   ILE n 
3  80   PRO n 
3  81   ARG n 
3  82   HIS n 
3  83   LEU n 
3  84   GLN n 
3  85   LEU n 
3  86   ALA n 
3  87   VAL n 
3  88   ARG n 
3  89   ASN n 
3  90   ASP n 
3  91   GLU n 
3  92   GLU n 
3  93   LEU n 
3  94   ASN n 
3  95   LYS n 
3  96   LEU n 
3  97   LEU n 
3  98   GLY n 
3  99   ARG n 
3  100  VAL n 
3  101  THR n 
3  102  ILE n 
3  103  ALA n 
3  104  GLN n 
3  105  GLY n 
3  106  GLY n 
3  107  VAL n 
3  108  LEU n 
3  109  PRO n 
3  110  ASN n 
3  111  ILE n 
3  112  GLN n 
3  113  SER n 
3  114  VAL n 
3  115  LEU n 
3  116  LEU n 
3  117  PRO n 
3  118  LYS n 
3  119  LYS n 
3  120  THR n 
3  121  GLU n 
3  122  SER n 
3  123  SER n 
3  124  LYS n 
3  125  SER n 
3  126  ALA n 
3  127  LYS n 
3  128  SER n 
3  129  LYS n 
4  1    ALA n 
4  2    LYS n 
4  3    SER n 
4  4    ALA n 
4  5    PRO n 
4  6    ALA n 
4  7    PRO n 
4  8    LYS n 
4  9    LYS n 
4  10   GLY n 
4  11   SER n 
4  12   LYS n 
4  13   LYS n 
4  14   ALA n 
4  15   VAL n 
4  16   THR n 
4  17   LYS n 
4  18   THR n 
4  19   GLN n 
4  20   LYS n 
4  21   LYS n 
4  22   ASP n 
4  23   GLY n 
4  24   LYS n 
4  25   LYS n 
4  26   ARG n 
4  27   ARG n 
4  28   LYS n 
4  29   THR n 
4  30   ARG n 
4  31   LYS n 
4  32   GLU n 
4  33   SER n 
4  34   TYR n 
4  35   ALA n 
4  36   ILE n 
4  37   TYR n 
4  38   VAL n 
4  39   TYR n 
4  40   LYS n 
4  41   VAL n 
4  42   LEU n 
4  43   LYS n 
4  44   GLN n 
4  45   VAL n 
4  46   HIS n 
4  47   PRO n 
4  48   ASP n 
4  49   THR n 
4  50   GLY n 
4  51   ILE n 
4  52   SER n 
4  53   SER n 
4  54   LYS n 
4  55   ALA n 
4  56   MET n 
4  57   SER n 
4  58   ILE n 
4  59   MET n 
4  60   ASN n 
4  61   SER n 
4  62   PHE n 
4  63   VAL n 
4  64   ASN n 
4  65   ASP n 
4  66   VAL n 
4  67   PHE n 
4  68   GLU n 
4  69   ARG n 
4  70   ILE n 
4  71   ALA n 
4  72   GLY n 
4  73   GLU n 
4  74   ALA n 
4  75   SER n 
4  76   ARG n 
4  77   LEU n 
4  78   ALA n 
4  79   HIS n 
4  80   TYR n 
4  81   ASN n 
4  82   LYS n 
4  83   ARG n 
4  84   SER n 
4  85   THR n 
4  86   ILE n 
4  87   THR n 
4  88   SER n 
4  89   ARG n 
4  90   GLU n 
4  91   ILE n 
4  92   GLN n 
4  93   THR n 
4  94   ALA n 
4  95   VAL n 
4  96   ARG n 
4  97   LEU n 
4  98   LEU n 
4  99   LEU n 
4  100  PRO n 
4  101  GLY n 
4  102  GLU n 
4  103  LEU n 
4  104  ALA n 
4  105  LYS n 
4  106  HIS n 
4  107  ALA n 
4  108  VAL n 
4  109  SER n 
4  110  GLU n 
4  111  GLY n 
4  112  THR n 
4  113  LYS n 
4  114  ALA n 
4  115  VAL n 
4  116  THR n 
4  117  LYS n 
4  118  TYR n 
4  119  THR n 
4  120  SER n 
4  121  ALA n 
4  122  LYS n 
5  1    DA  n 
5  2    DT  n 
5  3    DC  n 
5  4    DA  n 
5  5    DG  n 
5  6    DA  n 
5  7    DA  n 
5  8    DT  n 
5  9    DC  n 
5  10   DC  n 
5  11   DC  n 
5  12   DG  n 
5  13   DG  n 
5  14   DT  n 
5  15   DG  n 
5  16   DC  n 
5  17   DC  n 
5  18   DG  n 
5  19   DA  n 
5  20   DG  n 
5  21   DG  n 
5  22   DC  n 
5  23   DC  n 
5  24   DG  n 
5  25   DC  n 
5  26   DT  n 
5  27   DC  n 
5  28   DA  n 
5  29   DA  n 
5  30   DT  n 
5  31   DT  n 
5  32   DG  n 
5  33   DG  n 
5  34   DT  n 
5  35   DC  n 
5  36   DG  n 
5  37   DT  n 
5  38   DA  n 
5  39   DG  n 
5  40   DA  n 
5  41   DC  n 
5  42   DA  n 
5  43   DG  n 
5  44   DC  n 
5  45   DT  n 
5  46   DC  n 
5  47   DT  n 
5  48   DA  n 
5  49   DG  n 
5  50   DC  n 
5  51   DA  n 
5  52   DC  n 
5  53   DC  n 
5  54   DG  n 
5  55   DC  n 
5  56   DT  n 
5  57   DT  n 
5  58   DA  n 
5  59   DA  n 
5  60   DA  n 
5  61   DC  n 
5  62   DG  n 
5  63   DC  n 
5  64   DA  n 
5  65   DC  n 
5  66   DG  n 
5  67   DT  n 
5  68   DA  n 
5  69   DC  n 
5  70   DG  n 
5  71   DC  n 
5  72   DG  n 
5  73   DC  n 
5  74   DT  n 
5  75   DG  n 
5  76   DT  n 
5  77   DC  n 
5  78   DC  n 
5  79   DC  n 
5  80   DC  n 
5  81   DC  n 
5  82   DG  n 
5  83   DC  n 
5  84   DG  n 
5  85   DT  n 
5  86   DT  n 
5  87   DT  n 
5  88   DT  n 
5  89   DA  n 
5  90   DA  n 
5  91   DC  n 
5  92   DC  n 
5  93   DG  n 
5  94   DC  n 
5  95   DC  n 
5  96   DA  n 
5  97   DA  n 
5  98   DG  n 
5  99   DG  n 
5  100  DG  n 
5  101  DG  n 
5  102  DA  n 
5  103  DT  n 
5  104  DT  n 
5  105  DA  n 
5  106  DC  n 
5  107  DT  n 
5  108  DC  n 
5  109  DC  n 
5  110  DC  n 
5  111  DT  n 
5  112  DA  n 
5  113  DG  n 
5  114  DT  n 
5  115  DC  n 
5  116  DT  n 
5  117  DC  n 
5  118  DC  n 
5  119  DA  n 
5  120  DG  n 
5  121  DG  n 
5  122  DC  n 
5  123  DA  n 
5  124  DC  n 
5  125  DG  n 
5  126  DT  n 
5  127  DG  n 
5  128  DT  n 
5  129  DC  n 
5  130  DA  n 
5  131  DG  n 
5  132  DA  n 
5  133  DT  n 
5  134  DA  n 
5  135  DT  n 
5  136  DA  n 
5  137  DT  n 
5  138  DA  n 
5  139  DC  n 
5  140  DA  n 
5  141  DT  n 
5  142  DC  n 
5  143  DG  n 
5  144  DA  n 
5  145  DT  n 
5  146  DT  n 
5  147  DA  n 
5  148  DA  n 
5  149  DC  n 
5  150  DG  n 
5  151  DA  n 
5  152  DT  n 
5  153  DG  n 
5  154  DC  n 
5  155  DT  n 
5  156  DG  n 
5  157  DG  n 
5  158  DG  n 
5  159  DC  n 
5  160  DA  n 
5  161  DT  n 
5  162  DA  n 
5  163  DA  n 
5  164  DG  n 
5  165  DC  n 
5  166  DG  n 
5  167  DT  n 
5  168  DG  n 
5  169  DG  n 
5  170  DT  n 
5  171  DT  n 
5  172  DC  n 
5  173  DA  n 
5  174  DA  n 
5  175  DT  n 
5  176  DA  n 
5  177  DC  n 
5  178  DC  n 
5  179  DG  n 
5  180  DG  n 
5  181  DC  n 
5  182  DG  n 
5  183  DC  n 
5  184  DA  n 
5  185  DT  n 
6  1    DA  n 
6  2    DC  n 
6  3    DC  n 
6  4    DT  n 
6  5    DC  n 
6  6    DC  n 
6  7    DC  n 
6  8    DA  n 
6  9    DC  n 
6  10   DT  n 
6  11   DA  n 
6  12   DT  n 
6  13   DT  n 
6  14   DT  n 
6  15   DT  n 
6  16   DA  n 
6  17   DT  n 
6  18   DG  n 
6  19   DC  n 
6  20   DG  n 
6  21   DC  n 
6  22   DC  n 
6  23   DG  n 
6  24   DG  n 
6  25   DT  n 
6  26   DA  n 
6  27   DT  n 
6  28   DT  n 
6  29   DG  n 
6  30   DA  n 
6  31   DA  n 
6  32   DC  n 
6  33   DC  n 
6  34   DA  n 
6  35   DC  n 
6  36   DG  n 
6  37   DC  n 
6  38   DT  n 
6  39   DT  n 
6  40   DA  n 
6  41   DT  n 
6  42   DG  n 
6  43   DC  n 
6  44   DC  n 
6  45   DC  n 
6  46   DA  n 
6  47   DG  n 
6  48   DC  n 
6  49   DA  n 
6  50   DT  n 
6  51   DC  n 
6  52   DG  n 
6  53   DT  n 
6  54   DT  n 
6  55   DA  n 
6  56   DA  n 
6  57   DT  n 
6  58   DC  n 
6  59   DG  n 
6  60   DA  n 
6  61   DT  n 
6  62   DG  n 
6  63   DT  n 
6  64   DA  n 
6  65   DT  n 
6  66   DA  n 
6  67   DT  n 
6  68   DA  n 
6  69   DT  n 
6  70   DC  n 
6  71   DT  n 
6  72   DG  n 
6  73   DA  n 
6  74   DC  n 
6  75   DA  n 
6  76   DC  n 
6  77   DG  n 
6  78   DT  n 
6  79   DG  n 
6  80   DC  n 
6  81   DC  n 
6  82   DT  n 
6  83   DG  n 
6  84   DG  n 
6  85   DA  n 
6  86   DG  n 
6  87   DA  n 
6  88   DC  n 
6  89   DT  n 
6  90   DA  n 
6  91   DG  n 
6  92   DG  n 
6  93   DG  n 
6  94   DA  n 
6  95   DG  n 
6  96   DT  n 
6  97   DA  n 
6  98   DA  n 
6  99   DT  n 
6  100  DC  n 
6  101  DC  n 
6  102  DC  n 
6  103  DC  n 
6  104  DT  n 
6  105  DT  n 
6  106  DG  n 
6  107  DG  n 
6  108  DC  n 
6  109  DG  n 
6  110  DG  n 
6  111  DT  n 
6  112  DT  n 
6  113  DA  n 
6  114  DA  n 
6  115  DA  n 
6  116  DA  n 
6  117  DC  n 
6  118  DG  n 
6  119  DC  n 
6  120  DG  n 
6  121  DG  n 
6  122  DG  n 
6  123  DG  n 
6  124  DG  n 
6  125  DA  n 
6  126  DC  n 
6  127  DA  n 
6  128  DG  n 
6  129  DC  n 
6  130  DG  n 
6  131  DC  n 
6  132  DG  n 
6  133  DT  n 
6  134  DA  n 
6  135  DC  n 
6  136  DG  n 
6  137  DT  n 
6  138  DG  n 
6  139  DC  n 
6  140  DG  n 
6  141  DT  n 
6  142  DT  n 
6  143  DT  n 
6  144  DA  n 
6  145  DA  n 
6  146  DG  n 
6  147  DC  n 
6  148  DG  n 
6  149  DG  n 
6  150  DT  n 
6  151  DG  n 
6  152  DC  n 
6  153  DT  n 
6  154  DA  n 
6  155  DG  n 
6  156  DA  n 
6  157  DG  n 
6  158  DC  n 
6  159  DT  n 
6  160  DG  n 
6  161  DT  n 
6  162  DC  n 
6  163  DT  n 
6  164  DA  n 
6  165  DC  n 
6  166  DG  n 
6  167  DA  n 
6  168  DC  n 
6  169  DC  n 
6  170  DA  n 
6  171  DA  n 
6  172  DT  n 
6  173  DT  n 
6  174  DG  n 
6  175  DA  n 
6  176  DG  n 
6  177  DC  n 
6  178  DG  n 
6  179  DG  n 
6  180  DC  n 
6  181  DC  n 
6  182  DT  n 
6  183  DC  n 
6  184  DG  n 
6  185  DG  n 
6  186  DC  n 
6  187  DA  n 
6  188  DC  n 
6  189  DC  n 
6  190  DG  n 
6  191  DG  n 
6  192  DG  n 
6  193  DA  n 
6  194  DT  n 
6  195  DT  n 
6  196  DC  n 
6  197  DT  n 
6  198  DG  n 
6  199  DA  n 
6  200  DT  n 
7  1    MET n 
7  2    THR n 
7  3    LEU n 
7  4    ASN n 
7  5    ARG n 
7  6    LYS n 
7  7    CYS n 
7  8    VAL n 
7  9    VAL n 
7  10   ILE n 
7  11   HIS n 
7  12   ASN n 
7  13   GLY n 
7  14   SER n 
7  15   HIS n 
7  16   ARG n 
7  17   THR n 
7  18   VAL n 
7  19   ALA n 
7  20   GLY n 
7  21   PHE n 
7  22   SER n 
7  23   ASN n 
7  24   VAL n 
7  25   GLU n 
7  26   LEU n 
7  27   PRO n 
7  28   GLN n 
7  29   CYS n 
7  30   ILE n 
7  31   ILE n 
7  32   PRO n 
7  33   SER n 
7  34   SER n 
7  35   TYR n 
7  36   ILE n 
7  37   LYS n 
7  38   ARG n 
7  39   THR n 
7  40   ASP n 
7  41   GLU n 
7  42   GLY n 
7  43   GLY n 
7  44   GLU n 
7  45   ALA n 
7  46   GLU n 
7  47   PHE n 
7  48   ILE n 
7  49   PHE n 
7  50   GLY n 
7  51   THR n 
7  52   TYR n 
7  53   ASN n 
7  54   MET n 
7  55   ILE n 
7  56   ASP n 
7  57   ALA n 
7  58   ALA n 
7  59   ALA n 
7  60   GLU n 
7  61   LYS n 
7  62   ARG n 
7  63   ASN n 
7  64   GLY n 
7  65   ASP n 
7  66   GLU n 
7  67   VAL n 
7  68   TYR n 
7  69   THR n 
7  70   LEU n 
7  71   VAL n 
7  72   ASP n 
7  73   SER n 
7  74   GLN n 
7  75   GLY n 
7  76   LEU n 
7  77   PRO n 
7  78   TYR n 
7  79   ASN n 
7  80   TRP n 
7  81   ASP n 
7  82   ALA n 
7  83   LEU n 
7  84   GLU n 
7  85   MET n 
7  86   GLN n 
7  87   TRP n 
7  88   ARG n 
7  89   TYR n 
7  90   LEU n 
7  91   TYR n 
7  92   ASP n 
7  93   THR n 
7  94   GLN n 
7  95   LEU n 
7  96   LYS n 
7  97   VAL n 
7  98   SER n 
7  99   PRO n 
7  100  GLU n 
7  101  GLU n 
7  102  LEU n 
7  103  PRO n 
7  104  LEU n 
7  105  VAL n 
7  106  ILE n 
7  107  THR n 
7  108  MET n 
7  109  PRO n 
7  110  ALA n 
7  111  THR n 
7  112  ASN n 
7  113  GLY n 
7  114  LYS n 
7  115  PRO n 
7  116  ASP n 
7  117  MET n 
7  118  ALA n 
7  119  ILE n 
7  120  LEU n 
7  121  GLU n 
7  122  ARG n 
7  123  TYR n 
7  124  TYR n 
7  125  GLU n 
7  126  LEU n 
7  127  ALA n 
7  128  PHE n 
7  129  ASP n 
7  130  LYS n 
7  131  LEU n 
7  132  ASN n 
7  133  VAL n 
7  134  PRO n 
7  135  VAL n 
7  136  PHE n 
7  137  GLN n 
7  138  ILE n 
7  139  VAL n 
7  140  ILE n 
7  141  GLU n 
7  142  PRO n 
7  143  LEU n 
7  144  ALA n 
7  145  ILE n 
7  146  ALA n 
7  147  LEU n 
7  148  SER n 
7  149  MET n 
7  150  GLY n 
7  151  LYS n 
7  152  SER n 
7  153  SER n 
7  154  ALA n 
7  155  PHE n 
7  156  VAL n 
7  157  ILE n 
7  158  ASP n 
7  159  ILE n 
7  160  GLY n 
7  161  ALA n 
7  162  SER n 
7  163  GLY n 
7  164  CYS n 
7  165  ASN n 
7  166  VAL n 
7  167  THR n 
7  168  PRO n 
7  169  ILE n 
7  170  ILE n 
7  171  ASP n 
7  172  GLY n 
7  173  ILE n 
7  174  VAL n 
7  175  VAL n 
7  176  LYS n 
7  177  ASN n 
7  178  ALA n 
7  179  VAL n 
7  180  VAL n 
7  181  ARG n 
7  182  SER n 
7  183  LYS n 
7  184  PHE n 
7  185  GLY n 
7  186  GLY n 
7  187  ASP n 
7  188  PHE n 
7  189  LEU n 
7  190  ASP n 
7  191  PHE n 
7  192  GLN n 
7  193  VAL n 
7  194  HIS n 
7  195  GLU n 
7  196  ARG n 
7  197  LEU n 
7  198  ALA n 
7  199  PRO n 
7  200  LEU n 
7  201  ILE n 
7  202  LYS n 
7  203  GLU n 
7  204  GLU n 
7  205  ASN n 
7  206  ASP n 
7  207  MET n 
7  208  GLU n 
7  209  ASN n 
7  210  MET n 
7  211  ALA n 
7  212  ASP n 
7  213  GLU n 
7  214  GLN n 
7  215  LYS n 
7  216  ARG n 
7  217  SER n 
7  218  THR n 
7  219  ASP n 
7  220  VAL n 
7  221  TRP n 
7  222  TYR n 
7  223  GLU n 
7  224  ALA n 
7  225  SER n 
7  226  THR n 
7  227  TRP n 
7  228  ILE n 
7  229  GLN n 
7  230  GLN n 
7  231  PHE n 
7  232  LYS n 
7  233  SER n 
7  234  THR n 
7  235  MET n 
7  236  LEU n 
7  237  GLN n 
7  238  VAL n 
7  239  SER n 
7  240  GLU n 
7  241  LYS n 
7  242  ASP n 
7  243  LEU n 
7  244  PHE n 
7  245  GLU n 
7  246  LEU n 
7  247  GLU n 
7  248  ARG n 
7  249  TYR n 
7  250  TYR n 
7  251  LYS n 
7  252  GLU n 
7  253  GLN n 
7  254  ALA n 
7  255  ASP n 
7  256  ILE n 
7  257  TYR n 
7  258  ALA n 
7  259  LYS n 
7  260  GLN n 
7  261  GLN n 
7  262  GLU n 
7  263  GLN n 
7  264  LEU n 
7  265  LYS n 
7  266  GLN n 
7  267  MET n 
7  268  ASP n 
7  269  GLN n 
7  270  GLN n 
7  271  LEU n 
7  272  GLN n 
7  273  TYR n 
7  274  THR n 
7  275  ALA n 
7  276  LEU n 
7  277  THR n 
7  278  GLY n 
7  279  SER n 
7  280  PRO n 
7  281  ASN n 
7  282  ASN n 
7  283  PRO n 
7  284  LEU n 
7  285  VAL n 
7  286  GLN n 
7  287  LYS n 
7  288  LYS n 
7  289  ASN n 
7  290  PHE n 
7  291  LEU n 
7  292  PHE n 
7  293  LYS n 
7  294  PRO n 
7  295  LEU n 
7  296  ASN n 
7  297  LYS n 
7  298  THR n 
7  299  LEU n 
7  300  THR n 
7  301  LEU n 
7  302  ASP n 
7  303  LEU n 
7  304  LYS n 
7  305  GLU n 
7  306  CYS n 
7  307  TYR n 
7  308  GLN n 
7  309  PHE n 
7  310  ALA n 
7  311  GLU n 
7  312  TYR n 
7  313  LEU n 
7  314  PHE n 
7  315  LYS n 
7  316  PRO n 
7  317  GLN n 
7  318  LEU n 
7  319  ILE n 
7  320  SER n 
7  321  ASP n 
7  322  LYS n 
7  323  PHE n 
7  324  SER n 
7  325  PRO n 
7  326  GLU n 
7  327  ASP n 
7  328  GLY n 
7  329  LEU n 
7  330  GLY n 
7  331  PRO n 
7  332  LEU n 
7  333  MET n 
7  334  ALA n 
7  335  LYS n 
7  336  SER n 
7  337  VAL n 
7  338  LYS n 
7  339  LYS n 
7  340  ALA n 
7  341  GLY n 
7  342  ALA n 
7  343  SER n 
7  344  ILE n 
7  345  ASN n 
7  346  SER n 
7  347  MET n 
7  348  LYS n 
7  349  ALA n 
7  350  ASN n 
7  351  THR n 
7  352  SER n 
7  353  THR n 
7  354  ASN n 
7  355  PRO n 
7  356  ASN n 
7  357  GLY n 
7  358  LEU n 
7  359  GLY n 
7  360  THR n 
7  361  SER n 
7  362  HIS n 
7  363  ILE n 
7  364  ASN n 
7  365  THR n 
7  366  ASN n 
7  367  VAL n 
7  368  GLY n 
7  369  ASP n 
7  370  ASN n 
7  371  ASN n 
7  372  SER n 
7  373  THR n 
7  374  ALA n 
7  375  SER n 
7  376  SER n 
7  377  SER n 
7  378  ASN n 
7  379  ILE n 
7  380  SER n 
7  381  PRO n 
7  382  GLU n 
7  383  GLN n 
7  384  VAL n 
7  385  TYR n 
7  386  SER n 
7  387  LEU n 
7  388  LEU n 
7  389  LEU n 
7  390  THR n 
7  391  ASN n 
7  392  VAL n 
7  393  ILE n 
7  394  ILE n 
7  395  THR n 
7  396  GLY n 
7  397  SER n 
7  398  THR n 
7  399  SER n 
7  400  LEU n 
7  401  ILE n 
7  402  GLU n 
7  403  GLY n 
7  404  MET n 
7  405  GLU n 
7  406  GLN n 
7  407  ARG n 
7  408  ILE n 
7  409  ILE n 
7  410  LYS n 
7  411  GLU n 
7  412  LEU n 
7  413  SER n 
7  414  ILE n 
7  415  ARG n 
7  416  PHE n 
7  417  PRO n 
7  418  GLN n 
7  419  TYR n 
7  420  LYS n 
7  421  LEU n 
7  422  THR n 
7  423  THR n 
7  424  PHE n 
7  425  ALA n 
7  426  ASN n 
7  427  GLN n 
7  428  VAL n 
7  429  MET n 
7  430  MET n 
7  431  ASP n 
7  432  ARG n 
7  433  LYS n 
7  434  ILE n 
7  435  GLN n 
7  436  GLY n 
7  437  TRP n 
7  438  LEU n 
7  439  GLY n 
7  440  ALA n 
7  441  LEU n 
7  442  THR n 
7  443  MET n 
7  444  ALA n 
7  445  ASN n 
7  446  LEU n 
7  447  PRO n 
7  448  SER n 
7  449  TRP n 
7  450  SER n 
7  451  LEU n 
7  452  GLY n 
7  453  LYS n 
7  454  TRP n 
7  455  TYR n 
7  456  SER n 
7  457  LYS n 
7  458  GLU n 
7  459  ASP n 
7  460  TYR n 
7  461  GLU n 
7  462  THR n 
7  463  LEU n 
7  464  LYS n 
7  465  ARG n 
7  466  ASP n 
7  467  ARG n 
7  468  LYS n 
7  469  GLN n 
7  470  SER n 
7  471  GLN n 
7  472  ALA n 
7  473  THR n 
7  474  ASN n 
7  475  ALA n 
7  476  THR n 
7  477  ASN n 
8  1    MET n 
8  2    ALA n 
8  3    PRO n 
8  4    PHE n 
8  5    ARG n 
8  6    GLN n 
8  7    ASP n 
8  8    SER n 
8  9    ILE n 
8  10   LEU n 
8  11   ILE n 
8  12   ILE n 
8  13   TYR n 
8  14   PRO n 
8  15   ARG n 
8  16   SER n 
8  17   GLN n 
8  18   THR n 
8  19   THR n 
8  20   LEU n 
8  21   VAL n 
8  22   GLN n 
8  23   PHE n 
8  24   GLY n 
8  25   LEU n 
8  26   ASN n 
8  27   GLU n 
8  28   GLU n 
8  29   THR n 
8  30   PHE n 
8  31   THR n 
8  32   VAL n 
8  33   PRO n 
8  34   GLU n 
8  35   LEU n 
8  36   GLU n 
8  37   ILE n 
8  38   PRO n 
8  39   THR n 
8  40   GLN n 
8  41   ILE n 
8  42   TYR n 
8  43   ARG n 
8  44   THR n 
8  45   THR n 
8  46   ARG n 
8  47   GLN n 
8  48   ASP n 
8  49   GLY n 
8  50   SER n 
8  51   TYR n 
8  52   THR n 
8  53   TYR n 
8  54   HIS n 
8  55   SER n 
8  56   THR n 
8  57   ASN n 
8  58   LYS n 
8  59   ASP n 
8  60   ASN n 
8  61   LYS n 
8  62   ALA n 
8  63   GLU n 
8  64   LEU n 
8  65   ILE n 
8  66   LYS n 
8  67   PRO n 
8  68   ILE n 
8  69   GLN n 
8  70   ASN n 
8  71   GLY n 
8  72   GLU n 
8  73   ILE n 
8  74   ILE n 
8  75   ASP n 
8  76   ILE n 
8  77   SER n 
8  78   ALA n 
8  79   PHE n 
8  80   THR n 
8  81   GLN n 
8  82   PHE n 
8  83   LEU n 
8  84   ARG n 
8  85   LEU n 
8  86   ILE n 
8  87   PHE n 
8  88   VAL n 
8  89   SER n 
8  90   ILE n 
8  91   LEU n 
8  92   SER n 
8  93   ASP n 
8  94   ARG n 
8  95   ALA n 
8  96   ASN n 
8  97   LYS n 
8  98   ASN n 
8  99   GLN n 
8  100  ASP n 
8  101  ALA n 
8  102  PHE n 
8  103  GLU n 
8  104  ALA n 
8  105  GLU n 
8  106  LEU n 
8  107  SER n 
8  108  ASN n 
8  109  ILE n 
8  110  PRO n 
8  111  LEU n 
8  112  LEU n 
8  113  LEU n 
8  114  ILE n 
8  115  THR n 
8  116  HIS n 
8  117  HIS n 
8  118  SER n 
8  119  TRP n 
8  120  SER n 
8  121  GLN n 
8  122  SER n 
8  123  ASP n 
8  124  LEU n 
8  125  GLU n 
8  126  ILE n 
8  127  ILE n 
8  128  THR n 
8  129  GLN n 
8  130  TYR n 
8  131  VAL n 
8  132  PHE n 
8  133  GLU n 
8  134  SER n 
8  135  LEU n 
8  136  GLU n 
8  137  ILE n 
8  138  ASN n 
8  139  ASN n 
8  140  LEU n 
8  141  ILE n 
8  142  GLN n 
8  143  LEU n 
8  144  PRO n 
8  145  ALA n 
8  146  SER n 
8  147  LEU n 
8  148  ALA n 
8  149  ALA n 
8  150  THR n 
8  151  TYR n 
8  152  SER n 
8  153  MET n 
8  154  ILE n 
8  155  SER n 
8  156  LEU n 
8  157  GLN n 
8  158  ASN n 
8  159  CYS n 
8  160  CYS n 
8  161  ILE n 
8  162  ILE n 
8  163  ASP n 
8  164  VAL n 
8  165  GLY n 
8  166  THR n 
8  167  HIS n 
8  168  HIS n 
8  169  THR n 
8  170  ASP n 
8  171  ILE n 
8  172  ILE n 
8  173  PRO n 
8  174  ILE n 
8  175  VAL n 
8  176  ASP n 
8  177  TYR n 
8  178  ALA n 
8  179  GLN n 
8  180  LEU n 
8  181  ASP n 
8  182  HIS n 
8  183  LEU n 
8  184  VAL n 
8  185  SER n 
8  186  SER n 
8  187  ILE n 
8  188  PRO n 
8  189  MET n 
8  190  GLY n 
8  191  GLY n 
8  192  GLN n 
8  193  SER n 
8  194  ILE n 
8  195  ASN n 
8  196  ASP n 
8  197  SER n 
8  198  LEU n 
8  199  LYS n 
8  200  LYS n 
8  201  LEU n 
8  202  LEU n 
8  203  PRO n 
8  204  GLN n 
8  205  TRP n 
8  206  ASP n 
8  207  ASP n 
8  208  ASP n 
8  209  GLN n 
8  210  ILE n 
8  211  GLU n 
8  212  SER n 
8  213  LEU n 
8  214  LYS n 
8  215  LYS n 
8  216  SER n 
8  217  PRO n 
8  218  ILE n 
8  219  PHE n 
8  220  GLU n 
8  221  VAL n 
8  222  LEU n 
8  223  SER n 
8  224  ASP n 
8  225  ASP n 
8  226  ALA n 
8  227  LYS n 
8  228  LYS n 
8  229  LEU n 
8  230  SER n 
8  231  SER n 
8  232  PHE n 
8  233  ASP n 
8  234  PHE n 
8  235  GLY n 
8  236  ASN n 
8  237  GLU n 
8  238  ASN n 
8  239  GLU n 
8  240  ASP n 
8  241  GLU n 
8  242  ASP n 
8  243  GLU n 
8  244  GLY n 
8  245  THR n 
8  246  LEU n 
8  247  ASN n 
8  248  VAL n 
8  249  ALA n 
8  250  GLU n 
8  251  ILE n 
8  252  ILE n 
8  253  THR n 
8  254  SER n 
8  255  GLY n 
8  256  ARG n 
8  257  ASP n 
8  258  THR n 
8  259  ARG n 
8  260  GLU n 
8  261  VAL n 
8  262  LEU n 
8  263  GLU n 
8  264  GLU n 
8  265  ARG n 
8  266  GLU n 
8  267  ARG n 
8  268  GLY n 
8  269  GLN n 
8  270  LYS n 
8  271  VAL n 
8  272  LYS n 
8  273  ASN n 
8  274  VAL n 
8  275  LYS n 
8  276  ASN n 
8  277  SER n 
8  278  ASP n 
8  279  LEU n 
8  280  GLU n 
8  281  PHE n 
8  282  ASN n 
8  283  THR n 
8  284  PHE n 
8  285  TRP n 
8  286  ASP n 
8  287  GLU n 
8  288  LYS n 
8  289  GLY n 
8  290  ASN n 
8  291  GLU n 
8  292  ILE n 
8  293  LYS n 
8  294  VAL n 
8  295  GLY n 
8  296  LYS n 
8  297  GLN n 
8  298  ARG n 
8  299  PHE n 
8  300  GLN n 
8  301  GLY n 
8  302  CYS n 
8  303  ASN n 
8  304  ASN n 
8  305  LEU n 
8  306  ILE n 
8  307  LYS n 
8  308  ASN n 
8  309  ILE n 
8  310  SER n 
8  311  ASN n 
8  312  ARG n 
8  313  VAL n 
8  314  GLY n 
8  315  LEU n 
8  316  THR n 
8  317  LEU n 
8  318  ASP n 
8  319  ASN n 
8  320  ILE n 
8  321  ASP n 
8  322  ASP n 
8  323  ILE n 
8  324  ASN n 
8  325  LYS n 
8  326  ALA n 
8  327  LYS n 
8  328  ALA n 
8  329  VAL n 
8  330  TRP n 
8  331  GLU n 
8  332  ASN n 
8  333  ILE n 
8  334  ILE n 
8  335  ILE n 
8  336  VAL n 
8  337  GLY n 
8  338  GLY n 
8  339  THR n 
8  340  THR n 
8  341  SER n 
8  342  ILE n 
8  343  SER n 
8  344  GLY n 
8  345  PHE n 
8  346  LYS n 
8  347  GLU n 
8  348  ALA n 
8  349  LEU n 
8  350  LEU n 
8  351  GLY n 
8  352  GLN n 
8  353  LEU n 
8  354  LEU n 
8  355  LYS n 
8  356  ASP n 
8  357  HIS n 
8  358  LEU n 
8  359  ILE n 
8  360  ILE n 
8  361  GLU n 
8  362  PRO n 
8  363  GLU n 
8  364  GLU n 
8  365  GLU n 
8  366  LYS n 
8  367  SER n 
8  368  LYS n 
8  369  ARG n 
8  370  GLU n 
8  371  GLU n 
8  372  GLU n 
8  373  ALA n 
8  374  LYS n 
8  375  SER n 
8  376  VAL n 
8  377  LEU n 
8  378  PRO n 
8  379  ALA n 
8  380  ALA n 
8  381  THR n 
8  382  LYS n 
8  383  LYS n 
8  384  LYS n 
8  385  SER n 
8  386  LYS n 
8  387  PHE n 
8  388  MET n 
8  389  THR n 
8  390  ASN n 
8  391  SER n 
8  392  THR n 
8  393  ALA n 
8  394  PHE n 
8  395  VAL n 
8  396  PRO n 
8  397  THR n 
8  398  ILE n 
8  399  GLU n 
8  400  TYR n 
8  401  VAL n 
8  402  GLN n 
8  403  CYS n 
8  404  PRO n 
8  405  THR n 
8  406  VAL n 
8  407  ILE n 
8  408  LYS n 
8  409  LEU n 
8  410  ALA n 
8  411  LYS n 
8  412  TYR n 
8  413  PRO n 
8  414  ASP n 
8  415  TYR n 
8  416  PHE n 
8  417  PRO n 
8  418  GLU n 
8  419  TRP n 
8  420  LYS n 
8  421  LYS n 
8  422  SER n 
8  423  GLY n 
8  424  TYR n 
8  425  SER n 
8  426  GLU n 
8  427  ILE n 
8  428  ILE n 
8  429  PHE n 
8  430  LEU n 
8  431  GLY n 
8  432  ALA n 
8  433  GLN n 
8  434  ILE n 
8  435  VAL n 
8  436  SER n 
8  437  LYS n 
8  438  GLN n 
8  439  ILE n 
8  440  PHE n 
8  441  THR n 
8  442  HIS n 
8  443  PRO n 
8  444  LYS n 
8  445  ASP n 
8  446  THR n 
8  447  PHE n 
8  448  TYR n 
8  449  ILE n 
8  450  THR n 
8  451  ARG n 
8  452  GLU n 
8  453  LYS n 
8  454  TYR n 
8  455  ASN n 
8  456  MET n 
8  457  LYS n 
8  458  GLY n 
8  459  PRO n 
8  460  ALA n 
8  461  ALA n 
8  462  LEU n 
8  463  TRP n 
8  464  ASP n 
8  465  VAL n 
8  466  GLN n 
8  467  PHE n 
9  1    MET n 
9  2    ASP n 
9  3    PRO n 
9  4    GLN n 
9  5    THR n 
9  6    LEU n 
9  7    ILE n 
9  8    THR n 
9  9    LYS n 
9  10   ALA n 
9  11   ASN n 
9  12   LYS n 
9  13   VAL n 
9  14   SER n 
9  15   TYR n 
9  16   TYR n 
9  17   GLY n 
9  18   ASN n 
9  19   PRO n 
9  20   THR n 
9  21   SER n 
9  22   LYS n 
9  23   GLU n 
9  24   SER n 
9  25   TRP n 
9  26   ARG n 
9  27   TYR n 
9  28   ASP n 
9  29   TRP n 
9  30   TYR n 
9  31   GLN n 
9  32   PRO n 
9  33   SER n 
9  34   LYS n 
9  35   VAL n 
9  36   SER n 
9  37   SER n 
9  38   ASN n 
9  39   VAL n 
9  40   GLN n 
9  41   GLN n 
9  42   PRO n 
9  43   GLN n 
9  44   GLN n 
9  45   GLN n 
9  46   LEU n 
9  47   GLY n 
9  48   ASP n 
9  49   MET n 
9  50   GLU n 
9  51   ASN n 
9  52   ASN n 
9  53   LEU n 
9  54   GLU n 
9  55   LYS n 
9  56   TYR n 
9  57   PRO n 
9  58   PHE n 
9  59   ARG n 
9  60   TYR n 
9  61   LYS n 
9  62   THR n 
9  63   TRP n 
9  64   LEU n 
9  65   ARG n 
9  66   ASN n 
9  67   GLN n 
9  68   GLU n 
9  69   ASP n 
9  70   GLU n 
9  71   LYS n 
9  72   ASN n 
9  73   LEU n 
9  74   GLN n 
9  75   ARG n 
9  76   GLU n 
9  77   SER n 
9  78   CYS n 
9  79   GLU n 
9  80   ASP n 
9  81   ILE n 
9  82   LEU n 
9  83   ASP n 
9  84   LEU n 
9  85   LYS n 
9  86   GLU n 
9  87   PHE n 
9  88   ASP n 
9  89   ARG n 
9  90   ARG n 
9  91   ILE n 
9  92   LEU n 
9  93   LYS n 
9  94   LYS n 
9  95   SER n 
9  96   LEU n 
9  97   MET n 
9  98   THR n 
9  99   SER n 
9  100  HIS n 
9  101  THR n 
9  102  LYS n 
9  103  GLY n 
9  104  ASP n 
9  105  THR n 
9  106  SER n 
9  107  LYS n 
9  108  ALA n 
9  109  THR n 
9  110  GLY n 
9  111  ALA n 
9  112  PRO n 
9  113  SER n 
9  114  ALA n 
9  115  ASN n 
9  116  GLN n 
9  117  GLY n 
9  118  ASP n 
9  119  GLU n 
9  120  ALA n 
9  121  LEU n 
9  122  SER n 
9  123  VAL n 
9  124  ASP n 
9  125  ASP n 
9  126  ILE n 
9  127  ARG n 
9  128  GLY n 
9  129  ALA n 
9  130  VAL n 
9  131  GLY n 
9  132  ASN n 
9  133  SER n 
9  134  GLU n 
9  135  ALA n 
9  136  ILE n 
9  137  PRO n 
9  138  GLY n 
9  139  LEU n 
9  140  SER n 
9  141  ALA n 
9  142  GLY n 
9  143  VAL n 
9  144  ASN n 
9  145  ASN n 
9  146  ASP n 
9  147  ASN n 
9  148  THR n 
9  149  LYS n 
9  150  GLU n 
9  151  SER n 
9  152  LYS n 
9  153  ASP n 
9  154  VAL n 
9  155  LYS n 
9  156  MET n 
9  157  ASN n 
10 1    MET n 
10 2    ASN n 
10 3    ILE n 
10 4    PRO n 
10 5    GLN n 
10 6    ARG n 
10 7    GLN n 
10 8    PHE n 
10 9    SER n 
10 10   ASN n 
10 11   GLU n 
10 12   GLU n 
10 13   VAL n 
10 14   ASN n 
10 15   ARG n 
10 16   CYS n 
10 17   TYR n 
10 18   LEU n 
10 19   ARG n 
10 20   TRP n 
10 21   GLN n 
10 22   HIS n 
10 23   LEU n 
10 24   ARG n 
10 25   ASN n 
10 26   GLU n 
10 27   HIS n 
10 28   GLY n 
10 29   MET n 
10 30   ASN n 
10 31   ALA n 
10 32   PRO n 
10 33   SER n 
10 34   VAL n 
10 35   PRO n 
10 36   GLU n 
10 37   PHE n 
10 38   ILE n 
10 39   TYR n 
10 40   LEU n 
10 41   THR n 
10 42   LYS n 
10 43   VAL n 
10 44   LEU n 
10 45   GLN n 
10 46   PHE n 
10 47   ALA n 
10 48   ALA n 
10 49   LYS n 
10 50   GLN n 
10 51   ARG n 
10 52   GLN n 
10 53   GLU n 
10 54   LEU n 
10 55   GLN n 
10 56   MET n 
10 57   GLN n 
10 58   ARG n 
10 59   GLN n 
10 60   GLN n 
10 61   GLN n 
10 62   GLY n 
10 63   ILE n 
10 64   SER n 
10 65   GLY n 
10 66   SER n 
10 67   GLN n 
10 68   GLN n 
10 69   ASN n 
10 70   ILE n 
10 71   VAL n 
10 72   PRO n 
10 73   ASN n 
10 74   SER n 
10 75   SER n 
10 76   ASP n 
10 77   GLN n 
10 78   ALA n 
10 79   GLU n 
10 80   LEU n 
10 81   PRO n 
10 82   ASN n 
10 83   ASN n 
10 84   ALA n 
10 85   SER n 
10 86   SER n 
10 87   HIS n 
10 88   ILE n 
10 89   SER n 
10 90   ALA n 
10 91   SER n 
10 92   ALA n 
10 93   SER n 
10 94   PRO n 
10 95   HIS n 
10 96   LEU n 
10 97   ALA n 
10 98   PRO n 
10 99   ASN n 
10 100  MET n 
10 101  GLN n 
10 102  LEU n 
10 103  ASN n 
10 104  GLY n 
10 105  ASN n 
10 106  GLU n 
10 107  THR n 
10 108  PHE n 
10 109  SER n 
10 110  THR n 
10 111  SER n 
10 112  ALA n 
10 113  HIS n 
10 114  GLN n 
10 115  SER n 
10 116  PRO n 
10 117  ILE n 
10 118  MET n 
10 119  GLN n 
10 120  THR n 
10 121  GLN n 
10 122  MET n 
10 123  PRO n 
10 124  LEU n 
10 125  ASN n 
10 126  SER n 
10 127  ASN n 
10 128  GLY n 
10 129  GLY n 
10 130  ASN n 
10 131  ASN n 
10 132  MET n 
10 133  LEU n 
10 134  PRO n 
10 135  GLN n 
10 136  ARG n 
10 137  GLN n 
10 138  SER n 
10 139  SER n 
10 140  VAL n 
10 141  GLY n 
10 142  SER n 
10 143  LEU n 
10 144  ASN n 
10 145  ALA n 
10 146  THR n 
10 147  ASN n 
10 148  PHE n 
10 149  SER n 
10 150  PRO n 
10 151  THR n 
10 152  PRO n 
10 153  ALA n 
10 154  ASN n 
10 155  ASN n 
10 156  GLY n 
10 157  GLU n 
10 158  ASN n 
10 159  ALA n 
10 160  ALA n 
10 161  GLU n 
10 162  LYS n 
10 163  PRO n 
10 164  ASP n 
10 165  ASN n 
10 166  SER n 
10 167  ASN n 
10 168  HIS n 
10 169  ASN n 
10 170  ASN n 
10 171  LEU n 
10 172  ASN n 
10 173  LEU n 
10 174  ASN n 
10 175  ASN n 
10 176  SER n 
10 177  GLU n 
10 178  LEU n 
10 179  GLN n 
10 180  PRO n 
10 181  GLN n 
10 182  ASN n 
10 183  ARG n 
10 184  SER n 
10 185  LEU n 
10 186  GLN n 
10 187  GLU n 
10 188  HIS n 
10 189  ASN n 
10 190  ILE n 
10 191  GLN n 
10 192  ASP n 
10 193  SER n 
10 194  ASN n 
10 195  VAL n 
10 196  MET n 
10 197  PRO n 
10 198  GLY n 
10 199  SER n 
10 200  GLN n 
10 201  ILE n 
10 202  ASN n 
10 203  SER n 
10 204  PRO n 
10 205  MET n 
10 206  PRO n 
10 207  GLN n 
10 208  GLN n 
10 209  ALA n 
10 210  GLN n 
10 211  MET n 
10 212  GLN n 
10 213  GLN n 
10 214  ALA n 
10 215  GLN n 
10 216  PHE n 
10 217  GLN n 
10 218  ALA n 
10 219  GLN n 
10 220  GLN n 
10 221  ALA n 
10 222  GLN n 
10 223  GLN n 
10 224  ALA n 
10 225  GLN n 
10 226  GLN n 
10 227  ALA n 
10 228  GLN n 
10 229  GLN n 
10 230  ALA n 
10 231  GLN n 
10 232  GLN n 
10 233  ALA n 
10 234  GLN n 
10 235  ALA n 
10 236  ARG n 
10 237  LEU n 
10 238  GLN n 
10 239  GLN n 
10 240  GLY n 
10 241  ARG n 
10 242  ARG n 
10 243  LEU n 
10 244  PRO n 
10 245  MET n 
10 246  THR n 
10 247  MET n 
10 248  PHE n 
10 249  THR n 
10 250  ALA n 
10 251  GLU n 
10 252  GLN n 
10 253  SER n 
10 254  GLU n 
10 255  LEU n 
10 256  LEU n 
10 257  LYS n 
10 258  ALA n 
10 259  GLN n 
10 260  ILE n 
10 261  THR n 
10 262  SER n 
10 263  LEU n 
10 264  LYS n 
10 265  CYS n 
10 266  LEU n 
10 267  VAL n 
10 268  ASN n 
10 269  ARG n 
10 270  LYS n 
10 271  PRO n 
10 272  ILE n 
10 273  PRO n 
10 274  PHE n 
10 275  GLU n 
10 276  PHE n 
10 277  GLN n 
10 278  ALA n 
10 279  VAL n 
10 280  ILE n 
10 281  GLN n 
10 282  LYS n 
10 283  SER n 
10 284  ILE n 
10 285  ASN n 
10 286  HIS n 
10 287  PRO n 
10 288  PRO n 
10 289  ASP n 
10 290  PHE n 
10 291  LYS n 
10 292  ARG n 
10 293  MET n 
10 294  LEU n 
10 295  LEU n 
10 296  SER n 
10 297  LEU n 
10 298  SER n 
10 299  GLU n 
10 300  PHE n 
10 301  ALA n 
10 302  ARG n 
10 303  ARG n 
10 304  ARG n 
10 305  GLN n 
10 306  PRO n 
10 307  THR n 
10 308  ASP n 
10 309  GLN n 
10 310  ASN n 
10 311  ASN n 
10 312  GLN n 
10 313  SER n 
10 314  ASN n 
10 315  LEU n 
10 316  ASN n 
10 317  GLY n 
10 318  GLY n 
10 319  ASN n 
10 320  ASN n 
10 321  THR n 
10 322  GLN n 
10 323  GLN n 
10 324  PRO n 
10 325  GLY n 
10 326  THR n 
10 327  ASN n 
10 328  SER n 
10 329  HIS n 
10 330  TYR n 
10 331  ASN n 
10 332  ASN n 
10 333  THR n 
10 334  ASN n 
10 335  THR n 
10 336  ASP n 
10 337  ASN n 
10 338  VAL n 
10 339  SER n 
10 340  GLY n 
10 341  LEU n 
10 342  THR n 
10 343  ARG n 
10 344  ASN n 
10 345  ALA n 
10 346  PRO n 
10 347  LEU n 
10 348  ASP n 
10 349  SER n 
10 350  LYS n 
10 351  ASP n 
10 352  GLU n 
10 353  ASN n 
10 354  PHE n 
10 355  ALA n 
10 356  SER n 
10 357  VAL n 
10 358  SER n 
10 359  PRO n 
10 360  ALA n 
10 361  GLY n 
10 362  PRO n 
10 363  SER n 
10 364  SER n 
10 365  VAL n 
10 366  HIS n 
10 367  ASN n 
10 368  ALA n 
10 369  LYS n 
10 370  ASN n 
10 371  GLY n 
10 372  THR n 
10 373  LEU n 
10 374  ASP n 
10 375  LYS n 
10 376  ASN n 
10 377  SER n 
10 378  GLN n 
10 379  THR n 
10 380  VAL n 
10 381  SER n 
10 382  GLY n 
10 383  THR n 
10 384  PRO n 
10 385  ILE n 
10 386  THR n 
10 387  GLN n 
10 388  THR n 
10 389  GLU n 
10 390  SER n 
10 391  LYS n 
10 392  LYS n 
10 393  GLU n 
10 394  GLU n 
10 395  ASN n 
10 396  GLU n 
10 397  THR n 
10 398  ILE n 
10 399  SER n 
10 400  ASN n 
10 401  VAL n 
10 402  ALA n 
10 403  LYS n 
10 404  THR n 
10 405  ALA n 
10 406  PRO n 
10 407  ASN n 
10 408  SER n 
10 409  ASN n 
10 410  LYS n 
10 411  THR n 
10 412  HIS n 
10 413  THR n 
10 414  GLU n 
10 415  GLN n 
10 416  ASN n 
10 417  ASN n 
10 418  PRO n 
10 419  PRO n 
10 420  LYS n 
10 421  PRO n 
10 422  GLN n 
10 423  LYS n 
10 424  PRO n 
10 425  VAL n 
10 426  PRO n 
10 427  LEU n 
10 428  ASN n 
10 429  VAL n 
10 430  LEU n 
10 431  GLN n 
10 432  ASP n 
10 433  GLN n 
10 434  TYR n 
10 435  LYS n 
10 436  GLU n 
10 437  GLY n 
10 438  ILE n 
10 439  LYS n 
10 440  VAL n 
10 441  VAL n 
10 442  ASP n 
10 443  ILE n 
10 444  ASP n 
10 445  ASP n 
10 446  PRO n 
10 447  ASP n 
10 448  MET n 
10 449  MET n 
10 450  VAL n 
10 451  ASP n 
10 452  SER n 
10 453  PHE n 
10 454  THR n 
10 455  MET n 
10 456  PRO n 
10 457  ASN n 
10 458  ILE n 
10 459  SER n 
10 460  HIS n 
10 461  SER n 
10 462  ASN n 
10 463  ILE n 
10 464  ASP n 
10 465  TYR n 
10 466  GLN n 
10 467  THR n 
10 468  LEU n 
10 469  LEU n 
10 470  ALA n 
10 471  ASN n 
10 472  SER n 
10 473  ASP n 
10 474  HIS n 
10 475  ALA n 
10 476  LYS n 
10 477  PHE n 
10 478  THR n 
10 479  ILE n 
10 480  GLU n 
10 481  PRO n 
10 482  GLY n 
10 483  VAL n 
10 484  LEU n 
10 485  PRO n 
10 486  VAL n 
10 487  GLY n 
10 488  ILE n 
10 489  ASP n 
10 490  THR n 
10 491  HIS n 
10 492  THR n 
10 493  ALA n 
10 494  THR n 
10 495  ASP n 
10 496  ILE n 
10 497  TYR n 
10 498  GLN n 
10 499  THR n 
10 500  LEU n 
10 501  ILE n 
10 502  ALA n 
10 503  LEU n 
10 504  ASN n 
10 505  LEU n 
10 506  ASP n 
10 507  THR n 
10 508  THR n 
10 509  VAL n 
10 510  ASN n 
10 511  ASP n 
10 512  CYS n 
10 513  LEU n 
10 514  ASP n 
10 515  LYS n 
10 516  LEU n 
10 517  LEU n 
10 518  ASN n 
10 519  ASP n 
10 520  GLU n 
10 521  CYS n 
10 522  THR n 
10 523  GLU n 
10 524  SER n 
10 525  THR n 
10 526  ARG n 
10 527  GLU n 
10 528  ASN n 
10 529  ALA n 
10 530  LEU n 
10 531  TYR n 
10 532  ASP n 
10 533  TYR n 
10 534  TYR n 
10 535  ALA n 
10 536  LEU n 
10 537  GLN n 
10 538  LEU n 
10 539  LEU n 
10 540  PRO n 
10 541  LEU n 
10 542  GLN n 
10 543  LYS n 
10 544  ALA n 
10 545  VAL n 
10 546  ARG n 
10 547  GLY n 
10 548  HIS n 
10 549  VAL n 
10 550  LEU n 
10 551  GLN n 
10 552  PHE n 
10 553  GLU n 
10 554  TRP n 
10 555  HIS n 
10 556  GLN n 
10 557  ASN n 
10 558  SER n 
10 559  LEU n 
10 560  LEU n 
10 561  THR n 
10 562  ASN n 
10 563  THR n 
10 564  HIS n 
10 565  PRO n 
10 566  ASN n 
10 567  PHE n 
10 568  LEU n 
10 569  SER n 
10 570  LYS n 
10 571  ILE n 
10 572  ARG n 
10 573  ASN n 
10 574  ILE n 
10 575  ASN n 
10 576  VAL n 
10 577  GLN n 
10 578  ASP n 
10 579  ALA n 
10 580  LEU n 
10 581  LEU n 
10 582  THR n 
10 583  ASN n 
10 584  GLN n 
10 585  LEU n 
10 586  TYR n 
10 587  LYS n 
10 588  ASN n 
10 589  HIS n 
10 590  GLU n 
10 591  LEU n 
10 592  LEU n 
10 593  LYS n 
10 594  LEU n 
10 595  GLU n 
10 596  ARG n 
10 597  LYS n 
10 598  LYS n 
10 599  THR n 
10 600  GLU n 
10 601  ALA n 
10 602  VAL n 
10 603  ALA n 
10 604  ARG n 
10 605  LEU n 
10 606  LYS n 
10 607  SER n 
10 608  MET n 
10 609  ASN n 
10 610  LYS n 
10 611  SER n 
10 612  ALA n 
10 613  ILE n 
10 614  ASN n 
10 615  GLN n 
10 616  TYR n 
10 617  ASN n 
10 618  ARG n 
10 619  ARG n 
10 620  GLN n 
10 621  ASP n 
10 622  LYS n 
10 623  LYS n 
10 624  ASN n 
10 625  LYS n 
10 626  ARG n 
10 627  LEU n 
10 628  LYS n 
10 629  PHE n 
10 630  GLY n 
10 631  HIS n 
10 632  ARG n 
10 633  LEU n 
10 634  ILE n 
10 635  ALA n 
10 636  THR n 
10 637  HIS n 
10 638  THR n 
10 639  ASN n 
10 640  LEU n 
10 641  GLU n 
10 642  ARG n 
10 643  ASP n 
10 644  GLU n 
10 645  GLN n 
10 646  LYS n 
10 647  ARG n 
10 648  ALA n 
10 649  GLU n 
10 650  LYS n 
10 651  LYS n 
10 652  ALA n 
10 653  LYS n 
10 654  GLU n 
10 655  ARG n 
10 656  LEU n 
10 657  GLN n 
10 658  ALA n 
10 659  LEU n 
10 660  LYS n 
10 661  ALA n 
10 662  ASN n 
10 663  ASP n 
10 664  GLU n 
10 665  GLU n 
10 666  ALA n 
10 667  TYR n 
10 668  ILE n 
10 669  LYS n 
10 670  LEU n 
10 671  LEU n 
10 672  ASP n 
10 673  GLN n 
10 674  THR n 
10 675  LYS n 
10 676  ASP n 
10 677  THR n 
10 678  ARG n 
10 679  ILE n 
10 680  THR n 
10 681  HIS n 
10 682  LEU n 
10 683  LEU n 
10 684  ARG n 
10 685  GLN n 
10 686  THR n 
10 687  ASN n 
10 688  ALA n 
10 689  PHE n 
10 690  LEU n 
10 691  ASP n 
10 692  SER n 
10 693  LEU n 
10 694  THR n 
10 695  ARG n 
10 696  ALA n 
10 697  VAL n 
10 698  LYS n 
10 699  ASP n 
10 700  GLN n 
10 701  GLN n 
10 702  LYS n 
10 703  TYR n 
10 704  THR n 
10 705  LYS n 
10 706  GLU n 
10 707  MET n 
10 708  ILE n 
10 709  ASP n 
10 710  SER n 
10 711  HIS n 
10 712  ILE n 
10 713  LYS n 
10 714  GLU n 
10 715  ALA n 
10 716  SER n 
10 717  GLU n 
10 718  GLU n 
10 719  VAL n 
10 720  ASP n 
10 721  ASP n 
10 722  LEU n 
10 723  SER n 
10 724  MET n 
10 725  VAL n 
10 726  PRO n 
10 727  LYS n 
10 728  MET n 
10 729  LYS n 
10 730  ASP n 
10 731  GLU n 
10 732  GLU n 
10 733  TYR n 
10 734  ASP n 
10 735  ASP n 
10 736  ASP n 
10 737  ASP n 
10 738  ASP n 
10 739  ASN n 
10 740  SER n 
10 741  ASN n 
10 742  VAL n 
10 743  ASP n 
10 744  TYR n 
10 745  TYR n 
10 746  ASN n 
10 747  VAL n 
10 748  ALA n 
10 749  HIS n 
10 750  ARG n 
10 751  ILE n 
10 752  LYS n 
10 753  GLU n 
10 754  ASP n 
10 755  ILE n 
10 756  LYS n 
10 757  LYS n 
10 758  GLN n 
10 759  PRO n 
10 760  SER n 
10 761  ILE n 
10 762  LEU n 
10 763  VAL n 
10 764  GLY n 
10 765  GLY n 
10 766  THR n 
10 767  LEU n 
10 768  LYS n 
10 769  ASP n 
10 770  TYR n 
10 771  GLN n 
10 772  ILE n 
10 773  LYS n 
10 774  GLY n 
10 775  LEU n 
10 776  GLN n 
10 777  TRP n 
10 778  MET n 
10 779  VAL n 
10 780  SER n 
10 781  LEU n 
10 782  PHE n 
10 783  ASN n 
10 784  ASN n 
10 785  HIS n 
10 786  LEU n 
10 787  ASN n 
10 788  GLY n 
10 789  ILE n 
10 790  LEU n 
10 791  ALA n 
10 792  ASP n 
10 793  GLU n 
10 794  MET n 
10 795  GLY n 
10 796  LEU n 
10 797  GLY n 
10 798  LYS n 
10 799  THR n 
10 800  ILE n 
10 801  GLN n 
10 802  THR n 
10 803  ILE n 
10 804  SER n 
10 805  LEU n 
10 806  LEU n 
10 807  THR n 
10 808  TYR n 
10 809  LEU n 
10 810  TYR n 
10 811  GLU n 
10 812  MET n 
10 813  LYS n 
10 814  ASN n 
10 815  ILE n 
10 816  ARG n 
10 817  GLY n 
10 818  PRO n 
10 819  TYR n 
10 820  LEU n 
10 821  VAL n 
10 822  ILE n 
10 823  VAL n 
10 824  PRO n 
10 825  LEU n 
10 826  SER n 
10 827  THR n 
10 828  LEU n 
10 829  SER n 
10 830  ASN n 
10 831  TRP n 
10 832  SER n 
10 833  SER n 
10 834  GLU n 
10 835  PHE n 
10 836  ALA n 
10 837  LYS n 
10 838  TRP n 
10 839  ALA n 
10 840  PRO n 
10 841  THR n 
10 842  LEU n 
10 843  ARG n 
10 844  THR n 
10 845  ILE n 
10 846  SER n 
10 847  PHE n 
10 848  LYS n 
10 849  GLY n 
10 850  SER n 
10 851  PRO n 
10 852  ASN n 
10 853  GLU n 
10 854  ARG n 
10 855  LYS n 
10 856  ALA n 
10 857  LYS n 
10 858  GLN n 
10 859  ALA n 
10 860  LYS n 
10 861  ILE n 
10 862  ARG n 
10 863  ALA n 
10 864  GLY n 
10 865  GLU n 
10 866  PHE n 
10 867  ASP n 
10 868  VAL n 
10 869  VAL n 
10 870  LEU n 
10 871  THR n 
10 872  THR n 
10 873  PHE n 
10 874  GLU n 
10 875  TYR n 
10 876  ILE n 
10 877  ILE n 
10 878  LYS n 
10 879  GLU n 
10 880  ARG n 
10 881  ALA n 
10 882  LEU n 
10 883  LEU n 
10 884  SER n 
10 885  LYS n 
10 886  VAL n 
10 887  LYS n 
10 888  TRP n 
10 889  VAL n 
10 890  HIS n 
10 891  MET n 
10 892  ILE n 
10 893  ILE n 
10 894  ASP n 
10 895  GLU n 
10 896  GLY n 
10 897  HIS n 
10 898  ARG n 
10 899  MET n 
10 900  LYS n 
10 901  ASN n 
10 902  ALA n 
10 903  GLN n 
10 904  SER n 
10 905  LYS n 
10 906  LEU n 
10 907  SER n 
10 908  LEU n 
10 909  THR n 
10 910  LEU n 
10 911  ASN n 
10 912  THR n 
10 913  HIS n 
10 914  TYR n 
10 915  HIS n 
10 916  ALA n 
10 917  ASP n 
10 918  TYR n 
10 919  ARG n 
10 920  LEU n 
10 921  ILE n 
10 922  LEU n 
10 923  THR n 
10 924  GLY n 
10 925  THR n 
10 926  PRO n 
10 927  LEU n 
10 928  GLN n 
10 929  ASN n 
10 930  ASN n 
10 931  LEU n 
10 932  PRO n 
10 933  GLU n 
10 934  LEU n 
10 935  TRP n 
10 936  ALA n 
10 937  LEU n 
10 938  LEU n 
10 939  ASN n 
10 940  PHE n 
10 941  VAL n 
10 942  LEU n 
10 943  PRO n 
10 944  LYS n 
10 945  ILE n 
10 946  PHE n 
10 947  ASN n 
10 948  SER n 
10 949  VAL n 
10 950  LYS n 
10 951  SER n 
10 952  PHE n 
10 953  ASP n 
10 954  GLU n 
10 955  TRP n 
10 956  PHE n 
10 957  ASN n 
10 958  THR n 
10 959  PRO n 
10 960  PHE n 
10 961  ALA n 
10 962  ASN n 
10 963  THR n 
10 964  GLY n 
10 965  GLY n 
10 966  GLN n 
10 967  ASP n 
10 968  LYS n 
10 969  ILE n 
10 970  GLU n 
10 971  LEU n 
10 972  SER n 
10 973  GLU n 
10 974  GLU n 
10 975  GLU n 
10 976  THR n 
10 977  LEU n 
10 978  LEU n 
10 979  VAL n 
10 980  ILE n 
10 981  ARG n 
10 982  ARG n 
10 983  LEU n 
10 984  HIS n 
10 985  LYS n 
10 986  VAL n 
10 987  LEU n 
10 988  ARG n 
10 989  PRO n 
10 990  PHE n 
10 991  LEU n 
10 992  LEU n 
10 993  ARG n 
10 994  ARG n 
10 995  LEU n 
10 996  LYS n 
10 997  LYS n 
10 998  ASP n 
10 999  VAL n 
10 1000 GLU n 
10 1001 LYS n 
10 1002 GLU n 
10 1003 LEU n 
10 1004 PRO n 
10 1005 ASP n 
10 1006 LYS n 
10 1007 VAL n 
10 1008 GLU n 
10 1009 LYS n 
10 1010 VAL n 
10 1011 VAL n 
10 1012 LYS n 
10 1013 CYS n 
10 1014 LYS n 
10 1015 MET n 
10 1016 SER n 
10 1017 ALA n 
10 1018 LEU n 
10 1019 GLN n 
10 1020 GLN n 
10 1021 ILE n 
10 1022 MET n 
10 1023 TYR n 
10 1024 GLN n 
10 1025 GLN n 
10 1026 MET n 
10 1027 LEU n 
10 1028 LYS n 
10 1029 TYR n 
10 1030 ARG n 
10 1031 ARG n 
10 1032 LEU n 
10 1033 PHE n 
10 1034 ILE n 
10 1035 GLY n 
10 1036 ASP n 
10 1037 GLN n 
10 1038 ASN n 
10 1039 ASN n 
10 1040 LYS n 
10 1041 LYS n 
10 1042 MET n 
10 1043 VAL n 
10 1044 GLY n 
10 1045 LEU n 
10 1046 ARG n 
10 1047 GLY n 
10 1048 PHE n 
10 1049 ASN n 
10 1050 ASN n 
10 1051 GLN n 
10 1052 ILE n 
10 1053 MET n 
10 1054 GLN n 
10 1055 LEU n 
10 1056 LYS n 
10 1057 LYS n 
10 1058 ILE n 
10 1059 CYS n 
10 1060 ASN n 
10 1061 HIS n 
10 1062 PRO n 
10 1063 PHE n 
10 1064 VAL n 
10 1065 PHE n 
10 1066 GLU n 
10 1067 GLU n 
10 1068 VAL n 
10 1069 GLU n 
10 1070 ASP n 
10 1071 GLN n 
10 1072 ILE n 
10 1073 ASN n 
10 1074 PRO n 
10 1075 THR n 
10 1076 ARG n 
10 1077 GLU n 
10 1078 THR n 
10 1079 ASN n 
10 1080 ASP n 
10 1081 ASP n 
10 1082 ILE n 
10 1083 TRP n 
10 1084 ARG n 
10 1085 VAL n 
10 1086 ALA n 
10 1087 GLY n 
10 1088 LYS n 
10 1089 PHE n 
10 1090 GLU n 
10 1091 LEU n 
10 1092 LEU n 
10 1093 ASP n 
10 1094 ARG n 
10 1095 ILE n 
10 1096 LEU n 
10 1097 PRO n 
10 1098 LYS n 
10 1099 LEU n 
10 1100 LYS n 
10 1101 ALA n 
10 1102 THR n 
10 1103 GLY n 
10 1104 HIS n 
10 1105 ARG n 
10 1106 VAL n 
10 1107 LEU n 
10 1108 ILE n 
10 1109 PHE n 
10 1110 PHE n 
10 1111 GLN n 
10 1112 MET n 
10 1113 THR n 
10 1114 GLN n 
10 1115 ILE n 
10 1116 MET n 
10 1117 ASP n 
10 1118 ILE n 
10 1119 MET n 
10 1120 GLU n 
10 1121 ASP n 
10 1122 PHE n 
10 1123 LEU n 
10 1124 ARG n 
10 1125 TYR n 
10 1126 ILE n 
10 1127 ASN n 
10 1128 ILE n 
10 1129 LYS n 
10 1130 TYR n 
10 1131 LEU n 
10 1132 ARG n 
10 1133 LEU n 
10 1134 ASP n 
10 1135 GLY n 
10 1136 HIS n 
10 1137 THR n 
10 1138 LYS n 
10 1139 SER n 
10 1140 ASP n 
10 1141 GLU n 
10 1142 ARG n 
10 1143 SER n 
10 1144 GLU n 
10 1145 LEU n 
10 1146 LEU n 
10 1147 ARG n 
10 1148 LEU n 
10 1149 PHE n 
10 1150 ASN n 
10 1151 ALA n 
10 1152 PRO n 
10 1153 ASP n 
10 1154 SER n 
10 1155 GLU n 
10 1156 TYR n 
10 1157 LEU n 
10 1158 CYS n 
10 1159 PHE n 
10 1160 ILE n 
10 1161 LEU n 
10 1162 SER n 
10 1163 THR n 
10 1164 ARG n 
10 1165 ALA n 
10 1166 GLY n 
10 1167 GLY n 
10 1168 LEU n 
10 1169 GLY n 
10 1170 LEU n 
10 1171 ASN n 
10 1172 LEU n 
10 1173 GLN n 
10 1174 THR n 
10 1175 ALA n 
10 1176 ASP n 
10 1177 THR n 
10 1178 VAL n 
10 1179 ILE n 
10 1180 ILE n 
10 1181 PHE n 
10 1182 ASP n 
10 1183 THR n 
10 1184 ASP n 
10 1185 TRP n 
10 1186 ASN n 
10 1187 PRO n 
10 1188 HIS n 
10 1189 GLN n 
10 1190 ASP n 
10 1191 LEU n 
10 1192 GLN n 
10 1193 ALA n 
10 1194 GLN n 
10 1195 ASP n 
10 1196 ARG n 
10 1197 ALA n 
10 1198 HIS n 
10 1199 ARG n 
10 1200 ILE n 
10 1201 GLY n 
10 1202 GLN n 
10 1203 LYS n 
10 1204 ASN n 
10 1205 GLU n 
10 1206 VAL n 
10 1207 ARG n 
10 1208 ILE n 
10 1209 LEU n 
10 1210 ARG n 
10 1211 LEU n 
10 1212 ILE n 
10 1213 THR n 
10 1214 THR n 
10 1215 ASN n 
10 1216 SER n 
10 1217 VAL n 
10 1218 GLU n 
10 1219 GLU n 
10 1220 VAL n 
10 1221 ILE n 
10 1222 LEU n 
10 1223 GLU n 
10 1224 ARG n 
10 1225 ALA n 
10 1226 TYR n 
10 1227 LYS n 
10 1228 LYS n 
10 1229 LEU n 
10 1230 ASP n 
10 1231 ILE n 
10 1232 ASP n 
10 1233 GLY n 
10 1234 LYS n 
10 1235 VAL n 
10 1236 ILE n 
10 1237 GLN n 
10 1238 ALA n 
10 1239 GLY n 
10 1240 LYS n 
10 1241 PHE n 
10 1242 ASP n 
10 1243 ASN n 
10 1244 LYS n 
10 1245 SER n 
10 1246 THR n 
10 1247 SER n 
10 1248 GLU n 
10 1249 GLU n 
10 1250 GLN n 
10 1251 GLU n 
10 1252 ALA n 
10 1253 LEU n 
10 1254 LEU n 
10 1255 ARG n 
10 1256 SER n 
10 1257 LEU n 
10 1258 LEU n 
10 1259 ASP n 
10 1260 ALA n 
10 1261 GLU n 
10 1262 GLU n 
10 1263 GLU n 
10 1264 ARG n 
10 1265 ARG n 
10 1266 LYS n 
10 1267 LYS n 
10 1268 ARG n 
10 1269 GLU n 
10 1270 SER n 
10 1271 GLY n 
10 1272 VAL n 
10 1273 GLU n 
10 1274 GLU n 
10 1275 GLU n 
10 1276 GLU n 
10 1277 GLU n 
10 1278 LEU n 
10 1279 LYS n 
10 1280 ASP n 
10 1281 SER n 
10 1282 GLU n 
10 1283 ILE n 
10 1284 ASN n 
10 1285 GLU n 
10 1286 ILE n 
10 1287 LEU n 
10 1288 ALA n 
10 1289 ARG n 
10 1290 ASN n 
10 1291 ASP n 
10 1292 GLU n 
10 1293 GLU n 
10 1294 MET n 
10 1295 ALA n 
10 1296 VAL n 
10 1297 LEU n 
10 1298 THR n 
10 1299 ARG n 
10 1300 MET n 
10 1301 ASP n 
10 1302 GLU n 
10 1303 ASP n 
10 1304 ARG n 
10 1305 SER n 
10 1306 LYS n 
10 1307 LYS n 
10 1308 GLU n 
10 1309 GLU n 
10 1310 GLU n 
10 1311 LEU n 
10 1312 GLY n 
10 1313 VAL n 
10 1314 LYS n 
10 1315 SER n 
10 1316 ARG n 
10 1317 LEU n 
10 1318 LEU n 
10 1319 GLU n 
10 1320 LYS n 
10 1321 SER n 
10 1322 GLU n 
10 1323 LEU n 
10 1324 PRO n 
10 1325 ASP n 
10 1326 ILE n 
10 1327 TYR n 
10 1328 SER n 
10 1329 ARG n 
10 1330 ASP n 
10 1331 ILE n 
10 1332 GLY n 
10 1333 ALA n 
10 1334 GLU n 
10 1335 LEU n 
10 1336 LYS n 
10 1337 ARG n 
10 1338 GLU n 
10 1339 GLU n 
10 1340 SER n 
10 1341 GLU n 
10 1342 SER n 
10 1343 ALA n 
10 1344 ALA n 
10 1345 VAL n 
10 1346 TYR n 
10 1347 ASN n 
10 1348 GLY n 
10 1349 ARG n 
10 1350 GLY n 
10 1351 ALA n 
10 1352 ARG n 
10 1353 GLU n 
10 1354 ARG n 
10 1355 LYS n 
10 1356 THR n 
10 1357 ALA n 
10 1358 THR n 
10 1359 TYR n 
10 1360 ASN n 
10 1361 ASP n 
10 1362 ASN n 
10 1363 MET n 
10 1364 SER n 
10 1365 GLU n 
10 1366 GLU n 
10 1367 GLN n 
10 1368 TRP n 
10 1369 LEU n 
10 1370 ARG n 
10 1371 GLN n 
10 1372 PHE n 
10 1373 GLU n 
10 1374 VAL n 
10 1375 SER n 
10 1376 ASP n 
10 1377 ASP n 
10 1378 GLU n 
10 1379 LYS n 
10 1380 ASN n 
10 1381 ASP n 
10 1382 LYS n 
10 1383 GLN n 
10 1384 ALA n 
10 1385 ARG n 
10 1386 LYS n 
10 1387 GLN n 
10 1388 ARG n 
10 1389 THR n 
10 1390 LYS n 
10 1391 LYS n 
10 1392 GLU n 
10 1393 ASP n 
10 1394 LYS n 
10 1395 SER n 
10 1396 GLU n 
10 1397 ALA n 
10 1398 ILE n 
10 1399 ASP n 
10 1400 GLY n 
10 1401 ASN n 
10 1402 GLY n 
10 1403 GLU n 
10 1404 ILE n 
10 1405 LYS n 
10 1406 GLY n 
10 1407 GLU n 
10 1408 ASN n 
10 1409 ILE n 
10 1410 ASP n 
10 1411 ALA n 
10 1412 ASP n 
10 1413 ASN n 
10 1414 ASP n 
10 1415 GLY n 
10 1416 PRO n 
10 1417 ARG n 
10 1418 ILE n 
10 1419 ASN n 
10 1420 ASN n 
10 1421 ILE n 
10 1422 SER n 
10 1423 ALA n 
10 1424 GLU n 
10 1425 ASP n 
10 1426 ARG n 
10 1427 ALA n 
10 1428 ASP n 
10 1429 THR n 
10 1430 ASP n 
10 1431 LEU n 
10 1432 ALA n 
10 1433 MET n 
10 1434 ASN n 
10 1435 ASP n 
10 1436 ASP n 
10 1437 ASP n 
10 1438 PHE n 
10 1439 LEU n 
10 1440 SER n 
10 1441 LYS n 
10 1442 LYS n 
10 1443 ARG n 
10 1444 LYS n 
10 1445 ALA n 
10 1446 GLY n 
10 1447 ARG n 
10 1448 PRO n 
10 1449 ARG n 
10 1450 GLY n 
10 1451 ARG n 
10 1452 PRO n 
10 1453 LYS n 
10 1454 LYS n 
10 1455 VAL n 
10 1456 LYS n 
10 1457 LEU n 
10 1458 GLU n 
10 1459 GLY n 
10 1460 SER n 
10 1461 GLU n 
10 1462 ASN n 
10 1463 SER n 
10 1464 GLU n 
10 1465 PRO n 
10 1466 PRO n 
10 1467 ALA n 
10 1468 LEU n 
10 1469 GLU n 
10 1470 SER n 
10 1471 SER n 
10 1472 PRO n 
10 1473 VAL n 
10 1474 THR n 
10 1475 GLY n 
10 1476 ASP n 
10 1477 ASN n 
10 1478 SER n 
10 1479 PRO n 
10 1480 SER n 
10 1481 GLU n 
10 1482 ASP n 
10 1483 PHE n 
10 1484 MET n 
10 1485 ASP n 
10 1486 ILE n 
10 1487 PRO n 
10 1488 LYS n 
10 1489 PRO n 
10 1490 ARG n 
10 1491 THR n 
10 1492 ALA n 
10 1493 GLY n 
10 1494 LYS n 
10 1495 THR n 
10 1496 SER n 
10 1497 VAL n 
10 1498 LYS n 
10 1499 SER n 
10 1500 ALA n 
10 1501 ARG n 
10 1502 THR n 
10 1503 SER n 
10 1504 THR n 
10 1505 ARG n 
10 1506 GLY n 
10 1507 ARG n 
10 1508 GLY n 
10 1509 ARG n 
10 1510 GLY n 
10 1511 ARG n 
10 1512 GLY n 
10 1513 ARG n 
10 1514 GLY n 
10 1515 ARG n 
10 1516 GLY n 
10 1517 ARG n 
10 1518 GLY n 
10 1519 ARG n 
10 1520 GLY n 
10 1521 ARG n 
10 1522 GLY n 
10 1523 ARG n 
10 1524 PRO n 
10 1525 PRO n 
10 1526 LYS n 
10 1527 ALA n 
10 1528 ARG n 
10 1529 ASN n 
10 1530 GLY n 
10 1531 LEU n 
10 1532 ASP n 
10 1533 TYR n 
10 1534 VAL n 
10 1535 ARG n 
10 1536 THR n 
10 1537 PRO n 
10 1538 ALA n 
10 1539 ALA n 
10 1540 ALA n 
10 1541 THR n 
10 1542 SER n 
10 1543 PRO n 
10 1544 ILE n 
10 1545 ASP n 
10 1546 ILE n 
10 1547 ARG n 
10 1548 GLU n 
10 1549 LYS n 
10 1550 VAL n 
10 1551 ALA n 
10 1552 LYS n 
10 1553 GLN n 
10 1554 ALA n 
10 1555 LEU n 
10 1556 ASP n 
10 1557 LEU n 
10 1558 TYR n 
10 1559 HIS n 
10 1560 PHE n 
10 1561 ALA n 
10 1562 LEU n 
10 1563 ASN n 
10 1564 TYR n 
10 1565 GLU n 
10 1566 ASN n 
10 1567 GLU n 
10 1568 ALA n 
10 1569 GLY n 
10 1570 ARG n 
10 1571 LYS n 
10 1572 LEU n 
10 1573 SER n 
10 1574 ASP n 
10 1575 ILE n 
10 1576 PHE n 
10 1577 LEU n 
10 1578 SER n 
10 1579 LYS n 
10 1580 PRO n 
10 1581 SER n 
10 1582 LYS n 
10 1583 ALA n 
10 1584 LEU n 
10 1585 TYR n 
10 1586 PRO n 
10 1587 ASP n 
10 1588 TYR n 
10 1589 TYR n 
10 1590 MET n 
10 1591 ILE n 
10 1592 ILE n 
10 1593 LYS n 
10 1594 TYR n 
10 1595 PRO n 
10 1596 VAL n 
10 1597 ALA n 
10 1598 PHE n 
10 1599 ASP n 
10 1600 ASN n 
10 1601 ILE n 
10 1602 ASN n 
10 1603 THR n 
10 1604 HIS n 
10 1605 ILE n 
10 1606 GLU n 
10 1607 THR n 
10 1608 LEU n 
10 1609 ALA n 
10 1610 TYR n 
10 1611 ASN n 
10 1612 SER n 
10 1613 LEU n 
10 1614 LYS n 
10 1615 GLU n 
10 1616 THR n 
10 1617 LEU n 
10 1618 GLN n 
10 1619 ASP n 
10 1620 PHE n 
10 1621 HIS n 
10 1622 LEU n 
10 1623 ILE n 
10 1624 PHE n 
10 1625 SER n 
10 1626 ASN n 
10 1627 ALA n 
10 1628 ARG n 
10 1629 ILE n 
10 1630 TYR n 
10 1631 ASN n 
10 1632 THR n 
10 1633 GLU n 
10 1634 GLY n 
10 1635 SER n 
10 1636 VAL n 
10 1637 VAL n 
10 1638 TYR n 
10 1639 GLU n 
10 1640 ASP n 
10 1641 SER n 
10 1642 LEU n 
10 1643 GLU n 
10 1644 LEU n 
10 1645 GLU n 
10 1646 LYS n 
10 1647 VAL n 
10 1648 VAL n 
10 1649 THR n 
10 1650 LYS n 
10 1651 LYS n 
10 1652 TYR n 
10 1653 CYS n 
10 1654 GLU n 
10 1655 ILE n 
10 1656 MET n 
10 1657 GLY n 
10 1658 ASP n 
10 1659 ASN n 
10 1660 SER n 
10 1661 GLN n 
10 1662 LEU n 
10 1663 ASP n 
10 1664 PHE n 
10 1665 THR n 
10 1666 GLU n 
10 1667 PHE n 
10 1668 ASP n 
10 1669 GLU n 
10 1670 GLN n 
10 1671 TYR n 
10 1672 GLY n 
10 1673 THR n 
10 1674 ARG n 
10 1675 PRO n 
10 1676 LEU n 
10 1677 VAL n 
10 1678 LEU n 
10 1679 PRO n 
10 1680 PRO n 
10 1681 VAL n 
10 1682 VAL n 
10 1683 THR n 
10 1684 SER n 
10 1685 SER n 
10 1686 VAL n 
10 1687 ALA n 
10 1688 GLU n 
10 1689 SER n 
10 1690 PHE n 
10 1691 THR n 
10 1692 ASP n 
10 1693 GLU n 
10 1694 ALA n 
10 1695 ASP n 
10 1696 SER n 
10 1697 SER n 
10 1698 MET n 
10 1699 THR n 
10 1700 GLU n 
10 1701 ALA n 
10 1702 SER n 
10 1703 VAL n 
11 1    MET n 
11 2    ASP n 
11 3    PHE n 
11 4    PHE n 
11 5    ASN n 
11 6    LEU n 
11 7    ASN n 
11 8    ASN n 
11 9    ASN n 
11 10   ASN n 
11 11   ASN n 
11 12   ASN n 
11 13   ASN n 
11 14   ASN n 
11 15   THR n 
11 16   THR n 
11 17   THR n 
11 18   THR n 
11 19   THR n 
11 20   THR n 
11 21   THR n 
11 22   THR n 
11 23   ASN n 
11 24   ASN n 
11 25   ASN n 
11 26   ASN n 
11 27   THR n 
11 28   ASN n 
11 29   ASN n 
11 30   ASN n 
11 31   ASN n 
11 32   THR n 
11 33   ASN n 
11 34   ASN n 
11 35   ASN n 
11 36   ASN n 
11 37   ASN n 
11 38   PRO n 
11 39   ALA n 
11 40   ASN n 
11 41   ASN n 
11 42   THR n 
11 43   ASN n 
11 44   ASN n 
11 45   ASN n 
11 46   ASN n 
11 47   SER n 
11 48   THR n 
11 49   GLY n 
11 50   HIS n 
11 51   SER n 
11 52   SER n 
11 53   ASN n 
11 54   THR n 
11 55   ASN n 
11 56   ASN n 
11 57   ASN n 
11 58   THR n 
11 59   ASN n 
11 60   ASN n 
11 61   ASN n 
11 62   ASN n 
11 63   THR n 
11 64   ASN n 
11 65   THR n 
11 66   GLY n 
11 67   ALA n 
11 68   SER n 
11 69   GLY n 
11 70   VAL n 
11 71   ASP n 
11 72   ASP n 
11 73   PHE n 
11 74   GLN n 
11 75   ASN n 
11 76   PHE n 
11 77   PHE n 
11 78   ASP n 
11 79   PRO n 
11 80   LYS n 
11 81   PRO n 
11 82   PHE n 
11 83   ASP n 
11 84   GLN n 
11 85   ASN n 
11 86   LEU n 
11 87   ASP n 
11 88   SER n 
11 89   ASN n 
11 90   ASN n 
11 91   ASN n 
11 92   ASN n 
11 93   SER n 
11 94   ASN n 
11 95   SER n 
11 96   ASN n 
11 97   ASN n 
11 98   ASN n 
11 99   ASP n 
11 100  ASN n 
11 101  ASN n 
11 102  ASN n 
11 103  SER n 
11 104  ASN n 
11 105  THR n 
11 106  VAL n 
11 107  ALA n 
11 108  SER n 
11 109  SER n 
11 110  THR n 
11 111  ASN n 
11 112  PHE n 
11 113  THR n 
11 114  SER n 
11 115  PRO n 
11 116  THR n 
11 117  ALA n 
11 118  VAL n 
11 119  VAL n 
11 120  ASN n 
11 121  ASN n 
11 122  ALA n 
11 123  ALA n 
11 124  PRO n 
11 125  ALA n 
11 126  ASN n 
11 127  VAL n 
11 128  THR n 
11 129  GLY n 
11 130  GLY n 
11 131  LYS n 
11 132  ALA n 
11 133  ALA n 
11 134  ASN n 
11 135  PHE n 
11 136  ILE n 
11 137  GLN n 
11 138  ASN n 
11 139  GLN n 
11 140  SER n 
11 141  PRO n 
11 142  GLN n 
11 143  PHE n 
11 144  ASN n 
11 145  SER n 
11 146  PRO n 
11 147  TYR n 
11 148  ASP n 
11 149  SER n 
11 150  ASN n 
11 151  ASN n 
11 152  SER n 
11 153  ASN n 
11 154  THR n 
11 155  ASN n 
11 156  LEU n 
11 157  ASN n 
11 158  SER n 
11 159  LEU n 
11 160  SER n 
11 161  PRO n 
11 162  GLN n 
11 163  ALA n 
11 164  ILE n 
11 165  LEU n 
11 166  ALA n 
11 167  LYS n 
11 168  ASN n 
11 169  SER n 
11 170  ILE n 
11 171  ILE n 
11 172  ASP n 
11 173  SER n 
11 174  SER n 
11 175  ASN n 
11 176  LEU n 
11 177  PRO n 
11 178  LEU n 
11 179  GLN n 
11 180  ALA n 
11 181  GLN n 
11 182  GLN n 
11 183  GLN n 
11 184  LEU n 
11 185  TYR n 
11 186  GLY n 
11 187  GLY n 
11 188  ASN n 
11 189  ASN n 
11 190  ASN n 
11 191  ASN n 
11 192  ASN n 
11 193  SER n 
11 194  THR n 
11 195  GLY n 
11 196  ILE n 
11 197  ALA n 
11 198  ASN n 
11 199  ASP n 
11 200  ASN n 
11 201  VAL n 
11 202  ILE n 
11 203  THR n 
11 204  PRO n 
11 205  HIS n 
11 206  PHE n 
11 207  ILE n 
11 208  THR n 
11 209  ASN n 
11 210  VAL n 
11 211  GLN n 
11 212  SER n 
11 213  ILE n 
11 214  SER n 
11 215  GLN n 
11 216  ASN n 
11 217  SER n 
11 218  SER n 
11 219  SER n 
11 220  SER n 
11 221  THR n 
11 222  PRO n 
11 223  ASN n 
11 224  THR n 
11 225  ASN n 
11 226  SER n 
11 227  ASN n 
11 228  SER n 
11 229  THR n 
11 230  PRO n 
11 231  ASN n 
11 232  ALA n 
11 233  ASN n 
11 234  GLN n 
11 235  GLN n 
11 236  PHE n 
11 237  LEU n 
11 238  PRO n 
11 239  PHE n 
11 240  ASN n 
11 241  ASN n 
11 242  SER n 
11 243  ALA n 
11 244  SER n 
11 245  ASN n 
11 246  ASN n 
11 247  GLY n 
11 248  ASN n 
11 249  LEU n 
11 250  THR n 
11 251  SER n 
11 252  ASN n 
11 253  GLN n 
11 254  LEU n 
11 255  ILE n 
11 256  SER n 
11 257  ASN n 
11 258  TYR n 
11 259  ALA n 
11 260  ALA n 
11 261  SER n 
11 262  ASN n 
11 263  SER n 
11 264  MET n 
11 265  ASP n 
11 266  ARG n 
11 267  SER n 
11 268  SER n 
11 269  SER n 
11 270  ALA n 
11 271  SER n 
11 272  ASN n 
11 273  GLU n 
11 274  PHE n 
11 275  VAL n 
11 276  PRO n 
11 277  ASN n 
11 278  THR n 
11 279  SER n 
11 280  ASP n 
11 281  ASN n 
11 282  ASN n 
11 283  ASN n 
11 284  ASN n 
11 285  SER n 
11 286  ASN n 
11 287  ASN n 
11 288  HIS n 
11 289  ASN n 
11 290  MET n 
11 291  ARG n 
11 292  ASN n 
11 293  ASN n 
11 294  SER n 
11 295  ASN n 
11 296  ASN n 
11 297  LYS n 
11 298  THR n 
11 299  SER n 
11 300  ASN n 
11 301  ASN n 
11 302  ASN n 
11 303  ASN n 
11 304  VAL n 
11 305  THR n 
11 306  ALA n 
11 307  VAL n 
11 308  PRO n 
11 309  ALA n 
11 310  ALA n 
11 311  THR n 
11 312  PRO n 
11 313  ALA n 
11 314  ASN n 
11 315  THR n 
11 316  ASN n 
11 317  ASN n 
11 318  SER n 
11 319  THR n 
11 320  SER n 
11 321  ASN n 
11 322  ALA n 
11 323  ASN n 
11 324  THR n 
11 325  VAL n 
11 326  PHE n 
11 327  SER n 
11 328  GLU n 
11 329  ARG n 
11 330  ALA n 
11 331  ALA n 
11 332  MET n 
11 333  PHE n 
11 334  ALA n 
11 335  ALA n 
11 336  LEU n 
11 337  GLN n 
11 338  GLN n 
11 339  LYS n 
11 340  GLN n 
11 341  GLN n 
11 342  GLN n 
11 343  ARG n 
11 344  PHE n 
11 345  GLN n 
11 346  ALA n 
11 347  LEU n 
11 348  GLN n 
11 349  GLN n 
11 350  GLN n 
11 351  GLN n 
11 352  GLN n 
11 353  GLN n 
11 354  GLN n 
11 355  GLN n 
11 356  ASN n 
11 357  GLN n 
11 358  GLN n 
11 359  GLN n 
11 360  GLN n 
11 361  ASN n 
11 362  GLN n 
11 363  GLN n 
11 364  PRO n 
11 365  GLN n 
11 366  GLN n 
11 367  GLN n 
11 368  GLN n 
11 369  GLN n 
11 370  GLN n 
11 371  GLN n 
11 372  GLN n 
11 373  ASN n 
11 374  PRO n 
11 375  LYS n 
11 376  PHE n 
11 377  LEU n 
11 378  GLN n 
11 379  SER n 
11 380  GLN n 
11 381  ARG n 
11 382  GLN n 
11 383  GLN n 
11 384  GLN n 
11 385  GLN n 
11 386  ARG n 
11 387  SER n 
11 388  ILE n 
11 389  LEU n 
11 390  GLN n 
11 391  SER n 
11 392  LEU n 
11 393  ASN n 
11 394  PRO n 
11 395  ALA n 
11 396  LEU n 
11 397  GLN n 
11 398  GLU n 
11 399  LYS n 
11 400  ILE n 
11 401  SER n 
11 402  THR n 
11 403  GLU n 
11 404  LEU n 
11 405  ASN n 
11 406  ASN n 
11 407  LYS n 
11 408  GLN n 
11 409  TYR n 
11 410  GLU n 
11 411  LEU n 
11 412  PHE n 
11 413  MET n 
11 414  LYS n 
11 415  SER n 
11 416  LEU n 
11 417  ILE n 
11 418  GLU n 
11 419  ASN n 
11 420  CYS n 
11 421  LYS n 
11 422  LYS n 
11 423  ARG n 
11 424  ASN n 
11 425  MET n 
11 426  PRO n 
11 427  LEU n 
11 428  GLN n 
11 429  SER n 
11 430  ILE n 
11 431  PRO n 
11 432  GLU n 
11 433  ILE n 
11 434  GLY n 
11 435  ASN n 
11 436  ARG n 
11 437  LYS n 
11 438  ILE n 
11 439  ASN n 
11 440  LEU n 
11 441  PHE n 
11 442  TYR n 
11 443  LEU n 
11 444  TYR n 
11 445  MET n 
11 446  LEU n 
11 447  VAL n 
11 448  GLN n 
11 449  LYS n 
11 450  PHE n 
11 451  GLY n 
11 452  GLY n 
11 453  ALA n 
11 454  ASP n 
11 455  GLN n 
11 456  VAL n 
11 457  THR n 
11 458  ARG n 
11 459  THR n 
11 460  GLN n 
11 461  GLN n 
11 462  TRP n 
11 463  SER n 
11 464  MET n 
11 465  VAL n 
11 466  ALA n 
11 467  GLN n 
11 468  ARG n 
11 469  LEU n 
11 470  GLN n 
11 471  ILE n 
11 472  SER n 
11 473  ASP n 
11 474  TYR n 
11 475  GLN n 
11 476  GLN n 
11 477  LEU n 
11 478  GLU n 
11 479  SER n 
11 480  ILE n 
11 481  TYR n 
11 482  PHE n 
11 483  ARG n 
11 484  ILE n 
11 485  LEU n 
11 486  LEU n 
11 487  PRO n 
11 488  TYR n 
11 489  GLU n 
11 490  ARG n 
11 491  HIS n 
11 492  MET n 
11 493  ILE n 
11 494  SER n 
11 495  GLN n 
11 496  GLU n 
11 497  GLY n 
11 498  ILE n 
11 499  LYS n 
11 500  GLU n 
11 501  THR n 
11 502  GLN n 
11 503  ALA n 
11 504  LYS n 
11 505  ARG n 
11 506  ILE n 
11 507  PHE n 
11 508  LEU n 
11 509  GLN n 
11 510  GLN n 
11 511  PHE n 
11 512  LEU n 
11 513  GLN n 
11 514  GLU n 
11 515  LEU n 
11 516  LEU n 
11 517  LYS n 
11 518  LYS n 
11 519  VAL n 
11 520  GLN n 
11 521  GLN n 
11 522  GLN n 
11 523  GLN n 
11 524  GLN n 
11 525  ALA n 
11 526  ALA n 
11 527  ALA n 
11 528  LEU n 
11 529  ALA n 
11 530  ASN n 
11 531  ALA n 
11 532  ASN n 
11 533  ASN n 
11 534  ASN n 
11 535  ILE n 
11 536  ASN n 
11 537  SER n 
11 538  ALA n 
11 539  SER n 
11 540  SER n 
11 541  ALA n 
11 542  PRO n 
11 543  THR n 
11 544  PRO n 
11 545  ALA n 
11 546  ALA n 
11 547  PRO n 
11 548  GLY n 
11 549  ALA n 
11 550  SER n 
11 551  VAL n 
11 552  PRO n 
11 553  ALA n 
11 554  THR n 
11 555  ALA n 
11 556  ALA n 
11 557  PRO n 
11 558  GLY n 
11 559  THR n 
11 560  GLU n 
11 561  ALA n 
11 562  GLY n 
11 563  ILE n 
11 564  VAL n 
11 565  PRO n 
11 566  VAL n 
11 567  SER n 
11 568  ALA n 
11 569  ASN n 
11 570  THR n 
11 571  PRO n 
11 572  LYS n 
11 573  SER n 
11 574  LEU n 
11 575  ASN n 
11 576  SER n 
11 577  ASN n 
11 578  ILE n 
11 579  ASN n 
11 580  ILE n 
11 581  ASN n 
11 582  VAL n 
11 583  ASN n 
11 584  ASN n 
11 585  ASN n 
11 586  ASN n 
11 587  ILE n 
11 588  GLY n 
11 589  GLN n 
11 590  GLN n 
11 591  GLN n 
11 592  VAL n 
11 593  LYS n 
11 594  LYS n 
11 595  PRO n 
11 596  ARG n 
11 597  LYS n 
11 598  GLN n 
11 599  ARG n 
11 600  VAL n 
11 601  LYS n 
11 602  LYS n 
11 603  LYS n 
11 604  THR n 
11 605  LYS n 
11 606  LYS n 
11 607  GLU n 
11 608  LEU n 
11 609  GLU n 
11 610  LEU n 
11 611  GLU n 
11 612  ARG n 
11 613  LYS n 
11 614  GLU n 
11 615  ARG n 
11 616  GLU n 
11 617  ASP n 
11 618  PHE n 
11 619  GLN n 
11 620  LYS n 
11 621  ARG n 
11 622  GLN n 
11 623  GLN n 
11 624  LYS n 
11 625  LEU n 
11 626  LEU n 
11 627  GLU n 
11 628  ASP n 
11 629  GLN n 
11 630  GLN n 
11 631  ARG n 
11 632  GLN n 
11 633  GLN n 
11 634  LYS n 
11 635  LEU n 
11 636  LEU n 
11 637  LEU n 
11 638  GLU n 
11 639  THR n 
11 640  LYS n 
11 641  LEU n 
11 642  ARG n 
11 643  GLN n 
11 644  GLN n 
11 645  TYR n 
11 646  GLU n 
11 647  ILE n 
11 648  GLU n 
11 649  LEU n 
11 650  LYS n 
11 651  LYS n 
11 652  LEU n 
11 653  PRO n 
11 654  LYS n 
11 655  VAL n 
11 656  TYR n 
11 657  LYS n 
11 658  ARG n 
11 659  SER n 
11 660  ILE n 
11 661  VAL n 
11 662  ARG n 
11 663  ASN n 
11 664  TYR n 
11 665  LYS n 
11 666  PRO n 
11 667  LEU n 
11 668  ILE n 
11 669  ASN n 
11 670  ARG n 
11 671  LEU n 
11 672  LYS n 
11 673  HIS n 
11 674  TYR n 
11 675  ASN n 
11 676  GLY n 
11 677  TYR n 
11 678  ASP n 
11 679  ILE n 
11 680  ASN n 
11 681  TYR n 
11 682  ILE n 
11 683  SER n 
11 684  LYS n 
11 685  ILE n 
11 686  GLY n 
11 687  GLU n 
11 688  LYS n 
11 689  ILE n 
11 690  ASP n 
11 691  SER n 
11 692  ASN n 
11 693  LYS n 
11 694  PRO n 
11 695  ILE n 
11 696  PHE n 
11 697  LEU n 
11 698  PHE n 
11 699  ALA n 
11 700  PRO n 
11 701  GLU n 
11 702  LEU n 
11 703  GLY n 
11 704  ALA n 
11 705  ILE n 
11 706  ASN n 
11 707  LEU n 
11 708  HIS n 
11 709  ALA n 
11 710  LEU n 
11 711  SER n 
11 712  MET n 
11 713  SER n 
11 714  LEU n 
11 715  GLN n 
11 716  SER n 
11 717  LYS n 
11 718  ASN n 
11 719  LEU n 
11 720  GLY n 
11 721  GLU n 
11 722  ILE n 
11 723  ASN n 
11 724  THR n 
11 725  ALA n 
11 726  LEU n 
11 727  ASN n 
11 728  THR n 
11 729  LEU n 
11 730  LEU n 
11 731  VAL n 
11 732  THR n 
11 733  SER n 
11 734  ALA n 
11 735  ASP n 
11 736  SER n 
11 737  ASN n 
11 738  LEU n 
11 739  LYS n 
11 740  ILE n 
11 741  SER n 
11 742  LEU n 
11 743  VAL n 
11 744  LYS n 
11 745  TYR n 
11 746  PRO n 
11 747  GLU n 
11 748  LEU n 
11 749  LEU n 
11 750  ASP n 
11 751  SER n 
11 752  LEU n 
11 753  ALA n 
11 754  ILE n 
11 755  LEU n 
11 756  GLY n 
11 757  MET n 
11 758  ASN n 
11 759  LEU n 
11 760  LEU n 
11 761  SER n 
11 762  ASN n 
11 763  LEU n 
11 764  SER n 
11 765  GLN n 
11 766  ASN n 
11 767  VAL n 
11 768  VAL n 
11 769  PRO n 
11 770  TYR n 
11 771  HIS n 
11 772  ARG n 
11 773  ASN n 
11 774  THR n 
11 775  SER n 
11 776  ASP n 
11 777  TYR n 
11 778  TYR n 
11 779  TYR n 
11 780  GLU n 
11 781  ASP n 
11 782  ALA n 
11 783  GLY n 
11 784  SER n 
11 785  ASN n 
11 786  GLN n 
11 787  TYR n 
11 788  TYR n 
11 789  VAL n 
11 790  THR n 
11 791  GLN n 
11 792  HIS n 
11 793  ASP n 
11 794  LYS n 
11 795  MET n 
11 796  VAL n 
11 797  ASP n 
11 798  LYS n 
11 799  ILE n 
11 800  PHE n 
11 801  GLU n 
11 802  LYS n 
11 803  VAL n 
11 804  ASN n 
11 805  ASN n 
11 806  ASN n 
11 807  ALA n 
11 808  THR n 
11 809  LEU n 
11 810  THR n 
11 811  PRO n 
11 812  ASN n 
11 813  ASP n 
11 814  SER n 
11 815  ASN n 
11 816  ASP n 
11 817  GLU n 
11 818  LYS n 
11 819  VAL n 
11 820  THR n 
11 821  ILE n 
11 822  LEU n 
11 823  VAL n 
11 824  ASP n 
11 825  SER n 
11 826  LEU n 
11 827  THR n 
11 828  GLY n 
11 829  ASN n 
11 830  GLN n 
11 831  LEU n 
11 832  PRO n 
11 833  THR n 
11 834  PRO n 
11 835  THR n 
11 836  PRO n 
11 837  THR n 
11 838  GLU n 
11 839  MET n 
11 840  GLU n 
11 841  PRO n 
11 842  ASP n 
11 843  LEU n 
11 844  ASP n 
11 845  THR n 
11 846  GLU n 
11 847  CYS n 
11 848  PHE n 
11 849  ILE n 
11 850  SER n 
11 851  MET n 
11 852  GLN n 
11 853  SER n 
11 854  THR n 
11 855  SER n 
11 856  PRO n 
11 857  ALA n 
11 858  VAL n 
11 859  LYS n 
11 860  GLN n 
11 861  TRP n 
11 862  ASP n 
11 863  LEU n 
11 864  LEU n 
11 865  PRO n 
11 866  GLU n 
11 867  PRO n 
11 868  ILE n 
11 869  ARG n 
11 870  PHE n 
11 871  LEU n 
11 872  PRO n 
11 873  ASN n 
11 874  GLN n 
11 875  PHE n 
11 876  PRO n 
11 877  LEU n 
11 878  LYS n 
11 879  ILE n 
11 880  HIS n 
11 881  ARG n 
11 882  THR n 
11 883  PRO n 
11 884  TYR n 
11 885  LEU n 
11 886  THR n 
11 887  SER n 
11 888  LEU n 
11 889  LYS n 
11 890  LYS n 
11 891  ILE n 
11 892  LYS n 
11 893  ASP n 
11 894  GLU n 
11 895  ILE n 
11 896  ASP n 
11 897  ASP n 
11 898  PRO n 
11 899  PHE n 
11 900  THR n 
11 901  LYS n 
11 902  ILE n 
11 903  ASN n 
11 904  THR n 
11 905  ARG n 
11 906  GLY n 
11 907  ALA n 
11 908  GLU n 
11 909  ASP n 
11 910  PRO n 
11 911  LYS n 
11 912  VAL n 
11 913  LEU n 
11 914  ILE n 
11 915  ASN n 
11 916  ASP n 
11 917  GLN n 
11 918  LEU n 
11 919  SER n 
11 920  THR n 
11 921  ILE n 
11 922  SER n 
11 923  MET n 
11 924  ILE n 
11 925  LEU n 
11 926  ARG n 
11 927  ASN n 
11 928  ILE n 
11 929  SER n 
11 930  PHE n 
11 931  SER n 
11 932  ASP n 
11 933  ASN n 
11 934  ASN n 
11 935  SER n 
11 936  ARG n 
11 937  ILE n 
11 938  MET n 
11 939  SER n 
11 940  ARG n 
11 941  ASN n 
11 942  PHE n 
11 943  TYR n 
11 944  LEU n 
11 945  LYS n 
11 946  ARG n 
11 947  PHE n 
11 948  ILE n 
11 949  SER n 
11 950  ASP n 
11 951  LEU n 
11 952  LEU n 
11 953  TRP n 
11 954  LEU n 
11 955  VAL n 
11 956  LEU n 
11 957  ILE n 
11 958  HIS n 
11 959  PRO n 
11 960  GLU n 
11 961  ASN n 
11 962  PHE n 
11 963  THR n 
11 964  CYS n 
11 965  ASN n 
11 966  ARG n 
11 967  LYS n 
11 968  ILE n 
11 969  LEU n 
11 970  ASN n 
11 971  PHE n 
11 972  LYS n 
11 973  LYS n 
11 974  ASP n 
11 975  LEU n 
11 976  VAL n 
11 977  ILE n 
11 978  VAL n 
11 979  LEU n 
11 980  SER n 
11 981  ASN n 
11 982  ILE n 
11 983  SER n 
11 984  HIS n 
11 985  LEU n 
11 986  LEU n 
11 987  GLU n 
11 988  ILE n 
11 989  ALA n 
11 990  SER n 
11 991  SER n 
11 992  ILE n 
11 993  ASP n 
11 994  CYS n 
11 995  LEU n 
11 996  LEU n 
11 997  ILE n 
11 998  LEU n 
11 999  ILE n 
11 1000 LEU n 
11 1001 VAL n 
11 1002 ILE n 
11 1003 SER n 
11 1004 PHE n 
11 1005 GLY n 
11 1006 GLN n 
11 1007 PRO n 
11 1008 LYS n 
11 1009 LEU n 
11 1010 ASN n 
11 1011 PRO n 
11 1012 MET n 
11 1013 ALA n 
11 1014 SER n 
11 1015 SER n 
11 1016 SER n 
11 1017 SER n 
11 1018 PHE n 
11 1019 GLY n 
11 1020 SER n 
11 1021 GLU n 
11 1022 SER n 
11 1023 LEU n 
11 1024 THR n 
11 1025 PHE n 
11 1026 ASN n 
11 1027 GLU n 
11 1028 PHE n 
11 1029 GLN n 
11 1030 LEU n 
11 1031 GLN n 
11 1032 TRP n 
11 1033 GLY n 
11 1034 LYS n 
11 1035 TYR n 
11 1036 GLN n 
11 1037 THR n 
11 1038 PHE n 
11 1039 GLY n 
11 1040 VAL n 
11 1041 ASP n 
11 1042 ILE n 
11 1043 LEU n 
11 1044 ALA n 
11 1045 LYS n 
11 1046 LEU n 
11 1047 PHE n 
11 1048 SER n 
11 1049 LEU n 
11 1050 GLU n 
11 1051 LYS n 
11 1052 PRO n 
11 1053 ASN n 
11 1054 LEU n 
11 1055 ASN n 
11 1056 TYR n 
11 1057 PHE n 
11 1058 LYS n 
11 1059 SER n 
11 1060 ILE n 
11 1061 LEU n 
11 1062 LEU n 
11 1063 ASN n 
11 1064 LYS n 
11 1065 ASN n 
11 1066 THR n 
11 1067 GLY n 
11 1068 ASN n 
11 1069 ASN n 
11 1070 LEU n 
11 1071 TYR n 
11 1072 ASP n 
11 1073 ARG n 
11 1074 ASN n 
11 1075 SER n 
11 1076 ASN n 
11 1077 ASN n 
11 1078 ASN n 
11 1079 HIS n 
11 1080 LYS n 
11 1081 ASP n 
11 1082 LYS n 
11 1083 LYS n 
11 1084 LEU n 
11 1085 LEU n 
11 1086 ARG n 
11 1087 ARG n 
11 1088 LEU n 
11 1089 LEU n 
11 1090 ASN n 
11 1091 LEU n 
11 1092 TYR n 
11 1093 ASN n 
11 1094 ASP n 
11 1095 ASN n 
11 1096 ASN n 
11 1097 LYS n 
11 1098 ASN n 
11 1099 ASN n 
11 1100 ASN n 
11 1101 ASN n 
11 1102 ARG n 
11 1103 HIS n 
11 1104 ASN n 
11 1105 LEU n 
11 1106 LEU n 
11 1107 ASN n 
11 1108 ASP n 
11 1109 VAL n 
11 1110 VAL n 
11 1111 SER n 
11 1112 PHE n 
11 1113 LEU n 
11 1114 PHE n 
11 1115 SER n 
11 1116 ALA n 
11 1117 ILE n 
11 1118 PRO n 
11 1119 LEU n 
11 1120 GLN n 
11 1121 GLN n 
11 1122 VAL n 
11 1123 LEU n 
11 1124 SER n 
11 1125 GLN n 
11 1126 SER n 
11 1127 ALA n 
11 1128 ASP n 
11 1129 PRO n 
11 1130 SER n 
11 1131 LEU n 
11 1132 LEU n 
11 1133 ILE n 
11 1134 ASP n 
11 1135 GLN n 
11 1136 PHE n 
11 1137 SER n 
11 1138 PRO n 
11 1139 VAL n 
11 1140 ILE n 
11 1141 SER n 
11 1142 GLN n 
11 1143 SER n 
11 1144 LEU n 
11 1145 THR n 
11 1146 SER n 
11 1147 ILE n 
11 1148 LEU n 
11 1149 VAL n 
11 1150 ILE n 
11 1151 VAL n 
11 1152 GLN n 
11 1153 LYS n 
11 1154 ILE n 
11 1155 LEU n 
11 1156 PRO n 
11 1157 LEU n 
11 1158 SER n 
11 1159 ASN n 
11 1160 GLU n 
11 1161 VAL n 
11 1162 PHE n 
11 1163 GLU n 
11 1164 ILE n 
11 1165 SER n 
11 1166 GLU n 
11 1167 ASN n 
11 1168 ASN n 
11 1169 SER n 
11 1170 ASP n 
11 1171 SER n 
11 1172 ASN n 
11 1173 SER n 
11 1174 ASN n 
11 1175 ASN n 
11 1176 ASN n 
11 1177 GLY n 
11 1178 ASN n 
11 1179 LYS n 
11 1180 ASP n 
11 1181 SER n 
11 1182 SER n 
11 1183 PHE n 
11 1184 ASN n 
11 1185 PHE n 
11 1186 ASN n 
11 1187 LYS n 
11 1188 ASN n 
11 1189 LEU n 
11 1190 PRO n 
11 1191 PHE n 
11 1192 VAL n 
11 1193 TRP n 
11 1194 LEU n 
11 1195 SER n 
11 1196 SER n 
11 1197 GLU n 
11 1198 GLU n 
11 1199 ASN n 
11 1200 ILE n 
11 1201 GLY n 
11 1202 SER n 
11 1203 GLY n 
11 1204 LEU n 
11 1205 LEU n 
11 1206 LYS n 
11 1207 LEU n 
11 1208 SER n 
11 1209 GLU n 
11 1210 ILE n 
11 1211 ILE n 
11 1212 LEU n 
11 1213 ASN n 
11 1214 ILE n 
11 1215 ASN n 
11 1216 ASN n 
11 1217 SER n 
11 1218 THR n 
11 1219 SER n 
11 1220 LYS n 
11 1221 ASN n 
11 1222 THR n 
11 1223 LEU n 
11 1224 LEU n 
11 1225 GLN n 
11 1226 GLN n 
11 1227 GLN n 
11 1228 ASN n 
11 1229 TYR n 
11 1230 SER n 
11 1231 LYS n 
11 1232 VAL n 
11 1233 LEU n 
11 1234 LEU n 
11 1235 PRO n 
11 1236 SER n 
11 1237 ILE n 
11 1238 ASN n 
11 1239 ILE n 
11 1240 SER n 
11 1241 CYS n 
11 1242 VAL n 
11 1243 GLN n 
11 1244 LEU n 
11 1245 ILE n 
11 1246 LYS n 
11 1247 CYS n 
11 1248 LEU n 
11 1249 VAL n 
11 1250 GLU n 
11 1251 LYS n 
11 1252 SER n 
11 1253 ILE n 
11 1254 CYS n 
11 1255 PHE n 
11 1256 GLU n 
11 1257 ASN n 
11 1258 CYS n 
11 1259 LEU n 
11 1260 ASN n 
11 1261 ASN n 
11 1262 ASP n 
11 1263 PRO n 
11 1264 GLU n 
11 1265 ILE n 
11 1266 LEU n 
11 1267 LYS n 
11 1268 LYS n 
11 1269 ILE n 
11 1270 ALA n 
11 1271 SER n 
11 1272 ILE n 
11 1273 PRO n 
11 1274 ASN n 
11 1275 LEU n 
11 1276 PHE n 
11 1277 PRO n 
11 1278 THR n 
11 1279 ASP n 
11 1280 LEU n 
11 1281 GLU n 
11 1282 ILE n 
11 1283 PHE n 
11 1284 GLN n 
11 1285 LEU n 
11 1286 PHE n 
11 1287 THR n 
11 1288 ASN n 
11 1289 PRO n 
11 1290 SER n 
11 1291 VAL n 
11 1292 ASP n 
11 1293 ILE n 
11 1294 GLN n 
11 1295 ILE n 
11 1296 ILE n 
11 1297 ASN n 
11 1298 GLN n 
11 1299 TYR n 
11 1300 GLN n 
11 1301 LEU n 
11 1302 LEU n 
11 1303 TYR n 
11 1304 ASN n 
11 1305 LEU n 
11 1306 LYS n 
11 1307 ASN n 
11 1308 ASP n 
11 1309 ILE n 
11 1310 LEU n 
11 1311 THR n 
11 1312 ASN n 
11 1313 LEU n 
11 1314 GLU n 
12 1    MET n 
12 2    ASN n 
12 3    ASN n 
12 4    GLN n 
12 5    PRO n 
12 6    GLN n 
12 7    GLY n 
12 8    THR n 
12 9    ASN n 
12 10   SER n 
12 11   VAL n 
12 12   PRO n 
12 13   ASN n 
12 14   SER n 
12 15   ILE n 
12 16   GLY n 
12 17   ASN n 
12 18   ILE n 
12 19   PHE n 
12 20   SER n 
12 21   ASN n 
12 22   ILE n 
12 23   GLY n 
12 24   THR n 
12 25   PRO n 
12 26   SER n 
12 27   PHE n 
12 28   ASN n 
12 29   MET n 
12 30   ALA n 
12 31   GLN n 
12 32   ILE n 
12 33   PRO n 
12 34   GLN n 
12 35   GLN n 
12 36   LEU n 
12 37   TYR n 
12 38   GLN n 
12 39   SER n 
12 40   LEU n 
12 41   THR n 
12 42   PRO n 
12 43   GLN n 
12 44   GLN n 
12 45   LEU n 
12 46   GLN n 
12 47   MET n 
12 48   ILE n 
12 49   GLN n 
12 50   GLN n 
12 51   ARG n 
12 52   HIS n 
12 53   GLN n 
12 54   GLN n 
12 55   LEU n 
12 56   LEU n 
12 57   ARG n 
12 58   SER n 
12 59   ARG n 
12 60   LEU n 
12 61   GLN n 
12 62   GLN n 
12 63   GLN n 
12 64   GLN n 
12 65   GLN n 
12 66   GLN n 
12 67   GLN n 
12 68   GLN n 
12 69   GLN n 
12 70   THR n 
12 71   SER n 
12 72   PRO n 
12 73   PRO n 
12 74   PRO n 
12 75   GLN n 
12 76   THR n 
12 77   HIS n 
12 78   GLN n 
12 79   SER n 
12 80   PRO n 
12 81   PRO n 
12 82   PRO n 
12 83   PRO n 
12 84   PRO n 
12 85   GLN n 
12 86   GLN n 
12 87   SER n 
12 88   GLN n 
12 89   PRO n 
12 90   ILE n 
12 91   ALA n 
12 92   ASN n 
12 93   GLN n 
12 94   SER n 
12 95   ALA n 
12 96   THR n 
12 97   SER n 
12 98   THR n 
12 99   PRO n 
12 100  PRO n 
12 101  PRO n 
12 102  PRO n 
12 103  PRO n 
12 104  ALA n 
12 105  PRO n 
12 106  HIS n 
12 107  ASN n 
12 108  LEU n 
12 109  HIS n 
12 110  PRO n 
12 111  GLN n 
12 112  ILE n 
12 113  GLY n 
12 114  GLN n 
12 115  VAL n 
12 116  PRO n 
12 117  LEU n 
12 118  ALA n 
12 119  PRO n 
12 120  ALA n 
12 121  PRO n 
12 122  ILE n 
12 123  ASN n 
12 124  LEU n 
12 125  PRO n 
12 126  PRO n 
12 127  GLN n 
12 128  ILE n 
12 129  ALA n 
12 130  GLN n 
12 131  LEU n 
12 132  PRO n 
12 133  LEU n 
12 134  ALA n 
12 135  THR n 
12 136  GLN n 
12 137  GLN n 
12 138  GLN n 
12 139  VAL n 
12 140  LEU n 
12 141  ASN n 
12 142  LYS n 
12 143  LEU n 
12 144  ARG n 
12 145  GLN n 
12 146  GLN n 
12 147  ALA n 
12 148  ILE n 
12 149  ALA n 
12 150  LYS n 
12 151  ASN n 
12 152  ASN n 
12 153  PRO n 
12 154  GLN n 
12 155  VAL n 
12 156  VAL n 
12 157  ASN n 
12 158  ALA n 
12 159  ILE n 
12 160  THR n 
12 161  VAL n 
12 162  ALA n 
12 163  GLN n 
12 164  GLN n 
12 165  GLN n 
12 166  VAL n 
12 167  GLN n 
12 168  ARG n 
12 169  GLN n 
12 170  ILE n 
12 171  GLU n 
12 172  GLN n 
12 173  GLN n 
12 174  LYS n 
12 175  GLY n 
12 176  GLN n 
12 177  GLN n 
12 178  THR n 
12 179  ALA n 
12 180  GLN n 
12 181  THR n 
12 182  GLN n 
12 183  LEU n 
12 184  GLU n 
12 185  GLN n 
12 186  GLN n 
12 187  ARG n 
12 188  GLN n 
12 189  LEU n 
12 190  LEU n 
12 191  VAL n 
12 192  GLN n 
12 193  GLN n 
12 194  GLN n 
12 195  GLN n 
12 196  GLN n 
12 197  GLN n 
12 198  GLN n 
12 199  LEU n 
12 200  ARG n 
12 201  ASN n 
12 202  GLN n 
12 203  ILE n 
12 204  GLN n 
12 205  ARG n 
12 206  GLN n 
12 207  GLN n 
12 208  GLN n 
12 209  GLN n 
12 210  GLN n 
12 211  PHE n 
12 212  ARG n 
12 213  HIS n 
12 214  HIS n 
12 215  VAL n 
12 216  GLN n 
12 217  ILE n 
12 218  GLN n 
12 219  GLN n 
12 220  GLN n 
12 221  GLN n 
12 222  GLN n 
12 223  LYS n 
12 224  GLN n 
12 225  GLN n 
12 226  GLN n 
12 227  GLN n 
12 228  GLN n 
12 229  GLN n 
12 230  GLN n 
12 231  HIS n 
12 232  GLN n 
12 233  GLN n 
12 234  GLN n 
12 235  GLN n 
12 236  GLN n 
12 237  GLN n 
12 238  GLN n 
12 239  GLN n 
12 240  GLN n 
12 241  GLN n 
12 242  GLN n 
12 243  GLN n 
12 244  GLN n 
12 245  GLN n 
12 246  GLN n 
12 247  GLN n 
12 248  GLN n 
12 249  GLN n 
12 250  GLN n 
12 251  GLN n 
12 252  GLN n 
12 253  GLN n 
12 254  GLN n 
12 255  GLN n 
12 256  GLN n 
12 257  GLN n 
12 258  GLN n 
12 259  GLN n 
12 260  GLN n 
12 261  GLN n 
12 262  GLN n 
12 263  GLN n 
12 264  GLN n 
12 265  GLN n 
12 266  GLN n 
12 267  GLN n 
12 268  GLN n 
12 269  GLY n 
12 270  GLN n 
12 271  ILE n 
12 272  PRO n 
12 273  GLN n 
12 274  SER n 
12 275  GLN n 
12 276  GLN n 
12 277  VAL n 
12 278  PRO n 
12 279  GLN n 
12 280  VAL n 
12 281  ARG n 
12 282  SER n 
12 283  MET n 
12 284  SER n 
12 285  GLY n 
12 286  GLN n 
12 287  PRO n 
12 288  PRO n 
12 289  THR n 
12 290  ASN n 
12 291  VAL n 
12 292  GLN n 
12 293  PRO n 
12 294  THR n 
12 295  ILE n 
12 296  GLY n 
12 297  GLN n 
12 298  LEU n 
12 299  PRO n 
12 300  GLN n 
12 301  LEU n 
12 302  PRO n 
12 303  LYS n 
12 304  LEU n 
12 305  ASN n 
12 306  LEU n 
12 307  PRO n 
12 308  LYS n 
12 309  TYR n 
12 310  GLN n 
12 311  THR n 
12 312  ILE n 
12 313  GLN n 
12 314  TYR n 
12 315  ASP n 
12 316  PRO n 
12 317  PRO n 
12 318  GLU n 
12 319  THR n 
12 320  LYS n 
12 321  LEU n 
12 322  PRO n 
12 323  TYR n 
12 324  PRO n 
12 325  THR n 
12 326  TYR n 
12 327  TRP n 
12 328  SER n 
12 329  ASP n 
12 330  LYS n 
12 331  LYS n 
12 332  ALA n 
12 333  ASP n 
12 334  THR n 
12 335  ASP n 
12 336  THR n 
12 337  LEU n 
12 338  LEU n 
12 339  TYR n 
12 340  GLU n 
12 341  GLN n 
12 342  ILE n 
12 343  ILE n 
12 344  GLN n 
12 345  ARG n 
12 346  ASP n 
12 347  LYS n 
12 348  ILE n 
12 349  ASN n 
12 350  LYS n 
12 351  TYR n 
12 352  SER n 
12 353  LEU n 
12 354  ILE n 
12 355  ARG n 
12 356  GLU n 
12 357  THR n 
12 358  ASN n 
12 359  GLY n 
12 360  TYR n 
12 361  ASP n 
12 362  PRO n 
12 363  PHE n 
12 364  SER n 
12 365  ILE n 
12 366  TYR n 
12 367  GLY n 
12 368  PHE n 
12 369  SER n 
12 370  ASN n 
12 371  LYS n 
12 372  GLU n 
12 373  TYR n 
12 374  ILE n 
12 375  SER n 
12 376  ARG n 
12 377  LEU n 
12 378  TRP n 
12 379  HIS n 
12 380  THR n 
12 381  LEU n 
12 382  LYS n 
12 383  TYR n 
12 384  TYR n 
12 385  GLN n 
12 386  ASP n 
12 387  LEU n 
12 388  LYS n 
12 389  ASN n 
12 390  THR n 
12 391  ARG n 
12 392  MET n 
12 393  LYS n 
12 394  SER n 
12 395  ILE n 
12 396  THR n 
12 397  SER n 
12 398  THR n 
12 399  SER n 
12 400  GLN n 
12 401  LYS n 
12 402  ILE n 
12 403  PRO n 
12 404  SER n 
12 405  ALA n 
12 406  SER n 
12 407  ILE n 
12 408  TRP n 
12 409  GLY n 
12 410  ASN n 
12 411  GLY n 
12 412  TYR n 
12 413  SER n 
12 414  GLY n 
12 415  TYR n 
12 416  GLY n 
12 417  ASN n 
12 418  GLY n 
12 419  ILE n 
12 420  THR n 
12 421  ASN n 
12 422  THR n 
12 423  THR n 
12 424  THR n 
12 425  ARG n 
12 426  VAL n 
12 427  ILE n 
12 428  PRO n 
12 429  GLN n 
12 430  VAL n 
12 431  GLU n 
12 432  VAL n 
12 433  GLY n 
12 434  ASN n 
12 435  ARG n 
12 436  LYS n 
12 437  HIS n 
12 438  TYR n 
12 439  LEU n 
12 440  GLU n 
12 441  ASP n 
12 442  LYS n 
12 443  LEU n 
12 444  LYS n 
12 445  VAL n 
12 446  TYR n 
12 447  LYS n 
12 448  GLN n 
12 449  ALA n 
12 450  MET n 
12 451  ASN n 
12 452  GLU n 
12 453  THR n 
12 454  SER n 
12 455  GLU n 
12 456  GLN n 
12 457  LEU n 
12 458  VAL n 
12 459  PRO n 
12 460  ILE n 
12 461  ARG n 
12 462  LEU n 
12 463  GLU n 
12 464  PHE n 
12 465  ASP n 
12 466  GLN n 
12 467  ASP n 
12 468  ARG n 
12 469  ASP n 
12 470  ARG n 
12 471  PHE n 
12 472  PHE n 
12 473  LEU n 
12 474  ARG n 
12 475  ASP n 
12 476  THR n 
12 477  LEU n 
12 478  LEU n 
12 479  TRP n 
12 480  ASN n 
12 481  LYS n 
12 482  ASN n 
12 483  ASP n 
12 484  LYS n 
12 485  LEU n 
12 486  ILE n 
12 487  LYS n 
12 488  ILE n 
12 489  GLU n 
12 490  ASP n 
12 491  PHE n 
12 492  VAL n 
12 493  ASP n 
12 494  ASP n 
12 495  MET n 
12 496  LEU n 
12 497  ARG n 
12 498  ASP n 
12 499  TYR n 
12 500  ARG n 
12 501  PHE n 
12 502  GLU n 
12 503  ASP n 
12 504  ALA n 
12 505  THR n 
12 506  ARG n 
12 507  GLU n 
12 508  GLN n 
12 509  HIS n 
12 510  ILE n 
12 511  ASP n 
12 512  THR n 
12 513  ILE n 
12 514  CYS n 
12 515  GLN n 
12 516  SER n 
12 517  ILE n 
12 518  GLN n 
12 519  GLU n 
12 520  GLN n 
12 521  ILE n 
12 522  GLN n 
12 523  GLU n 
12 524  PHE n 
12 525  GLN n 
12 526  GLY n 
12 527  ASN n 
12 528  PRO n 
12 529  TYR n 
12 530  ILE n 
12 531  GLU n 
12 532  LEU n 
12 533  ASN n 
12 534  GLN n 
12 535  ASP n 
12 536  ARG n 
12 537  LEU n 
12 538  GLY n 
12 539  GLY n 
12 540  ASP n 
12 541  ASP n 
12 542  LEU n 
12 543  ARG n 
12 544  ILE n 
12 545  ARG n 
12 546  ILE n 
12 547  LYS n 
12 548  LEU n 
12 549  ASP n 
12 550  ILE n 
12 551  VAL n 
12 552  VAL n 
12 553  GLY n 
12 554  GLN n 
12 555  ASN n 
12 556  GLN n 
12 557  LEU n 
12 558  ILE n 
12 559  ASP n 
12 560  GLN n 
12 561  PHE n 
12 562  GLU n 
12 563  TRP n 
12 564  ASP n 
12 565  ILE n 
12 566  SER n 
12 567  ASN n 
12 568  SER n 
12 569  ASP n 
12 570  ASN n 
12 571  CYS n 
12 572  PRO n 
12 573  GLU n 
12 574  GLU n 
12 575  PHE n 
12 576  ALA n 
12 577  GLU n 
12 578  SER n 
12 579  MET n 
12 580  CYS n 
12 581  GLN n 
12 582  GLU n 
12 583  LEU n 
12 584  GLU n 
12 585  LEU n 
12 586  PRO n 
12 587  GLY n 
12 588  GLU n 
12 589  PHE n 
12 590  VAL n 
12 591  THR n 
12 592  ALA n 
12 593  ILE n 
12 594  ALA n 
12 595  HIS n 
12 596  SER n 
12 597  ILE n 
12 598  ARG n 
12 599  GLU n 
12 600  GLN n 
12 601  VAL n 
12 602  HIS n 
12 603  MET n 
12 604  TYR n 
12 605  HIS n 
12 606  LYS n 
12 607  SER n 
12 608  LEU n 
12 609  ALA n 
12 610  LEU n 
12 611  LEU n 
12 612  GLY n 
12 613  TYR n 
12 614  ASN n 
12 615  PHE n 
12 616  ASP n 
12 617  GLY n 
12 618  SER n 
12 619  ALA n 
12 620  ILE n 
12 621  GLU n 
12 622  ASP n 
12 623  ASP n 
12 624  ASP n 
12 625  ILE n 
12 626  ARG n 
12 627  SER n 
12 628  ARG n 
12 629  MET n 
12 630  LEU n 
12 631  PRO n 
12 632  THR n 
12 633  ILE n 
12 634  THR n 
12 635  LEU n 
12 636  ASP n 
12 637  ASP n 
12 638  VAL n 
12 639  TYR n 
12 640  ARG n 
12 641  PRO n 
12 642  ALA n 
12 643  ALA n 
12 644  GLU n 
12 645  SER n 
12 646  LYS n 
12 647  ILE n 
12 648  PHE n 
12 649  THR n 
12 650  PRO n 
12 651  ASN n 
12 652  LEU n 
12 653  LEU n 
12 654  GLN n 
12 655  ILE n 
12 656  SER n 
12 657  ALA n 
12 658  ALA n 
12 659  GLU n 
12 660  LEU n 
12 661  GLU n 
12 662  ARG n 
12 663  LEU n 
12 664  ASP n 
12 665  LYS n 
12 666  ASP n 
12 667  LYS n 
12 668  ASP n 
12 669  ARG n 
12 670  ASP n 
12 671  THR n 
12 672  ARG n 
12 673  ARG n 
12 674  LYS n 
12 675  ARG n 
12 676  ARG n 
12 677  GLN n 
12 678  GLY n 
12 679  ARG n 
12 680  SER n 
12 681  ASN n 
12 682  ARG n 
12 683  ARG n 
12 684  GLY n 
12 685  MET n 
12 686  LEU n 
12 687  ALA n 
12 688  LEU n 
12 689  SER n 
12 690  GLY n 
12 691  THR n 
12 692  SER n 
12 693  ALA n 
12 694  SER n 
12 695  ASN n 
12 696  THR n 
12 697  SER n 
12 698  MET n 
12 699  ASN n 
12 700  GLY n 
12 701  VAL n 
12 702  HIS n 
12 703  ASN n 
12 704  THR n 
12 705  VAL n 
12 706  ALA n 
12 707  ALA n 
12 708  GLY n 
12 709  ASN n 
12 710  ALA n 
12 711  SER n 
12 712  SER n 
12 713  LEU n 
12 714  PRO n 
12 715  PRO n 
12 716  GLY n 
12 717  GLU n 
12 718  ILE n 
12 719  LEU n 
12 720  LEU n 
12 721  PRO n 
12 722  ASP n 
12 723  ILE n 
12 724  ALA n 
12 725  ASP n 
12 726  ILE n 
12 727  PRO n 
12 728  ARG n 
12 729  THR n 
12 730  PHE n 
12 731  ARG n 
12 732  THR n 
12 733  PRO n 
12 734  VAL n 
12 735  PRO n 
12 736  SER n 
12 737  THR n 
12 738  LEU n 
12 739  MET n 
12 740  PRO n 
12 741  GLY n 
12 742  GLY n 
12 743  VAL n 
12 744  ASP n 
12 745  VAL n 
12 746  GLY n 
12 747  PRO n 
12 748  SER n 
12 749  VAL n 
12 750  GLU n 
12 751  SER n 
12 752  TYR n 
12 753  GLU n 
12 754  LEU n 
12 755  ARG n 
12 756  ASN n 
12 757  THR n 
12 758  THR n 
12 759  THR n 
12 760  TYR n 
12 761  LYS n 
12 762  SER n 
12 763  ARG n 
12 764  PRO n 
12 765  ASP n 
12 766  ARG n 
12 767  PRO n 
12 768  LYS n 
12 769  PRO n 
12 770  VAL n 
12 771  SER n 
12 772  PRO n 
12 773  PRO n 
12 774  CYS n 
12 775  TYR n 
12 776  ILE n 
12 777  ILE n 
12 778  ASP n 
12 779  HIS n 
12 780  ILE n 
12 781  PRO n 
12 782  GLY n 
12 783  HIS n 
12 784  SER n 
12 785  LEU n 
12 786  LEU n 
12 787  LEU n 
12 788  SER n 
12 789  ILE n 
12 790  LYS n 
12 791  LEU n 
12 792  PRO n 
12 793  GLY n 
12 794  LYS n 
12 795  VAL n 
12 796  ASN n 
12 797  THR n 
12 798  LYS n 
12 799  GLU n 
12 800  GLU n 
12 801  PHE n 
12 802  ALA n 
12 803  ALA n 
12 804  ALA n 
12 805  PRO n 
12 806  ASN n 
12 807  ASP n 
12 808  THR n 
12 809  SER n 
12 810  SER n 
12 811  GLY n 
12 812  THR n 
12 813  ASN n 
12 814  ALA n 
12 815  MET n 
12 816  LEU n 
12 817  PRO n 
12 818  SER n 
12 819  PRO n 
12 820  GLU n 
12 821  SER n 
12 822  LEU n 
12 823  LYS n 
12 824  THR n 
12 825  LYS n 
12 826  LEU n 
12 827  ASN n 
12 828  SER n 
12 829  ASN n 
12 830  ILE n 
12 831  ARG n 
12 832  ALA n 
12 833  GLY n 
12 834  VAL n 
12 835  THR n 
12 836  ILE n 
12 837  PRO n 
12 838  SER n 
12 839  ILE n 
12 840  PRO n 
12 841  ASN n 
12 842  PRO n 
12 843  ILE n 
12 844  ALA n 
12 845  ASN n 
12 846  HIS n 
12 847  THR n 
12 848  VAL n 
12 849  THR n 
12 850  ASN n 
12 851  SER n 
12 852  PRO n 
12 853  ASN n 
12 854  PRO n 
12 855  THR n 
12 856  LEU n 
12 857  GLN n 
12 858  PRO n 
12 859  VAL n 
12 860  ILE n 
12 861  PRO n 
12 862  GLY n 
12 863  GLY n 
12 864  ALA n 
12 865  ALA n 
12 866  SER n 
12 867  LYS n 
12 868  SER n 
12 869  VAL n 
12 870  PRO n 
12 871  THR n 
12 872  PRO n 
12 873  SER n 
12 874  LEU n 
12 875  PRO n 
12 876  ILE n 
12 877  ALA n 
12 878  PRO n 
12 879  PRO n 
12 880  VAL n 
12 881  ALA n 
12 882  PRO n 
12 883  HIS n 
12 884  ASP n 
12 885  SER n 
12 886  GLU n 
12 887  ALA n 
12 888  THR n 
12 889  LEU n 
12 890  LEU n 
12 891  THR n 
12 892  ASN n 
12 893  SER n 
12 894  ASN n 
12 895  ASN n 
12 896  GLY n 
12 897  SER n 
12 898  SER n 
12 899  ASN n 
12 900  ASN n 
12 901  ASN n 
12 902  THR n 
12 903  GLN n 
12 904  ASN n 
12 905  THR n 
13 1    MET n 
13 2    GLU n 
13 3    ASN n 
13 4    THR n 
13 5    LEU n 
13 6    GLY n 
13 7    GLU n 
13 8    GLY n 
13 9    SER n 
13 10   THR n 
13 11   VAL n 
13 12   ASN n 
13 13   ALA n 
13 14   SER n 
13 15   VAL n 
13 16   ASP n 
13 17   VAL n 
13 18   ASP n 
13 19   GLN n 
13 20   HIS n 
13 21   GLY n 
13 22   ASN n 
13 23   ASP n 
13 24   ASN n 
13 25   ASN n 
13 26   SER n 
13 27   ASP n 
13 28   SER n 
13 29   ASN n 
13 30   ALA n 
13 31   ASN n 
13 32   ALA n 
13 33   ALA n 
13 34   VAL n 
13 35   ALA n 
13 36   GLY n 
13 37   VAL n 
13 38   ALA n 
13 39   ASN n 
13 40   THR n 
13 41   ASP n 
13 42   THR n 
13 43   ALA n 
13 44   GLY n 
13 45   GLU n 
13 46   GLU n 
13 47   SER n 
13 48   GLN n 
13 49   GLN n 
13 50   GLN n 
13 51   ASP n 
13 52   GLU n 
13 53   SER n 
13 54   LEU n 
13 55   LYS n 
13 56   ASP n 
13 57   GLU n 
13 58   ALA n 
13 59   THR n 
13 60   VAL n 
13 61   PRO n 
13 62   ASN n 
13 63   THR n 
13 64   ARG n 
13 65   ASP n 
13 66   ALA n 
13 67   GLU n 
13 68   SER n 
13 69   GLU n 
13 70   ALA n 
13 71   ILE n 
13 72   THR n 
13 73   VAL n 
13 74   THR n 
13 75   ALA n 
13 76   LYS n 
13 77   GLN n 
13 78   GLN n 
13 79   PRO n 
13 80   THR n 
13 81   MET n 
13 82   GLN n 
13 83   ALA n 
13 84   ASN n 
13 85   LYS n 
13 86   LEU n 
13 87   ASP n 
13 88   SER n 
13 89   GLN n 
13 90   GLU n 
13 91   THR n 
13 92   PRO n 
13 93   SER n 
13 94   THR n 
13 95   GLU n 
13 96   GLU n 
13 97   SER n 
13 98   ARG n 
13 99   ALA n 
13 100  GLN n 
13 101  ASN n 
13 102  VAL n 
13 103  PHE n 
13 104  GLY n 
13 105  GLN n 
13 106  ASP n 
13 107  ASN n 
13 108  GLU n 
13 109  ASP n 
13 110  SER n 
13 111  ASP n 
13 112  ASN n 
13 113  LEU n 
13 114  PHE n 
13 115  GLY n 
13 116  GLU n 
13 117  THR n 
13 118  GLU n 
13 119  SER n 
13 120  SER n 
13 121  VAL n 
13 122  SER n 
13 123  ASN n 
13 124  ASN n 
13 125  GLU n 
13 126  ALA n 
13 127  ASN n 
13 128  THR n 
13 129  PRO n 
13 130  SER n 
13 131  ILE n 
13 132  PRO n 
13 133  THR n 
13 134  ASN n 
13 135  PRO n 
13 136  VAL n 
13 137  ASP n 
13 138  ASN n 
13 139  GLU n 
13 140  ASN n 
13 141  ASN n 
13 142  LYS n 
13 143  PRO n 
13 144  ALA n 
13 145  ILE n 
13 146  LYS n 
13 147  GLU n 
13 148  ASP n 
13 149  SER n 
13 150  THR n 
13 151  ILE n 
13 152  GLN n 
13 153  ASP n 
13 154  SER n 
13 155  ASN n 
13 156  GLY n 
13 157  ASP n 
13 158  VAL n 
13 159  LYS n 
13 160  ASN n 
13 161  MET n 
13 162  GLU n 
13 163  ASP n 
13 164  VAL n 
13 165  LYS n 
13 166  ILE n 
13 167  GLN n 
13 168  LYS n 
13 169  GLU n 
13 170  GLU n 
13 171  GLU n 
13 172  PRO n 
13 173  GLU n 
13 174  ASN n 
13 175  ASN n 
13 176  THR n 
13 177  VAL n 
13 178  ILE n 
13 179  GLU n 
13 180  GLY n 
13 181  VAL n 
13 182  LYS n 
13 183  GLU n 
13 184  GLU n 
13 185  SER n 
13 186  GLN n 
13 187  PRO n 
13 188  ASP n 
13 189  GLU n 
13 190  ASN n 
13 191  THR n 
13 192  LYS n 
13 193  GLU n 
13 194  MET n 
13 195  ASP n 
13 196  GLU n 
13 197  VAL n 
13 198  GLU n 
13 199  GLU n 
13 200  ASP n 
13 201  ASP n 
13 202  GLU n 
13 203  ASP n 
13 204  ASP n 
13 205  ASP n 
13 206  GLN n 
13 207  PRO n 
13 208  MET n 
13 209  ILE n 
13 210  SER n 
13 211  PRO n 
13 212  ASP n 
13 213  ASN n 
13 214  SER n 
13 215  ILE n 
13 216  PHE n 
13 217  GLY n 
13 218  ASP n 
13 219  THR n 
13 220  LYS n 
13 221  SER n 
13 222  GLU n 
13 223  SER n 
13 224  LYS n 
13 225  GLN n 
13 226  LEU n 
13 227  GLY n 
13 228  ASN n 
13 229  THR n 
13 230  SER n 
13 231  SER n 
13 232  VAL n 
13 233  ALA n 
13 234  ASN n 
13 235  THR n 
13 236  PRO n 
13 237  SER n 
13 238  GLU n 
13 239  ILE n 
13 240  PRO n 
13 241  ASP n 
13 242  ALA n 
13 243  HIS n 
13 244  LYS n 
13 245  ALA n 
13 246  GLU n 
13 247  GLN n 
13 248  GLU n 
13 249  ASP n 
13 250  ILE n 
13 251  ILE n 
13 252  GLU n 
13 253  LYS n 
13 254  THR n 
13 255  GLU n 
13 256  SER n 
13 257  VAL n 
13 258  ASP n 
13 259  LYS n 
13 260  LYS n 
13 261  VAL n 
13 262  ASP n 
13 263  SER n 
13 264  GLY n 
13 265  GLU n 
13 266  GLU n 
13 267  ARG n 
13 268  ASN n 
13 269  GLU n 
13 270  GLN n 
13 271  GLU n 
13 272  ARG n 
13 273  GLU n 
13 274  ILE n 
13 275  MET n 
13 276  ASN n 
13 277  ASP n 
13 278  HIS n 
13 279  SER n 
13 280  LYS n 
13 281  SER n 
13 282  ALA n 
13 283  ASN n 
13 284  PRO n 
13 285  LYS n 
13 286  LYS n 
13 287  THR n 
13 288  THR n 
13 289  ILE n 
13 290  THR n 
13 291  ARG n 
13 292  VAL n 
13 293  GLU n 
13 294  PRO n 
13 295  GLU n 
13 296  THR n 
13 297  PHE n 
13 298  GLU n 
13 299  ILE n 
13 300  PRO n 
13 301  GLN n 
13 302  ALA n 
13 303  HIS n 
13 304  GLU n 
13 305  ILE n 
13 306  VAL n 
13 307  ILE n 
13 308  PRO n 
13 309  SER n 
13 310  TYR n 
13 311  SER n 
13 312  LYS n 
13 313  TRP n 
13 314  PHE n 
13 315  ASN n 
13 316  LEU n 
13 317  GLU n 
13 318  LYS n 
13 319  ILE n 
13 320  HIS n 
13 321  SER n 
13 322  ILE n 
13 323  GLU n 
13 324  VAL n 
13 325  GLN n 
13 326  SER n 
13 327  LEU n 
13 328  PRO n 
13 329  GLU n 
13 330  PHE n 
13 331  PHE n 
13 332  THR n 
13 333  ASN n 
13 334  ARG n 
13 335  ILE n 
13 336  PRO n 
13 337  SER n 
13 338  LYS n 
13 339  THR n 
13 340  PRO n 
13 341  GLU n 
13 342  VAL n 
13 343  TYR n 
13 344  MET n 
13 345  ARG n 
13 346  TYR n 
13 347  ARG n 
13 348  ASN n 
13 349  PHE n 
13 350  MET n 
13 351  VAL n 
13 352  ASN n 
13 353  SER n 
13 354  TYR n 
13 355  ARG n 
13 356  LEU n 
13 357  ASN n 
13 358  PRO n 
13 359  ASN n 
13 360  GLU n 
13 361  TYR n 
13 362  PHE n 
13 363  SER n 
13 364  VAL n 
13 365  THR n 
13 366  THR n 
13 367  ALA n 
13 368  ARG n 
13 369  ARG n 
13 370  ASN n 
13 371  VAL n 
13 372  SER n 
13 373  GLY n 
13 374  ASP n 
13 375  ALA n 
13 376  ALA n 
13 377  ALA n 
13 378  LEU n 
13 379  PHE n 
13 380  ARG n 
13 381  LEU n 
13 382  HIS n 
13 383  LYS n 
13 384  PHE n 
13 385  LEU n 
13 386  THR n 
13 387  LYS n 
13 388  TRP n 
13 389  GLY n 
13 390  LEU n 
13 391  ILE n 
13 392  ASN n 
13 393  TYR n 
13 394  GLN n 
13 395  VAL n 
13 396  ASP n 
13 397  SER n 
13 398  LYS n 
13 399  LEU n 
13 400  LEU n 
13 401  PRO n 
13 402  LYS n 
13 403  ASN n 
13 404  ILE n 
13 405  GLU n 
13 406  PRO n 
13 407  PRO n 
13 408  LEU n 
13 409  THR n 
13 410  SER n 
13 411  GLN n 
13 412  TYR n 
13 413  SER n 
13 414  THR n 
13 415  ARG n 
13 416  HIS n 
13 417  ASP n 
13 418  ALA n 
13 419  PRO n 
13 420  ARG n 
13 421  GLY n 
13 422  LEU n 
13 423  PHE n 
13 424  PRO n 
13 425  PHE n 
13 426  GLU n 
13 427  SER n 
13 428  TYR n 
13 429  LYS n 
13 430  PRO n 
13 431  SER n 
13 432  VAL n 
13 433  GLN n 
13 434  LEU n 
13 435  PRO n 
13 436  ASP n 
13 437  MET n 
13 438  ALA n 
13 439  LYS n 
13 440  LEU n 
13 441  LYS n 
13 442  LYS n 
13 443  MET n 
13 444  MET n 
13 445  ASN n 
13 446  THR n 
13 447  SER n 
13 448  ASP n 
13 449  SER n 
13 450  GLU n 
13 451  SER n 
13 452  THR n 
13 453  LEU n 
13 454  TYR n 
13 455  LYS n 
13 456  TYR n 
13 457  LEU n 
13 458  LYS n 
13 459  GLU n 
13 460  SER n 
13 461  LYS n 
13 462  ARG n 
13 463  LYS n 
13 464  TYR n 
13 465  ASP n 
13 466  GLU n 
13 467  ILE n 
13 468  THR n 
13 469  HIS n 
13 470  PRO n 
13 471  PRO n 
13 472  SER n 
13 473  THR n 
13 474  THR n 
13 475  ASP n 
13 476  ASP n 
13 477  GLU n 
13 478  ASN n 
13 479  GLY n 
13 480  ASP n 
13 481  LYS n 
13 482  ASN n 
13 483  ASP n 
13 484  ASN n 
13 485  GLY n 
13 486  GLY n 
13 487  LYS n 
13 488  MET n 
13 489  ASN n 
13 490  ASN n 
13 491  GLU n 
13 492  VAL n 
13 493  SER n 
13 494  THR n 
13 495  SER n 
13 496  THR n 
13 497  SER n 
13 498  MET n 
13 499  THR n 
13 500  GLY n 
13 501  ASP n 
13 502  ALA n 
13 503  ASN n 
13 504  LEU n 
13 505  LEU n 
13 506  GLU n 
13 507  GLU n 
13 508  GLY n 
13 509  GLU n 
13 510  THR n 
13 511  SER n 
13 512  ARG n 
13 513  PRO n 
13 514  LEU n 
13 515  LYS n 
13 516  LYS n 
13 517  VAL n 
13 518  LYS n 
13 519  ILE n 
13 520  LEU n 
13 521  GLU n 
13 522  GLN n 
13 523  ILE n 
13 524  ASP n 
13 525  GLU n 
13 526  ASN n 
13 527  TRP n 
13 528  SER n 
13 529  LYS n 
13 530  GLU n 
13 531  ASP n 
13 532  LEU n 
13 533  GLN n 
13 534  LYS n 
13 535  LEU n 
13 536  LEU n 
13 537  LYS n 
13 538  GLY n 
13 539  ILE n 
13 540  GLN n 
13 541  GLU n 
13 542  PHE n 
13 543  GLY n 
13 544  ALA n 
13 545  ASP n 
13 546  TRP n 
13 547  TYR n 
13 548  LYS n 
13 549  VAL n 
13 550  ALA n 
13 551  LYS n 
13 552  ASN n 
13 553  VAL n 
13 554  GLY n 
13 555  ASN n 
13 556  LYS n 
13 557  SER n 
13 558  PRO n 
13 559  GLU n 
13 560  GLN n 
13 561  CYS n 
13 562  ILE n 
13 563  LEU n 
13 564  ARG n 
13 565  PHE n 
13 566  LEU n 
13 567  GLN n 
13 568  LEU n 
13 569  PRO n 
13 570  ILE n 
13 571  GLU n 
13 572  ASP n 
13 573  LYS n 
13 574  PHE n 
13 575  LEU n 
13 576  TYR n 
13 577  GLY n 
13 578  ASP n 
13 579  GLY n 
13 580  ASN n 
13 581  GLY n 
13 582  LYS n 
13 583  GLY n 
13 584  ASP n 
13 585  ASN n 
13 586  ASP n 
13 587  ASN n 
13 588  GLY n 
13 589  LEU n 
13 590  GLY n 
13 591  PRO n 
13 592  LEU n 
13 593  LYS n 
13 594  TYR n 
13 595  ALA n 
13 596  PRO n 
13 597  HIS n 
13 598  LEU n 
13 599  PRO n 
13 600  PHE n 
13 601  SER n 
13 602  LYS n 
13 603  SER n 
13 604  GLU n 
13 605  ASN n 
13 606  PRO n 
13 607  VAL n 
13 608  LEU n 
13 609  SER n 
13 610  THR n 
13 611  ILE n 
13 612  ALA n 
13 613  PHE n 
13 614  LEU n 
13 615  VAL n 
13 616  GLY n 
13 617  LEU n 
13 618  VAL n 
13 619  ASN n 
13 620  PRO n 
13 621  LYS n 
13 622  THR n 
13 623  VAL n 
13 624  GLN n 
13 625  SER n 
13 626  MET n 
13 627  THR n 
13 628  GLN n 
13 629  ARG n 
13 630  ALA n 
13 631  ILE n 
13 632  GLN n 
13 633  SER n 
13 634  ALA n 
13 635  GLU n 
13 636  SER n 
13 637  ILE n 
13 638  LYS n 
13 639  SER n 
13 640  GLN n 
13 641  LYS n 
13 642  GLU n 
13 643  GLU n 
13 644  ILE n 
13 645  SER n 
13 646  ASP n 
13 647  GLN n 
13 648  LYS n 
13 649  PRO n 
13 650  ILE n 
13 651  GLU n 
13 652  HIS n 
13 653  ILE n 
13 654  LYS n 
13 655  GLU n 
13 656  GLY n 
13 657  SER n 
13 658  GLU n 
13 659  ILE n 
13 660  ALA n 
13 661  ILE n 
13 662  SER n 
13 663  SER n 
13 664  LEU n 
13 665  GLY n 
13 666  TYR n 
13 667  ARG n 
13 668  SER n 
13 669  HIS n 
13 670  ILE n 
13 671  PHE n 
13 672  ALA n 
13 673  THR n 
13 674  ASN n 
13 675  GLU n 
13 676  GLU n 
13 677  ARG n 
13 678  GLN n 
13 679  MET n 
13 680  ASN n 
13 681  PHE n 
13 682  LEU n 
13 683  THR n 
13 684  ASN n 
13 685  GLU n 
13 686  LEU n 
13 687  ILE n 
13 688  ARG n 
13 689  LEU n 
13 690  GLN n 
13 691  MET n 
13 692  GLU n 
13 693  LYS n 
13 694  LEU n 
13 695  ASP n 
13 696  ALA n 
13 697  LYS n 
13 698  LEU n 
13 699  ASN n 
13 700  HIS n 
13 701  LEU n 
13 702  LYS n 
13 703  LYS n 
13 704  LEU n 
13 705  GLU n 
13 706  LYS n 
13 707  PHE n 
13 708  MET n 
13 709  GLU n 
13 710  LEU n 
13 711  GLU n 
13 712  ARG n 
13 713  LYS n 
13 714  THR n 
13 715  LEU n 
13 716  GLU n 
13 717  ARG n 
13 718  GLN n 
13 719  GLN n 
13 720  GLU n 
13 721  ASN n 
13 722  LEU n 
13 723  LEU n 
13 724  ILE n 
13 725  GLN n 
13 726  ARG n 
13 727  LEU n 
13 728  ASN n 
13 729  PHE n 
13 730  ASN n 
13 731  GLN n 
13 732  ASN n 
13 733  SER n 
13 734  SER n 
13 735  LYS n 
13 736  ILE n 
13 737  VAL n 
13 738  ASN n 
13 739  VAL n 
13 740  LEU n 
13 741  SER n 
13 742  LYS n 
13 743  CYS n 
13 744  LEU n 
13 745  ASN n 
13 746  LEU n 
13 747  ILE n 
13 748  SER n 
13 749  ASP n 
13 750  SER n 
13 751  ASN n 
13 752  ILE n 
13 753  ASN n 
13 754  ASN n 
13 755  SER n 
13 756  SER n 
13 757  VAL n 
13 758  ALA n 
13 759  GLU n 
13 760  LYS n 
13 761  GLU n 
13 762  GLU n 
13 763  ILE n 
13 764  ARG n 
13 765  SER n 
13 766  GLN n 
13 767  ILE n 
13 768  ASP n 
13 769  HIS n 
13 770  PHE n 
13 771  LYS n 
13 772  SER n 
13 773  MET n 
13 774  LEU n 
13 775  SER n 
13 776  LYS n 
13 777  PRO n 
13 778  GLU n 
13 779  THR n 
13 780  LEU n 
13 781  SER n 
13 782  ILE n 
13 783  GLY n 
13 784  LYS n 
13 785  ASN n 
13 786  PRO n 
13 787  PHE n 
13 788  ASN n 
13 789  LYS n 
13 790  PRO n 
13 791  ASN n 
13 792  ILE n 
13 793  GLU n 
13 794  THR n 
13 795  GLY n 
13 796  GLU n 
13 797  ASN n 
13 798  HIS n 
13 799  ASN n 
13 800  GLY n 
13 801  GLN n 
13 802  SER n 
13 803  ILE n 
13 804  SER n 
13 805  ASN n 
13 806  GLU n 
13 807  ASN n 
13 808  ASP n 
13 809  VAL n 
13 810  LYS n 
13 811  PRO n 
13 812  ILE n 
13 813  SER n 
13 814  ILE n 
13 815  GLU n 
13 816  ALA n 
13 817  PRO n 
13 818  GLN n 
13 819  PHE n 
13 820  TYR n 
13 821  ARG n 
13 822  TYR n 
13 823  TRP n 
13 824  SER n 
13 825  ALA n 
14 1    MET n 
14 2    SER n 
14 3    LYS n 
14 4    VAL n 
14 5    MET n 
14 6    LYS n 
14 7    PRO n 
14 8    SER n 
14 9    ASN n 
14 10   GLY n 
14 11   LYS n 
14 12   GLY n 
14 13   SER n 
14 14   ARG n 
14 15   LYS n 
14 16   SER n 
14 17   SER n 
14 18   LYS n 
14 19   ALA n 
14 20   ALA n 
14 21   THR n 
14 22   PRO n 
14 23   ASP n 
14 24   THR n 
14 25   LYS n 
14 26   ASN n 
14 27   PHE n 
14 28   PHE n 
14 29   HIS n 
14 30   ALA n 
14 31   LYS n 
14 32   LYS n 
14 33   LYS n 
14 34   ASP n 
14 35   PRO n 
14 36   VAL n 
14 37   ASN n 
14 38   GLN n 
14 39   ASP n 
14 40   LYS n 
14 41   ALA n 
14 42   ASN n 
14 43   ASN n 
14 44   ALA n 
14 45   SER n 
14 46   GLN n 
14 47   ILE n 
14 48   THR n 
14 49   PRO n 
14 50   THR n 
14 51   VAL n 
14 52   PRO n 
14 53   HIS n 
14 54   SER n 
14 55   HIS n 
14 56   PRO n 
14 57   SER n 
14 58   ASP n 
14 59   MET n 
14 60   VAL n 
14 61   ILE n 
14 62   PRO n 
14 63   ASP n 
14 64   HIS n 
14 65   LEU n 
14 66   ALA n 
14 67   GLU n 
14 68   LEU n 
14 69   ILE n 
14 70   PRO n 
14 71   GLU n 
14 72   LEU n 
14 73   TYR n 
14 74   SER n 
14 75   PHE n 
14 76   GLN n 
14 77   GLN n 
14 78   LEU n 
14 79   VAL n 
14 80   ASP n 
14 81   SER n 
14 82   GLU n 
14 83   LYS n 
14 84   ARG n 
14 85   LEU n 
14 86   ASP n 
14 87   HIS n 
14 88   PHE n 
14 89   ILE n 
14 90   HIS n 
14 91   LEU n 
14 92   ARG n 
14 93   ASN n 
14 94   LEU n 
14 95   HIS n 
14 96   MET n 
14 97   LYS n 
14 98   ARG n 
14 99   MET n 
14 100  VAL n 
14 101  ALA n 
14 102  GLN n 
14 103  TRP n 
14 104  GLU n 
14 105  ARG n 
14 106  SER n 
14 107  LYS n 
14 108  LEU n 
14 109  SER n 
14 110  GLN n 
14 111  GLU n 
14 112  PHE n 
14 113  LEU n 
14 114  TYR n 
14 115  PRO n 
14 116  HIS n 
14 117  LEU n 
14 118  ASN n 
14 119  PHE n 
14 120  PRO n 
14 121  ASN n 
14 122  VAL n 
14 123  LYS n 
14 124  PHE n 
14 125  LEU n 
14 126  ARG n 
14 127  ILE n 
14 128  PHE n 
14 129  ILE n 
14 130  SER n 
14 131  ASN n 
14 132  VAL n 
14 133  SER n 
14 134  GLU n 
14 135  ASN n 
14 136  GLN n 
14 137  PRO n 
14 138  TRP n 
14 139  GLN n 
14 140  MET n 
14 141  ASP n 
14 142  THR n 
14 143  ASN n 
14 144  ASN n 
14 145  GLU n 
14 146  ALA n 
14 147  ASP n 
14 148  LEU n 
14 149  MET n 
14 150  ALA n 
14 151  LEU n 
14 152  GLU n 
14 153  ASN n 
14 154  ALA n 
14 155  THR n 
14 156  TRP n 
14 157  THR n 
14 158  MET n 
14 159  ARG n 
14 160  ILE n 
14 161  GLU n 
14 162  GLY n 
14 163  ARG n 
14 164  LEU n 
14 165  LEU n 
14 166  ASP n 
14 167  ASN n 
14 168  VAL n 
14 169  GLN n 
14 170  ALA n 
14 171  ASN n 
14 172  ASP n 
14 173  PRO n 
14 174  ALA n 
14 175  ARG n 
14 176  GLU n 
14 177  LYS n 
14 178  PHE n 
14 179  SER n 
14 180  SER n 
14 181  PHE n 
14 182  ILE n 
14 183  GLU n 
14 184  SER n 
14 185  ILE n 
14 186  VAL n 
14 187  VAL n 
14 188  ASP n 
14 189  PHE n 
14 190  LYS n 
14 191  ASN n 
14 192  LYS n 
14 193  GLU n 
14 194  ASN n 
14 195  ASP n 
14 196  ASN n 
14 197  VAL n 
14 198  PRO n 
14 199  SER n 
14 200  THR n 
14 201  LYS n 
14 202  PHE n 
14 203  ASN n 
14 204  ALA n 
14 205  ALA n 
14 206  PRO n 
14 207  GLU n 
14 208  GLU n 
14 209  ASN n 
14 210  ALA n 
14 211  THR n 
14 212  GLU n 
14 213  GLY n 
14 214  PRO n 
14 215  SER n 
14 216  ASP n 
14 217  LYS n 
14 218  LYS n 
14 219  LEU n 
14 220  ASN n 
14 221  LEU n 
14 222  ASN n 
14 223  LEU n 
14 224  PRO n 
14 225  LEU n 
14 226  GLN n 
14 227  PHE n 
14 228  SER n 
14 229  LEU n 
14 230  PRO n 
14 231  ASN n 
14 232  GLY n 
14 233  ASP n 
14 234  ASN n 
14 235  SER n 
14 236  THR n 
14 237  THR n 
14 238  THR n 
14 239  ASN n 
14 240  THR n 
14 241  ASP n 
14 242  GLN n 
14 243  ASN n 
14 244  ASN n 
14 245  ALA n 
14 246  THR n 
14 247  MET n 
14 248  GLY n 
14 249  GLU n 
14 250  GLU n 
14 251  THR n 
14 252  ALA n 
14 253  LYS n 
14 254  LYS n 
14 255  ASP n 
14 256  MET n 
14 257  SER n 
14 258  SER n 
14 259  THR n 
14 260  THR n 
14 261  PRO n 
14 262  LYS n 
14 263  LEU n 
14 264  GLU n 
14 265  SER n 
14 266  VAL n 
14 267  LYS n 
14 268  TRP n 
14 269  GLN n 
14 270  TYR n 
14 271  ASP n 
14 272  PRO n 
14 273  ASN n 
14 274  ASN n 
14 275  PRO n 
14 276  VAL n 
14 277  ASP n 
14 278  PHE n 
14 279  ASP n 
14 280  GLY n 
14 281  LEU n 
14 282  ASP n 
14 283  ILE n 
14 284  LYS n 
14 285  ARG n 
14 286  VAL n 
14 287  GLY n 
14 288  SER n 
14 289  GLU n 
14 290  ASN n 
14 291  VAL n 
14 292  GLU n 
14 293  CYS n 
14 294  THR n 
14 295  ILE n 
14 296  SER n 
14 297  ILE n 
14 298  LEU n 
14 299  ARG n 
14 300  LYS n 
14 301  SER n 
14 302  SER n 
14 303  PRO n 
14 304  GLU n 
14 305  GLU n 
14 306  PRO n 
14 307  PHE n 
14 308  MET n 
14 309  SER n 
14 310  TYR n 
14 311  SER n 
14 312  PRO n 
14 313  GLN n 
14 314  LEU n 
14 315  THR n 
14 316  ALA n 
14 317  ILE n 
14 318  ILE n 
14 319  GLY n 
14 320  LEU n 
14 321  LYS n 
14 322  SER n 
14 323  GLY n 
14 324  THR n 
14 325  SER n 
14 326  HIS n 
14 327  ASP n 
14 328  ALA n 
14 329  ILE n 
14 330  PHE n 
14 331  SER n 
14 332  ILE n 
14 333  TYR n 
14 334  LYS n 
14 335  TYR n 
14 336  ILE n 
14 337  HIS n 
14 338  LEU n 
14 339  ASN n 
14 340  GLU n 
14 341  LEU n 
14 342  LEU n 
14 343  THR n 
14 344  ASN n 
14 345  ASP n 
14 346  GLU n 
14 347  SER n 
14 348  ALA n 
14 349  PHE n 
14 350  GLU n 
14 351  ASN n 
14 352  LEU n 
14 353  MET n 
14 354  GLY n 
14 355  ASN n 
14 356  ARG n 
14 357  ASN n 
14 358  ASN n 
14 359  HIS n 
14 360  ASN n 
14 361  SER n 
14 362  ASN n 
14 363  THR n 
14 364  SER n 
14 365  THR n 
14 366  SER n 
14 367  LYS n 
14 368  MET n 
14 369  LEU n 
14 370  ASP n 
14 371  ALA n 
14 372  ALA n 
14 373  SER n 
14 374  SER n 
14 375  GLN n 
14 376  VAL n 
14 377  SER n 
14 378  ILE n 
14 379  VAL n 
14 380  LYS n 
14 381  LEU n 
14 382  ASP n 
14 383  THR n 
14 384  GLN n 
14 385  LEU n 
14 386  ILE n 
14 387  THR n 
14 388  LEU n 
14 389  LEU n 
14 390  PRO n 
14 391  SER n 
14 392  SER n 
14 393  LEU n 
14 394  LYS n 
14 395  GLU n 
14 396  SER n 
14 397  SER n 
14 398  PRO n 
14 399  ASP n 
14 400  THR n 
14 401  MET n 
14 402  LYS n 
14 403  LEU n 
14 404  THR n 
14 405  ASP n 
14 406  LEU n 
14 407  LEU n 
14 408  SER n 
14 409  LEU n 
14 410  ILE n 
14 411  ASN n 
14 412  SER n 
14 413  THR n 
14 414  HIS n 
14 415  LEU n 
14 416  LEU n 
14 417  PRO n 
14 418  LEU n 
14 419  GLN n 
14 420  PRO n 
14 421  ILE n 
14 422  GLU n 
14 423  ILE n 
14 424  ASP n 
14 425  TYR n 
14 426  THR n 
14 427  VAL n 
14 428  ARG n 
14 429  VAL n 
14 430  ASP n 
14 431  LYS n 
14 432  ALA n 
14 433  SER n 
14 434  THR n 
14 435  TYR n 
14 436  GLY n 
14 437  GLU n 
14 438  LEU n 
14 439  VAL n 
14 440  LEU n 
14 441  ASP n 
14 442  ILE n 
14 443  GLU n 
14 444  VAL n 
14 445  PRO n 
14 446  ASP n 
14 447  VAL n 
14 448  ASN n 
14 449  ALA n 
14 450  LEU n 
14 451  LYS n 
14 452  PHE n 
14 453  ASN n 
14 454  ASN n 
14 455  THR n 
14 456  GLN n 
14 457  ARG n 
14 458  GLU n 
14 459  SER n 
14 460  GLN n 
14 461  ILE n 
14 462  GLY n 
14 463  ALA n 
14 464  ALA n 
14 465  GLU n 
14 466  LEU n 
14 467  ASN n 
14 468  GLU n 
14 469  ASN n 
14 470  ALA n 
14 471  ARG n 
14 472  GLU n 
14 473  LEU n 
14 474  GLU n 
14 475  GLN n 
14 476  ILE n 
14 477  LYS n 
14 478  PRO n 
14 479  LYS n 
14 480  ILE n 
14 481  ALA n 
14 482  LEU n 
14 483  GLN n 
14 484  ASP n 
14 485  LYS n 
14 486  GLU n 
14 487  ILE n 
14 488  THR n 
14 489  SER n 
14 490  VAL n 
14 491  LEU n 
14 492  SER n 
14 493  ASN n 
14 494  LEU n 
14 495  HIS n 
14 496  GLU n 
14 497  SER n 
14 498  ASN n 
14 499  LYS n 
14 500  ARG n 
14 501  TYR n 
14 502  ARG n 
14 503  PHE n 
14 504  PHE n 
14 505  LYS n 
14 506  LYS n 
14 507  ILE n 
14 508  SER n 
14 509  GLU n 
14 510  ASP n 
14 511  PRO n 
14 512  VAL n 
14 513  LYS n 
14 514  ALA n 
14 515  LEU n 
14 516  ASN n 
14 517  GLU n 
14 518  CYS n 
14 519  ILE n 
14 520  ALA n 
14 521  SER n 
14 522  THR n 
14 523  SER n 
14 524  ASN n 
14 525  ALA n 
14 526  LEU n 
14 527  LYS n 
14 528  VAL n 
14 529  LEU n 
14 530  SER n 
14 531  GLY n 
14 532  ASP n 
14 533  GLU n 
14 534  GLY n 
14 535  TYR n 
14 536  ASN n 
14 537  GLU n 
14 538  ASP n 
14 539  MET n 
14 540  VAL n 
14 541  ARG n 
14 542  ARG n 
14 543  ALA n 
14 544  ASN n 
14 545  PHE n 
14 546  TYR n 
14 547  LYS n 
14 548  GLU n 
14 549  ASN n 
14 550  GLU n 
14 551  ALA n 
14 552  MET n 
14 553  LEU n 
14 554  ARG n 
14 555  GLU n 
14 556  ASN n 
14 557  ILE n 
14 558  GLU n 
14 559  VAL n 
14 560  ILE n 
14 561  LEU n 
14 562  SER n 
14 563  ASN n 
14 564  GLY n 
14 565  ARG n 
14 566  MET n 
15 1    MET n 
15 2    GLY n 
15 3    VAL n 
15 4    ILE n 
15 5    LYS n 
15 6    LYS n 
15 7    LYS n 
15 8    ARG n 
15 9    SER n 
15 10   HIS n 
15 11   HIS n 
15 12   GLY n 
15 13   LYS n 
15 14   ALA n 
15 15   SER n 
15 16   ARG n 
15 17   GLN n 
15 18   GLN n 
15 19   TYR n 
15 20   TYR n 
15 21   SER n 
15 22   GLY n 
15 23   VAL n 
15 24   GLN n 
15 25   VAL n 
15 26   GLY n 
15 27   GLY n 
15 28   VAL n 
15 29   GLY n 
15 30   SER n 
15 31   MET n 
15 32   GLY n 
15 33   ALA n 
15 34   ILE n 
15 35   ASN n 
15 36   ASN n 
15 37   ASN n 
15 38   ILE n 
15 39   PRO n 
15 40   SER n 
15 41   LEU n 
15 42   THR n 
15 43   SER n 
15 44   PHE n 
15 45   ALA n 
15 46   GLU n 
15 47   GLU n 
15 48   ASN n 
15 49   ASN n 
15 50   TYR n 
15 51   GLN n 
15 52   TYR n 
15 53   GLY n 
15 54   TYR n 
15 55   SER n 
15 56   GLY n 
15 57   SER n 
15 58   SER n 
15 59   ALA n 
15 60   GLY n 
15 61   MET n 
15 62   ASN n 
15 63   GLY n 
15 64   ARG n 
15 65   SER n 
15 66   LEU n 
15 67   THR n 
15 68   TYR n 
15 69   ALA n 
15 70   GLN n 
15 71   GLN n 
15 72   GLN n 
15 73   LEU n 
15 74   ASN n 
15 75   LYS n 
15 76   GLN n 
15 77   ARG n 
15 78   GLN n 
15 79   ASP n 
15 80   PHE n 
15 81   GLU n 
15 82   ARG n 
15 83   VAL n 
15 84   ARG n 
15 85   LEU n 
15 86   ARG n 
15 87   PRO n 
15 88   GLU n 
15 89   GLN n 
15 90   LEU n 
15 91   SER n 
15 92   ASN n 
15 93   ILE n 
15 94   ILE n 
15 95   HIS n 
15 96   ASP n 
15 97   GLU n 
15 98   SER n 
15 99   ASP n 
15 100  THR n 
15 101  ILE n 
15 102  SER n 
15 103  PHE n 
15 104  ARG n 
15 105  SER n 
15 106  ASN n 
15 107  LEU n 
15 108  LEU n 
15 109  LYS n 
15 110  ASN n 
15 111  PHE n 
15 112  ILE n 
15 113  SER n 
15 114  SER n 
15 115  ASN n 
15 116  ASP n 
15 117  ALA n 
15 118  PHE n 
15 119  ASN n 
15 120  MET n 
15 121  LEU n 
15 122  SER n 
15 123  LEU n 
15 124  THR n 
15 125  THR n 
15 126  VAL n 
15 127  PRO n 
15 128  CYS n 
15 129  ASP n 
15 130  ARG n 
15 131  ILE n 
15 132  GLU n 
15 133  LYS n 
15 134  SER n 
15 135  ARG n 
15 136  LEU n 
15 137  PHE n 
15 138  SER n 
15 139  GLU n 
15 140  LYS n 
15 141  THR n 
15 142  ILE n 
15 143  ARG n 
15 144  TYR n 
15 145  LEU n 
15 146  MET n 
15 147  GLN n 
15 148  LYS n 
15 149  GLN n 
15 150  HIS n 
15 151  UNK n 
15 152  UNK n 
15 153  UNK n 
15 154  UNK n 
15 155  UNK n 
15 156  UNK n 
15 157  UNK n 
15 158  UNK n 
15 159  UNK n 
15 160  UNK n 
15 161  UNK n 
15 162  UNK n 
15 163  UNK n 
15 164  UNK n 
15 165  UNK n 
15 166  UNK n 
15 167  UNK n 
15 168  UNK n 
15 169  UNK n 
15 170  UNK n 
15 171  UNK n 
15 172  UNK n 
15 173  UNK n 
15 174  UNK n 
15 175  UNK n 
15 176  UNK n 
15 177  UNK n 
15 178  UNK n 
15 179  UNK n 
16 1    UNK n 
16 2    UNK n 
16 3    UNK n 
16 4    UNK n 
16 5    UNK n 
16 6    UNK n 
16 7    UNK n 
16 8    UNK n 
16 9    UNK n 
16 10   UNK n 
16 11   UNK n 
16 12   UNK n 
16 13   UNK n 
16 14   UNK n 
16 15   UNK n 
16 16   UNK n 
16 17   UNK n 
16 18   UNK n 
16 19   UNK n 
16 20   UNK n 
16 21   UNK n 
16 22   UNK n 
16 23   UNK n 
16 24   UNK n 
16 25   UNK n 
16 26   UNK n 
16 27   UNK n 
16 28   UNK n 
16 29   UNK n 
16 30   UNK n 
16 31   UNK n 
16 32   UNK n 
16 33   UNK n 
16 34   UNK n 
16 35   UNK n 
16 36   UNK n 
16 37   UNK n 
16 38   UNK n 
16 39   UNK n 
16 40   UNK n 
16 41   UNK n 
16 42   UNK n 
16 43   UNK n 
16 44   UNK n 
16 45   UNK n 
16 46   UNK n 
16 47   UNK n 
16 48   UNK n 
16 49   UNK n 
16 50   UNK n 
16 51   UNK n 
16 52   UNK n 
16 53   UNK n 
16 54   UNK n 
16 55   UNK n 
16 56   UNK n 
16 57   UNK n 
16 58   UNK n 
16 59   UNK n 
16 60   UNK n 
16 61   UNK n 
16 62   UNK n 
16 63   UNK n 
16 64   UNK n 
16 65   UNK n 
16 66   UNK n 
16 67   UNK n 
17 1    UNK n 
17 2    UNK n 
17 3    UNK n 
17 4    UNK n 
17 5    UNK n 
17 6    UNK n 
17 7    UNK n 
17 8    UNK n 
17 9    UNK n 
17 10   UNK n 
17 11   UNK n 
17 12   UNK n 
17 13   UNK n 
17 14   UNK n 
17 15   UNK n 
17 16   UNK n 
17 17   UNK n 
17 18   UNK n 
17 19   UNK n 
17 20   UNK n 
17 21   UNK n 
17 22   UNK n 
17 23   UNK n 
17 24   UNK n 
17 25   UNK n 
17 26   UNK n 
17 27   UNK n 
17 28   UNK n 
17 29   UNK n 
17 30   UNK n 
17 31   UNK n 
17 32   UNK n 
17 33   UNK n 
17 34   UNK n 
17 35   UNK n 
17 36   UNK n 
17 37   UNK n 
17 38   UNK n 
17 39   UNK n 
17 40   UNK n 
17 41   UNK n 
17 42   UNK n 
17 43   UNK n 
17 44   UNK n 
17 45   UNK n 
17 46   UNK n 
17 47   UNK n 
17 48   UNK n 
17 49   UNK n 
17 50   UNK n 
17 51   UNK n 
17 52   UNK n 
17 53   UNK n 
17 54   UNK n 
17 55   UNK n 
17 56   UNK n 
17 57   UNK n 
17 58   UNK n 
17 59   UNK n 
17 60   UNK n 
17 61   UNK n 
17 62   UNK n 
17 63   UNK n 
17 64   UNK n 
17 65   UNK n 
17 66   UNK n 
17 67   UNK n 
17 68   UNK n 
17 69   UNK n 
17 70   UNK n 
17 71   UNK n 
17 72   UNK n 
17 73   UNK n 
17 74   UNK n 
17 75   UNK n 
17 76   UNK n 
17 77   UNK n 
17 78   UNK n 
17 79   UNK n 
17 80   UNK n 
17 81   UNK n 
17 82   UNK n 
17 83   UNK n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 135 'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 102 'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 129 'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 122 'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
7  1 sample 1   477  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 1   467  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 1   157  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 1   1703 
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 1   1314 
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 1   905  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample 1   825  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample 1   566  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample 1   150  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 2 sample 151 179  
;Baker's yeast
;
'Saccharomyces cerevisiae S288C'                        559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample 1   67   
;Baker's yeast
;
'Saccharomyces cerevisiae S288C'                        559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample 1   83   
;Baker's yeast
;
'Saccharomyces cerevisiae S288C'                        559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample 1 185 'synthetic construct' ? 32630 ? 
6 1 sample 1 200 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP H32_XENLA   P84233 ? 1  
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2   
2  UNP H4_XENLA    P62799 ? 2  
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2   
3  UNP H2A1_XENLA  P06897 ? 3  
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
2   
4  UNP H2B11_XENLA P02281 ? 4  
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
5   
5  PDB 6UXW        6UXW   ? 5  ? 1   
6  PDB 6UXW        6UXW   ? 6  ? 1   
7  UNP ARP7_YEAST  Q12406 ? 7  
;MTLNRKCVVIHNGSHRTVAGFSNVELPQCIIPSSYIKRTDEGGEAEFIFGTYNMIDAAAEKRNGDEVYTLVDSQGLPYNW
DALEMQWRYLYDTQLKVSPEELPLVITMPATNGKPDMAILERYYELAFDKLNVPVFQIVIEPLAIALSMGKSSAFVIDIG
ASGCNVTPIIDGIVVKNAVVRSKFGGDFLDFQVHERLAPLIKEENDMENMADEQKRSTDVWYEASTWIQQFKSTMLQVSE
KDLFELERYYKEQADIYAKQQEQLKQMDQQLQYTALTGSPNNPLVQKKNFLFKPLNKTLTLDLKECYQFAEYLFKPQLIS
DKFSPEDGLGPLMAKSVKKAGASINSMKANTSTNPNGLGTSHINTNVGDNNSTASSSNISPEQVYSLLLTNVIITGSTSL
IEGMEQRIIKELSIRFPQYKLTTFANQVMMDRKIQGWLGALTMANLPSWSLGKWYSKEDYETLKRDRKQSQATNATN
;
1   
8  UNP ARP9_YEAST  Q05123 ? 8  
;MAPFRQDSILIIYPRSQTTLVQFGLNEETFTVPELEIPTQIYRTTRQDGSYTYHSTNKDNKAELIKPIQNGEIIDISAFT
QFLRLIFVSILSDRANKNQDAFEAELSNIPLLLITHHSWSQSDLEIITQYVFESLEINNLIQLPASLAATYSMISLQNCC
IIDVGTHHTDIIPIVDYAQLDHLVSSIPMGGQSINDSLKKLLPQWDDDQIESLKKSPIFEVLSDDAKKLSSFDFGNENED
EDEGTLNVAEIITSGRDTREVLEERERGQKVKNVKNSDLEFNTFWDEKGNEIKVGKQRFQGCNNLIKNISNRVGLTLDNI
DDINKAKAVWENIIIVGGTTSISGFKEALLGQLLKDHLIIEPEEEKSKREEEAKSVLPAATKKKSKFMTNSTAFVPTIEY
VQCPTVIKLAKYPDYFPEWKKSGYSEIIFLGAQIVSKQIFTHPKDTFYITREKYNMKGPAALWDVQF
;
1   
9  UNP RT102_YEAST P53330 ? 9  
;MDPQTLITKANKVSYYGNPTSKESWRYDWYQPSKVSSNVQQPQQQLGDMENNLEKYPFRYKTWLRNQEDEKNLQRESCED
ILDLKEFDRRILKKSLMTSHTKGDTSKATGAPSANQGDEALSVDDIRGAVGNSEAIPGLSAGVNNDNTKESKDVKMN
;
1   
10 UNP SNF2_YEAST  P22082 ? 10 
;MNIPQRQFSNEEVNRCYLRWQHLRNEHGMNAPSVPEFIYLTKVLQFAAKQRQELQMQRQQQGISGSQQNIVPNSSDQAEL
PNNASSHISASASPHLAPNMQLNGNETFSTSAHQSPIMQTQMPLNSNGGNNMLPQRQSSVGSLNATNFSPTPANNGENAA
EKPDNSNHNNLNLNNSELQPQNRSLQEHNIQDSNVMPGSQINSPMPQQAQMQQAQFQAQQAQQAQQAQQAQQAQARLQQG
RRLPMTMFTAEQSELLKAQITSLKCLVNRKPIPFEFQAVIQKSINHPPDFKRMLLSLSEFARRRQPTDQNNQSNLNGGNN
TQQPGTNSHYNNTNTDNVSGLTRNAPLDSKDENFASVSPAGPSSVHNAKNGTLDKNSQTVSGTPITQTESKKEENETISN
VAKTAPNSNKTHTEQNNPPKPQKPVPLNVLQDQYKEGIKVVDIDDPDMMVDSFTMPNISHSNIDYQTLLANSDHAKFTIE
PGVLPVGIDTHTATDIYQTLIALNLDTTVNDCLDKLLNDECTESTRENALYDYYALQLLPLQKAVRGHVLQFEWHQNSLL
TNTHPNFLSKIRNINVQDALLTNQLYKNHELLKLERKKTEAVARLKSMNKSAINQYNRRQDKKNKRLKFGHRLIATHTNL
ERDEQKRAEKKAKERLQALKANDEEAYIKLLDQTKDTRITHLLRQTNAFLDSLTRAVKDQQKYTKEMIDSHIKEASEEVD
DLSMVPKMKDEEYDDDDDNSNVDYYNVAHRIKEDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTI
QTISLLTYLYEMKNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKER
ALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPF
ANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNK
KMVGLRGFNNQIMQLKKICNHPFVFEEVEDQINPTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIME
DFLRYINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRI
GQKNEVRILRLITTNSVEEVILERAYKKLDIDGKVIQAGKFDNKSTSEEQEALLRSLLDAEEERRKKRESGVEEEEELKD
SEINEILARNDEEMAVLTRMDEDRSKKEEELGVKSRLLEKSELPDIYSRDIGAELKREESESAAVYNGRGARERKTATYN
DNMSEEQWLRQFEVSDDEKNDKQARKQRTKKEDKSEAIDGNGEIKGENIDADNDGPRINNISAEDRADTDLAMNDDDFLS
KKRKAGRPRGRPKKVKLEGSENSEPPALESSPVTGDNSPSEDFMDIPKPRTAGKTSVKSARTSTRGRGRGRGRGRGRGRG
RGRPPKARNGLDYVRTPAAATSPIDIREKVAKQALDLYHFALNYENEAGRKLSDIFLSKPSKALYPDYYMIIKYPVAFDN
INTHIETLAYNSLKETLQDFHLIFSNARIYNTEGSVVYEDSLELEKVVTKKYCEIMGDNSQLDFTEFDEQYGTRPLVLPP
VVTSSVAESFTDEADSSMTEASV
;
1   
11 UNP SWI1_YEAST  P09547 ? 11 
;MDFFNLNNNNNNNNTTTTTTTTNNNNTNNNNTNNNNNPANNTNNNNSTGHSSNTNNNTNNNNTNTGASGVDDFQNFFDPK
PFDQNLDSNNNNSNSNNNDNNNSNTVASSTNFTSPTAVVNNAAPANVTGGKAANFIQNQSPQFNSPYDSNNSNTNLNSLS
PQAILAKNSIIDSSNLPLQAQQQLYGGNNNNNSTGIANDNVITPHFITNVQSISQNSSSSTPNTNSNSTPNANQQFLPFN
NSASNNGNLTSNQLISNYAASNSMDRSSSASNEFVPNTSDNNNNSNNHNMRNNSNNKTSNNNNVTAVPAATPANTNNSTS
NANTVFSERAAMFAALQQKQQQRFQALQQQQQQQQNQQQQNQQPQQQQQQQQNPKFLQSQRQQQQRSILQSLNPALQEKI
STELNNKQYELFMKSLIENCKKRNMPLQSIPEIGNRKINLFYLYMLVQKFGGADQVTRTQQWSMVAQRLQISDYQQLESI
YFRILLPYERHMISQEGIKETQAKRIFLQQFLQELLKKVQQQQQAAALANANNNINSASSAPTPAAPGASVPATAAPGTE
AGIVPVSANTPKSLNSNININVNNNNIGQQQVKKPRKQRVKKKTKKELELERKEREDFQKRQQKLLEDQQRQQKLLLETK
LRQQYEIELKKLPKVYKRSIVRNYKPLINRLKHYNGYDINYISKIGEKIDSNKPIFLFAPELGAINLHALSMSLQSKNLG
EINTALNTLLVTSADSNLKISLVKYPELLDSLAILGMNLLSNLSQNVVPYHRNTSDYYYEDAGSNQYYVTQHDKMVDKIF
EKVNNNATLTPNDSNDEKVTILVDSLTGNQLPTPTPTEMEPDLDTECFISMQSTSPAVKQWDLLPEPIRFLPNQFPLKIH
RTPYLTSLKKIKDEIDDPFTKINTRGAEDPKVLINDQLSTISMILRNISFSDNNSRIMSRNFYLKRFISDLLWLVLIHPE
NFTCNRKILNFKKDLVIVLSNISHLLEIASSIDCLLILILVISFGQPKLNPMASSSSFGSESLTFNEFQLQWGKYQTFGV
DILAKLFSLEKPNLNYFKSILLNKNTGNNLYDRNSNNNHKDKKLLRRLLNLYNDNNKNNNNRHNLLNDVVSFLFSAIPLQ
QVLSQSADPSLLIDQFSPVISQSLTSILVIVQKILPLSNEVFEISENNSDSNSNNNGNKDSSFNFNKNLPFVWLSSEENI
GSGLLKLSEIILNINNSTSKNTLLQQQNYSKVLLPSINISCVQLIKCLVEKSICFENCLNNDPEILKKIASIPNLFPTDL
EIFQLFTNPSVDIQIINQYQLLYNLKNDILTNLE
;
1   
12 UNP SNF5_YEAST  P18480 ? 12 
;MNNQPQGTNSVPNSIGNIFSNIGTPSFNMAQIPQQLYQSLTPQQLQMIQQRHQQLLRSRLQQQQQQQQQTSPPPQTHQSP
PPPPQQSQPIANQSATSTPPPPPAPHNLHPQIGQVPLAPAPINLPPQIAQLPLATQQQVLNKLRQQAIAKNNPQVVNAIT
VAQQQVQRQIEQQKGQQTAQTQLEQQRQLLVQQQQQQQLRNQIQRQQQQQFRHHVQIQQQQQKQQQQQQQHQQQQQQQQQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQQGQIPQSQQVPQVRSMSGQPPTNVQPTIGQLPQLPKLNLPKYQTIQYDPPETK
LPYPTYWSDKKADTDTLLYEQIIQRDKINKYSLIRETNGYDPFSIYGFSNKEYISRLWHTLKYYQDLKNTRMKSITSTSQ
KIPSASIWGNGYSGYGNGITNTTTRVIPQVEVGNRKHYLEDKLKVYKQAMNETSEQLVPIRLEFDQDRDRFFLRDTLLWN
KNDKLIKIEDFVDDMLRDYRFEDATREQHIDTICQSIQEQIQEFQGNPYIELNQDRLGGDDLRIRIKLDIVVGQNQLIDQ
FEWDISNSDNCPEEFAESMCQELELPGEFVTAIAHSIREQVHMYHKSLALLGYNFDGSAIEDDDIRSRMLPTITLDDVYR
PAAESKIFTPNLLQISAAELERLDKDKDRDTRRKRRQGRSNRRGMLALSGTSASNTSMNGVHNTVAAGNASSLPPGEILL
PDIADIPRTFRTPVPSTLMPGGVDVGPSVESYELRNTTTYKSRPDRPKPVSPPCYIIDHIPGHSLLLSIKLPGKVNTKEE
FAAAPNDTSSGTNAMLPSPESLKTKLNSNIRAGVTIPSIPNPIANHTVTNSPNPTLQPVIPGGAASKSVPTPSLPIAPPV
APHDSEATLLTNSNNGSSNNNTQNT
;
1   
13 UNP SWI3_YEAST  P32591 ? 13 
;MENTLGEGSTVNASVDVDQHGNDNNSDSNANAAVAGVANTDTAGEESQQQDESLKDEATVPNTRDAESEAITVTAKQQPT
MQANKLDSQETPSTEESRAQNVFGQDNEDSDNLFGETESSVSNNEANTPSIPTNPVDNENNKPAIKEDSTIQDSNGDVKN
MEDVKIQKEEEPENNTVIEGVKEESQPDENTKEMDEVEEDDEDDDQPMISPDNSIFGDTKSESKQLGNTSSVANTPSEIP
DAHKAEQEDIIEKTESVDKKVDSGEERNEQEREIMNDHSKSANPKKTTITRVEPETFEIPQAHEIVIPSYSKWFNLEKIH
SIEVQSLPEFFTNRIPSKTPEVYMRYRNFMVNSYRLNPNEYFSVTTARRNVSGDAAALFRLHKFLTKWGLINYQVDSKLL
PKNIEPPLTSQYSTRHDAPRGLFPFESYKPSVQLPDMAKLKKMMNTSDSESTLYKYLKESKRKYDEITHPPSTTDDENGD
KNDNGGKMNNEVSTSTSMTGDANLLEEGETSRPLKKVKILEQIDENWSKEDLQKLLKGIQEFGADWYKVAKNVGNKSPEQ
CILRFLQLPIEDKFLYGDGNGKGDNDNGLGPLKYAPHLPFSKSENPVLSTIAFLVGLVNPKTVQSMTQRAIQSAESIKSQ
KEEISDQKPIEHIKEGSEIAISSLGYRSHIFATNEERQMNFLTNELIRLQMEKLDAKLNHLKKLEKFMELERKTLERQQE
NLLIQRLNFNQNSSKIVNVLSKCLNLISDSNINNSSVAEKEEIRSQIDHFKSMLSKPETLSIGKNPFNKPNIETGENHNG
QSISNENDVKPISIEAPQFYRYWSA
;
1   
14 UNP SNF12_YEAST P53628 ? 14 
;MSKVMKPSNGKGSRKSSKAATPDTKNFFHAKKKDPVNQDKANNASQITPTVPHSHPSDMVIPDHLAELIPELYSFQQLVD
SEKRLDHFIHLRNLHMKRMVAQWERSKLSQEFLYPHLNFPNVKFLRIFISNVSENQPWQMDTNNEADLMALENATWTMRI
EGRLLDNVQANDPAREKFSSFIESIVVDFKNKENDNVPSTKFNAAPEENATEGPSDKKLNLNLPLQFSLPNGDNSTTTNT
DQNNATMGEETAKKDMSSTTPKLESVKWQYDPNNPVDFDGLDIKRVGSENVECTISILRKSSPEEPFMSYSPQLTAIIGL
KSGTSHDAIFSIYKYIHLNELLTNDESAFENLMGNRNNHNSNTSTSKMLDAASSQVSIVKLDTQLITLLPSSLKESSPDT
MKLTDLLSLINSTHLLPLQPIEIDYTVRVDKASTYGELVLDIEVPDVNALKFNNTQRESQIGAAELNENARELEQIKPKI
ALQDKEITSVLSNLHESNKRYRFFKKISEDPVKALNECIASTSNALKVLSGDEGYNEDMVRRANFYKENEAMLRENIEVI
LSNGRM
;
1   
15 UNP SNF6_YEAST  P18888 ? 15 
;MGVIKKKRSHHGKASRQQYYSGVQVGGVGSMGAINNNIPSLTSFAEENNYQYGYSGSSAGMNGRSLTYAQQQLNKQRQDF
ERVRLRPEQLSNIIHDESDTISFRSNLLKNFISSNDAFNMLSLTTVPCDRIEKSRLFSEKTIRYLMQKQH
;
1   
16 PDB 6UXW        6UXW   ? 15 ? 151 
17 PDB 6UXW        6UXW   ? 16 ? 1   
18 PDB 6UXW        6UXW   ? 17 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6UXW R 1   ? 135  ? P84233 2   ? 136  ? 1   135  
2  2  6UXW S 1   ? 102  ? P62799 2   ? 103  ? 1   102  
3  3  6UXW T 1   ? 129  ? P06897 2   ? 130  ? 1   129  
4  4  6UXW U 1   ? 122  ? P02281 5   ? 126  ? 1   122  
5  1  6UXW V 1   ? 135  ? P84233 2   ? 136  ? 1   135  
6  2  6UXW W 1   ? 102  ? P62799 2   ? 103  ? 1   102  
7  3  6UXW X 1   ? 129  ? P06897 2   ? 130  ? 1   129  
8  4  6UXW Y 1   ? 122  ? P02281 5   ? 126  ? 1   122  
9  5  6UXW a 1   ? 185  ? 6UXW   1   ? 185  ? 1   185  
10 6  6UXW b 1   ? 200  ? 6UXW   -44 ? 155  ? -44 155  
11 7  6UXW P 1   ? 477  ? Q12406 1   ? 477  ? 1   477  
12 8  6UXW Q 1   ? 467  ? Q05123 1   ? 467  ? 1   467  
13 9  6UXW Z 1   ? 157  ? P53330 1   ? 157  ? 1   157  
14 10 6UXW A 1   ? 1703 ? P22082 1   ? 1703 ? 1   1703 
15 11 6UXW B 1   ? 1314 ? P09547 1   ? 1314 ? 1   1314 
16 12 6UXW C 1   ? 905  ? P18480 1   ? 905  ? 1   905  
17 13 6UXW D 1   ? 825  ? P32591 1   ? 825  ? 1   825  
18 13 6UXW E 1   ? 825  ? P32591 1   ? 825  ? 1   825  
19 13 6UXW F 1   ? 825  ? P32591 1   ? 825  ? 1   825  
20 13 6UXW G 1   ? 825  ? P32591 1   ? 825  ? 1   825  
21 14 6UXW H 1   ? 566  ? P53628 1   ? 566  ? 1   566  
22 15 6UXW I 1   ? 150  ? P18888 1   ? 150  ? 1   150  
23 16 6UXW I 151 ? 179  ? 6UXW   152 ? 180  ? 152 180  
24 17 6UXW J 1   ? 67   ? 6UXW   1   ? 67   ? 1   67   
25 17 6UXW K 1   ? 67   ? 6UXW   2   ? 68   ? 2   68   
26 17 6UXW L 1   ? 67   ? 6UXW   5   ? 71   ? 5   71   
27 18 6UXW M 1   ? 83   ? 6UXW   1   ? 84   ? 1   84   
28 17 6UXW N 1   ? 67   ? 6UXW   3   ? 69   ? 3   69   
29 17 6UXW O 1   ? 67   ? 6UXW   3   ? 69   ? 3   69   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6UXW ALA R 102 ? UNP P84233 GLY 103 conflict 102 1 
3 6UXW ARG T 99  ? UNP P06897 GLY 100 conflict 99  2 
3 6UXW SER T 123 ? UNP P06897 ALA 124 conflict 123 3 
4 6UXW THR U 29  ? UNP P02281 SER 33  conflict 29  4 
5 6UXW ALA V 102 ? UNP P84233 GLY 103 conflict 102 5 
7 6UXW ARG X 99  ? UNP P06897 GLY 100 conflict 99  6 
7 6UXW SER X 123 ? UNP P06897 ALA 124 conflict 123 7 
8 6UXW THR Y 29  ? UNP P02281 SER 33  conflict 29  8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"           ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
BEF non-polymer         . 'BERYLLIUM TRIFLUORIDE ION'          ? 'Be F3 -1'          66.007  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                      ? 'O4 P -3'           94.971  
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
UNK 'L-peptide linking' . UNKNOWN                              ? 'C4 H9 N O2'        103.120 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6UXW 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 6UXW 
_refine.pdbx_diffrn_id                           ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            . 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.006 ? 16924 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.777 ? 22956 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 5.667 ? 10401 ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.041 ? 2687  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.005 ? 3000  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6UXW 
_struct.title                        'SWI/SNF nucleosome complex with ADP-BeFx' 
_struct.pdbx_descriptor              
;Histone H3.2, Histone H4, Histone H2A type 1, Histone H2B 1.1, Actin-related protein 7, Actin-like protein ARP9, Regulator of Ty1 transposition protein 102, Transcription regulatory protein SNF2, SWI/SNF chromatin-remodeling complex subunit SWI1, SWI/SNF chromatin-remodeling complex subunit SNF5, SWI/SNF complex subunit SWI3, Transcription regulatory protein SNF12, Transcription regulatory protein SNF6, SWI/SNF global transcription activator complex subunit SWP82/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6UXW 
_struct_keywords.text            'SWI/SNF, chromatin remodeler, TRANSCRIPTION, TRANSCRIPTION-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 1  ? 
F  N N 2  ? 
G  N N 3  ? 
H  N N 4  ? 
I  N N 5  ? 
J  N N 6  ? 
K  N N 7  ? 
L  N N 8  ? 
M  N N 9  ? 
N  N N 10 ? 
O  N N 11 ? 
P  N N 12 ? 
Q  N N 13 ? 
R  N N 13 ? 
S  N N 13 ? 
T  N N 13 ? 
U  N N 14 ? 
V  N N 15 ? 
W  N N 16 ? 
X  N N 16 ? 
Y  N N 16 ? 
Z  N N 17 ? 
AA N N 16 ? 
BA N N 16 ? 
CA N N 18 ? 
DA N N 18 ? 
EA N N 18 ? 
FA N N 18 ? 
GA N N 18 ? 
HA N N 18 ? 
IA N N 18 ? 
JA N N 18 ? 
KA N N 18 ? 
LA N N 18 ? 
MA N N 18 ? 
NA N N 18 ? 
OA N N 19 ? 
PA N N 20 ? 
QA N N 21 ? 
RA N N 22 ? 
SA N N 22 ? 
TA N N 22 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A  44   ? SER A  57   ? GLY R 44   SER R 57   1 ? 14 
HELX_P HELX_P2   AA2 ARG A  63   ? ASP A  77   ? ARG R 63   ASP R 77   1 ? 15 
HELX_P HELX_P3   AA3 GLN A  85   ? ALA A  114  ? GLN R 85   ALA R 114  1 ? 30 
HELX_P HELX_P4   AA4 MET A  120  ? ARG A  131  ? MET R 120  ARG R 131  1 ? 12 
HELX_P HELX_P5   AA5 ASN B  25   ? ILE B  29   ? ASN S 25   ILE S 29   5 ? 5  
HELX_P HELX_P6   AA6 THR B  30   ? GLY B  42   ? THR S 30   GLY S 42   1 ? 13 
HELX_P HELX_P7   AA7 LEU B  49   ? ALA B  76   ? LEU S 49   ALA S 76   1 ? 28 
HELX_P HELX_P8   AA8 THR B  82   ? GLY B  94   ? THR S 82   GLY S 94   1 ? 13 
HELX_P HELX_P9   AA9 THR C  16   ? ALA C  21   ? THR T 16   ALA T 21   1 ? 6  
HELX_P HELX_P10  AB1 PRO C  26   ? GLY C  37   ? PRO T 26   GLY T 37   1 ? 12 
HELX_P HELX_P11  AB2 GLY C  46   ? ASN C  73   ? GLY T 46   ASN T 73   1 ? 28 
HELX_P HELX_P12  AB3 ILE C  79   ? ASN C  89   ? ILE T 79   ASN T 89   1 ? 11 
HELX_P HELX_P13  AB4 ASP C  90   ? GLY C  98   ? ASP T 90   GLY T 98   1 ? 9  
HELX_P HELX_P14  AB5 GLN C  112  ? LEU C  116  ? GLN T 112  LEU T 116  5 ? 5  
HELX_P HELX_P15  AB6 TYR D  34   ? HIS D  46   ? TYR U 34   HIS U 46   1 ? 13 
HELX_P HELX_P16  AB7 SER D  52   ? ASN D  81   ? SER U 52   ASN U 81   1 ? 30 
HELX_P HELX_P17  AB8 THR D  87   ? LEU D  99   ? THR U 87   LEU U 99   1 ? 13 
HELX_P HELX_P18  AB9 GLY D  101  ? ALA D  121  ? GLY U 101  ALA U 121  1 ? 21 
HELX_P HELX_P19  AC1 GLY E  44   ? SER E  57   ? GLY V 44   SER V 57   1 ? 14 
HELX_P HELX_P20  AC2 ARG E  63   ? ASP E  77   ? ARG V 63   ASP V 77   1 ? 15 
HELX_P HELX_P21  AC3 GLN E  85   ? ALA E  114  ? GLN V 85   ALA V 114  1 ? 30 
HELX_P HELX_P22  AC4 MET E  120  ? ARG E  131  ? MET V 120  ARG V 131  1 ? 12 
HELX_P HELX_P23  AC5 ASN F  25   ? ILE F  29   ? ASN W 25   ILE W 29   5 ? 5  
HELX_P HELX_P24  AC6 THR F  30   ? GLY F  42   ? THR W 30   GLY W 42   1 ? 13 
HELX_P HELX_P25  AC7 LEU F  49   ? ALA F  76   ? LEU W 49   ALA W 76   1 ? 28 
HELX_P HELX_P26  AC8 THR F  82   ? GLY F  94   ? THR W 82   GLY W 94   1 ? 13 
HELX_P HELX_P27  AC9 THR G  16   ? ALA G  21   ? THR X 16   ALA X 21   1 ? 6  
HELX_P HELX_P28  AD1 PRO G  26   ? GLY G  37   ? PRO X 26   GLY X 37   1 ? 12 
HELX_P HELX_P29  AD2 GLY G  46   ? ASN G  73   ? GLY X 46   ASN X 73   1 ? 28 
HELX_P HELX_P30  AD3 ILE G  79   ? ASN G  89   ? ILE X 79   ASN X 89   1 ? 11 
HELX_P HELX_P31  AD4 ASP G  90   ? GLY G  98   ? ASP X 90   GLY X 98   1 ? 9  
HELX_P HELX_P32  AD5 GLN G  112  ? LEU G  116  ? GLN X 112  LEU X 116  5 ? 5  
HELX_P HELX_P33  AD6 TYR H  34   ? HIS H  46   ? TYR Y 34   HIS Y 46   1 ? 13 
HELX_P HELX_P34  AD7 SER H  52   ? ASN H  81   ? SER Y 52   ASN Y 81   1 ? 30 
HELX_P HELX_P35  AD8 THR H  87   ? LEU H  99   ? THR Y 87   LEU Y 99   1 ? 13 
HELX_P HELX_P36  AD9 GLY H  101  ? ALA H  121  ? GLY Y 101  ALA Y 121  1 ? 21 
HELX_P HELX_P37  AE1 GLY K  50   ? GLU K  60   ? GLY P 50   GLU P 60   1 ? 11 
HELX_P HELX_P38  AE2 ASN K  79   ? GLN K  94   ? ASN P 79   GLN P 94   1 ? 16 
HELX_P HELX_P39  AE3 PRO K  115  ? PHE K  128  ? PRO P 115  PHE P 128  1 ? 14 
HELX_P HELX_P40  AE4 GLU K  141  ? SER K  148  ? GLU P 141  SER P 148  1 ? 8  
HELX_P HELX_P41  AE5 LYS K  176  ? VAL K  179  ? LYS P 176  VAL P 179  5 ? 4  
HELX_P HELX_P42  AE6 GLY K  185  ? ALA K  198  ? GLY P 185  ALA P 198  1 ? 14 
HELX_P HELX_P43  AE7 PRO K  199  ? ILE K  201  ? PRO P 199  ILE P 201  5 ? 3  
HELX_P HELX_P44  AE8 ARG K  216  ? THR K  226  ? ARG P 216  THR P 226  1 ? 11 
HELX_P HELX_P45  AE9 THR K  226  ? MET K  235  ? THR P 226  MET P 235  1 ? 10 
HELX_P HELX_P46  AF1 ASP K  242  ? GLU K  262  ? ASP P 242  GLU P 262  1 ? 21 
HELX_P HELX_P47  AF2 ASN K  282  ? VAL K  285  ? ASN P 282  VAL P 285  5 ? 4  
HELX_P HELX_P48  AF3 LYS K  293  ? ASN K  296  ? LYS P 293  ASN P 296  5 ? 4  
HELX_P HELX_P49  AF4 LEU K  303  ? LYS K  315  ? LEU P 303  LYS P 315  1 ? 13 
HELX_P HELX_P50  AF5 PRO K  316  ? ILE K  319  ? PRO P 316  ILE P 319  5 ? 4  
HELX_P HELX_P51  AF6 SER K  324  ? ASP K  327  ? SER P 324  ASP P 327  5 ? 4  
HELX_P HELX_P52  AF7 GLY K  328  ? LYS K  339  ? GLY P 328  LYS P 339  1 ? 12 
HELX_P HELX_P53  AF8 PRO K  381  ? LEU K  389  ? PRO P 381  LEU P 389  1 ? 9  
HELX_P HELX_P54  AF9 GLY K  396  ? ILE K  401  ? GLY P 396  ILE P 401  5 ? 6  
HELX_P HELX_P55  AG1 GLY K  403  ? PHE K  416  ? GLY P 403  PHE P 416  1 ? 14 
HELX_P HELX_P56  AG2 VAL K  428  ? ILE K  434  ? VAL P 428  ILE P 434  1 ? 7  
HELX_P HELX_P57  AG3 ILE K  434  ? ASN K  445  ? ILE P 434  ASN P 445  1 ? 12 
HELX_P HELX_P58  AG4 SER K  448  ? GLY K  452  ? SER P 448  GLY P 452  5 ? 5  
HELX_P HELX_P59  AG5 LYS K  457  ? LYS K  464  ? LYS P 457  LYS P 464  1 ? 8  
HELX_P HELX_P60  AG6 ARG L  5    ? SER L  8    ? ARG Q 5    SER Q 8    5 ? 4  
HELX_P HELX_P61  AG7 ASN L  57   ? LYS L  61   ? ASN Q 57   LYS Q 61   5 ? 5  
HELX_P HELX_P62  AG8 ASP L  75   ? GLN L  99   ? ASP Q 75   GLN Q 99   1 ? 25 
HELX_P HELX_P63  AG9 SER L  120  ? SER L  134  ? SER Q 120  SER Q 134  1 ? 15 
HELX_P HELX_P64  AH1 ALA L  145  ? MET L  153  ? ALA Q 145  MET Q 153  1 ? 9  
HELX_P HELX_P65  AH2 GLY L  190  ? LEU L  202  ? GLY Q 190  LEU Q 202  1 ? 13 
HELX_P HELX_P66  AH3 ASP L  206  ? LYS L  215  ? ASP Q 206  LYS Q 215  1 ? 10 
HELX_P HELX_P67  AH4 LYS L  275  ? LEU L  279  ? LYS Q 275  LEU Q 279  5 ? 5  
HELX_P HELX_P68  AH5 GLY L  295  ? GLN L  300  ? GLY Q 295  GLN Q 300  5 ? 6  
HELX_P HELX_P69  AH6 CYS L  302  ? ASP L  318  ? CYS Q 302  ASP Q 318  1 ? 17 
HELX_P HELX_P70  AH7 ASP L  322  ? TRP L  330  ? ASP Q 322  TRP Q 330  1 ? 9  
HELX_P HELX_P71  AH8 GLY L  337  ? ILE L  342  ? GLY Q 337  ILE Q 342  5 ? 6  
HELX_P HELX_P72  AH9 GLY L  344  ? LEU L  358  ? GLY Q 344  LEU Q 358  1 ? 15 
HELX_P HELX_P73  AI1 PRO L  362  ? ALA L  373  ? PRO Q 362  ALA Q 373  1 ? 12 
HELX_P HELX_P74  AI2 PHE L  416  ? GLY L  423  ? PHE Q 416  GLY Q 423  1 ? 8  
HELX_P HELX_P75  AI3 ILE L  427  ? THR L  441  ? ILE Q 427  THR Q 441  1 ? 15 
HELX_P HELX_P76  AI4 ARG L  451  ? GLY L  458  ? ARG Q 451  GLY Q 458  1 ? 8  
HELX_P HELX_P77  AI5 PRO L  459  ? VAL L  465  ? PRO Q 459  VAL Q 465  5 ? 7  
HELX_P HELX_P78  AI6 ASP M  2    ? ALA M  10   ? ASP Z 2    ALA Z 10   1 ? 9  
HELX_P HELX_P79  AI7 THR N  490  ? ASN N  518  ? THR A 490  ASN A 518  1 ? 29 
HELX_P HELX_P80  AI8 THR N  525  ? ASN N  557  ? THR A 525  ASN A 557  1 ? 33 
HELX_P HELX_P81  AI9 ASN N  575  ? ALA N  658  ? ASN A 575  ALA A 658  1 ? 84 
HELX_P HELX_P82  AJ1 ASP N  672  ? PHE N  689  ? ASP A 672  PHE A 689  1 ? 18 
HELX_P HELX_P83  AJ2 TYR N  744  ? ALA N  748  ? TYR A 744  ALA A 748  1 ? 5  
HELX_P HELX_P84  AJ3 ASP N  769  ? ASN N  784  ? ASP A 769  ASN A 784  1 ? 16 
HELX_P HELX_P85  AJ4 GLY N  797  ? LYS N  813  ? GLY A 797  LYS A 813  1 ? 17 
HELX_P HELX_P86  AJ5 LEU N  828  ? PHE N  835  ? LEU A 828  PHE A 835  1 ? 8  
HELX_P HELX_P87  AJ6 SER N  850  ? ILE N  861  ? SER A 850  ILE A 861  1 ? 12 
HELX_P HELX_P88  AJ7 ARG N  862  ? GLY N  864  ? ARG A 862  GLY A 864  5 ? 3  
HELX_P HELX_P89  AJ8 GLU N  874  ? GLU N  879  ? GLU A 874  GLU A 879  1 ? 6  
HELX_P HELX_P90  AJ9 GLU N  879  ? SER N  884  ? GLU A 879  SER A 884  1 ? 6  
HELX_P HELX_P91  AK1 GLU N  895  ? LYS N  900  ? GLU A 895  LYS A 900  1 ? 6  
HELX_P HELX_P92  AK2 SER N  904  ? ASN N  911  ? SER A 904  ASN A 911  1 ? 8  
HELX_P HELX_P93  AK3 GLU N  933  ? LEU N  942  ? GLU A 933  LEU A 942  1 ? 10 
HELX_P HELX_P94  AK4 LYS N  950  ? GLU N  954  ? LYS A 950  GLU A 954  5 ? 5  
HELX_P HELX_P95  AK5 LYS N  968  ? ARG N  988  ? LYS A 968  ARG A 988  1 ? 21 
HELX_P HELX_P96  AK6 LEU N  995  ? GLU N  1000 ? LEU A 995  GLU A 1000 1 ? 6  
HELX_P HELX_P97  AK7 SER N  1016 ? ARG N  1030 ? SER A 1016 ARG A 1030 1 ? 15 
HELX_P HELX_P98  AK8 ASN N  1049 ? HIS N  1061 ? ASN A 1049 HIS A 1061 1 ? 13 
HELX_P HELX_P99  AK9 PHE N  1065 ? ASN N  1073 ? PHE A 1065 ASN A 1073 1 ? 9  
HELX_P HELX_P100 AL1 ASN N  1079 ? TRP N  1083 ? ASN A 1079 TRP A 1083 5 ? 5  
HELX_P HELX_P101 AL2 GLY N  1087 ? GLY N  1103 ? GLY A 1087 GLY A 1103 1 ? 17 
HELX_P HELX_P102 AL3 THR N  1113 ? ILE N  1126 ? THR A 1113 ILE A 1126 1 ? 14 
HELX_P HELX_P103 AL4 SER N  1139 ? ASN N  1150 ? SER A 1139 ASN A 1150 1 ? 12 
HELX_P HELX_P104 AL5 THR N  1163 ? GLY N  1167 ? THR A 1163 GLY A 1167 1 ? 5  
HELX_P HELX_P105 AL6 ASN N  1186 ? ASP N  1195 ? ASN A 1186 ASP A 1195 1 ? 10 
HELX_P HELX_P106 AL7 VAL N  1217 ? ASP N  1232 ? VAL A 1217 ASP A 1232 1 ? 16 
HELX_P HELX_P107 AL8 GLU N  1248 ? GLU N  1269 ? GLU A 1248 GLU A 1269 1 ? 22 
HELX_P HELX_P108 AL9 LYS N  1279 ? ARG N  1289 ? LYS A 1279 ARG A 1289 1 ? 11 
HELX_P HELX_P109 AM1 ASN N  1290 ? LEU N  1297 ? ASN A 1290 LEU A 1297 1 ? 8  
HELX_P HELX_P110 AM2 THR N  1298 ? ASP N  1301 ? THR A 1298 ASP A 1301 5 ? 4  
HELX_P HELX_P111 AM3 GLU N  1338 ? ASN N  1347 ? GLU A 1338 ASN A 1347 1 ? 10 
HELX_P HELX_P112 AM4 ALA O  709  ? GLN O  715  ? ALA B 709  GLN B 715  1 ? 7  
HELX_P HELX_P113 AM5 LYS O  717  ? ALA O  734  ? LYS B 717  ALA B 734  1 ? 18 
HELX_P HELX_P114 AM6 PRO O  746  ? GLN O  765  ? PRO B 746  GLN B 765  1 ? 20 
HELX_P HELX_P115 AM7 HIS O  792  ? ASN O  805  ? HIS B 792  ASN B 805  1 ? 14 
HELX_P HELX_P116 AM8 LEU O  885  ? ILE O  895  ? LEU B 885  ILE B 895  1 ? 11 
HELX_P HELX_P117 AM9 ASP O  909  ? SER O  929  ? ASP B 909  SER B 929  1 ? 21 
HELX_P HELX_P118 AN1 ASN O  933  ? MET O  938  ? ASN B 933  MET B 938  1 ? 6  
HELX_P HELX_P119 AN2 ASN O  941  ? ILE O  957  ? ASN B 941  ILE B 957  1 ? 17 
HELX_P HELX_P120 AN3 CYS O  964  ? ASN O  981  ? CYS B 964  ASN B 981  1 ? 18 
HELX_P HELX_P121 AN4 ALA O  989  ? SER O  1003 ? ALA B 989  SER B 1003 1 ? 15 
HELX_P HELX_P122 AN5 LYS O  1034 ? LEU O  1046 ? LYS B 1034 LEU B 1046 1 ? 13 
HELX_P HELX_P123 AN6 ASN O  1053 ? LEU O  1061 ? ASN B 1053 LEU B 1061 1 ? 9  
HELX_P HELX_P124 AN7 HIS O  1079 ? ASN O  1090 ? HIS B 1079 ASN B 1090 1 ? 12 
HELX_P HELX_P125 AN8 LEU O  1091 ? ASN O  1093 ? LEU B 1091 ASN B 1093 5 ? 3  
HELX_P HELX_P126 AN9 LEU O  1105 ? PHE O  1114 ? LEU B 1105 PHE B 1114 1 ? 10 
HELX_P HELX_P127 AO1 PRO O  1129 ? SER O  1137 ? PRO B 1129 SER B 1137 1 ? 9  
HELX_P HELX_P128 AO2 SER O  1137 ? VAL O  1149 ? SER B 1137 VAL B 1149 1 ? 13 
HELX_P HELX_P129 AO3 GLY O  1203 ? ASN O  1216 ? GLY B 1203 ASN B 1216 1 ? 14 
HELX_P HELX_P130 AO4 VAL O  1232 ? LEU O  1259 ? VAL B 1232 LEU B 1259 1 ? 28 
HELX_P HELX_P131 AO5 PRO O  1263 ? ALA O  1270 ? PRO B 1263 ALA B 1270 1 ? 8  
HELX_P HELX_P132 AO6 THR O  1278 ? PHE O  1286 ? THR B 1278 PHE B 1286 1 ? 9  
HELX_P HELX_P133 AO7 ASP O  1292 ? GLU O  1314 ? ASP B 1292 GLU B 1314 1 ? 23 
HELX_P HELX_P134 AO8 LYS P  442  ? MET P  450  ? LYS C 442  MET C 450  1 ? 9  
HELX_P HELX_P135 AO9 LYS P  487  ? TYR P  499  ? LYS C 487  TYR C 499  1 ? 13 
HELX_P HELX_P136 AP1 ILE P  510  ? GLN P  522  ? ILE C 510  GLN C 522  1 ? 13 
HELX_P HELX_P137 AP2 PRO P  528  ? ASN P  533  ? PRO C 528  ASN C 533  1 ? 6  
HELX_P HELX_P138 AP3 CYS P  571  ? CYS P  580  ? CYS C 571  CYS C 580  1 ? 10 
HELX_P HELX_P139 AP4 GLY P  587  ? LEU P  610  ? GLY C 587  LEU C 610  1 ? 24 
HELX_P HELX_P140 AP5 SER P  645  ? THR P  649  ? SER C 645  THR C 649  5 ? 5  
HELX_P HELX_P141 AP6 PRO Q  308  ? LYS Q  312  ? PRO D 308  LYS D 312  5 ? 5  
HELX_P HELX_P142 AP7 HIS Q  320  ? LEU Q  327  ? HIS D 320  LEU D 327  1 ? 8  
HELX_P HELX_P143 AP8 PRO Q  328  ? THR Q  332  ? PRO D 328  THR D 332  5 ? 5  
HELX_P HELX_P144 AP9 THR Q  339  ? ASN Q  357  ? THR D 339  ASN D 357  1 ? 19 
HELX_P HELX_P145 AQ1 VAL Q  364  ? SER Q  372  ? VAL D 364  SER D 372  1 ? 9  
HELX_P HELX_P146 AQ2 ASP Q  374  ? TRP Q  388  ? ASP D 374  TRP D 388  1 ? 15 
HELX_P HELX_P147 AQ3 ASP Q  436  ? LYS Q  442  ? ASP D 436  LYS D 442  1 ? 7  
HELX_P HELX_P148 AQ4 SER Q  449  ? LYS Q  461  ? SER D 449  LYS D 461  1 ? 13 
HELX_P HELX_P149 AQ5 PRO R  308  ? LYS R  312  ? PRO E 308  LYS E 312  5 ? 5  
HELX_P HELX_P150 AQ6 HIS R  320  ? LEU R  327  ? HIS E 320  LEU E 327  1 ? 8  
HELX_P HELX_P151 AQ7 PRO R  328  ? PHE R  331  ? PRO E 328  PHE E 331  5 ? 4  
HELX_P HELX_P152 AQ8 THR R  339  ? ASN R  357  ? THR E 339  ASN E 357  1 ? 19 
HELX_P HELX_P153 AQ9 SER R  363  ? VAL R  371  ? SER E 363  VAL E 371  1 ? 9  
HELX_P HELX_P154 AR1 ALA R  375  ? TRP R  388  ? ALA E 375  TRP E 388  1 ? 14 
HELX_P HELX_P155 AR2 LYS R  429  ? LEU R  434  ? LYS E 429  LEU E 434  5 ? 6  
HELX_P HELX_P156 AR3 SER S  528  ? PHE S  542  ? SER F 528  PHE F 542  1 ? 15 
HELX_P HELX_P157 AR4 ASP S  545  ? ASN S  552  ? ASP F 545  ASN F 552  1 ? 8  
HELX_P HELX_P158 AR5 SER S  557  ? LEU S  566  ? SER F 557  LEU F 566  1 ? 10 
HELX_P HELX_P159 AR6 ILE S  611  ? GLN S  624  ? ILE F 611  GLN F 624  1 ? 14 
HELX_P HELX_P160 AR7 SER S  636  ? GLN S  647  ? SER F 636  GLN F 647  1 ? 12 
HELX_P HELX_P161 AR8 GLU S  651  ? ASP S  749  ? GLU F 651  ASP F 749  1 ? 99 
HELX_P HELX_P162 AR9 GLN S  766  ? LEU S  780  ? GLN F 766  LEU F 780  1 ? 15 
HELX_P HELX_P163 AS1 SER T  528  ? GLU T  541  ? SER G 528  GLU G 541  1 ? 14 
HELX_P HELX_P164 AS2 ASP T  545  ? ASN T  552  ? ASP G 545  ASN G 552  1 ? 8  
HELX_P HELX_P165 AS3 SER T  557  ? GLN T  567  ? SER G 557  GLN G 567  1 ? 11 
HELX_P HELX_P166 AS4 SER T  625  ? ALA T  630  ? SER G 625  ALA G 630  1 ? 6  
HELX_P HELX_P167 AS5 ALA T  634  ? GLU T  655  ? ALA G 634  GLU G 655  1 ? 22 
HELX_P HELX_P168 AS6 ASN T  680  ? ILE T  747  ? ASN G 680  ILE G 747  1 ? 68 
HELX_P HELX_P169 AS7 ARG T  764  ? THR T  779  ? ARG G 764  THR G 779  1 ? 16 
HELX_P HELX_P170 AS8 GLU U  82   ? TYR U  114  ? GLU H 82   TYR H 114  1 ? 33 
HELX_P HELX_P171 AS9 PRO U  115  ? LEU U  117  ? PRO H 115  LEU H 117  5 ? 3  
HELX_P HELX_P172 AT1 SER U  311  ? ILE U  318  ? SER H 311  ILE H 318  1 ? 8  
HELX_P HELX_P173 AT2 THR U  324  ? GLU U  340  ? THR H 324  GLU H 340  1 ? 17 
HELX_P HELX_P174 AT3 ASP U  382  ? THR U  387  ? ASP H 382  THR H 387  1 ? 6  
HELX_P HELX_P175 AT4 LEU U  393  ? SER U  397  ? LEU H 393  SER H 397  5 ? 5  
HELX_P HELX_P176 AT5 LEU U  403  ? ILE U  410  ? LEU H 403  ILE H 410  1 ? 8  
HELX_P HELX_P177 AT6 LEU U  450  ? GLN U  456  ? LEU H 450  GLN H 456  5 ? 7  
HELX_P HELX_P178 AT7 SER U  459  ? ASP U  510  ? SER H 459  ASP H 510  1 ? 52 
HELX_P HELX_P179 AT8 ASP U  510  ? LEU U  529  ? ASP H 510  LEU H 529  1 ? 20 
HELX_P HELX_P180 AT9 VAL U  540  ? LYS U  547  ? VAL H 540  LYS H 547  1 ? 8  
HELX_P HELX_P181 AU1 ASN U  549  ? SER U  562  ? ASN H 549  SER H 562  1 ? 14 
HELX_P HELX_P182 AU2 GLN V  72   ? ARG V  86   ? GLN I 72   ARG I 86   1 ? 15 
HELX_P HELX_P183 AU3 PRO V  87   ? GLN V  89   ? PRO I 87   GLN I 89   5 ? 3  
HELX_P HELX_P184 AU4 SER V  102  ? LEU V  121  ? SER I 102  LEU I 121  1 ? 20 
HELX_P HELX_P185 AU5 ARG V  135  ? GLN V  147  ? ARG I 135  GLN I 147  1 ? 13 
HELX_P HELX_P186 AU6 UNK V  155  ? UNK V  162  ? UNK I 156  UNK I 163  1 ? 8  
HELX_P HELX_P187 AU7 UNK V  168  ? UNK V  174  ? UNK I 169  UNK I 175  1 ? 7  
HELX_P HELX_P188 AU8 UNK W  2    ? UNK W  57   ? UNK J 2    UNK J 57   1 ? 56 
HELX_P HELX_P189 AU9 UNK X  2    ? UNK X  15   ? UNK K 3    UNK K 16   1 ? 14 
HELX_P HELX_P190 AV1 UNK Y  5    ? UNK Y  15   ? UNK L 9    UNK L 19   1 ? 11 
HELX_P HELX_P191 AV2 UNK Y  16   ? UNK Y  18   ? UNK L 20   UNK L 22   5 ? 3  
HELX_P HELX_P192 AV3 UNK Z  42   ? UNK Z  80   ? UNK M 43   UNK M 81   1 ? 39 
HELX_P HELX_P193 AV4 UNK Z  81   ? UNK Z  83   ? UNK M 82   UNK M 84   5 ? 3  
HELX_P HELX_P194 AV5 UNK BA 5    ? UNK BA 15   ? UNK O 7    UNK O 17   1 ? 11 
HELX_P HELX_P195 AV6 UNK BA 16   ? UNK BA 18   ? UNK O 18   UNK O 20   5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? OA ADP .   O2B ? ? ? 1_555 QA MG .   MG ? ? A ADP 1802 A MG 1804 1_555 ? ? ? ? ? ? ?               2.825 ? 
hydrog1   hydrog ? ? I  DT  2   N3  ? ? ? 1_555 J  DA 199 N1 ? ? a DT  2    b DA 154  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? I  DT  2   O4  ? ? ? 1_555 J  DA 199 N6 ? ? a DT  2    b DA 154  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? I  DC  3   N3  ? ? ? 1_555 J  DG 198 N1 ? ? a DC  3    b DG 153  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? I  DC  3   N4  ? ? ? 1_555 J  DG 198 O6 ? ? a DC  3    b DG 153  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? I  DC  3   O2  ? ? ? 1_555 J  DG 198 N2 ? ? a DC  3    b DG 153  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? I  DA  4   N1  ? ? ? 1_555 J  DT 197 N3 ? ? a DA  4    b DT 152  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? I  DA  4   N6  ? ? ? 1_555 J  DT 197 O4 ? ? a DA  4    b DT 152  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? I  DG  5   N1  ? ? ? 1_555 J  DC 196 N3 ? ? a DG  5    b DC 151  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? I  DG  5   N2  ? ? ? 1_555 J  DC 196 O2 ? ? a DG  5    b DC 151  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? I  DG  5   O6  ? ? ? 1_555 J  DC 196 N4 ? ? a DG  5    b DC 151  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? I  DA  6   N1  ? ? ? 1_555 J  DT 195 N3 ? ? a DA  6    b DT 150  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? I  DA  6   N6  ? ? ? 1_555 J  DT 195 O4 ? ? a DA  6    b DT 150  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? I  DA  7   N1  ? ? ? 1_555 J  DT 194 N3 ? ? a DA  7    b DT 149  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? I  DA  7   N6  ? ? ? 1_555 J  DT 194 O4 ? ? a DA  7    b DT 149  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? I  DT  8   N3  ? ? ? 1_555 J  DA 193 N1 ? ? a DT  8    b DA 148  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? I  DT  8   O4  ? ? ? 1_555 J  DA 193 N6 ? ? a DT  8    b DA 148  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? I  DC  9   N3  ? ? ? 1_555 J  DG 192 N1 ? ? a DC  9    b DG 147  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? I  DC  9   N4  ? ? ? 1_555 J  DG 192 O6 ? ? a DC  9    b DG 147  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? I  DC  9   O2  ? ? ? 1_555 J  DG 192 N2 ? ? a DC  9    b DG 147  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? I  DC  10  N3  ? ? ? 1_555 J  DG 191 N1 ? ? a DC  10   b DG 146  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? I  DC  10  N4  ? ? ? 1_555 J  DG 191 O6 ? ? a DC  10   b DG 146  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? I  DC  10  O2  ? ? ? 1_555 J  DG 191 N2 ? ? a DC  10   b DG 146  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? I  DC  11  N3  ? ? ? 1_555 J  DG 190 N1 ? ? a DC  11   b DG 145  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? I  DC  11  N4  ? ? ? 1_555 J  DG 190 O6 ? ? a DC  11   b DG 145  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? I  DC  11  O2  ? ? ? 1_555 J  DG 190 N2 ? ? a DC  11   b DG 145  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? I  DG  12  N1  ? ? ? 1_555 J  DC 189 N3 ? ? a DG  12   b DC 144  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? I  DG  12  N2  ? ? ? 1_555 J  DC 189 O2 ? ? a DG  12   b DC 144  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? I  DG  12  O6  ? ? ? 1_555 J  DC 189 N4 ? ? a DG  12   b DC 144  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? I  DG  13  N1  ? ? ? 1_555 J  DC 188 N3 ? ? a DG  13   b DC 143  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? I  DG  13  N2  ? ? ? 1_555 J  DC 188 O2 ? ? a DG  13   b DC 143  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? I  DG  13  O6  ? ? ? 1_555 J  DC 188 N4 ? ? a DG  13   b DC 143  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? I  DT  14  N3  ? ? ? 1_555 J  DA 187 N1 ? ? a DT  14   b DA 142  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? I  DT  14  O4  ? ? ? 1_555 J  DA 187 N6 ? ? a DT  14   b DA 142  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? I  DG  15  N1  ? ? ? 1_555 J  DC 186 N3 ? ? a DG  15   b DC 141  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? I  DG  15  N2  ? ? ? 1_555 J  DC 186 O2 ? ? a DG  15   b DC 141  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? I  DG  15  O6  ? ? ? 1_555 J  DC 186 N4 ? ? a DG  15   b DC 141  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? I  DC  16  N3  ? ? ? 1_555 J  DG 185 N1 ? ? a DC  16   b DG 140  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? I  DC  16  N4  ? ? ? 1_555 J  DG 185 O6 ? ? a DC  16   b DG 140  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? I  DC  16  O2  ? ? ? 1_555 J  DG 185 N2 ? ? a DC  16   b DG 140  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? I  DC  17  N3  ? ? ? 1_555 J  DG 184 N1 ? ? a DC  17   b DG 139  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? I  DC  17  N4  ? ? ? 1_555 J  DG 184 O6 ? ? a DC  17   b DG 139  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? I  DC  17  O2  ? ? ? 1_555 J  DG 184 N2 ? ? a DC  17   b DG 139  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? I  DG  18  N1  ? ? ? 1_555 J  DC 183 N3 ? ? a DG  18   b DC 138  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? I  DG  18  N2  ? ? ? 1_555 J  DC 183 O2 ? ? a DG  18   b DC 138  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? I  DG  18  O6  ? ? ? 1_555 J  DC 183 N4 ? ? a DG  18   b DC 138  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? I  DA  19  N1  ? ? ? 1_555 J  DT 182 N3 ? ? a DA  19   b DT 137  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? I  DA  19  N6  ? ? ? 1_555 J  DT 182 O4 ? ? a DA  19   b DT 137  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? I  DG  20  N1  ? ? ? 1_555 J  DC 181 N3 ? ? a DG  20   b DC 136  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? I  DG  20  N2  ? ? ? 1_555 J  DC 181 O2 ? ? a DG  20   b DC 136  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? I  DG  20  O6  ? ? ? 1_555 J  DC 181 N4 ? ? a DG  20   b DC 136  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? I  DG  21  N1  ? ? ? 1_555 J  DC 180 N3 ? ? a DG  21   b DC 135  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? I  DG  21  N2  ? ? ? 1_555 J  DC 180 O2 ? ? a DG  21   b DC 135  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? I  DG  21  O6  ? ? ? 1_555 J  DC 180 N4 ? ? a DG  21   b DC 135  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? I  DC  22  N3  ? ? ? 1_555 J  DG 179 N1 ? ? a DC  22   b DG 134  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? I  DC  22  N4  ? ? ? 1_555 J  DG 179 O6 ? ? a DC  22   b DG 134  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? I  DC  22  O2  ? ? ? 1_555 J  DG 179 N2 ? ? a DC  22   b DG 134  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? I  DC  23  N3  ? ? ? 1_555 J  DG 178 N1 ? ? a DC  23   b DG 133  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? I  DC  23  N4  ? ? ? 1_555 J  DG 178 O6 ? ? a DC  23   b DG 133  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? I  DC  23  O2  ? ? ? 1_555 J  DG 178 N2 ? ? a DC  23   b DG 133  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? I  DG  24  N1  ? ? ? 1_555 J  DC 177 N3 ? ? a DG  24   b DC 132  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? I  DG  24  N2  ? ? ? 1_555 J  DC 177 O2 ? ? a DG  24   b DC 132  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? I  DG  24  O6  ? ? ? 1_555 J  DC 177 N4 ? ? a DG  24   b DC 132  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? I  DC  25  N3  ? ? ? 1_555 J  DG 176 N1 ? ? a DC  25   b DG 131  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? I  DC  25  N4  ? ? ? 1_555 J  DG 176 O6 ? ? a DC  25   b DG 131  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? I  DC  25  O2  ? ? ? 1_555 J  DG 176 N2 ? ? a DC  25   b DG 131  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? I  DT  26  N3  ? ? ? 1_555 J  DA 175 N1 ? ? a DT  26   b DA 130  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? I  DT  26  O4  ? ? ? 1_555 J  DA 175 N6 ? ? a DT  26   b DA 130  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? I  DC  27  N3  ? ? ? 1_555 J  DG 174 N1 ? ? a DC  27   b DG 129  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? I  DC  27  N4  ? ? ? 1_555 J  DG 174 O6 ? ? a DC  27   b DG 129  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? I  DC  27  O2  ? ? ? 1_555 J  DG 174 N2 ? ? a DC  27   b DG 129  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? I  DA  28  N1  ? ? ? 1_555 J  DT 173 N3 ? ? a DA  28   b DT 128  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? I  DA  28  N6  ? ? ? 1_555 J  DT 173 O4 ? ? a DA  28   b DT 128  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? I  DA  29  N1  ? ? ? 1_555 J  DT 172 N3 ? ? a DA  29   b DT 127  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? I  DA  29  N6  ? ? ? 1_555 J  DT 172 O4 ? ? a DA  29   b DT 127  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? I  DT  30  N3  ? ? ? 1_555 J  DA 171 N1 ? ? a DT  30   b DA 126  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? I  DT  30  O4  ? ? ? 1_555 J  DA 171 N6 ? ? a DT  30   b DA 126  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? I  DT  31  N3  ? ? ? 1_555 J  DA 170 N1 ? ? a DT  31   b DA 125  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? I  DT  31  O4  ? ? ? 1_555 J  DA 170 N6 ? ? a DT  31   b DA 125  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? I  DG  32  N1  ? ? ? 1_555 J  DC 169 N3 ? ? a DG  32   b DC 124  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? I  DG  32  N2  ? ? ? 1_555 J  DC 169 O2 ? ? a DG  32   b DC 124  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? I  DG  32  O6  ? ? ? 1_555 J  DC 169 N4 ? ? a DG  32   b DC 124  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? I  DG  33  N1  ? ? ? 1_555 J  DC 168 N3 ? ? a DG  33   b DC 123  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? I  DG  33  N2  ? ? ? 1_555 J  DC 168 O2 ? ? a DG  33   b DC 123  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? I  DG  33  O6  ? ? ? 1_555 J  DC 168 N4 ? ? a DG  33   b DC 123  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? I  DT  34  N3  ? ? ? 1_555 J  DA 167 N1 ? ? a DT  34   b DA 122  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? I  DT  34  O4  ? ? ? 1_555 J  DA 167 N6 ? ? a DT  34   b DA 122  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? I  DC  35  N3  ? ? ? 1_555 J  DG 166 N1 ? ? a DC  35   b DG 121  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? I  DC  35  N4  ? ? ? 1_555 J  DG 166 O6 ? ? a DC  35   b DG 121  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? I  DC  35  O2  ? ? ? 1_555 J  DG 166 N2 ? ? a DC  35   b DG 121  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? I  DG  36  N1  ? ? ? 1_555 J  DC 165 N3 ? ? a DG  36   b DC 120  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? I  DG  36  N2  ? ? ? 1_555 J  DC 165 O2 ? ? a DG  36   b DC 120  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I  DG  36  O6  ? ? ? 1_555 J  DC 165 N4 ? ? a DG  36   b DC 120  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? I  DT  37  N3  ? ? ? 1_555 J  DA 164 N1 ? ? a DT  37   b DA 119  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? I  DT  37  O4  ? ? ? 1_555 J  DA 164 N6 ? ? a DT  37   b DA 119  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I  DA  38  N1  ? ? ? 1_555 J  DT 163 N3 ? ? a DA  38   b DT 118  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? I  DA  38  N6  ? ? ? 1_555 J  DT 163 O4 ? ? a DA  38   b DT 118  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I  DG  39  N1  ? ? ? 1_555 J  DC 162 N3 ? ? a DG  39   b DC 117  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I  DG  39  N2  ? ? ? 1_555 J  DC 162 O2 ? ? a DG  39   b DC 117  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I  DG  39  O6  ? ? ? 1_555 J  DC 162 N4 ? ? a DG  39   b DC 117  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? I  DA  40  N1  ? ? ? 1_555 J  DT 161 N3 ? ? a DA  40   b DT 116  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? I  DA  40  N6  ? ? ? 1_555 J  DT 161 O4 ? ? a DA  40   b DT 116  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? I  DC  41  N3  ? ? ? 1_555 J  DG 160 N1 ? ? a DC  41   b DG 115  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I  DC  41  N4  ? ? ? 1_555 J  DG 160 O6 ? ? a DC  41   b DG 115  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I  DC  41  O2  ? ? ? 1_555 J  DG 160 N2 ? ? a DC  41   b DG 115  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? I  DA  42  N1  ? ? ? 1_555 J  DT 159 N3 ? ? a DA  42   b DT 114  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? I  DA  42  N6  ? ? ? 1_555 J  DT 159 O4 ? ? a DA  42   b DT 114  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I  DG  43  N1  ? ? ? 1_555 J  DC 158 N3 ? ? a DG  43   b DC 113  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? I  DG  43  N2  ? ? ? 1_555 J  DC 158 O2 ? ? a DG  43   b DC 113  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? I  DG  43  O6  ? ? ? 1_555 J  DC 158 N4 ? ? a DG  43   b DC 113  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? I  DC  44  N3  ? ? ? 1_555 J  DG 157 N1 ? ? a DC  44   b DG 112  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? I  DC  44  N4  ? ? ? 1_555 J  DG 157 O6 ? ? a DC  44   b DG 112  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? I  DC  44  O2  ? ? ? 1_555 J  DG 157 N2 ? ? a DC  44   b DG 112  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I  DT  45  N3  ? ? ? 1_555 J  DA 156 N1 ? ? a DT  45   b DA 111  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I  DT  45  O4  ? ? ? 1_555 J  DA 156 N6 ? ? a DT  45   b DA 111  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? I  DC  46  N3  ? ? ? 1_555 J  DG 155 N1 ? ? a DC  46   b DG 110  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? I  DC  46  N4  ? ? ? 1_555 J  DG 155 O6 ? ? a DC  46   b DG 110  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? I  DC  46  O2  ? ? ? 1_555 J  DG 155 N2 ? ? a DC  46   b DG 110  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? I  DT  47  N3  ? ? ? 1_555 J  DA 154 N1 ? ? a DT  47   b DA 109  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? I  DT  47  O4  ? ? ? 1_555 J  DA 154 N6 ? ? a DT  47   b DA 109  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? I  DA  48  N1  ? ? ? 1_555 J  DT 153 N3 ? ? a DA  48   b DT 108  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? I  DA  48  N6  ? ? ? 1_555 J  DT 153 O4 ? ? a DA  48   b DT 108  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? I  DG  49  N1  ? ? ? 1_555 J  DC 152 N3 ? ? a DG  49   b DC 107  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? I  DG  49  N2  ? ? ? 1_555 J  DC 152 O2 ? ? a DG  49   b DC 107  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? I  DG  49  O6  ? ? ? 1_555 J  DC 152 N4 ? ? a DG  49   b DC 107  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? I  DC  50  N3  ? ? ? 1_555 J  DG 151 N1 ? ? a DC  50   b DG 106  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? I  DC  50  N4  ? ? ? 1_555 J  DG 151 O6 ? ? a DC  50   b DG 106  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? I  DC  50  O2  ? ? ? 1_555 J  DG 151 N2 ? ? a DC  50   b DG 106  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? I  DA  51  N1  ? ? ? 1_555 J  DT 150 N3 ? ? a DA  51   b DT 105  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? I  DA  51  N6  ? ? ? 1_555 J  DT 150 O4 ? ? a DA  51   b DT 105  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? I  DC  52  N3  ? ? ? 1_555 J  DG 149 N1 ? ? a DC  52   b DG 104  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I  DC  52  N4  ? ? ? 1_555 J  DG 149 O6 ? ? a DC  52   b DG 104  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I  DC  52  O2  ? ? ? 1_555 J  DG 149 N2 ? ? a DC  52   b DG 104  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I  DC  53  N3  ? ? ? 1_555 J  DG 148 N1 ? ? a DC  53   b DG 103  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I  DC  53  N4  ? ? ? 1_555 J  DG 148 O6 ? ? a DC  53   b DG 103  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I  DC  53  O2  ? ? ? 1_555 J  DG 148 N2 ? ? a DC  53   b DG 103  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I  DG  54  N1  ? ? ? 1_555 J  DC 147 N3 ? ? a DG  54   b DC 102  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I  DG  54  N2  ? ? ? 1_555 J  DC 147 O2 ? ? a DG  54   b DC 102  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? I  DG  54  O6  ? ? ? 1_555 J  DC 147 N4 ? ? a DG  54   b DC 102  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? I  DC  55  N3  ? ? ? 1_555 J  DG 146 N1 ? ? a DC  55   b DG 101  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? I  DC  55  N4  ? ? ? 1_555 J  DG 146 O6 ? ? a DC  55   b DG 101  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? I  DC  55  O2  ? ? ? 1_555 J  DG 146 N2 ? ? a DC  55   b DG 101  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I  DT  56  N3  ? ? ? 1_555 J  DA 145 N1 ? ? a DT  56   b DA 100  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? I  DT  56  O4  ? ? ? 1_555 J  DA 145 N6 ? ? a DT  56   b DA 100  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I  DT  57  N3  ? ? ? 1_555 J  DA 144 N1 ? ? a DT  57   b DA 99   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I  DT  57  O4  ? ? ? 1_555 J  DA 144 N6 ? ? a DT  57   b DA 99   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I  DA  58  N1  ? ? ? 1_555 J  DT 143 N3 ? ? a DA  58   b DT 98   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? I  DA  58  N6  ? ? ? 1_555 J  DT 143 O4 ? ? a DA  58   b DT 98   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? I  DA  59  N1  ? ? ? 1_555 J  DT 142 N3 ? ? a DA  59   b DT 97   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? I  DA  59  N6  ? ? ? 1_555 J  DT 142 O4 ? ? a DA  59   b DT 97   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? I  DA  60  N1  ? ? ? 1_555 J  DT 141 N3 ? ? a DA  60   b DT 96   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? I  DA  60  N6  ? ? ? 1_555 J  DT 141 O4 ? ? a DA  60   b DT 96   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? I  DC  61  N3  ? ? ? 1_555 J  DG 140 N1 ? ? a DC  61   b DG 95   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? I  DC  61  N4  ? ? ? 1_555 J  DG 140 O6 ? ? a DC  61   b DG 95   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? I  DC  61  O2  ? ? ? 1_555 J  DG 140 N2 ? ? a DC  61   b DG 95   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I  DG  62  N1  ? ? ? 1_555 J  DC 139 N3 ? ? a DG  62   b DC 94   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I  DG  62  N2  ? ? ? 1_555 J  DC 139 O2 ? ? a DG  62   b DC 94   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? I  DG  62  O6  ? ? ? 1_555 J  DC 139 N4 ? ? a DG  62   b DC 94   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I  DC  63  N3  ? ? ? 1_555 J  DG 138 N1 ? ? a DC  63   b DG 93   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? I  DC  63  N4  ? ? ? 1_555 J  DG 138 O6 ? ? a DC  63   b DG 93   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? I  DC  63  O2  ? ? ? 1_555 J  DG 138 N2 ? ? a DC  63   b DG 93   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I  DA  64  N1  ? ? ? 1_555 J  DT 137 N3 ? ? a DA  64   b DT 92   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I  DA  64  N6  ? ? ? 1_555 J  DT 137 O4 ? ? a DA  64   b DT 92   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? I  DC  65  N3  ? ? ? 1_555 J  DG 136 N1 ? ? a DC  65   b DG 91   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? I  DC  65  N4  ? ? ? 1_555 J  DG 136 O6 ? ? a DC  65   b DG 91   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? I  DC  65  O2  ? ? ? 1_555 J  DG 136 N2 ? ? a DC  65   b DG 91   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? I  DG  66  N1  ? ? ? 1_555 J  DC 135 N3 ? ? a DG  66   b DC 90   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? I  DG  66  N2  ? ? ? 1_555 J  DC 135 O2 ? ? a DG  66   b DC 90   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? I  DG  66  O6  ? ? ? 1_555 J  DC 135 N4 ? ? a DG  66   b DC 90   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I  DT  67  N3  ? ? ? 1_555 J  DA 134 N1 ? ? a DT  67   b DA 89   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I  DT  67  O4  ? ? ? 1_555 J  DA 134 N6 ? ? a DT  67   b DA 89   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I  DA  68  N1  ? ? ? 1_555 J  DT 133 N3 ? ? a DA  68   b DT 88   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? I  DA  68  N6  ? ? ? 1_555 J  DT 133 O4 ? ? a DA  68   b DT 88   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? I  DC  69  N3  ? ? ? 1_555 J  DG 132 N1 ? ? a DC  69   b DG 87   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? I  DC  69  N4  ? ? ? 1_555 J  DG 132 O6 ? ? a DC  69   b DG 87   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I  DC  69  O2  ? ? ? 1_555 J  DG 132 N2 ? ? a DC  69   b DG 87   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? I  DG  70  N1  ? ? ? 1_555 J  DC 131 N3 ? ? a DG  70   b DC 86   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? I  DG  70  N2  ? ? ? 1_555 J  DC 131 O2 ? ? a DG  70   b DC 86   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? I  DG  70  O6  ? ? ? 1_555 J  DC 131 N4 ? ? a DG  70   b DC 86   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? I  DC  71  N3  ? ? ? 1_555 J  DG 130 N1 ? ? a DC  71   b DG 85   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? I  DC  71  N4  ? ? ? 1_555 J  DG 130 O6 ? ? a DC  71   b DG 85   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? I  DC  71  O2  ? ? ? 1_555 J  DG 130 N2 ? ? a DC  71   b DG 85   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? I  DG  72  N1  ? ? ? 1_555 J  DC 129 N3 ? ? a DG  72   b DC 84   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? I  DG  72  N2  ? ? ? 1_555 J  DC 129 O2 ? ? a DG  72   b DC 84   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? I  DG  72  O6  ? ? ? 1_555 J  DC 129 N4 ? ? a DG  72   b DC 84   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? I  DC  73  N3  ? ? ? 1_555 J  DG 128 N1 ? ? a DC  73   b DG 83   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? I  DC  73  N4  ? ? ? 1_555 J  DG 128 O6 ? ? a DC  73   b DG 83   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? I  DC  73  O2  ? ? ? 1_555 J  DG 128 N2 ? ? a DC  73   b DG 83   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? I  DT  74  N3  ? ? ? 1_555 J  DA 127 N1 ? ? a DT  74   b DA 82   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? I  DT  74  O4  ? ? ? 1_555 J  DA 127 N6 ? ? a DT  74   b DA 82   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? I  DG  75  N1  ? ? ? 1_555 J  DC 126 N3 ? ? a DG  75   b DC 81   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? I  DG  75  N2  ? ? ? 1_555 J  DC 126 O2 ? ? a DG  75   b DC 81   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? I  DG  75  O6  ? ? ? 1_555 J  DC 126 N4 ? ? a DG  75   b DC 81   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? I  DT  76  N3  ? ? ? 1_555 J  DA 125 N1 ? ? a DT  76   b DA 80   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? I  DT  76  O4  ? ? ? 1_555 J  DA 125 N6 ? ? a DT  76   b DA 80   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? I  DC  77  N3  ? ? ? 1_555 J  DG 124 N1 ? ? a DC  77   b DG 79   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? I  DC  77  N4  ? ? ? 1_555 J  DG 124 O6 ? ? a DC  77   b DG 79   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? I  DC  77  O2  ? ? ? 1_555 J  DG 124 N2 ? ? a DC  77   b DG 79   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? I  DC  78  N3  ? ? ? 1_555 J  DG 123 N1 ? ? a DC  78   b DG 78   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? I  DC  78  N4  ? ? ? 1_555 J  DG 123 O6 ? ? a DC  78   b DG 78   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? I  DC  78  O2  ? ? ? 1_555 J  DG 123 N2 ? ? a DC  78   b DG 78   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? I  DC  79  N3  ? ? ? 1_555 J  DG 122 N1 ? ? a DC  79   b DG 77   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? I  DC  79  N4  ? ? ? 1_555 J  DG 122 O6 ? ? a DC  79   b DG 77   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? I  DC  79  O2  ? ? ? 1_555 J  DG 122 N2 ? ? a DC  79   b DG 77   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? I  DC  80  N3  ? ? ? 1_555 J  DG 121 N1 ? ? a DC  80   b DG 76   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? I  DC  80  N4  ? ? ? 1_555 J  DG 121 O6 ? ? a DC  80   b DG 76   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? I  DC  80  O2  ? ? ? 1_555 J  DG 121 N2 ? ? a DC  80   b DG 76   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? I  DC  81  N3  ? ? ? 1_555 J  DG 120 N1 ? ? a DC  81   b DG 75   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? I  DC  81  N4  ? ? ? 1_555 J  DG 120 O6 ? ? a DC  81   b DG 75   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? I  DC  81  O2  ? ? ? 1_555 J  DG 120 N2 ? ? a DC  81   b DG 75   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? I  DG  82  N1  ? ? ? 1_555 J  DC 119 N3 ? ? a DG  82   b DC 74   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? I  DG  82  N2  ? ? ? 1_555 J  DC 119 O2 ? ? a DG  82   b DC 74   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? I  DG  82  O6  ? ? ? 1_555 J  DC 119 N4 ? ? a DG  82   b DC 74   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? I  DC  83  N3  ? ? ? 1_555 J  DG 118 N1 ? ? a DC  83   b DG 73   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? I  DC  83  N4  ? ? ? 1_555 J  DG 118 O6 ? ? a DC  83   b DG 73   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? I  DC  83  O2  ? ? ? 1_555 J  DG 118 N2 ? ? a DC  83   b DG 73   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? I  DG  84  N1  ? ? ? 1_555 J  DC 117 N3 ? ? a DG  84   b DC 72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? I  DG  84  N2  ? ? ? 1_555 J  DC 117 O2 ? ? a DG  84   b DC 72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? I  DG  84  O6  ? ? ? 1_555 J  DC 117 N4 ? ? a DG  84   b DC 72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? I  DT  85  N3  ? ? ? 1_555 J  DA 116 N1 ? ? a DT  85   b DA 71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? I  DT  85  O4  ? ? ? 1_555 J  DA 116 N6 ? ? a DT  85   b DA 71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? I  DT  86  N3  ? ? ? 1_555 J  DA 115 N1 ? ? a DT  86   b DA 70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? I  DT  86  O4  ? ? ? 1_555 J  DA 115 N6 ? ? a DT  86   b DA 70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? I  DT  87  N3  ? ? ? 1_555 J  DA 114 N1 ? ? a DT  87   b DA 69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? I  DT  87  O4  ? ? ? 1_555 J  DA 114 N6 ? ? a DT  87   b DA 69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? I  DT  88  N3  ? ? ? 1_555 J  DA 113 N1 ? ? a DT  88   b DA 68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? I  DT  88  O4  ? ? ? 1_555 J  DA 113 N6 ? ? a DT  88   b DA 68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? I  DA  89  N1  ? ? ? 1_555 J  DT 112 N3 ? ? a DA  89   b DT 67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? I  DA  89  N6  ? ? ? 1_555 J  DT 112 O4 ? ? a DA  89   b DT 67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? I  DA  90  N1  ? ? ? 1_555 J  DT 111 N3 ? ? a DA  90   b DT 66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? I  DA  90  N6  ? ? ? 1_555 J  DT 111 O4 ? ? a DA  90   b DT 66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? I  DC  91  N3  ? ? ? 1_555 J  DG 110 N1 ? ? a DC  91   b DG 65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? I  DC  91  N4  ? ? ? 1_555 J  DG 110 O6 ? ? a DC  91   b DG 65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? I  DC  91  O2  ? ? ? 1_555 J  DG 110 N2 ? ? a DC  91   b DG 65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? I  DC  92  N3  ? ? ? 1_555 J  DG 109 N1 ? ? a DC  92   b DG 64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? I  DC  92  N4  ? ? ? 1_555 J  DG 109 O6 ? ? a DC  92   b DG 64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? I  DC  92  O2  ? ? ? 1_555 J  DG 109 N2 ? ? a DC  92   b DG 64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? I  DG  93  N1  ? ? ? 1_555 J  DC 108 N3 ? ? a DG  93   b DC 63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? I  DG  93  N2  ? ? ? 1_555 J  DC 108 O2 ? ? a DG  93   b DC 63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? I  DG  93  O6  ? ? ? 1_555 J  DC 108 N4 ? ? a DG  93   b DC 63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? I  DC  94  N3  ? ? ? 1_555 J  DG 107 N1 ? ? a DC  94   b DG 62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? I  DC  94  N4  ? ? ? 1_555 J  DG 107 O6 ? ? a DC  94   b DG 62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? I  DC  94  O2  ? ? ? 1_555 J  DG 107 N2 ? ? a DC  94   b DG 62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? I  DC  95  N3  ? ? ? 1_555 J  DG 106 N1 ? ? a DC  95   b DG 61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? I  DC  95  N4  ? ? ? 1_555 J  DG 106 O6 ? ? a DC  95   b DG 61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? I  DC  95  O2  ? ? ? 1_555 J  DG 106 N2 ? ? a DC  95   b DG 61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? I  DA  96  N1  ? ? ? 1_555 J  DT 105 N3 ? ? a DA  96   b DT 60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? I  DA  96  N6  ? ? ? 1_555 J  DT 105 O4 ? ? a DA  96   b DT 60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? I  DA  97  N1  ? ? ? 1_555 J  DT 104 N3 ? ? a DA  97   b DT 59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? I  DA  97  N6  ? ? ? 1_555 J  DT 104 O4 ? ? a DA  97   b DT 59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? I  DG  98  N1  ? ? ? 1_555 J  DC 103 N3 ? ? a DG  98   b DC 58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? I  DG  98  N2  ? ? ? 1_555 J  DC 103 O2 ? ? a DG  98   b DC 58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? I  DG  98  O6  ? ? ? 1_555 J  DC 103 N4 ? ? a DG  98   b DC 58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? I  DG  99  N1  ? ? ? 1_555 J  DC 102 N3 ? ? a DG  99   b DC 57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? I  DG  99  N2  ? ? ? 1_555 J  DC 102 O2 ? ? a DG  99   b DC 57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? I  DG  99  O6  ? ? ? 1_555 J  DC 102 N4 ? ? a DG  99   b DC 57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog256 hydrog ? ? I  DG  100 N1  ? ? ? 1_555 J  DC 101 N3 ? ? a DG  100  b DC 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog257 hydrog ? ? I  DG  100 N2  ? ? ? 1_555 J  DC 101 O2 ? ? a DG  100  b DC 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? I  DG  100 O6  ? ? ? 1_555 J  DC 101 N4 ? ? a DG  100  b DC 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? I  DG  101 N1  ? ? ? 1_555 J  DC 100 N3 ? ? a DG  101  b DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog260 hydrog ? ? I  DG  101 N2  ? ? ? 1_555 J  DC 100 O2 ? ? a DG  101  b DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog261 hydrog ? ? I  DG  101 O6  ? ? ? 1_555 J  DC 100 N4 ? ? a DG  101  b DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog262 hydrog ? ? I  DA  102 N1  ? ? ? 1_555 J  DT 99  N3 ? ? a DA  102  b DT 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog263 hydrog ? ? I  DA  102 N6  ? ? ? 1_555 J  DT 99  O4 ? ? a DA  102  b DT 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? I  DT  103 N3  ? ? ? 1_555 J  DA 98  N1 ? ? a DT  103  b DA 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? I  DT  103 O4  ? ? ? 1_555 J  DA 98  N6 ? ? a DT  103  b DA 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? I  DT  104 N3  ? ? ? 1_555 J  DA 97  N1 ? ? a DT  104  b DA 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? I  DT  104 O4  ? ? ? 1_555 J  DA 97  N6 ? ? a DT  104  b DA 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? I  DA  105 N1  ? ? ? 1_555 J  DT 96  N3 ? ? a DA  105  b DT 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? I  DA  105 N6  ? ? ? 1_555 J  DT 96  O4 ? ? a DA  105  b DT 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? I  DC  106 N3  ? ? ? 1_555 J  DG 95  N1 ? ? a DC  106  b DG 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? I  DC  106 N4  ? ? ? 1_555 J  DG 95  O6 ? ? a DC  106  b DG 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? I  DC  106 O2  ? ? ? 1_555 J  DG 95  N2 ? ? a DC  106  b DG 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? I  DT  107 N3  ? ? ? 1_555 J  DA 94  N1 ? ? a DT  107  b DA 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? I  DT  107 O4  ? ? ? 1_555 J  DA 94  N6 ? ? a DT  107  b DA 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? I  DC  108 N3  ? ? ? 1_555 J  DG 93  N1 ? ? a DC  108  b DG 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog276 hydrog ? ? I  DC  108 N4  ? ? ? 1_555 J  DG 93  O6 ? ? a DC  108  b DG 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? I  DC  108 O2  ? ? ? 1_555 J  DG 93  N2 ? ? a DC  108  b DG 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? I  DC  109 N3  ? ? ? 1_555 J  DG 92  N1 ? ? a DC  109  b DG 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? I  DC  109 N4  ? ? ? 1_555 J  DG 92  O6 ? ? a DC  109  b DG 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? I  DC  109 O2  ? ? ? 1_555 J  DG 92  N2 ? ? a DC  109  b DG 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? I  DC  110 N3  ? ? ? 1_555 J  DG 91  N1 ? ? a DC  110  b DG 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? I  DC  110 N4  ? ? ? 1_555 J  DG 91  O6 ? ? a DC  110  b DG 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ? ? I  DC  110 O2  ? ? ? 1_555 J  DG 91  N2 ? ? a DC  110  b DG 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? I  DT  111 N3  ? ? ? 1_555 J  DA 90  N1 ? ? a DT  111  b DA 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? I  DT  111 O4  ? ? ? 1_555 J  DA 90  N6 ? ? a DT  111  b DA 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? I  DA  112 N1  ? ? ? 1_555 J  DT 89  N3 ? ? a DA  112  b DT 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? I  DA  112 N6  ? ? ? 1_555 J  DT 89  O4 ? ? a DA  112  b DT 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog288 hydrog ? ? I  DG  113 N1  ? ? ? 1_555 J  DC 88  N3 ? ? a DG  113  b DC 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ? ? I  DG  113 N2  ? ? ? 1_555 J  DC 88  O2 ? ? a DG  113  b DC 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ? ? I  DG  113 O6  ? ? ? 1_555 J  DC 88  N4 ? ? a DG  113  b DC 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ? ? I  DT  114 N3  ? ? ? 1_555 J  DA 87  N1 ? ? a DT  114  b DA 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog292 hydrog ? ? I  DT  114 O4  ? ? ? 1_555 J  DA 87  N6 ? ? a DT  114  b DA 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog293 hydrog ? ? I  DC  115 N3  ? ? ? 1_555 J  DG 86  N1 ? ? a DC  115  b DG 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ? ? I  DC  115 N4  ? ? ? 1_555 J  DG 86  O6 ? ? a DC  115  b DG 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog295 hydrog ? ? I  DC  115 O2  ? ? ? 1_555 J  DG 86  N2 ? ? a DC  115  b DG 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog296 hydrog ? ? I  DT  116 N3  ? ? ? 1_555 J  DA 85  N1 ? ? a DT  116  b DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ? ? I  DT  116 O4  ? ? ? 1_555 J  DA 85  N6 ? ? a DT  116  b DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog298 hydrog ? ? I  DC  117 N3  ? ? ? 1_555 J  DG 84  N1 ? ? a DC  117  b DG 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog299 hydrog ? ? I  DC  117 N4  ? ? ? 1_555 J  DG 84  O6 ? ? a DC  117  b DG 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog300 hydrog ? ? I  DC  117 O2  ? ? ? 1_555 J  DG 84  N2 ? ? a DC  117  b DG 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog301 hydrog ? ? I  DC  118 N3  ? ? ? 1_555 J  DG 83  N1 ? ? a DC  118  b DG 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog302 hydrog ? ? I  DC  118 N4  ? ? ? 1_555 J  DG 83  O6 ? ? a DC  118  b DG 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog303 hydrog ? ? I  DC  118 O2  ? ? ? 1_555 J  DG 83  N2 ? ? a DC  118  b DG 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog304 hydrog ? ? I  DA  119 N1  ? ? ? 1_555 J  DT 82  N3 ? ? a DA  119  b DT 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog305 hydrog ? ? I  DA  119 N6  ? ? ? 1_555 J  DT 82  O4 ? ? a DA  119  b DT 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog306 hydrog ? ? I  DG  120 N1  ? ? ? 1_555 J  DC 81  N3 ? ? a DG  120  b DC 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog307 hydrog ? ? I  DG  120 N2  ? ? ? 1_555 J  DC 81  O2 ? ? a DG  120  b DC 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog308 hydrog ? ? I  DG  120 O6  ? ? ? 1_555 J  DC 81  N4 ? ? a DG  120  b DC 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog309 hydrog ? ? I  DG  121 N1  ? ? ? 1_555 J  DC 80  N3 ? ? a DG  121  b DC 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog310 hydrog ? ? I  DG  121 N2  ? ? ? 1_555 J  DC 80  O2 ? ? a DG  121  b DC 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog311 hydrog ? ? I  DG  121 O6  ? ? ? 1_555 J  DC 80  N4 ? ? a DG  121  b DC 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog312 hydrog ? ? I  DC  122 N3  ? ? ? 1_555 J  DG 79  N1 ? ? a DC  122  b DG 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog313 hydrog ? ? I  DC  122 N4  ? ? ? 1_555 J  DG 79  O6 ? ? a DC  122  b DG 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog314 hydrog ? ? I  DC  122 O2  ? ? ? 1_555 J  DG 79  N2 ? ? a DC  122  b DG 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog315 hydrog ? ? I  DA  123 N1  ? ? ? 1_555 J  DT 78  N3 ? ? a DA  123  b DT 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog316 hydrog ? ? I  DA  123 N6  ? ? ? 1_555 J  DT 78  O4 ? ? a DA  123  b DT 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog317 hydrog ? ? I  DC  124 N3  ? ? ? 1_555 J  DG 77  N1 ? ? a DC  124  b DG 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog318 hydrog ? ? I  DC  124 N4  ? ? ? 1_555 J  DG 77  O6 ? ? a DC  124  b DG 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog319 hydrog ? ? I  DC  124 O2  ? ? ? 1_555 J  DG 77  N2 ? ? a DC  124  b DG 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog320 hydrog ? ? I  DG  125 N1  ? ? ? 1_555 J  DC 76  N3 ? ? a DG  125  b DC 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog321 hydrog ? ? I  DG  125 N2  ? ? ? 1_555 J  DC 76  O2 ? ? a DG  125  b DC 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog322 hydrog ? ? I  DG  125 O6  ? ? ? 1_555 J  DC 76  N4 ? ? a DG  125  b DC 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog323 hydrog ? ? I  DT  126 N3  ? ? ? 1_555 J  DA 75  N1 ? ? a DT  126  b DA 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog324 hydrog ? ? I  DT  126 O4  ? ? ? 1_555 J  DA 75  N6 ? ? a DT  126  b DA 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog325 hydrog ? ? I  DG  127 N1  ? ? ? 1_555 J  DC 74  N3 ? ? a DG  127  b DC 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog326 hydrog ? ? I  DG  127 N2  ? ? ? 1_555 J  DC 74  O2 ? ? a DG  127  b DC 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog327 hydrog ? ? I  DG  127 O6  ? ? ? 1_555 J  DC 74  N4 ? ? a DG  127  b DC 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog328 hydrog ? ? I  DT  128 N3  ? ? ? 1_555 J  DA 73  N1 ? ? a DT  128  b DA 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog329 hydrog ? ? I  DT  128 O4  ? ? ? 1_555 J  DA 73  N6 ? ? a DT  128  b DA 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog330 hydrog ? ? I  DC  129 N3  ? ? ? 1_555 J  DG 72  N1 ? ? a DC  129  b DG 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog331 hydrog ? ? I  DC  129 N4  ? ? ? 1_555 J  DG 72  O6 ? ? a DC  129  b DG 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog332 hydrog ? ? I  DC  129 O2  ? ? ? 1_555 J  DG 72  N2 ? ? a DC  129  b DG 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog333 hydrog ? ? I  DA  130 N1  ? ? ? 1_555 J  DT 71  N3 ? ? a DA  130  b DT 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog334 hydrog ? ? I  DA  130 N6  ? ? ? 1_555 J  DT 71  O4 ? ? a DA  130  b DT 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog335 hydrog ? ? I  DG  131 N1  ? ? ? 1_555 J  DC 70  N3 ? ? a DG  131  b DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog336 hydrog ? ? I  DG  131 N2  ? ? ? 1_555 J  DC 70  O2 ? ? a DG  131  b DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog337 hydrog ? ? I  DG  131 O6  ? ? ? 1_555 J  DC 70  N4 ? ? a DG  131  b DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog338 hydrog ? ? I  DA  132 N1  ? ? ? 1_555 J  DT 69  N3 ? ? a DA  132  b DT 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog339 hydrog ? ? I  DA  132 N6  ? ? ? 1_555 J  DT 69  O4 ? ? a DA  132  b DT 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog340 hydrog ? ? I  DT  133 N3  ? ? ? 1_555 J  DA 68  N1 ? ? a DT  133  b DA 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog341 hydrog ? ? I  DT  133 O4  ? ? ? 1_555 J  DA 68  N6 ? ? a DT  133  b DA 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog342 hydrog ? ? I  DA  134 N1  ? ? ? 1_555 J  DT 67  N3 ? ? a DA  134  b DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog343 hydrog ? ? I  DA  134 N6  ? ? ? 1_555 J  DT 67  O4 ? ? a DA  134  b DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog344 hydrog ? ? I  DT  135 N3  ? ? ? 1_555 J  DA 66  N1 ? ? a DT  135  b DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog345 hydrog ? ? I  DT  135 O4  ? ? ? 1_555 J  DA 66  N6 ? ? a DT  135  b DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog346 hydrog ? ? I  DA  136 N1  ? ? ? 1_555 J  DT 65  N3 ? ? a DA  136  b DT 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog347 hydrog ? ? I  DA  136 N6  ? ? ? 1_555 J  DT 65  O4 ? ? a DA  136  b DT 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog348 hydrog ? ? I  DT  137 N3  ? ? ? 1_555 J  DA 64  N1 ? ? a DT  137  b DA 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog349 hydrog ? ? I  DT  137 O4  ? ? ? 1_555 J  DA 64  N6 ? ? a DT  137  b DA 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog350 hydrog ? ? I  DA  138 N1  ? ? ? 1_555 J  DT 63  N3 ? ? a DA  138  b DT 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog351 hydrog ? ? I  DA  138 N6  ? ? ? 1_555 J  DT 63  O4 ? ? a DA  138  b DT 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog352 hydrog ? ? I  DC  139 N3  ? ? ? 1_555 J  DG 62  N1 ? ? a DC  139  b DG 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog353 hydrog ? ? I  DC  139 N4  ? ? ? 1_555 J  DG 62  O6 ? ? a DC  139  b DG 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog354 hydrog ? ? I  DC  139 O2  ? ? ? 1_555 J  DG 62  N2 ? ? a DC  139  b DG 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog355 hydrog ? ? I  DA  140 N1  ? ? ? 1_555 J  DT 61  N3 ? ? a DA  140  b DT 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog356 hydrog ? ? I  DA  140 N6  ? ? ? 1_555 J  DT 61  O4 ? ? a DA  140  b DT 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog357 hydrog ? ? I  DT  141 N3  ? ? ? 1_555 J  DA 60  N1 ? ? a DT  141  b DA 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog358 hydrog ? ? I  DT  141 O4  ? ? ? 1_555 J  DA 60  N6 ? ? a DT  141  b DA 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog359 hydrog ? ? I  DC  142 N3  ? ? ? 1_555 J  DG 59  N1 ? ? a DC  142  b DG 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog360 hydrog ? ? I  DC  142 N4  ? ? ? 1_555 J  DG 59  O6 ? ? a DC  142  b DG 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog361 hydrog ? ? I  DC  142 O2  ? ? ? 1_555 J  DG 59  N2 ? ? a DC  142  b DG 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog362 hydrog ? ? I  DG  143 N1  ? ? ? 1_555 J  DC 58  N3 ? ? a DG  143  b DC 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog363 hydrog ? ? I  DG  143 N2  ? ? ? 1_555 J  DC 58  O2 ? ? a DG  143  b DC 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog364 hydrog ? ? I  DG  143 O6  ? ? ? 1_555 J  DC 58  N4 ? ? a DG  143  b DC 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog365 hydrog ? ? I  DA  144 N1  ? ? ? 1_555 J  DT 57  N3 ? ? a DA  144  b DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog366 hydrog ? ? I  DA  144 N6  ? ? ? 1_555 J  DT 57  O4 ? ? a DA  144  b DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog367 hydrog ? ? I  DT  145 N3  ? ? ? 1_555 J  DT 57  O4 ? ? a DT  145  b DT 12   1_555 ? ? ? ? ? ? 'DT-DT MISPAIR' ?     ? 
hydrog368 hydrog ? ? I  DT  146 N3  ? ? ? 1_555 J  DA 55  N1 ? ? a DT  146  b DA 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog369 hydrog ? ? I  DT  146 O4  ? ? ? 1_555 J  DA 55  N6 ? ? a DT  146  b DA 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog370 hydrog ? ? I  DA  148 N1  ? ? ? 1_555 J  DT 53  N3 ? ? a DA  148  b DT 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog371 hydrog ? ? I  DA  148 N6  ? ? ? 1_555 J  DT 53  O4 ? ? a DA  148  b DT 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog372 hydrog ? ? I  DC  149 N3  ? ? ? 1_555 J  DG 52  N1 ? ? a DC  149  b DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog373 hydrog ? ? I  DC  149 N4  ? ? ? 1_555 J  DG 52  O6 ? ? a DC  149  b DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog374 hydrog ? ? I  DC  149 O2  ? ? ? 1_555 J  DG 52  N2 ? ? a DC  149  b DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog375 hydrog ? ? I  DG  150 N1  ? ? ? 1_555 J  DC 51  N3 ? ? a DG  150  b DC 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog376 hydrog ? ? I  DG  150 N2  ? ? ? 1_555 J  DC 51  O2 ? ? a DG  150  b DC 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog377 hydrog ? ? I  DG  150 O6  ? ? ? 1_555 J  DC 51  N4 ? ? a DG  150  b DC 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog378 hydrog ? ? I  DA  151 N1  ? ? ? 1_555 J  DT 50  N3 ? ? a DA  151  b DT 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog379 hydrog ? ? I  DA  151 N6  ? ? ? 1_555 J  DT 50  O4 ? ? a DA  151  b DT 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog380 hydrog ? ? I  DT  152 N3  ? ? ? 1_555 J  DA 49  N1 ? ? a DT  152  b DA 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog381 hydrog ? ? I  DT  152 O4  ? ? ? 1_555 J  DA 49  N6 ? ? a DT  152  b DA 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog382 hydrog ? ? I  DG  153 N1  ? ? ? 1_555 J  DC 48  N3 ? ? a DG  153  b DC 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog383 hydrog ? ? I  DG  153 N2  ? ? ? 1_555 J  DC 48  O2 ? ? a DG  153  b DC 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog384 hydrog ? ? I  DG  153 O6  ? ? ? 1_555 J  DC 48  N4 ? ? a DG  153  b DC 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog385 hydrog ? ? I  DC  154 N3  ? ? ? 1_555 J  DG 47  N1 ? ? a DC  154  b DG 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog386 hydrog ? ? I  DC  154 N4  ? ? ? 1_555 J  DG 47  O6 ? ? a DC  154  b DG 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog387 hydrog ? ? I  DC  154 O2  ? ? ? 1_555 J  DG 47  N2 ? ? a DC  154  b DG 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog388 hydrog ? ? I  DT  155 N3  ? ? ? 1_555 J  DA 46  N1 ? ? a DT  155  b DA 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog389 hydrog ? ? I  DT  155 O4  ? ? ? 1_555 J  DA 46  N6 ? ? a DT  155  b DA 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 343 K . ? SER 343 P ILE 344 K ? ILE 344 P 1 -4.47 
2 PRO 3   L . ? PRO 3   Q PHE 4   L ? PHE 4   Q 1 -5.50 
3 CYS 403 L . ? CYS 403 Q PRO 404 L ? PRO 404 Q 1 4.67  
4 LEU 659 N . ? LEU 659 A LYS 660 N ? LYS 660 A 1 5.90  
5 GLY 817 N . ? GLY 817 A PRO 818 N ? PRO 818 A 1 -8.13 
6 UNK 21  Z . ? UNK 21  M UNK 22  Z ? UNK 22  M 1 -0.94 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 6 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 5 ? 
AB6 ? 2 ? 
AB7 ? 6 ? 
AB8 ? 3 ? 
AB9 ? 2 ? 
AC1 ? 3 ? 
AC2 ? 4 ? 
AC3 ? 2 ? 
AC4 ? 2 ? 
AC5 ? 5 ? 
AC6 ? 4 ? 
AC7 ? 4 ? 
AC8 ? 2 ? 
AC9 ? 2 ? 
AD1 ? 3 ? 
AD2 ? 2 ? 
AD3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA2 1 2 ? parallel      
AA3 1 2 ? parallel      
AA4 1 2 ? parallel      
AA5 1 2 ? parallel      
AA6 1 2 ? parallel      
AA7 1 2 ? parallel      
AA8 1 2 ? parallel      
AA9 1 2 ? parallel      
AB1 1 2 ? parallel      
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? parallel      
AB2 4 5 ? parallel      
AB2 5 6 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? parallel      
AB5 4 5 ? parallel      
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? parallel      
AB7 4 5 ? parallel      
AB7 5 6 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? parallel      
AC3 1 2 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? parallel      
AC5 2 3 ? parallel      
AC5 3 4 ? parallel      
AC5 4 5 ? parallel      
AC6 1 2 ? parallel      
AC6 2 3 ? parallel      
AC6 3 4 ? parallel      
AC7 1 2 ? parallel      
AC7 2 3 ? parallel      
AC7 3 4 ? parallel      
AC8 1 2 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD2 1 2 ? parallel      
AD3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 83   ? PHE A 84   ? ARG R 83   PHE R 84   
AA1 2 THR B 80   ? VAL B 81   ? THR S 80   VAL S 81   
AA2 1 THR A 118  ? ILE A 119  ? THR R 118  ILE R 119  
AA2 2 ARG B 45   ? ILE B 46   ? ARG S 45   ILE S 46   
AA3 1 THR B 96   ? TYR B 98   ? THR S 96   TYR S 98   
AA3 2 VAL G 100  ? ILE G 102  ? VAL X 100  ILE X 102  
AA4 1 ARG C 42   ? VAL C 43   ? ARG T 42   VAL T 43   
AA4 2 THR D 85   ? ILE D 86   ? THR U 85   ILE U 86   
AA5 1 ARG C 77   ? ILE C 78   ? ARG T 77   ILE T 78   
AA5 2 GLY D 50   ? ILE D 51   ? GLY U 50   ILE U 51   
AA6 1 VAL C 100  ? ILE C 102  ? VAL T 100  ILE T 102  
AA6 2 THR F 96   ? TYR F 98   ? THR W 96   TYR W 98   
AA7 1 ARG E 83   ? PHE E 84   ? ARG V 83   PHE V 84   
AA7 2 THR F 80   ? VAL F 81   ? THR W 80   VAL W 81   
AA8 1 THR E 118  ? ILE E 119  ? THR V 118  ILE V 119  
AA8 2 ARG F 45   ? ILE F 46   ? ARG W 45   ILE W 46   
AA9 1 ARG G 42   ? VAL G 43   ? ARG X 42   VAL X 43   
AA9 2 THR H 85   ? ILE H 86   ? THR Y 85   ILE Y 86   
AB1 1 ARG G 77   ? ILE G 78   ? ARG X 77   ILE X 78   
AB1 2 GLY H 50   ? ILE H 51   ? GLY Y 50   ILE Y 51   
AB2 1 CYS K 29   ? PRO K 32   ? CYS P 29   PRO P 32   
AB2 2 ARG K 16   ? PHE K 21   ? ARG P 16   PHE P 21   
AB2 3 VAL K 8    ? ASN K 12   ? VAL P 8    ASN P 12   
AB2 4 LEU K 104  ? MET K 108  ? LEU P 104  MET P 108  
AB2 5 VAL K 135  ? ILE K 140  ? VAL P 135  ILE P 140  
AB2 6 TRP K 454  ? SER K 456  ? TRP P 454  SER P 456  
AB3 1 PHE K 47   ? ILE K 48   ? PHE P 47   ILE P 48   
AB3 2 SER K 34   ? LYS K 37   ? SER P 34   LYS P 37   
AB3 3 GLU K 66   ? THR K 69   ? GLU P 66   THR P 69   
AB4 1 ILE K 173  ? VAL K 174  ? ILE P 173  VAL P 174  
AB4 2 CYS K 164  ? ILE K 170  ? CYS P 164  ILE P 170  
AB4 3 VAL K 180  ? ARG K 181  ? VAL P 180  ARG P 181  
AB5 1 ILE K 173  ? VAL K 174  ? ILE P 173  VAL P 174  
AB5 2 CYS K 164  ? ILE K 170  ? CYS P 164  ILE P 170  
AB5 3 ALA K 154  ? ILE K 159  ? ALA P 154  ILE P 159  
AB5 4 VAL K 392  ? THR K 395  ? VAL P 392  THR P 395  
AB5 5 THR K 423  ? PHE K 424  ? THR P 423  PHE P 424  
AB6 1 LYS K 287  ? PHE K 292  ? LYS P 287  PHE P 292  
AB6 2 LYS K 297  ? ASP K 302  ? LYS P 297  ASP P 302  
AB7 1 LEU L 35   ? PRO L 38   ? LEU Q 35   PRO Q 38   
AB7 2 THR L 18   ? PHE L 23   ? THR Q 18   PHE Q 23   
AB7 3 LEU L 10   ? PRO L 14   ? LEU Q 10   PRO Q 14   
AB7 4 LEU L 111  ? THR L 115  ? LEU Q 111  THR Q 115  
AB7 5 ASN L 139  ? PRO L 144  ? ASN Q 139  PRO Q 144  
AB7 6 ILE L 449  ? THR L 450  ? ILE Q 449  THR Q 450  
AB8 1 TYR L 51   ? HIS L 54   ? TYR Q 51   HIS Q 54   
AB8 2 ILE L 41   ? THR L 45   ? ILE Q 41   THR Q 45   
AB8 3 GLU L 63   ? ILE L 65   ? GLU Q 63   ILE Q 65   
AB9 1 ILE L 68   ? GLN L 69   ? ILE Q 68   GLN Q 69   
AB9 2 GLU L 72   ? ILE L 73   ? GLU Q 72   ILE Q 73   
AC1 1 ALA L 178  ? GLN L 179  ? ALA Q 178  GLN Q 179  
AC1 2 THR L 169  ? VAL L 175  ? THR Q 169  VAL Q 175  
AC1 3 SER L 185  ? ILE L 187  ? SER Q 185  ILE Q 187  
AC2 1 ALA L 178  ? GLN L 179  ? ALA Q 178  GLN Q 179  
AC2 2 THR L 169  ? VAL L 175  ? THR Q 169  VAL Q 175  
AC2 3 CYS L 159  ? VAL L 164  ? CYS Q 159  VAL Q 164  
AC2 4 ILE L 333  ? VAL L 336  ? ILE Q 333  VAL Q 336  
AC3 1 ASN L 282  ? TRP L 285  ? ASN Q 282  TRP Q 285  
AC3 2 GLU L 291  ? VAL L 294  ? GLU Q 291  VAL Q 294  
AC4 1 TRP M 25   ? TYR M 30   ? TRP Z 25   TYR Z 30   
AC4 2 TYR M 60   ? ARG M 65   ? TYR Z 60   ARG Z 65   
AC5 1 ILE N 789  ? LEU N 790  ? ILE A 789  LEU A 790  
AC5 2 ILE N 921  ? LEU N 922  ? ILE A 921  LEU A 922  
AC5 3 TRP N 888  ? ASP N 894  ? TRP A 888  ASP A 894  
AC5 4 TYR N 819  ? ILE N 822  ? TYR A 819  ILE A 822  
AC5 5 VAL N 868  ? THR N 871  ? VAL A 868  THR A 871  
AC6 1 ILE N 789  ? LEU N 790  ? ILE A 789  LEU A 790  
AC6 2 ILE N 921  ? LEU N 922  ? ILE A 921  LEU A 922  
AC6 3 TRP N 888  ? ASP N 894  ? TRP A 888  ASP A 894  
AC6 4 ALA N 916  ? TYR N 918  ? ALA A 916  TYR A 918  
AC7 1 ILE N 1160 ? SER N 1162 ? ILE A 1160 SER A 1162 
AC7 2 VAL N 1106 ? PHE N 1110 ? VAL A 1106 PHE A 1110 
AC7 3 THR N 1177 ? ILE N 1180 ? THR A 1177 ILE A 1180 
AC7 4 ARG N 1207 ? ARG N 1210 ? ARG A 1207 ARG A 1210 
AC8 1 GLN O 1006 ? PRO O 1007 ? GLN B 1006 PRO B 1007 
AC8 2 PHE O 1025 ? ASN O 1026 ? PHE B 1025 ASN B 1026 
AC9 1 VAL P 458  ? ARG P 461  ? VAL C 458  ARG C 461  
AC9 2 THR P 476  ? TRP P 479  ? THR C 476  TRP C 479  
AD1 1 ARG P 543  ? VAL P 552  ? ARG C 543  VAL C 552  
AD1 2 ASN P 555  ? ASP P 564  ? ASN C 555  ASP C 564  
AD1 3 GLN P 654  ? ILE P 655  ? GLN C 654  ILE C 655  
AD2 1 GLN Q 411  ? TYR Q 412  ? GLN D 411  TYR D 412  
AD2 2 VAL R 306  ? ILE R 307  ? VAL E 306  ILE E 307  
AD3 1 ILE U 378  ? LYS U 380  ? ILE H 378  LYS H 380  
AD3 2 THR U 400  ? LYS U 402  ? THR H 400  LYS H 402  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 83   ? N ARG R 83   O VAL B 81   ? O VAL S 81   
AA2 1 2 N ILE A 119  ? N ILE R 119  O ARG B 45   ? O ARG S 45   
AA3 1 2 N THR B 96   ? N THR S 96   O THR G 101  ? O THR X 101  
AA4 1 2 N ARG C 42   ? N ARG T 42   O ILE D 86   ? O ILE U 86   
AA5 1 2 N ILE C 78   ? N ILE T 78   O GLY D 50   ? O GLY U 50   
AA6 1 2 N THR C 101  ? N THR T 101  O THR F 96   ? O THR W 96   
AA7 1 2 N ARG E 83   ? N ARG V 83   O VAL F 81   ? O VAL W 81   
AA8 1 2 N ILE E 119  ? N ILE V 119  O ARG F 45   ? O ARG W 45   
AA9 1 2 N ARG G 42   ? N ARG X 42   O ILE H 86   ? O ILE Y 86   
AB1 1 2 N ILE G 78   ? N ILE X 78   O GLY H 50   ? O GLY Y 50   
AB2 1 2 O ILE K 31   ? O ILE P 31   N THR K 17   ? N THR P 17   
AB2 2 3 O VAL K 18   ? O VAL P 18   N HIS K 11   ? N HIS P 11   
AB2 3 4 N VAL K 8    ? N VAL P 8    O VAL K 105  ? O VAL P 105  
AB2 4 5 N LEU K 104  ? N LEU P 104  O GLN K 137  ? O GLN P 137  
AB2 5 6 N PHE K 136  ? N PHE P 136  O TYR K 455  ? O TYR P 455  
AB3 1 2 O ILE K 48   ? O ILE P 48   N ILE K 36   ? N ILE P 36   
AB3 2 3 N LYS K 37   ? N LYS P 37   O GLU K 66   ? O GLU P 66   
AB4 1 2 O ILE K 173  ? O ILE P 173  N ILE K 170  ? N ILE P 170  
AB4 2 3 N VAL K 166  ? N VAL P 166  O VAL K 180  ? O VAL P 180  
AB5 1 2 O ILE K 173  ? O ILE P 173  N ILE K 170  ? N ILE P 170  
AB5 2 3 O ILE K 169  ? O ILE P 169  N ALA K 154  ? N ALA P 154  
AB5 3 4 N ILE K 157  ? N ILE P 157  O ILE K 393  ? O ILE P 393  
AB5 4 5 N VAL K 392  ? N VAL P 392  O PHE K 424  ? O PHE P 424  
AB6 1 2 N PHE K 292  ? N PHE P 292  O LYS K 297  ? O LYS P 297  
AB7 1 2 O LEU L 35   ? O LEU Q 35   N VAL L 21   ? N VAL Q 21   
AB7 2 3 O GLN L 22   ? O GLN Q 22   N ILE L 11   ? N ILE Q 11   
AB7 3 4 N LEU L 10   ? N LEU Q 10   O LEU L 112  ? O LEU Q 112  
AB7 4 5 N LEU L 113  ? N LEU Q 113  O ILE L 141  ? O ILE Q 141  
AB7 5 6 N LEU L 140  ? N LEU Q 140  O ILE L 449  ? O ILE Q 449  
AB8 1 2 O HIS L 54   ? O HIS Q 54   N TYR L 42   ? N TYR Q 42   
AB8 2 3 N ARG L 43   ? N ARG Q 43   O GLU L 63   ? O GLU Q 63   
AB9 1 2 N GLN L 69   ? N GLN Q 69   O GLU L 72   ? O GLU Q 72   
AC1 1 2 O ALA L 178  ? O ALA Q 178  N VAL L 175  ? N VAL Q 175  
AC1 2 3 N ILE L 171  ? N ILE Q 171  O SER L 185  ? O SER Q 185  
AC2 1 2 O ALA L 178  ? O ALA Q 178  N VAL L 175  ? N VAL Q 175  
AC2 2 3 O ILE L 174  ? O ILE Q 174  N CYS L 159  ? N CYS Q 159  
AC2 3 4 N ILE L 162  ? N ILE Q 162  O ILE L 334  ? O ILE Q 334  
AC3 1 2 N PHE L 284  ? N PHE Q 284  O ILE L 292  ? O ILE Q 292  
AC4 1 2 N ARG M 26   ? N ARG Z 26   O LEU M 64   ? O LEU Z 64   
AC5 1 2 N LEU N 790  ? N LEU A 790  O ILE N 921  ? O ILE A 921  
AC5 2 3 O LEU N 922  ? O LEU A 922  N ILE N 893  ? N ILE A 893  
AC5 3 4 O ILE N 892  ? O ILE A 892  N ILE N 822  ? N ILE A 822  
AC5 4 5 N VAL N 821  ? N VAL A 821  O VAL N 869  ? O VAL A 869  
AC6 1 2 N LEU N 790  ? N LEU A 790  O ILE N 921  ? O ILE A 921  
AC6 2 3 O LEU N 922  ? O LEU A 922  N ILE N 893  ? N ILE A 893  
AC6 3 4 N MET N 891  ? N MET A 891  O TYR N 918  ? O TYR A 918  
AC7 1 2 O LEU N 1161 ? O LEU A 1161 N PHE N 1110 ? N PHE A 1110 
AC7 2 3 N LEU N 1107 ? N LEU A 1107 O THR N 1177 ? O THR A 1177 
AC7 3 4 N VAL N 1178 ? N VAL A 1178 O LEU N 1209 ? O LEU A 1209 
AC8 1 2 N GLN O 1006 ? N GLN B 1006 O ASN O 1026 ? O ASN B 1026 
AC9 1 2 N VAL P 458  ? N VAL C 458  O TRP P 479  ? O TRP C 479  
AD1 1 2 N VAL P 552  ? N VAL C 552  O ASN P 555  ? O ASN C 555  
AD1 2 3 N GLN P 556  ? N GLN C 556  O GLN P 654  ? O GLN C 654  
AD2 1 2 N GLN Q 411  ? N GLN D 411  O ILE R 307  ? O ILE E 307  
AD3 1 2 N VAL U 379  ? N VAL H 379  O MET U 401  ? O MET H 401  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software P PO4 501  ? 7  'binding site for residue PO4 P 501'  
AC2 Software P PO4 502  ? 2  'binding site for residue PO4 P 502'  
AC3 Software P PO4 503  ? 11 'binding site for residue PO4 P 503'  
AC4 Software P PO4 504  ? 7  'binding site for residue PO4 P 504'  
AC5 Software P PO4 505  ? 6  'binding site for residue PO4 P 505'  
AC6 Software Q PO4 501  ? 7  'binding site for residue PO4 Q 501'  
AC7 Software Q PO4 502  ? 4  'binding site for residue PO4 Q 502'  
AC8 Software Q PO4 503  ? 4  'binding site for residue PO4 Q 503'  
AC9 Software Q PO4 504  ? 4  'binding site for residue PO4 Q 504'  
AD1 Software Q PO4 505  ? 4  'binding site for residue PO4 Q 505'  
AD2 Software Q PO4 506  ? 5  'binding site for residue PO4 Q 506'  
AD3 Software A PO4 1801 ? 2  'binding site for residue PO4 A 1801' 
AD4 Software A ADP 1802 ? 14 'binding site for residue ADP A 1802' 
AD5 Software A BEF 1803 ? 5  'binding site for residue BEF A 1803' 
AD6 Software A MG  1804 ? 3  'binding site for residue MG A 1804'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  HIS K  15   ? HIS P 15   . ? 1_555 ? 
2  AC1 7  ASP K  190  ? ASP P 190  . ? 1_555 ? 
3  AC1 7  ALA K  224  ? ALA P 224  . ? 1_555 ? 
4  AC1 7  GLN K  229  ? GLN P 229  . ? 1_555 ? 
5  AC1 7  LYS K  232  ? LYS P 232  . ? 1_555 ? 
6  AC1 7  PO4 EA .    ? PO4 P 503  . ? 1_555 ? 
7  AC1 7  HOH RA .    ? HOH P 608  . ? 1_555 ? 
8  AC2 2  ASN K  53   ? ASN P 53   . ? 1_555 ? 
9  AC2 2  TYR K  89   ? TYR P 89   . ? 1_555 ? 
10 AC3 11 HIS K  15   ? HIS P 15   . ? 1_555 ? 
11 AC3 11 ARG K  16   ? ARG P 16   . ? 1_555 ? 
12 AC3 11 ALA K  161  ? ALA P 161  . ? 1_555 ? 
13 AC3 11 GLY K  186  ? GLY P 186  . ? 1_555 ? 
14 AC3 11 LYS K  232  ? LYS P 232  . ? 1_555 ? 
15 AC3 11 SER K  397  ? SER P 397  . ? 1_555 ? 
16 AC3 11 THR K  398  ? THR P 398  . ? 1_555 ? 
17 AC3 11 PO4 CA .    ? PO4 P 501  . ? 1_555 ? 
18 AC3 11 HOH RA .    ? HOH P 602  . ? 1_555 ? 
19 AC3 11 HOH RA .    ? HOH P 603  . ? 1_555 ? 
20 AC3 11 HOH RA .    ? HOH P 608  . ? 1_555 ? 
21 AC4 7  HIS K  11   ? HIS P 11   . ? 1_555 ? 
22 AC4 7  GLY K  13   ? GLY P 13   . ? 1_555 ? 
23 AC4 7  GLU K  141  ? GLU P 141  . ? 1_555 ? 
24 AC4 7  PO4 GA .    ? PO4 P 505  . ? 1_555 ? 
25 AC4 7  HOH RA .    ? HOH P 601  . ? 1_555 ? 
26 AC4 7  HOH RA .    ? HOH P 602  . ? 1_555 ? 
27 AC4 7  HOH RA .    ? HOH P 612  . ? 1_555 ? 
28 AC5 6  SER K  14   ? SER P 14   . ? 1_555 ? 
29 AC5 6  ASP K  158  ? ASP P 158  . ? 1_555 ? 
30 AC5 6  SER K  162  ? SER P 162  . ? 1_555 ? 
31 AC5 6  ASN K  165  ? ASN P 165  . ? 1_555 ? 
32 AC5 6  ARG K  181  ? ARG P 181  . ? 1_555 ? 
33 AC5 6  PO4 FA .    ? PO4 P 504  . ? 1_555 ? 
34 AC6 7  SER L  16   ? SER Q 16   . ? 1_555 ? 
35 AC6 7  GLN L  17   ? GLN Q 17   . ? 1_555 ? 
36 AC6 7  ASN L  70   ? ASN Q 70   . ? 1_555 ? 
37 AC6 7  GLY L  71   ? GLY Q 71   . ? 1_555 ? 
38 AC6 7  THR L  166  ? THR Q 166  . ? 1_555 ? 
39 AC6 7  HIS L  167  ? HIS Q 167  . ? 1_555 ? 
40 AC6 7  HIS L  168  ? HIS Q 168  . ? 1_555 ? 
41 AC7 4  ARG L  15   ? ARG Q 15   . ? 1_555 ? 
42 AC7 4  GLY L  338  ? GLY Q 338  . ? 1_555 ? 
43 AC7 4  SER L  425  ? SER Q 425  . ? 1_555 ? 
44 AC7 4  GLU L  426  ? GLU Q 426  . ? 1_555 ? 
45 AC8 4  GLY L  344  ? GLY Q 344  . ? 1_555 ? 
46 AC8 4  LYS L  346  ? LYS Q 346  . ? 1_555 ? 
47 AC8 4  HOH SA .    ? HOH Q 605  . ? 1_555 ? 
48 AC8 4  HOH SA .    ? HOH Q 616  . ? 1_555 ? 
49 AC9 4  ARG L  15   ? ARG Q 15   . ? 1_555 ? 
50 AC9 4  ASP L  163  ? ASP Q 163  . ? 1_555 ? 
51 AC9 4  GLY L  338  ? GLY Q 338  . ? 1_555 ? 
52 AC9 4  HOH SA .    ? HOH Q 601  . ? 1_555 ? 
53 AD1 4  ASP L  206  ? ASP Q 206  . ? 1_555 ? 
54 AD1 4  ASP L  208  ? ASP Q 208  . ? 1_555 ? 
55 AD1 4  ASP L  286  ? ASP Q 286  . ? 1_555 ? 
56 AD1 4  LYS L  288  ? LYS Q 288  . ? 1_555 ? 
57 AD2 5  LYS K  293  ? LYS P 293  . ? 1_555 ? 
58 AD2 5  GLY L  314  ? GLY Q 314  . ? 1_555 ? 
59 AD2 5  ASP L  318  ? ASP Q 318  . ? 1_555 ? 
60 AD2 5  ASP L  356  ? ASP Q 356  . ? 1_555 ? 
61 AD2 5  HIS L  357  ? HIS Q 357  . ? 1_555 ? 
62 AD3 2  ARG N  619  ? ARG A 619  . ? 1_555 ? 
63 AD3 2  ASP K  431  ? ASP P 431  . ? 1_555 ? 
64 AD4 14 THR N  766  ? THR A 766  . ? 1_555 ? 
65 AD4 14 LYS N  768  ? LYS A 768  . ? 1_555 ? 
66 AD4 14 TYR N  770  ? TYR A 770  . ? 1_555 ? 
67 AD4 14 GLY N  795  ? GLY A 795  . ? 1_555 ? 
68 AD4 14 GLY N  797  ? GLY A 797  . ? 1_555 ? 
69 AD4 14 LYS N  798  ? LYS A 798  . ? 1_555 ? 
70 AD4 14 THR N  799  ? THR A 799  . ? 1_555 ? 
71 AD4 14 ILE N  800  ? ILE A 800  . ? 1_555 ? 
72 AD4 14 TRP N  838  ? TRP A 838  . ? 1_555 ? 
73 AD4 14 ASN N  1171 ? ASN A 1171 . ? 1_555 ? 
74 AD4 14 GLN N  1173 ? GLN A 1173 . ? 1_555 ? 
75 AD4 14 ILE N  1200 ? ILE A 1200 . ? 1_555 ? 
76 AD4 14 BEF PA .    ? BEF A 1803 . ? 1_555 ? 
77 AD4 14 MG  QA .    ? MG  A 1804 . ? 1_555 ? 
78 AD5 5  ASN N  1171 ? ASN A 1171 . ? 1_555 ? 
79 AD5 5  ARG N  1196 ? ARG A 1196 . ? 1_555 ? 
80 AD5 5  ARG N  1199 ? ARG A 1199 . ? 1_555 ? 
81 AD5 5  ADP OA .    ? ADP A 1802 . ? 1_555 ? 
82 AD5 5  MG  QA .    ? MG  A 1804 . ? 1_555 ? 
83 AD6 3  GLU N  895  ? GLU A 895  . ? 1_555 ? 
84 AD6 3  ADP OA .    ? ADP A 1802 . ? 1_555 ? 
85 AD6 3  BEF PA .    ? BEF A 1803 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6UXW 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
BE 
C  
F  
MG 
N  
O  
P  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LYS A  1  37   ? 212.780 299.139 187.040 1.00 174.25 ? 37   LYS R N     1 
ATOM   2     C  CA    . LYS A  1  37   ? 213.490 297.871 186.911 1.00 178.37 ? 37   LYS R CA    1 
ATOM   3     C  C     . LYS A  1  37   ? 214.506 297.925 185.773 1.00 183.02 ? 37   LYS R C     1 
ATOM   4     O  O     . LYS A  1  37   ? 214.238 298.514 184.724 1.00 181.88 ? 37   LYS R O     1 
ATOM   5     C  CB    . LYS A  1  37   ? 212.503 296.726 186.679 1.00 166.01 ? 37   LYS R CB    1 
ATOM   6     N  N     . PRO A  1  38   ? 215.675 297.321 185.984 1.00 173.00 ? 38   PRO R N     1 
ATOM   7     C  CA    . PRO A  1  38   ? 216.680 297.267 184.917 1.00 170.24 ? 38   PRO R CA    1 
ATOM   8     C  C     . PRO A  1  38   ? 216.132 296.557 183.687 1.00 170.78 ? 38   PRO R C     1 
ATOM   9     O  O     . PRO A  1  38   ? 215.485 295.512 183.786 1.00 171.64 ? 38   PRO R O     1 
ATOM   10    C  CB    . PRO A  1  38   ? 217.832 296.484 185.557 1.00 165.54 ? 38   PRO R CB    1 
ATOM   11    C  CG    . PRO A  1  38   ? 217.667 296.718 187.023 1.00 167.88 ? 38   PRO R CG    1 
ATOM   12    C  CD    . PRO A  1  38   ? 216.184 296.763 187.249 1.00 172.28 ? 38   PRO R CD    1 
ATOM   13    N  N     . HIS A  1  39   ? 216.399 297.137 182.519 1.00 161.00 ? 39   HIS R N     1 
ATOM   14    C  CA    . HIS A  1  39   ? 215.845 296.609 181.277 1.00 154.90 ? 39   HIS R CA    1 
ATOM   15    C  C     . HIS A  1  39   ? 216.587 295.338 180.879 1.00 148.81 ? 39   HIS R C     1 
ATOM   16    O  O     . HIS A  1  39   ? 217.812 295.351 180.711 1.00 148.38 ? 39   HIS R O     1 
ATOM   17    C  CB    . HIS A  1  39   ? 215.937 297.654 180.172 1.00 158.93 ? 39   HIS R CB    1 
ATOM   18    C  CG    . HIS A  1  39   ? 215.238 297.254 178.909 1.00 153.19 ? 39   HIS R CG    1 
ATOM   19    N  ND1   . HIS A  1  39   ? 215.815 296.428 177.967 1.00 150.47 ? 39   HIS R ND1   1 
ATOM   20    C  CD2   . HIS A  1  39   ? 214.010 297.567 178.433 1.00 148.98 ? 39   HIS R CD2   1 
ATOM   21    C  CE1   . HIS A  1  39   ? 214.971 296.251 176.966 1.00 148.44 ? 39   HIS R CE1   1 
ATOM   22    N  NE2   . HIS A  1  39   ? 213.868 296.931 177.224 1.00 148.78 ? 39   HIS R NE2   1 
ATOM   23    N  N     . ARG A  1  40   ? 215.845 294.248 180.725 1.00 150.03 ? 40   ARG R N     1 
ATOM   24    C  CA    . ARG A  1  40   ? 216.391 292.957 180.336 1.00 141.03 ? 40   ARG R CA    1 
ATOM   25    C  C     . ARG A  1  40   ? 215.699 292.459 179.076 1.00 135.11 ? 40   ARG R C     1 
ATOM   26    O  O     . ARG A  1  40   ? 214.488 292.631 178.912 1.00 129.40 ? 40   ARG R O     1 
ATOM   27    C  CB    . ARG A  1  40   ? 216.227 291.930 181.461 1.00 120.75 ? 40   ARG R CB    1 
ATOM   28    C  CG    . ARG A  1  40   ? 217.079 292.203 182.687 1.00 123.52 ? 40   ARG R CG    1 
ATOM   29    C  CD    . ARG A  1  40   ? 216.789 291.194 183.788 1.00 123.97 ? 40   ARG R CD    1 
ATOM   30    N  NE    . ARG A  1  40   ? 217.135 289.832 183.393 1.00 121.19 ? 40   ARG R NE    1 
ATOM   31    C  CZ    . ARG A  1  40   ? 218.349 289.306 183.517 1.00 125.21 ? 40   ARG R CZ    1 
ATOM   32    N  NH1   . ARG A  1  40   ? 219.337 290.024 184.030 1.00 127.84 ? 40   ARG R NH1   1 
ATOM   33    N  NH2   . ARG A  1  40   ? 218.572 288.056 183.129 1.00 122.53 ? 40   ARG R NH2   1 
ATOM   34    N  N     . TYR A  1  41   ? 216.473 291.846 178.185 1.00 144.12 ? 41   TYR R N     1 
ATOM   35    C  CA    . TYR A  1  41   ? 215.914 291.272 176.973 1.00 123.28 ? 41   TYR R CA    1 
ATOM   36    C  C     . TYR A  1  41   ? 215.228 289.946 177.274 1.00 127.54 ? 41   TYR R C     1 
ATOM   37    O  O     . TYR A  1  41   ? 215.626 289.208 178.181 1.00 130.05 ? 41   TYR R O     1 
ATOM   38    C  CB    . TYR A  1  41   ? 217.004 291.060 175.918 1.00 112.52 ? 41   TYR R CB    1 
ATOM   39    C  CG    . TYR A  1  41   ? 217.632 292.337 175.408 1.00 122.09 ? 41   TYR R CG    1 
ATOM   40    C  CD1   . TYR A  1  41   ? 216.859 293.463 175.156 1.00 126.80 ? 41   TYR R CD1   1 
ATOM   41    C  CD2   . TYR A  1  41   ? 218.997 292.413 175.169 1.00 131.22 ? 41   TYR R CD2   1 
ATOM   42    C  CE1   . TYR A  1  41   ? 217.430 294.629 174.686 1.00 132.55 ? 41   TYR R CE1   1 
ATOM   43    C  CE2   . TYR A  1  41   ? 219.576 293.575 174.699 1.00 134.18 ? 41   TYR R CE2   1 
ATOM   44    C  CZ    . TYR A  1  41   ? 218.788 294.680 174.460 1.00 135.44 ? 41   TYR R CZ    1 
ATOM   45    O  OH    . TYR A  1  41   ? 219.361 295.840 173.992 1.00 138.44 ? 41   TYR R OH    1 
ATOM   46    N  N     . ARG A  1  42   ? 214.182 289.656 176.510 1.00 128.35 ? 42   ARG R N     1 
ATOM   47    C  CA    . ARG A  1  42   ? 213.521 288.367 176.629 1.00 136.38 ? 42   ARG R CA    1 
ATOM   48    C  C     . ARG A  1  42   ? 214.492 287.259 176.227 1.00 132.78 ? 42   ARG R C     1 
ATOM   49    O  O     . ARG A  1  42   ? 215.231 287.412 175.248 1.00 129.96 ? 42   ARG R O     1 
ATOM   50    C  CB    . ARG A  1  42   ? 212.268 288.324 175.753 1.00 137.98 ? 42   ARG R CB    1 
ATOM   51    C  CG    . ARG A  1  42   ? 211.503 287.013 175.806 1.00 147.46 ? 42   ARG R CG    1 
ATOM   52    C  CD    . ARG A  1  42   ? 210.295 287.036 174.885 1.00 158.60 ? 42   ARG R CD    1 
ATOM   53    N  NE    . ARG A  1  42   ? 209.288 287.996 175.327 1.00 168.21 ? 42   ARG R NE    1 
ATOM   54    C  CZ    . ARG A  1  42   ? 208.164 288.255 174.669 1.00 177.34 ? 42   ARG R CZ    1 
ATOM   55    N  NH1   . ARG A  1  42   ? 207.900 287.624 173.531 1.00 179.67 ? 42   ARG R NH1   1 
ATOM   56    N  NH2   . ARG A  1  42   ? 207.303 289.144 175.143 1.00 180.11 ? 42   ARG R NH2   1 
ATOM   57    N  N     . PRO A  1  43   ? 214.536 286.151 176.967 1.00 129.40 ? 43   PRO R N     1 
ATOM   58    C  CA    . PRO A  1  43   ? 215.484 285.078 176.639 1.00 120.70 ? 43   PRO R CA    1 
ATOM   59    C  C     . PRO A  1  43   ? 215.298 284.582 175.212 1.00 117.79 ? 43   PRO R C     1 
ATOM   60    O  O     . PRO A  1  43   ? 214.181 284.306 174.769 1.00 119.75 ? 43   PRO R O     1 
ATOM   61    C  CB    . PRO A  1  43   ? 215.150 283.992 177.664 1.00 113.33 ? 43   PRO R CB    1 
ATOM   62    C  CG    . PRO A  1  43   ? 214.601 284.743 178.826 1.00 118.40 ? 43   PRO R CG    1 
ATOM   63    C  CD    . PRO A  1  43   ? 213.832 285.899 178.239 1.00 124.14 ? 43   PRO R CD    1 
ATOM   64    N  N     . GLY A  1  44   ? 216.413 284.473 174.494 1.00 94.61  ? 44   GLY R N     1 
ATOM   65    C  CA    . GLY A  1  44   ? 216.429 284.035 173.114 1.00 88.42  ? 44   GLY R CA    1 
ATOM   66    C  C     . GLY A  1  44   ? 216.703 285.133 172.109 1.00 101.58 ? 44   GLY R C     1 
ATOM   67    O  O     . GLY A  1  44   ? 217.023 284.827 170.954 1.00 101.43 ? 44   GLY R O     1 
ATOM   68    N  N     . THR A  1  45   ? 216.593 286.400 172.509 1.00 95.87  ? 45   THR R N     1 
ATOM   69    C  CA    . THR A  1  45   ? 216.893 287.496 171.594 1.00 93.50  ? 45   THR R CA    1 
ATOM   70    C  C     . THR A  1  45   ? 218.398 287.699 171.449 1.00 101.92 ? 45   THR R C     1 
ATOM   71    O  O     . THR A  1  45   ? 218.909 287.851 170.333 1.00 95.19  ? 45   THR R O     1 
ATOM   72    C  CB    . THR A  1  45   ? 216.227 288.784 172.078 1.00 120.51 ? 45   THR R CB    1 
ATOM   73    O  OG1   . THR A  1  45   ? 214.807 288.599 172.122 1.00 130.84 ? 45   THR R OG1   1 
ATOM   74    C  CG2   . THR A  1  45   ? 216.553 289.935 171.143 1.00 122.84 ? 45   THR R CG2   1 
ATOM   75    N  N     . VAL A  1  46   ? 219.118 287.702 172.573 1.00 96.92  ? 46   VAL R N     1 
ATOM   76    C  CA    . VAL A  1  46   ? 220.571 287.839 172.531 1.00 89.14  ? 46   VAL R CA    1 
ATOM   77    C  C     . VAL A  1  46   ? 221.187 286.694 171.739 1.00 87.57  ? 46   VAL R C     1 
ATOM   78    O  O     . VAL A  1  46   ? 222.169 286.881 171.011 1.00 87.91  ? 46   VAL R O     1 
ATOM   79    C  CB    . VAL A  1  46   ? 221.138 287.912 173.962 1.00 90.55  ? 46   VAL R CB    1 
ATOM   80    C  CG1   . VAL A  1  46   ? 222.658 287.960 173.938 1.00 78.89  ? 46   VAL R CG1   1 
ATOM   81    C  CG2   . VAL A  1  46   ? 220.570 289.115 174.696 1.00 100.90 ? 46   VAL R CG2   1 
ATOM   82    N  N     . ALA A  1  47   ? 220.614 285.494 171.859 1.00 78.44  ? 47   ALA R N     1 
ATOM   83    C  CA    . ALA A  1  47   ? 221.122 284.356 171.101 1.00 73.01  ? 47   ALA R CA    1 
ATOM   84    C  C     . ALA A  1  47   ? 220.988 284.586 169.602 1.00 73.00  ? 47   ALA R C     1 
ATOM   85    O  O     . ALA A  1  47   ? 221.909 284.284 168.835 1.00 72.58  ? 47   ALA R O     1 
ATOM   86    C  CB    . ALA A  1  47   ? 220.391 283.079 171.517 1.00 50.30  ? 47   ALA R CB    1 
ATOM   87    N  N     . LEU A  1  48   ? 219.848 285.128 169.163 1.00 64.92  ? 48   LEU R N     1 
ATOM   88    C  CA    . LEU A  1  48   ? 219.662 285.399 167.741 1.00 66.10  ? 48   LEU R CA    1 
ATOM   89    C  C     . LEU A  1  48   ? 220.594 286.504 167.263 1.00 68.01  ? 48   LEU R C     1 
ATOM   90    O  O     . LEU A  1  48   ? 221.187 286.400 166.180 1.00 81.34  ? 48   LEU R O     1 
ATOM   91    C  CB    . LEU A  1  48   ? 218.206 285.764 167.464 1.00 68.95  ? 48   LEU R CB    1 
ATOM   92    C  CG    . LEU A  1  48   ? 217.186 284.658 167.728 1.00 76.27  ? 48   LEU R CG    1 
ATOM   93    C  CD1   . LEU A  1  48   ? 215.774 285.179 167.541 1.00 78.65  ? 48   LEU R CD1   1 
ATOM   94    C  CD2   . LEU A  1  48   ? 217.446 283.462 166.827 1.00 87.97  ? 48   LEU R CD2   1 
ATOM   95    N  N     . ARG A  1  49   ? 220.737 287.573 168.052 1.00 68.06  ? 49   ARG R N     1 
ATOM   96    C  CA    . ARG A  1  49   ? 221.657 288.638 167.676 1.00 74.57  ? 49   ARG R CA    1 
ATOM   97    C  C     . ARG A  1  49   ? 223.083 288.110 167.562 1.00 78.92  ? 49   ARG R C     1 
ATOM   98    O  O     . ARG A  1  49   ? 223.847 288.539 166.687 1.00 77.70  ? 49   ARG R O     1 
ATOM   99    C  CB    . ARG A  1  49   ? 221.577 289.785 168.684 1.00 102.46 ? 49   ARG R CB    1 
ATOM   100   C  CG    . ARG A  1  49   ? 222.428 290.991 168.314 1.00 112.59 ? 49   ARG R CG    1 
ATOM   101   C  CD    . ARG A  1  49   ? 222.279 292.123 169.322 1.00 115.57 ? 49   ARG R CD    1 
ATOM   102   N  NE    . ARG A  1  49   ? 222.788 291.770 170.643 1.00 108.16 ? 49   ARG R NE    1 
ATOM   103   C  CZ    . ARG A  1  49   ? 222.021 291.468 171.683 1.00 110.38 ? 49   ARG R CZ    1 
ATOM   104   N  NH1   . ARG A  1  49   ? 220.701 291.474 171.560 1.00 101.83 ? 49   ARG R NH1   1 
ATOM   105   N  NH2   . ARG A  1  49   ? 222.572 291.158 172.849 1.00 118.00 ? 49   ARG R NH2   1 
ATOM   106   N  N     . GLU A  1  50   ? 223.456 287.167 168.429 1.00 70.18  ? 50   GLU R N     1 
ATOM   107   C  CA    . GLU A  1  50   ? 224.759 286.524 168.298 1.00 63.16  ? 50   GLU R CA    1 
ATOM   108   C  C     . GLU A  1  50   ? 224.826 285.663 167.043 1.00 63.22  ? 50   GLU R C     1 
ATOM   109   O  O     . GLU A  1  50   ? 225.872 285.591 166.393 1.00 67.74  ? 50   GLU R O     1 
ATOM   110   C  CB    . GLU A  1  50   ? 225.070 285.688 169.538 1.00 57.87  ? 50   GLU R CB    1 
ATOM   111   C  CG    . GLU A  1  50   ? 225.314 286.499 170.797 1.00 72.75  ? 50   GLU R CG    1 
ATOM   112   C  CD    . GLU A  1  50   ? 225.589 285.624 172.005 1.00 80.88  ? 50   GLU R CD    1 
ATOM   113   O  OE1   . GLU A  1  50   ? 225.417 284.391 171.898 1.00 89.71  ? 50   GLU R OE1   1 
ATOM   114   O  OE2   . GLU A  1  50   ? 225.975 286.167 173.060 1.00 73.65  ? 50   GLU R OE2   1 
ATOM   115   N  N     . ILE A  1  51   ? 223.724 284.997 166.687 1.00 56.00  ? 51   ILE R N     1 
ATOM   116   C  CA    . ILE A  1  51   ? 223.705 284.207 165.460 1.00 56.51  ? 51   ILE R CA    1 
ATOM   117   C  C     . ILE A  1  51   ? 224.011 285.091 164.257 1.00 72.58  ? 51   ILE R C     1 
ATOM   118   O  O     . ILE A  1  51   ? 224.888 284.778 163.442 1.00 82.20  ? 51   ILE R O     1 
ATOM   119   C  CB    . ILE A  1  51   ? 222.356 283.482 165.297 1.00 60.50  ? 51   ILE R CB    1 
ATOM   120   C  CG1   . ILE A  1  51   ? 222.206 282.380 166.347 1.00 55.69  ? 51   ILE R CG1   1 
ATOM   121   C  CG2   . ILE A  1  51   ? 222.222 282.914 163.897 1.00 47.54  ? 51   ILE R CG2   1 
ATOM   122   C  CD1   . ILE A  1  51   ? 220.829 281.759 166.382 1.00 52.56  ? 51   ILE R CD1   1 
ATOM   123   N  N     . ARG A  1  52   ? 223.303 286.216 164.138 1.00 68.41  ? 52   ARG R N     1 
ATOM   124   C  CA    . ARG A  1  52   ? 223.567 287.126 163.028 1.00 70.84  ? 52   ARG R CA    1 
ATOM   125   C  C     . ARG A  1  52   ? 224.982 287.688 163.098 1.00 69.60  ? 52   ARG R C     1 
ATOM   126   O  O     . ARG A  1  52   ? 225.661 287.814 162.070 1.00 67.27  ? 52   ARG R O     1 
ATOM   127   C  CB    . ARG A  1  52   ? 222.538 288.256 163.018 1.00 99.82  ? 52   ARG R CB    1 
ATOM   128   C  CG    . ARG A  1  52   ? 221.122 287.797 162.715 1.00 106.21 ? 52   ARG R CG    1 
ATOM   129   C  CD    . ARG A  1  52   ? 220.142 288.958 162.754 1.00 103.20 ? 52   ARG R CD    1 
ATOM   130   N  NE    . ARG A  1  52   ? 218.781 288.533 162.441 1.00 110.39 ? 52   ARG R NE    1 
ATOM   131   C  CZ    . ARG A  1  52   ? 217.937 288.017 163.327 1.00 122.63 ? 52   ARG R CZ    1 
ATOM   132   N  NH1   . ARG A  1  52   ? 218.312 287.859 164.589 1.00 125.45 ? 52   ARG R NH1   1 
ATOM   133   N  NH2   . ARG A  1  52   ? 216.717 287.659 162.953 1.00 120.91 ? 52   ARG R NH2   1 
ATOM   134   N  N     . ARG A  1  53   ? 225.451 288.013 164.305 1.00 62.53  ? 53   ARG R N     1 
ATOM   135   C  CA    . ARG A  1  53   ? 226.775 288.612 164.452 1.00 62.55  ? 53   ARG R CA    1 
ATOM   136   C  C     . ARG A  1  53   ? 227.871 287.664 163.985 1.00 71.93  ? 53   ARG R C     1 
ATOM   137   O  O     . ARG A  1  53   ? 228.699 288.022 163.139 1.00 77.22  ? 53   ARG R O     1 
ATOM   138   C  CB    . ARG A  1  53   ? 227.005 289.026 165.905 1.00 87.39  ? 53   ARG R CB    1 
ATOM   139   C  CG    . ARG A  1  53   ? 228.365 289.654 166.155 1.00 89.34  ? 53   ARG R CG    1 
ATOM   140   C  CD    . ARG A  1  53   ? 228.522 290.088 167.600 1.00 100.45 ? 53   ARG R CD    1 
ATOM   141   N  NE    . ARG A  1  53   ? 229.827 290.694 167.844 1.00 111.76 ? 53   ARG R NE    1 
ATOM   142   C  CZ    . ARG A  1  53   ? 230.169 291.304 168.976 1.00 122.80 ? 53   ARG R CZ    1 
ATOM   143   N  NH1   . ARG A  1  53   ? 229.299 291.393 169.971 1.00 121.47 ? 53   ARG R NH1   1 
ATOM   144   N  NH2   . ARG A  1  53   ? 231.381 291.825 169.109 1.00 134.47 ? 53   ARG R NH2   1 
ATOM   145   N  N     . TYR A  1  54   ? 227.900 286.444 164.529 1.00 68.53  ? 54   TYR R N     1 
ATOM   146   C  CA    . TYR A  1  54   ? 228.975 285.519 164.188 1.00 66.18  ? 54   TYR R CA    1 
ATOM   147   C  C     . TYR A  1  54   ? 228.817 284.954 162.782 1.00 57.86  ? 54   TYR R C     1 
ATOM   148   O  O     . TYR A  1  54   ? 229.822 284.686 162.114 1.00 57.99  ? 54   TYR R O     1 
ATOM   149   C  CB    . TYR A  1  54   ? 229.058 284.387 165.210 1.00 55.77  ? 54   TYR R CB    1 
ATOM   150   C  CG    . TYR A  1  54   ? 229.481 284.846 166.587 1.00 50.15  ? 54   TYR R CG    1 
ATOM   151   C  CD1   . TYR A  1  54   ? 230.820 285.047 166.888 1.00 55.44  ? 54   TYR R CD1   1 
ATOM   152   C  CD2   . TYR A  1  54   ? 228.548 285.055 167.590 1.00 48.21  ? 54   TYR R CD2   1 
ATOM   153   C  CE1   . TYR A  1  54   ? 231.213 285.463 168.143 1.00 57.22  ? 54   TYR R CE1   1 
ATOM   154   C  CE2   . TYR A  1  54   ? 228.932 285.469 168.849 1.00 44.82  ? 54   TYR R CE2   1 
ATOM   155   C  CZ    . TYR A  1  54   ? 230.267 285.670 169.120 1.00 47.55  ? 54   TYR R CZ    1 
ATOM   156   O  OH    . TYR A  1  54   ? 230.657 286.081 170.374 1.00 46.48  ? 54   TYR R OH    1 
ATOM   157   N  N     . GLN A  1  55   ? 227.583 284.762 162.311 1.00 55.12  ? 55   GLN R N     1 
ATOM   158   C  CA    . GLN A  1  55   ? 227.408 284.370 160.917 1.00 59.46  ? 55   GLN R CA    1 
ATOM   159   C  C     . GLN A  1  55   ? 227.742 285.500 159.957 1.00 55.69  ? 55   GLN R C     1 
ATOM   160   O  O     . GLN A  1  55   ? 227.895 285.250 158.757 1.00 68.31  ? 55   GLN R O     1 
ATOM   161   C  CB    . GLN A  1  55   ? 225.981 283.886 160.660 1.00 44.29  ? 55   GLN R CB    1 
ATOM   162   C  CG    . GLN A  1  55   ? 225.643 282.555 161.302 1.00 49.39  ? 55   GLN R CG    1 
ATOM   163   C  CD    . GLN A  1  55   ? 224.221 282.122 161.020 1.00 54.84  ? 55   GLN R CD    1 
ATOM   164   O  OE1   . GLN A  1  55   ? 223.352 282.947 160.744 1.00 51.63  ? 55   GLN R OE1   1 
ATOM   165   N  NE2   . GLN A  1  55   ? 223.977 280.819 161.079 1.00 66.65  ? 55   GLN R NE2   1 
ATOM   166   N  N     . LYS A  1  56   ? 227.858 286.733 160.450 1.00 65.31  ? 56   LYS R N     1 
ATOM   167   C  CA    . LYS A  1  56   ? 228.176 287.852 159.572 1.00 61.28  ? 56   LYS R CA    1 
ATOM   168   C  C     . LYS A  1  56   ? 229.665 287.921 159.244 1.00 73.77  ? 56   LYS R C     1 
ATOM   169   O  O     . LYS A  1  56   ? 230.034 288.224 158.104 1.00 75.78  ? 56   LYS R O     1 
ATOM   170   C  CB    . LYS A  1  56   ? 227.710 289.163 160.205 1.00 66.42  ? 56   LYS R CB    1 
ATOM   171   C  CG    . LYS A  1  56   ? 227.918 290.384 159.327 1.00 90.82  ? 56   LYS R CG    1 
ATOM   172   C  CD    . LYS A  1  56   ? 227.423 291.650 160.007 1.00 117.33 ? 56   LYS R CD    1 
ATOM   173   C  CE    . LYS A  1  56   ? 227.798 292.885 159.205 1.00 130.28 ? 56   LYS R CE    1 
ATOM   174   N  NZ    . LYS A  1  56   ? 227.164 292.891 157.858 1.00 132.84 ? 56   LYS R NZ    1 
ATOM   175   N  N     . SER A  1  57   ? 230.533 287.645 160.214 1.00 74.85  ? 57   SER R N     1 
ATOM   176   C  CA    . SER A  1  57   ? 231.962 287.865 160.042 1.00 66.41  ? 57   SER R CA    1 
ATOM   177   C  C     . SER A  1  57   ? 232.711 286.558 159.791 1.00 71.67  ? 57   SER R C     1 
ATOM   178   O  O     . SER A  1  57   ? 232.153 285.460 159.845 1.00 79.94  ? 57   SER R O     1 
ATOM   179   C  CB    . SER A  1  57   ? 232.541 288.570 161.273 1.00 52.06  ? 57   SER R CB    1 
ATOM   180   O  OG    . SER A  1  57   ? 232.429 287.755 162.425 1.00 63.41  ? 57   SER R OG    1 
ATOM   181   N  N     . THR A  1  58   ? 234.007 286.703 159.510 1.00 65.04  ? 58   THR R N     1 
ATOM   182   C  CA    . THR A  1  58   ? 234.917 285.592 159.259 1.00 71.53  ? 58   THR R CA    1 
ATOM   183   C  C     . THR A  1  58   ? 235.777 285.229 160.465 1.00 72.47  ? 58   THR R C     1 
ATOM   184   O  O     . THR A  1  58   ? 236.635 284.348 160.348 1.00 78.98  ? 58   THR R O     1 
ATOM   185   C  CB    . THR A  1  58   ? 235.826 285.916 158.068 1.00 75.57  ? 58   THR R CB    1 
ATOM   186   O  OG1   . THR A  1  58   ? 236.581 287.100 158.352 1.00 71.44  ? 58   THR R OG1   1 
ATOM   187   C  CG2   . THR A  1  58   ? 234.996 286.144 156.814 1.00 70.79  ? 58   THR R CG2   1 
ATOM   188   N  N     . GLU A  1  59   ? 235.578 285.892 161.602 1.00 82.36  ? 59   GLU R N     1 
ATOM   189   C  CA    . GLU A  1  59   ? 236.484 285.768 162.738 1.00 81.39  ? 59   GLU R CA    1 
ATOM   190   C  C     . GLU A  1  59   ? 236.616 284.317 163.196 1.00 80.07  ? 59   GLU R C     1 
ATOM   191   O  O     . GLU A  1  59   ? 235.670 283.529 163.127 1.00 86.00  ? 59   GLU R O     1 
ATOM   192   C  CB    . GLU A  1  59   ? 235.986 286.635 163.898 1.00 93.31  ? 59   GLU R CB    1 
ATOM   193   C  CG    . GLU A  1  59   ? 236.887 286.645 165.119 1.00 106.11 ? 59   GLU R CG    1 
ATOM   194   C  CD    . GLU A  1  59   ? 236.346 287.519 166.233 1.00 117.38 ? 59   GLU R CD    1 
ATOM   195   O  OE1   . GLU A  1  59   ? 235.244 288.082 166.066 1.00 112.47 ? 59   GLU R OE1   1 
ATOM   196   O  OE2   . GLU A  1  59   ? 237.020 287.641 167.276 1.00 125.87 ? 59   GLU R OE2   1 
ATOM   197   N  N     . LEU A  1  60   ? 237.817 283.967 163.657 1.00 73.19  ? 60   LEU R N     1 
ATOM   198   C  CA    . LEU A  1  60   ? 238.064 282.649 164.224 1.00 76.17  ? 60   LEU R CA    1 
ATOM   199   C  C     . LEU A  1  60   ? 237.569 282.608 165.664 1.00 82.04  ? 60   LEU R C     1 
ATOM   200   O  O     . LEU A  1  60   ? 237.838 283.523 166.448 1.00 86.66  ? 60   LEU R O     1 
ATOM   201   C  CB    . LEU A  1  60   ? 239.552 282.311 164.162 1.00 71.49  ? 60   LEU R CB    1 
ATOM   202   C  CG    . LEU A  1  60   ? 240.138 282.230 162.753 1.00 63.23  ? 60   LEU R CG    1 
ATOM   203   C  CD1   . LEU A  1  60   ? 241.633 281.966 162.802 1.00 60.32  ? 60   LEU R CD1   1 
ATOM   204   C  CD2   . LEU A  1  60   ? 239.421 281.170 161.938 1.00 61.17  ? 60   LEU R CD2   1 
ATOM   205   N  N     . LEU A  1  61   ? 236.847 281.546 166.009 1.00 57.62  ? 61   LEU R N     1 
ATOM   206   C  CA    . LEU A  1  61   ? 236.111 281.484 167.264 1.00 58.49  ? 61   LEU R CA    1 
ATOM   207   C  C     . LEU A  1  61   ? 236.854 280.762 168.381 1.00 62.45  ? 61   LEU R C     1 
ATOM   208   O  O     . LEU A  1  61   ? 236.337 280.692 169.499 1.00 66.08  ? 61   LEU R O     1 
ATOM   209   C  CB    . LEU A  1  61   ? 234.755 280.816 167.031 1.00 75.39  ? 61   LEU R CB    1 
ATOM   210   C  CG    . LEU A  1  61   ? 233.871 281.571 166.039 1.00 73.19  ? 61   LEU R CG    1 
ATOM   211   C  CD1   . LEU A  1  61   ? 232.567 280.832 165.783 1.00 73.79  ? 61   LEU R CD1   1 
ATOM   212   C  CD2   . LEU A  1  61   ? 233.613 282.984 166.527 1.00 59.33  ? 61   LEU R CD2   1 
ATOM   213   N  N     . ILE A  1  62   ? 238.044 280.229 168.120 1.00 63.24  ? 62   ILE R N     1 
ATOM   214   C  CA    . ILE A  1  62   ? 238.820 279.516 169.126 1.00 55.87  ? 62   ILE R CA    1 
ATOM   215   C  C     . ILE A  1  62   ? 240.144 280.240 169.323 1.00 61.91  ? 62   ILE R C     1 
ATOM   216   O  O     . ILE A  1  62   ? 240.796 280.635 168.351 1.00 66.98  ? 62   ILE R O     1 
ATOM   217   C  CB    . ILE A  1  62   ? 239.051 278.041 168.731 1.00 58.85  ? 62   ILE R CB    1 
ATOM   218   C  CG1   . ILE A  1  62   ? 237.722 277.288 168.701 1.00 64.31  ? 62   ILE R CG1   1 
ATOM   219   C  CG2   . ILE A  1  62   ? 240.013 277.368 169.698 1.00 64.83  ? 62   ILE R CG2   1 
ATOM   220   C  CD1   . ILE A  1  62   ? 237.825 275.895 168.124 1.00 52.76  ? 62   ILE R CD1   1 
ATOM   221   N  N     . ARG A  1  63   ? 240.537 280.414 170.582 1.00 62.25  ? 63   ARG R N     1 
ATOM   222   C  CA    . ARG A  1  63   ? 241.766 281.130 170.887 1.00 69.79  ? 63   ARG R CA    1 
ATOM   223   C  C     . ARG A  1  63   ? 242.986 280.297 170.516 1.00 72.60  ? 63   ARG R C     1 
ATOM   224   O  O     . ARG A  1  63   ? 243.005 279.076 170.692 1.00 75.25  ? 63   ARG R O     1 
ATOM   225   C  CB    . ARG A  1  63   ? 241.804 281.515 172.364 1.00 88.18  ? 63   ARG R CB    1 
ATOM   226   C  CG    . ARG A  1  63   ? 240.705 282.489 172.732 1.00 83.07  ? 63   ARG R CG    1 
ATOM   227   C  CD    . ARG A  1  63   ? 240.879 283.775 171.944 1.00 92.37  ? 63   ARG R CD    1 
ATOM   228   N  NE    . ARG A  1  63   ? 239.817 284.743 172.196 1.00 104.78 ? 63   ARG R NE    1 
ATOM   229   C  CZ    . ARG A  1  63   ? 239.623 285.831 171.458 1.00 107.93 ? 63   ARG R CZ    1 
ATOM   230   N  NH1   . ARG A  1  63   ? 240.413 286.085 170.427 1.00 105.76 ? 63   ARG R NH1   1 
ATOM   231   N  NH2   . ARG A  1  63   ? 238.634 286.663 171.748 1.00 108.93 ? 63   ARG R NH2   1 
ATOM   232   N  N     . LYS A  1  64   ? 244.009 280.976 169.994 1.00 75.04  ? 64   LYS R N     1 
ATOM   233   C  CA    . LYS A  1  64   ? 245.191 280.340 169.424 1.00 82.52  ? 64   LYS R CA    1 
ATOM   234   C  C     . LYS A  1  64   ? 245.912 279.427 170.407 1.00 86.85  ? 64   LYS R C     1 
ATOM   235   O  O     . LYS A  1  64   ? 245.974 278.212 170.195 1.00 89.37  ? 64   LYS R O     1 
ATOM   236   C  CB    . LYS A  1  64   ? 246.160 281.401 168.900 1.00 87.45  ? 64   LYS R CB    1 
ATOM   237   C  CG    . LYS A  1  64   ? 245.927 281.809 167.453 1.00 92.32  ? 64   LYS R CG    1 
ATOM   238   C  CD    . LYS A  1  64   ? 244.620 282.567 167.282 1.00 92.22  ? 64   LYS R CD    1 
ATOM   239   C  CE    . LYS A  1  64   ? 244.404 282.971 165.835 1.00 96.80  ? 64   LYS R CE    1 
ATOM   240   N  NZ    . LYS A  1  64   ? 243.128 283.713 165.654 1.00 101.00 ? 64   LYS R NZ    1 
ATOM   241   N  N     . LEU A  1  65   ? 246.465 280.005 171.476 1.00 85.72  ? 65   LEU R N     1 
ATOM   242   C  CA    . LEU A  1  65   ? 247.358 279.250 172.358 1.00 87.56  ? 65   LEU R CA    1 
ATOM   243   C  C     . LEU A  1  65   ? 246.732 277.980 172.928 1.00 89.71  ? 65   LEU R C     1 
ATOM   244   O  O     . LEU A  1  65   ? 247.403 276.932 172.910 1.00 92.16  ? 65   LEU R O     1 
ATOM   245   C  CB    . LEU A  1  65   ? 247.870 280.168 173.472 1.00 92.10  ? 65   LEU R CB    1 
ATOM   246   C  CG    . LEU A  1  65   ? 248.739 281.337 173.012 1.00 99.69  ? 65   LEU R CG    1 
ATOM   247   C  CD1   . LEU A  1  65   ? 249.099 282.236 174.186 1.00 101.79 ? 65   LEU R CD1   1 
ATOM   248   C  CD2   . LEU A  1  65   ? 249.993 280.835 172.312 1.00 101.21 ? 65   LEU R CD2   1 
ATOM   249   N  N     . PRO A  1  66   ? 245.496 277.983 173.448 1.00 89.93  ? 66   PRO R N     1 
ATOM   250   C  CA    . PRO A  1  66   ? 244.926 276.713 173.926 1.00 88.51  ? 66   PRO R CA    1 
ATOM   251   C  C     . PRO A  1  66   ? 244.827 275.656 172.841 1.00 89.40  ? 66   PRO R C     1 
ATOM   252   O  O     . PRO A  1  66   ? 245.168 274.489 173.078 1.00 107.39 ? 66   PRO R O     1 
ATOM   253   C  CB    . PRO A  1  66   ? 243.540 277.126 174.444 1.00 83.14  ? 66   PRO R CB    1 
ATOM   254   C  CG    . PRO A  1  66   ? 243.688 278.556 174.793 1.00 93.38  ? 66   PRO R CG    1 
ATOM   255   C  CD    . PRO A  1  66   ? 244.604 279.117 173.749 1.00 90.86  ? 66   PRO R CD    1 
ATOM   256   N  N     . PHE A  1  67   ? 244.377 276.043 171.646 1.00 73.97  ? 67   PHE R N     1 
ATOM   257   C  CA    . PHE A  1  67   ? 244.274 275.089 170.548 1.00 77.27  ? 67   PHE R CA    1 
ATOM   258   C  C     . PHE A  1  67   ? 245.644 274.554 170.155 1.00 83.28  ? 67   PHE R C     1 
ATOM   259   O  O     . PHE A  1  67   ? 245.790 273.367 169.843 1.00 89.26  ? 67   PHE R O     1 
ATOM   260   C  CB    . PHE A  1  67   ? 243.584 275.742 169.352 1.00 71.69  ? 67   PHE R CB    1 
ATOM   261   C  CG    . PHE A  1  67   ? 243.479 274.852 168.152 1.00 66.75  ? 67   PHE R CG    1 
ATOM   262   C  CD1   . PHE A  1  67   ? 242.490 273.888 168.075 1.00 69.86  ? 67   PHE R CD1   1 
ATOM   263   C  CD2   . PHE A  1  67   ? 244.364 274.984 167.096 1.00 65.31  ? 67   PHE R CD2   1 
ATOM   264   C  CE1   . PHE A  1  67   ? 242.388 273.068 166.969 1.00 60.99  ? 67   PHE R CE1   1 
ATOM   265   C  CE2   . PHE A  1  67   ? 244.269 274.166 165.989 1.00 61.01  ? 67   PHE R CE2   1 
ATOM   266   C  CZ    . PHE A  1  67   ? 243.279 273.207 165.927 1.00 65.01  ? 67   PHE R CZ    1 
ATOM   267   N  N     . GLN A  1  68   ? 246.663 275.415 170.167 1.00 74.19  ? 68   GLN R N     1 
ATOM   268   C  CA    . GLN A  1  68   ? 248.009 274.974 169.818 1.00 81.01  ? 68   GLN R CA    1 
ATOM   269   C  C     . GLN A  1  68   ? 248.550 273.989 170.846 1.00 89.73  ? 68   GLN R C     1 
ATOM   270   O  O     . GLN A  1  68   ? 249.138 272.963 170.481 1.00 88.21  ? 68   GLN R O     1 
ATOM   271   C  CB    . GLN A  1  68   ? 248.938 276.179 169.682 1.00 82.49  ? 68   GLN R CB    1 
ATOM   272   C  CG    . GLN A  1  68   ? 250.337 275.831 169.208 1.00 97.87  ? 68   GLN R CG    1 
ATOM   273   C  CD    . GLN A  1  68   ? 251.178 277.061 168.931 1.00 113.20 ? 68   GLN R CD    1 
ATOM   274   O  OE1   . GLN A  1  68   ? 250.690 278.189 168.999 1.00 118.31 ? 68   GLN R OE1   1 
ATOM   275   N  NE2   . GLN A  1  68   ? 252.450 276.849 168.617 1.00 115.19 ? 68   GLN R NE2   1 
ATOM   276   N  N     . ARG A  1  69   ? 248.358 274.281 172.135 1.00 75.54  ? 69   ARG R N     1 
ATOM   277   C  CA    . ARG A  1  69   ? 248.776 273.333 173.163 1.00 82.96  ? 69   ARG R CA    1 
ATOM   278   C  C     . ARG A  1  69   ? 248.023 272.016 173.045 1.00 86.80  ? 69   ARG R C     1 
ATOM   279   O  O     . ARG A  1  69   ? 248.594 270.949 173.306 1.00 90.41  ? 69   ARG R O     1 
ATOM   280   C  CB    . ARG A  1  69   ? 248.578 273.936 174.553 1.00 87.57  ? 69   ARG R CB    1 
ATOM   281   C  CG    . ARG A  1  69   ? 249.506 275.094 174.868 1.00 86.09  ? 69   ARG R CG    1 
ATOM   282   C  CD    . ARG A  1  69   ? 249.467 275.436 176.346 1.00 90.36  ? 69   ARG R CD    1 
ATOM   283   N  NE    . ARG A  1  69   ? 248.138 275.864 176.772 1.00 86.05  ? 69   ARG R NE    1 
ATOM   284   C  CZ    . ARG A  1  69   ? 247.697 277.113 176.696 1.00 93.76  ? 69   ARG R CZ    1 
ATOM   285   N  NH1   . ARG A  1  69   ? 248.481 278.065 176.208 1.00 93.29  ? 69   ARG R NH1   1 
ATOM   286   N  NH2   . ARG A  1  69   ? 246.473 277.414 177.107 1.00 102.29 ? 69   ARG R NH2   1 
ATOM   287   N  N     . LEU A  1  70   ? 246.749 272.066 172.649 1.00 88.17  ? 70   LEU R N     1 
ATOM   288   C  CA    . LEU A  1  70   ? 245.995 270.835 172.433 1.00 77.12  ? 70   LEU R CA    1 
ATOM   289   C  C     . LEU A  1  70   ? 246.581 270.028 171.282 1.00 85.72  ? 70   LEU R C     1 
ATOM   290   O  O     . LEU A  1  70   ? 246.771 268.809 171.396 1.00 87.33  ? 70   LEU R O     1 
ATOM   291   C  CB    . LEU A  1  70   ? 244.526 271.163 172.171 1.00 74.26  ? 70   LEU R CB    1 
ATOM   292   C  CG    . LEU A  1  70   ? 243.627 269.972 171.837 1.00 89.63  ? 70   LEU R CG    1 
ATOM   293   C  CD1   . LEU A  1  70   ? 243.595 268.990 172.994 1.00 99.53  ? 70   LEU R CD1   1 
ATOM   294   C  CD2   . LEU A  1  70   ? 242.226 270.447 171.497 1.00 84.40  ? 70   LEU R CD2   1 
ATOM   295   N  N     . VAL A  1  71   ? 246.873 270.692 170.162 1.00 71.28  ? 71   VAL R N     1 
ATOM   296   C  CA    . VAL A  1  71   ? 247.481 270.011 169.021 1.00 67.34  ? 71   VAL R CA    1 
ATOM   297   C  C     . VAL A  1  71   ? 248.802 269.372 169.422 1.00 67.60  ? 71   VAL R C     1 
ATOM   298   O  O     . VAL A  1  71   ? 249.095 268.230 169.048 1.00 74.82  ? 71   VAL R O     1 
ATOM   299   C  CB    . VAL A  1  71   ? 247.664 270.992 167.848 1.00 69.35  ? 71   VAL R CB    1 
ATOM   300   C  CG1   . VAL A  1  71   ? 248.460 270.339 166.737 1.00 63.81  ? 71   VAL R CG1   1 
ATOM   301   C  CG2   . VAL A  1  71   ? 246.314 271.449 167.329 1.00 60.43  ? 71   VAL R CG2   1 
ATOM   302   N  N     . ARG A  1  72   ? 249.619 270.092 170.195 1.00 73.18  ? 72   ARG R N     1 
ATOM   303   C  CA    . ARG A  1  72   ? 250.902 269.536 170.609 1.00 80.50  ? 72   ARG R CA    1 
ATOM   304   C  C     . ARG A  1  72   ? 250.715 268.332 171.524 1.00 88.24  ? 72   ARG R C     1 
ATOM   305   O  O     . ARG A  1  72   ? 251.406 267.317 171.367 1.00 77.80  ? 72   ARG R O     1 
ATOM   306   C  CB    . ARG A  1  72   ? 251.744 270.616 171.286 1.00 67.92  ? 72   ARG R CB    1 
ATOM   307   C  CG    . ARG A  1  72   ? 252.148 271.738 170.345 1.00 70.70  ? 72   ARG R CG    1 
ATOM   308   C  CD    . ARG A  1  72   ? 253.048 272.754 171.024 1.00 86.79  ? 72   ARG R CD    1 
ATOM   309   N  NE    . ARG A  1  72   ? 253.409 273.842 170.118 1.00 99.38  ? 72   ARG R NE    1 
ATOM   310   C  CZ    . ARG A  1  72   ? 254.411 273.787 169.247 1.00 101.61 ? 72   ARG R CZ    1 
ATOM   311   N  NH1   . ARG A  1  72   ? 255.159 272.696 169.161 1.00 92.08  ? 72   ARG R NH1   1 
ATOM   312   N  NH2   . ARG A  1  72   ? 254.667 274.823 168.460 1.00 101.84 ? 72   ARG R NH2   1 
ATOM   313   N  N     . GLU A  1  73   ? 249.781 268.416 172.477 1.00 81.79  ? 73   GLU R N     1 
ATOM   314   C  CA    . GLU A  1  73   ? 249.513 267.274 173.347 1.00 71.72  ? 73   GLU R CA    1 
ATOM   315   C  C     . GLU A  1  73   ? 249.089 266.055 172.540 1.00 78.42  ? 73   GLU R C     1 
ATOM   316   O  O     . GLU A  1  73   ? 249.584 264.946 172.764 1.00 93.10  ? 73   GLU R O     1 
ATOM   317   C  CB    . GLU A  1  73   ? 248.435 267.620 174.372 1.00 105.43 ? 73   GLU R CB    1 
ATOM   318   C  CG    . GLU A  1  73   ? 248.120 266.457 175.307 1.00 108.25 ? 73   GLU R CG    1 
ATOM   319   C  CD    . GLU A  1  73   ? 247.013 266.771 176.291 1.00 132.51 ? 73   GLU R CD    1 
ATOM   320   O  OE1   . GLU A  1  73   ? 246.449 267.878 176.216 1.00 138.02 ? 73   GLU R OE1   1 
ATOM   321   O  OE2   . GLU A  1  73   ? 246.704 265.905 177.137 1.00 142.40 ? 73   GLU R OE2   1 
ATOM   322   N  N     . ILE A  1  74   ? 248.161 266.243 171.600 1.00 73.85  ? 74   ILE R N     1 
ATOM   323   C  CA    . ILE A  1  74   ? 247.686 265.122 170.793 1.00 68.25  ? 74   ILE R CA    1 
ATOM   324   C  C     . ILE A  1  74   ? 248.819 264.557 169.946 1.00 72.76  ? 74   ILE R C     1 
ATOM   325   O  O     . ILE A  1  74   ? 248.905 263.343 169.725 1.00 81.42  ? 74   ILE R O     1 
ATOM   326   C  CB    . ILE A  1  74   ? 246.488 265.559 169.933 1.00 50.31  ? 74   ILE R CB    1 
ATOM   327   C  CG1   . ILE A  1  74   ? 245.302 265.917 170.830 1.00 54.02  ? 74   ILE R CG1   1 
ATOM   328   C  CG2   . ILE A  1  74   ? 246.096 264.469 168.955 1.00 51.77  ? 74   ILE R CG2   1 
ATOM   329   C  CD1   . ILE A  1  74   ? 244.159 266.565 170.098 1.00 59.10  ? 74   ILE R CD1   1 
ATOM   330   N  N     . ALA A  1  75   ? 249.718 265.422 169.477 1.00 70.28  ? 75   ALA R N     1 
ATOM   331   C  CA    . ALA A  1  75   ? 250.836 264.969 168.662 1.00 73.21  ? 75   ALA R CA    1 
ATOM   332   C  C     . ALA A  1  75   ? 251.934 264.298 169.476 1.00 81.58  ? 75   ALA R C     1 
ATOM   333   O  O     . ALA A  1  75   ? 252.773 263.602 168.893 1.00 85.25  ? 75   ALA R O     1 
ATOM   334   C  CB    . ALA A  1  75   ? 251.424 266.141 167.875 1.00 71.79  ? 75   ALA R CB    1 
ATOM   335   N  N     . GLN A  1  76   ? 251.958 264.492 170.797 1.00 81.49  ? 76   GLN R N     1 
ATOM   336   C  CA    . GLN A  1  76   ? 252.971 263.832 171.615 1.00 76.61  ? 76   GLN R CA    1 
ATOM   337   C  C     . GLN A  1  76   ? 252.837 262.314 171.575 1.00 89.77  ? 76   GLN R C     1 
ATOM   338   O  O     . GLN A  1  76   ? 253.843 261.602 171.662 1.00 97.80  ? 76   GLN R O     1 
ATOM   339   C  CB    . GLN A  1  76   ? 252.895 264.317 173.063 1.00 91.62  ? 76   GLN R CB    1 
ATOM   340   C  CG    . GLN A  1  76   ? 253.329 265.755 173.271 1.00 111.67 ? 76   GLN R CG    1 
ATOM   341   C  CD    . GLN A  1  76   ? 253.181 266.203 174.711 1.00 113.64 ? 76   GLN R CD    1 
ATOM   342   O  OE1   . GLN A  1  76   ? 252.374 265.656 175.464 1.00 114.74 ? 76   GLN R OE1   1 
ATOM   343   N  NE2   . GLN A  1  76   ? 253.964 267.202 175.102 1.00 92.83  ? 76   GLN R NE2   1 
ATOM   344   N  N     . ASP A  1  77   ? 251.614 261.803 171.443 1.00 81.89  ? 77   ASP R N     1 
ATOM   345   C  CA    . ASP A  1  77   ? 251.382 260.364 171.485 1.00 73.97  ? 77   ASP R CA    1 
ATOM   346   C  C     . ASP A  1  77   ? 251.833 259.644 170.222 1.00 79.70  ? 77   ASP R C     1 
ATOM   347   O  O     . ASP A  1  77   ? 251.821 258.409 170.198 1.00 102.61 ? 77   ASP R O     1 
ATOM   348   C  CB    . ASP A  1  77   ? 249.898 260.081 171.727 1.00 88.09  ? 77   ASP R CB    1 
ATOM   349   C  CG    . ASP A  1  77   ? 249.452 260.468 173.122 1.00 107.36 ? 77   ASP R CG    1 
ATOM   350   O  OD1   . ASP A  1  77   ? 250.325 260.668 173.991 1.00 107.48 ? 77   ASP R OD1   1 
ATOM   351   O  OD2   . ASP A  1  77   ? 248.227 260.572 173.349 1.00 118.29 ? 77   ASP R OD2   1 
ATOM   352   N  N     . PHE A  1  78   ? 252.229 260.374 169.182 1.00 72.99  ? 78   PHE R N     1 
ATOM   353   C  CA    . PHE A  1  78   ? 252.603 259.758 167.915 1.00 73.43  ? 78   PHE R CA    1 
ATOM   354   C  C     . PHE A  1  78   ? 254.117 259.729 167.755 1.00 75.81  ? 78   PHE R C     1 
ATOM   355   O  O     . PHE A  1  78   ? 254.723 258.654 167.738 1.00 82.04  ? 78   PHE R O     1 
ATOM   356   C  CB    . PHE A  1  78   ? 251.947 260.507 166.755 1.00 62.40  ? 78   PHE R CB    1 
ATOM   357   C  CG    . PHE A  1  78   ? 250.446 260.454 166.776 1.00 69.62  ? 78   PHE R CG    1 
ATOM   358   C  CD1   . PHE A  1  78   ? 249.786 259.437 167.444 1.00 77.96  ? 78   PHE R CD1   1 
ATOM   359   C  CD2   . PHE A  1  78   ? 249.696 261.432 166.151 1.00 66.86  ? 78   PHE R CD2   1 
ATOM   360   C  CE1   . PHE A  1  78   ? 248.409 259.387 167.473 1.00 73.48  ? 78   PHE R CE1   1 
ATOM   361   C  CE2   . PHE A  1  78   ? 248.317 261.390 166.181 1.00 68.97  ? 78   PHE R CE2   1 
ATOM   362   C  CZ    . PHE A  1  78   ? 247.673 260.364 166.840 1.00 63.51  ? 78   PHE R CZ    1 
ATOM   363   N  N     . LYS A  1  79   ? 254.732 260.902 167.635 1.00 76.85  ? 79   LYS R N     1 
ATOM   364   C  CA    . LYS A  1  79   ? 256.182 261.026 167.584 1.00 76.46  ? 79   LYS R CA    1 
ATOM   365   C  C     . LYS A  1  79   ? 256.606 262.164 168.500 1.00 79.20  ? 79   LYS R C     1 
ATOM   366   O  O     . LYS A  1  79   ? 256.051 263.264 168.423 1.00 82.49  ? 79   LYS R O     1 
ATOM   367   C  CB    . LYS A  1  79   ? 256.678 261.281 166.158 1.00 68.13  ? 79   LYS R CB    1 
ATOM   368   C  CG    . LYS A  1  79   ? 258.193 261.363 166.044 1.00 79.19  ? 79   LYS R CG    1 
ATOM   369   C  CD    . LYS A  1  79   ? 258.636 261.613 164.613 1.00 86.95  ? 79   LYS R CD    1 
ATOM   370   C  CE    . LYS A  1  79   ? 260.131 261.888 164.543 1.00 96.73  ? 79   LYS R CE    1 
ATOM   371   N  NZ    . LYS A  1  79   ? 260.932 260.722 165.007 1.00 106.52 ? 79   LYS R NZ    1 
ATOM   372   N  N     . THR A  1  80   ? 257.580 261.897 169.361 1.00 89.49  ? 80   THR R N     1 
ATOM   373   C  CA    . THR A  1  80   ? 258.043 262.901 170.305 1.00 95.46  ? 80   THR R CA    1 
ATOM   374   C  C     . THR A  1  80   ? 258.949 263.913 169.615 1.00 92.71  ? 80   THR R C     1 
ATOM   375   O  O     . THR A  1  80   ? 259.613 263.611 168.620 1.00 83.27  ? 80   THR R O     1 
ATOM   376   C  CB    . THR A  1  80   ? 258.790 262.247 171.467 1.00 116.68 ? 80   THR R CB    1 
ATOM   377   O  OG1   . THR A  1  80   ? 259.915 261.515 170.962 1.00 126.61 ? 80   THR R OG1   1 
ATOM   378   C  CG2   . THR A  1  80   ? 257.873 261.297 172.221 1.00 109.11 ? 80   THR R CG2   1 
ATOM   379   N  N     . ASP A  1  81   ? 258.967 265.130 170.163 1.00 83.60  ? 81   ASP R N     1 
ATOM   380   C  CA    . ASP A  1  81   ? 259.837 266.214 169.711 1.00 83.71  ? 81   ASP R CA    1 
ATOM   381   C  C     . ASP A  1  81   ? 259.574 266.553 168.239 1.00 80.79  ? 81   ASP R C     1 
ATOM   382   O  O     . ASP A  1  81   ? 260.392 266.311 167.349 1.00 77.35  ? 81   ASP R O     1 
ATOM   383   C  CB    . ASP A  1  81   ? 261.310 265.857 169.944 1.00 103.62 ? 81   ASP R CB    1 
ATOM   384   C  CG    . ASP A  1  81   ? 261.655 265.743 171.415 1.00 117.13 ? 81   ASP R CG    1 
ATOM   385   O  OD1   . ASP A  1  81   ? 260.858 266.218 172.250 1.00 121.17 ? 81   ASP R OD1   1 
ATOM   386   O  OD2   . ASP A  1  81   ? 262.720 265.175 171.737 1.00 119.37 ? 81   ASP R OD2   1 
ATOM   387   N  N     . LEU A  1  82   ? 258.396 267.125 168.009 1.00 78.78  ? 82   LEU R N     1 
ATOM   388   C  CA    . LEU A  1  82   ? 257.977 267.564 166.687 1.00 65.61  ? 82   LEU R CA    1 
ATOM   389   C  C     . LEU A  1  82   ? 257.924 269.084 166.621 1.00 69.34  ? 82   LEU R C     1 
ATOM   390   O  O     . LEU A  1  82   ? 257.648 269.759 167.617 1.00 58.88  ? 82   LEU R O     1 
ATOM   391   C  CB    . LEU A  1  82   ? 256.607 266.990 166.315 1.00 63.16  ? 82   LEU R CB    1 
ATOM   392   C  CG    . LEU A  1  82   ? 256.525 265.481 166.094 1.00 73.89  ? 82   LEU R CG    1 
ATOM   393   C  CD1   . LEU A  1  82   ? 255.086 265.061 165.860 1.00 68.01  ? 82   LEU R CD1   1 
ATOM   394   C  CD2   . LEU A  1  82   ? 257.398 265.073 164.922 1.00 68.61  ? 82   LEU R CD2   1 
ATOM   395   N  N     . ARG A  1  83   ? 258.192 269.613 165.432 1.00 66.19  ? 83   ARG R N     1 
ATOM   396   C  CA    . ARG A  1  83   ? 258.134 271.042 165.168 1.00 62.97  ? 83   ARG R CA    1 
ATOM   397   C  C     . ARG A  1  83   ? 256.926 271.349 164.294 1.00 60.66  ? 83   ARG R C     1 
ATOM   398   O  O     . ARG A  1  83   ? 256.655 270.638 163.321 1.00 62.06  ? 83   ARG R O     1 
ATOM   399   C  CB    . ARG A  1  83   ? 259.413 271.527 164.481 1.00 75.96  ? 83   ARG R CB    1 
ATOM   400   C  CG    . ARG A  1  83   ? 260.674 271.317 165.298 1.00 90.45  ? 83   ARG R CG    1 
ATOM   401   C  CD    . ARG A  1  83   ? 260.655 272.167 166.555 1.00 95.88  ? 83   ARG R CD    1 
ATOM   402   N  NE    . ARG A  1  83   ? 261.863 271.993 167.355 1.00 94.92  ? 83   ARG R NE    1 
ATOM   403   C  CZ    . ARG A  1  83   ? 262.983 272.685 167.174 1.00 111.42 ? 83   ARG R CZ    1 
ATOM   404   N  NH1   . ARG A  1  83   ? 263.050 273.602 166.219 1.00 99.56  ? 83   ARG R NH1   1 
ATOM   405   N  NH2   . ARG A  1  83   ? 264.036 272.461 167.949 1.00 130.92 ? 83   ARG R NH2   1 
ATOM   406   N  N     . PHE A  1  84   ? 256.202 272.407 164.642 1.00 72.76  ? 84   PHE R N     1 
ATOM   407   C  CA    . PHE A  1  84   ? 255.006 272.819 163.924 1.00 67.51  ? 84   PHE R CA    1 
ATOM   408   C  C     . PHE A  1  84   ? 255.204 274.215 163.355 1.00 63.70  ? 84   PHE R C     1 
ATOM   409   O  O     . PHE A  1  84   ? 255.629 275.125 164.073 1.00 66.05  ? 84   PHE R O     1 
ATOM   410   C  CB    . PHE A  1  84   ? 253.776 272.803 164.834 1.00 82.97  ? 84   PHE R CB    1 
ATOM   411   C  CG    . PHE A  1  84   ? 253.390 271.435 165.308 1.00 78.58  ? 84   PHE R CG    1 
ATOM   412   C  CD1   . PHE A  1  84   ? 252.575 270.628 164.537 1.00 73.38  ? 84   PHE R CD1   1 
ATOM   413   C  CD2   . PHE A  1  84   ? 253.845 270.957 166.523 1.00 74.08  ? 84   PHE R CD2   1 
ATOM   414   C  CE1   . PHE A  1  84   ? 252.216 269.369 164.968 1.00 81.43  ? 84   PHE R CE1   1 
ATOM   415   C  CE2   . PHE A  1  84   ? 253.491 269.698 166.963 1.00 73.55  ? 84   PHE R CE2   1 
ATOM   416   C  CZ    . PHE A  1  84   ? 252.676 268.904 166.182 1.00 74.21  ? 84   PHE R CZ    1 
ATOM   417   N  N     . GLN A  1  85   ? 254.896 274.382 162.074 1.00 63.99  ? 85   GLN R N     1 
ATOM   418   C  CA    . GLN A  1  85   ? 254.831 275.709 161.492 1.00 60.63  ? 85   GLN R CA    1 
ATOM   419   C  C     . GLN A  1  85   ? 253.517 276.374 161.880 1.00 64.84  ? 85   GLN R C     1 
ATOM   420   O  O     . GLN A  1  85   ? 252.510 275.706 162.130 1.00 68.26  ? 85   GLN R O     1 
ATOM   421   C  CB    . GLN A  1  85   ? 254.960 275.645 159.970 1.00 65.70  ? 85   GLN R CB    1 
ATOM   422   C  CG    . GLN A  1  85   ? 256.313 275.157 159.484 1.00 79.14  ? 85   GLN R CG    1 
ATOM   423   C  CD    . GLN A  1  85   ? 256.398 275.093 157.974 1.00 80.91  ? 85   GLN R CD    1 
ATOM   424   O  OE1   . GLN A  1  85   ? 255.382 275.001 157.286 1.00 75.27  ? 85   GLN R OE1   1 
ATOM   425   N  NE2   . GLN A  1  85   ? 257.616 275.142 157.447 1.00 70.76  ? 85   GLN R NE2   1 
ATOM   426   N  N     . SER A  1  86   ? 253.537 277.707 161.933 1.00 77.27  ? 86   SER R N     1 
ATOM   427   C  CA    . SER A  1  86   ? 252.337 278.445 162.322 1.00 73.86  ? 86   SER R CA    1 
ATOM   428   C  C     . SER A  1  86   ? 251.193 278.189 161.350 1.00 78.54  ? 86   SER R C     1 
ATOM   429   O  O     . SER A  1  86   ? 250.036 278.046 161.766 1.00 80.14  ? 86   SER R O     1 
ATOM   430   C  CB    . SER A  1  86   ? 252.645 279.938 162.406 1.00 74.66  ? 86   SER R CB    1 
ATOM   431   O  OG    . SER A  1  86   ? 253.014 280.452 161.138 1.00 93.44  ? 86   SER R OG    1 
ATOM   432   N  N     . SER A  1  87   ? 251.498 278.115 160.053 1.00 57.76  ? 87   SER R N     1 
ATOM   433   C  CA    . SER A  1  87   ? 250.459 277.870 159.060 1.00 54.93  ? 87   SER R CA    1 
ATOM   434   C  C     . SER A  1  87   ? 249.837 276.488 159.216 1.00 55.67  ? 87   SER R C     1 
ATOM   435   O  O     . SER A  1  87   ? 248.685 276.282 158.819 1.00 49.84  ? 87   SER R O     1 
ATOM   436   C  CB    . SER A  1  87   ? 251.032 278.044 157.655 1.00 68.22  ? 87   SER R CB    1 
ATOM   437   O  OG    . SER A  1  87   ? 252.076 277.116 157.414 1.00 74.90  ? 87   SER R OG    1 
ATOM   438   N  N     . ALA A  1  88   ? 250.573 275.533 159.788 1.00 59.17  ? 88   ALA R N     1 
ATOM   439   C  CA    . ALA A  1  88   ? 250.004 274.212 160.031 1.00 62.40  ? 88   ALA R CA    1 
ATOM   440   C  C     . ALA A  1  88   ? 248.970 274.258 161.146 1.00 52.45  ? 88   ALA R C     1 
ATOM   441   O  O     . ALA A  1  88   ? 247.864 273.721 161.008 1.00 54.29  ? 88   ALA R O     1 
ATOM   442   C  CB    . ALA A  1  88   ? 251.114 273.215 160.364 1.00 52.96  ? 88   ALA R CB    1 
ATOM   443   N  N     . VAL A  1  89   ? 249.314 274.900 162.267 1.00 38.56  ? 89   VAL R N     1 
ATOM   444   C  CA    . VAL A  1  89   ? 248.360 275.056 163.359 1.00 43.07  ? 89   VAL R CA    1 
ATOM   445   C  C     . VAL A  1  89   ? 247.147 275.847 162.890 1.00 44.76  ? 89   VAL R C     1 
ATOM   446   O  O     . VAL A  1  89   ? 246.001 275.522 163.235 1.00 56.33  ? 89   VAL R O     1 
ATOM   447   C  CB    . VAL A  1  89   ? 249.040 275.720 164.570 1.00 47.54  ? 89   VAL R CB    1 
ATOM   448   C  CG1   . VAL A  1  89   ? 248.032 275.973 165.676 1.00 53.73  ? 89   VAL R CG1   1 
ATOM   449   C  CG2   . VAL A  1  89   ? 250.184 274.855 165.071 1.00 45.42  ? 89   VAL R CG2   1 
ATOM   450   N  N     . MET A  1  90   ? 247.373 276.887 162.086 1.00 46.31  ? 90   MET R N     1 
ATOM   451   C  CA    . MET A  1  90   ? 246.255 277.629 161.513 1.00 48.06  ? 90   MET R CA    1 
ATOM   452   C  C     . MET A  1  90   ? 245.403 276.736 160.620 1.00 50.27  ? 90   MET R C     1 
ATOM   453   O  O     . MET A  1  90   ? 244.177 276.881 160.574 1.00 60.70  ? 90   MET R O     1 
ATOM   454   C  CB    . MET A  1  90   ? 246.768 278.837 160.733 1.00 63.12  ? 90   MET R CB    1 
ATOM   455   C  CG    . MET A  1  90   ? 247.436 279.892 161.597 1.00 74.40  ? 90   MET R CG    1 
ATOM   456   S  SD    . MET A  1  90   ? 246.324 280.563 162.844 1.00 87.16  ? 90   MET R SD    1 
ATOM   457   C  CE    . MET A  1  90   ? 245.131 281.401 161.805 1.00 223.44 ? 90   MET R CE    1 
ATOM   458   N  N     . ALA A  1  91   ? 246.035 275.800 159.907 1.00 42.18  ? 91   ALA R N     1 
ATOM   459   C  CA    . ALA A  1  91   ? 245.280 274.877 159.067 1.00 44.96  ? 91   ALA R CA    1 
ATOM   460   C  C     . ALA A  1  91   ? 244.389 273.974 159.908 1.00 55.33  ? 91   ALA R C     1 
ATOM   461   O  O     . ALA A  1  91   ? 243.195 273.814 159.621 1.00 56.58  ? 91   ALA R O     1 
ATOM   462   C  CB    . ALA A  1  91   ? 246.235 274.047 158.208 1.00 66.50  ? 91   ALA R CB    1 
ATOM   463   N  N     . LEU A  1  92   ? 244.954 273.377 160.962 1.00 33.99  ? 92   LEU R N     1 
ATOM   464   C  CA    . LEU A  1  92   ? 244.150 272.547 161.853 1.00 35.40  ? 92   LEU R CA    1 
ATOM   465   C  C     . LEU A  1  92   ? 243.031 273.345 162.504 1.00 37.35  ? 92   LEU R C     1 
ATOM   466   O  O     . LEU A  1  92   ? 241.953 272.801 162.765 1.00 28.45  ? 92   LEU R O     1 
ATOM   467   C  CB    . LEU A  1  92   ? 245.039 271.906 162.917 1.00 39.01  ? 92   LEU R CB    1 
ATOM   468   C  CG    . LEU A  1  92   ? 246.057 270.906 162.376 1.00 44.53  ? 92   LEU R CG    1 
ATOM   469   C  CD1   . LEU A  1  92   ? 246.970 270.420 163.483 1.00 30.46  ? 92   LEU R CD1   1 
ATOM   470   C  CD2   . LEU A  1  92   ? 245.340 269.744 161.727 1.00 28.67  ? 92   LEU R CD2   1 
ATOM   471   N  N     . GLN A  1  93   ? 243.260 274.633 162.767 1.00 41.78  ? 93   GLN R N     1 
ATOM   472   C  CA    . GLN A  1  93   ? 242.200 275.452 163.345 1.00 38.05  ? 93   GLN R CA    1 
ATOM   473   C  C     . GLN A  1  93   ? 241.092 275.714 162.331 1.00 48.21  ? 93   GLN R C     1 
ATOM   474   O  O     . GLN A  1  93   ? 239.906 275.660 162.677 1.00 51.08  ? 93   GLN R O     1 
ATOM   475   C  CB    . GLN A  1  93   ? 242.775 276.765 163.871 1.00 39.74  ? 93   GLN R CB    1 
ATOM   476   C  CG    . GLN A  1  93   ? 241.768 277.621 164.618 1.00 54.54  ? 93   GLN R CG    1 
ATOM   477   C  CD    . GLN A  1  93   ? 242.408 278.820 165.283 1.00 68.24  ? 93   GLN R CD    1 
ATOM   478   O  OE1   . GLN A  1  93   ? 243.629 278.968 165.281 1.00 71.95  ? 93   GLN R OE1   1 
ATOM   479   N  NE2   . GLN A  1  93   ? 241.584 279.685 165.860 1.00 70.21  ? 93   GLN R NE2   1 
ATOM   480   N  N     . GLU A  1  94   ? 241.455 275.994 161.077 1.00 23.72  ? 94   GLU R N     1 
ATOM   481   C  CA    . GLU A  1  94   ? 240.445 276.182 160.040 1.00 29.29  ? 94   GLU R CA    1 
ATOM   482   C  C     . GLU A  1  94   ? 239.600 274.928 159.867 1.00 38.83  ? 94   GLU R C     1 
ATOM   483   O  O     . GLU A  1  94   ? 238.364 274.978 159.942 1.00 38.86  ? 94   GLU R O     1 
ATOM   484   C  CB    . GLU A  1  94   ? 241.111 276.559 158.715 1.00 43.78  ? 94   GLU R CB    1 
ATOM   485   C  CG    . GLU A  1  94   ? 241.825 277.898 158.715 1.00 62.92  ? 94   GLU R CG    1 
ATOM   486   C  CD    . GLU A  1  94   ? 240.904 279.053 159.043 1.00 67.82  ? 94   GLU R CD    1 
ATOM   487   O  OE1   . GLU A  1  94   ? 239.735 279.030 158.603 1.00 68.10  ? 94   GLU R OE1   1 
ATOM   488   O  OE2   . GLU A  1  94   ? 241.355 279.991 159.731 1.00 64.27  ? 94   GLU R OE2   1 
ATOM   489   N  N     . ALA A  1  95   ? 240.254 273.787 159.636 1.00 22.37  ? 95   ALA R N     1 
ATOM   490   C  CA    . ALA A  1  95   ? 239.519 272.548 159.400 1.00 27.86  ? 95   ALA R CA    1 
ATOM   491   C  C     . ALA A  1  95   ? 238.690 272.151 160.614 1.00 33.24  ? 95   ALA R C     1 
ATOM   492   O  O     . ALA A  1  95   ? 237.542 271.713 160.475 1.00 40.96  ? 95   ALA R O     1 
ATOM   493   C  CB    . ALA A  1  95   ? 240.487 271.428 159.025 1.00 21.07  ? 95   ALA R CB    1 
ATOM   494   N  N     . SER A  1  96   ? 239.252 272.302 161.814 1.00 20.97  ? 96   SER R N     1 
ATOM   495   C  CA    . SER A  1  96   ? 238.529 271.919 163.022 1.00 20.48  ? 96   SER R CA    1 
ATOM   496   C  C     . SER A  1  96   ? 237.301 272.797 163.230 1.00 24.76  ? 96   SER R C     1 
ATOM   497   O  O     . SER A  1  96   ? 236.199 272.291 163.475 1.00 33.27  ? 96   SER R O     1 
ATOM   498   C  CB    . SER A  1  96   ? 239.454 271.993 164.235 1.00 36.36  ? 96   SER R CB    1 
ATOM   499   O  OG    . SER A  1  96   ? 240.498 271.044 164.125 1.00 46.27  ? 96   SER R OG    1 
ATOM   500   N  N     . GLU A  1  97   ? 237.469 274.117 163.133 1.00 25.79  ? 97   GLU R N     1 
ATOM   501   C  CA    . GLU A  1  97   ? 236.338 275.011 163.355 1.00 30.11  ? 97   GLU R CA    1 
ATOM   502   C  C     . GLU A  1  97   ? 235.258 274.811 162.301 1.00 21.54  ? 97   GLU R C     1 
ATOM   503   O  O     . GLU A  1  97   ? 234.067 274.764 162.630 1.00 21.80  ? 97   GLU R O     1 
ATOM   504   C  CB    . GLU A  1  97   ? 236.804 276.464 163.384 1.00 37.06  ? 97   GLU R CB    1 
ATOM   505   C  CG    . GLU A  1  97   ? 237.657 276.810 164.590 1.00 47.33  ? 97   GLU R CG    1 
ATOM   506   C  CD    . GLU A  1  97   ? 238.122 278.248 164.572 1.00 68.43  ? 97   GLU R CD    1 
ATOM   507   O  OE1   . GLU A  1  97   ? 237.909 278.923 163.547 1.00 70.36  ? 97   GLU R OE1   1 
ATOM   508   O  OE2   . GLU A  1  97   ? 238.702 278.701 165.581 1.00 72.42  ? 97   GLU R OE2   1 
ATOM   509   N  N     . ALA A  1  98   ? 235.647 274.680 161.030 1.00 16.80  ? 98   ALA R N     1 
ATOM   510   C  CA    . ALA A  1  98   ? 234.648 274.449 159.990 1.00 20.00  ? 98   ALA R CA    1 
ATOM   511   C  C     . ALA A  1  98   ? 233.918 273.130 160.211 1.00 34.01  ? 98   ALA R C     1 
ATOM   512   O  O     . ALA A  1  98   ? 232.691 273.051 160.053 1.00 27.99  ? 98   ALA R O     1 
ATOM   513   C  CB    . ALA A  1  98   ? 235.307 274.476 158.613 1.00 16.37  ? 98   ALA R CB    1 
ATOM   514   N  N     . TYR A  1  99   ? 234.657 272.083 160.590 1.00 26.08  ? 99   TYR R N     1 
ATOM   515   C  CA    . TYR A  1  99   ? 234.035 270.789 160.855 1.00 23.39  ? 99   TYR R CA    1 
ATOM   516   C  C     . TYR A  1  99   ? 233.030 270.879 161.997 1.00 21.09  ? 99   TYR R C     1 
ATOM   517   O  O     . TYR A  1  99   ? 231.929 270.324 161.909 1.00 25.82  ? 99   TYR R O     1 
ATOM   518   C  CB    . TYR A  1  99   ? 235.111 269.750 161.162 1.00 33.39  ? 99   TYR R CB    1 
ATOM   519   C  CG    . TYR A  1  99   ? 234.566 268.406 161.584 1.00 21.26  ? 99   TYR R CG    1 
ATOM   520   C  CD1   . TYR A  1  99   ? 234.017 267.536 160.653 1.00 14.64  ? 99   TYR R CD1   1 
ATOM   521   C  CD2   . TYR A  1  99   ? 234.617 268.001 162.910 1.00 29.53  ? 99   TYR R CD2   1 
ATOM   522   C  CE1   . TYR A  1  99   ? 233.522 266.305 161.033 1.00 24.87  ? 99   TYR R CE1   1 
ATOM   523   C  CE2   . TYR A  1  99   ? 234.128 266.772 163.300 1.00 25.95  ? 99   TYR R CE2   1 
ATOM   524   C  CZ    . TYR A  1  99   ? 233.581 265.928 162.356 1.00 26.40  ? 99   TYR R CZ    1 
ATOM   525   O  OH    . TYR A  1  99   ? 233.091 264.701 162.740 1.00 36.36  ? 99   TYR R OH    1 
ATOM   526   N  N     . LEU A  1  100  ? 233.386 271.581 163.077 1.00 18.66  ? 100  LEU R N     1 
ATOM   527   C  CA    . LEU A  1  100  ? 232.452 271.715 164.191 1.00 23.39  ? 100  LEU R CA    1 
ATOM   528   C  C     . LEU A  1  100  ? 231.252 272.575 163.822 1.00 26.62  ? 100  LEU R C     1 
ATOM   529   O  O     . LEU A  1  100  ? 230.144 272.329 164.312 1.00 20.65  ? 100  LEU R O     1 
ATOM   530   C  CB    . LEU A  1  100  ? 233.167 272.291 165.412 1.00 8.18   ? 100  LEU R CB    1 
ATOM   531   C  CG    . LEU A  1  100  ? 234.242 271.388 166.013 1.00 16.37  ? 100  LEU R CG    1 
ATOM   532   C  CD1   . LEU A  1  100  ? 234.958 272.087 167.155 1.00 22.26  ? 100  LEU R CD1   1 
ATOM   533   C  CD2   . LEU A  1  100  ? 233.635 270.079 166.481 1.00 13.22  ? 100  LEU R CD2   1 
ATOM   534   N  N     . VAL A  1  101  ? 231.441 273.578 162.962 1.00 21.73  ? 101  VAL R N     1 
ATOM   535   C  CA    . VAL A  1  101  ? 230.313 274.393 162.518 1.00 27.76  ? 101  VAL R CA    1 
ATOM   536   C  C     . VAL A  1  101  ? 229.329 273.545 161.721 1.00 25.88  ? 101  VAL R C     1 
ATOM   537   O  O     . VAL A  1  101  ? 228.115 273.592 161.954 1.00 25.13  ? 101  VAL R O     1 
ATOM   538   C  CB    . VAL A  1  101  ? 230.802 275.604 161.705 1.00 30.83  ? 101  VAL R CB    1 
ATOM   539   C  CG1   . VAL A  1  101  ? 229.625 276.313 161.069 1.00 31.66  ? 101  VAL R CG1   1 
ATOM   540   C  CG2   . VAL A  1  101  ? 231.552 276.567 162.603 1.00 13.99  ? 101  VAL R CG2   1 
ATOM   541   N  N     . ALA A  1  102  ? 229.838 272.754 160.772 1.00 27.64  ? 102  ALA R N     1 
ATOM   542   C  CA    . ALA A  1  102  ? 228.953 271.871 160.015 1.00 19.93  ? 102  ALA R CA    1 
ATOM   543   C  C     . ALA A  1  102  ? 228.271 270.860 160.929 1.00 26.36  ? 102  ALA R C     1 
ATOM   544   O  O     . ALA A  1  102  ? 227.071 270.584 160.782 1.00 28.43  ? 102  ALA R O     1 
ATOM   545   C  CB    . ALA A  1  102  ? 229.738 271.158 158.914 1.00 34.66  ? 102  ALA R CB    1 
ATOM   546   N  N     . LEU A  1  103  ? 229.018 270.309 161.889 1.00 18.41  ? 103  LEU R N     1 
ATOM   547   C  CA    . LEU A  1  103  ? 228.444 269.346 162.822 1.00 20.42  ? 103  LEU R CA    1 
ATOM   548   C  C     . LEU A  1  103  ? 227.307 269.964 163.627 1.00 26.11  ? 103  LEU R C     1 
ATOM   549   O  O     . LEU A  1  103  ? 226.295 269.306 163.890 1.00 18.70  ? 103  LEU R O     1 
ATOM   550   C  CB    . LEU A  1  103  ? 229.532 268.811 163.754 1.00 24.73  ? 103  LEU R CB    1 
ATOM   551   C  CG    . LEU A  1  103  ? 229.082 267.822 164.826 1.00 18.18  ? 103  LEU R CG    1 
ATOM   552   C  CD1   . LEU A  1  103  ? 228.528 266.566 164.184 1.00 23.87  ? 103  LEU R CD1   1 
ATOM   553   C  CD2   . LEU A  1  103  ? 230.232 267.488 165.761 1.00 13.94  ? 103  LEU R CD2   1 
ATOM   554   N  N     . PHE A  1  104  ? 227.455 271.230 164.026 1.00 17.62  ? 104  PHE R N     1 
ATOM   555   C  CA    . PHE A  1  104  ? 226.373 271.905 164.735 1.00 16.07  ? 104  PHE R CA    1 
ATOM   556   C  C     . PHE A  1  104  ? 225.228 272.295 163.811 1.00 20.26  ? 104  PHE R C     1 
ATOM   557   O  O     . PHE A  1  104  ? 224.094 272.435 164.282 1.00 16.72  ? 104  PHE R O     1 
ATOM   558   C  CB    . PHE A  1  104  ? 226.907 273.133 165.468 1.00 14.92  ? 104  PHE R CB    1 
ATOM   559   C  CG    . PHE A  1  104  ? 227.785 272.799 166.640 1.00 25.66  ? 104  PHE R CG    1 
ATOM   560   C  CD1   . PHE A  1  104  ? 227.695 271.565 167.257 1.00 27.40  ? 104  PHE R CD1   1 
ATOM   561   C  CD2   . PHE A  1  104  ? 228.704 273.714 167.118 1.00 22.10  ? 104  PHE R CD2   1 
ATOM   562   C  CE1   . PHE A  1  104  ? 228.501 271.253 168.334 1.00 20.99  ? 104  PHE R CE1   1 
ATOM   563   C  CE2   . PHE A  1  104  ? 229.512 273.407 168.194 1.00 23.21  ? 104  PHE R CE2   1 
ATOM   564   C  CZ    . PHE A  1  104  ? 229.409 272.174 168.803 1.00 16.92  ? 104  PHE R CZ    1 
ATOM   565   N  N     . GLU A  1  105  ? 225.489 272.474 162.517 1.00 24.96  ? 105  GLU R N     1 
ATOM   566   C  CA    . GLU A  1  105  ? 224.394 272.672 161.572 1.00 21.90  ? 105  GLU R CA    1 
ATOM   567   C  C     . GLU A  1  105  ? 223.531 271.421 161.477 1.00 31.69  ? 105  GLU R C     1 
ATOM   568   O  O     . GLU A  1  105  ? 222.304 271.483 161.637 1.00 36.44  ? 105  GLU R O     1 
ATOM   569   C  CB    . GLU A  1  105  ? 224.937 273.054 160.195 1.00 9.44   ? 105  GLU R CB    1 
ATOM   570   C  CG    . GLU A  1  105  ? 225.596 274.419 160.132 1.00 34.50  ? 105  GLU R CG    1 
ATOM   571   C  CD    . GLU A  1  105  ? 226.174 274.724 158.764 1.00 57.59  ? 105  GLU R CD    1 
ATOM   572   O  OE1   . GLU A  1  105  ? 226.229 273.801 157.922 1.00 61.64  ? 105  GLU R OE1   1 
ATOM   573   O  OE2   . GLU A  1  105  ? 226.568 275.884 158.527 1.00 59.84  ? 105  GLU R OE2   1 
ATOM   574   N  N     . ASP A  1  106  ? 224.157 270.268 161.223 1.00 22.08  ? 106  ASP R N     1 
ATOM   575   C  CA    . ASP A  1  106  ? 223.390 269.030 161.114 1.00 25.39  ? 106  ASP R CA    1 
ATOM   576   C  C     . ASP A  1  106  ? 222.738 268.666 162.444 1.00 26.54  ? 106  ASP R C     1 
ATOM   577   O  O     . ASP A  1  106  ? 221.596 268.193 162.477 1.00 34.10  ? 106  ASP R O     1 
ATOM   578   C  CB    . ASP A  1  106  ? 224.291 267.900 160.623 1.00 43.11  ? 106  ASP R CB    1 
ATOM   579   C  CG    . ASP A  1  106  ? 224.724 268.090 159.181 1.00 57.65  ? 106  ASP R CG    1 
ATOM   580   O  OD1   . ASP A  1  106  ? 224.106 268.918 158.479 1.00 69.99  ? 106  ASP R OD1   1 
ATOM   581   O  OD2   . ASP A  1  106  ? 225.682 267.415 158.750 1.00 49.18  ? 106  ASP R OD2   1 
ATOM   582   N  N     . THR A  1  107  ? 223.448 268.891 163.552 1.00 29.20  ? 107  THR R N     1 
ATOM   583   C  CA    . THR A  1  107  ? 222.856 268.666 164.868 1.00 33.20  ? 107  THR R CA    1 
ATOM   584   C  C     . THR A  1  107  ? 221.634 269.550 165.078 1.00 31.32  ? 107  THR R C     1 
ATOM   585   O  O     . THR A  1  107  ? 220.620 269.102 165.624 1.00 35.85  ? 107  THR R O     1 
ATOM   586   C  CB    . THR A  1  107  ? 223.895 268.914 165.960 1.00 27.85  ? 107  THR R CB    1 
ATOM   587   O  OG1   . THR A  1  107  ? 224.986 268.000 165.800 1.00 27.41  ? 107  THR R OG1   1 
ATOM   588   C  CG2   . THR A  1  107  ? 223.282 268.721 167.335 1.00 20.46  ? 107  THR R CG2   1 
ATOM   589   N  N     . ASN A  1  108  ? 221.711 270.810 164.640 1.00 20.50  ? 108  ASN R N     1 
ATOM   590   C  CA    . ASN A  1  108  ? 220.546 271.684 164.716 1.00 22.56  ? 108  ASN R CA    1 
ATOM   591   C  C     . ASN A  1  108  ? 219.401 271.146 163.870 1.00 32.72  ? 108  ASN R C     1 
ATOM   592   O  O     . ASN A  1  108  ? 218.234 271.233 164.266 1.00 35.72  ? 108  ASN R O     1 
ATOM   593   C  CB    . ASN A  1  108  ? 220.916 273.098 164.274 1.00 29.96  ? 108  ASN R CB    1 
ATOM   594   C  CG    . ASN A  1  108  ? 219.809 274.095 164.541 1.00 33.16  ? 108  ASN R CG    1 
ATOM   595   O  OD1   . ASN A  1  108  ? 219.039 273.945 165.489 1.00 15.54  ? 108  ASN R OD1   1 
ATOM   596   N  ND2   . ASN A  1  108  ? 219.723 275.121 163.703 1.00 43.02  ? 108  ASN R ND2   1 
ATOM   597   N  N     . LEU A  1  109  ? 219.715 270.581 162.700 1.00 18.87  ? 109  LEU R N     1 
ATOM   598   C  CA    . LEU A  1  109  ? 218.670 269.970 161.882 1.00 22.61  ? 109  LEU R CA    1 
ATOM   599   C  C     . LEU A  1  109  ? 218.009 268.807 162.610 1.00 26.82  ? 109  LEU R C     1 
ATOM   600   O  O     . LEU A  1  109  ? 216.790 268.621 162.521 1.00 34.03  ? 109  LEU R O     1 
ATOM   601   C  CB    . LEU A  1  109  ? 219.247 269.510 160.544 1.00 36.64  ? 109  LEU R CB    1 
ATOM   602   C  CG    . LEU A  1  109  ? 219.742 270.613 159.610 1.00 31.56  ? 109  LEU R CG    1 
ATOM   603   C  CD1   . LEU A  1  109  ? 220.405 270.016 158.379 1.00 23.79  ? 109  LEU R CD1   1 
ATOM   604   C  CD2   . LEU A  1  109  ? 218.596 271.526 159.213 1.00 13.95  ? 109  LEU R CD2   1 
ATOM   605   N  N     . CYS A  1  110  ? 218.798 268.012 163.341 1.00 20.15  ? 110  CYS R N     1 
ATOM   606   C  CA    . CYS A  1  110  ? 218.224 266.905 164.101 1.00 20.93  ? 110  CYS R CA    1 
ATOM   607   C  C     . CYS A  1  110  ? 217.328 267.415 165.223 1.00 23.29  ? 110  CYS R C     1 
ATOM   608   O  O     . CYS A  1  110  ? 216.192 266.950 165.384 1.00 28.44  ? 110  CYS R O     1 
ATOM   609   C  CB    . CYS A  1  110  ? 219.336 266.021 164.660 1.00 24.82  ? 110  CYS R CB    1 
ATOM   610   S  SG    . CYS A  1  110  ? 220.326 265.178 163.408 1.00 21.32  ? 110  CYS R SG    1 
ATOM   611   N  N     . ALA A  1  111  ? 217.825 268.371 166.011 1.00 13.88  ? 111  ALA R N     1 
ATOM   612   C  CA    . ALA A  1  111  ? 217.038 268.906 167.116 1.00 13.58  ? 111  ALA R CA    1 
ATOM   613   C  C     . ALA A  1  111  ? 215.731 269.513 166.623 1.00 28.38  ? 111  ALA R C     1 
ATOM   614   O  O     . ALA A  1  111  ? 214.672 269.294 167.220 1.00 41.29  ? 111  ALA R O     1 
ATOM   615   C  CB    . ALA A  1  111  ? 217.850 269.947 167.885 1.00 18.68  ? 111  ALA R CB    1 
ATOM   616   N  N     . ILE A  1  112  ? 215.787 270.273 165.527 1.00 27.24  ? 112  ILE R N     1 
ATOM   617   C  CA    . ILE A  1  112  ? 214.568 270.853 164.976 1.00 26.71  ? 112  ILE R CA    1 
ATOM   618   C  C     . ILE A  1  112  ? 213.648 269.764 164.437 1.00 31.73  ? 112  ILE R C     1 
ATOM   619   O  O     . ILE A  1  112  ? 212.419 269.882 164.520 1.00 34.26  ? 112  ILE R O     1 
ATOM   620   C  CB    . ILE A  1  112  ? 214.923 271.896 163.901 1.00 44.47  ? 112  ILE R CB    1 
ATOM   621   C  CG1   . ILE A  1  112  ? 215.635 273.083 164.551 1.00 42.08  ? 112  ILE R CG1   1 
ATOM   622   C  CG2   . ILE A  1  112  ? 213.683 272.362 163.160 1.00 30.36  ? 112  ILE R CG2   1 
ATOM   623   C  CD1   . ILE A  1  112  ? 216.241 274.043 163.567 1.00 41.17  ? 112  ILE R CD1   1 
ATOM   624   N  N     . HIS A  1  113  ? 214.214 268.682 163.896 1.00 25.42  ? 113  HIS R N     1 
ATOM   625   C  CA    . HIS A  1  113  ? 213.376 267.569 163.462 1.00 21.81  ? 113  HIS R CA    1 
ATOM   626   C  C     . HIS A  1  113  ? 212.671 266.909 164.638 1.00 24.48  ? 113  HIS R C     1 
ATOM   627   O  O     . HIS A  1  113  ? 211.594 266.326 164.470 1.00 32.92  ? 113  HIS R O     1 
ATOM   628   C  CB    . HIS A  1  113  ? 214.201 266.532 162.707 1.00 21.71  ? 113  HIS R CB    1 
ATOM   629   C  CG    . HIS A  1  113  ? 213.392 265.379 162.203 1.00 28.32  ? 113  HIS R CG    1 
ATOM   630   N  ND1   . HIS A  1  113  ? 212.398 265.528 161.261 1.00 33.01  ? 113  HIS R ND1   1 
ATOM   631   C  CD2   . HIS A  1  113  ? 213.408 264.067 162.530 1.00 32.82  ? 113  HIS R CD2   1 
ATOM   632   C  CE1   . HIS A  1  113  ? 211.848 264.353 161.015 1.00 33.61  ? 113  HIS R CE1   1 
ATOM   633   N  NE2   . HIS A  1  113  ? 212.444 263.449 161.771 1.00 34.98  ? 113  HIS R NE2   1 
ATOM   634   N  N     . ALA A  1  114  ? 213.253 266.991 165.831 1.00 31.14  ? 114  ALA R N     1 
ATOM   635   C  CA    . ALA A  1  114  ? 212.636 266.426 167.024 1.00 32.03  ? 114  ALA R CA    1 
ATOM   636   C  C     . ALA A  1  114  ? 211.612 267.361 167.653 1.00 43.14  ? 114  ALA R C     1 
ATOM   637   O  O     . ALA A  1  114  ? 211.086 267.037 168.724 1.00 48.91  ? 114  ALA R O     1 
ATOM   638   C  CB    . ALA A  1  114  ? 213.709 266.065 168.053 1.00 30.04  ? 114  ALA R CB    1 
ATOM   639   N  N     . LYS A  1  115  ? 211.338 268.506 167.026 1.00 44.36  ? 115  LYS R N     1 
ATOM   640   C  CA    . LYS A  1  115  ? 210.431 269.524 167.560 1.00 47.80  ? 115  LYS R CA    1 
ATOM   641   C  C     . LYS A  1  115  ? 210.961 270.092 168.874 1.00 55.20  ? 115  LYS R C     1 
ATOM   642   O  O     . LYS A  1  115  ? 210.219 270.284 169.838 1.00 56.10  ? 115  LYS R O     1 
ATOM   643   C  CB    . LYS A  1  115  ? 209.009 268.984 167.729 1.00 66.80  ? 115  LYS R CB    1 
ATOM   644   C  CG    . LYS A  1  115  ? 208.316 268.651 166.419 1.00 78.05  ? 115  LYS R CG    1 
ATOM   645   C  CD    . LYS A  1  115  ? 206.902 268.149 166.656 1.00 92.57  ? 115  LYS R CD    1 
ATOM   646   C  CE    . LYS A  1  115  ? 206.218 267.799 165.344 1.00 95.25  ? 115  LYS R CE    1 
ATOM   647   N  NZ    . LYS A  1  115  ? 206.073 268.987 164.460 1.00 90.50  ? 115  LYS R NZ    1 
ATOM   648   N  N     . ARG A  1  116  ? 212.264 270.361 168.909 1.00 33.37  ? 116  ARG R N     1 
ATOM   649   C  CA    . ARG A  1  116  ? 212.916 270.976 170.052 1.00 29.97  ? 116  ARG R CA    1 
ATOM   650   C  C     . ARG A  1  116  ? 213.923 271.999 169.548 1.00 34.82  ? 116  ARG R C     1 
ATOM   651   O  O     . ARG A  1  116  ? 214.573 271.785 168.523 1.00 42.12  ? 116  ARG R O     1 
ATOM   652   C  CB    . ARG A  1  116  ? 213.621 269.938 170.932 1.00 40.92  ? 116  ARG R CB    1 
ATOM   653   C  CG    . ARG A  1  116  ? 212.683 268.976 171.637 1.00 48.34  ? 116  ARG R CG    1 
ATOM   654   C  CD    . ARG A  1  116  ? 213.444 267.993 172.513 1.00 47.59  ? 116  ARG R CD    1 
ATOM   655   N  NE    . ARG A  1  116  ? 214.307 267.112 171.734 1.00 51.65  ? 116  ARG R NE    1 
ATOM   656   C  CZ    . ARG A  1  116  ? 215.623 267.262 171.622 1.00 47.59  ? 116  ARG R CZ    1 
ATOM   657   N  NH1   . ARG A  1  116  ? 216.231 268.263 172.243 1.00 47.44  ? 116  ARG R NH1   1 
ATOM   658   N  NH2   . ARG A  1  116  ? 216.330 266.412 170.892 1.00 36.59  ? 116  ARG R NH2   1 
ATOM   659   N  N     . VAL A  1  117  ? 214.044 273.116 170.272 1.00 37.84  ? 117  VAL R N     1 
ATOM   660   C  CA    . VAL A  1  117  ? 214.997 274.156 169.902 1.00 37.92  ? 117  VAL R CA    1 
ATOM   661   C  C     . VAL A  1  117  ? 216.329 274.006 170.620 1.00 40.73  ? 117  VAL R C     1 
ATOM   662   O  O     . VAL A  1  117  ? 217.224 274.841 170.425 1.00 41.10  ? 117  VAL R O     1 
ATOM   663   C  CB    . VAL A  1  117  ? 214.417 275.556 170.176 1.00 63.29  ? 117  VAL R CB    1 
ATOM   664   C  CG1   . VAL A  1  117  ? 213.187 275.795 169.318 1.00 57.55  ? 117  VAL R CG1   1 
ATOM   665   C  CG2   . VAL A  1  117  ? 214.081 275.710 171.649 1.00 56.47  ? 117  VAL R CG2   1 
ATOM   666   N  N     . THR A  1  118  ? 216.493 272.970 171.438 1.00 31.39  ? 118  THR R N     1 
ATOM   667   C  CA    . THR A  1  118  ? 217.704 272.760 172.220 1.00 35.91  ? 118  THR R CA    1 
ATOM   668   C  C     . THR A  1  118  ? 218.394 271.492 171.739 1.00 37.52  ? 118  THR R C     1 
ATOM   669   O  O     . THR A  1  118  ? 217.835 270.398 171.848 1.00 47.58  ? 118  THR R O     1 
ATOM   670   C  CB    . THR A  1  118  ? 217.381 272.657 173.710 1.00 55.77  ? 118  THR R CB    1 
ATOM   671   O  OG1   . THR A  1  118  ? 216.767 273.872 174.154 1.00 52.63  ? 118  THR R OG1   1 
ATOM   672   C  CG2   . THR A  1  118  ? 218.648 272.412 174.509 1.00 54.30  ? 118  THR R CG2   1 
ATOM   673   N  N     . ILE A  1  119  ? 219.611 271.639 171.214 1.00 29.24  ? 119  ILE R N     1 
ATOM   674   C  CA    . ILE A  1  119  ? 220.373 270.480 170.770 1.00 34.99  ? 119  ILE R CA    1 
ATOM   675   C  C     . ILE A  1  119  ? 220.814 269.665 171.980 1.00 42.97  ? 119  ILE R C     1 
ATOM   676   O  O     . ILE A  1  119  ? 221.090 270.204 173.058 1.00 38.36  ? 119  ILE R O     1 
ATOM   677   C  CB    . ILE A  1  119  ? 221.581 270.917 169.919 1.00 33.65  ? 119  ILE R CB    1 
ATOM   678   C  CG1   . ILE A  1  119  ? 222.521 271.805 170.732 1.00 36.07  ? 119  ILE R CG1   1 
ATOM   679   C  CG2   . ILE A  1  119  ? 221.114 271.651 168.674 1.00 25.64  ? 119  ILE R CG2   1 
ATOM   680   C  CD1   . ILE A  1  119  ? 223.815 272.129 170.024 1.00 24.55  ? 119  ILE R CD1   1 
ATOM   681   N  N     . MET A  1  120  ? 220.870 268.353 171.805 1.00 30.96  ? 120  MET R N     1 
ATOM   682   C  CA    . MET A  1  120  ? 221.222 267.415 172.858 1.00 23.88  ? 120  MET R CA    1 
ATOM   683   C  C     . MET A  1  120  ? 222.322 266.490 172.366 1.00 21.80  ? 120  MET R C     1 
ATOM   684   O  O     . MET A  1  120  ? 222.543 266.365 171.156 1.00 30.48  ? 120  MET R O     1 
ATOM   685   C  CB    . MET A  1  120  ? 219.997 266.598 173.296 1.00 53.46  ? 120  MET R CB    1 
ATOM   686   C  CG    . MET A  1  120  ? 218.937 267.415 174.015 1.00 56.44  ? 120  MET R CG    1 
ATOM   687   S  SD    . MET A  1  120  ? 217.501 266.431 174.478 1.00 81.58  ? 120  MET R SD    1 
ATOM   688   C  CE    . MET A  1  120  ? 218.200 265.424 175.785 1.00 58.32  ? 120  MET R CE    1 
ATOM   689   N  N     . PRO A  1  121  ? 223.051 265.838 173.282 1.00 28.42  ? 121  PRO R N     1 
ATOM   690   C  CA    . PRO A  1  121  ? 224.122 264.926 172.843 1.00 28.23  ? 121  PRO R CA    1 
ATOM   691   C  C     . PRO A  1  121  ? 223.643 263.835 171.905 1.00 33.80  ? 121  PRO R C     1 
ATOM   692   O  O     . PRO A  1  121  ? 224.367 263.464 170.971 1.00 31.71  ? 121  PRO R O     1 
ATOM   693   C  CB    . PRO A  1  121  ? 224.646 264.353 174.165 1.00 11.92  ? 121  PRO R CB    1 
ATOM   694   C  CG    . PRO A  1  121  ? 224.356 265.407 175.162 1.00 30.88  ? 121  PRO R CG    1 
ATOM   695   C  CD    . PRO A  1  121  ? 223.051 266.021 174.744 1.00 30.73  ? 121  PRO R CD    1 
ATOM   696   N  N     . LYS A  1  122  ? 222.441 263.305 172.128 1.00 22.62  ? 122  LYS R N     1 
ATOM   697   C  CA    . LYS A  1  122  ? 221.902 262.295 171.226 1.00 25.27  ? 122  LYS R CA    1 
ATOM   698   C  C     . LYS A  1  122  ? 221.693 262.839 169.820 1.00 24.68  ? 122  LYS R C     1 
ATOM   699   O  O     . LYS A  1  122  ? 221.720 262.064 168.856 1.00 29.31  ? 122  LYS R O     1 
ATOM   700   C  CB    . LYS A  1  122  ? 220.593 261.733 171.786 1.00 37.15  ? 122  LYS R CB    1 
ATOM   701   C  CG    . LYS A  1  122  ? 219.491 262.759 171.962 1.00 35.69  ? 122  LYS R CG    1 
ATOM   702   C  CD    . LYS A  1  122  ? 218.255 262.124 172.576 1.00 43.17  ? 122  LYS R CD    1 
ATOM   703   C  CE    . LYS A  1  122  ? 217.156 263.147 172.798 1.00 58.96  ? 122  LYS R CE    1 
ATOM   704   N  NZ    . LYS A  1  122  ? 215.948 262.536 173.416 1.00 68.14  ? 122  LYS R NZ    1 
ATOM   705   N  N     . ASP A  1  123  ? 221.504 264.151 169.676 1.00 41.99  ? 123  ASP R N     1 
ATOM   706   C  CA    . ASP A  1  123  ? 221.445 264.748 168.347 1.00 35.17  ? 123  ASP R CA    1 
ATOM   707   C  C     . ASP A  1  123  ? 222.816 264.728 167.683 1.00 41.27  ? 123  ASP R C     1 
ATOM   708   O  O     . ASP A  1  123  ? 222.942 264.382 166.503 1.00 38.35  ? 123  ASP R O     1 
ATOM   709   C  CB    . ASP A  1  123  ? 220.908 266.175 168.437 1.00 13.26  ? 123  ASP R CB    1 
ATOM   710   C  CG    . ASP A  1  123  ? 219.452 266.225 168.844 1.00 24.87  ? 123  ASP R CG    1 
ATOM   711   O  OD1   . ASP A  1  123  ? 218.770 265.188 168.739 1.00 37.43  ? 123  ASP R OD1   1 
ATOM   712   O  OD2   . ASP A  1  123  ? 218.992 267.300 169.280 1.00 18.95  ? 123  ASP R OD2   1 
ATOM   713   N  N     . ILE A  1  124  ? 223.855 265.112 168.432 1.00 38.50  ? 124  ILE R N     1 
ATOM   714   C  CA    . ILE A  1  124  ? 225.221 265.059 167.914 1.00 33.09  ? 124  ILE R CA    1 
ATOM   715   C  C     . ILE A  1  124  ? 225.566 263.644 167.473 1.00 34.43  ? 124  ILE R C     1 
ATOM   716   O  O     . ILE A  1  124  ? 225.830 263.386 166.292 1.00 37.70  ? 124  ILE R O     1 
ATOM   717   C  CB    . ILE A  1  124  ? 226.219 265.580 168.962 1.00 23.72  ? 124  ILE R CB    1 
ATOM   718   C  CG1   . ILE A  1  124  ? 226.004 267.071 169.218 1.00 25.95  ? 124  ILE R CG1   1 
ATOM   719   C  CG2   . ILE A  1  124  ? 227.646 265.323 168.512 1.00 10.59  ? 124  ILE R CG2   1 
ATOM   720   C  CD1   . ILE A  1  124  ? 226.815 267.605 170.372 1.00 30.63  ? 124  ILE R CD1   1 
ATOM   721   N  N     . GLN A  1  125  ? 225.580 262.703 168.424 1.00 45.52  ? 125  GLN R N     1 
ATOM   722   C  CA    . GLN A  1  125  ? 225.940 261.329 168.095 1.00 42.13  ? 125  GLN R CA    1 
ATOM   723   C  C     . GLN A  1  125  ? 224.991 260.711 167.074 1.00 40.39  ? 125  GLN R C     1 
ATOM   724   O  O     . GLN A  1  125  ? 225.383 259.771 166.375 1.00 38.95  ? 125  GLN R O     1 
ATOM   725   C  CB    . GLN A  1  125  ? 225.986 260.479 169.365 1.00 32.14  ? 125  GLN R CB    1 
ATOM   726   C  CG    . GLN A  1  125  ? 224.657 260.337 170.076 1.00 40.35  ? 125  GLN R CG    1 
ATOM   727   C  CD    . GLN A  1  125  ? 224.765 259.529 171.353 1.00 56.45  ? 125  GLN R CD    1 
ATOM   728   O  OE1   . GLN A  1  125  ? 225.851 259.369 171.910 1.00 58.87  ? 125  GLN R OE1   1 
ATOM   729   N  NE2   . GLN A  1  125  ? 223.636 259.016 171.828 1.00 56.46  ? 125  GLN R NE2   1 
ATOM   730   N  N     . LEU A  1  126  ? 223.764 261.221 166.962 1.00 33.65  ? 126  LEU R N     1 
ATOM   731   C  CA    . LEU A  1  126  ? 222.898 260.795 165.869 1.00 26.00  ? 126  LEU R CA    1 
ATOM   732   C  C     . LEU A  1  126  ? 223.444 261.261 164.527 1.00 27.90  ? 126  LEU R C     1 
ATOM   733   O  O     . LEU A  1  126  ? 223.524 260.479 163.573 1.00 30.09  ? 126  LEU R O     1 
ATOM   734   C  CB    . LEU A  1  126  ? 221.479 261.324 166.066 1.00 20.84  ? 126  LEU R CB    1 
ATOM   735   C  CG    . LEU A  1  126  ? 220.586 260.996 164.866 1.00 22.75  ? 126  LEU R CG    1 
ATOM   736   C  CD1   . LEU A  1  126  ? 220.394 259.493 164.731 1.00 35.48  ? 126  LEU R CD1   1 
ATOM   737   C  CD2   . LEU A  1  126  ? 219.255 261.716 164.939 1.00 24.38  ? 126  LEU R CD2   1 
ATOM   738   N  N     . ALA A  1  127  ? 223.814 262.540 164.430 1.00 37.51  ? 127  ALA R N     1 
ATOM   739   C  CA    . ALA A  1  127  ? 224.363 263.057 163.179 1.00 36.62  ? 127  ALA R CA    1 
ATOM   740   C  C     . ALA A  1  127  ? 225.647 262.333 162.802 1.00 40.55  ? 127  ALA R C     1 
ATOM   741   O  O     . ALA A  1  127  ? 225.846 261.968 161.637 1.00 40.18  ? 127  ALA R O     1 
ATOM   742   C  CB    . ALA A  1  127  ? 224.607 264.561 163.293 1.00 27.67  ? 127  ALA R CB    1 
ATOM   743   N  N     . ARG A  1  128  ? 226.529 262.102 163.777 1.00 39.46  ? 128  ARG R N     1 
ATOM   744   C  CA    . ARG A  1  128  ? 227.746 261.349 163.511 1.00 42.20  ? 128  ARG R CA    1 
ATOM   745   C  C     . ARG A  1  128  ? 227.464 259.882 163.217 1.00 45.37  ? 128  ARG R C     1 
ATOM   746   O  O     . ARG A  1  128  ? 228.303 259.213 162.605 1.00 39.58  ? 128  ARG R O     1 
ATOM   747   C  CB    . ARG A  1  128  ? 228.709 261.472 164.689 1.00 30.84  ? 128  ARG R CB    1 
ATOM   748   C  CG    . ARG A  1  128  ? 229.169 262.890 164.955 1.00 41.49  ? 128  ARG R CG    1 
ATOM   749   C  CD    . ARG A  1  128  ? 230.110 262.949 166.142 1.00 56.31  ? 128  ARG R CD    1 
ATOM   750   N  NE    . ARG A  1  128  ? 231.363 262.249 165.879 1.00 54.53  ? 128  ARG R NE    1 
ATOM   751   C  CZ    . ARG A  1  128  ? 231.718 261.110 166.464 1.00 49.33  ? 128  ARG R CZ    1 
ATOM   752   N  NH1   . ARG A  1  128  ? 230.915 260.538 167.351 1.00 42.38  ? 128  ARG R NH1   1 
ATOM   753   N  NH2   . ARG A  1  128  ? 232.878 260.543 166.165 1.00 47.74  ? 128  ARG R NH2   1 
ATOM   754   N  N     . ARG A  1  129  ? 226.311 259.368 163.641 1.00 42.54  ? 129  ARG R N     1 
ATOM   755   C  CA    . ARG A  1  129  ? 225.928 258.008 163.280 1.00 44.93  ? 129  ARG R CA    1 
ATOM   756   C  C     . ARG A  1  129  ? 225.392 257.926 161.858 1.00 46.02  ? 129  ARG R C     1 
ATOM   757   O  O     . ARG A  1  129  ? 225.628 256.931 161.167 1.00 62.15  ? 129  ARG R O     1 
ATOM   758   C  CB    . ARG A  1  129  ? 224.887 257.477 164.271 1.00 73.98  ? 129  ARG R CB    1 
ATOM   759   C  CG    . ARG A  1  129  ? 224.367 256.085 163.955 1.00 72.69  ? 129  ARG R CG    1 
ATOM   760   C  CD    . ARG A  1  129  ? 225.477 255.051 164.023 1.00 77.86  ? 129  ARG R CD    1 
ATOM   761   N  NE    . ARG A  1  129  ? 224.987 253.709 163.727 1.00 100.12 ? 129  ARG R NE    1 
ATOM   762   C  CZ    . ARG A  1  129  ? 224.879 253.205 162.502 1.00 97.16  ? 129  ARG R CZ    1 
ATOM   763   N  NH1   . ARG A  1  129  ? 225.227 253.933 161.451 1.00 79.07  ? 129  ARG R NH1   1 
ATOM   764   N  NH2   . ARG A  1  129  ? 224.421 251.972 162.328 1.00 100.40 ? 129  ARG R NH2   1 
ATOM   765   N  N     . ILE A  1  130  ? 224.681 258.959 161.405 1.00 46.67  ? 130  ILE R N     1 
ATOM   766   C  CA    . ILE A  1  130  ? 224.121 258.950 160.057 1.00 54.55  ? 130  ILE R CA    1 
ATOM   767   C  C     . ILE A  1  130  ? 225.194 259.272 159.022 1.00 52.29  ? 130  ILE R C     1 
ATOM   768   O  O     . ILE A  1  130  ? 225.204 258.696 157.929 1.00 54.54  ? 130  ILE R O     1 
ATOM   769   C  CB    . ILE A  1  130  ? 222.934 259.926 159.975 1.00 49.93  ? 130  ILE R CB    1 
ATOM   770   C  CG1   . ILE A  1  130  ? 221.791 259.440 160.867 1.00 44.55  ? 130  ILE R CG1   1 
ATOM   771   C  CG2   . ILE A  1  130  ? 222.454 260.075 158.543 1.00 44.64  ? 130  ILE R CG2   1 
ATOM   772   C  CD1   . ILE A  1  130  ? 220.677 260.441 161.026 1.00 46.31  ? 130  ILE R CD1   1 
ATOM   773   N  N     . ARG A  1  131  ? 226.114 260.185 159.347 1.00 48.69  ? 131  ARG R N     1 
ATOM   774   C  CA    . ARG A  1  131  ? 227.197 260.500 158.423 1.00 50.21  ? 131  ARG R CA    1 
ATOM   775   C  C     . ARG A  1  131  ? 228.107 259.308 158.162 1.00 59.97  ? 131  ARG R C     1 
ATOM   776   O  O     . ARG A  1  131  ? 228.831 259.302 157.161 1.00 68.95  ? 131  ARG R O     1 
ATOM   777   C  CB    . ARG A  1  131  ? 228.039 261.659 158.954 1.00 53.68  ? 131  ARG R CB    1 
ATOM   778   C  CG    . ARG A  1  131  ? 227.351 263.008 158.962 1.00 49.08  ? 131  ARG R CG    1 
ATOM   779   C  CD    . ARG A  1  131  ? 228.323 264.073 159.436 1.00 54.04  ? 131  ARG R CD    1 
ATOM   780   N  NE    . ARG A  1  131  ? 227.728 265.404 159.476 1.00 63.17  ? 131  ARG R NE    1 
ATOM   781   C  CZ    . ARG A  1  131  ? 228.351 266.479 159.945 1.00 72.95  ? 131  ARG R CZ    1 
ATOM   782   N  NH1   . ARG A  1  131  ? 229.587 266.377 160.411 1.00 78.11  ? 131  ARG R NH1   1 
ATOM   783   N  NH2   . ARG A  1  131  ? 227.740 267.656 159.947 1.00 66.83  ? 131  ARG R NH2   1 
ATOM   784   N  N     . GLY A  1  132  ? 228.093 258.305 159.033 1.00 61.42  ? 132  GLY R N     1 
ATOM   785   C  CA    . GLY A  1  132  ? 228.974 257.169 158.890 1.00 60.23  ? 132  GLY R CA    1 
ATOM   786   C  C     . GLY A  1  132  ? 230.322 257.325 159.550 1.00 65.36  ? 132  GLY R C     1 
ATOM   787   O  O     . GLY A  1  132  ? 231.254 256.591 159.205 1.00 67.17  ? 132  GLY R O     1 
ATOM   788   N  N     . GLU A  1  133  ? 230.458 258.256 160.489 1.00 59.02  ? 133  GLU R N     1 
ATOM   789   C  CA    . GLU A  1  133  ? 231.719 258.503 161.173 1.00 59.51  ? 133  GLU R CA    1 
ATOM   790   C  C     . GLU A  1  133  ? 231.923 257.601 162.383 1.00 73.99  ? 133  GLU R C     1 
ATOM   791   O  O     . GLU A  1  133  ? 232.958 257.706 163.047 1.00 84.07  ? 133  GLU R O     1 
ATOM   792   C  CB    . GLU A  1  133  ? 231.801 259.971 161.604 1.00 64.38  ? 133  GLU R CB    1 
ATOM   793   C  CG    . GLU A  1  133  ? 231.822 260.951 160.442 1.00 68.92  ? 133  GLU R CG    1 
ATOM   794   C  CD    . GLU A  1  133  ? 231.826 262.395 160.898 1.00 74.45  ? 133  GLU R CD    1 
ATOM   795   O  OE1   . GLU A  1  133  ? 231.648 262.639 162.110 1.00 76.35  ? 133  GLU R OE1   1 
ATOM   796   O  OE2   . GLU A  1  133  ? 232.002 263.289 160.042 1.00 70.68  ? 133  GLU R OE2   1 
ATOM   797   N  N     . ARG A  1  134  ? 230.969 256.725 162.683 1.00 107.56 ? 134  ARG R N     1 
ATOM   798   C  CA    . ARG A  1  134  ? 231.087 255.824 163.821 1.00 108.38 ? 134  ARG R CA    1 
ATOM   799   C  C     . ARG A  1  134  ? 230.380 254.501 163.545 1.00 120.38 ? 134  ARG R C     1 
ATOM   800   O  O     . ARG A  1  134  ? 229.686 253.965 164.408 1.00 122.41 ? 134  ARG R O     1 
ATOM   801   C  CB    . ARG A  1  134  ? 230.513 256.475 165.082 1.00 118.36 ? 134  ARG R CB    1 
ATOM   802   N  N     . LYS B  2  20   ? 258.026 266.532 179.317 1.00 142.98 ? 20   LYS S N     1 
ATOM   803   C  CA    . LYS B  2  20   ? 256.973 267.416 179.804 1.00 154.76 ? 20   LYS S CA    1 
ATOM   804   C  C     . LYS B  2  20   ? 255.599 266.910 179.379 1.00 161.61 ? 20   LYS S C     1 
ATOM   805   O  O     . LYS B  2  20   ? 255.155 267.152 178.257 1.00 152.80 ? 20   LYS S O     1 
ATOM   806   C  CB    . LYS B  2  20   ? 257.191 268.842 179.291 1.00 131.98 ? 20   LYS S CB    1 
ATOM   807   N  N     . VAL B  2  21   ? 254.927 266.204 180.289 1.00 171.06 ? 21   VAL S N     1 
ATOM   808   C  CA    . VAL B  2  21   ? 253.614 265.646 179.988 1.00 164.77 ? 21   VAL S CA    1 
ATOM   809   C  C     . VAL B  2  21   ? 252.572 266.756 180.017 1.00 169.60 ? 21   VAL S C     1 
ATOM   810   O  O     . VAL B  2  21   ? 252.473 267.513 180.991 1.00 179.61 ? 21   VAL S O     1 
ATOM   811   C  CB    . VAL B  2  21   ? 253.265 264.527 180.980 1.00 171.32 ? 21   VAL S CB    1 
ATOM   812   C  CG1   . VAL B  2  21   ? 251.852 264.019 180.735 1.00 155.91 ? 21   VAL S CG1   1 
ATOM   813   C  CG2   . VAL B  2  21   ? 254.272 263.392 180.875 1.00 161.94 ? 21   VAL S CG2   1 
ATOM   814   N  N     . LEU B  2  22   ? 251.795 266.860 178.944 1.00 167.44 ? 22   LEU S N     1 
ATOM   815   C  CA    . LEU B  2  22   ? 250.705 267.822 178.850 1.00 157.54 ? 22   LEU S CA    1 
ATOM   816   C  C     . LEU B  2  22   ? 249.383 267.109 179.100 1.00 147.73 ? 22   LEU S C     1 
ATOM   817   O  O     . LEU B  2  22   ? 249.110 266.069 178.491 1.00 142.33 ? 22   LEU S O     1 
ATOM   818   C  CB    . LEU B  2  22   ? 250.689 268.500 177.478 1.00 140.72 ? 22   LEU S CB    1 
ATOM   819   C  CG    . LEU B  2  22   ? 251.891 269.374 177.124 1.00 132.10 ? 22   LEU S CG    1 
ATOM   820   C  CD1   . LEU B  2  22   ? 251.778 269.884 175.695 1.00 127.33 ? 22   LEU S CD1   1 
ATOM   821   C  CD2   . LEU B  2  22   ? 252.020 270.531 178.101 1.00 132.51 ? 22   LEU S CD2   1 
ATOM   822   N  N     . ARG B  2  23   ? 248.573 267.660 180.003 1.00 132.11 ? 23   ARG S N     1 
ATOM   823   C  CA    . ARG B  2  23   ? 247.283 267.078 180.343 1.00 145.72 ? 23   ARG S CA    1 
ATOM   824   C  C     . ARG B  2  23   ? 246.270 268.187 180.582 1.00 143.05 ? 23   ARG S C     1 
ATOM   825   O  O     . ARG B  2  23   ? 246.626 269.326 180.900 1.00 135.44 ? 23   ARG S O     1 
ATOM   826   C  CB    . ARG B  2  23   ? 247.374 266.171 181.581 1.00 147.53 ? 23   ARG S CB    1 
ATOM   827   C  CG    . ARG B  2  23   ? 248.225 264.926 181.388 1.00 163.09 ? 23   ARG S CG    1 
ATOM   828   C  CD    . ARG B  2  23   ? 248.329 264.117 182.667 1.00 171.99 ? 23   ARG S CD    1 
ATOM   829   N  NE    . ARG B  2  23   ? 247.031 263.603 183.095 1.00 178.42 ? 23   ARG S NE    1 
ATOM   830   C  CZ    . ARG B  2  23   ? 246.827 262.939 184.226 1.00 183.72 ? 23   ARG S CZ    1 
ATOM   831   N  NH1   . ARG B  2  23   ? 247.837 262.703 185.051 1.00 184.20 ? 23   ARG S NH1   1 
ATOM   832   N  NH2   . ARG B  2  23   ? 245.611 262.507 184.534 1.00 184.18 ? 23   ARG S NH2   1 
ATOM   833   N  N     . ASP B  2  24   ? 244.994 267.835 180.421 1.00 120.34 ? 24   ASP S N     1 
ATOM   834   C  CA    . ASP B  2  24   ? 243.860 268.733 180.642 1.00 127.71 ? 24   ASP S CA    1 
ATOM   835   C  C     . ASP B  2  24   ? 243.909 269.971 179.752 1.00 118.12 ? 24   ASP S C     1 
ATOM   836   O  O     . ASP B  2  24   ? 243.329 271.006 180.093 1.00 123.79 ? 24   ASP S O     1 
ATOM   837   C  CB    . ASP B  2  24   ? 243.759 269.150 182.115 1.00 134.57 ? 24   ASP S CB    1 
ATOM   838   C  CG    . ASP B  2  24   ? 243.318 268.011 183.013 1.00 141.27 ? 24   ASP S CG    1 
ATOM   839   O  OD1   . ASP B  2  24   ? 242.791 267.008 182.487 1.00 149.82 ? 24   ASP S OD1   1 
ATOM   840   O  OD2   . ASP B  2  24   ? 243.497 268.119 184.245 1.00 139.23 ? 24   ASP S OD2   1 
ATOM   841   N  N     . ASN B  2  25   ? 244.592 269.886 178.609 1.00 101.42 ? 25   ASN S N     1 
ATOM   842   C  CA    . ASN B  2  25   ? 244.616 271.002 177.672 1.00 100.54 ? 25   ASN S CA    1 
ATOM   843   C  C     . ASN B  2  25   ? 243.359 271.069 176.819 1.00 100.00 ? 25   ASN S C     1 
ATOM   844   O  O     . ASN B  2  25   ? 243.023 272.149 176.322 1.00 100.04 ? 25   ASN S O     1 
ATOM   845   C  CB    . ASN B  2  25   ? 245.849 270.910 176.774 1.00 113.24 ? 25   ASN S CB    1 
ATOM   846   C  CG    . ASN B  2  25   ? 247.136 271.167 177.528 1.00 113.61 ? 25   ASN S CG    1 
ATOM   847   O  OD1   . ASN B  2  25   ? 247.482 272.311 177.821 1.00 114.10 ? 25   ASN S OD1   1 
ATOM   848   N  ND2   . ASN B  2  25   ? 247.849 270.097 177.859 1.00 113.99 ? 25   ASN S ND2   1 
ATOM   849   N  N     . ILE B  2  26   ? 242.663 269.945 176.635 1.00 85.67  ? 26   ILE S N     1 
ATOM   850   C  CA    . ILE B  2  26   ? 241.391 269.983 175.923 1.00 85.48  ? 26   ILE S CA    1 
ATOM   851   C  C     . ILE B  2  26   ? 240.369 270.785 176.717 1.00 94.94  ? 26   ILE S C     1 
ATOM   852   O  O     . ILE B  2  26   ? 239.451 271.383 176.140 1.00 105.28 ? 26   ILE S O     1 
ATOM   853   C  CB    . ILE B  2  26   ? 240.899 268.553 175.625 1.00 85.88  ? 26   ILE S CB    1 
ATOM   854   C  CG1   . ILE B  2  26   ? 239.650 268.586 174.743 1.00 83.71  ? 26   ILE S CG1   1 
ATOM   855   C  CG2   . ILE B  2  26   ? 240.636 267.792 176.914 1.00 72.90  ? 26   ILE S CG2   1 
ATOM   856   C  CD1   . ILE B  2  26   ? 239.276 267.239 174.180 1.00 104.49 ? 26   ILE S CD1   1 
ATOM   857   N  N     . GLN B  2  27   ? 240.510 270.827 178.043 1.00 86.63  ? 27   GLN S N     1 
ATOM   858   C  CA    . GLN B  2  27   ? 239.714 271.743 178.847 1.00 95.36  ? 27   GLN S CA    1 
ATOM   859   C  C     . GLN B  2  27   ? 240.039 273.195 178.526 1.00 95.55  ? 27   GLN S C     1 
ATOM   860   O  O     . GLN B  2  27   ? 239.245 274.083 178.854 1.00 81.16  ? 27   GLN S O     1 
ATOM   861   C  CB    . GLN B  2  27   ? 239.934 271.473 180.336 1.00 82.19  ? 27   GLN S CB    1 
ATOM   862   C  CG    . GLN B  2  27   ? 239.447 270.111 180.802 1.00 97.65  ? 27   GLN S CG    1 
ATOM   863   C  CD    . GLN B  2  27   ? 237.945 269.960 180.681 1.00 111.91 ? 27   GLN S CD    1 
ATOM   864   O  OE1   . GLN B  2  27   ? 237.444 269.343 179.741 1.00 115.52 ? 27   GLN S OE1   1 
ATOM   865   N  NE2   . GLN B  2  27   ? 237.215 270.528 181.634 1.00 113.69 ? 27   GLN S NE2   1 
ATOM   866   N  N     . GLY B  2  28   ? 241.191 273.453 177.902 1.00 95.76  ? 28   GLY S N     1 
ATOM   867   C  CA    . GLY B  2  28   ? 241.492 274.794 177.439 1.00 91.19  ? 28   GLY S CA    1 
ATOM   868   C  C     . GLY B  2  28   ? 240.463 275.319 176.461 1.00 85.54  ? 28   GLY S C     1 
ATOM   869   O  O     . GLY B  2  28   ? 240.229 276.529 176.390 1.00 85.19  ? 28   GLY S O     1 
ATOM   870   N  N     . ILE B  2  29   ? 239.841 274.426 175.688 1.00 79.74  ? 29   ILE S N     1 
ATOM   871   C  CA    . ILE B  2  29   ? 238.675 274.816 174.908 1.00 78.88  ? 29   ILE S CA    1 
ATOM   872   C  C     . ILE B  2  29   ? 237.595 275.272 175.876 1.00 88.60  ? 29   ILE S C     1 
ATOM   873   O  O     . ILE B  2  29   ? 237.212 274.535 176.792 1.00 94.57  ? 29   ILE S O     1 
ATOM   874   C  CB    . ILE B  2  29   ? 238.197 273.657 174.028 1.00 75.47  ? 29   ILE S CB    1 
ATOM   875   C  CG1   . ILE B  2  29   ? 239.323 273.188 173.108 1.00 64.20  ? 29   ILE S CG1   1 
ATOM   876   C  CG2   . ILE B  2  29   ? 236.982 274.074 173.215 1.00 87.77  ? 29   ILE S CG2   1 
ATOM   877   C  CD1   . ILE B  2  29   ? 239.845 274.266 172.185 1.00 63.41  ? 29   ILE S CD1   1 
ATOM   878   N  N     . THR B  2  30   ? 237.103 276.486 175.682 1.00 77.90  ? 30   THR S N     1 
ATOM   879   C  CA    . THR B  2  30   ? 236.233 277.127 176.651 1.00 78.98  ? 30   THR S CA    1 
ATOM   880   C  C     . THR B  2  30   ? 234.769 276.952 176.270 1.00 77.83  ? 30   THR S C     1 
ATOM   881   O  O     . THR B  2  30   ? 234.415 276.909 175.090 1.00 73.21  ? 30   THR S O     1 
ATOM   882   C  CB    . THR B  2  30   ? 236.562 278.615 176.777 1.00 93.73  ? 30   THR S CB    1 
ATOM   883   O  OG1   . THR B  2  30   ? 236.413 279.252 175.501 1.00 100.52 ? 30   THR S OG1   1 
ATOM   884   C  CG2   . THR B  2  30   ? 237.987 278.804 177.267 1.00 82.04  ? 30   THR S CG2   1 
ATOM   885   N  N     . LYS B  2  31   ? 233.929 276.813 177.292 1.00 73.12  ? 31   LYS S N     1 
ATOM   886   C  CA    . LYS B  2  31   ? 232.479 276.834 177.105 1.00 72.18  ? 31   LYS S CA    1 
ATOM   887   C  C     . LYS B  2  31   ? 232.007 277.982 176.218 1.00 73.40  ? 31   LYS S C     1 
ATOM   888   O  O     . LYS B  2  31   ? 231.196 277.732 175.310 1.00 65.01  ? 31   LYS S O     1 
ATOM   889   C  CB    . LYS B  2  31   ? 231.819 276.865 178.491 1.00 66.70  ? 31   LYS S CB    1 
ATOM   890   C  CG    . LYS B  2  31   ? 230.305 276.883 178.500 1.00 75.32  ? 31   LYS S CG    1 
ATOM   891   C  CD    . LYS B  2  31   ? 229.795 276.898 179.935 1.00 90.20  ? 31   LYS S CD    1 
ATOM   892   C  CE    . LYS B  2  31   ? 228.279 276.962 180.007 1.00 97.22  ? 31   LYS S CE    1 
ATOM   893   N  NZ    . LYS B  2  31   ? 227.800 276.979 181.418 1.00 95.07  ? 31   LYS S NZ    1 
ATOM   894   N  N     . PRO B  2  32   ? 232.463 279.229 176.398 1.00 65.60  ? 32   PRO S N     1 
ATOM   895   C  CA    . PRO B  2  32   ? 232.058 280.279 175.451 1.00 67.64  ? 32   PRO S CA    1 
ATOM   896   C  C     . PRO B  2  32   ? 232.531 280.032 174.030 1.00 75.20  ? 32   PRO S C     1 
ATOM   897   O  O     . PRO B  2  32   ? 231.850 280.454 173.090 1.00 83.54  ? 32   PRO S O     1 
ATOM   898   C  CB    . PRO B  2  32   ? 232.691 281.545 176.042 1.00 79.92  ? 32   PRO S CB    1 
ATOM   899   C  CG    . PRO B  2  32   ? 232.829 281.249 177.484 1.00 88.23  ? 32   PRO S CG    1 
ATOM   900   C  CD    . PRO B  2  32   ? 233.202 279.800 177.535 1.00 81.43  ? 32   PRO S CD    1 
ATOM   901   N  N     . ALA B  2  33   ? 233.689 279.394 173.842 1.00 63.50  ? 33   ALA S N     1 
ATOM   902   C  CA    . ALA B  2  33   ? 234.154 279.070 172.497 1.00 49.65  ? 33   ALA S CA    1 
ATOM   903   C  C     . ALA B  2  33   ? 233.152 278.182 171.768 1.00 56.38  ? 33   ALA S C     1 
ATOM   904   O  O     . ALA B  2  33   ? 232.584 278.573 170.740 1.00 61.14  ? 33   ALA S O     1 
ATOM   905   C  CB    . ALA B  2  33   ? 235.527 278.401 172.559 1.00 54.47  ? 33   ALA S CB    1 
ATOM   906   N  N     . ILE B  2  34   ? 232.942 276.966 172.282 1.00 56.60  ? 34   ILE S N     1 
ATOM   907   C  CA    . ILE B  2  34   ? 231.978 276.041 171.685 1.00 46.21  ? 34   ILE S CA    1 
ATOM   908   C  C     . ILE B  2  34   ? 230.619 276.711 171.545 1.00 52.12  ? 34   ILE S C     1 
ATOM   909   O  O     . ILE B  2  34   ? 229.911 276.519 170.546 1.00 57.88  ? 34   ILE S O     1 
ATOM   910   C  CB    . ILE B  2  34   ? 231.889 274.755 172.528 1.00 48.69  ? 34   ILE S CB    1 
ATOM   911   C  CG1   . ILE B  2  34   ? 233.229 274.021 172.521 1.00 43.90  ? 34   ILE S CG1   1 
ATOM   912   C  CG2   . ILE B  2  34   ? 230.790 273.846 172.006 1.00 47.99  ? 34   ILE S CG2   1 
ATOM   913   C  CD1   . ILE B  2  34   ? 233.303 272.881 173.508 1.00 48.60  ? 34   ILE S CD1   1 
ATOM   914   N  N     . ARG B  2  35   ? 230.238 277.518 172.539 1.00 53.20  ? 35   ARG S N     1 
ATOM   915   C  CA    . ARG B  2  35   ? 228.997 278.277 172.440 1.00 58.57  ? 35   ARG S CA    1 
ATOM   916   C  C     . ARG B  2  35   ? 228.987 279.160 171.196 1.00 51.36  ? 35   ARG S C     1 
ATOM   917   O  O     . ARG B  2  35   ? 227.984 279.218 170.478 1.00 61.48  ? 35   ARG S O     1 
ATOM   918   C  CB    . ARG B  2  35   ? 228.802 279.114 173.703 1.00 66.62  ? 35   ARG S CB    1 
ATOM   919   C  CG    . ARG B  2  35   ? 227.512 279.913 173.738 1.00 95.11  ? 35   ARG S CG    1 
ATOM   920   C  CD    . ARG B  2  35   ? 227.368 280.641 175.062 1.00 110.81 ? 35   ARG S CD    1 
ATOM   921   N  NE    . ARG B  2  35   ? 226.126 281.404 175.143 1.00 115.51 ? 35   ARG S NE    1 
ATOM   922   C  CZ    . ARG B  2  35   ? 225.685 281.995 176.248 1.00 116.92 ? 35   ARG S CZ    1 
ATOM   923   N  NH1   . ARG B  2  35   ? 226.385 281.909 177.371 1.00 118.13 ? 35   ARG S NH1   1 
ATOM   924   N  NH2   . ARG B  2  35   ? 224.545 282.670 176.232 1.00 116.56 ? 35   ARG S NH2   1 
ATOM   925   N  N     . ARG B  2  36   ? 230.104 279.835 170.916 1.00 49.36  ? 36   ARG S N     1 
ATOM   926   C  CA    . ARG B  2  36   ? 230.189 280.686 169.732 1.00 48.22  ? 36   ARG S CA    1 
ATOM   927   C  C     . ARG B  2  36   ? 230.127 279.862 168.454 1.00 60.49  ? 36   ARG S C     1 
ATOM   928   O  O     . ARG B  2  36   ? 229.474 280.263 167.482 1.00 72.67  ? 36   ARG S O     1 
ATOM   929   C  CB    . ARG B  2  36   ? 231.472 281.516 169.765 1.00 50.14  ? 36   ARG S CB    1 
ATOM   930   C  CG    . ARG B  2  36   ? 231.507 282.588 170.840 1.00 55.10  ? 36   ARG S CG    1 
ATOM   931   C  CD    . ARG B  2  36   ? 232.681 283.530 170.633 1.00 51.08  ? 36   ARG S CD    1 
ATOM   932   N  NE    . ARG B  2  36   ? 233.965 282.843 170.734 1.00 56.30  ? 36   ARG S NE    1 
ATOM   933   C  CZ    . ARG B  2  36   ? 234.629 282.663 171.870 1.00 57.57  ? 36   ARG S CZ    1 
ATOM   934   N  NH1   . ARG B  2  36   ? 234.134 283.125 173.008 1.00 59.65  ? 36   ARG S NH1   1 
ATOM   935   N  NH2   . ARG B  2  36   ? 235.791 282.025 171.868 1.00 46.04  ? 36   ARG S NH2   1 
ATOM   936   N  N     . LEU B  2  37   ? 230.807 278.712 168.431 1.00 51.85  ? 37   LEU S N     1 
ATOM   937   C  CA    . LEU B  2  37   ? 230.727 277.831 167.271 1.00 49.09  ? 37   LEU S CA    1 
ATOM   938   C  C     . LEU B  2  37   ? 229.286 277.428 166.988 1.00 57.75  ? 37   LEU S C     1 
ATOM   939   O  O     . LEU B  2  37   ? 228.859 277.388 165.829 1.00 56.62  ? 37   LEU S O     1 
ATOM   940   C  CB    . LEU B  2  37   ? 231.596 276.593 167.484 1.00 37.82  ? 37   LEU S CB    1 
ATOM   941   C  CG    . LEU B  2  37   ? 233.107 276.810 167.552 1.00 44.94  ? 37   LEU S CG    1 
ATOM   942   C  CD1   . LEU B  2  37   ? 233.812 275.520 167.925 1.00 41.41  ? 37   LEU S CD1   1 
ATOM   943   C  CD2   . LEU B  2  37   ? 233.619 277.335 166.224 1.00 42.66  ? 37   LEU S CD2   1 
ATOM   944   N  N     . ALA B  2  38   ? 228.517 277.135 168.039 1.00 52.08  ? 38   ALA S N     1 
ATOM   945   C  CA    . ALA B  2  38   ? 227.118 276.782 167.831 1.00 49.49  ? 38   ALA S CA    1 
ATOM   946   C  C     . ALA B  2  38   ? 226.298 277.991 167.402 1.00 48.51  ? 38   ALA S C     1 
ATOM   947   O  O     . ALA B  2  38   ? 225.364 277.859 166.602 1.00 35.03  ? 38   ALA S O     1 
ATOM   948   C  CB    . ALA B  2  38   ? 226.541 276.161 169.101 1.00 40.02  ? 38   ALA S CB    1 
ATOM   949   N  N     . ARG B  2  39   ? 226.626 279.178 167.921 1.00 38.88  ? 39   ARG S N     1 
ATOM   950   C  CA    . ARG B  2  39   ? 225.933 280.387 167.485 1.00 41.97  ? 39   ARG S CA    1 
ATOM   951   C  C     . ARG B  2  39   ? 226.147 280.638 166.000 1.00 50.43  ? 39   ARG S C     1 
ATOM   952   O  O     . ARG B  2  39   ? 225.242 281.113 165.305 1.00 53.81  ? 39   ARG S O     1 
ATOM   953   C  CB    . ARG B  2  39   ? 226.395 281.594 168.302 1.00 41.41  ? 39   ARG S CB    1 
ATOM   954   C  CG    . ARG B  2  39   ? 226.076 281.513 169.782 1.00 43.70  ? 39   ARG S CG    1 
ATOM   955   C  CD    . ARG B  2  39   ? 224.592 281.690 170.045 1.00 51.50  ? 39   ARG S CD    1 
ATOM   956   N  NE    . ARG B  2  39   ? 224.287 281.643 171.471 1.00 60.26  ? 39   ARG S NE    1 
ATOM   957   C  CZ    . ARG B  2  39   ? 223.938 280.540 172.124 1.00 65.03  ? 39   ARG S CZ    1 
ATOM   958   N  NH1   . ARG B  2  39   ? 223.842 279.389 171.474 1.00 66.44  ? 39   ARG S NH1   1 
ATOM   959   N  NH2   . ARG B  2  39   ? 223.682 280.588 173.422 1.00 58.33  ? 39   ARG S NH2   1 
ATOM   960   N  N     . ARG B  2  40   ? 227.341 280.325 165.492 1.00 53.36  ? 40   ARG S N     1 
ATOM   961   C  CA    . ARG B  2  40   ? 227.575 280.452 164.060 1.00 43.16  ? 40   ARG S CA    1 
ATOM   962   C  C     . ARG B  2  40   ? 226.886 279.333 163.289 1.00 50.63  ? 40   ARG S C     1 
ATOM   963   O  O     . ARG B  2  40   ? 226.374 279.554 162.187 1.00 71.98  ? 40   ARG S O     1 
ATOM   964   C  CB    . ARG B  2  40   ? 229.073 280.460 163.764 1.00 49.76  ? 40   ARG S CB    1 
ATOM   965   C  CG    . ARG B  2  40   ? 229.403 280.556 162.285 1.00 50.82  ? 40   ARG S CG    1 
ATOM   966   C  CD    . ARG B  2  40   ? 230.898 280.537 162.035 1.00 51.89  ? 40   ARG S CD    1 
ATOM   967   N  NE    . ARG B  2  40   ? 231.550 281.738 162.549 1.00 49.82  ? 40   ARG S NE    1 
ATOM   968   C  CZ    . ARG B  2  40   ? 232.860 281.948 162.511 1.00 56.51  ? 40   ARG S CZ    1 
ATOM   969   N  NH1   . ARG B  2  40   ? 233.662 281.034 161.987 1.00 66.62  ? 40   ARG S NH1   1 
ATOM   970   N  NH2   . ARG B  2  40   ? 233.368 283.070 163.002 1.00 51.99  ? 40   ARG S NH2   1 
ATOM   971   N  N     . GLY B  2  41   ? 226.855 278.127 163.856 1.00 30.45  ? 41   GLY S N     1 
ATOM   972   C  CA    . GLY B  2  41   ? 226.228 277.003 163.187 1.00 28.50  ? 41   GLY S CA    1 
ATOM   973   C  C     . GLY B  2  41   ? 224.724 277.105 163.048 1.00 34.11  ? 41   GLY S C     1 
ATOM   974   O  O     . GLY B  2  41   ? 224.123 276.252 162.384 1.00 47.44  ? 41   GLY S O     1 
ATOM   975   N  N     . GLY B  2  42   ? 224.103 278.117 163.650 1.00 33.05  ? 42   GLY S N     1 
ATOM   976   C  CA    . GLY B  2  42   ? 222.667 278.280 163.603 1.00 33.93  ? 42   GLY S CA    1 
ATOM   977   C  C     . GLY B  2  42   ? 221.931 277.794 164.831 1.00 42.60  ? 42   GLY S C     1 
ATOM   978   O  O     . GLY B  2  42   ? 220.697 277.873 164.862 1.00 44.07  ? 42   GLY S O     1 
ATOM   979   N  N     . VAL B  2  43   ? 222.643 277.293 165.838 1.00 28.07  ? 43   VAL S N     1 
ATOM   980   C  CA    . VAL B  2  43   ? 221.995 276.790 167.042 1.00 29.08  ? 43   VAL S CA    1 
ATOM   981   C  C     . VAL B  2  43   ? 221.483 277.960 167.870 1.00 38.51  ? 43   VAL S C     1 
ATOM   982   O  O     . VAL B  2  43   ? 222.213 278.924 168.132 1.00 39.44  ? 43   VAL S O     1 
ATOM   983   C  CB    . VAL B  2  43   ? 222.968 275.921 167.851 1.00 36.21  ? 43   VAL S CB    1 
ATOM   984   C  CG1   . VAL B  2  43   ? 222.328 275.483 169.157 1.00 35.00  ? 43   VAL S CG1   1 
ATOM   985   C  CG2   . VAL B  2  43   ? 223.402 274.718 167.034 1.00 40.07  ? 43   VAL S CG2   1 
ATOM   986   N  N     . LYS B  2  44   ? 220.219 277.881 168.284 1.00 54.05  ? 44   LYS S N     1 
ATOM   987   C  CA    . LYS B  2  44   ? 219.636 278.927 169.119 1.00 45.44  ? 44   LYS S CA    1 
ATOM   988   C  C     . LYS B  2  44   ? 219.953 278.695 170.591 1.00 44.97  ? 44   LYS S C     1 
ATOM   989   O  O     . LYS B  2  44   ? 220.633 279.507 171.227 1.00 55.54  ? 44   LYS S O     1 
ATOM   990   C  CB    . LYS B  2  44   ? 218.122 278.996 168.896 1.00 69.78  ? 44   LYS S CB    1 
ATOM   991   C  CG    . LYS B  2  44   ? 217.435 280.107 169.669 1.00 67.78  ? 44   LYS S CG    1 
ATOM   992   C  CD    . LYS B  2  44   ? 215.948 280.155 169.360 1.00 74.74  ? 44   LYS S CD    1 
ATOM   993   C  CE    . LYS B  2  44   ? 215.254 281.258 170.142 1.00 82.19  ? 44   LYS S CE    1 
ATOM   994   N  NZ    . LYS B  2  44   ? 213.796 281.319 169.844 1.00 82.82  ? 44   LYS S NZ    1 
ATOM   995   N  N     . ARG B  2  45   ? 219.465 277.592 171.150 1.00 40.52  ? 45   ARG S N     1 
ATOM   996   C  CA    . ARG B  2  45   ? 219.657 277.262 172.554 1.00 43.07  ? 45   ARG S CA    1 
ATOM   997   C  C     . ARG B  2  45   ? 220.467 275.978 172.676 1.00 44.66  ? 45   ARG S C     1 
ATOM   998   O  O     . ARG B  2  45   ? 220.258 275.030 171.913 1.00 46.39  ? 45   ARG S O     1 
ATOM   999   C  CB    . ARG B  2  45   ? 218.309 277.120 173.264 1.00 52.18  ? 45   ARG S CB    1 
ATOM   1000  C  CG    . ARG B  2  45   ? 218.401 276.804 174.742 1.00 59.95  ? 45   ARG S CG    1 
ATOM   1001  C  CD    . ARG B  2  45   ? 217.026 276.814 175.383 1.00 62.28  ? 45   ARG S CD    1 
ATOM   1002  N  NE    . ARG B  2  45   ? 217.088 276.502 176.806 1.00 70.67  ? 45   ARG S NE    1 
ATOM   1003  C  CZ    . ARG B  2  45   ? 216.063 276.632 177.643 1.00 77.63  ? 45   ARG S CZ    1 
ATOM   1004  N  NH1   . ARG B  2  45   ? 214.897 277.076 177.198 1.00 72.53  ? 45   ARG S NH1   1 
ATOM   1005  N  NH2   . ARG B  2  45   ? 216.207 276.323 178.923 1.00 79.99  ? 45   ARG S NH2   1 
ATOM   1006  N  N     . ILE B  2  46   ? 221.387 275.951 173.636 1.00 41.65  ? 46   ILE S N     1 
ATOM   1007  C  CA    . ILE B  2  46   ? 222.328 274.851 173.809 1.00 36.53  ? 46   ILE S CA    1 
ATOM   1008  C  C     . ILE B  2  46   ? 222.051 274.168 175.139 1.00 38.73  ? 46   ILE S C     1 
ATOM   1009  O  O     . ILE B  2  46   ? 221.833 274.837 176.155 1.00 47.59  ? 46   ILE S O     1 
ATOM   1010  C  CB    . ILE B  2  46   ? 223.788 275.349 173.760 1.00 46.50  ? 46   ILE S CB    1 
ATOM   1011  C  CG1   . ILE B  2  46   ? 224.104 275.993 172.415 1.00 48.83  ? 46   ILE S CG1   1 
ATOM   1012  C  CG2   . ILE B  2  46   ? 224.756 274.207 174.009 1.00 43.13  ? 46   ILE S CG2   1 
ATOM   1013  C  CD1   . ILE B  2  46   ? 225.440 276.692 172.410 1.00 47.58  ? 46   ILE S CD1   1 
ATOM   1014  N  N     . SER B  2  47   ? 222.058 272.838 175.133 1.00 38.37  ? 47   SER S N     1 
ATOM   1015  C  CA    . SER B  2  47   ? 221.987 272.082 176.376 1.00 36.15  ? 47   SER S CA    1 
ATOM   1016  C  C     . SER B  2  47   ? 223.354 272.033 177.044 1.00 41.76  ? 47   SER S C     1 
ATOM   1017  O  O     . SER B  2  47   ? 224.395 272.134 176.390 1.00 48.11  ? 47   SER S O     1 
ATOM   1018  C  CB    . SER B  2  47   ? 221.482 270.663 176.123 1.00 47.57  ? 47   SER S CB    1 
ATOM   1019  O  OG    . SER B  2  47   ? 221.458 269.913 177.325 1.00 54.38  ? 47   SER S OG    1 
ATOM   1020  N  N     . GLY B  2  48   ? 223.343 271.866 178.366 1.00 59.63  ? 48   GLY S N     1 
ATOM   1021  C  CA    . GLY B  2  48   ? 224.579 271.868 179.129 1.00 51.89  ? 48   GLY S CA    1 
ATOM   1022  C  C     . GLY B  2  48   ? 225.464 270.657 178.916 1.00 69.30  ? 48   GLY S C     1 
ATOM   1023  O  O     . GLY B  2  48   ? 226.617 270.674 179.359 1.00 86.32  ? 48   GLY S O     1 
ATOM   1024  N  N     . LEU B  2  49   ? 224.958 269.614 178.261 1.00 44.62  ? 49   LEU S N     1 
ATOM   1025  C  CA    . LEU B  2  49   ? 225.716 268.390 178.043 1.00 48.01  ? 49   LEU S CA    1 
ATOM   1026  C  C     . LEU B  2  49   ? 226.404 268.339 176.683 1.00 48.82  ? 49   LEU S C     1 
ATOM   1027  O  O     . LEU B  2  49   ? 227.088 267.355 176.388 1.00 55.62  ? 49   LEU S O     1 
ATOM   1028  C  CB    . LEU B  2  49   ? 224.798 267.174 178.206 1.00 57.11  ? 49   LEU S CB    1 
ATOM   1029  C  CG    . LEU B  2  49   ? 224.195 266.963 179.596 1.00 54.37  ? 49   LEU S CG    1 
ATOM   1030  C  CD1   . LEU B  2  49   ? 223.211 265.804 179.583 1.00 55.68  ? 49   LEU S CD1   1 
ATOM   1031  C  CD2   . LEU B  2  49   ? 225.287 266.733 180.628 1.00 42.51  ? 49   LEU S CD2   1 
ATOM   1032  N  N     . ILE B  2  50   ? 226.238 269.370 175.851 1.00 64.76  ? 50   ILE S N     1 
ATOM   1033  C  CA    . ILE B  2  50   ? 226.862 269.383 174.531 1.00 53.91  ? 50   ILE S CA    1 
ATOM   1034  C  C     . ILE B  2  50   ? 228.379 269.462 174.648 1.00 47.95  ? 50   ILE S C     1 
ATOM   1035  O  O     . ILE B  2  50   ? 229.111 268.865 173.850 1.00 54.56  ? 50   ILE S O     1 
ATOM   1036  C  CB    . ILE B  2  50   ? 226.305 270.557 173.701 1.00 30.75  ? 50   ILE S CB    1 
ATOM   1037  C  CG1   . ILE B  2  50   ? 224.795 270.421 173.523 1.00 41.98  ? 50   ILE S CG1   1 
ATOM   1038  C  CG2   . ILE B  2  50   ? 226.992 270.643 172.353 1.00 24.31  ? 50   ILE S CG2   1 
ATOM   1039  C  CD1   . ILE B  2  50   ? 224.394 269.172 172.792 1.00 25.51  ? 50   ILE S CD1   1 
ATOM   1040  N  N     . TYR B  2  51   ? 228.866 270.191 175.651 1.00 53.45  ? 51   TYR S N     1 
ATOM   1041  C  CA    . TYR B  2  51   ? 230.265 270.605 175.703 1.00 57.54  ? 51   TYR S CA    1 
ATOM   1042  C  C     . TYR B  2  51   ? 231.221 269.415 175.702 1.00 63.83  ? 51   TYR S C     1 
ATOM   1043  O  O     . TYR B  2  51   ? 232.026 269.253 174.778 1.00 67.51  ? 51   TYR S O     1 
ATOM   1044  C  CB    . TYR B  2  51   ? 230.467 271.498 176.925 1.00 51.40  ? 51   TYR S CB    1 
ATOM   1045  C  CG    . TYR B  2  51   ? 229.622 272.745 176.833 1.00 64.37  ? 51   TYR S CG    1 
ATOM   1046  C  CD1   . TYR B  2  51   ? 229.538 273.455 175.643 1.00 73.45  ? 51   TYR S CD1   1 
ATOM   1047  C  CD2   . TYR B  2  51   ? 228.865 273.182 177.907 1.00 73.89  ? 51   TYR S CD2   1 
ATOM   1048  C  CE1   . TYR B  2  51   ? 228.758 274.586 175.537 1.00 82.93  ? 51   TYR S CE1   1 
ATOM   1049  C  CE2   . TYR B  2  51   ? 228.075 274.312 177.809 1.00 80.24  ? 51   TYR S CE2   1 
ATOM   1050  C  CZ    . TYR B  2  51   ? 228.029 275.010 176.621 1.00 88.78  ? 51   TYR S CZ    1 
ATOM   1051  O  OH    . TYR B  2  51   ? 227.247 276.137 176.513 1.00 100.86 ? 51   TYR S OH    1 
ATOM   1052  N  N     . GLU B  2  52   ? 231.162 268.579 176.745 1.00 56.15  ? 52   GLU S N     1 
ATOM   1053  C  CA    . GLU B  2  52   ? 232.101 267.464 176.862 1.00 56.03  ? 52   GLU S CA    1 
ATOM   1054  C  C     . GLU B  2  52   ? 232.082 266.574 175.624 1.00 65.06  ? 52   GLU S C     1 
ATOM   1055  O  O     . GLU B  2  52   ? 233.138 266.144 175.140 1.00 70.05  ? 52   GLU S O     1 
ATOM   1056  C  CB    . GLU B  2  52   ? 231.785 266.643 178.114 1.00 62.34  ? 52   GLU S CB    1 
ATOM   1057  C  CG    . GLU B  2  52   ? 231.989 267.390 179.422 1.00 86.34  ? 52   GLU S CG    1 
ATOM   1058  C  CD    . GLU B  2  52   ? 233.417 267.870 179.610 1.00 92.13  ? 52   GLU S CD    1 
ATOM   1059  O  OE1   . GLU B  2  52   ? 234.349 267.125 179.242 1.00 87.77  ? 52   GLU S OE1   1 
ATOM   1060  O  OE2   . GLU B  2  52   ? 233.607 268.988 180.132 1.00 100.24 ? 52   GLU S OE2   1 
ATOM   1061  N  N     . GLU B  2  53   ? 230.890 266.293 175.093 1.00 52.85  ? 53   GLU S N     1 
ATOM   1062  C  CA    . GLU B  2  53   ? 230.791 265.483 173.882 1.00 49.21  ? 53   GLU S CA    1 
ATOM   1063  C  C     . GLU B  2  53   ? 231.505 266.156 172.714 1.00 57.86  ? 53   GLU S C     1 
ATOM   1064  O  O     . GLU B  2  53   ? 232.237 265.504 171.959 1.00 56.62  ? 53   GLU S O     1 
ATOM   1065  C  CB    . GLU B  2  53   ? 229.322 265.227 173.541 1.00 52.99  ? 53   GLU S CB    1 
ATOM   1066  C  CG    . GLU B  2  53   ? 229.105 264.339 172.325 1.00 57.10  ? 53   GLU S CG    1 
ATOM   1067  C  CD    . GLU B  2  53   ? 229.569 262.909 172.541 1.00 72.97  ? 53   GLU S CD    1 
ATOM   1068  O  OE1   . GLU B  2  53   ? 229.805 262.522 173.705 1.00 80.73  ? 53   GLU S OE1   1 
ATOM   1069  O  OE2   . GLU B  2  53   ? 229.699 262.171 171.542 1.00 68.04  ? 53   GLU S OE2   1 
ATOM   1070  N  N     . THR B  2  54   ? 231.305 267.468 172.555 1.00 49.12  ? 54   THR S N     1 
ATOM   1071  C  CA    . THR B  2  54   ? 231.989 268.197 171.494 1.00 45.26  ? 54   THR S CA    1 
ATOM   1072  C  C     . THR B  2  54   ? 233.500 268.118 171.661 1.00 47.32  ? 54   THR S C     1 
ATOM   1073  O  O     . THR B  2  54   ? 234.237 267.982 170.675 1.00 48.86  ? 54   THR S O     1 
ATOM   1074  C  CB    . THR B  2  54   ? 231.523 269.653 171.471 1.00 29.04  ? 54   THR S CB    1 
ATOM   1075  O  OG1   . THR B  2  54   ? 230.112 269.699 171.229 1.00 36.98  ? 54   THR S OG1   1 
ATOM   1076  C  CG2   . THR B  2  54   ? 232.239 270.425 170.376 1.00 21.13  ? 54   THR S CG2   1 
ATOM   1077  N  N     . ARG B  2  55   ? 233.984 268.186 172.903 1.00 43.73  ? 55   ARG S N     1 
ATOM   1078  C  CA    . ARG B  2  55   ? 235.415 268.030 173.137 1.00 46.32  ? 55   ARG S CA    1 
ATOM   1079  C  C     . ARG B  2  55   ? 235.892 266.647 172.713 1.00 50.00  ? 55   ARG S C     1 
ATOM   1080  O  O     . ARG B  2  55   ? 236.958 266.512 172.099 1.00 48.65  ? 55   ARG S O     1 
ATOM   1081  C  CB    . ARG B  2  55   ? 235.751 268.285 174.606 1.00 53.73  ? 55   ARG S CB    1 
ATOM   1082  C  CG    . ARG B  2  55   ? 235.539 269.718 175.062 1.00 54.27  ? 55   ARG S CG    1 
ATOM   1083  C  CD    . ARG B  2  55   ? 235.963 269.890 176.512 1.00 65.09  ? 55   ARG S CD    1 
ATOM   1084  N  NE    . ARG B  2  55   ? 235.791 271.261 176.978 1.00 70.68  ? 55   ARG S NE    1 
ATOM   1085  C  CZ    . ARG B  2  55   ? 234.663 271.739 177.493 1.00 75.50  ? 55   ARG S CZ    1 
ATOM   1086  N  NH1   . ARG B  2  55   ? 233.604 270.952 177.617 1.00 71.11  ? 55   ARG S NH1   1 
ATOM   1087  N  NH2   . ARG B  2  55   ? 234.597 273.000 177.893 1.00 83.73  ? 55   ARG S NH2   1 
ATOM   1088  N  N     . GLY B  2  56   ? 235.115 265.607 173.025 1.00 31.95  ? 56   GLY S N     1 
ATOM   1089  C  CA    . GLY B  2  56   ? 235.492 264.269 172.593 1.00 42.23  ? 56   GLY S CA    1 
ATOM   1090  C  C     . GLY B  2  56   ? 235.572 264.150 171.082 1.00 40.07  ? 56   GLY S C     1 
ATOM   1091  O  O     . GLY B  2  56   ? 236.543 263.614 170.536 1.00 38.36  ? 56   GLY S O     1 
ATOM   1092  N  N     . VAL B  2  57   ? 234.553 264.658 170.385 1.00 31.34  ? 57   VAL S N     1 
ATOM   1093  C  CA    . VAL B  2  57   ? 234.528 264.588 168.925 1.00 30.97  ? 57   VAL S CA    1 
ATOM   1094  C  C     . VAL B  2  57   ? 235.725 265.326 168.337 1.00 35.66  ? 57   VAL S C     1 
ATOM   1095  O  O     . VAL B  2  57   ? 236.437 264.804 167.469 1.00 47.03  ? 57   VAL S O     1 
ATOM   1096  C  CB    . VAL B  2  57   ? 233.201 265.150 168.387 1.00 35.38  ? 57   VAL S CB    1 
ATOM   1097  C  CG1   . VAL B  2  57   ? 233.210 265.178 166.871 1.00 36.63  ? 57   VAL S CG1   1 
ATOM   1098  C  CG2   . VAL B  2  57   ? 232.034 264.329 168.905 1.00 34.13  ? 57   VAL S CG2   1 
ATOM   1099  N  N     . LEU B  2  58   ? 235.959 266.556 168.804 1.00 24.71  ? 58   LEU S N     1 
ATOM   1100  C  CA    . LEU B  2  58   ? 237.099 267.328 168.322 1.00 28.82  ? 58   LEU S CA    1 
ATOM   1101  C  C     . LEU B  2  58   ? 238.408 266.586 168.561 1.00 39.13  ? 58   LEU S C     1 
ATOM   1102  O  O     . LEU B  2  58   ? 239.293 266.578 167.696 1.00 40.98  ? 58   LEU S O     1 
ATOM   1103  C  CB    . LEU B  2  58   ? 237.125 268.694 169.003 1.00 27.63  ? 58   LEU S CB    1 
ATOM   1104  C  CG    . LEU B  2  58   ? 238.297 269.611 168.652 1.00 30.88  ? 58   LEU S CG    1 
ATOM   1105  C  CD1   . LEU B  2  58   ? 238.256 269.975 167.178 1.00 26.90  ? 58   LEU S CD1   1 
ATOM   1106  C  CD2   . LEU B  2  58   ? 238.280 270.857 169.520 1.00 23.26  ? 58   LEU S CD2   1 
ATOM   1107  N  N     . LYS B  2  59   ? 238.542 265.946 169.725 1.00 39.99  ? 59   LYS S N     1 
ATOM   1108  C  CA    . LYS B  2  59   ? 239.764 265.204 170.013 1.00 35.21  ? 59   LYS S CA    1 
ATOM   1109  C  C     . LYS B  2  59   ? 239.941 264.037 169.052 1.00 31.46  ? 59   LYS S C     1 
ATOM   1110  O  O     . LYS B  2  59   ? 241.059 263.767 168.596 1.00 28.07  ? 59   LYS S O     1 
ATOM   1111  C  CB    . LYS B  2  59   ? 239.759 264.709 171.458 1.00 37.05  ? 59   LYS S CB    1 
ATOM   1112  C  CG    . LYS B  2  59   ? 241.039 263.991 171.854 1.00 52.38  ? 59   LYS S CG    1 
ATOM   1113  C  CD    . LYS B  2  59   ? 241.020 263.566 173.312 1.00 68.25  ? 59   LYS S CD    1 
ATOM   1114  C  CE    . LYS B  2  59   ? 242.305 262.842 173.684 1.00 76.46  ? 59   LYS S CE    1 
ATOM   1115  N  NZ    . LYS B  2  59   ? 242.317 262.415 175.109 1.00 66.95  ? 59   LYS S NZ    1 
ATOM   1116  N  N     . VAL B  2  60   ? 238.853 263.335 168.724 1.00 26.35  ? 60   VAL S N     1 
ATOM   1117  C  CA    . VAL B  2  60   ? 238.945 262.239 167.760 1.00 28.10  ? 60   VAL S CA    1 
ATOM   1118  C  C     . VAL B  2  60   ? 239.404 262.763 166.401 1.00 33.62  ? 60   VAL S C     1 
ATOM   1119  O  O     . VAL B  2  60   ? 240.351 262.237 165.796 1.00 39.61  ? 60   VAL S O     1 
ATOM   1120  C  CB    . VAL B  2  60   ? 237.598 261.501 167.651 1.00 25.51  ? 60   VAL S CB    1 
ATOM   1121  C  CG1   . VAL B  2  60   ? 237.658 260.455 166.553 1.00 18.06  ? 60   VAL S CG1   1 
ATOM   1122  C  CG2   . VAL B  2  60   ? 237.242 260.858 168.981 1.00 27.86  ? 60   VAL S CG2   1 
ATOM   1123  N  N     . PHE B  2  61   ? 238.737 263.808 165.906 1.00 17.53  ? 61   PHE S N     1 
ATOM   1124  C  CA    . PHE B  2  61   ? 239.098 264.391 164.616 1.00 24.92  ? 61   PHE S CA    1 
ATOM   1125  C  C     . PHE B  2  61   ? 240.572 264.780 164.579 1.00 28.00  ? 61   PHE S C     1 
ATOM   1126  O  O     . PHE B  2  61   ? 241.293 264.460 163.622 1.00 26.71  ? 61   PHE S O     1 
ATOM   1127  C  CB    . PHE B  2  61   ? 238.207 265.603 164.337 1.00 17.54  ? 61   PHE S CB    1 
ATOM   1128  C  CG    . PHE B  2  61   ? 238.539 266.324 163.064 1.00 17.49  ? 61   PHE S CG    1 
ATOM   1129  C  CD1   . PHE B  2  61   ? 238.074 265.859 161.845 1.00 13.80  ? 61   PHE S CD1   1 
ATOM   1130  C  CD2   . PHE B  2  61   ? 239.304 267.476 163.086 1.00 32.00  ? 61   PHE S CD2   1 
ATOM   1131  C  CE1   . PHE B  2  61   ? 238.374 266.526 160.676 1.00 17.94  ? 61   PHE S CE1   1 
ATOM   1132  C  CE2   . PHE B  2  61   ? 239.606 268.146 161.917 1.00 25.50  ? 61   PHE S CE2   1 
ATOM   1133  C  CZ    . PHE B  2  61   ? 239.142 267.672 160.713 1.00 16.40  ? 61   PHE S CZ    1 
ATOM   1134  N  N     . LEU B  2  62   ? 241.043 265.460 165.627 1.00 35.94  ? 62   LEU S N     1 
ATOM   1135  C  CA    . LEU B  2  62   ? 242.443 265.863 165.666 1.00 35.99  ? 62   LEU S CA    1 
ATOM   1136  C  C     . LEU B  2  62   ? 243.377 264.663 165.744 1.00 46.07  ? 62   LEU S C     1 
ATOM   1137  O  O     . LEU B  2  62   ? 244.479 264.705 165.190 1.00 47.70  ? 62   LEU S O     1 
ATOM   1138  C  CB    . LEU B  2  62   ? 242.689 266.807 166.842 1.00 31.76  ? 62   LEU S CB    1 
ATOM   1139  C  CG    . LEU B  2  62   ? 241.994 268.164 166.752 1.00 35.72  ? 62   LEU S CG    1 
ATOM   1140  C  CD1   . LEU B  2  62   ? 242.222 268.969 168.019 1.00 28.74  ? 62   LEU S CD1   1 
ATOM   1141  C  CD2   . LEU B  2  62   ? 242.488 268.924 165.535 1.00 34.88  ? 62   LEU S CD2   1 
ATOM   1142  N  N     . GLU B  2  63   ? 242.966 263.587 166.420 1.00 35.23  ? 63   GLU S N     1 
ATOM   1143  C  CA    . GLU B  2  63   ? 243.786 262.379 166.429 1.00 41.26  ? 63   GLU S CA    1 
ATOM   1144  C  C     . GLU B  2  63   ? 243.954 261.826 165.020 1.00 42.02  ? 63   GLU S C     1 
ATOM   1145  O  O     . GLU B  2  63   ? 245.066 261.473 164.608 1.00 40.35  ? 63   GLU S O     1 
ATOM   1146  C  CB    . GLU B  2  63   ? 243.177 261.323 167.353 1.00 37.92  ? 63   GLU S CB    1 
ATOM   1147  C  CG    . GLU B  2  63   ? 243.293 261.640 168.833 1.00 45.69  ? 63   GLU S CG    1 
ATOM   1148  C  CD    . GLU B  2  63   ? 242.613 260.601 169.703 1.00 52.56  ? 63   GLU S CD    1 
ATOM   1149  O  OE1   . GLU B  2  63   ? 241.887 259.747 169.154 1.00 52.68  ? 63   GLU S OE1   1 
ATOM   1150  O  OE2   . GLU B  2  63   ? 242.807 260.636 170.938 1.00 52.63  ? 63   GLU S OE2   1 
ATOM   1151  N  N     . ASN B  2  64   ? 242.856 261.737 164.268 1.00 39.70  ? 64   ASN S N     1 
ATOM   1152  C  CA    . ASN B  2  64   ? 242.938 261.282 162.881 1.00 40.89  ? 64   ASN S CA    1 
ATOM   1153  C  C     . ASN B  2  64   ? 243.863 262.174 162.054 1.00 38.64  ? 64   ASN S C     1 
ATOM   1154  O  O     . ASN B  2  64   ? 244.898 261.723 161.541 1.00 41.72  ? 64   ASN S O     1 
ATOM   1155  C  CB    . ASN B  2  64   ? 241.539 261.231 162.269 1.00 49.94  ? 64   ASN S CB    1 
ATOM   1156  C  CG    . ASN B  2  64   ? 240.693 260.114 162.843 1.00 46.74  ? 64   ASN S CG    1 
ATOM   1157  O  OD1   . ASN B  2  64   ? 241.218 259.130 163.362 1.00 50.04  ? 64   ASN S OD1   1 
ATOM   1158  N  ND2   . ASN B  2  64   ? 239.377 260.258 162.748 1.00 52.71  ? 64   ASN S ND2   1 
ATOM   1159  N  N     . VAL B  2  65   ? 243.492 263.449 161.903 1.00 45.71  ? 65   VAL S N     1 
ATOM   1160  C  CA    . VAL B  2  65   ? 244.240 264.339 161.014 1.00 43.72  ? 65   VAL S CA    1 
ATOM   1161  C  C     . VAL B  2  65   ? 245.706 264.401 161.423 1.00 42.10  ? 65   VAL S C     1 
ATOM   1162  O  O     . VAL B  2  65   ? 246.606 264.396 160.573 1.00 48.58  ? 65   VAL S O     1 
ATOM   1163  C  CB    . VAL B  2  65   ? 243.598 265.736 160.995 1.00 23.12  ? 65   VAL S CB    1 
ATOM   1164  C  CG1   . VAL B  2  65   ? 244.391 266.670 160.103 1.00 18.81  ? 65   VAL S CG1   1 
ATOM   1165  C  CG2   . VAL B  2  65   ? 242.156 265.647 160.538 1.00 31.36  ? 65   VAL S CG2   1 
ATOM   1166  N  N     . ILE B  2  66   ? 245.971 264.441 162.730 1.00 34.56  ? 66   ILE S N     1 
ATOM   1167  C  CA    . ILE B  2  66   ? 247.351 264.559 163.191 1.00 27.00  ? 66   ILE S CA    1 
ATOM   1168  C  C     . ILE B  2  66   ? 248.116 263.257 162.982 1.00 39.50  ? 66   ILE S C     1 
ATOM   1169  O  O     . ILE B  2  66   ? 249.321 263.287 162.712 1.00 39.36  ? 66   ILE S O     1 
ATOM   1170  C  CB    . ILE B  2  66   ? 247.385 265.029 164.657 1.00 36.60  ? 66   ILE S CB    1 
ATOM   1171  C  CG1   . ILE B  2  66   ? 246.950 266.494 164.743 1.00 39.62  ? 66   ILE S CG1   1 
ATOM   1172  C  CG2   . ILE B  2  66   ? 248.773 264.870 165.257 1.00 37.35  ? 66   ILE S CG2   1 
ATOM   1173  C  CD1   . ILE B  2  66   ? 246.756 266.992 166.154 1.00 48.83  ? 66   ILE S CD1   1 
ATOM   1174  N  N     . ARG B  2  67   ? 247.458 262.098 163.073 1.00 43.16  ? 67   ARG S N     1 
ATOM   1175  C  CA    . ARG B  2  67   ? 248.205 260.873 162.797 1.00 40.87  ? 67   ARG S CA    1 
ATOM   1176  C  C     . ARG B  2  67   ? 248.536 260.755 161.315 1.00 41.89  ? 67   ARG S C     1 
ATOM   1177  O  O     . ARG B  2  67   ? 249.609 260.251 160.961 1.00 46.29  ? 67   ARG S O     1 
ATOM   1178  C  CB    . ARG B  2  67   ? 247.451 259.632 163.287 1.00 45.43  ? 67   ARG S CB    1 
ATOM   1179  C  CG    . ARG B  2  67   ? 246.272 259.197 162.442 1.00 59.28  ? 67   ARG S CG    1 
ATOM   1180  C  CD    . ARG B  2  67   ? 245.756 257.837 162.877 1.00 80.12  ? 67   ARG S CD    1 
ATOM   1181  N  NE    . ARG B  2  67   ? 245.220 257.860 164.234 1.00 90.50  ? 67   ARG S NE    1 
ATOM   1182  C  CZ    . ARG B  2  67   ? 244.988 256.775 164.963 1.00 88.76  ? 67   ARG S CZ    1 
ATOM   1183  N  NH1   . ARG B  2  67   ? 245.243 255.574 164.466 1.00 86.01  ? 67   ARG S NH1   1 
ATOM   1184  N  NH2   . ARG B  2  67   ? 244.498 256.891 166.190 1.00 80.72  ? 67   ARG S NH2   1 
ATOM   1185  N  N     . ASP B  2  68   ? 247.653 261.241 160.436 1.00 45.42  ? 68   ASP S N     1 
ATOM   1186  C  CA    . ASP B  2  68   ? 247.990 261.251 159.015 1.00 37.86  ? 68   ASP S CA    1 
ATOM   1187  C  C     . ASP B  2  68   ? 249.136 262.218 158.727 1.00 42.66  ? 68   ASP S C     1 
ATOM   1188  O  O     . ASP B  2  68   ? 250.113 261.858 158.057 1.00 49.19  ? 68   ASP S O     1 
ATOM   1189  C  CB    . ASP B  2  68   ? 246.759 261.605 158.179 1.00 44.29  ? 68   ASP S CB    1 
ATOM   1190  C  CG    . ASP B  2  68   ? 245.739 260.485 158.141 1.00 75.37  ? 68   ASP S CG    1 
ATOM   1191  O  OD1   . ASP B  2  68   ? 246.094 259.343 158.498 1.00 75.15  ? 68   ASP S OD1   1 
ATOM   1192  O  OD2   . ASP B  2  68   ? 244.583 260.746 157.748 1.00 86.69  ? 68   ASP S OD2   1 
ATOM   1193  N  N     . ALA B  2  69   ? 249.038 263.451 159.236 1.00 42.22  ? 69   ALA S N     1 
ATOM   1194  C  CA    . ALA B  2  69   ? 250.078 264.442 158.971 1.00 40.04  ? 69   ALA S CA    1 
ATOM   1195  C  C     . ALA B  2  69   ? 251.420 264.009 159.545 1.00 45.26  ? 69   ALA S C     1 
ATOM   1196  O  O     . ALA B  2  69   ? 252.454 264.116 158.874 1.00 42.49  ? 69   ALA S O     1 
ATOM   1197  C  CB    . ALA B  2  69   ? 249.663 265.800 159.538 1.00 47.78  ? 69   ALA S CB    1 
ATOM   1198  N  N     . VAL B  2  70   ? 251.426 263.520 160.786 1.00 34.60  ? 70   VAL S N     1 
ATOM   1199  C  CA    . VAL B  2  70   ? 252.661 263.032 161.392 1.00 37.56  ? 70   VAL S CA    1 
ATOM   1200  C  C     . VAL B  2  70   ? 253.189 261.822 160.637 1.00 38.68  ? 70   VAL S C     1 
ATOM   1201  O  O     . VAL B  2  70   ? 254.403 261.610 160.566 1.00 27.20  ? 70   VAL S O     1 
ATOM   1202  C  CB    . VAL B  2  70   ? 252.443 262.730 162.889 1.00 52.93  ? 70   VAL S CB    1 
ATOM   1203  C  CG1   . VAL B  2  70   ? 253.656 262.037 163.484 1.00 51.92  ? 70   VAL S CG1   1 
ATOM   1204  C  CG2   . VAL B  2  70   ? 252.179 264.019 163.644 1.00 47.38  ? 70   VAL S CG2   1 
ATOM   1205  N  N     . THR B  2  71   ? 252.301 261.015 160.051 1.00 42.33  ? 71   THR S N     1 
ATOM   1206  C  CA    . THR B  2  71   ? 252.772 259.920 159.205 1.00 33.63  ? 71   THR S CA    1 
ATOM   1207  C  C     . THR B  2  71   ? 253.522 260.457 157.990 1.00 30.13  ? 71   THR S C     1 
ATOM   1208  O  O     . THR B  2  71   ? 254.622 259.989 157.665 1.00 37.58  ? 71   THR S O     1 
ATOM   1209  C  CB    . THR B  2  71   ? 251.598 259.043 158.770 1.00 47.53  ? 71   THR S CB    1 
ATOM   1210  O  OG1   . THR B  2  71   ? 250.949 258.503 159.927 1.00 49.11  ? 71   THR S OG1   1 
ATOM   1211  C  CG2   . THR B  2  71   ? 252.095 257.902 157.904 1.00 37.87  ? 71   THR S CG2   1 
ATOM   1212  N  N     . TYR B  2  72   ? 252.941 261.454 157.312 1.00 34.31  ? 72   TYR S N     1 
ATOM   1213  C  CA    . TYR B  2  72   ? 253.638 262.100 156.202 1.00 42.67  ? 72   TYR S CA    1 
ATOM   1214  C  C     . TYR B  2  72   ? 254.994 262.643 156.640 1.00 51.40  ? 72   TYR S C     1 
ATOM   1215  O  O     . TYR B  2  72   ? 255.999 262.474 155.941 1.00 40.21  ? 72   TYR S O     1 
ATOM   1216  C  CB    . TYR B  2  72   ? 252.785 263.230 155.624 1.00 43.43  ? 72   TYR S CB    1 
ATOM   1217  C  CG    . TYR B  2  72   ? 251.526 262.779 154.925 1.00 43.51  ? 72   TYR S CG    1 
ATOM   1218  C  CD1   . TYR B  2  72   ? 251.529 261.671 154.096 1.00 40.41  ? 72   TYR S CD1   1 
ATOM   1219  C  CD2   . TYR B  2  72   ? 250.337 263.472 155.088 1.00 44.75  ? 72   TYR S CD2   1 
ATOM   1220  C  CE1   . TYR B  2  72   ? 250.384 261.262 153.452 1.00 38.66  ? 72   TYR S CE1   1 
ATOM   1221  C  CE2   . TYR B  2  72   ? 249.185 263.070 154.448 1.00 43.22  ? 72   TYR S CE2   1 
ATOM   1222  C  CZ    . TYR B  2  72   ? 249.214 261.963 153.630 1.00 44.63  ? 72   TYR S CZ    1 
ATOM   1223  O  OH    . TYR B  2  72   ? 248.068 261.553 152.989 1.00 57.71  ? 72   TYR S OH    1 
ATOM   1224  N  N     . THR B  2  73   ? 255.036 263.301 157.799 1.00 35.73  ? 73   THR S N     1 
ATOM   1225  C  CA    . THR B  2  73   ? 256.283 263.896 158.269 1.00 37.35  ? 73   THR S CA    1 
ATOM   1226  C  C     . THR B  2  73   ? 257.321 262.826 158.586 1.00 44.78  ? 73   THR S C     1 
ATOM   1227  O  O     . THR B  2  73   ? 258.516 263.019 158.335 1.00 40.11  ? 73   THR S O     1 
ATOM   1228  C  CB    . THR B  2  73   ? 256.009 264.771 159.492 1.00 61.99  ? 73   THR S CB    1 
ATOM   1229  O  OG1   . THR B  2  73   ? 255.072 265.795 159.140 1.00 70.85  ? 73   THR S OG1   1 
ATOM   1230  C  CG2   . THR B  2  73   ? 257.284 265.428 159.976 1.00 51.82  ? 73   THR S CG2   1 
ATOM   1231  N  N     . GLU B  2  74   ? 256.885 261.688 159.129 1.00 34.14  ? 74   GLU S N     1 
ATOM   1232  C  CA    . GLU B  2  74   ? 257.811 260.592 159.394 1.00 37.21  ? 74   GLU S CA    1 
ATOM   1233  C  C     . GLU B  2  74   ? 258.351 260.002 158.099 1.00 41.06  ? 74   GLU S C     1 
ATOM   1234  O  O     . GLU B  2  74   ? 259.520 259.599 158.037 1.00 49.66  ? 74   GLU S O     1 
ATOM   1235  C  CB    . GLU B  2  74   ? 257.127 259.503 160.222 1.00 50.79  ? 74   GLU S CB    1 
ATOM   1236  C  CG    . GLU B  2  74   ? 256.802 259.898 161.652 1.00 65.82  ? 74   GLU S CG    1 
ATOM   1237  C  CD    . GLU B  2  74   ? 256.055 258.808 162.396 1.00 88.31  ? 74   GLU S CD    1 
ATOM   1238  O  OE1   . GLU B  2  74   ? 255.626 257.831 161.746 1.00 89.76  ? 74   GLU S OE1   1 
ATOM   1239  O  OE2   . GLU B  2  74   ? 255.894 258.928 163.628 1.00 100.16 ? 74   GLU S OE2   1 
ATOM   1240  N  N     . HIS B  2  75   ? 257.521 259.936 157.056 1.00 39.66  ? 75   HIS S N     1 
ATOM   1241  C  CA    . HIS B  2  75   ? 257.991 259.361 155.799 1.00 45.61  ? 75   HIS S CA    1 
ATOM   1242  C  C     . HIS B  2  75   ? 259.069 260.218 155.144 1.00 58.04  ? 75   HIS S C     1 
ATOM   1243  O  O     . HIS B  2  75   ? 259.947 259.682 154.458 1.00 70.41  ? 75   HIS S O     1 
ATOM   1244  C  CB    . HIS B  2  75   ? 256.830 259.164 154.829 1.00 41.51  ? 75   HIS S CB    1 
ATOM   1245  C  CG    . HIS B  2  75   ? 257.242 258.585 153.513 1.00 41.65  ? 75   HIS S CG    1 
ATOM   1246  N  ND1   . HIS B  2  75   ? 257.834 257.345 153.400 1.00 45.51  ? 75   HIS S ND1   1 
ATOM   1247  C  CD2   . HIS B  2  75   ? 257.164 259.081 152.257 1.00 43.83  ? 75   HIS S CD2   1 
ATOM   1248  C  CE1   . HIS B  2  75   ? 258.096 257.100 152.129 1.00 51.25  ? 75   HIS S CE1   1 
ATOM   1249  N  NE2   . HIS B  2  75   ? 257.699 258.137 151.415 1.00 50.29  ? 75   HIS S NE2   1 
ATOM   1250  N  N     . ALA B  2  76   ? 259.024 261.532 155.338 1.00 63.05  ? 76   ALA S N     1 
ATOM   1251  C  CA    . ALA B  2  76   ? 259.973 262.438 154.708 1.00 59.22  ? 76   ALA S CA    1 
ATOM   1252  C  C     . ALA B  2  76   ? 261.254 262.619 155.513 1.00 55.74  ? 76   ALA S C     1 
ATOM   1253  O  O     . ALA B  2  76   ? 262.120 263.395 155.096 1.00 56.25  ? 76   ALA S O     1 
ATOM   1254  C  CB    . ALA B  2  76   ? 259.320 263.804 154.473 1.00 61.33  ? 76   ALA S CB    1 
ATOM   1255  N  N     . LYS B  2  77   ? 261.389 261.931 156.648 1.00 69.19  ? 77   LYS S N     1 
ATOM   1256  C  CA    . LYS B  2  77   ? 262.563 262.041 157.517 1.00 71.26  ? 77   LYS S CA    1 
ATOM   1257  C  C     . LYS B  2  77   ? 262.780 263.472 157.997 1.00 69.72  ? 77   LYS S C     1 
ATOM   1258  O  O     . LYS B  2  77   ? 263.915 263.896 158.228 1.00 75.64  ? 77   LYS S O     1 
ATOM   1259  C  CB    . LYS B  2  77   ? 263.824 261.513 156.826 1.00 78.17  ? 77   LYS S CB    1 
ATOM   1260  C  CG    . LYS B  2  77   ? 263.806 260.020 156.555 1.00 89.44  ? 77   LYS S CG    1 
ATOM   1261  C  CD    . LYS B  2  77   ? 265.050 259.584 155.801 1.00 96.59  ? 77   LYS S CD    1 
ATOM   1262  C  CE    . LYS B  2  77   ? 265.048 258.086 155.552 1.00 104.87 ? 77   LYS S CE    1 
ATOM   1263  N  NZ    . LYS B  2  77   ? 266.235 257.651 154.762 1.00 109.13 ? 77   LYS S NZ    1 
ATOM   1264  N  N     . ARG B  2  78   ? 261.696 264.226 158.151 1.00 63.77  ? 78   ARG S N     1 
ATOM   1265  C  CA    . ARG B  2  78   ? 261.749 265.597 158.630 1.00 61.94  ? 78   ARG S CA    1 
ATOM   1266  C  C     . ARG B  2  78   ? 261.206 265.676 160.051 1.00 59.35  ? 78   ARG S C     1 
ATOM   1267  O  O     . ARG B  2  78   ? 260.328 264.904 160.442 1.00 70.74  ? 78   ARG S O     1 
ATOM   1268  C  CB    . ARG B  2  78   ? 260.956 266.533 157.711 1.00 68.83  ? 78   ARG S CB    1 
ATOM   1269  C  CG    . ARG B  2  78   ? 261.571 266.699 156.330 1.00 71.12  ? 78   ARG S CG    1 
ATOM   1270  C  CD    . ARG B  2  78   ? 260.785 267.671 155.463 1.00 63.35  ? 78   ARG S CD    1 
ATOM   1271  N  NE    . ARG B  2  78   ? 259.449 267.181 155.141 1.00 65.12  ? 78   ARG S NE    1 
ATOM   1272  C  CZ    . ARG B  2  78   ? 258.336 267.600 155.734 1.00 72.97  ? 78   ARG S CZ    1 
ATOM   1273  N  NH1   . ARG B  2  78   ? 258.398 268.522 156.683 1.00 68.65  ? 78   ARG S NH1   1 
ATOM   1274  N  NH2   . ARG B  2  78   ? 257.162 267.100 155.377 1.00 49.08  ? 78   ARG S NH2   1 
ATOM   1275  N  N     . LYS B  2  79   ? 261.757 266.605 160.829 1.00 65.57  ? 79   LYS S N     1 
ATOM   1276  C  CA    . LYS B  2  79   ? 261.325 266.823 162.203 1.00 69.65  ? 79   LYS S CA    1 
ATOM   1277  C  C     . LYS B  2  79   ? 260.249 267.893 162.324 1.00 70.62  ? 79   LYS S C     1 
ATOM   1278  O  O     . LYS B  2  79   ? 259.744 268.118 163.429 1.00 70.75  ? 79   LYS S O     1 
ATOM   1279  C  CB    . LYS B  2  79   ? 262.523 267.207 163.075 1.00 73.23  ? 79   LYS S CB    1 
ATOM   1280  C  CG    . LYS B  2  79   ? 263.608 266.149 163.152 1.00 84.77  ? 79   LYS S CG    1 
ATOM   1281  C  CD    . LYS B  2  79   ? 263.119 264.913 163.884 1.00 95.76  ? 79   LYS S CD    1 
ATOM   1282  C  CE    . LYS B  2  79   ? 264.213 263.865 163.977 1.00 99.33  ? 79   LYS S CE    1 
ATOM   1283  N  NZ    . LYS B  2  79   ? 265.363 264.343 164.793 1.00 99.40  ? 79   LYS S NZ    1 
ATOM   1284  N  N     . THR B  2  80   ? 259.887 268.551 161.228 1.00 68.30  ? 80   THR S N     1 
ATOM   1285  C  CA    . THR B  2  80   ? 258.921 269.638 161.239 1.00 55.50  ? 80   THR S CA    1 
ATOM   1286  C  C     . THR B  2  80   ? 257.687 269.240 160.439 1.00 64.77  ? 80   THR S C     1 
ATOM   1287  O  O     . THR B  2  80   ? 257.800 268.677 159.347 1.00 83.34  ? 80   THR S O     1 
ATOM   1288  C  CB    . THR B  2  80   ? 259.532 270.916 160.654 1.00 71.58  ? 80   THR S CB    1 
ATOM   1289  O  OG1   . THR B  2  80   ? 260.669 271.303 161.432 1.00 90.68  ? 80   THR S OG1   1 
ATOM   1290  C  CG2   . THR B  2  80   ? 258.518 272.049 160.657 1.00 77.25  ? 80   THR S CG2   1 
ATOM   1291  N  N     . VAL B  2  81   ? 256.512 269.540 160.985 1.00 53.73  ? 81   VAL S N     1 
ATOM   1292  C  CA    . VAL B  2  81   ? 255.253 269.251 160.311 1.00 52.08  ? 81   VAL S CA    1 
ATOM   1293  C  C     . VAL B  2  81   ? 254.851 270.495 159.530 1.00 63.77  ? 81   VAL S C     1 
ATOM   1294  O  O     . VAL B  2  81   ? 254.459 271.511 160.113 1.00 63.65  ? 81   VAL S O     1 
ATOM   1295  C  CB    . VAL B  2  81   ? 254.165 268.844 161.310 1.00 57.78  ? 81   VAL S CB    1 
ATOM   1296  C  CG1   . VAL B  2  81   ? 252.838 268.648 160.597 1.00 53.37  ? 81   VAL S CG1   1 
ATOM   1297  C  CG2   . VAL B  2  81   ? 254.570 267.581 162.050 1.00 70.69  ? 81   VAL S CG2   1 
ATOM   1298  N  N     . THR B  2  82   ? 254.941 270.415 158.207 1.00 47.60  ? 82   THR S N     1 
ATOM   1299  C  CA    . THR B  2  82   ? 254.589 271.527 157.342 1.00 39.37  ? 82   THR S CA    1 
ATOM   1300  C  C     . THR B  2  82   ? 253.081 271.594 157.135 1.00 45.52  ? 82   THR S C     1 
ATOM   1301  O  O     . THR B  2  82   ? 252.360 270.607 157.295 1.00 45.72  ? 82   THR S O     1 
ATOM   1302  C  CB    . THR B  2  82   ? 255.294 271.410 155.992 1.00 60.78  ? 82   THR S CB    1 
ATOM   1303  O  OG1   . THR B  2  82   ? 254.931 270.172 155.368 1.00 49.13  ? 82   THR S OG1   1 
ATOM   1304  C  CG2   . THR B  2  82   ? 256.803 271.454 156.176 1.00 63.09  ? 82   THR S CG2   1 
ATOM   1305  N  N     . ALA B  2  83   ? 252.605 272.793 156.787 1.00 46.66  ? 83   ALA S N     1 
ATOM   1306  C  CA    . ALA B  2  83   ? 251.197 272.951 156.443 1.00 39.30  ? 83   ALA S CA    1 
ATOM   1307  C  C     . ALA B  2  83   ? 250.806 272.084 155.257 1.00 49.11  ? 83   ALA S C     1 
ATOM   1308  O  O     . ALA B  2  83   ? 249.653 271.648 155.159 1.00 46.93  ? 83   ALA S O     1 
ATOM   1309  C  CB    . ALA B  2  83   ? 250.888 274.419 156.146 1.00 47.86  ? 83   ALA S CB    1 
ATOM   1310  N  N     . MET B  2  84   ? 251.751 271.817 154.350 1.00 46.12  ? 84   MET S N     1 
ATOM   1311  C  CA    . MET B  2  84   ? 251.459 270.947 153.216 1.00 49.59  ? 84   MET S CA    1 
ATOM   1312  C  C     . MET B  2  84   ? 251.093 269.543 153.675 1.00 50.79  ? 84   MET S C     1 
ATOM   1313  O  O     . MET B  2  84   ? 250.226 268.894 153.077 1.00 45.54  ? 84   MET S O     1 
ATOM   1314  C  CB    . MET B  2  84   ? 252.655 270.906 152.265 1.00 64.87  ? 84   MET S CB    1 
ATOM   1315  C  CG    . MET B  2  84   ? 252.982 272.241 151.623 1.00 73.80  ? 84   MET S CG    1 
ATOM   1316  S  SD    . MET B  2  84   ? 251.652 272.835 150.560 1.00 96.22  ? 84   MET S SD    1 
ATOM   1317  C  CE    . MET B  2  84   ? 252.352 274.377 149.976 1.00 144.39 ? 84   MET S CE    1 
ATOM   1318  N  N     . ASP B  2  85   ? 251.742 269.055 154.735 1.00 42.01  ? 85   ASP S N     1 
ATOM   1319  C  CA    . ASP B  2  85   ? 251.393 267.744 155.268 1.00 36.65  ? 85   ASP S CA    1 
ATOM   1320  C  C     . ASP B  2  85   ? 249.968 267.732 155.802 1.00 39.13  ? 85   ASP S C     1 
ATOM   1321  O  O     . ASP B  2  85   ? 249.230 266.759 155.609 1.00 49.55  ? 85   ASP S O     1 
ATOM   1322  C  CB    . ASP B  2  85   ? 252.383 267.345 156.363 1.00 42.49  ? 85   ASP S CB    1 
ATOM   1323  C  CG    . ASP B  2  85   ? 253.766 267.059 155.818 1.00 49.52  ? 85   ASP S CG    1 
ATOM   1324  O  OD1   . ASP B  2  85   ? 253.895 266.877 154.590 1.00 51.92  ? 85   ASP S OD1   1 
ATOM   1325  O  OD2   . ASP B  2  85   ? 254.724 267.016 156.617 1.00 43.58  ? 85   ASP S OD2   1 
ATOM   1326  N  N     . VAL B  2  86   ? 249.563 268.809 156.476 1.00 37.31  ? 86   VAL S N     1 
ATOM   1327  C  CA    . VAL B  2  86   ? 248.195 268.899 156.975 1.00 38.13  ? 86   VAL S CA    1 
ATOM   1328  C  C     . VAL B  2  86   ? 247.206 268.950 155.819 1.00 44.35  ? 86   VAL S C     1 
ATOM   1329  O  O     . VAL B  2  86   ? 246.138 268.326 155.868 1.00 52.33  ? 86   VAL S O     1 
ATOM   1330  C  CB    . VAL B  2  86   ? 248.046 270.117 157.902 1.00 38.69  ? 86   VAL S CB    1 
ATOM   1331  C  CG1   . VAL B  2  86   ? 246.600 270.292 158.325 1.00 44.40  ? 86   VAL S CG1   1 
ATOM   1332  C  CG2   . VAL B  2  86   ? 248.942 269.964 159.117 1.00 41.78  ? 86   VAL S CG2   1 
ATOM   1333  N  N     . VAL B  2  87   ? 247.546 269.681 154.755 1.00 33.40  ? 87   VAL S N     1 
ATOM   1334  C  CA    . VAL B  2  87   ? 246.659 269.754 153.596 1.00 30.04  ? 87   VAL S CA    1 
ATOM   1335  C  C     . VAL B  2  87   ? 246.523 268.385 152.941 1.00 34.79  ? 87   VAL S C     1 
ATOM   1336  O  O     . VAL B  2  87   ? 245.428 267.983 152.531 1.00 43.11  ? 87   VAL S O     1 
ATOM   1337  C  CB    . VAL B  2  87   ? 247.163 270.815 152.600 1.00 46.84  ? 87   VAL S CB    1 
ATOM   1338  C  CG1   . VAL B  2  87   ? 246.314 270.805 151.342 1.00 36.49  ? 87   VAL S CG1   1 
ATOM   1339  C  CG2   . VAL B  2  87   ? 247.138 272.189 153.239 1.00 35.20  ? 87   VAL S CG2   1 
ATOM   1340  N  N     . TYR B  2  88   ? 247.629 267.642 152.838 1.00 30.02  ? 88   TYR S N     1 
ATOM   1341  C  CA    . TYR B  2  88   ? 247.563 266.301 152.272 1.00 30.96  ? 88   TYR S CA    1 
ATOM   1342  C  C     . TYR B  2  88   ? 246.837 265.324 153.188 1.00 35.13  ? 88   TYR S C     1 
ATOM   1343  O  O     . TYR B  2  88   ? 246.311 264.318 152.703 1.00 39.69  ? 88   TYR S O     1 
ATOM   1344  C  CB    . TYR B  2  88   ? 248.965 265.773 151.966 1.00 37.27  ? 88   TYR S CB    1 
ATOM   1345  C  CG    . TYR B  2  88   ? 249.711 266.577 150.927 1.00 48.33  ? 88   TYR S CG    1 
ATOM   1346  C  CD1   . TYR B  2  88   ? 249.046 267.138 149.847 1.00 58.01  ? 88   TYR S CD1   1 
ATOM   1347  C  CD2   . TYR B  2  88   ? 251.084 266.756 151.017 1.00 50.15  ? 88   TYR S CD2   1 
ATOM   1348  C  CE1   . TYR B  2  88   ? 249.724 267.872 148.895 1.00 67.69  ? 88   TYR S CE1   1 
ATOM   1349  C  CE2   . TYR B  2  88   ? 251.772 267.486 150.070 1.00 57.27  ? 88   TYR S CE2   1 
ATOM   1350  C  CZ    . TYR B  2  88   ? 251.086 268.041 149.011 1.00 66.35  ? 88   TYR S CZ    1 
ATOM   1351  O  OH    . TYR B  2  88   ? 251.768 268.766 148.064 1.00 73.29  ? 88   TYR S OH    1 
ATOM   1352  N  N     . ALA B  2  89   ? 246.805 265.593 154.494 1.00 31.78  ? 89   ALA S N     1 
ATOM   1353  C  CA    . ALA B  2  89   ? 246.038 264.742 155.397 1.00 25.10  ? 89   ALA S CA    1 
ATOM   1354  C  C     . ALA B  2  89   ? 244.546 265.026 155.293 1.00 37.48  ? 89   ALA S C     1 
ATOM   1355  O  O     . ALA B  2  89   ? 243.730 264.098 155.307 1.00 49.14  ? 89   ALA S O     1 
ATOM   1356  C  CB    . ALA B  2  89   ? 246.521 264.934 156.834 1.00 21.68  ? 89   ALA S CB    1 
ATOM   1357  N  N     . LEU B  2  90   ? 244.173 266.301 155.184 1.00 26.90  ? 90   LEU S N     1 
ATOM   1358  C  CA    . LEU B  2  90   ? 242.765 266.650 155.034 1.00 33.14  ? 90   LEU S CA    1 
ATOM   1359  C  C     . LEU B  2  90   ? 242.228 266.184 153.688 1.00 44.77  ? 90   LEU S C     1 
ATOM   1360  O  O     . LEU B  2  90   ? 241.171 265.545 153.617 1.00 38.59  ? 90   LEU S O     1 
ATOM   1361  C  CB    . LEU B  2  90   ? 242.586 268.157 155.204 1.00 25.19  ? 90   LEU S CB    1 
ATOM   1362  C  CG    . LEU B  2  90   ? 242.928 268.692 156.594 1.00 31.83  ? 90   LEU S CG    1 
ATOM   1363  C  CD1   . LEU B  2  90   ? 242.882 270.205 156.603 1.00 29.85  ? 90   LEU S CD1   1 
ATOM   1364  C  CD2   . LEU B  2  90   ? 241.975 268.120 157.627 1.00 22.66  ? 90   LEU S CD2   1 
ATOM   1365  N  N     . LYS B  2  91   ? 242.937 266.504 152.602 1.00 30.35  ? 91   LYS S N     1 
ATOM   1366  C  CA    . LYS B  2  91   ? 242.578 265.957 151.297 1.00 29.19  ? 91   LYS S CA    1 
ATOM   1367  C  C     . LYS B  2  91   ? 242.621 264.437 151.312 1.00 32.96  ? 91   LYS S C     1 
ATOM   1368  O  O     . LYS B  2  91   ? 241.856 263.782 150.595 1.00 36.58  ? 91   LYS S O     1 
ATOM   1369  C  CB    . LYS B  2  91   ? 243.516 266.509 150.223 1.00 36.54  ? 91   LYS S CB    1 
ATOM   1370  C  CG    . LYS B  2  91   ? 243.214 266.034 148.811 1.00 54.06  ? 91   LYS S CG    1 
ATOM   1371  C  CD    . LYS B  2  91   ? 244.185 266.642 147.811 1.00 79.71  ? 91   LYS S CD    1 
ATOM   1372  C  CE    . LYS B  2  91   ? 243.909 266.151 146.401 1.00 97.89  ? 91   LYS S CE    1 
ATOM   1373  N  NZ    . LYS B  2  91   ? 244.867 266.730 145.418 1.00 104.44 ? 91   LYS S NZ    1 
ATOM   1374  N  N     . ARG B  2  92   ? 243.508 263.864 152.127 1.00 44.93  ? 92   ARG S N     1 
ATOM   1375  C  CA    . ARG B  2  92   ? 243.551 262.416 152.296 1.00 40.01  ? 92   ARG S CA    1 
ATOM   1376  C  C     . ARG B  2  92   ? 242.250 261.889 152.886 1.00 47.08  ? 92   ARG S C     1 
ATOM   1377  O  O     . ARG B  2  92   ? 241.758 260.833 152.474 1.00 48.85  ? 92   ARG S O     1 
ATOM   1378  C  CB    . ARG B  2  92   ? 244.743 262.044 153.176 1.00 39.10  ? 92   ARG S CB    1 
ATOM   1379  C  CG    . ARG B  2  92   ? 244.822 260.592 153.572 1.00 50.80  ? 92   ARG S CG    1 
ATOM   1380  C  CD    . ARG B  2  92   ? 245.027 259.684 152.387 1.00 54.69  ? 92   ARG S CD    1 
ATOM   1381  N  NE    . ARG B  2  92   ? 245.115 258.302 152.834 1.00 65.47  ? 92   ARG S NE    1 
ATOM   1382  C  CZ    . ARG B  2  92   ? 244.062 257.516 153.027 1.00 80.24  ? 92   ARG S CZ    1 
ATOM   1383  N  NH1   . ARG B  2  92   ? 242.839 257.976 152.803 1.00 80.30  ? 92   ARG S NH1   1 
ATOM   1384  N  NH2   . ARG B  2  92   ? 244.233 256.272 153.446 1.00 81.47  ? 92   ARG S NH2   1 
ATOM   1385  N  N     . GLN B  2  93   ? 241.670 262.614 153.845 1.00 37.33  ? 93   GLN S N     1 
ATOM   1386  C  CA    . GLN B  2  93   ? 240.420 262.181 154.457 1.00 32.44  ? 93   GLN S CA    1 
ATOM   1387  C  C     . GLN B  2  93   ? 239.193 262.530 153.626 1.00 37.02  ? 93   GLN S C     1 
ATOM   1388  O  O     . GLN B  2  93   ? 238.098 262.050 153.941 1.00 30.65  ? 93   GLN S O     1 
ATOM   1389  C  CB    . GLN B  2  93   ? 240.264 262.791 155.849 1.00 30.95  ? 93   GLN S CB    1 
ATOM   1390  C  CG    . GLN B  2  93   ? 241.296 262.327 156.852 1.00 46.85  ? 93   GLN S CG    1 
ATOM   1391  C  CD    . GLN B  2  93   ? 241.096 262.968 158.206 1.00 57.15  ? 93   GLN S CD    1 
ATOM   1392  O  OE1   . GLN B  2  93   ? 240.468 264.019 158.320 1.00 64.08  ? 93   GLN S OE1   1 
ATOM   1393  N  NE2   . GLN B  2  93   ? 241.637 262.342 159.240 1.00 50.34  ? 93   GLN S NE2   1 
ATOM   1394  N  N     . GLY B  2  94   ? 239.340 263.346 152.585 1.00 42.42  ? 94   GLY S N     1 
ATOM   1395  C  CA    . GLY B  2  94   ? 238.220 263.745 151.755 1.00 44.71  ? 94   GLY S CA    1 
ATOM   1396  C  C     . GLY B  2  94   ? 237.739 265.164 151.959 1.00 38.30  ? 94   GLY S C     1 
ATOM   1397  O  O     . GLY B  2  94   ? 236.756 265.559 151.320 1.00 49.12  ? 94   GLY S O     1 
ATOM   1398  N  N     . ARG B  2  95   ? 238.384 265.944 152.823 1.00 30.15  ? 95   ARG S N     1 
ATOM   1399  C  CA    . ARG B  2  95   ? 238.032 267.342 153.046 1.00 32.34  ? 95   ARG S CA    1 
ATOM   1400  C  C     . ARG B  2  95   ? 239.156 268.208 152.492 1.00 49.09  ? 95   ARG S C     1 
ATOM   1401  O  O     . ARG B  2  95   ? 240.245 268.266 153.068 1.00 43.27  ? 95   ARG S O     1 
ATOM   1402  C  CB    . ARG B  2  95   ? 237.812 267.617 154.532 1.00 39.10  ? 95   ARG S CB    1 
ATOM   1403  C  CG    . ARG B  2  95   ? 236.630 266.883 155.131 1.00 47.44  ? 95   ARG S CG    1 
ATOM   1404  C  CD    . ARG B  2  95   ? 236.443 267.245 156.594 1.00 55.54  ? 95   ARG S CD    1 
ATOM   1405  N  NE    . ARG B  2  95   ? 235.308 266.544 157.185 1.00 63.18  ? 95   ARG S NE    1 
ATOM   1406  C  CZ    . ARG B  2  95   ? 234.048 266.957 157.096 1.00 76.82  ? 95   ARG S CZ    1 
ATOM   1407  N  NH1   . ARG B  2  95   ? 233.759 268.070 156.437 1.00 84.47  ? 95   ARG S NH1   1 
ATOM   1408  N  NH2   . ARG B  2  95   ? 233.076 266.257 157.665 1.00 76.76  ? 95   ARG S NH2   1 
ATOM   1409  N  N     . THR B  2  96   ? 238.886 268.896 151.389 1.00 43.66  ? 96   THR S N     1 
ATOM   1410  C  CA    . THR B  2  96   ? 239.904 269.697 150.721 1.00 46.67  ? 96   THR S CA    1 
ATOM   1411  C  C     . THR B  2  96   ? 239.926 271.100 151.315 1.00 47.31  ? 96   THR S C     1 
ATOM   1412  O  O     . THR B  2  96   ? 238.878 271.736 151.461 1.00 57.28  ? 96   THR S O     1 
ATOM   1413  C  CB    . THR B  2  96   ? 239.638 269.759 149.217 1.00 57.71  ? 96   THR S CB    1 
ATOM   1414  O  OG1   . THR B  2  96   ? 239.615 268.429 148.681 1.00 63.83  ? 96   THR S OG1   1 
ATOM   1415  C  CG2   . THR B  2  96   ? 240.734 270.544 148.520 1.00 54.70  ? 96   THR S CG2   1 
ATOM   1416  N  N     . LEU B  2  97   ? 241.123 271.574 151.658 1.00 60.58  ? 97   LEU S N     1 
ATOM   1417  C  CA    . LEU B  2  97   ? 241.315 272.887 152.267 1.00 57.63  ? 97   LEU S CA    1 
ATOM   1418  C  C     . LEU B  2  97   ? 242.093 273.768 151.296 1.00 69.08  ? 97   LEU S C     1 
ATOM   1419  O  O     . LEU B  2  97   ? 243.293 273.559 151.089 1.00 66.99  ? 97   LEU S O     1 
ATOM   1420  C  CB    . LEU B  2  97   ? 242.051 272.749 153.598 1.00 49.76  ? 97   LEU S CB    1 
ATOM   1421  C  CG    . LEU B  2  97   ? 242.420 274.016 154.371 1.00 56.75  ? 97   LEU S CG    1 
ATOM   1422  C  CD1   . LEU B  2  97   ? 241.181 274.757 154.829 1.00 65.80  ? 97   LEU S CD1   1 
ATOM   1423  C  CD2   . LEU B  2  97   ? 243.302 273.672 155.556 1.00 53.23  ? 97   LEU S CD2   1 
ATOM   1424  N  N     . TYR B  2  98   ? 241.416 274.748 150.703 1.00 57.39  ? 98   TYR S N     1 
ATOM   1425  C  CA    . TYR B  2  98   ? 242.088 275.684 149.815 1.00 63.89  ? 98   TYR S CA    1 
ATOM   1426  C  C     . TYR B  2  98   ? 242.781 276.796 150.598 1.00 62.21  ? 98   TYR S C     1 
ATOM   1427  O  O     . TYR B  2  98   ? 242.424 277.118 151.734 1.00 55.68  ? 98   TYR S O     1 
ATOM   1428  C  CB    . TYR B  2  98   ? 241.116 276.314 148.814 1.00 46.01  ? 98   TYR S CB    1 
ATOM   1429  C  CG    . TYR B  2  98   ? 240.530 275.357 147.807 1.00 39.76  ? 98   TYR S CG    1 
ATOM   1430  C  CD1   . TYR B  2  98   ? 241.243 274.247 147.379 1.00 38.26  ? 98   TYR S CD1   1 
ATOM   1431  C  CD2   . TYR B  2  98   ? 239.296 275.604 147.224 1.00 35.90  ? 98   TYR S CD2   1 
ATOM   1432  C  CE1   . TYR B  2  98   ? 240.714 273.377 146.443 1.00 42.54  ? 98   TYR S CE1   1 
ATOM   1433  C  CE2   . TYR B  2  98   ? 238.762 274.743 146.286 1.00 32.47  ? 98   TYR S CE2   1 
ATOM   1434  C  CZ    . TYR B  2  98   ? 239.475 273.632 145.898 1.00 39.50  ? 98   TYR S CZ    1 
ATOM   1435  O  OH    . TYR B  2  98   ? 238.947 272.775 144.963 1.00 40.79  ? 98   TYR S OH    1 
ATOM   1436  N  N     . GLY B  2  99   ? 243.795 277.380 149.963 1.00 48.45  ? 99   GLY S N     1 
ATOM   1437  C  CA    . GLY B  2  99   ? 244.414 278.605 150.409 1.00 58.17  ? 99   GLY S CA    1 
ATOM   1438  C  C     . GLY B  2  99   ? 245.735 278.440 151.130 1.00 63.16  ? 99   GLY S C     1 
ATOM   1439  O  O     . GLY B  2  99   ? 246.536 279.381 151.146 1.00 64.90  ? 99   GLY S O     1 
ATOM   1440  N  N     . PHE B  2  100  ? 245.989 277.276 151.720 1.00 75.24  ? 100  PHE S N     1 
ATOM   1441  C  CA    . PHE B  2  100  ? 247.240 277.024 152.419 1.00 55.55  ? 100  PHE S CA    1 
ATOM   1442  C  C     . PHE B  2  100  ? 248.253 276.261 151.576 1.00 54.25  ? 100  PHE S C     1 
ATOM   1443  O  O     . PHE B  2  100  ? 249.348 275.969 152.064 1.00 64.60  ? 100  PHE S O     1 
ATOM   1444  C  CB    . PHE B  2  100  ? 246.964 276.280 153.726 1.00 73.32  ? 100  PHE S CB    1 
ATOM   1445  C  CG    . PHE B  2  100  ? 246.170 277.084 154.716 1.00 74.98  ? 100  PHE S CG    1 
ATOM   1446  C  CD1   . PHE B  2  100  ? 246.154 278.467 154.645 1.00 71.49  ? 100  PHE S CD1   1 
ATOM   1447  C  CD2   . PHE B  2  100  ? 245.425 276.463 155.701 1.00 71.97  ? 100  PHE S CD2   1 
ATOM   1448  C  CE1   . PHE B  2  100  ? 245.424 279.212 155.547 1.00 81.06  ? 100  PHE S CE1   1 
ATOM   1449  C  CE2   . PHE B  2  100  ? 244.692 277.206 156.604 1.00 69.16  ? 100  PHE S CE2   1 
ATOM   1450  C  CZ    . PHE B  2  100  ? 244.692 278.582 156.527 1.00 77.35  ? 100  PHE S CZ    1 
ATOM   1451  N  N     . GLY B  2  101  ? 247.918 275.938 150.332 1.00 67.45  ? 101  GLY S N     1 
ATOM   1452  C  CA    . GLY B  2  101  ? 248.827 275.221 149.461 1.00 54.31  ? 101  GLY S CA    1 
ATOM   1453  C  C     . GLY B  2  101  ? 248.298 273.868 149.025 1.00 54.63  ? 101  GLY S C     1 
ATOM   1454  O  O     . GLY B  2  101  ? 247.914 273.684 147.872 1.00 56.90  ? 101  GLY S O     1 
ATOM   1455  N  N     . ALA C  3  12   ? 271.379 227.940 134.771 1.00 147.77 ? 12   ALA T N     1 
ATOM   1456  C  CA    . ALA C  3  12   ? 270.766 227.647 136.060 1.00 156.08 ? 12   ALA T CA    1 
ATOM   1457  C  C     . ALA C  3  12   ? 269.248 227.569 135.939 1.00 168.86 ? 12   ALA T C     1 
ATOM   1458  O  O     . ALA C  3  12   ? 268.659 228.167 135.038 1.00 168.15 ? 12   ALA T O     1 
ATOM   1459  C  CB    . ALA C  3  12   ? 271.164 228.696 137.086 1.00 160.41 ? 12   ALA T CB    1 
ATOM   1460  N  N     . LYS C  3  13   ? 268.621 226.829 136.849 1.00 160.86 ? 13   LYS T N     1 
ATOM   1461  C  CA    . LYS C  3  13   ? 267.172 226.691 136.844 1.00 150.40 ? 13   LYS T CA    1 
ATOM   1462  C  C     . LYS C  3  13   ? 266.532 227.912 137.494 1.00 154.47 ? 13   LYS T C     1 
ATOM   1463  O  O     . LYS C  3  13   ? 266.888 228.289 138.616 1.00 155.87 ? 13   LYS T O     1 
ATOM   1464  C  CB    . LYS C  3  13   ? 266.751 225.417 137.576 1.00 148.69 ? 13   LYS T CB    1 
ATOM   1465  N  N     . ALA C  3  14   ? 265.590 228.528 136.787 1.00 155.65 ? 14   ALA T N     1 
ATOM   1466  C  CA    . ALA C  3  14   ? 264.964 229.750 137.271 1.00 141.07 ? 14   ALA T CA    1 
ATOM   1467  C  C     . ALA C  3  14   ? 264.034 229.453 138.438 1.00 140.06 ? 14   ALA T C     1 
ATOM   1468  O  O     . ALA C  3  14   ? 263.168 228.577 138.351 1.00 137.78 ? 14   ALA T O     1 
ATOM   1469  C  CB    . ALA C  3  14   ? 264.197 230.436 136.142 1.00 135.38 ? 14   ALA T CB    1 
ATOM   1470  N  N     . LYS C  3  15   ? 264.213 230.186 139.533 1.00 133.58 ? 15   LYS T N     1 
ATOM   1471  C  CA    . LYS C  3  15   ? 263.363 230.080 140.709 1.00 130.10 ? 15   LYS T CA    1 
ATOM   1472  C  C     . LYS C  3  15   ? 262.510 231.334 140.816 1.00 129.02 ? 15   LYS T C     1 
ATOM   1473  O  O     . LYS C  3  15   ? 263.021 232.450 140.677 1.00 127.90 ? 15   LYS T O     1 
ATOM   1474  C  CB    . LYS C  3  15   ? 264.198 229.894 141.978 1.00 117.82 ? 15   LYS T CB    1 
ATOM   1475  C  CG    . LYS C  3  15   ? 263.375 229.663 143.234 1.00 123.14 ? 15   LYS T CG    1 
ATOM   1476  C  CD    . LYS C  3  15   ? 264.255 229.614 144.473 1.00 133.89 ? 15   LYS T CD    1 
ATOM   1477  C  CE    . LYS C  3  15   ? 265.138 228.376 144.475 1.00 136.46 ? 15   LYS T CE    1 
ATOM   1478  N  NZ    . LYS C  3  15   ? 266.016 228.324 145.674 1.00 136.69 ? 15   LYS T NZ    1 
ATOM   1479  N  N     . THR C  3  16   ? 261.215 231.148 141.054 1.00 125.60 ? 16   THR T N     1 
ATOM   1480  C  CA    . THR C  3  16   ? 260.298 232.277 141.124 1.00 113.97 ? 16   THR T CA    1 
ATOM   1481  C  C     . THR C  3  16   ? 260.593 233.135 142.348 1.00 116.04 ? 16   THR T C     1 
ATOM   1482  O  O     . THR C  3  16   ? 260.892 232.623 143.430 1.00 117.96 ? 16   THR T O     1 
ATOM   1483  C  CB    . THR C  3  16   ? 258.851 231.788 141.168 1.00 120.03 ? 16   THR T CB    1 
ATOM   1484  O  OG1   . THR C  3  16   ? 258.666 230.945 142.312 1.00 113.73 ? 16   THR T OG1   1 
ATOM   1485  C  CG2   . THR C  3  16   ? 258.519 231.002 139.908 1.00 113.26 ? 16   THR T CG2   1 
ATOM   1486  N  N     . ARG C  3  17   ? 260.509 234.455 142.167 1.00 117.60 ? 17   ARG T N     1 
ATOM   1487  C  CA    . ARG C  3  17   ? 260.725 235.372 143.282 1.00 104.58 ? 17   ARG T CA    1 
ATOM   1488  C  C     . ARG C  3  17   ? 259.660 235.235 144.358 1.00 104.54 ? 17   ARG T C     1 
ATOM   1489  O  O     . ARG C  3  17   ? 259.922 235.571 145.517 1.00 106.88 ? 17   ARG T O     1 
ATOM   1490  C  CB    . ARG C  3  17   ? 260.778 236.816 142.781 1.00 102.62 ? 17   ARG T CB    1 
ATOM   1491  C  CG    . ARG C  3  17   ? 262.013 237.143 141.957 1.00 105.94 ? 17   ARG T CG    1 
ATOM   1492  C  CD    . ARG C  3  17   ? 261.962 238.561 141.409 1.00 107.31 ? 17   ARG T CD    1 
ATOM   1493  N  NE    . ARG C  3  17   ? 260.878 238.752 140.453 1.00 103.97 ? 17   ARG T NE    1 
ATOM   1494  C  CZ    . ARG C  3  17   ? 260.618 239.904 139.843 1.00 111.79 ? 17   ARG T CZ    1 
ATOM   1495  N  NH1   . ARG C  3  17   ? 261.362 240.972 140.094 1.00 105.80 ? 17   ARG T NH1   1 
ATOM   1496  N  NH2   . ARG C  3  17   ? 259.612 239.990 138.983 1.00 128.05 ? 17   ARG T NH2   1 
ATOM   1497  N  N     . SER C  3  18   ? 258.463 234.756 144.004 1.00 94.64  ? 18   SER T N     1 
ATOM   1498  C  CA    . SER C  3  18   ? 257.442 234.519 145.016 1.00 95.49  ? 18   SER T CA    1 
ATOM   1499  C  C     . SER C  3  18   ? 257.850 233.409 145.974 1.00 100.84 ? 18   SER T C     1 
ATOM   1500  O  O     . SER C  3  18   ? 257.501 233.455 147.158 1.00 96.04  ? 18   SER T O     1 
ATOM   1501  C  CB    . SER C  3  18   ? 256.110 234.180 144.349 1.00 81.28  ? 18   SER T CB    1 
ATOM   1502  O  OG    . SER C  3  18   ? 255.624 235.275 143.595 1.00 87.31  ? 18   SER T OG    1 
ATOM   1503  N  N     . SER C  3  19   ? 258.591 232.414 145.486 1.00 95.74  ? 19   SER T N     1 
ATOM   1504  C  CA    . SER C  3  19   ? 259.048 231.323 146.334 1.00 101.42 ? 19   SER T CA    1 
ATOM   1505  C  C     . SER C  3  19   ? 260.236 231.712 147.203 1.00 96.55  ? 19   SER T C     1 
ATOM   1506  O  O     . SER C  3  19   ? 260.460 231.077 148.240 1.00 90.19  ? 19   SER T O     1 
ATOM   1507  C  CB    . SER C  3  19   ? 259.414 230.109 145.480 1.00 116.43 ? 19   SER T CB    1 
ATOM   1508  O  OG    . SER C  3  19   ? 260.497 230.406 144.616 1.00 119.08 ? 19   SER T OG    1 
ATOM   1509  N  N     . ARG C  3  20   ? 261.003 232.728 146.805 1.00 89.07  ? 20   ARG T N     1 
ATOM   1510  C  CA    . ARG C  3  20   ? 262.134 233.167 147.615 1.00 85.53  ? 20   ARG T CA    1 
ATOM   1511  C  C     . ARG C  3  20   ? 261.665 233.754 148.938 1.00 96.79  ? 20   ARG T C     1 
ATOM   1512  O  O     . ARG C  3  20   ? 262.119 233.342 150.011 1.00 109.29 ? 20   ARG T O     1 
ATOM   1513  C  CB    . ARG C  3  20   ? 262.972 234.185 146.842 1.00 91.31  ? 20   ARG T CB    1 
ATOM   1514  C  CG    . ARG C  3  20   ? 263.657 233.623 145.610 1.00 97.31  ? 20   ARG T CG    1 
ATOM   1515  C  CD    . ARG C  3  20   ? 264.513 234.681 144.931 1.00 104.20 ? 20   ARG T CD    1 
ATOM   1516  N  NE    . ARG C  3  20   ? 265.168 234.170 143.732 1.00 119.66 ? 20   ARG T NE    1 
ATOM   1517  C  CZ    . ARG C  3  20   ? 266.319 233.505 143.736 1.00 129.27 ? 20   ARG T CZ    1 
ATOM   1518  N  NH1   . ARG C  3  20   ? 266.947 233.269 144.881 1.00 129.54 ? 20   ARG T NH1   1 
ATOM   1519  N  NH2   . ARG C  3  20   ? 266.845 233.078 142.596 1.00 132.86 ? 20   ARG T NH2   1 
ATOM   1520  N  N     . ALA C  3  21   ? 260.751 234.723 148.882 1.00 92.83  ? 21   ALA T N     1 
ATOM   1521  C  CA    . ALA C  3  21   ? 260.225 235.350 150.087 1.00 90.87  ? 21   ALA T CA    1 
ATOM   1522  C  C     . ALA C  3  21   ? 259.195 234.490 150.805 1.00 90.86  ? 21   ALA T C     1 
ATOM   1523  O  O     . ALA C  3  21   ? 258.766 234.855 151.905 1.00 93.53  ? 21   ALA T O     1 
ATOM   1524  C  CB    . ALA C  3  21   ? 259.608 236.708 149.748 1.00 74.50  ? 21   ALA T CB    1 
ATOM   1525  N  N     . GLY C  3  22   ? 258.789 233.366 150.219 1.00 85.88  ? 22   GLY T N     1 
ATOM   1526  C  CA    . GLY C  3  22   ? 257.768 232.539 150.829 1.00 84.03  ? 22   GLY T CA    1 
ATOM   1527  C  C     . GLY C  3  22   ? 256.360 233.055 150.650 1.00 83.48  ? 22   GLY T C     1 
ATOM   1528  O  O     . GLY C  3  22   ? 255.519 232.856 151.531 1.00 86.94  ? 22   GLY T O     1 
ATOM   1529  N  N     . LEU C  3  23   ? 256.078 233.708 149.527 1.00 94.55  ? 23   LEU T N     1 
ATOM   1530  C  CA    . LEU C  3  23   ? 254.776 234.297 149.259 1.00 93.61  ? 23   LEU T CA    1 
ATOM   1531  C  C     . LEU C  3  23   ? 254.047 233.474 148.205 1.00 90.83  ? 23   LEU T C     1 
ATOM   1532  O  O     . LEU C  3  23   ? 254.665 232.979 147.256 1.00 82.22  ? 23   LEU T O     1 
ATOM   1533  C  CB    . LEU C  3  23   ? 254.919 235.743 148.781 1.00 89.77  ? 23   LEU T CB    1 
ATOM   1534  C  CG    . LEU C  3  23   ? 255.618 236.715 149.733 1.00 79.06  ? 23   LEU T CG    1 
ATOM   1535  C  CD1   . LEU C  3  23   ? 255.753 238.087 149.085 1.00 67.44  ? 23   LEU T CD1   1 
ATOM   1536  C  CD2   . LEU C  3  23   ? 254.890 236.807 151.056 1.00 66.43  ? 23   LEU T CD2   1 
ATOM   1537  N  N     . GLN C  3  24   ? 252.732 233.327 148.375 1.00 97.07  ? 24   GLN T N     1 
ATOM   1538  C  CA    . GLN C  3  24   ? 251.932 232.591 147.403 1.00 91.82  ? 24   GLN T CA    1 
ATOM   1539  C  C     . GLN C  3  24   ? 251.479 233.459 146.236 1.00 88.27  ? 24   GLN T C     1 
ATOM   1540  O  O     . GLN C  3  24   ? 251.048 232.919 145.213 1.00 99.77  ? 24   GLN T O     1 
ATOM   1541  C  CB    . GLN C  3  24   ? 250.710 231.975 148.088 1.00 98.92  ? 24   GLN T CB    1 
ATOM   1542  C  CG    . GLN C  3  24   ? 251.039 230.929 149.141 1.00 106.80 ? 24   GLN T CG    1 
ATOM   1543  C  CD    . GLN C  3  24   ? 251.791 229.741 148.576 1.00 112.74 ? 24   GLN T CD    1 
ATOM   1544  O  OE1   . GLN C  3  24   ? 251.508 229.276 147.471 1.00 111.43 ? 24   GLN T OE1   1 
ATOM   1545  N  NE2   . GLN C  3  24   ? 252.756 229.235 149.336 1.00 122.02 ? 24   GLN T NE2   1 
ATOM   1546  N  N     . PHE C  3  25   ? 251.572 234.792 146.362 1.00 70.24  ? 25   PHE T N     1 
ATOM   1547  C  CA    . PHE C  3  25   ? 251.113 235.745 145.361 1.00 78.21  ? 25   PHE T CA    1 
ATOM   1548  C  C     . PHE C  3  25   ? 252.209 236.071 144.346 1.00 85.27  ? 25   PHE T C     1 
ATOM   1549  O  O     . PHE C  3  25   ? 253.401 236.009 144.665 1.00 92.03  ? 25   PHE T O     1 
ATOM   1550  C  CB    . PHE C  3  25   ? 250.623 237.024 146.036 1.00 62.93  ? 25   PHE T CB    1 
ATOM   1551  C  CG    . PHE C  3  25   ? 249.283 236.877 146.695 1.00 70.99  ? 25   PHE T CG    1 
ATOM   1552  C  CD1   . PHE C  3  25   ? 248.124 237.090 145.968 1.00 70.10  ? 25   PHE T CD1   1 
ATOM   1553  C  CD2   . PHE C  3  25   ? 249.170 236.489 148.017 1.00 70.58  ? 25   PHE T CD2   1 
ATOM   1554  C  CE1   . PHE C  3  25   ? 246.883 236.943 146.549 1.00 69.11  ? 25   PHE T CE1   1 
ATOM   1555  C  CE2   . PHE C  3  25   ? 247.924 236.337 148.601 1.00 73.09  ? 25   PHE T CE2   1 
ATOM   1556  C  CZ    . PHE C  3  25   ? 246.783 236.567 147.865 1.00 72.37  ? 25   PHE T CZ    1 
ATOM   1557  N  N     . PRO C  3  26   ? 251.814 236.427 143.115 1.00 77.78  ? 26   PRO T N     1 
ATOM   1558  C  CA    . PRO C  3  26   ? 252.794 236.586 142.032 1.00 78.98  ? 26   PRO T CA    1 
ATOM   1559  C  C     . PRO C  3  26   ? 253.588 237.879 142.122 1.00 79.32  ? 26   PRO T C     1 
ATOM   1560  O  O     . PRO C  3  26   ? 253.200 238.890 141.525 1.00 87.62  ? 26   PRO T O     1 
ATOM   1561  C  CB    . PRO C  3  26   ? 251.921 236.559 140.773 1.00 74.92  ? 26   PRO T CB    1 
ATOM   1562  C  CG    . PRO C  3  26   ? 250.626 237.127 141.220 1.00 72.17  ? 26   PRO T CG    1 
ATOM   1563  C  CD    . PRO C  3  26   ? 250.439 236.678 142.645 1.00 75.08  ? 26   PRO T CD    1 
ATOM   1564  N  N     . VAL C  3  27   ? 254.683 237.861 142.887 1.00 78.29  ? 27   VAL T N     1 
ATOM   1565  C  CA    . VAL C  3  27   ? 255.549 239.035 143.006 1.00 76.25  ? 27   VAL T CA    1 
ATOM   1566  C  C     . VAL C  3  27   ? 255.876 239.608 141.633 1.00 75.82  ? 27   VAL T C     1 
ATOM   1567  O  O     . VAL C  3  27   ? 255.915 240.830 141.446 1.00 80.65  ? 27   VAL T O     1 
ATOM   1568  C  CB    . VAL C  3  27   ? 256.827 238.672 143.786 1.00 73.03  ? 27   VAL T CB    1 
ATOM   1569  C  CG1   . VAL C  3  27   ? 257.777 239.854 143.827 1.00 59.82  ? 27   VAL T CG1   1 
ATOM   1570  C  CG2   . VAL C  3  27   ? 256.478 238.213 145.192 1.00 85.33  ? 27   VAL T CG2   1 
ATOM   1571  N  N     . GLY C  3  28   ? 256.107 238.737 140.649 1.00 71.80  ? 28   GLY T N     1 
ATOM   1572  C  CA    . GLY C  3  28   ? 256.391 239.215 139.305 1.00 74.74  ? 28   GLY T CA    1 
ATOM   1573  C  C     . GLY C  3  28   ? 255.230 239.972 138.689 1.00 81.45  ? 28   GLY T C     1 
ATOM   1574  O  O     . GLY C  3  28   ? 255.422 241.021 138.066 1.00 81.75  ? 28   GLY T O     1 
ATOM   1575  N  N     . ARG C  3  29   ? 254.010 239.453 138.855 1.00 74.12  ? 29   ARG T N     1 
ATOM   1576  C  CA    . ARG C  3  29   ? 252.842 240.131 138.303 1.00 67.63  ? 29   ARG T CA    1 
ATOM   1577  C  C     . ARG C  3  29   ? 252.613 241.474 138.983 1.00 68.59  ? 29   ARG T C     1 
ATOM   1578  O  O     . ARG C  3  29   ? 252.284 242.466 138.321 1.00 73.81  ? 29   ARG T O     1 
ATOM   1579  C  CB    . ARG C  3  29   ? 251.605 239.244 138.440 1.00 75.69  ? 29   ARG T CB    1 
ATOM   1580  C  CG    . ARG C  3  29   ? 250.330 239.870 137.903 1.00 82.61  ? 29   ARG T CG    1 
ATOM   1581  C  CD    . ARG C  3  29   ? 249.132 238.961 138.126 1.00 81.25  ? 29   ARG T CD    1 
ATOM   1582  N  NE    . ARG C  3  29   ? 249.227 237.730 137.349 1.00 82.59  ? 29   ARG T NE    1 
ATOM   1583  C  CZ    . ARG C  3  29   ? 248.345 236.739 137.412 1.00 81.99  ? 29   ARG T CZ    1 
ATOM   1584  N  NH1   . ARG C  3  29   ? 247.296 236.829 138.218 1.00 80.18  ? 29   ARG T NH1   1 
ATOM   1585  N  NH2   . ARG C  3  29   ? 248.511 235.654 136.668 1.00 73.06  ? 29   ARG T NH2   1 
ATOM   1586  N  N     . VAL C  3  30   ? 252.781 241.524 140.306 1.00 64.07  ? 30   VAL T N     1 
ATOM   1587  C  CA    . VAL C  3  30   ? 252.658 242.789 141.023 1.00 66.98  ? 30   VAL T CA    1 
ATOM   1588  C  C     . VAL C  3  30   ? 253.707 243.779 140.533 1.00 69.26  ? 30   VAL T C     1 
ATOM   1589  O  O     . VAL C  3  30   ? 253.429 244.974 140.365 1.00 74.22  ? 30   VAL T O     1 
ATOM   1590  C  CB    . VAL C  3  30   ? 252.765 242.554 142.541 1.00 68.57  ? 30   VAL T CB    1 
ATOM   1591  C  CG1   . VAL C  3  30   ? 252.747 243.875 143.285 1.00 58.39  ? 30   VAL T CG1   1 
ATOM   1592  C  CG2   . VAL C  3  30   ? 251.634 241.658 143.016 1.00 61.67  ? 30   VAL T CG2   1 
ATOM   1593  N  N     . HIS C  3  31   ? 254.925 243.295 140.281 1.00 60.22  ? 31   HIS T N     1 
ATOM   1594  C  CA    . HIS C  3  31   ? 255.974 244.163 139.752 1.00 63.11  ? 31   HIS T CA    1 
ATOM   1595  C  C     . HIS C  3  31   ? 255.593 244.712 138.383 1.00 70.05  ? 31   HIS T C     1 
ATOM   1596  O  O     . HIS C  3  31   ? 255.788 245.903 138.107 1.00 72.68  ? 31   HIS T O     1 
ATOM   1597  C  CB    . HIS C  3  31   ? 257.294 243.399 139.683 1.00 58.75  ? 31   HIS T CB    1 
ATOM   1598  C  CG    . HIS C  3  31   ? 258.444 244.222 139.192 1.00 75.38  ? 31   HIS T CG    1 
ATOM   1599  N  ND1   . HIS C  3  31   ? 258.894 245.342 139.858 1.00 74.73  ? 31   HIS T ND1   1 
ATOM   1600  C  CD2   . HIS C  3  31   ? 259.241 244.085 138.108 1.00 92.55  ? 31   HIS T CD2   1 
ATOM   1601  C  CE1   . HIS C  3  31   ? 259.915 245.861 139.201 1.00 86.76  ? 31   HIS T CE1   1 
ATOM   1602  N  NE2   . HIS C  3  31   ? 260.147 245.117 138.134 1.00 97.66  ? 31   HIS T NE2   1 
ATOM   1603  N  N     . ARG C  3  32   ? 255.043 243.861 137.514 1.00 59.32  ? 32   ARG T N     1 
ATOM   1604  C  CA    . ARG C  3  32   ? 254.611 244.327 136.201 1.00 63.30  ? 32   ARG T CA    1 
ATOM   1605  C  C     . ARG C  3  32   ? 253.521 245.382 136.327 1.00 70.48  ? 32   ARG T C     1 
ATOM   1606  O  O     . ARG C  3  32   ? 253.555 246.413 135.646 1.00 69.41  ? 32   ARG T O     1 
ATOM   1607  C  CB    . ARG C  3  32   ? 254.114 243.159 135.355 1.00 68.09  ? 32   ARG T CB    1 
ATOM   1608  C  CG    . ARG C  3  32   ? 253.698 243.573 133.954 1.00 70.10  ? 32   ARG T CG    1 
ATOM   1609  C  CD    . ARG C  3  32   ? 253.059 242.422 133.215 1.00 77.80  ? 32   ARG T CD    1 
ATOM   1610  N  NE    . ARG C  3  32   ? 251.812 242.031 133.859 1.00 76.35  ? 32   ARG T NE    1 
ATOM   1611  C  CZ    . ARG C  3  32   ? 251.182 240.884 133.641 1.00 76.10  ? 32   ARG T CZ    1 
ATOM   1612  N  NH1   . ARG C  3  32   ? 251.679 240.001 132.787 1.00 64.45  ? 32   ARG T NH1   1 
ATOM   1613  N  NH2   . ARG C  3  32   ? 250.052 240.622 134.278 1.00 74.31  ? 32   ARG T NH2   1 
ATOM   1614  N  N     . LEU C  3  33   ? 252.536 245.136 137.195 1.00 65.25  ? 33   LEU T N     1 
ATOM   1615  C  CA    . LEU C  3  33   ? 251.451 246.096 137.364 1.00 58.89  ? 33   LEU T CA    1 
ATOM   1616  C  C     . LEU C  3  33   ? 251.953 247.415 137.934 1.00 67.33  ? 33   LEU T C     1 
ATOM   1617  O  O     . LEU C  3  33   ? 251.412 248.478 137.609 1.00 77.50  ? 33   LEU T O     1 
ATOM   1618  C  CB    . LEU C  3  33   ? 250.360 245.506 138.255 1.00 51.03  ? 33   LEU T CB    1 
ATOM   1619  C  CG    . LEU C  3  33   ? 249.628 244.291 137.687 1.00 55.40  ? 33   LEU T CG    1 
ATOM   1620  C  CD1   . LEU C  3  33   ? 248.656 243.721 138.708 1.00 57.76  ? 33   LEU T CD1   1 
ATOM   1621  C  CD2   . LEU C  3  33   ? 248.904 244.661 136.403 1.00 37.38  ? 33   LEU T CD2   1 
ATOM   1622  N  N     . LEU C  3  34   ? 252.983 247.373 138.780 1.00 59.11  ? 34   LEU T N     1 
ATOM   1623  C  CA    . LEU C  3  34   ? 253.578 248.614 139.261 1.00 59.90  ? 34   LEU T CA    1 
ATOM   1624  C  C     . LEU C  3  34   ? 254.356 249.328 138.164 1.00 63.84  ? 34   LEU T C     1 
ATOM   1625  O  O     . LEU C  3  34   ? 254.415 250.562 138.154 1.00 59.20  ? 34   LEU T O     1 
ATOM   1626  C  CB    . LEU C  3  34   ? 254.483 248.344 140.463 1.00 54.46  ? 34   LEU T CB    1 
ATOM   1627  C  CG    . LEU C  3  34   ? 253.800 247.865 141.744 1.00 46.47  ? 34   LEU T CG    1 
ATOM   1628  C  CD1   . LEU C  3  34   ? 254.833 247.521 142.800 1.00 43.40  ? 34   LEU T CD1   1 
ATOM   1629  C  CD2   . LEU C  3  34   ? 252.838 248.921 142.255 1.00 38.04  ? 34   LEU T CD2   1 
ATOM   1630  N  N     . ARG C  3  35   ? 254.959 248.580 137.239 1.00 66.29  ? 35   ARG T N     1 
ATOM   1631  C  CA    . ARG C  3  35   ? 255.714 249.217 136.163 1.00 65.61  ? 35   ARG T CA    1 
ATOM   1632  C  C     . ARG C  3  35   ? 254.788 249.860 135.138 1.00 73.04  ? 35   ARG T C     1 
ATOM   1633  O  O     . ARG C  3  35   ? 254.997 251.010 134.733 1.00 81.97  ? 35   ARG T O     1 
ATOM   1634  C  CB    . ARG C  3  35   ? 256.641 248.205 135.489 1.00 47.14  ? 35   ARG T CB    1 
ATOM   1635  C  CG    . ARG C  3  35   ? 257.796 247.741 136.360 1.00 68.66  ? 35   ARG T CG    1 
ATOM   1636  C  CD    . ARG C  3  35   ? 258.616 246.670 135.659 1.00 82.64  ? 35   ARG T CD    1 
ATOM   1637  N  NE    . ARG C  3  35   ? 257.843 245.458 135.409 1.00 99.23  ? 35   ARG T NE    1 
ATOM   1638  C  CZ    . ARG C  3  35   ? 258.328 244.377 134.808 1.00 103.30 ? 35   ARG T CZ    1 
ATOM   1639  N  NH1   . ARG C  3  35   ? 259.585 244.356 134.391 1.00 103.40 ? 35   ARG T NH1   1 
ATOM   1640  N  NH2   . ARG C  3  35   ? 257.552 243.315 134.621 1.00 95.51  ? 35   ARG T NH2   1 
ATOM   1641  N  N     . LYS C  3  36   ? 253.760 249.137 134.705 1.00 53.76  ? 36   LYS T N     1 
ATOM   1642  C  CA    . LYS C  3  36   ? 252.855 249.616 133.668 1.00 55.74  ? 36   LYS T CA    1 
ATOM   1643  C  C     . LYS C  3  36   ? 251.634 250.337 134.222 1.00 57.68  ? 36   LYS T C     1 
ATOM   1644  O  O     . LYS C  3  36   ? 250.770 250.748 133.441 1.00 62.11  ? 36   LYS T O     1 
ATOM   1645  C  CB    . LYS C  3  36   ? 252.404 248.451 132.783 1.00 80.45  ? 36   LYS T CB    1 
ATOM   1646  N  N     . GLY C  3  37   ? 251.538 250.503 135.537 1.00 46.25  ? 37   GLY T N     1 
ATOM   1647  C  CA    . GLY C  3  37   ? 250.402 251.174 136.133 1.00 42.82  ? 37   GLY T CA    1 
ATOM   1648  C  C     . GLY C  3  37   ? 250.460 252.684 136.141 1.00 53.14  ? 37   GLY T C     1 
ATOM   1649  O  O     . GLY C  3  37   ? 249.540 253.318 136.665 1.00 59.31  ? 37   GLY T O     1 
ATOM   1650  N  N     . ASN C  3  38   ? 251.512 253.277 135.573 1.00 54.72  ? 38   ASN T N     1 
ATOM   1651  C  CA    . ASN C  3  38   ? 251.692 254.731 135.554 1.00 52.92  ? 38   ASN T CA    1 
ATOM   1652  C  C     . ASN C  3  38   ? 251.653 255.314 136.965 1.00 50.72  ? 38   ASN T C     1 
ATOM   1653  O  O     . ASN C  3  38   ? 251.090 256.385 137.201 1.00 58.70  ? 38   ASN T O     1 
ATOM   1654  C  CB    . ASN C  3  38   ? 250.657 255.409 134.654 1.00 61.61  ? 38   ASN T CB    1 
ATOM   1655  C  CG    . ASN C  3  38   ? 250.894 255.131 133.185 1.00 65.32  ? 38   ASN T CG    1 
ATOM   1656  O  OD1   . ASN C  3  38   ? 251.783 255.718 132.566 1.00 60.41  ? 38   ASN T OD1   1 
ATOM   1657  N  ND2   . ASN C  3  38   ? 250.101 254.231 132.616 1.00 58.62  ? 38   ASN T ND2   1 
ATOM   1658  N  N     . TYR C  3  39   ? 252.253 254.596 137.912 1.00 53.63  ? 39   TYR T N     1 
ATOM   1659  C  CA    . TYR C  3  39   ? 252.307 255.060 139.292 1.00 48.51  ? 39   TYR T CA    1 
ATOM   1660  C  C     . TYR C  3  39   ? 253.489 255.999 139.501 1.00 54.30  ? 39   TYR T C     1 
ATOM   1661  O  O     . TYR C  3  39   ? 253.312 257.178 139.818 1.00 55.49  ? 39   TYR T O     1 
ATOM   1662  C  CB    . TYR C  3  39   ? 252.368 253.859 140.237 1.00 45.26  ? 39   TYR T CB    1 
ATOM   1663  C  CG    . TYR C  3  39   ? 251.140 252.985 140.139 1.00 46.69  ? 39   TYR T CG    1 
ATOM   1664  C  CD1   . TYR C  3  39   ? 249.871 253.548 140.083 1.00 51.96  ? 39   TYR T CD1   1 
ATOM   1665  C  CD2   . TYR C  3  39   ? 251.246 251.604 140.066 1.00 47.80  ? 39   TYR T CD2   1 
ATOM   1666  C  CE1   . TYR C  3  39   ? 248.743 252.758 139.982 1.00 52.48  ? 39   TYR T CE1   1 
ATOM   1667  C  CE2   . TYR C  3  39   ? 250.123 250.806 139.961 1.00 52.96  ? 39   TYR T CE2   1 
ATOM   1668  C  CZ    . TYR C  3  39   ? 248.875 251.390 139.920 1.00 57.12  ? 39   TYR T CZ    1 
ATOM   1669  O  OH    . TYR C  3  39   ? 247.752 250.603 139.819 1.00 58.20  ? 39   TYR T OH    1 
ATOM   1670  N  N     . ALA C  3  40   ? 254.704 255.486 139.332 1.00 55.34  ? 40   ALA T N     1 
ATOM   1671  C  CA    . ALA C  3  40   ? 255.902 256.307 139.275 1.00 54.23  ? 40   ALA T CA    1 
ATOM   1672  C  C     . ALA C  3  40   ? 256.692 255.933 138.029 1.00 62.14  ? 40   ALA T C     1 
ATOM   1673  O  O     . ALA C  3  40   ? 256.316 255.028 137.277 1.00 65.25  ? 40   ALA T O     1 
ATOM   1674  C  CB    . ALA C  3  40   ? 256.756 256.145 140.538 1.00 47.03  ? 40   ALA T CB    1 
ATOM   1675  N  N     . GLU C  3  41   ? 257.804 256.635 137.810 1.00 61.40  ? 41   GLU T N     1 
ATOM   1676  C  CA    . GLU C  3  41   ? 258.633 256.349 136.645 1.00 57.84  ? 41   GLU T CA    1 
ATOM   1677  C  C     . GLU C  3  41   ? 259.513 255.125 136.860 1.00 65.46  ? 41   GLU T C     1 
ATOM   1678  O  O     . GLU C  3  41   ? 259.818 254.410 135.899 1.00 76.22  ? 41   GLU T O     1 
ATOM   1679  C  CB    . GLU C  3  41   ? 259.485 257.570 136.299 1.00 53.79  ? 41   GLU T CB    1 
ATOM   1680  C  CG    . GLU C  3  41   ? 260.316 257.420 135.034 1.00 77.55  ? 41   GLU T CG    1 
ATOM   1681  C  CD    . GLU C  3  41   ? 261.092 258.676 134.692 1.00 89.61  ? 41   GLU T CD    1 
ATOM   1682  O  OE1   . GLU C  3  41   ? 261.009 259.654 135.465 1.00 84.54  ? 41   GLU T OE1   1 
ATOM   1683  O  OE2   . GLU C  3  41   ? 261.783 258.688 133.653 1.00 96.92  ? 41   GLU T OE2   1 
ATOM   1684  N  N     . ARG C  3  42   ? 259.918 254.864 138.100 1.00 60.89  ? 42   ARG T N     1 
ATOM   1685  C  CA    . ARG C  3  42   ? 260.758 253.726 138.427 1.00 64.31  ? 42   ARG T CA    1 
ATOM   1686  C  C     . ARG C  3  42   ? 260.180 253.002 139.636 1.00 60.95  ? 42   ARG T C     1 
ATOM   1687  O  O     . ARG C  3  42   ? 259.548 253.614 140.500 1.00 60.23  ? 42   ARG T O     1 
ATOM   1688  C  CB    . ARG C  3  42   ? 262.202 254.162 138.710 1.00 64.03  ? 42   ARG T CB    1 
ATOM   1689  C  CG    . ARG C  3  42   ? 262.890 254.791 137.507 1.00 69.75  ? 42   ARG T CG    1 
ATOM   1690  C  CD    . ARG C  3  42   ? 264.279 255.303 137.847 1.00 79.53  ? 42   ARG T CD    1 
ATOM   1691  N  NE    . ARG C  3  42   ? 265.187 254.226 138.223 1.00 86.46  ? 42   ARG T NE    1 
ATOM   1692  C  CZ    . ARG C  3  42   ? 266.436 254.414 138.635 1.00 90.12  ? 42   ARG T CZ    1 
ATOM   1693  N  NH1   . ARG C  3  42   ? 266.931 255.638 138.716 1.00 87.99  ? 42   ARG T NH1   1 
ATOM   1694  N  NH2   . ARG C  3  42   ? 267.196 253.377 138.958 1.00 89.87  ? 42   ARG T NH2   1 
ATOM   1695  N  N     . VAL C  3  43   ? 260.396 251.690 139.686 1.00 58.06  ? 43   VAL T N     1 
ATOM   1696  C  CA    . VAL C  3  43   ? 259.855 250.837 140.737 1.00 46.26  ? 43   VAL T CA    1 
ATOM   1697  C  C     . VAL C  3  43   ? 261.010 250.108 141.411 1.00 52.14  ? 43   VAL T C     1 
ATOM   1698  O  O     . VAL C  3  43   ? 261.873 249.543 140.730 1.00 53.73  ? 43   VAL T O     1 
ATOM   1699  C  CB    . VAL C  3  43   ? 258.825 249.837 140.183 1.00 37.07  ? 43   VAL T CB    1 
ATOM   1700  C  CG1   . VAL C  3  43   ? 258.343 248.903 141.281 1.00 35.80  ? 43   VAL T CG1   1 
ATOM   1701  C  CG2   . VAL C  3  43   ? 257.655 250.577 139.555 1.00 33.60  ? 43   VAL T CG2   1 
ATOM   1702  N  N     . GLY C  3  44   ? 261.020 250.121 142.740 1.00 42.84  ? 44   GLY T N     1 
ATOM   1703  C  CA    . GLY C  3  44   ? 262.067 249.456 143.486 1.00 44.21  ? 44   GLY T CA    1 
ATOM   1704  C  C     . GLY C  3  44   ? 261.914 247.948 143.484 1.00 44.37  ? 44   GLY T C     1 
ATOM   1705  O  O     . GLY C  3  44   ? 260.947 247.381 142.975 1.00 50.42  ? 44   GLY T O     1 
ATOM   1706  N  N     . ALA C  3  45   ? 262.907 247.285 144.073 1.00 46.26  ? 45   ALA T N     1 
ATOM   1707  C  CA    . ALA C  3  45   ? 262.943 245.830 144.121 1.00 47.28  ? 45   ALA T CA    1 
ATOM   1708  C  C     . ALA C  3  45   ? 262.208 245.247 145.321 1.00 48.45  ? 45   ALA T C     1 
ATOM   1709  O  O     . ALA C  3  45   ? 261.968 244.036 145.346 1.00 55.17  ? 45   ALA T O     1 
ATOM   1710  C  CB    . ALA C  3  45   ? 264.392 245.337 144.127 1.00 36.87  ? 45   ALA T CB    1 
ATOM   1711  N  N     . GLY C  3  46   ? 261.849 246.064 146.308 1.00 51.81  ? 46   GLY T N     1 
ATOM   1712  C  CA    . GLY C  3  46   ? 261.153 245.564 147.477 1.00 47.78  ? 46   GLY T CA    1 
ATOM   1713  C  C     . GLY C  3  46   ? 259.662 245.828 147.452 1.00 49.59  ? 46   GLY T C     1 
ATOM   1714  O  O     . GLY C  3  46   ? 258.907 245.260 148.251 1.00 63.94  ? 46   GLY T O     1 
ATOM   1715  N  N     . ALA C  3  47   ? 259.229 246.686 146.529 1.00 60.24  ? 47   ALA T N     1 
ATOM   1716  C  CA    . ALA C  3  47   ? 257.816 247.048 146.454 1.00 52.86  ? 47   ALA T CA    1 
ATOM   1717  C  C     . ALA C  3  47   ? 256.911 245.866 146.130 1.00 63.92  ? 47   ALA T C     1 
ATOM   1718  O  O     . ALA C  3  47   ? 255.915 245.669 146.849 1.00 70.19  ? 47   ALA T O     1 
ATOM   1719  C  CB    . ALA C  3  47   ? 257.627 248.189 145.448 1.00 29.49  ? 47   ALA T CB    1 
ATOM   1720  N  N     . PRO C  3  48   ? 257.168 245.054 145.098 1.00 45.82  ? 48   PRO T N     1 
ATOM   1721  C  CA    . PRO C  3  48   ? 256.255 243.932 144.835 1.00 41.80  ? 48   PRO T CA    1 
ATOM   1722  C  C     . PRO C  3  48   ? 256.266 242.881 145.928 1.00 49.18  ? 48   PRO T C     1 
ATOM   1723  O  O     . PRO C  3  48   ? 255.217 242.292 146.213 1.00 50.25  ? 48   PRO T O     1 
ATOM   1724  C  CB    . PRO C  3  48   ? 256.761 243.371 143.499 1.00 45.63  ? 48   PRO T CB    1 
ATOM   1725  C  CG    . PRO C  3  48   ? 258.195 243.728 143.477 1.00 49.48  ? 48   PRO T CG    1 
ATOM   1726  C  CD    . PRO C  3  48   ? 258.276 245.079 144.123 1.00 51.12  ? 48   PRO T CD    1 
ATOM   1727  N  N     . VAL C  3  49   ? 257.417 242.626 146.554 1.00 52.93  ? 49   VAL T N     1 
ATOM   1728  C  CA    . VAL C  3  49   ? 257.474 241.649 147.637 1.00 53.87  ? 49   VAL T CA    1 
ATOM   1729  C  C     . VAL C  3  49   ? 256.666 242.135 148.834 1.00 55.00  ? 49   VAL T C     1 
ATOM   1730  O  O     . VAL C  3  49   ? 255.791 241.424 149.344 1.00 63.49  ? 49   VAL T O     1 
ATOM   1731  C  CB    . VAL C  3  49   ? 258.935 241.366 148.022 1.00 59.05  ? 49   VAL T CB    1 
ATOM   1732  C  CG1   . VAL C  3  49   ? 258.994 240.439 149.225 1.00 61.18  ? 49   VAL T CG1   1 
ATOM   1733  C  CG2   . VAL C  3  49   ? 259.691 240.773 146.847 1.00 53.36  ? 49   VAL T CG2   1 
ATOM   1734  N  N     . TYR C  3  50   ? 256.947 243.355 149.295 1.00 55.67  ? 50   TYR T N     1 
ATOM   1735  C  CA    . TYR C  3  50   ? 256.251 243.894 150.460 1.00 57.20  ? 50   TYR T CA    1 
ATOM   1736  C  C     . TYR C  3  50   ? 254.753 243.993 150.202 1.00 57.06  ? 50   TYR T C     1 
ATOM   1737  O  O     . TYR C  3  50   ? 253.934 243.552 151.020 1.00 55.40  ? 50   TYR T O     1 
ATOM   1738  C  CB    . TYR C  3  50   ? 256.837 245.261 150.810 1.00 66.73  ? 50   TYR T CB    1 
ATOM   1739  C  CG    . TYR C  3  50   ? 256.228 245.914 152.027 1.00 62.73  ? 50   TYR T CG    1 
ATOM   1740  C  CD1   . TYR C  3  50   ? 256.677 245.603 153.301 1.00 63.95  ? 50   TYR T CD1   1 
ATOM   1741  C  CD2   . TYR C  3  50   ? 255.202 246.833 151.900 1.00 64.22  ? 50   TYR T CD2   1 
ATOM   1742  C  CE1   . TYR C  3  50   ? 256.123 246.199 154.414 1.00 60.28  ? 50   TYR T CE1   1 
ATOM   1743  C  CE2   . TYR C  3  50   ? 254.642 247.432 153.003 1.00 63.00  ? 50   TYR T CE2   1 
ATOM   1744  C  CZ    . TYR C  3  50   ? 255.105 247.113 154.258 1.00 63.39  ? 50   TYR T CZ    1 
ATOM   1745  O  OH    . TYR C  3  50   ? 254.546 247.712 155.359 1.00 71.45  ? 50   TYR T OH    1 
ATOM   1746  N  N     . LEU C  3  51   ? 254.378 244.560 149.053 1.00 48.61  ? 51   LEU T N     1 
ATOM   1747  C  CA    . LEU C  3  51   ? 252.968 244.720 148.721 1.00 43.25  ? 51   LEU T CA    1 
ATOM   1748  C  C     . LEU C  3  51   ? 252.264 243.373 148.612 1.00 43.46  ? 51   LEU T C     1 
ATOM   1749  O  O     . LEU C  3  51   ? 251.153 243.200 149.132 1.00 43.64  ? 51   LEU T O     1 
ATOM   1750  C  CB    . LEU C  3  51   ? 252.835 245.511 147.421 1.00 39.58  ? 51   LEU T CB    1 
ATOM   1751  C  CG    . LEU C  3  51   ? 251.433 245.696 146.856 1.00 38.69  ? 51   LEU T CG    1 
ATOM   1752  C  CD1   . LEU C  3  51   ? 250.561 246.397 147.867 1.00 25.04  ? 51   LEU T CD1   1 
ATOM   1753  C  CD2   . LEU C  3  51   ? 251.516 246.508 145.584 1.00 38.54  ? 51   LEU T CD2   1 
ATOM   1754  N  N     . ALA C  3  52   ? 252.896 242.405 147.944 1.00 54.02  ? 52   ALA T N     1 
ATOM   1755  C  CA    . ALA C  3  52   ? 252.308 241.075 147.841 1.00 53.81  ? 52   ALA T CA    1 
ATOM   1756  C  C     . ALA C  3  52   ? 252.124 240.449 149.216 1.00 61.81  ? 52   ALA T C     1 
ATOM   1757  O  O     . ALA C  3  52   ? 251.130 239.756 149.462 1.00 50.27  ? 52   ALA T O     1 
ATOM   1758  C  CB    . ALA C  3  52   ? 253.177 240.183 146.955 1.00 44.47  ? 52   ALA T CB    1 
ATOM   1759  N  N     . ALA C  3  53   ? 253.069 240.687 150.128 1.00 58.37  ? 53   ALA T N     1 
ATOM   1760  C  CA    . ALA C  3  53   ? 252.920 240.168 151.484 1.00 38.26  ? 53   ALA T CA    1 
ATOM   1761  C  C     . ALA C  3  53   ? 251.729 240.804 152.190 1.00 48.12  ? 53   ALA T C     1 
ATOM   1762  O  O     . ALA C  3  53   ? 250.951 240.108 152.859 1.00 60.69  ? 53   ALA T O     1 
ATOM   1763  C  CB    . ALA C  3  53   ? 254.201 240.402 152.280 1.00 42.95  ? 53   ALA T CB    1 
ATOM   1764  N  N     . VAL C  3  54   ? 251.567 242.122 152.055 1.00 62.49  ? 54   VAL T N     1 
ATOM   1765  C  CA    . VAL C  3  54   ? 250.427 242.797 152.673 1.00 60.18  ? 54   VAL T CA    1 
ATOM   1766  C  C     . VAL C  3  54   ? 249.118 242.228 152.137 1.00 60.20  ? 54   VAL T C     1 
ATOM   1767  O  O     . VAL C  3  54   ? 248.195 241.910 152.900 1.00 64.50  ? 54   VAL T O     1 
ATOM   1768  C  CB    . VAL C  3  54   ? 250.515 244.316 152.447 1.00 45.16  ? 54   VAL T CB    1 
ATOM   1769  C  CG1   . VAL C  3  54   ? 249.273 245.004 152.986 1.00 45.95  ? 54   VAL T CG1   1 
ATOM   1770  C  CG2   . VAL C  3  54   ? 251.764 244.875 153.103 1.00 46.00  ? 54   VAL T CG2   1 
ATOM   1771  N  N     . LEU C  3  55   ? 249.024 242.089 150.811 1.00 53.85  ? 55   LEU T N     1 
ATOM   1772  C  CA    . LEU C  3  55   ? 247.829 241.498 150.215 1.00 51.24  ? 55   LEU T CA    1 
ATOM   1773  C  C     . LEU C  3  55   ? 247.599 240.083 150.734 1.00 61.31  ? 55   LEU T C     1 
ATOM   1774  O  O     . LEU C  3  55   ? 246.451 239.666 150.931 1.00 54.96  ? 55   LEU T O     1 
ATOM   1775  C  CB    . LEU C  3  55   ? 247.949 241.498 148.693 1.00 48.75  ? 55   LEU T CB    1 
ATOM   1776  C  CG    . LEU C  3  55   ? 248.020 242.866 148.019 1.00 55.17  ? 55   LEU T CG    1 
ATOM   1777  C  CD1   . LEU C  3  55   ? 248.266 242.707 146.529 1.00 54.86  ? 55   LEU T CD1   1 
ATOM   1778  C  CD2   . LEU C  3  55   ? 246.747 243.643 148.273 1.00 46.69  ? 55   LEU T CD2   1 
ATOM   1779  N  N     . GLU C  3  56   ? 248.680 239.333 150.969 1.00 67.12  ? 56   GLU T N     1 
ATOM   1780  C  CA    . GLU C  3  56   ? 248.527 237.984 151.504 1.00 67.38  ? 56   GLU T CA    1 
ATOM   1781  C  C     . GLU C  3  56   ? 247.967 238.012 152.917 1.00 70.00  ? 56   GLU T C     1 
ATOM   1782  O  O     . GLU C  3  56   ? 247.140 237.169 153.278 1.00 66.36  ? 56   GLU T O     1 
ATOM   1783  C  CB    . GLU C  3  56   ? 249.860 237.237 151.480 1.00 63.86  ? 56   GLU T CB    1 
ATOM   1784  C  CG    . GLU C  3  56   ? 249.736 235.791 151.950 1.00 71.97  ? 56   GLU T CG    1 
ATOM   1785  C  CD    . GLU C  3  56   ? 251.036 235.026 151.856 1.00 96.11  ? 56   GLU T CD    1 
ATOM   1786  O  OE1   . GLU C  3  56   ? 252.039 235.621 151.419 1.00 100.63 ? 56   GLU T OE1   1 
ATOM   1787  O  OE2   . GLU C  3  56   ? 251.060 233.831 152.223 1.00 103.51 ? 56   GLU T OE2   1 
ATOM   1788  N  N     . TYR C  3  57   ? 248.409 238.970 153.733 1.00 73.71  ? 57   TYR T N     1 
ATOM   1789  C  CA    . TYR C  3  57   ? 247.873 239.074 155.086 1.00 69.69  ? 57   TYR T CA    1 
ATOM   1790  C  C     . TYR C  3  57   ? 246.390 239.425 155.058 1.00 71.06  ? 57   TYR T C     1 
ATOM   1791  O  O     . TYR C  3  57   ? 245.579 238.788 155.742 1.00 66.02  ? 57   TYR T O     1 
ATOM   1792  C  CB    . TYR C  3  57   ? 248.652 240.106 155.897 1.00 65.06  ? 57   TYR T CB    1 
ATOM   1793  C  CG    . TYR C  3  57   ? 248.063 240.311 157.269 1.00 73.13  ? 57   TYR T CG    1 
ATOM   1794  C  CD1   . TYR C  3  57   ? 248.290 239.393 158.285 1.00 71.03  ? 57   TYR T CD1   1 
ATOM   1795  C  CD2   . TYR C  3  57   ? 247.259 241.408 157.548 1.00 84.86  ? 57   TYR T CD2   1 
ATOM   1796  C  CE1   . TYR C  3  57   ? 247.743 239.568 159.542 1.00 79.28  ? 57   TYR T CE1   1 
ATOM   1797  C  CE2   . TYR C  3  57   ? 246.708 241.591 158.800 1.00 84.23  ? 57   TYR T CE2   1 
ATOM   1798  C  CZ    . TYR C  3  57   ? 246.953 240.669 159.794 1.00 86.61  ? 57   TYR T CZ    1 
ATOM   1799  O  OH    . TYR C  3  57   ? 246.409 240.845 161.044 1.00 83.23  ? 57   TYR T OH    1 
ATOM   1800  N  N     . LEU C  3  58   ? 246.019 240.437 154.271 1.00 64.83  ? 58   LEU T N     1 
ATOM   1801  C  CA    . LEU C  3  58   ? 244.616 240.843 154.215 1.00 66.44  ? 58   LEU T CA    1 
ATOM   1802  C  C     . LEU C  3  58   ? 243.734 239.706 153.709 1.00 70.30  ? 58   LEU T C     1 
ATOM   1803  O  O     . LEU C  3  58   ? 242.710 239.373 154.324 1.00 66.03  ? 58   LEU T O     1 
ATOM   1804  C  CB    . LEU C  3  58   ? 244.463 242.080 153.332 1.00 58.43  ? 58   LEU T CB    1 
ATOM   1805  C  CG    . LEU C  3  58   ? 245.154 243.346 153.839 1.00 58.52  ? 58   LEU T CG    1 
ATOM   1806  C  CD1   . LEU C  3  58   ? 245.032 244.463 152.821 1.00 56.20  ? 58   LEU T CD1   1 
ATOM   1807  C  CD2   . LEU C  3  58   ? 244.578 243.772 155.176 1.00 44.98  ? 58   LEU T CD2   1 
ATOM   1808  N  N     . THR C  3  59   ? 244.127 239.086 152.593 1.00 59.41  ? 59   THR T N     1 
ATOM   1809  C  CA    . THR C  3  59   ? 243.348 237.983 152.041 1.00 62.20  ? 59   THR T CA    1 
ATOM   1810  C  C     . THR C  3  59   ? 243.251 236.826 153.028 1.00 66.43  ? 59   THR T C     1 
ATOM   1811  O  O     . THR C  3  59   ? 242.186 236.218 153.184 1.00 67.95  ? 59   THR T O     1 
ATOM   1812  C  CB    . THR C  3  59   ? 243.966 237.521 150.725 1.00 82.57  ? 59   THR T CB    1 
ATOM   1813  O  OG1   . THR C  3  59   ? 243.941 238.599 149.782 1.00 80.66  ? 59   THR T OG1   1 
ATOM   1814  C  CG2   . THR C  3  59   ? 243.198 236.346 150.158 1.00 77.93  ? 59   THR T CG2   1 
ATOM   1815  N  N     . ALA C  3  60   ? 244.353 236.521 153.718 1.00 55.16  ? 60   ALA T N     1 
ATOM   1816  C  CA    . ALA C  3  60   ? 244.336 235.447 154.704 1.00 54.87  ? 60   ALA T CA    1 
ATOM   1817  C  C     . ALA C  3  60   ? 243.370 235.751 155.840 1.00 58.36  ? 60   ALA T C     1 
ATOM   1818  O  O     . ALA C  3  60   ? 242.660 234.857 156.318 1.00 52.62  ? 60   ALA T O     1 
ATOM   1819  C  CB    . ALA C  3  60   ? 245.745 235.215 155.246 1.00 49.52  ? 60   ALA T CB    1 
ATOM   1820  N  N     . GLU C  3  61   ? 243.317 237.009 156.283 1.00 47.81  ? 61   GLU T N     1 
ATOM   1821  C  CA    . GLU C  3  61   ? 242.404 237.364 157.365 1.00 52.04  ? 61   GLU T CA    1 
ATOM   1822  C  C     . GLU C  3  61   ? 240.949 237.272 156.918 1.00 58.72  ? 61   GLU T C     1 
ATOM   1823  O  O     . GLU C  3  61   ? 240.126 236.635 157.589 1.00 62.18  ? 61   GLU T O     1 
ATOM   1824  C  CB    . GLU C  3  61   ? 242.723 238.766 157.887 1.00 59.25  ? 61   GLU T CB    1 
ATOM   1825  C  CG    . GLU C  3  61   ? 244.070 238.877 158.579 1.00 79.32  ? 61   GLU T CG    1 
ATOM   1826  C  CD    . GLU C  3  61   ? 244.198 237.943 159.767 1.00 86.51  ? 61   GLU T CD    1 
ATOM   1827  O  OE1   . GLU C  3  61   ? 243.204 237.776 160.504 1.00 90.43  ? 61   GLU T OE1   1 
ATOM   1828  O  OE2   . GLU C  3  61   ? 245.292 237.373 159.963 1.00 83.79  ? 61   GLU T OE2   1 
ATOM   1829  N  N     . ILE C  3  62   ? 240.614 237.894 155.785 1.00 55.39  ? 62   ILE T N     1 
ATOM   1830  C  CA    . ILE C  3  62   ? 239.215 237.910 155.354 1.00 57.56  ? 62   ILE T CA    1 
ATOM   1831  C  C     . ILE C  3  62   ? 238.737 236.501 155.020 1.00 50.70  ? 62   ILE T C     1 
ATOM   1832  O  O     . ILE C  3  62   ? 237.584 236.142 155.288 1.00 43.81  ? 62   ILE T O     1 
ATOM   1833  C  CB    . ILE C  3  62   ? 239.022 238.884 154.176 1.00 48.72  ? 62   ILE T CB    1 
ATOM   1834  C  CG1   . ILE C  3  62   ? 237.545 238.960 153.774 1.00 49.25  ? 62   ILE T CG1   1 
ATOM   1835  C  CG2   . ILE C  3  62   ? 239.880 238.494 152.994 1.00 70.90  ? 62   ILE T CG2   1 
ATOM   1836  C  CD1   . ILE C  3  62   ? 237.232 240.075 152.800 1.00 72.71  ? 62   ILE T CD1   1 
ATOM   1837  N  N     . LEU C  3  63   ? 239.615 235.669 154.451 1.00 64.38  ? 63   LEU T N     1 
ATOM   1838  C  CA    . LEU C  3  63   ? 239.235 234.281 154.210 1.00 61.83  ? 63   LEU T CA    1 
ATOM   1839  C  C     . LEU C  3  63   ? 239.160 233.486 155.507 1.00 63.95  ? 63   LEU T C     1 
ATOM   1840  O  O     . LEU C  3  63   ? 238.414 232.504 155.584 1.00 68.94  ? 63   LEU T O     1 
ATOM   1841  C  CB    . LEU C  3  63   ? 240.208 233.612 153.242 1.00 46.43  ? 63   LEU T CB    1 
ATOM   1842  C  CG    . LEU C  3  63   ? 240.179 234.100 151.798 1.00 59.29  ? 63   LEU T CG    1 
ATOM   1843  C  CD1   . LEU C  3  63   ? 241.255 233.398 150.994 1.00 67.52  ? 63   LEU T CD1   1 
ATOM   1844  C  CD2   . LEU C  3  63   ? 238.808 233.868 151.188 1.00 47.11  ? 63   LEU T CD2   1 
ATOM   1845  N  N     . GLU C  3  64   ? 239.920 233.884 156.528 1.00 71.10  ? 64   GLU T N     1 
ATOM   1846  C  CA    . GLU C  3  64   ? 239.814 233.215 157.818 1.00 70.27  ? 64   GLU T CA    1 
ATOM   1847  C  C     . GLU C  3  64   ? 238.459 233.488 158.459 1.00 67.86  ? 64   GLU T C     1 
ATOM   1848  O  O     . GLU C  3  64   ? 237.766 232.558 158.894 1.00 80.74  ? 64   GLU T O     1 
ATOM   1849  C  CB    . GLU C  3  64   ? 240.948 233.665 158.741 1.00 78.10  ? 64   GLU T CB    1 
ATOM   1850  C  CG    . GLU C  3  64   ? 240.964 232.961 160.086 1.00 82.64  ? 64   GLU T CG    1 
ATOM   1851  C  CD    . GLU C  3  64   ? 242.129 233.393 160.955 1.00 99.30  ? 64   GLU T CD    1 
ATOM   1852  O  OE1   . GLU C  3  64   ? 242.901 234.273 160.522 1.00 99.14  ? 64   GLU T OE1   1 
ATOM   1853  O  OE2   . GLU C  3  64   ? 242.273 232.848 162.069 1.00 108.11 ? 64   GLU T OE2   1 
ATOM   1854  N  N     . LEU C  3  65   ? 238.057 234.760 158.515 1.00 78.48  ? 65   LEU T N     1 
ATOM   1855  C  CA    . LEU C  3  65   ? 236.748 235.088 159.070 1.00 76.25  ? 65   LEU T CA    1 
ATOM   1856  C  C     . LEU C  3  65   ? 235.628 234.490 158.229 1.00 74.01  ? 65   LEU T C     1 
ATOM   1857  O  O     . LEU C  3  65   ? 234.617 234.022 158.768 1.00 70.08  ? 65   LEU T O     1 
ATOM   1858  C  CB    . LEU C  3  65   ? 236.589 236.604 159.181 1.00 72.63  ? 65   LEU T CB    1 
ATOM   1859  C  CG    . LEU C  3  65   ? 237.543 237.301 160.152 1.00 65.72  ? 65   LEU T CG    1 
ATOM   1860  C  CD1   . LEU C  3  65   ? 237.360 238.806 160.086 1.00 70.44  ? 65   LEU T CD1   1 
ATOM   1861  C  CD2   . LEU C  3  65   ? 237.330 236.792 161.569 1.00 62.56  ? 65   LEU T CD2   1 
ATOM   1862  N  N     . ALA C  3  66   ? 235.788 234.495 156.903 1.00 74.13  ? 66   ALA T N     1 
ATOM   1863  C  CA    . ALA C  3  66   ? 234.782 233.885 156.039 1.00 79.68  ? 66   ALA T CA    1 
ATOM   1864  C  C     . ALA C  3  66   ? 234.659 232.392 156.306 1.00 86.36  ? 66   ALA T C     1 
ATOM   1865  O  O     . ALA C  3  66   ? 233.549 231.846 156.330 1.00 91.94  ? 66   ALA T O     1 
ATOM   1866  C  CB    . ALA C  3  66   ? 235.121 234.143 154.572 1.00 55.07  ? 66   ALA T CB    1 
ATOM   1867  N  N     . GLY C  3  67   ? 235.788 231.715 156.514 1.00 95.83  ? 67   GLY T N     1 
ATOM   1868  C  CA    . GLY C  3  67   ? 235.739 230.298 156.835 1.00 94.38  ? 67   GLY T CA    1 
ATOM   1869  C  C     . GLY C  3  67   ? 235.098 230.030 158.181 1.00 95.07  ? 67   GLY T C     1 
ATOM   1870  O  O     . GLY C  3  67   ? 234.358 229.056 158.342 1.00 88.60  ? 67   GLY T O     1 
ATOM   1871  N  N     . ASN C  3  68   ? 235.368 230.890 159.168 1.00 95.05  ? 68   ASN T N     1 
ATOM   1872  C  CA    . ASN C  3  68   ? 234.738 230.727 160.474 1.00 91.27  ? 68   ASN T CA    1 
ATOM   1873  C  C     . ASN C  3  68   ? 233.229 230.914 160.382 1.00 100.74 ? 68   ASN T C     1 
ATOM   1874  O  O     . ASN C  3  68   ? 232.462 230.151 160.983 1.00 103.87 ? 68   ASN T O     1 
ATOM   1875  C  CB    . ASN C  3  68   ? 235.342 231.706 161.478 1.00 88.80  ? 68   ASN T CB    1 
ATOM   1876  C  CG    . ASN C  3  68   ? 236.765 231.348 161.855 1.00 97.65  ? 68   ASN T CG    1 
ATOM   1877  O  OD1   . ASN C  3  68   ? 237.179 230.194 161.733 1.00 96.38  ? 68   ASN T OD1   1 
ATOM   1878  N  ND2   . ASN C  3  68   ? 237.521 232.333 162.321 1.00 94.01  ? 68   ASN T ND2   1 
ATOM   1879  N  N     . ALA C  3  69   ? 232.778 231.924 159.630 1.00 109.74 ? 69   ALA T N     1 
ATOM   1880  C  CA    . ALA C  3  69   ? 231.344 232.135 159.465 1.00 96.97  ? 69   ALA T CA    1 
ATOM   1881  C  C     . ALA C  3  69   ? 230.699 230.978 158.714 1.00 99.67  ? 69   ALA T C     1 
ATOM   1882  O  O     . ALA C  3  69   ? 229.599 230.533 159.070 1.00 104.34 ? 69   ALA T O     1 
ATOM   1883  C  CB    . ALA C  3  69   ? 231.087 233.456 158.742 1.00 90.47  ? 69   ALA T CB    1 
ATOM   1884  N  N     . ALA C  3  70   ? 231.364 230.477 157.670 1.00 78.35  ? 70   ALA T N     1 
ATOM   1885  C  CA    . ALA C  3  70   ? 230.840 229.330 156.938 1.00 96.13  ? 70   ALA T CA    1 
ATOM   1886  C  C     . ALA C  3  70   ? 230.721 228.110 157.840 1.00 105.23 ? 70   ALA T C     1 
ATOM   1887  O  O     . ALA C  3  70   ? 229.735 227.368 157.771 1.00 111.38 ? 70   ALA T O     1 
ATOM   1888  C  CB    . ALA C  3  70   ? 231.729 229.021 155.735 1.00 97.12  ? 70   ALA T CB    1 
ATOM   1889  N  N     . ARG C  3  71   ? 231.720 227.889 158.700 1.00 100.48 ? 71   ARG T N     1 
ATOM   1890  C  CA    . ARG C  3  71   ? 231.642 226.785 159.650 1.00 107.64 ? 71   ARG T CA    1 
ATOM   1891  C  C     . ARG C  3  71   ? 230.521 226.994 160.658 1.00 107.22 ? 71   ARG T C     1 
ATOM   1892  O  O     . ARG C  3  71   ? 229.888 226.023 161.091 1.00 107.73 ? 71   ARG T O     1 
ATOM   1893  C  CB    . ARG C  3  71   ? 232.983 226.617 160.365 1.00 104.18 ? 71   ARG T CB    1 
ATOM   1894  C  CG    . ARG C  3  71   ? 233.029 225.458 161.347 1.00 122.17 ? 71   ARG T CG    1 
ATOM   1895  C  CD    . ARG C  3  71   ? 234.372 225.394 162.049 1.00 130.68 ? 71   ARG T CD    1 
ATOM   1896  N  NE    . ARG C  3  71   ? 234.609 226.576 162.873 1.00 132.40 ? 71   ARG T NE    1 
ATOM   1897  C  CZ    . ARG C  3  71   ? 235.799 226.929 163.349 1.00 128.87 ? 71   ARG T CZ    1 
ATOM   1898  N  NH1   . ARG C  3  71   ? 236.867 226.190 163.084 1.00 127.58 ? 71   ARG T NH1   1 
ATOM   1899  N  NH2   . ARG C  3  71   ? 235.920 228.023 164.089 1.00 123.32 ? 71   ARG T NH2   1 
ATOM   1900  N  N     . ASP C  3  72   ? 230.253 228.246 161.037 1.00 99.65  ? 72   ASP T N     1 
ATOM   1901  C  CA    . ASP C  3  72   ? 229.168 228.512 161.976 1.00 109.05 ? 72   ASP T CA    1 
ATOM   1902  C  C     . ASP C  3  72   ? 227.803 228.301 161.334 1.00 120.60 ? 72   ASP T C     1 
ATOM   1903  O  O     . ASP C  3  72   ? 226.842 227.950 162.028 1.00 124.20 ? 72   ASP T O     1 
ATOM   1904  C  CB    . ASP C  3  72   ? 229.281 229.933 162.526 1.00 119.64 ? 72   ASP T CB    1 
ATOM   1905  C  CG    . ASP C  3  72   ? 230.466 230.105 163.454 1.00 132.49 ? 72   ASP T CG    1 
ATOM   1906  O  OD1   . ASP C  3  72   ? 231.017 229.081 163.909 1.00 127.77 ? 72   ASP T OD1   1 
ATOM   1907  O  OD2   . ASP C  3  72   ? 230.841 231.263 163.734 1.00 135.85 ? 72   ASP T OD2   1 
ATOM   1908  N  N     . ASN C  3  73   ? 227.694 228.508 160.024 1.00 112.55 ? 73   ASN T N     1 
ATOM   1909  C  CA    . ASN C  3  73   ? 226.435 228.321 159.313 1.00 105.93 ? 73   ASN T CA    1 
ATOM   1910  C  C     . ASN C  3  73   ? 226.253 226.905 158.786 1.00 98.60  ? 73   ASN T C     1 
ATOM   1911  O  O     . ASN C  3  73   ? 225.280 226.651 158.070 1.00 106.70 ? 73   ASN T O     1 
ATOM   1912  C  CB    . ASN C  3  73   ? 226.328 229.320 158.156 1.00 106.73 ? 73   ASN T CB    1 
ATOM   1913  C  CG    . ASN C  3  73   ? 226.112 230.741 158.635 1.00 123.95 ? 73   ASN T CG    1 
ATOM   1914  O  OD1   . ASN C  3  73   ? 225.008 231.114 159.027 1.00 133.10 ? 73   ASN T OD1   1 
ATOM   1915  N  ND2   . ASN C  3  73   ? 227.170 231.543 158.605 1.00 120.49 ? 73   ASN T ND2   1 
ATOM   1916  N  N     . LYS C  3  74   ? 227.172 225.991 159.107 1.00 111.17 ? 74   LYS T N     1 
ATOM   1917  C  CA    . LYS C  3  74   ? 227.082 224.587 158.698 1.00 116.19 ? 74   LYS T CA    1 
ATOM   1918  C  C     . LYS C  3  74   ? 227.117 224.446 157.176 1.00 105.75 ? 74   LYS T C     1 
ATOM   1919  O  O     . LYS C  3  74   ? 226.428 223.605 156.596 1.00 117.13 ? 74   LYS T O     1 
ATOM   1920  C  CB    . LYS C  3  74   ? 225.835 223.914 159.279 1.00 95.61  ? 74   LYS T CB    1 
ATOM   1921  C  CG    . LYS C  3  74   ? 225.855 223.782 160.792 1.00 104.06 ? 74   LYS T CG    1 
ATOM   1922  C  CD    . LYS C  3  74   ? 224.563 223.173 161.313 1.00 122.54 ? 74   LYS T CD    1 
ATOM   1923  C  CE    . LYS C  3  74   ? 224.597 223.021 162.824 1.00 132.21 ? 74   LYS T CE    1 
ATOM   1924  N  NZ    . LYS C  3  74   ? 223.318 222.475 163.356 1.00 135.77 ? 74   LYS T NZ    1 
ATOM   1925  N  N     . LYS C  3  75   ? 227.929 225.277 156.530 1.00 106.83 ? 75   LYS T N     1 
ATOM   1926  C  CA    . LYS C  3  75   ? 228.144 225.217 155.090 1.00 112.18 ? 75   LYS T CA    1 
ATOM   1927  C  C     . LYS C  3  75   ? 229.641 225.192 154.824 1.00 115.85 ? 75   LYS T C     1 
ATOM   1928  O  O     . LYS C  3  75   ? 230.376 226.046 155.329 1.00 124.25 ? 75   LYS T O     1 
ATOM   1929  C  CB    . LYS C  3  75   ? 227.497 226.408 154.378 1.00 124.77 ? 75   LYS T CB    1 
ATOM   1930  C  CG    . LYS C  3  75   ? 225.997 226.530 154.592 1.00 131.02 ? 75   LYS T CG    1 
ATOM   1931  C  CD    . LYS C  3  75   ? 225.260 225.318 154.048 1.00 141.00 ? 75   LYS T CD    1 
ATOM   1932  C  CE    . LYS C  3  75   ? 223.755 225.477 154.201 1.00 150.26 ? 75   LYS T CE    1 
ATOM   1933  N  NZ    . LYS C  3  75   ? 223.014 224.292 153.686 1.00 155.21 ? 75   LYS T NZ    1 
ATOM   1934  N  N     . THR C  3  76   ? 230.090 224.218 154.037 1.00 110.77 ? 76   THR T N     1 
ATOM   1935  C  CA    . THR C  3  76   ? 231.508 224.053 153.749 1.00 121.59 ? 76   THR T CA    1 
ATOM   1936  C  C     . THR C  3  76   ? 231.960 224.831 152.520 1.00 119.73 ? 76   THR T C     1 
ATOM   1937  O  O     . THR C  3  76   ? 233.130 224.728 152.138 1.00 110.54 ? 76   THR T O     1 
ATOM   1938  C  CB    . THR C  3  76   ? 231.842 222.570 153.564 1.00 123.57 ? 76   THR T CB    1 
ATOM   1939  O  OG1   . THR C  3  76   ? 231.068 222.034 152.485 1.00 120.62 ? 76   THR T OG1   1 
ATOM   1940  C  CG2   . THR C  3  76   ? 231.535 221.795 154.835 1.00 115.97 ? 76   THR T CG2   1 
ATOM   1941  N  N     . ARG C  3  77   ? 231.073 225.599 151.895 1.00 111.29 ? 77   ARG T N     1 
ATOM   1942  C  CA    . ARG C  3  77   ? 231.405 226.407 150.728 1.00 104.09 ? 77   ARG T CA    1 
ATOM   1943  C  C     . ARG C  3  77   ? 231.101 227.865 151.044 1.00 98.65  ? 77   ARG T C     1 
ATOM   1944  O  O     . ARG C  3  77   ? 229.971 228.200 151.409 1.00 111.69 ? 77   ARG T O     1 
ATOM   1945  C  CB    . ARG C  3  77   ? 230.628 225.943 149.496 1.00 100.22 ? 77   ARG T CB    1 
ATOM   1946  C  CG    . ARG C  3  77   ? 230.933 226.735 148.237 1.00 119.56 ? 77   ARG T CG    1 
ATOM   1947  C  CD    . ARG C  3  77   ? 230.336 226.076 147.005 1.00 125.27 ? 77   ARG T CD    1 
ATOM   1948  N  NE    . ARG C  3  77   ? 230.972 224.794 146.710 1.00 125.01 ? 77   ARG T NE    1 
ATOM   1949  C  CZ    . ARG C  3  77   ? 230.412 223.610 146.929 1.00 125.89 ? 77   ARG T CZ    1 
ATOM   1950  N  NH1   . ARG C  3  77   ? 229.195 223.537 147.449 1.00 112.81 ? 77   ARG T NH1   1 
ATOM   1951  N  NH2   . ARG C  3  77   ? 231.067 222.498 146.629 1.00 137.26 ? 77   ARG T NH2   1 
ATOM   1952  N  N     . ILE C  3  78   ? 232.109 228.724 150.902 1.00 87.39  ? 78   ILE T N     1 
ATOM   1953  C  CA    . ILE C  3  78   ? 231.953 230.133 151.241 1.00 87.54  ? 78   ILE T CA    1 
ATOM   1954  C  C     . ILE C  3  78   ? 231.081 230.820 150.201 1.00 82.12  ? 78   ILE T C     1 
ATOM   1955  O  O     . ILE C  3  78   ? 231.281 230.660 148.991 1.00 73.49  ? 78   ILE T O     1 
ATOM   1956  C  CB    . ILE C  3  78   ? 233.326 230.812 151.360 1.00 71.31  ? 78   ILE T CB    1 
ATOM   1957  C  CG1   . ILE C  3  78   ? 234.095 230.244 152.553 1.00 69.79  ? 78   ILE T CG1   1 
ATOM   1958  C  CG2   . ILE C  3  78   ? 233.172 232.317 151.493 1.00 58.05  ? 78   ILE T CG2   1 
ATOM   1959  C  CD1   . ILE C  3  78   ? 235.532 230.702 152.625 1.00 70.02  ? 78   ILE T CD1   1 
ATOM   1960  N  N     . ILE C  3  79   ? 230.109 231.590 150.670 1.00 73.62  ? 79   ILE T N     1 
ATOM   1961  C  CA    . ILE C  3  79   ? 229.181 232.311 149.805 1.00 73.17  ? 79   ILE T CA    1 
ATOM   1962  C  C     . ILE C  3  79   ? 229.299 233.791 150.137 1.00 83.57  ? 79   ILE T C     1 
ATOM   1963  O  O     . ILE C  3  79   ? 229.816 234.160 151.206 1.00 90.09  ? 79   ILE T O     1 
ATOM   1964  C  CB    . ILE C  3  79   ? 227.731 231.798 149.969 1.00 79.73  ? 79   ILE T CB    1 
ATOM   1965  C  CG1   . ILE C  3  79   ? 227.266 231.961 151.414 1.00 79.43  ? 79   ILE T CG1   1 
ATOM   1966  C  CG2   . ILE C  3  79   ? 227.627 230.348 149.522 1.00 76.86  ? 79   ILE T CG2   1 
ATOM   1967  C  CD1   . ILE C  3  79   ? 225.801 231.646 151.620 1.00 76.80  ? 79   ILE T CD1   1 
ATOM   1968  N  N     . PRO C  3  80   ? 228.857 234.673 149.235 1.00 86.81  ? 80   PRO T N     1 
ATOM   1969  C  CA    . PRO C  3  80   ? 228.932 236.117 149.521 1.00 68.86  ? 80   PRO T CA    1 
ATOM   1970  C  C     . PRO C  3  80   ? 228.302 236.527 150.838 1.00 70.11  ? 80   PRO T C     1 
ATOM   1971  O  O     . PRO C  3  80   ? 228.745 237.507 151.448 1.00 76.67  ? 80   PRO T O     1 
ATOM   1972  C  CB    . PRO C  3  80   ? 228.201 236.739 148.324 1.00 75.71  ? 80   PRO T CB    1 
ATOM   1973  C  CG    . PRO C  3  80   ? 228.424 235.778 147.222 1.00 79.76  ? 80   PRO T CG    1 
ATOM   1974  C  CD    . PRO C  3  80   ? 228.419 234.413 147.852 1.00 85.97  ? 80   PRO T CD    1 
ATOM   1975  N  N     . ARG C  3  81   ? 227.272 235.813 151.294 1.00 72.22  ? 81   ARG T N     1 
ATOM   1976  C  CA    . ARG C  3  81   ? 226.702 236.094 152.608 1.00 62.29  ? 81   ARG T CA    1 
ATOM   1977  C  C     . ARG C  3  81   ? 227.746 235.924 153.705 1.00 64.73  ? 81   ARG T C     1 
ATOM   1978  O  O     . ARG C  3  81   ? 227.805 236.723 154.648 1.00 66.79  ? 81   ARG T O     1 
ATOM   1979  C  CB    . ARG C  3  81   ? 225.500 235.183 152.865 1.00 59.90  ? 81   ARG T CB    1 
ATOM   1980  C  CG    . ARG C  3  81   ? 224.860 235.362 154.231 1.00 52.46  ? 81   ARG T CG    1 
ATOM   1981  C  CD    . ARG C  3  81   ? 224.331 236.772 154.416 1.00 59.58  ? 81   ARG T CD    1 
ATOM   1982  N  NE    . ARG C  3  81   ? 223.678 236.945 155.708 1.00 68.42  ? 81   ARG T NE    1 
ATOM   1983  C  CZ    . ARG C  3  81   ? 223.361 238.125 156.230 1.00 70.69  ? 81   ARG T CZ    1 
ATOM   1984  N  NH1   . ARG C  3  81   ? 223.637 239.241 155.567 1.00 80.96  ? 81   ARG T NH1   1 
ATOM   1985  N  NH2   . ARG C  3  81   ? 222.768 238.192 157.413 1.00 66.87  ? 81   ARG T NH2   1 
ATOM   1986  N  N     . HIS C  3  82   ? 228.584 234.892 153.591 1.00 55.01  ? 82   HIS T N     1 
ATOM   1987  C  CA    . HIS C  3  82   ? 229.621 234.669 154.592 1.00 55.58  ? 82   HIS T CA    1 
ATOM   1988  C  C     . HIS C  3  82   ? 230.694 235.748 154.536 1.00 60.73  ? 82   HIS T C     1 
ATOM   1989  O  O     . HIS C  3  82   ? 231.353 236.017 155.548 1.00 65.43  ? 82   HIS T O     1 
ATOM   1990  C  CB    . HIS C  3  82   ? 230.239 233.287 154.401 1.00 71.91  ? 82   HIS T CB    1 
ATOM   1991  C  CG    . HIS C  3  82   ? 229.260 232.167 154.559 1.00 82.13  ? 82   HIS T CG    1 
ATOM   1992  N  ND1   . HIS C  3  82   ? 229.523 230.883 154.133 1.00 83.52  ? 82   HIS T ND1   1 
ATOM   1993  C  CD2   . HIS C  3  82   ? 228.018 232.136 155.097 1.00 85.81  ? 82   HIS T CD2   1 
ATOM   1994  C  CE1   . HIS C  3  82   ? 228.484 230.111 154.402 1.00 85.71  ? 82   HIS T CE1   1 
ATOM   1995  N  NE2   . HIS C  3  82   ? 227.557 230.848 154.986 1.00 86.50  ? 82   HIS T NE2   1 
ATOM   1996  N  N     . LEU C  3  83   ? 230.891 236.369 153.372 1.00 46.71  ? 83   LEU T N     1 
ATOM   1997  C  CA    . LEU C  3  83   ? 231.806 237.502 153.291 1.00 56.44  ? 83   LEU T CA    1 
ATOM   1998  C  C     . LEU C  3  83   ? 231.191 238.746 153.916 1.00 49.62  ? 83   LEU T C     1 
ATOM   1999  O  O     . LEU C  3  83   ? 231.877 239.502 154.614 1.00 50.56  ? 83   LEU T O     1 
ATOM   2000  C  CB    . LEU C  3  83   ? 232.194 237.767 151.837 1.00 54.29  ? 83   LEU T CB    1 
ATOM   2001  C  CG    . LEU C  3  83   ? 233.008 236.672 151.150 1.00 57.80  ? 83   LEU T CG    1 
ATOM   2002  C  CD1   . LEU C  3  83   ? 233.215 237.003 149.683 1.00 57.60  ? 83   LEU T CD1   1 
ATOM   2003  C  CD2   . LEU C  3  83   ? 234.340 236.484 151.848 1.00 57.54  ? 83   LEU T CD2   1 
ATOM   2004  N  N     . GLN C  3  84   ? 229.897 238.973 153.679 1.00 61.06  ? 84   GLN T N     1 
ATOM   2005  C  CA    . GLN C  3  84   ? 229.207 240.093 154.306 1.00 58.62  ? 84   GLN T CA    1 
ATOM   2006  C  C     . GLN C  3  84   ? 229.273 239.985 155.825 1.00 56.64  ? 84   GLN T C     1 
ATOM   2007  O  O     . GLN C  3  84   ? 229.659 240.937 156.516 1.00 56.33  ? 84   GLN T O     1 
ATOM   2008  C  CB    . GLN C  3  84   ? 227.755 240.133 153.830 1.00 58.82  ? 84   GLN T CB    1 
ATOM   2009  C  CG    . GLN C  3  84   ? 226.982 241.377 154.226 1.00 58.21  ? 84   GLN T CG    1 
ATOM   2010  C  CD    . GLN C  3  84   ? 227.465 242.615 153.496 1.00 66.90  ? 84   GLN T CD    1 
ATOM   2011  O  OE1   . GLN C  3  84   ? 227.437 242.672 152.268 1.00 72.41  ? 84   GLN T OE1   1 
ATOM   2012  N  NE2   . GLN C  3  84   ? 227.898 243.614 154.246 1.00 69.57  ? 84   GLN T NE2   1 
ATOM   2013  N  N     . LEU C  3  85   ? 228.910 238.816 156.360 1.00 48.53  ? 85   LEU T N     1 
ATOM   2014  C  CA    . LEU C  3  85   ? 228.961 238.604 157.802 1.00 56.63  ? 85   LEU T CA    1 
ATOM   2015  C  C     . LEU C  3  85   ? 230.391 238.686 158.320 1.00 54.93  ? 85   LEU T C     1 
ATOM   2016  O  O     . LEU C  3  85   ? 230.660 239.335 159.337 1.00 55.25  ? 85   LEU T O     1 
ATOM   2017  C  CB    . LEU C  3  85   ? 228.346 237.248 158.150 1.00 58.18  ? 85   LEU T CB    1 
ATOM   2018  C  CG    . LEU C  3  85   ? 226.871 237.028 157.812 1.00 61.91  ? 85   LEU T CG    1 
ATOM   2019  C  CD1   . LEU C  3  85   ? 226.473 235.588 158.095 1.00 64.09  ? 85   LEU T CD1   1 
ATOM   2020  C  CD2   . LEU C  3  85   ? 225.989 237.985 158.589 1.00 53.15  ? 85   LEU T CD2   1 
ATOM   2021  N  N     . ALA C  3  86   ? 231.325 238.032 157.625 1.00 52.74  ? 86   ALA T N     1 
ATOM   2022  C  CA    . ALA C  3  86   ? 232.705 237.973 158.097 1.00 61.29  ? 86   ALA T CA    1 
ATOM   2023  C  C     . ALA C  3  86   ? 233.338 239.357 158.147 1.00 65.68  ? 86   ALA T C     1 
ATOM   2024  O  O     . ALA C  3  86   ? 234.140 239.648 159.041 1.00 77.92  ? 86   ALA T O     1 
ATOM   2025  C  CB    . ALA C  3  86   ? 233.523 237.047 157.200 1.00 60.28  ? 86   ALA T CB    1 
ATOM   2026  N  N     . VAL C  3  87   ? 232.994 240.220 157.195 1.00 68.46  ? 87   VAL T N     1 
ATOM   2027  C  CA    . VAL C  3  87   ? 233.519 241.581 157.198 1.00 66.77  ? 87   VAL T CA    1 
ATOM   2028  C  C     . VAL C  3  87   ? 232.812 242.428 158.248 1.00 69.64  ? 87   VAL T C     1 
ATOM   2029  O  O     . VAL C  3  87   ? 233.440 242.938 159.182 1.00 69.27  ? 87   VAL T O     1 
ATOM   2030  C  CB    . VAL C  3  87   ? 233.406 242.211 155.800 1.00 61.08  ? 87   VAL T CB    1 
ATOM   2031  C  CG1   . VAL C  3  87   ? 233.767 243.680 155.864 1.00 63.54  ? 87   VAL T CG1   1 
ATOM   2032  C  CG2   . VAL C  3  87   ? 234.322 241.493 154.826 1.00 59.93  ? 87   VAL T CG2   1 
ATOM   2033  N  N     . ARG C  3  88   ? 231.495 242.596 158.103 1.00 68.12  ? 88   ARG T N     1 
ATOM   2034  C  CA    . ARG C  3  88   ? 230.770 243.530 158.959 1.00 70.99  ? 88   ARG T CA    1 
ATOM   2035  C  C     . ARG C  3  88   ? 230.850 243.156 160.435 1.00 75.44  ? 88   ARG T C     1 
ATOM   2036  O  O     . ARG C  3  88   ? 230.766 244.039 161.296 1.00 86.68  ? 88   ARG T O     1 
ATOM   2037  C  CB    . ARG C  3  88   ? 229.312 243.622 158.516 1.00 80.26  ? 88   ARG T CB    1 
ATOM   2038  C  CG    . ARG C  3  88   ? 229.123 244.137 157.110 1.00 76.97  ? 88   ARG T CG    1 
ATOM   2039  C  CD    . ARG C  3  88   ? 229.453 245.614 157.008 1.00 71.31  ? 88   ARG T CD    1 
ATOM   2040  N  NE    . ARG C  3  88   ? 229.199 246.134 155.668 1.00 89.92  ? 88   ARG T NE    1 
ATOM   2041  C  CZ    . ARG C  3  88   ? 230.106 246.180 154.697 1.00 86.12  ? 88   ARG T CZ    1 
ATOM   2042  N  NH1   . ARG C  3  88   ? 231.335 245.735 154.915 1.00 75.32  ? 88   ARG T NH1   1 
ATOM   2043  N  NH2   . ARG C  3  88   ? 229.783 246.667 153.509 1.00 77.56  ? 88   ARG T NH2   1 
ATOM   2044  N  N     . ASN C  3  89   ? 231.006 241.869 160.755 1.00 74.28  ? 89   ASN T N     1 
ATOM   2045  C  CA    . ASN C  3  89   ? 231.161 241.492 162.157 1.00 77.02  ? 89   ASN T CA    1 
ATOM   2046  C  C     . ASN C  3  89   ? 232.513 241.906 162.723 1.00 81.53  ? 89   ASN T C     1 
ATOM   2047  O  O     . ASN C  3  89   ? 232.642 242.040 163.943 1.00 88.12  ? 89   ASN T O     1 
ATOM   2048  C  CB    . ASN C  3  89   ? 230.961 239.986 162.338 1.00 87.67  ? 89   ASN T CB    1 
ATOM   2049  C  CG    . ASN C  3  89   ? 229.512 239.570 162.196 1.00 86.54  ? 89   ASN T CG    1 
ATOM   2050  O  OD1   . ASN C  3  89   ? 228.602 240.377 162.391 1.00 87.05  ? 89   ASN T OD1   1 
ATOM   2051  N  ND2   . ASN C  3  89   ? 229.286 238.308 161.857 1.00 77.66  ? 89   ASN T ND2   1 
ATOM   2052  N  N     . ASP C  3  90   ? 233.514 242.116 161.872 1.00 93.60  ? 90   ASP T N     1 
ATOM   2053  C  CA    . ASP C  3  90   ? 234.818 242.580 162.316 1.00 81.54  ? 90   ASP T CA    1 
ATOM   2054  C  C     . ASP C  3  90   ? 234.877 244.099 162.248 1.00 82.53  ? 90   ASP T C     1 
ATOM   2055  O  O     . ASP C  3  90   ? 234.401 244.708 161.286 1.00 99.30  ? 90   ASP T O     1 
ATOM   2056  C  CB    . ASP C  3  90   ? 235.930 241.972 161.461 1.00 68.61  ? 90   ASP T CB    1 
ATOM   2057  C  CG    . ASP C  3  90   ? 237.313 242.385 161.924 1.00 95.48  ? 90   ASP T CG    1 
ATOM   2058  O  OD1   . ASP C  3  90   ? 237.712 241.982 163.036 1.00 107.11 ? 90   ASP T OD1   1 
ATOM   2059  O  OD2   . ASP C  3  90   ? 237.999 243.113 161.178 1.00 104.63 ? 90   ASP T OD2   1 
ATOM   2060  N  N     . GLU C  3  91   ? 235.461 244.710 163.280 1.00 99.87  ? 91   GLU T N     1 
ATOM   2061  C  CA    . GLU C  3  91   ? 235.458 246.166 163.378 1.00 97.45  ? 91   GLU T CA    1 
ATOM   2062  C  C     . GLU C  3  91   ? 236.396 246.797 162.354 1.00 94.36  ? 91   GLU T C     1 
ATOM   2063  O  O     . GLU C  3  91   ? 236.007 247.715 161.623 1.00 94.66  ? 91   GLU T O     1 
ATOM   2064  C  CB    . GLU C  3  91   ? 235.844 246.591 164.795 1.00 104.86 ? 91   GLU T CB    1 
ATOM   2065  C  CG    . GLU C  3  91   ? 235.815 248.093 165.028 1.00 137.36 ? 91   GLU T CG    1 
ATOM   2066  C  CD    . GLU C  3  91   ? 236.159 248.469 166.456 1.00 168.74 ? 91   GLU T CD    1 
ATOM   2067  O  OE1   . GLU C  3  91   ? 236.461 247.558 167.256 1.00 174.83 ? 91   GLU T OE1   1 
ATOM   2068  O  OE2   . GLU C  3  91   ? 236.127 249.673 166.781 1.00 174.61 ? 91   GLU T OE2   1 
ATOM   2069  N  N     . GLU C  3  92   ? 237.637 246.310 162.283 1.00 76.39  ? 92   GLU T N     1 
ATOM   2070  C  CA    . GLU C  3  92   ? 238.643 246.962 161.452 1.00 68.10  ? 92   GLU T CA    1 
ATOM   2071  C  C     . GLU C  3  92   ? 238.334 246.799 159.969 1.00 70.65  ? 92   GLU T C     1 
ATOM   2072  O  O     . GLU C  3  92   ? 238.413 247.764 159.199 1.00 74.59  ? 92   GLU T O     1 
ATOM   2073  C  CB    . GLU C  3  92   ? 240.028 246.410 161.791 1.00 76.37  ? 92   GLU T CB    1 
ATOM   2074  C  CG    . GLU C  3  92   ? 240.472 246.747 163.203 1.00 101.60 ? 92   GLU T CG    1 
ATOM   2075  C  CD    . GLU C  3  92   ? 241.811 246.136 163.562 1.00 117.89 ? 92   GLU T CD    1 
ATOM   2076  O  OE1   . GLU C  3  92   ? 242.315 245.300 162.784 1.00 129.03 ? 92   GLU T OE1   1 
ATOM   2077  O  OE2   . GLU C  3  92   ? 242.357 246.492 164.627 1.00 114.70 ? 92   GLU T OE2   1 
ATOM   2078  N  N     . LEU C  3  93   ? 237.975 245.583 159.548 1.00 74.70  ? 93   LEU T N     1 
ATOM   2079  C  CA    . LEU C  3  93   ? 237.603 245.377 158.152 1.00 66.77  ? 93   LEU T CA    1 
ATOM   2080  C  C     . LEU C  3  93   ? 236.345 246.152 157.791 1.00 82.46  ? 93   LEU T C     1 
ATOM   2081  O  O     . LEU C  3  93   ? 236.178 246.559 156.635 1.00 90.28  ? 93   LEU T O     1 
ATOM   2082  C  CB    . LEU C  3  93   ? 237.414 243.888 157.866 1.00 62.46  ? 93   LEU T CB    1 
ATOM   2083  C  CG    . LEU C  3  93   ? 238.677 243.032 157.946 1.00 72.88  ? 93   LEU T CG    1 
ATOM   2084  C  CD1   . LEU C  3  93   ? 238.335 241.563 157.777 1.00 69.48  ? 93   LEU T CD1   1 
ATOM   2085  C  CD2   . LEU C  3  93   ? 239.682 243.473 156.896 1.00 58.08  ? 93   LEU T CD2   1 
ATOM   2086  N  N     . ASN C  3  94   ? 235.451 246.371 158.757 1.00 73.03  ? 94   ASN T N     1 
ATOM   2087  C  CA    . ASN C  3  94   ? 234.299 247.230 158.507 1.00 70.38  ? 94   ASN T CA    1 
ATOM   2088  C  C     . ASN C  3  94   ? 234.727 248.680 158.335 1.00 76.51  ? 94   ASN T C     1 
ATOM   2089  O  O     . ASN C  3  94   ? 234.133 249.416 157.541 1.00 85.49  ? 94   ASN T O     1 
ATOM   2090  C  CB    . ASN C  3  94   ? 233.285 247.107 159.641 1.00 97.98  ? 94   ASN T CB    1 
ATOM   2091  C  CG    . ASN C  3  94   ? 231.986 247.820 159.336 1.00 106.04 ? 94   ASN T CG    1 
ATOM   2092  O  OD1   . ASN C  3  94   ? 231.589 247.944 158.178 1.00 110.05 ? 94   ASN T OD1   1 
ATOM   2093  N  ND2   . ASN C  3  94   ? 231.314 248.297 160.377 1.00 111.09 ? 94   ASN T ND2   1 
ATOM   2094  N  N     . LYS C  3  95   ? 235.751 249.109 159.073 1.00 77.42  ? 95   LYS T N     1 
ATOM   2095  C  CA    . LYS C  3  95   ? 236.249 250.469 158.904 1.00 70.40  ? 95   LYS T CA    1 
ATOM   2096  C  C     . LYS C  3  95   ? 236.947 250.645 157.563 1.00 78.04  ? 95   LYS T C     1 
ATOM   2097  O  O     . LYS C  3  95   ? 236.862 251.718 156.957 1.00 93.83  ? 95   LYS T O     1 
ATOM   2098  C  CB    . LYS C  3  95   ? 237.193 250.833 160.051 1.00 73.29  ? 95   LYS T CB    1 
ATOM   2099  C  CG    . LYS C  3  95   ? 237.695 252.265 160.003 1.00 88.68  ? 95   LYS T CG    1 
ATOM   2100  C  CD    . LYS C  3  95   ? 236.558 253.251 160.221 1.00 119.82 ? 95   LYS T CD    1 
ATOM   2101  C  CE    . LYS C  3  95   ? 237.047 254.689 160.164 1.00 135.62 ? 95   LYS T CE    1 
ATOM   2102  N  NZ    . LYS C  3  95   ? 237.999 254.997 161.267 1.00 140.02 ? 95   LYS T NZ    1 
ATOM   2103  N  N     . LEU C  3  96   ? 237.632 249.607 157.079 1.00 80.89  ? 96   LEU T N     1 
ATOM   2104  C  CA    . LEU C  3  96   ? 238.290 249.695 155.779 1.00 72.79  ? 96   LEU T CA    1 
ATOM   2105  C  C     . LEU C  3  96   ? 237.278 249.637 154.641 1.00 74.80  ? 96   LEU T C     1 
ATOM   2106  O  O     . LEU C  3  96   ? 237.352 250.423 153.689 1.00 80.97  ? 96   LEU T O     1 
ATOM   2107  C  CB    . LEU C  3  96   ? 239.319 248.573 155.640 1.00 81.34  ? 96   LEU T CB    1 
ATOM   2108  C  CG    . LEU C  3  96   ? 240.025 248.456 154.290 1.00 78.24  ? 96   LEU T CG    1 
ATOM   2109  C  CD1   . LEU C  3  96   ? 240.846 249.700 154.001 1.00 70.59  ? 96   LEU T CD1   1 
ATOM   2110  C  CD2   . LEU C  3  96   ? 240.896 247.212 154.248 1.00 72.87  ? 96   LEU T CD2   1 
ATOM   2111  N  N     . LEU C  3  97   ? 236.327 248.711 154.723 1.00 73.35  ? 97   LEU T N     1 
ATOM   2112  C  CA    . LEU C  3  97   ? 235.365 248.458 153.662 1.00 79.13  ? 97   LEU T CA    1 
ATOM   2113  C  C     . LEU C  3  97   ? 234.060 249.230 153.834 1.00 75.00  ? 97   LEU T C     1 
ATOM   2114  O  O     . LEU C  3  97   ? 233.102 248.962 153.108 1.00 58.48  ? 97   LEU T O     1 
ATOM   2115  C  CB    . LEU C  3  97   ? 235.077 246.959 153.558 1.00 60.12  ? 97   LEU T CB    1 
ATOM   2116  C  CG    . LEU C  3  97   ? 236.282 246.100 153.169 1.00 58.02  ? 97   LEU T CG    1 
ATOM   2117  C  CD1   . LEU C  3  97   ? 235.931 244.622 153.166 1.00 47.72  ? 97   LEU T CD1   1 
ATOM   2118  C  CD2   . LEU C  3  97   ? 236.829 246.522 151.818 1.00 59.14  ? 97   LEU T CD2   1 
ATOM   2119  N  N     . GLY C  3  98   ? 233.997 250.153 154.799 1.00 77.34  ? 98   GLY T N     1 
ATOM   2120  C  CA    . GLY C  3  98   ? 232.751 250.850 155.090 1.00 72.06  ? 98   GLY T CA    1 
ATOM   2121  C  C     . GLY C  3  98   ? 232.063 251.457 153.882 1.00 79.87  ? 98   GLY T C     1 
ATOM   2122  O  O     . GLY C  3  98   ? 230.835 251.574 153.857 1.00 86.80  ? 98   GLY T O     1 
ATOM   2123  N  N     . ARG C  3  99   ? 232.831 251.851 152.869 1.00 64.79  ? 99   ARG T N     1 
ATOM   2124  C  CA    . ARG C  3  99   ? 232.267 252.428 151.655 1.00 66.37  ? 99   ARG T CA    1 
ATOM   2125  C  C     . ARG C  3  99   ? 231.921 251.389 150.598 1.00 69.52  ? 99   ARG T C     1 
ATOM   2126  O  O     . ARG C  3  99   ? 231.512 251.766 149.496 1.00 78.39  ? 99   ARG T O     1 
ATOM   2127  C  CB    . ARG C  3  99   ? 233.240 253.446 151.055 1.00 56.48  ? 99   ARG T CB    1 
ATOM   2128  C  CG    . ARG C  3  99   ? 233.455 254.685 151.899 1.00 76.02  ? 99   ARG T CG    1 
ATOM   2129  C  CD    . ARG C  3  99   ? 234.387 255.657 151.199 1.00 101.74 ? 99   ARG T CD    1 
ATOM   2130  N  NE    . ARG C  3  99   ? 234.621 256.863 151.986 1.00 130.63 ? 99   ARG T NE    1 
ATOM   2131  C  CZ    . ARG C  3  99   ? 233.830 257.930 151.973 1.00 150.81 ? 99   ARG T CZ    1 
ATOM   2132  N  NH1   . ARG C  3  99   ? 232.747 257.948 151.208 1.00 156.95 ? 99   ARG T NH1   1 
ATOM   2133  N  NH2   . ARG C  3  99   ? 234.126 258.985 152.721 1.00 154.45 ? 99   ARG T NH2   1 
ATOM   2134  N  N     . VAL C  3  100  ? 232.079 250.104 150.895 1.00 83.46  ? 100  VAL T N     1 
ATOM   2135  C  CA    . VAL C  3  100  ? 231.930 249.042 149.905 1.00 81.04  ? 100  VAL T CA    1 
ATOM   2136  C  C     . VAL C  3  100  ? 230.521 248.473 149.967 1.00 82.14  ? 100  VAL T C     1 
ATOM   2137  O  O     . VAL C  3  100  ? 229.953 248.300 151.053 1.00 83.68  ? 100  VAL T O     1 
ATOM   2138  C  CB    . VAL C  3  100  ? 232.975 247.934 150.123 1.00 55.94  ? 100  VAL T CB    1 
ATOM   2139  C  CG1   . VAL C  3  100  ? 232.739 246.796 149.161 1.00 58.74  ? 100  VAL T CG1   1 
ATOM   2140  C  CG2   . VAL C  3  100  ? 234.377 248.489 149.963 1.00 54.86  ? 100  VAL T CG2   1 
ATOM   2141  N  N     . THR C  3  101  ? 229.956 248.185 148.797 1.00 52.68  ? 101  THR T N     1 
ATOM   2142  C  CA    . THR C  3  101  ? 228.707 247.443 148.663 1.00 49.67  ? 101  THR T CA    1 
ATOM   2143  C  C     . THR C  3  101  ? 229.037 246.082 148.064 1.00 58.46  ? 101  THR T C     1 
ATOM   2144  O  O     . THR C  3  101  ? 229.465 245.995 146.909 1.00 58.82  ? 101  THR T O     1 
ATOM   2145  C  CB    . THR C  3  101  ? 227.708 248.196 147.788 1.00 57.32  ? 101  THR T CB    1 
ATOM   2146  O  OG1   . THR C  3  101  ? 227.350 249.431 148.419 1.00 66.43  ? 101  THR T OG1   1 
ATOM   2147  C  CG2   . THR C  3  101  ? 226.463 247.356 147.554 1.00 44.68  ? 101  THR T CG2   1 
ATOM   2148  N  N     . ILE C  3  102  ? 228.845 245.026 148.845 1.00 50.04  ? 102  ILE T N     1 
ATOM   2149  C  CA    . ILE C  3  102  ? 229.146 243.669 148.405 1.00 50.67  ? 102  ILE T CA    1 
ATOM   2150  C  C     . ILE C  3  102  ? 227.903 243.074 147.759 1.00 54.90  ? 102  ILE T C     1 
ATOM   2151  O  O     . ILE C  3  102  ? 226.814 243.098 148.344 1.00 65.92  ? 102  ILE T O     1 
ATOM   2152  C  CB    . ILE C  3  102  ? 229.626 242.805 149.583 1.00 52.85  ? 102  ILE T CB    1 
ATOM   2153  C  CG1   . ILE C  3  102  ? 230.968 243.318 150.103 1.00 51.06  ? 102  ILE T CG1   1 
ATOM   2154  C  CG2   . ILE C  3  102  ? 229.736 241.352 149.168 1.00 39.38  ? 102  ILE T CG2   1 
ATOM   2155  C  CD1   . ILE C  3  102  ? 231.407 242.670 151.393 1.00 48.12  ? 102  ILE T CD1   1 
ATOM   2156  N  N     . ALA C  3  103  ? 228.064 242.539 146.552 1.00 49.14  ? 103  ALA T N     1 
ATOM   2157  C  CA    . ALA C  3  103  ? 226.946 241.925 145.852 1.00 54.81  ? 103  ALA T CA    1 
ATOM   2158  C  C     . ALA C  3  103  ? 226.513 240.645 146.555 1.00 67.47  ? 103  ALA T C     1 
ATOM   2159  O  O     . ALA C  3  103  ? 227.345 239.863 147.024 1.00 80.24  ? 103  ALA T O     1 
ATOM   2160  C  CB    . ALA C  3  103  ? 227.324 241.626 144.401 1.00 50.86  ? 103  ALA T CB    1 
ATOM   2161  N  N     . GLN C  3  104  ? 225.198 240.441 146.634 1.00 67.82  ? 104  GLN T N     1 
ATOM   2162  C  CA    . GLN C  3  104  ? 224.588 239.289 147.299 1.00 73.20  ? 104  GLN T CA    1 
ATOM   2163  C  C     . GLN C  3  104  ? 224.978 239.200 148.769 1.00 67.70  ? 104  GLN T C     1 
ATOM   2164  O  O     . GLN C  3  104  ? 224.935 238.118 149.362 1.00 72.81  ? 104  GLN T O     1 
ATOM   2165  C  CB    . GLN C  3  104  ? 224.940 237.980 146.583 1.00 50.45  ? 104  GLN T CB    1 
ATOM   2166  C  CG    . GLN C  3  104  ? 224.384 237.867 145.175 1.00 69.02  ? 104  GLN T CG    1 
ATOM   2167  C  CD    . GLN C  3  104  ? 222.871 237.936 145.140 1.00 86.57  ? 104  GLN T CD    1 
ATOM   2168  O  OE1   . GLN C  3  104  ? 222.193 237.388 146.009 1.00 85.17  ? 104  GLN T OE1   1 
ATOM   2169  N  NE2   . GLN C  3  104  ? 222.334 238.609 144.131 1.00 93.49  ? 104  GLN T NE2   1 
ATOM   2170  N  N     . GLY C  3  105  ? 225.360 240.324 149.368 1.00 75.86  ? 105  GLY T N     1 
ATOM   2171  C  CA    . GLY C  3  105  ? 225.820 240.326 150.741 1.00 72.19  ? 105  GLY T CA    1 
ATOM   2172  C  C     . GLY C  3  105  ? 224.716 240.228 151.773 1.00 71.98  ? 105  GLY T C     1 
ATOM   2173  O  O     . GLY C  3  105  ? 224.807 239.434 152.713 1.00 77.71  ? 105  GLY T O     1 
ATOM   2174  N  N     . GLY C  3  106  ? 223.666 241.025 151.606 1.00 65.64  ? 106  GLY T N     1 
ATOM   2175  C  CA    . GLY C  3  106  ? 222.635 241.101 152.621 1.00 57.88  ? 106  GLY T CA    1 
ATOM   2176  C  C     . GLY C  3  106  ? 222.998 242.100 153.705 1.00 71.59  ? 106  GLY T C     1 
ATOM   2177  O  O     . GLY C  3  106  ? 223.882 242.947 153.545 1.00 68.24  ? 106  GLY T O     1 
ATOM   2178  N  N     . VAL C  3  107  ? 222.295 241.994 154.829 1.00 56.27  ? 107  VAL T N     1 
ATOM   2179  C  CA    . VAL C  3  107  ? 222.478 242.890 155.962 1.00 55.13  ? 107  VAL T CA    1 
ATOM   2180  C  C     . VAL C  3  107  ? 222.604 242.055 157.226 1.00 59.95  ? 107  VAL T C     1 
ATOM   2181  O  O     . VAL C  3  107  ? 221.935 241.026 157.369 1.00 69.51  ? 107  VAL T O     1 
ATOM   2182  C  CB    . VAL C  3  107  ? 221.309 243.894 156.085 1.00 57.91  ? 107  VAL T CB    1 
ATOM   2183  C  CG1   . VAL C  3  107  ? 221.477 244.777 157.312 1.00 54.87  ? 107  VAL T CG1   1 
ATOM   2184  C  CG2   . VAL C  3  107  ? 221.204 244.745 154.828 1.00 58.47  ? 107  VAL T CG2   1 
ATOM   2185  N  N     . LEU C  3  108  ? 223.484 242.486 158.131 1.00 62.28  ? 108  LEU T N     1 
ATOM   2186  C  CA    . LEU C  3  108  ? 223.560 241.860 159.441 1.00 63.90  ? 108  LEU T CA    1 
ATOM   2187  C  C     . LEU C  3  108  ? 222.185 241.894 160.104 1.00 69.10  ? 108  LEU T C     1 
ATOM   2188  O  O     . LEU C  3  108  ? 221.503 242.925 160.058 1.00 82.38  ? 108  LEU T O     1 
ATOM   2189  C  CB    . LEU C  3  108  ? 224.566 242.584 160.334 1.00 53.59  ? 108  LEU T CB    1 
ATOM   2190  C  CG    . LEU C  3  108  ? 226.044 242.627 159.967 1.00 58.06  ? 108  LEU T CG    1 
ATOM   2191  C  CD1   . LEU C  3  108  ? 226.781 243.504 160.964 1.00 52.47  ? 108  LEU T CD1   1 
ATOM   2192  C  CD2   . LEU C  3  108  ? 226.630 241.233 159.948 1.00 69.76  ? 108  LEU T CD2   1 
ATOM   2193  N  N     . PRO C  3  109  ? 221.739 240.797 160.712 1.00 82.47  ? 109  PRO T N     1 
ATOM   2194  C  CA    . PRO C  3  109  ? 220.465 240.843 161.446 1.00 87.25  ? 109  PRO T CA    1 
ATOM   2195  C  C     . PRO C  3  109  ? 220.565 241.840 162.589 1.00 85.41  ? 109  PRO T C     1 
ATOM   2196  O  O     . PRO C  3  109  ? 221.461 241.756 163.435 1.00 96.23  ? 109  PRO T O     1 
ATOM   2197  C  CB    . PRO C  3  109  ? 220.299 239.406 161.948 1.00 73.17  ? 109  PRO T CB    1 
ATOM   2198  C  CG    . PRO C  3  109  ? 221.104 238.582 160.996 1.00 67.43  ? 109  PRO T CG    1 
ATOM   2199  C  CD    . PRO C  3  109  ? 222.290 239.434 160.647 1.00 72.67  ? 109  PRO T CD    1 
ATOM   2200  N  N     . ASN C  3  110  ? 219.637 242.790 162.614 1.00 107.36 ? 110  ASN T N     1 
ATOM   2201  C  CA    . ASN C  3  110  ? 219.644 243.813 163.646 1.00 107.96 ? 110  ASN T CA    1 
ATOM   2202  C  C     . ASN C  3  110  ? 218.221 244.305 163.863 1.00 101.90 ? 110  ASN T C     1 
ATOM   2203  O  O     . ASN C  3  110  ? 217.458 244.465 162.906 1.00 105.14 ? 110  ASN T O     1 
ATOM   2204  C  CB    . ASN C  3  110  ? 220.564 244.978 163.256 1.00 111.83 ? 110  ASN T CB    1 
ATOM   2205  C  CG    . ASN C  3  110  ? 220.802 245.951 164.398 1.00 127.37 ? 110  ASN T CG    1 
ATOM   2206  O  OD1   . ASN C  3  110  ? 220.037 246.005 165.361 1.00 128.52 ? 110  ASN T OD1   1 
ATOM   2207  N  ND2   . ASN C  3  110  ? 221.871 246.731 164.290 1.00 128.29 ? 110  ASN T ND2   1 
ATOM   2208  N  N     . ILE C  3  111  ? 217.879 244.552 165.125 1.00 118.65 ? 111  ILE T N     1 
ATOM   2209  C  CA    . ILE C  3  111  ? 216.615 245.171 165.506 1.00 115.67 ? 111  ILE T CA    1 
ATOM   2210  C  C     . ILE C  3  111  ? 216.896 246.111 166.666 1.00 126.32 ? 111  ILE T C     1 
ATOM   2211  O  O     . ILE C  3  111  ? 217.551 245.722 167.639 1.00 122.95 ? 111  ILE T O     1 
ATOM   2212  C  CB    . ILE C  3  111  ? 215.545 244.133 165.898 1.00 121.21 ? 111  ILE T CB    1 
ATOM   2213  C  CG1   . ILE C  3  111  ? 215.129 243.291 164.693 1.00 125.23 ? 111  ILE T CG1   1 
ATOM   2214  C  CG2   . ILE C  3  111  ? 214.332 244.820 166.503 1.00 116.35 ? 111  ILE T CG2   1 
ATOM   2215  C  CD1   . ILE C  3  111  ? 214.250 242.112 165.042 1.00 123.62 ? 111  ILE T CD1   1 
ATOM   2216  N  N     . GLN C  3  112  ? 216.409 247.344 166.567 1.00 133.91 ? 112  GLN T N     1 
ATOM   2217  C  CA    . GLN C  3  112  ? 216.574 248.296 167.656 1.00 126.55 ? 112  GLN T CA    1 
ATOM   2218  C  C     . GLN C  3  112  ? 215.774 247.833 168.868 1.00 134.18 ? 112  GLN T C     1 
ATOM   2219  O  O     . GLN C  3  112  ? 214.613 247.436 168.743 1.00 141.29 ? 112  GLN T O     1 
ATOM   2220  C  CB    . GLN C  3  112  ? 216.134 249.689 167.215 1.00 115.64 ? 112  GLN T CB    1 
ATOM   2221  C  CG    . GLN C  3  112  ? 216.991 250.277 166.103 1.00 109.12 ? 112  GLN T CG    1 
ATOM   2222  C  CD    . GLN C  3  112  ? 218.421 250.530 166.536 1.00 119.26 ? 112  GLN T CD    1 
ATOM   2223  O  OE1   . GLN C  3  112  ? 219.321 249.746 166.236 1.00 117.64 ? 112  GLN T OE1   1 
ATOM   2224  N  NE2   . GLN C  3  112  ? 218.638 251.629 167.248 1.00 123.04 ? 112  GLN T NE2   1 
ATOM   2225  N  N     . SER C  3  113  ? 216.406 247.878 170.044 1.00 131.79 ? 113  SER T N     1 
ATOM   2226  C  CA    . SER C  3  113  ? 215.804 247.317 171.249 1.00 138.39 ? 113  SER T CA    1 
ATOM   2227  C  C     . SER C  3  113  ? 214.479 247.978 171.607 1.00 139.73 ? 113  SER T C     1 
ATOM   2228  O  O     . SER C  3  113  ? 213.660 247.361 172.297 1.00 145.49 ? 113  SER T O     1 
ATOM   2229  C  CB    . SER C  3  113  ? 216.775 247.434 172.422 1.00 148.23 ? 113  SER T CB    1 
ATOM   2230  O  OG    . SER C  3  113  ? 217.939 246.657 172.199 1.00 153.76 ? 113  SER T OG    1 
ATOM   2231  N  N     . VAL C  3  114  ? 214.245 249.212 171.155 1.00 127.93 ? 114  VAL T N     1 
ATOM   2232  C  CA    . VAL C  3  114  ? 212.987 249.882 171.453 1.00 124.20 ? 114  VAL T CA    1 
ATOM   2233  C  C     . VAL C  3  114  ? 211.835 249.291 170.649 1.00 129.72 ? 114  VAL T C     1 
ATOM   2234  O  O     . VAL C  3  114  ? 210.679 249.360 171.081 1.00 143.24 ? 114  VAL T O     1 
ATOM   2235  C  CB    . VAL C  3  114  ? 213.127 251.398 171.206 1.00 101.95 ? 114  VAL T CB    1 
ATOM   2236  C  CG1   . VAL C  3  114  ? 213.394 251.679 169.734 1.00 103.78 ? 114  VAL T CG1   1 
ATOM   2237  C  CG2   . VAL C  3  114  ? 211.896 252.150 171.695 1.00 109.80 ? 114  VAL T CG2   1 
ATOM   2238  N  N     . LEU C  3  115  ? 212.122 248.686 169.495 1.00 131.79 ? 115  LEU T N     1 
ATOM   2239  C  CA    . LEU C  3  115  ? 211.077 248.131 168.644 1.00 138.07 ? 115  LEU T CA    1 
ATOM   2240  C  C     . LEU C  3  115  ? 210.568 246.778 169.122 1.00 143.91 ? 115  LEU T C     1 
ATOM   2241  O  O     . LEU C  3  115  ? 209.528 246.322 168.640 1.00 140.51 ? 115  LEU T O     1 
ATOM   2242  C  CB    . LEU C  3  115  ? 211.584 248.000 167.206 1.00 118.48 ? 115  LEU T CB    1 
ATOM   2243  C  CG    . LEU C  3  115  ? 211.932 249.305 166.489 1.00 110.62 ? 115  LEU T CG    1 
ATOM   2244  C  CD1   . LEU C  3  115  ? 212.533 249.024 165.122 1.00 116.00 ? 115  LEU T CD1   1 
ATOM   2245  C  CD2   . LEU C  3  115  ? 210.704 250.192 166.365 1.00 113.74 ? 115  LEU T CD2   1 
ATOM   2246  N  N     . LEU C  3  116  ? 211.265 246.130 170.052 1.00 149.60 ? 116  LEU T N     1 
ATOM   2247  C  CA    . LEU C  3  116  ? 210.830 244.821 170.517 1.00 147.01 ? 116  LEU T CA    1 
ATOM   2248  C  C     . LEU C  3  116  ? 209.678 244.967 171.509 1.00 158.29 ? 116  LEU T C     1 
ATOM   2249  O  O     . LEU C  3  116  ? 209.659 245.908 172.308 1.00 152.83 ? 116  LEU T O     1 
ATOM   2250  C  CB    . LEU C  3  116  ? 211.988 244.071 171.171 1.00 148.74 ? 116  LEU T CB    1 
ATOM   2251  C  CG    . LEU C  3  116  ? 213.153 243.712 170.245 1.00 150.32 ? 116  LEU T CG    1 
ATOM   2252  C  CD1   . LEU C  3  116  ? 214.294 243.089 171.035 1.00 143.51 ? 116  LEU T CD1   1 
ATOM   2253  C  CD2   . LEU C  3  116  ? 212.688 242.777 169.142 1.00 165.17 ? 116  LEU T CD2   1 
ATOM   2254  N  N     . PRO C  3  117  ? 208.708 244.059 171.476 1.00 155.01 ? 117  PRO T N     1 
ATOM   2255  C  CA    . PRO C  3  117  ? 207.580 244.144 172.410 1.00 157.30 ? 117  PRO T CA    1 
ATOM   2256  C  C     . PRO C  3  117  ? 208.022 243.939 173.851 1.00 166.43 ? 117  PRO T C     1 
ATOM   2257  O  O     . PRO C  3  117  ? 209.099 243.414 174.138 1.00 157.39 ? 117  PRO T O     1 
ATOM   2258  C  CB    . PRO C  3  117  ? 206.656 243.009 171.954 1.00 146.21 ? 117  PRO T CB    1 
ATOM   2259  C  CG    . PRO C  3  117  ? 207.012 242.791 170.520 1.00 141.71 ? 117  PRO T CG    1 
ATOM   2260  C  CD    . PRO C  3  117  ? 208.497 243.020 170.457 1.00 148.66 ? 117  PRO T CD    1 
ATOM   2261  N  N     . LYS C  3  118  ? 207.157 244.368 174.764 1.00 161.12 ? 118  LYS T N     1 
ATOM   2262  C  CA    . LYS C  3  118  ? 207.418 244.234 176.194 1.00 166.01 ? 118  LYS T CA    1 
ATOM   2263  C  C     . LYS C  3  118  ? 206.114 244.129 176.972 1.00 165.96 ? 118  LYS T C     1 
ATOM   2264  O  O     . LYS C  3  118  ? 205.028 244.223 176.401 1.00 165.64 ? 118  LYS T O     1 
ATOM   2265  C  CB    . LYS C  3  118  ? 208.243 245.418 176.699 1.00 159.36 ? 118  LYS T CB    1 
ATOM   2266  N  N     . THR D  4  29   ? 242.368 234.939 123.583 1.00 143.97 ? 29   THR U N     1 
ATOM   2267  C  CA    . THR D  4  29   ? 242.448 235.921 124.658 1.00 145.92 ? 29   THR U CA    1 
ATOM   2268  C  C     . THR D  4  29   ? 242.502 235.242 126.021 1.00 142.90 ? 29   THR U C     1 
ATOM   2269  O  O     . THR D  4  29   ? 241.627 234.450 126.365 1.00 140.85 ? 29   THR U O     1 
ATOM   2270  C  CB    . THR D  4  29   ? 241.252 236.889 124.628 1.00 136.45 ? 29   THR U CB    1 
ATOM   2271  O  OG1   . THR D  4  29   ? 241.247 237.609 123.389 1.00 144.10 ? 29   THR U OG1   1 
ATOM   2272  C  CG2   . THR D  4  29   ? 241.335 237.876 125.783 1.00 126.22 ? 29   THR U CG2   1 
ATOM   2273  N  N     . ARG D  4  30   ? 243.538 235.558 126.792 1.00 144.01 ? 30   ARG U N     1 
ATOM   2274  C  CA    . ARG D  4  30   ? 243.732 235.008 128.129 1.00 135.30 ? 30   ARG U CA    1 
ATOM   2275  C  C     . ARG D  4  30   ? 243.613 236.140 129.140 1.00 131.94 ? 30   ARG U C     1 
ATOM   2276  O  O     . ARG D  4  30   ? 244.437 237.060 129.152 1.00 132.80 ? 30   ARG U O     1 
ATOM   2277  C  CB    . ARG D  4  30   ? 245.088 234.314 128.242 1.00 148.64 ? 30   ARG U CB    1 
ATOM   2278  C  CG    . ARG D  4  30   ? 245.223 233.070 127.381 1.00 149.40 ? 30   ARG U CG    1 
ATOM   2279  C  CD    . ARG D  4  30   ? 246.608 232.457 127.509 1.00 151.83 ? 30   ARG U CD    1 
ATOM   2280  N  NE    . ARG D  4  30   ? 246.742 231.248 126.703 1.00 154.48 ? 30   ARG U NE    1 
ATOM   2281  C  CZ    . ARG D  4  30   ? 247.047 231.245 125.408 1.00 152.28 ? 30   ARG U CZ    1 
ATOM   2282  N  NH1   . ARG D  4  30   ? 247.252 232.387 124.769 1.00 155.23 ? 30   ARG U NH1   1 
ATOM   2283  N  NH2   . ARG D  4  30   ? 247.149 230.096 124.754 1.00 140.36 ? 30   ARG U NH2   1 
ATOM   2284  N  N     . LYS D  4  31   ? 242.584 236.076 129.982 1.00 137.29 ? 31   LYS U N     1 
ATOM   2285  C  CA    . LYS D  4  31   ? 242.363 237.065 131.030 1.00 125.97 ? 31   LYS U CA    1 
ATOM   2286  C  C     . LYS D  4  31   ? 242.809 236.462 132.357 1.00 130.21 ? 31   LYS U C     1 
ATOM   2287  O  O     . LYS D  4  31   ? 242.158 235.557 132.888 1.00 137.77 ? 31   LYS U O     1 
ATOM   2288  C  CB    . LYS D  4  31   ? 240.897 237.488 131.079 1.00 113.58 ? 31   LYS U CB    1 
ATOM   2289  N  N     . GLU D  4  32   ? 243.918 236.967 132.889 1.00 107.30 ? 32   GLU U N     1 
ATOM   2290  C  CA    . GLU D  4  32   ? 244.474 236.461 134.133 1.00 94.23  ? 32   GLU U CA    1 
ATOM   2291  C  C     . GLU D  4  32   ? 243.695 236.991 135.331 1.00 95.55  ? 32   GLU U C     1 
ATOM   2292  O  O     . GLU D  4  32   ? 243.026 238.026 135.266 1.00 97.16  ? 32   GLU U O     1 
ATOM   2293  C  CB    . GLU D  4  32   ? 245.945 236.848 134.255 1.00 84.35  ? 32   GLU U CB    1 
ATOM   2294  C  CG    . GLU D  4  32   ? 246.172 238.343 134.311 1.00 92.88  ? 32   GLU U CG    1 
ATOM   2295  C  CD    . GLU D  4  32   ? 247.639 238.707 134.305 1.00 105.32 ? 32   GLU U CD    1 
ATOM   2296  O  OE1   . GLU D  4  32   ? 248.475 237.822 134.582 1.00 96.31  ? 32   GLU U OE1   1 
ATOM   2297  O  OE2   . GLU D  4  32   ? 247.955 239.881 134.020 1.00 107.64 ? 32   GLU U OE2   1 
ATOM   2298  N  N     . SER D  4  33   ? 243.791 236.263 136.440 1.00 84.40  ? 33   SER U N     1 
ATOM   2299  C  CA    . SER D  4  33   ? 243.139 236.659 137.680 1.00 83.11  ? 33   SER U CA    1 
ATOM   2300  C  C     . SER D  4  33   ? 243.959 236.146 138.856 1.00 75.97  ? 33   SER U C     1 
ATOM   2301  O  O     . SER D  4  33   ? 244.985 235.481 138.687 1.00 83.56  ? 33   SER U O     1 
ATOM   2302  C  CB    . SER D  4  33   ? 241.700 236.138 137.734 1.00 83.23  ? 33   SER U CB    1 
ATOM   2303  O  OG    . SER D  4  33   ? 241.083 236.480 138.960 1.00 76.29  ? 33   SER U OG    1 
ATOM   2304  N  N     . TYR D  4  34   ? 243.494 236.467 140.060 1.00 57.72  ? 34   TYR U N     1 
ATOM   2305  C  CA    . TYR D  4  34   ? 244.102 236.025 141.306 1.00 62.70  ? 34   TYR U CA    1 
ATOM   2306  C  C     . TYR D  4  34   ? 243.462 234.758 141.856 1.00 67.58  ? 34   TYR U C     1 
ATOM   2307  O  O     . TYR D  4  34   ? 243.782 234.356 142.979 1.00 60.04  ? 34   TYR U O     1 
ATOM   2308  C  CB    . TYR D  4  34   ? 244.030 237.140 142.354 1.00 48.28  ? 34   TYR U CB    1 
ATOM   2309  C  CG    . TYR D  4  34   ? 244.832 238.372 142.000 1.00 59.94  ? 34   TYR U CG    1 
ATOM   2310  C  CD1   . TYR D  4  34   ? 246.168 238.481 142.363 1.00 58.72  ? 34   TYR U CD1   1 
ATOM   2311  C  CD2   . TYR D  4  34   ? 244.255 239.422 141.302 1.00 54.28  ? 34   TYR U CD2   1 
ATOM   2312  C  CE1   . TYR D  4  34   ? 246.905 239.604 142.042 1.00 58.59  ? 34   TYR U CE1   1 
ATOM   2313  C  CE2   . TYR D  4  34   ? 244.984 240.548 140.978 1.00 51.68  ? 34   TYR U CE2   1 
ATOM   2314  C  CZ    . TYR D  4  34   ? 246.308 240.634 141.349 1.00 63.34  ? 34   TYR U CZ    1 
ATOM   2315  O  OH    . TYR D  4  34   ? 247.035 241.754 141.027 1.00 70.64  ? 34   TYR U OH    1 
ATOM   2316  N  N     . ALA D  4  35   ? 242.555 234.137 141.095 1.00 58.37  ? 35   ALA U N     1 
ATOM   2317  C  CA    . ALA D  4  35   ? 241.713 233.063 141.614 1.00 57.95  ? 35   ALA U CA    1 
ATOM   2318  C  C     . ALA D  4  35   ? 242.526 231.951 142.270 1.00 66.39  ? 35   ALA U C     1 
ATOM   2319  O  O     . ALA D  4  35   ? 242.258 231.565 143.413 1.00 71.86  ? 35   ALA U O     1 
ATOM   2320  C  CB    . ALA D  4  35   ? 240.847 232.496 140.488 1.00 72.66  ? 35   ALA U CB    1 
ATOM   2321  N  N     . ILE D  4  36   ? 243.522 231.418 141.559 1.00 68.24  ? 36   ILE U N     1 
ATOM   2322  C  CA    . ILE D  4  36   ? 244.264 230.271 142.077 1.00 75.88  ? 36   ILE U CA    1 
ATOM   2323  C  C     . ILE D  4  36   ? 245.039 230.639 143.334 1.00 69.15  ? 36   ILE U C     1 
ATOM   2324  O  O     . ILE D  4  36   ? 245.290 229.784 144.191 1.00 61.81  ? 36   ILE U O     1 
ATOM   2325  C  CB    . ILE D  4  36   ? 245.195 229.698 140.990 1.00 76.39  ? 36   ILE U CB    1 
ATOM   2326  C  CG1   . ILE D  4  36   ? 246.215 230.745 140.548 1.00 75.84  ? 36   ILE U CG1   1 
ATOM   2327  C  CG2   . ILE D  4  36   ? 244.385 229.212 139.801 1.00 92.74  ? 36   ILE U CG2   1 
ATOM   2328  C  CD1   . ILE D  4  36   ? 247.283 230.199 139.632 1.00 81.37  ? 36   ILE U CD1   1 
ATOM   2329  N  N     . TYR D  4  37   ? 245.417 231.908 143.474 1.00 57.06  ? 37   TYR U N     1 
ATOM   2330  C  CA    . TYR D  4  37   ? 246.193 232.339 144.632 1.00 59.35  ? 37   TYR U CA    1 
ATOM   2331  C  C     . TYR D  4  37   ? 245.313 232.456 145.870 1.00 65.70  ? 37   TYR U C     1 
ATOM   2332  O  O     . TYR D  4  37   ? 245.682 231.980 146.951 1.00 65.19  ? 37   TYR U O     1 
ATOM   2333  C  CB    . TYR D  4  37   ? 246.879 233.665 144.307 1.00 73.99  ? 37   TYR U CB    1 
ATOM   2334  C  CG    . TYR D  4  37   ? 247.838 233.537 143.151 1.00 73.91  ? 37   TYR U CG    1 
ATOM   2335  C  CD1   . TYR D  4  37   ? 248.757 232.500 143.105 1.00 77.06  ? 37   TYR U CD1   1 
ATOM   2336  C  CD2   . TYR D  4  37   ? 247.781 234.408 142.074 1.00 63.81  ? 37   TYR U CD2   1 
ATOM   2337  C  CE1   . TYR D  4  37   ? 249.626 232.361 142.044 1.00 77.17  ? 37   TYR U CE1   1 
ATOM   2338  C  CE2   . TYR D  4  37   ? 248.639 234.273 141.002 1.00 70.20  ? 37   TYR U CE2   1 
ATOM   2339  C  CZ    . TYR D  4  37   ? 249.562 233.250 140.995 1.00 80.91  ? 37   TYR U CZ    1 
ATOM   2340  O  OH    . TYR D  4  37   ? 250.424 233.113 139.933 1.00 87.28  ? 37   TYR U OH    1 
ATOM   2341  N  N     . VAL D  4  38   ? 244.144 233.085 145.724 1.00 64.74  ? 38   VAL U N     1 
ATOM   2342  C  CA    . VAL D  4  38   ? 243.153 233.076 146.794 1.00 60.26  ? 38   VAL U CA    1 
ATOM   2343  C  C     . VAL D  4  38   ? 242.780 231.646 147.154 1.00 54.80  ? 38   VAL U C     1 
ATOM   2344  O  O     . VAL D  4  38   ? 242.526 231.333 148.323 1.00 64.97  ? 38   VAL U O     1 
ATOM   2345  C  CB    . VAL D  4  38   ? 241.917 233.899 146.372 1.00 59.33  ? 38   VAL U CB    1 
ATOM   2346  C  CG1   . VAL D  4  38   ? 240.833 233.831 147.433 1.00 51.58  ? 38   VAL U CG1   1 
ATOM   2347  C  CG2   . VAL D  4  38   ? 242.313 235.339 146.098 1.00 47.83  ? 38   VAL U CG2   1 
ATOM   2348  N  N     . TYR D  4  39   ? 242.760 230.754 146.161 1.00 62.74  ? 39   TYR U N     1 
ATOM   2349  C  CA    . TYR D  4  39   ? 242.492 229.345 146.425 1.00 69.86  ? 39   TYR U CA    1 
ATOM   2350  C  C     . TYR D  4  39   ? 243.590 228.725 147.282 1.00 72.20  ? 39   TYR U C     1 
ATOM   2351  O  O     . TYR D  4  39   ? 243.300 227.995 148.240 1.00 76.29  ? 39   TYR U O     1 
ATOM   2352  C  CB    . TYR D  4  39   ? 242.349 228.600 145.097 1.00 90.48  ? 39   TYR U CB    1 
ATOM   2353  C  CG    . TYR D  4  39   ? 242.107 227.117 145.225 1.00 102.94 ? 39   TYR U CG    1 
ATOM   2354  C  CD1   . TYR D  4  39   ? 240.847 226.625 145.536 1.00 100.77 ? 39   TYR U CD1   1 
ATOM   2355  C  CD2   . TYR D  4  39   ? 243.135 226.207 145.023 1.00 119.34 ? 39   TYR U CD2   1 
ATOM   2356  C  CE1   . TYR D  4  39   ? 240.619 225.269 145.644 1.00 113.81 ? 39   TYR U CE1   1 
ATOM   2357  C  CE2   . TYR D  4  39   ? 242.919 224.848 145.134 1.00 123.52 ? 39   TYR U CE2   1 
ATOM   2358  C  CZ    . TYR D  4  39   ? 241.658 224.386 145.444 1.00 125.65 ? 39   TYR U CZ    1 
ATOM   2359  O  OH    . TYR D  4  39   ? 241.437 223.031 145.557 1.00 129.57 ? 39   TYR U OH    1 
ATOM   2360  N  N     . LYS D  4  40   ? 244.855 229.013 146.965 1.00 58.80  ? 40   LYS U N     1 
ATOM   2361  C  CA    . LYS D  4  40   ? 245.961 228.470 147.747 1.00 59.37  ? 40   LYS U CA    1 
ATOM   2362  C  C     . LYS D  4  40   ? 245.930 228.986 149.180 1.00 63.39  ? 40   LYS U C     1 
ATOM   2363  O  O     . LYS D  4  40   ? 246.083 228.214 150.135 1.00 66.67  ? 40   LYS U O     1 
ATOM   2364  C  CB    . LYS D  4  40   ? 247.296 228.811 147.087 1.00 48.31  ? 40   LYS U CB    1 
ATOM   2365  C  CG    . LYS D  4  40   ? 247.533 228.123 145.756 1.00 60.55  ? 40   LYS U CG    1 
ATOM   2366  C  CD    . LYS D  4  40   ? 248.841 228.585 145.134 1.00 73.98  ? 40   LYS U CD    1 
ATOM   2367  C  CE    . LYS D  4  40   ? 249.104 227.884 143.812 1.00 82.25  ? 40   LYS U CE    1 
ATOM   2368  N  NZ    . LYS D  4  40   ? 250.353 228.377 143.168 1.00 88.86  ? 40   LYS U NZ    1 
ATOM   2369  N  N     . VAL D  4  41   ? 245.742 230.298 149.350 1.00 67.72  ? 41   VAL U N     1 
ATOM   2370  C  CA    . VAL D  4  41   ? 245.680 230.868 150.694 1.00 62.68  ? 41   VAL U CA    1 
ATOM   2371  C  C     . VAL D  4  41   ? 244.510 230.277 151.469 1.00 67.85  ? 41   VAL U C     1 
ATOM   2372  O  O     . VAL D  4  41   ? 244.614 229.998 152.672 1.00 77.13  ? 41   VAL U O     1 
ATOM   2373  C  CB    . VAL D  4  41   ? 245.600 232.403 150.619 1.00 68.82  ? 41   VAL U CB    1 
ATOM   2374  C  CG1   . VAL D  4  41   ? 245.449 232.997 152.009 1.00 56.82  ? 41   VAL U CG1   1 
ATOM   2375  C  CG2   . VAL D  4  41   ? 246.833 232.962 149.930 1.00 58.18  ? 41   VAL U CG2   1 
ATOM   2376  N  N     . LEU D  4  42   ? 243.378 230.068 150.791 1.00 63.54  ? 42   LEU U N     1 
ATOM   2377  C  CA    . LEU D  4  42   ? 242.235 229.433 151.439 1.00 65.70  ? 42   LEU U CA    1 
ATOM   2378  C  C     . LEU D  4  42   ? 242.579 228.022 151.898 1.00 71.01  ? 42   LEU U C     1 
ATOM   2379  O  O     . LEU D  4  42   ? 242.195 227.613 153.000 1.00 70.70  ? 42   LEU U O     1 
ATOM   2380  C  CB    . LEU D  4  42   ? 241.038 229.409 150.490 1.00 66.30  ? 42   LEU U CB    1 
ATOM   2381  C  CG    . LEU D  4  42   ? 239.802 228.686 151.026 1.00 68.07  ? 42   LEU U CG    1 
ATOM   2382  C  CD1   . LEU D  4  42   ? 239.269 229.381 152.265 1.00 65.16  ? 42   LEU U CD1   1 
ATOM   2383  C  CD2   . LEU D  4  42   ? 238.730 228.593 149.958 1.00 63.15  ? 42   LEU U CD2   1 
ATOM   2384  N  N     . LYS D  4  43   ? 243.300 227.266 151.070 1.00 71.38  ? 43   LYS U N     1 
ATOM   2385  C  CA    . LYS D  4  43   ? 243.717 225.930 151.477 1.00 77.38  ? 43   LYS U CA    1 
ATOM   2386  C  C     . LYS D  4  43   ? 244.781 225.957 152.565 1.00 84.02  ? 43   LYS U C     1 
ATOM   2387  O  O     . LYS D  4  43   ? 244.976 224.944 153.243 1.00 84.72  ? 43   LYS U O     1 
ATOM   2388  C  CB    . LYS D  4  43   ? 244.214 225.135 150.270 1.00 92.30  ? 43   LYS U CB    1 
ATOM   2389  C  CG    . LYS D  4  43   ? 243.146 224.902 149.220 1.00 102.37 ? 43   LYS U CG    1 
ATOM   2390  C  CD    . LYS D  4  43   ? 241.977 224.131 149.817 1.00 108.32 ? 43   LYS U CD    1 
ATOM   2391  C  CE    . LYS D  4  43   ? 240.920 223.821 148.775 1.00 105.79 ? 43   LYS U CE    1 
ATOM   2392  N  NZ    . LYS D  4  43   ? 239.754 223.101 149.349 1.00 102.71 ? 43   LYS U NZ    1 
ATOM   2393  N  N     . GLN D  4  44   ? 245.471 227.083 152.749 1.00 71.47  ? 44   GLN U N     1 
ATOM   2394  C  CA    . GLN D  4  44   ? 246.369 227.207 153.889 1.00 60.08  ? 44   GLN U CA    1 
ATOM   2395  C  C     . GLN D  4  44   ? 245.594 227.475 155.174 1.00 64.14  ? 44   GLN U C     1 
ATOM   2396  O  O     . GLN D  4  44   ? 245.849 226.843 156.205 1.00 76.33  ? 44   GLN U O     1 
ATOM   2397  C  CB    . GLN D  4  44   ? 247.396 228.317 153.648 1.00 63.38  ? 44   GLN U CB    1 
ATOM   2398  C  CG    . GLN D  4  44   ? 248.393 228.018 152.545 1.00 79.19  ? 44   GLN U CG    1 
ATOM   2399  C  CD    . GLN D  4  44   ? 249.373 229.153 152.328 1.00 101.54 ? 44   GLN U CD    1 
ATOM   2400  O  OE1   . GLN D  4  44   ? 249.089 230.306 152.653 1.00 99.76  ? 44   GLN U OE1   1 
ATOM   2401  N  NE2   . GLN D  4  44   ? 250.537 228.831 151.777 1.00 110.45 ? 44   GLN U NE2   1 
ATOM   2402  N  N     . VAL D  4  45   ? 244.649 228.416 155.131 1.00 84.67  ? 45   VAL U N     1 
ATOM   2403  C  CA    . VAL D  4  45   ? 243.897 228.763 156.334 1.00 84.36  ? 45   VAL U CA    1 
ATOM   2404  C  C     . VAL D  4  45   ? 242.911 227.656 156.690 1.00 82.80  ? 45   VAL U C     1 
ATOM   2405  O  O     . VAL D  4  45   ? 242.904 227.148 157.817 1.00 79.19  ? 45   VAL U O     1 
ATOM   2406  C  CB    . VAL D  4  45   ? 243.186 230.115 156.147 1.00 77.84  ? 45   VAL U CB    1 
ATOM   2407  C  CG1   . VAL D  4  45   ? 242.345 230.440 157.367 1.00 72.45  ? 45   VAL U CG1   1 
ATOM   2408  C  CG2   . VAL D  4  45   ? 244.203 231.214 155.886 1.00 77.42  ? 45   VAL U CG2   1 
ATOM   2409  N  N     . HIS D  4  46   ? 242.064 227.266 155.738 1.00 83.26  ? 46   HIS U N     1 
ATOM   2410  C  CA    . HIS D  4  46   ? 241.052 226.228 155.942 1.00 77.35  ? 46   HIS U CA    1 
ATOM   2411  C  C     . HIS D  4  46   ? 241.195 225.176 154.852 1.00 90.36  ? 46   HIS U C     1 
ATOM   2412  O  O     . HIS D  4  46   ? 240.606 225.299 153.769 1.00 97.13  ? 46   HIS U O     1 
ATOM   2413  C  CB    . HIS D  4  46   ? 239.642 226.813 155.944 1.00 68.43  ? 46   HIS U CB    1 
ATOM   2414  C  CG    . HIS D  4  46   ? 239.393 227.791 157.048 1.00 77.86  ? 46   HIS U CG    1 
ATOM   2415  N  ND1   . HIS D  4  46   ? 239.324 227.415 158.374 1.00 80.75  ? 46   HIS U ND1   1 
ATOM   2416  C  CD2   . HIS D  4  46   ? 239.184 229.129 157.028 1.00 92.51  ? 46   HIS U CD2   1 
ATOM   2417  C  CE1   . HIS D  4  46   ? 239.092 228.481 159.120 1.00 79.86  ? 46   HIS U CE1   1 
ATOM   2418  N  NE2   . HIS D  4  46   ? 239.002 229.532 158.328 1.00 90.27  ? 46   HIS U NE2   1 
ATOM   2419  N  N     . PRO D  4  47   ? 241.978 224.124 155.100 1.00 100.38 ? 47   PRO U N     1 
ATOM   2420  C  CA    . PRO D  4  47   ? 242.168 223.094 154.065 1.00 95.65  ? 47   PRO U CA    1 
ATOM   2421  C  C     . PRO D  4  47   ? 240.891 222.367 153.682 1.00 98.77  ? 47   PRO U C     1 
ATOM   2422  O  O     . PRO D  4  47   ? 240.787 221.871 152.554 1.00 106.48 ? 47   PRO U O     1 
ATOM   2423  C  CB    . PRO D  4  47   ? 243.183 222.139 154.709 1.00 92.07  ? 47   PRO U CB    1 
ATOM   2424  C  CG    . PRO D  4  47   ? 243.903 222.982 155.713 1.00 88.09  ? 47   PRO U CG    1 
ATOM   2425  C  CD    . PRO D  4  47   ? 242.858 223.909 156.259 1.00 87.68  ? 47   PRO U CD    1 
ATOM   2426  N  N     . ASP D  4  48   ? 239.916 222.290 154.583 1.00 91.54  ? 48   ASP U N     1 
ATOM   2427  C  CA    . ASP D  4  48   ? 238.706 221.517 154.349 1.00 113.62 ? 48   ASP U CA    1 
ATOM   2428  C  C     . ASP D  4  48   ? 237.588 222.319 153.694 1.00 112.54 ? 48   ASP U C     1 
ATOM   2429  O  O     . ASP D  4  48   ? 236.571 221.731 153.311 1.00 119.60 ? 48   ASP U O     1 
ATOM   2430  C  CB    . ASP D  4  48   ? 238.193 220.929 155.667 1.00 131.24 ? 48   ASP U CB    1 
ATOM   2431  C  CG    . ASP D  4  48   ? 239.110 219.857 156.224 1.00 138.92 ? 48   ASP U CG    1 
ATOM   2432  O  OD1   . ASP D  4  48   ? 239.954 219.343 155.463 1.00 133.59 ? 48   ASP U OD1   1 
ATOM   2433  O  OD2   . ASP D  4  48   ? 238.983 219.531 157.421 1.00 138.21 ? 48   ASP U OD2   1 
ATOM   2434  N  N     . THR D  4  49   ? 237.746 223.632 153.556 1.00 96.65  ? 49   THR U N     1 
ATOM   2435  C  CA    . THR D  4  49   ? 236.671 224.503 153.095 1.00 82.17  ? 49   THR U CA    1 
ATOM   2436  C  C     . THR D  4  49   ? 236.922 224.938 151.658 1.00 85.45  ? 49   THR U C     1 
ATOM   2437  O  O     . THR D  4  49   ? 238.028 225.369 151.316 1.00 93.40  ? 49   THR U O     1 
ATOM   2438  C  CB    . THR D  4  49   ? 236.546 225.729 154.002 1.00 100.15 ? 49   THR U CB    1 
ATOM   2439  O  OG1   . THR D  4  49   ? 236.241 225.307 155.336 1.00 97.44  ? 49   THR U OG1   1 
ATOM   2440  C  CG2   . THR D  4  49   ? 235.442 226.649 153.506 1.00 95.15  ? 49   THR U CG2   1 
ATOM   2441  N  N     . GLY D  4  50   ? 235.889 224.823 150.822 1.00 70.19  ? 50   GLY U N     1 
ATOM   2442  C  CA    . GLY D  4  50   ? 235.932 225.320 149.466 1.00 76.29  ? 50   GLY U CA    1 
ATOM   2443  C  C     . GLY D  4  50   ? 235.292 226.695 149.347 1.00 85.59  ? 50   GLY U C     1 
ATOM   2444  O  O     . GLY D  4  50   ? 234.762 227.261 150.301 1.00 95.66  ? 50   GLY U O     1 
ATOM   2445  N  N     . ILE D  4  51   ? 235.346 227.235 148.131 1.00 58.66  ? 51   ILE U N     1 
ATOM   2446  C  CA    . ILE D  4  51   ? 234.850 228.575 147.849 1.00 65.04  ? 51   ILE U CA    1 
ATOM   2447  C  C     . ILE D  4  51   ? 234.060 228.555 146.548 1.00 68.86  ? 51   ILE U C     1 
ATOM   2448  O  O     . ILE D  4  51   ? 234.455 227.900 145.577 1.00 70.76  ? 51   ILE U O     1 
ATOM   2449  C  CB    . ILE D  4  51   ? 236.005 229.601 147.782 1.00 60.51  ? 51   ILE U CB    1 
ATOM   2450  C  CG1   . ILE D  4  51   ? 235.466 231.016 147.572 1.00 65.71  ? 51   ILE U CG1   1 
ATOM   2451  C  CG2   . ILE D  4  51   ? 237.013 229.222 146.707 1.00 51.25  ? 51   ILE U CG2   1 
ATOM   2452  C  CD1   . ILE D  4  51   ? 236.506 232.096 147.761 1.00 62.16  ? 51   ILE U CD1   1 
ATOM   2453  N  N     . SER D  4  52   ? 232.932 229.259 146.539 1.00 61.98  ? 52   SER U N     1 
ATOM   2454  C  CA    . SER D  4  52   ? 232.123 229.379 145.339 1.00 51.13  ? 52   SER U CA    1 
ATOM   2455  C  C     . SER D  4  52   ? 232.781 230.330 144.344 1.00 55.82  ? 52   SER U C     1 
ATOM   2456  O  O     . SER D  4  52   ? 233.649 231.136 144.689 1.00 50.91  ? 52   SER U O     1 
ATOM   2457  C  CB    . SER D  4  52   ? 230.717 229.869 145.687 1.00 83.00  ? 52   SER U CB    1 
ATOM   2458  O  OG    . SER D  4  52   ? 230.754 231.168 146.253 1.00 82.26  ? 52   SER U OG    1 
ATOM   2459  N  N     . SER D  4  53   ? 232.360 230.219 143.082 1.00 55.81  ? 53   SER U N     1 
ATOM   2460  C  CA    . SER D  4  53   ? 232.935 231.058 142.035 1.00 62.74  ? 53   SER U CA    1 
ATOM   2461  C  C     . SER D  4  53   ? 232.626 232.531 142.270 1.00 67.46  ? 53   SER U C     1 
ATOM   2462  O  O     . SER D  4  53   ? 233.488 233.394 142.059 1.00 69.43  ? 53   SER U O     1 
ATOM   2463  C  CB    . SER D  4  53   ? 232.416 230.615 140.666 1.00 51.97  ? 53   SER U CB    1 
ATOM   2464  O  OG    . SER D  4  53   ? 231.015 230.799 140.574 1.00 72.88  ? 53   SER U OG    1 
ATOM   2465  N  N     . LYS D  4  54   ? 231.402 232.840 142.705 1.00 49.02  ? 54   LYS U N     1 
ATOM   2466  C  CA    . LYS D  4  54   ? 231.035 234.231 142.946 1.00 47.50  ? 54   LYS U CA    1 
ATOM   2467  C  C     . LYS D  4  54   ? 231.877 234.838 144.060 1.00 47.47  ? 54   LYS U C     1 
ATOM   2468  O  O     . LYS D  4  54   ? 232.375 235.965 143.933 1.00 60.31  ? 54   LYS U O     1 
ATOM   2469  C  CB    . LYS D  4  54   ? 229.548 234.332 143.281 1.00 61.29  ? 54   LYS U CB    1 
ATOM   2470  N  N     . ALA D  4  55   ? 232.053 234.104 145.163 1.00 37.15  ? 55   ALA U N     1 
ATOM   2471  C  CA    . ALA D  4  55   ? 232.924 234.580 146.232 1.00 34.45  ? 55   ALA U CA    1 
ATOM   2472  C  C     . ALA D  4  55   ? 234.356 234.746 145.747 1.00 34.37  ? 55   ALA U C     1 
ATOM   2473  O  O     . ALA D  4  55   ? 235.068 235.644 146.211 1.00 44.21  ? 55   ALA U O     1 
ATOM   2474  C  CB    . ALA D  4  55   ? 232.872 233.622 147.420 1.00 54.21  ? 55   ALA U CB    1 
ATOM   2475  N  N     . MET D  4  56   ? 234.797 233.897 144.816 1.00 41.01  ? 56   MET U N     1 
ATOM   2476  C  CA    . MET D  4  56   ? 236.121 234.073 144.232 1.00 45.11  ? 56   MET U CA    1 
ATOM   2477  C  C     . MET D  4  56   ? 236.196 235.364 143.428 1.00 43.10  ? 56   MET U C     1 
ATOM   2478  O  O     . MET D  4  56   ? 237.228 236.045 143.431 1.00 48.77  ? 56   MET U O     1 
ATOM   2479  C  CB    . MET D  4  56   ? 236.476 232.873 143.356 1.00 49.00  ? 56   MET U CB    1 
ATOM   2480  C  CG    . MET D  4  56   ? 237.866 232.950 142.760 1.00 40.39  ? 56   MET U CG    1 
ATOM   2481  S  SD    . MET D  4  56   ? 239.140 232.908 144.033 1.00 65.61  ? 56   MET U SD    1 
ATOM   2482  C  CE    . MET D  4  56   ? 239.090 231.182 144.503 1.00 52.72  ? 56   MET U CE    1 
ATOM   2483  N  N     . SER D  4  57   ? 235.114 235.717 142.732 1.00 34.84  ? 57   SER U N     1 
ATOM   2484  C  CA    . SER D  4  57   ? 235.083 236.991 142.020 1.00 36.64  ? 57   SER U CA    1 
ATOM   2485  C  C     . SER D  4  57   ? 235.131 238.164 142.992 1.00 40.07  ? 57   SER U C     1 
ATOM   2486  O  O     . SER D  4  57   ? 235.820 239.161 142.737 1.00 32.46  ? 57   SER U O     1 
ATOM   2487  C  CB    . SER D  4  57   ? 233.835 237.072 141.141 1.00 33.72  ? 57   SER U CB    1 
ATOM   2488  O  OG    . SER D  4  57   ? 233.765 238.318 140.473 1.00 63.40  ? 57   SER U OG    1 
ATOM   2489  N  N     . ILE D  4  58   ? 234.413 238.060 144.112 1.00 20.53  ? 58   ILE U N     1 
ATOM   2490  C  CA    . ILE D  4  58   ? 234.456 239.116 145.121 1.00 24.92  ? 58   ILE U CA    1 
ATOM   2491  C  C     . ILE D  4  58   ? 235.866 239.262 145.678 1.00 28.28  ? 58   ILE U C     1 
ATOM   2492  O  O     . ILE D  4  58   ? 236.362 240.379 145.870 1.00 28.28  ? 58   ILE U O     1 
ATOM   2493  C  CB    . ILE D  4  58   ? 233.432 238.834 146.235 1.00 33.98  ? 58   ILE U CB    1 
ATOM   2494  C  CG1   . ILE D  4  58   ? 232.010 238.905 145.679 1.00 25.33  ? 58   ILE U CG1   1 
ATOM   2495  C  CG2   . ILE D  4  58   ? 233.599 239.819 147.376 1.00 20.53  ? 58   ILE U CG2   1 
ATOM   2496  C  CD1   . ILE D  4  58   ? 230.958 238.432 146.647 1.00 37.84  ? 58   ILE U CD1   1 
ATOM   2497  N  N     . MET D  4  59   ? 236.537 238.138 145.942 1.00 31.62  ? 59   MET U N     1 
ATOM   2498  C  CA    . MET D  4  59   ? 237.915 238.197 146.418 1.00 29.27  ? 59   MET U CA    1 
ATOM   2499  C  C     . MET D  4  59   ? 238.833 238.822 145.375 1.00 40.13  ? 59   MET U C     1 
ATOM   2500  O  O     . MET D  4  59   ? 239.748 239.582 145.717 1.00 42.00  ? 59   MET U O     1 
ATOM   2501  C  CB    . MET D  4  59   ? 238.400 236.798 146.793 1.00 32.99  ? 59   MET U CB    1 
ATOM   2502  C  CG    . MET D  4  59   ? 237.698 236.206 147.998 1.00 33.89  ? 59   MET U CG    1 
ATOM   2503  S  SD    . MET D  4  59   ? 237.937 237.228 149.457 1.00 49.73  ? 59   MET U SD    1 
ATOM   2504  C  CE    . MET D  4  59   ? 239.708 237.076 149.657 1.00 47.34  ? 59   MET U CE    1 
ATOM   2505  N  N     . ASN D  4  60   ? 238.608 238.509 144.099 1.00 30.98  ? 60   ASN U N     1 
ATOM   2506  C  CA    . ASN D  4  60   ? 239.414 239.095 143.033 1.00 27.34  ? 60   ASN U CA    1 
ATOM   2507  C  C     . ASN D  4  60   ? 239.259 240.611 142.999 1.00 38.97  ? 60   ASN U C     1 
ATOM   2508  O  O     . ASN D  4  60   ? 240.252 241.351 142.996 1.00 46.23  ? 60   ASN U O     1 
ATOM   2509  C  CB    . ASN D  4  60   ? 239.023 238.482 141.690 1.00 26.14  ? 60   ASN U CB    1 
ATOM   2510  C  CG    . ASN D  4  60   ? 239.966 238.875 140.576 1.00 46.40  ? 60   ASN U CG    1 
ATOM   2511  O  OD1   . ASN D  4  60   ? 241.151 239.112 140.808 1.00 56.30  ? 60   ASN U OD1   1 
ATOM   2512  N  ND2   . ASN D  4  60   ? 239.446 238.944 139.358 1.00 38.34  ? 60   ASN U ND2   1 
ATOM   2513  N  N     . SER D  4  61   ? 238.013 241.093 142.979 1.00 31.45  ? 61   SER U N     1 
ATOM   2514  C  CA    . SER D  4  61   ? 237.784 242.534 142.982 1.00 34.02  ? 61   SER U CA    1 
ATOM   2515  C  C     . SER D  4  61   ? 238.320 243.184 144.251 1.00 34.98  ? 61   SER U C     1 
ATOM   2516  O  O     . SER D  4  61   ? 238.716 244.354 144.230 1.00 39.15  ? 61   SER U O     1 
ATOM   2517  C  CB    . SER D  4  61   ? 236.294 242.829 142.817 1.00 26.42  ? 61   SER U CB    1 
ATOM   2518  O  OG    . SER D  4  61   ? 235.827 242.392 141.553 1.00 52.11  ? 61   SER U OG    1 
ATOM   2519  N  N     . PHE D  4  62   ? 238.343 242.444 145.360 1.00 33.99  ? 62   PHE U N     1 
ATOM   2520  C  CA    . PHE D  4  62   ? 238.922 242.971 146.591 1.00 30.15  ? 62   PHE U CA    1 
ATOM   2521  C  C     . PHE D  4  62   ? 240.426 243.160 146.451 1.00 40.14  ? 62   PHE U C     1 
ATOM   2522  O  O     . PHE D  4  62   ? 240.965 244.221 146.795 1.00 39.55  ? 62   PHE U O     1 
ATOM   2523  C  CB    . PHE D  4  62   ? 238.600 242.041 147.759 1.00 28.75  ? 62   PHE U CB    1 
ATOM   2524  C  CG    . PHE D  4  62   ? 239.240 242.448 149.053 1.00 41.65  ? 62   PHE U CG    1 
ATOM   2525  C  CD1   . PHE D  4  62   ? 238.686 243.451 149.829 1.00 42.82  ? 62   PHE U CD1   1 
ATOM   2526  C  CD2   . PHE D  4  62   ? 240.391 241.822 149.498 1.00 34.25  ? 62   PHE U CD2   1 
ATOM   2527  C  CE1   . PHE D  4  62   ? 239.274 243.823 151.022 1.00 45.71  ? 62   PHE U CE1   1 
ATOM   2528  C  CE2   . PHE D  4  62   ? 240.982 242.190 150.688 1.00 42.07  ? 62   PHE U CE2   1 
ATOM   2529  C  CZ    . PHE D  4  62   ? 240.423 243.192 151.451 1.00 42.05  ? 62   PHE U CZ    1 
ATOM   2530  N  N     . VAL D  4  63   ? 241.123 242.140 145.944 1.00 25.09  ? 63   VAL U N     1 
ATOM   2531  C  CA    . VAL D  4  63   ? 242.572 242.235 145.789 1.00 27.24  ? 63   VAL U CA    1 
ATOM   2532  C  C     . VAL D  4  63   ? 242.934 243.342 144.808 1.00 31.68  ? 63   VAL U C     1 
ATOM   2533  O  O     . VAL D  4  63   ? 243.874 244.115 145.043 1.00 43.05  ? 63   VAL U O     1 
ATOM   2534  C  CB    . VAL D  4  63   ? 243.153 240.876 145.353 1.00 42.05  ? 63   VAL U CB    1 
ATOM   2535  C  CG1   . VAL D  4  63   ? 244.636 241.003 145.062 1.00 32.92  ? 63   VAL U CG1   1 
ATOM   2536  C  CG2   . VAL D  4  63   ? 242.914 239.833 146.431 1.00 25.16  ? 63   VAL U CG2   1 
ATOM   2537  N  N     . ASN D  4  64   ? 242.197 243.445 143.699 1.00 38.59  ? 64   ASN U N     1 
ATOM   2538  C  CA    . ASN D  4  64   ? 242.450 244.531 142.756 1.00 47.44  ? 64   ASN U CA    1 
ATOM   2539  C  C     . ASN D  4  64   ? 242.196 245.890 143.399 1.00 48.93  ? 64   ASN U C     1 
ATOM   2540  O  O     . ASN D  4  64   ? 242.972 246.834 143.203 1.00 39.86  ? 64   ASN U O     1 
ATOM   2541  C  CB    . ASN D  4  64   ? 241.589 244.360 141.508 1.00 25.25  ? 64   ASN U CB    1 
ATOM   2542  C  CG    . ASN D  4  64   ? 242.034 243.192 140.650 1.00 45.76  ? 64   ASN U CG    1 
ATOM   2543  O  OD1   . ASN D  4  64   ? 243.025 243.281 139.928 1.00 52.92  ? 64   ASN U OD1   1 
ATOM   2544  N  ND2   . ASN D  4  64   ? 241.299 242.090 140.724 1.00 54.04  ? 64   ASN U ND2   1 
ATOM   2545  N  N     . ASP D  4  65   ? 241.113 246.005 144.171 1.00 35.43  ? 65   ASP U N     1 
ATOM   2546  C  CA    . ASP D  4  65   ? 240.809 247.252 144.866 1.00 30.80  ? 65   ASP U CA    1 
ATOM   2547  C  C     . ASP D  4  65   ? 241.961 247.668 145.775 1.00 41.54  ? 65   ASP U C     1 
ATOM   2548  O  O     . ASP D  4  65   ? 242.560 248.735 145.593 1.00 44.18  ? 65   ASP U O     1 
ATOM   2549  C  CB    . ASP D  4  65   ? 239.514 247.100 145.667 1.00 26.03  ? 65   ASP U CB    1 
ATOM   2550  C  CG    . ASP D  4  65   ? 239.050 248.405 146.286 1.00 48.72  ? 65   ASP U CG    1 
ATOM   2551  O  OD1   . ASP D  4  65   ? 239.668 249.456 146.014 1.00 67.28  ? 65   ASP U OD1   1 
ATOM   2552  O  OD2   . ASP D  4  65   ? 238.063 248.381 147.050 1.00 47.99  ? 65   ASP U OD2   1 
ATOM   2553  N  N     . VAL D  4  66   ? 242.270 246.839 146.777 1.00 31.50  ? 66   VAL U N     1 
ATOM   2554  C  CA    . VAL D  4  66   ? 243.322 247.175 147.735 1.00 32.60  ? 66   VAL U CA    1 
ATOM   2555  C  C     . VAL D  4  66   ? 244.639 247.444 147.019 1.00 39.91  ? 66   VAL U C     1 
ATOM   2556  O  O     . VAL D  4  66   ? 245.393 248.354 147.390 1.00 32.62  ? 66   VAL U O     1 
ATOM   2557  C  CB    . VAL D  4  66   ? 243.464 246.053 148.780 1.00 35.56  ? 66   VAL U CB    1 
ATOM   2558  C  CG1   . VAL D  4  66   ? 244.619 246.344 149.720 1.00 29.73  ? 66   VAL U CG1   1 
ATOM   2559  C  CG2   . VAL D  4  66   ? 242.170 245.890 149.556 1.00 33.02  ? 66   VAL U CG2   1 
ATOM   2560  N  N     . PHE D  4  67   ? 244.933 246.668 145.972 1.00 37.89  ? 67   PHE U N     1 
ATOM   2561  C  CA    . PHE D  4  67   ? 246.144 246.898 145.193 1.00 31.26  ? 67   PHE U CA    1 
ATOM   2562  C  C     . PHE D  4  67   ? 246.167 248.308 144.612 1.00 40.00  ? 67   PHE U C     1 
ATOM   2563  O  O     . PHE D  4  67   ? 247.164 249.029 144.738 1.00 55.66  ? 67   PHE U O     1 
ATOM   2564  C  CB    . PHE D  4  67   ? 246.255 245.856 144.081 1.00 52.41  ? 67   PHE U CB    1 
ATOM   2565  C  CG    . PHE D  4  67   ? 247.411 246.084 143.153 1.00 65.37  ? 67   PHE U CG    1 
ATOM   2566  C  CD1   . PHE D  4  67   ? 248.687 245.687 143.504 1.00 72.13  ? 67   PHE U CD1   1 
ATOM   2567  C  CD2   . PHE D  4  67   ? 247.220 246.695 141.927 1.00 60.08  ? 67   PHE U CD2   1 
ATOM   2568  C  CE1   . PHE D  4  67   ? 249.748 245.897 142.649 1.00 72.83  ? 67   PHE U CE1   1 
ATOM   2569  C  CE2   . PHE D  4  67   ? 248.277 246.908 141.071 1.00 53.55  ? 67   PHE U CE2   1 
ATOM   2570  C  CZ    . PHE D  4  67   ? 249.543 246.508 141.434 1.00 61.53  ? 67   PHE U CZ    1 
ATOM   2571  N  N     . GLU D  4  68   ? 245.070 248.720 143.969 1.00 25.83  ? 68   GLU U N     1 
ATOM   2572  C  CA    . GLU D  4  68   ? 245.021 250.060 143.394 1.00 38.61  ? 68   GLU U CA    1 
ATOM   2573  C  C     . GLU D  4  68   ? 245.094 251.137 144.469 1.00 37.54  ? 68   GLU U C     1 
ATOM   2574  O  O     . GLU D  4  68   ? 245.639 252.219 144.224 1.00 39.45  ? 68   GLU U O     1 
ATOM   2575  C  CB    . GLU D  4  68   ? 243.759 250.233 142.556 1.00 59.30  ? 68   GLU U CB    1 
ATOM   2576  C  CG    . GLU D  4  68   ? 243.725 249.372 141.304 1.00 85.23  ? 68   GLU U CG    1 
ATOM   2577  C  CD    . GLU D  4  68   ? 242.439 249.539 140.519 1.00 105.04 ? 68   GLU U CD    1 
ATOM   2578  O  OE1   . GLU D  4  68   ? 241.508 250.193 141.035 1.00 103.76 ? 68   GLU U OE1   1 
ATOM   2579  O  OE2   . GLU D  4  68   ? 242.359 249.016 139.388 1.00 112.82 ? 68   GLU U OE2   1 
ATOM   2580  N  N     . ARG D  4  69   ? 244.558 250.862 145.659 1.00 21.68  ? 69   ARG U N     1 
ATOM   2581  C  CA    . ARG D  4  69   ? 244.652 251.832 146.746 1.00 25.61  ? 69   ARG U CA    1 
ATOM   2582  C  C     . ARG D  4  69   ? 246.098 252.027 147.185 1.00 41.78  ? 69   ARG U C     1 
ATOM   2583  O  O     . ARG D  4  69   ? 246.597 253.158 147.224 1.00 45.86  ? 69   ARG U O     1 
ATOM   2584  C  CB    . ARG D  4  69   ? 243.791 251.393 147.929 1.00 20.30  ? 69   ARG U CB    1 
ATOM   2585  C  CG    . ARG D  4  69   ? 242.297 251.426 147.674 1.00 23.06  ? 69   ARG U CG    1 
ATOM   2586  C  CD    . ARG D  4  69   ? 241.532 251.040 148.928 1.00 29.88  ? 69   ARG U CD    1 
ATOM   2587  N  NE    . ARG D  4  69   ? 240.090 251.023 148.710 1.00 39.33  ? 69   ARG U NE    1 
ATOM   2588  C  CZ    . ARG D  4  69   ? 239.203 250.624 149.618 1.00 40.79  ? 69   ARG U CZ    1 
ATOM   2589  N  NH1   . ARG D  4  69   ? 239.613 250.211 150.807 1.00 40.93  ? 69   ARG U NH1   1 
ATOM   2590  N  NH2   . ARG D  4  69   ? 237.909 250.639 149.334 1.00 45.30  ? 69   ARG U NH2   1 
ATOM   2591  N  N     . ILE D  4  70   ? 246.786 250.933 147.523 1.00 22.28  ? 70   ILE U N     1 
ATOM   2592  C  CA    . ILE D  4  70   ? 248.157 251.049 148.015 1.00 31.81  ? 70   ILE U CA    1 
ATOM   2593  C  C     . ILE D  4  70   ? 249.067 251.625 146.938 1.00 32.15  ? 70   ILE U C     1 
ATOM   2594  O  O     . ILE D  4  70   ? 249.941 252.454 147.220 1.00 39.89  ? 70   ILE U O     1 
ATOM   2595  C  CB    . ILE D  4  70   ? 248.663 249.685 148.518 1.00 52.07  ? 70   ILE U CB    1 
ATOM   2596  C  CG1   . ILE D  4  70   ? 247.847 249.227 149.728 1.00 48.85  ? 70   ILE U CG1   1 
ATOM   2597  C  CG2   . ILE D  4  70   ? 250.131 249.767 148.893 1.00 47.48  ? 70   ILE U CG2   1 
ATOM   2598  C  CD1   . ILE D  4  70   ? 248.136 247.812 150.163 1.00 39.98  ? 70   ILE U CD1   1 
ATOM   2599  N  N     . ALA D  4  71   ? 248.870 251.207 145.685 1.00 32.48  ? 71   ALA U N     1 
ATOM   2600  C  CA    . ALA D  4  71   ? 249.682 251.751 144.602 1.00 42.82  ? 71   ALA U CA    1 
ATOM   2601  C  C     . ALA D  4  71   ? 249.416 253.238 144.402 1.00 52.58  ? 71   ALA U C     1 
ATOM   2602  O  O     . ALA D  4  71   ? 250.348 254.012 144.149 1.00 55.96  ? 71   ALA U O     1 
ATOM   2603  C  CB    . ALA D  4  71   ? 249.418 250.978 143.312 1.00 37.40  ? 71   ALA U CB    1 
ATOM   2604  N  N     . GLY D  4  72   ? 248.155 253.657 144.515 1.00 41.20  ? 72   GLY U N     1 
ATOM   2605  C  CA    . GLY D  4  72   ? 247.843 255.070 144.372 1.00 24.17  ? 72   GLY U CA    1 
ATOM   2606  C  C     . GLY D  4  72   ? 248.460 255.915 145.469 1.00 41.23  ? 72   GLY U C     1 
ATOM   2607  O  O     . GLY D  4  72   ? 249.076 256.953 145.203 1.00 41.51  ? 72   GLY U O     1 
ATOM   2608  N  N     . GLU D  4  73   ? 248.308 255.478 146.723 1.00 49.03  ? 73   GLU U N     1 
ATOM   2609  C  CA    . GLU D  4  73   ? 248.924 256.200 147.832 1.00 40.77  ? 73   GLU U CA    1 
ATOM   2610  C  C     . GLU D  4  73   ? 250.437 256.237 147.691 1.00 46.57  ? 73   GLU U C     1 
ATOM   2611  O  O     . GLU D  4  73   ? 251.078 257.234 148.043 1.00 61.54  ? 73   GLU U O     1 
ATOM   2612  C  CB    . GLU D  4  73   ? 248.523 255.563 149.162 1.00 56.02  ? 73   GLU U CB    1 
ATOM   2613  C  CG    . GLU D  4  73   ? 247.044 255.671 149.483 1.00 70.68  ? 73   GLU U CG    1 
ATOM   2614  C  CD    . GLU D  4  73   ? 246.564 257.108 149.547 1.00 91.15  ? 73   GLU U CD    1 
ATOM   2615  O  OE1   . GLU D  4  73   ? 247.317 257.965 150.057 1.00 86.73  ? 73   GLU U OE1   1 
ATOM   2616  O  OE2   . GLU D  4  73   ? 245.435 257.378 149.089 1.00 98.67  ? 73   GLU U OE2   1 
ATOM   2617  N  N     . ALA D  4  74   ? 251.031 255.158 147.174 1.00 34.88  ? 74   ALA U N     1 
ATOM   2618  C  CA    . ALA D  4  74   ? 252.470 255.159 146.933 1.00 46.57  ? 74   ALA U CA    1 
ATOM   2619  C  C     . ALA D  4  74   ? 252.848 256.171 145.862 1.00 50.59  ? 74   ALA U C     1 
ATOM   2620  O  O     . ALA D  4  74   ? 253.894 256.825 145.956 1.00 52.09  ? 74   ALA U O     1 
ATOM   2621  C  CB    . ALA D  4  74   ? 252.936 253.760 146.537 1.00 49.69  ? 74   ALA U CB    1 
ATOM   2622  N  N     . SER D  4  75   ? 252.011 256.314 144.829 1.00 38.52  ? 75   SER U N     1 
ATOM   2623  C  CA    . SER D  4  75   ? 252.277 257.316 143.805 1.00 39.04  ? 75   SER U CA    1 
ATOM   2624  C  C     . SER D  4  75   ? 252.189 258.725 144.377 1.00 43.49  ? 75   SER U C     1 
ATOM   2625  O  O     . SER D  4  75   ? 253.018 259.585 144.054 1.00 47.88  ? 75   SER U O     1 
ATOM   2626  C  CB    . SER D  4  75   ? 251.300 257.149 142.641 1.00 31.30  ? 75   SER U CB    1 
ATOM   2627  O  OG    . SER D  4  75   ? 251.510 258.147 141.658 1.00 46.67  ? 75   SER U OG    1 
ATOM   2628  N  N     . ARG D  4  76   ? 251.196 258.979 145.232 1.00 56.08  ? 76   ARG U N     1 
ATOM   2629  C  CA    . ARG D  4  76   ? 251.068 260.298 145.844 1.00 44.52  ? 76   ARG U CA    1 
ATOM   2630  C  C     . ARG D  4  76   ? 252.258 260.602 146.746 1.00 58.81  ? 76   ARG U C     1 
ATOM   2631  O  O     . ARG D  4  76   ? 252.824 261.699 146.695 1.00 67.99  ? 76   ARG U O     1 
ATOM   2632  C  CB    . ARG D  4  76   ? 249.758 260.389 146.624 1.00 68.31  ? 76   ARG U CB    1 
ATOM   2633  C  CG    . ARG D  4  76   ? 248.515 260.328 145.755 1.00 74.01  ? 76   ARG U CG    1 
ATOM   2634  C  CD    . ARG D  4  76   ? 247.252 260.468 146.588 1.00 78.43  ? 76   ARG U CD    1 
ATOM   2635  N  NE    . ARG D  4  76   ? 246.047 260.404 145.768 1.00 100.20 ? 76   ARG U NE    1 
ATOM   2636  C  CZ    . ARG D  4  76   ? 245.518 261.445 145.131 1.00 105.07 ? 76   ARG U CZ    1 
ATOM   2637  N  NH1   . ARG D  4  76   ? 246.091 262.639 145.221 1.00 101.66 ? 76   ARG U NH1   1 
ATOM   2638  N  NH2   . ARG D  4  76   ? 244.418 261.293 144.407 1.00 100.84 ? 76   ARG U NH2   1 
ATOM   2639  N  N     . LEU D  4  77   ? 252.653 259.637 147.583 1.00 52.19  ? 77   LEU U N     1 
ATOM   2640  C  CA    . LEU D  4  77   ? 253.801 259.847 148.460 1.00 49.14  ? 77   LEU U CA    1 
ATOM   2641  C  C     . LEU D  4  77   ? 255.082 260.046 147.662 1.00 56.74  ? 77   LEU U C     1 
ATOM   2642  O  O     . LEU D  4  77   ? 255.957 260.823 148.062 1.00 63.88  ? 77   LEU U O     1 
ATOM   2643  C  CB    . LEU D  4  77   ? 253.952 258.669 149.421 1.00 46.33  ? 77   LEU U CB    1 
ATOM   2644  C  CG    . LEU D  4  77   ? 252.857 258.526 150.470 1.00 45.08  ? 77   LEU U CG    1 
ATOM   2645  C  CD1   . LEU D  4  77   ? 253.032 257.237 151.243 1.00 44.82  ? 77   LEU U CD1   1 
ATOM   2646  C  CD2   . LEU D  4  77   ? 252.899 259.715 151.405 1.00 37.50  ? 77   LEU U CD2   1 
ATOM   2647  N  N     . ALA D  4  78   ? 255.215 259.353 146.530 1.00 48.29  ? 78   ALA U N     1 
ATOM   2648  C  CA    . ALA D  4  78   ? 256.397 259.538 145.699 1.00 44.48  ? 78   ALA U CA    1 
ATOM   2649  C  C     . ALA D  4  78   ? 256.388 260.893 145.006 1.00 58.84  ? 78   ALA U C     1 
ATOM   2650  O  O     . ALA D  4  78   ? 257.453 261.469 144.764 1.00 71.78  ? 78   ALA U O     1 
ATOM   2651  C  CB    . ALA D  4  78   ? 256.501 258.415 144.671 1.00 42.81  ? 78   ALA U CB    1 
ATOM   2652  N  N     . HIS D  4  79   ? 255.205 261.418 144.683 1.00 62.34  ? 79   HIS U N     1 
ATOM   2653  C  CA    . HIS D  4  79   ? 255.136 262.702 143.993 1.00 66.67  ? 79   HIS U CA    1 
ATOM   2654  C  C     . HIS D  4  79   ? 255.325 263.875 144.948 1.00 62.16  ? 79   HIS U C     1 
ATOM   2655  O  O     . HIS D  4  79   ? 255.976 264.864 144.593 1.00 61.31  ? 79   HIS U O     1 
ATOM   2656  C  CB    . HIS D  4  79   ? 253.807 262.835 143.252 1.00 65.68  ? 79   HIS U CB    1 
ATOM   2657  C  CG    . HIS D  4  79   ? 253.669 264.116 142.493 1.00 93.96  ? 79   HIS U CG    1 
ATOM   2658  N  ND1   . HIS D  4  79   ? 254.514 264.466 141.463 1.00 104.34 ? 79   HIS U ND1   1 
ATOM   2659  C  CD2   . HIS D  4  79   ? 252.786 265.137 142.619 1.00 104.51 ? 79   HIS U CD2   1 
ATOM   2660  C  CE1   . HIS D  4  79   ? 254.158 265.645 140.984 1.00 112.10 ? 79   HIS U CE1   1 
ATOM   2661  N  NE2   . HIS D  4  79   ? 253.112 266.073 141.668 1.00 110.98 ? 79   HIS U NE2   1 
ATOM   2662  N  N     . TYR D  4  80   ? 254.763 263.791 146.157 1.00 63.21  ? 80   TYR U N     1 
ATOM   2663  C  CA    . TYR D  4  80   ? 254.860 264.915 147.085 1.00 63.05  ? 80   TYR U CA    1 
ATOM   2664  C  C     . TYR D  4  80   ? 256.289 265.113 147.574 1.00 63.79  ? 80   TYR U C     1 
ATOM   2665  O  O     . TYR D  4  80   ? 256.737 266.250 147.751 1.00 73.11  ? 80   TYR U O     1 
ATOM   2666  C  CB    . TYR D  4  80   ? 253.917 264.709 148.273 1.00 58.78  ? 80   TYR U CB    1 
ATOM   2667  C  CG    . TYR D  4  80   ? 252.451 264.680 147.903 1.00 70.35  ? 80   TYR U CG    1 
ATOM   2668  C  CD1   . TYR D  4  80   ? 251.949 265.503 146.904 1.00 68.90  ? 80   TYR U CD1   1 
ATOM   2669  C  CD2   . TYR D  4  80   ? 251.564 263.847 148.571 1.00 70.17  ? 80   TYR U CD2   1 
ATOM   2670  C  CE1   . TYR D  4  80   ? 250.608 265.482 146.568 1.00 69.40  ? 80   TYR U CE1   1 
ATOM   2671  C  CE2   . TYR D  4  80   ? 250.223 263.819 148.242 1.00 76.23  ? 80   TYR U CE2   1 
ATOM   2672  C  CZ    . TYR D  4  80   ? 249.751 264.639 147.241 1.00 79.39  ? 80   TYR U CZ    1 
ATOM   2673  O  OH    . TYR D  4  80   ? 248.415 264.617 146.912 1.00 79.44  ? 80   TYR U OH    1 
ATOM   2674  N  N     . ASN D  4  81   ? 257.019 264.024 147.795 1.00 59.13  ? 81   ASN U N     1 
ATOM   2675  C  CA    . ASN D  4  81   ? 258.394 264.097 148.270 1.00 63.73  ? 81   ASN U CA    1 
ATOM   2676  C  C     . ASN D  4  81   ? 259.401 264.268 147.142 1.00 70.83  ? 81   ASN U C     1 
ATOM   2677  O  O     . ASN D  4  81   ? 260.607 264.307 147.413 1.00 65.90  ? 81   ASN U O     1 
ATOM   2678  C  CB    . ASN D  4  81   ? 258.736 262.850 149.087 1.00 62.90  ? 81   ASN U CB    1 
ATOM   2679  C  CG    . ASN D  4  81   ? 258.018 262.811 150.419 1.00 62.19  ? 81   ASN U CG    1 
ATOM   2680  O  OD1   . ASN D  4  81   ? 258.397 263.506 151.360 1.00 79.48  ? 81   ASN U OD1   1 
ATOM   2681  N  ND2   . ASN D  4  81   ? 256.972 262.000 150.506 1.00 52.81  ? 81   ASN U ND2   1 
ATOM   2682  N  N     . LYS D  4  82   ? 258.937 264.369 145.897 1.00 66.40  ? 82   LYS U N     1 
ATOM   2683  C  CA    . LYS D  4  82   ? 259.793 264.570 144.730 1.00 68.05  ? 82   LYS U CA    1 
ATOM   2684  C  C     . LYS D  4  82   ? 260.816 263.441 144.592 1.00 63.36  ? 82   LYS U C     1 
ATOM   2685  O  O     . LYS D  4  82   ? 262.029 263.639 144.693 1.00 67.26  ? 82   LYS U O     1 
ATOM   2686  C  CB    . LYS D  4  82   ? 260.478 265.941 144.784 1.00 61.75  ? 82   LYS U CB    1 
ATOM   2687  C  CG    . LYS D  4  82   ? 259.522 267.113 144.640 1.00 65.01  ? 82   LYS U CG    1 
ATOM   2688  C  CD    . LYS D  4  82   ? 260.178 268.425 145.045 1.00 87.54  ? 82   LYS U CD    1 
ATOM   2689  C  CE    . LYS D  4  82   ? 261.362 268.752 144.151 1.00 98.20  ? 82   LYS U CE    1 
ATOM   2690  N  NZ    . LYS D  4  82   ? 262.019 270.028 144.543 1.00 87.44  ? 82   LYS U NZ    1 
ATOM   2691  N  N     . ARG D  4  83   ? 260.297 262.239 144.355 1.00 70.36  ? 83   ARG U N     1 
ATOM   2692  C  CA    . ARG D  4  83   ? 261.111 261.075 144.037 1.00 65.42  ? 83   ARG U CA    1 
ATOM   2693  C  C     . ARG D  4  83   ? 260.431 260.290 142.925 1.00 77.86  ? 83   ARG U C     1 
ATOM   2694  O  O     . ARG D  4  83   ? 259.206 260.159 142.907 1.00 85.17  ? 83   ARG U O     1 
ATOM   2695  C  CB    . ARG D  4  83   ? 261.331 260.165 145.252 1.00 69.34  ? 83   ARG U CB    1 
ATOM   2696  C  CG    . ARG D  4  83   ? 262.229 260.744 146.331 1.00 93.85  ? 83   ARG U CG    1 
ATOM   2697  C  CD    . ARG D  4  83   ? 262.419 259.737 147.456 1.00 109.83 ? 83   ARG U CD    1 
ATOM   2698  N  NE    . ARG D  4  83   ? 263.321 260.224 148.495 1.00 121.82 ? 83   ARG U NE    1 
ATOM   2699  C  CZ    . ARG D  4  83   ? 262.942 260.978 149.520 1.00 130.53 ? 83   ARG U CZ    1 
ATOM   2700  N  NH1   . ARG D  4  83   ? 261.672 261.334 149.654 1.00 130.65 ? 83   ARG U NH1   1 
ATOM   2701  N  NH2   . ARG D  4  83   ? 263.835 261.374 150.419 1.00 129.40 ? 83   ARG U NH2   1 
ATOM   2702  N  N     . SER D  4  84   ? 261.237 259.773 142.002 1.00 68.89  ? 84   SER U N     1 
ATOM   2703  C  CA    . SER D  4  84   ? 260.736 259.062 140.834 1.00 75.64  ? 84   SER U CA    1 
ATOM   2704  C  C     . SER D  4  84   ? 260.702 257.549 141.018 1.00 72.80  ? 84   SER U C     1 
ATOM   2705  O  O     . SER D  4  84   ? 260.344 256.837 140.074 1.00 65.78  ? 84   SER U O     1 
ATOM   2706  C  CB    . SER D  4  84   ? 261.582 259.411 139.607 1.00 72.77  ? 84   SER U CB    1 
ATOM   2707  O  OG    . SER D  4  84   ? 262.925 258.996 139.782 1.00 79.82  ? 84   SER U OG    1 
ATOM   2708  N  N     . THR D  4  85   ? 261.063 257.040 142.194 1.00 60.02  ? 85   THR U N     1 
ATOM   2709  C  CA    . THR D  4  85   ? 261.157 255.603 142.423 1.00 53.82  ? 85   THR U CA    1 
ATOM   2710  C  C     . THR D  4  85   ? 260.293 255.207 143.610 1.00 53.77  ? 85   THR U C     1 
ATOM   2711  O  O     . THR D  4  85   ? 260.390 255.811 144.683 1.00 65.86  ? 85   THR U O     1 
ATOM   2712  C  CB    . THR D  4  85   ? 262.610 255.180 142.670 1.00 57.80  ? 85   THR U CB    1 
ATOM   2713  O  OG1   . THR D  4  85   ? 263.403 255.488 141.517 1.00 77.89  ? 85   THR U OG1   1 
ATOM   2714  C  CG2   . THR D  4  85   ? 262.694 253.687 142.950 1.00 56.87  ? 85   THR U CG2   1 
ATOM   2715  N  N     . ILE D  4  86   ? 259.455 254.193 143.415 1.00 51.05  ? 86   ILE U N     1 
ATOM   2716  C  CA    . ILE D  4  86   ? 258.659 253.612 144.491 1.00 46.45  ? 86   ILE U CA    1 
ATOM   2717  C  C     . ILE D  4  86   ? 259.458 252.480 145.123 1.00 47.38  ? 86   ILE U C     1 
ATOM   2718  O  O     . ILE D  4  86   ? 259.780 251.490 144.456 1.00 54.08  ? 86   ILE U O     1 
ATOM   2719  C  CB    . ILE D  4  86   ? 257.307 253.099 143.976 1.00 39.32  ? 86   ILE U CB    1 
ATOM   2720  C  CG1   . ILE D  4  86   ? 256.418 254.259 143.537 1.00 36.80  ? 86   ILE U CG1   1 
ATOM   2721  C  CG2   . ILE D  4  86   ? 256.615 252.268 145.038 1.00 31.22  ? 86   ILE U CG2   1 
ATOM   2722  C  CD1   . ILE D  4  86   ? 255.153 253.810 142.839 1.00 37.01  ? 86   ILE U CD1   1 
ATOM   2723  N  N     . THR D  4  87   ? 259.770 252.617 146.403 1.00 50.57  ? 87   THR U N     1 
ATOM   2724  C  CA    . THR D  4  87   ? 260.493 251.602 147.153 1.00 51.17  ? 87   THR U CA    1 
ATOM   2725  C  C     . THR D  4  87   ? 259.591 251.022 148.235 1.00 46.47  ? 87   THR U C     1 
ATOM   2726  O  O     . THR D  4  87   ? 258.411 251.368 148.348 1.00 50.99  ? 87   THR U O     1 
ATOM   2727  C  CB    . THR D  4  87   ? 261.773 252.184 147.758 1.00 56.23  ? 87   THR U CB    1 
ATOM   2728  O  OG1   . THR D  4  87   ? 261.439 253.272 148.625 1.00 54.82  ? 87   THR U OG1   1 
ATOM   2729  C  CG2   . THR D  4  87   ? 262.700 252.682 146.663 1.00 53.76  ? 87   THR U CG2   1 
ATOM   2730  N  N     . SER D  4  88   ? 260.160 250.121 149.039 1.00 51.85  ? 88   SER U N     1 
ATOM   2731  C  CA    . SER D  4  88   ? 259.396 249.495 150.112 1.00 56.51  ? 88   SER U CA    1 
ATOM   2732  C  C     . SER D  4  88   ? 258.971 250.492 151.181 1.00 56.99  ? 88   SER U C     1 
ATOM   2733  O  O     . SER D  4  88   ? 257.991 250.238 151.889 1.00 65.16  ? 88   SER U O     1 
ATOM   2734  C  CB    . SER D  4  88   ? 260.213 248.371 150.749 1.00 61.97  ? 88   SER U CB    1 
ATOM   2735  O  OG    . SER D  4  88   ? 261.380 248.880 151.370 1.00 79.53  ? 88   SER U OG    1 
ATOM   2736  N  N     . ARG D  4  89   ? 259.678 251.614 151.311 1.00 51.56  ? 89   ARG U N     1 
ATOM   2737  C  CA    . ARG D  4  89   ? 259.316 252.602 152.322 1.00 51.07  ? 89   ARG U CA    1 
ATOM   2738  C  C     . ARG D  4  89   ? 258.000 253.288 151.980 1.00 56.02  ? 89   ARG U C     1 
ATOM   2739  O  O     . ARG D  4  89   ? 257.139 253.463 152.851 1.00 69.25  ? 89   ARG U O     1 
ATOM   2740  C  CB    . ARG D  4  89   ? 260.440 253.627 152.473 1.00 61.83  ? 89   ARG U CB    1 
ATOM   2741  C  CG    . ARG D  4  89   ? 260.234 254.620 153.599 1.00 65.07  ? 89   ARG U CG    1 
ATOM   2742  C  CD    . ARG D  4  89   ? 261.438 255.537 153.749 1.00 79.29  ? 89   ARG U CD    1 
ATOM   2743  N  NE    . ARG D  4  89   ? 261.261 256.499 154.831 1.00 83.24  ? 89   ARG U NE    1 
ATOM   2744  C  CZ    . ARG D  4  89   ? 261.516 256.242 156.109 1.00 72.45  ? 89   ARG U CZ    1 
ATOM   2745  N  NH1   . ARG D  4  89   ? 261.965 255.046 156.469 1.00 63.47  ? 89   ARG U NH1   1 
ATOM   2746  N  NH2   . ARG D  4  89   ? 261.324 257.176 157.029 1.00 75.64  ? 89   ARG U NH2   1 
ATOM   2747  N  N     . GLU D  4  90   ? 257.824 253.679 150.716 1.00 52.89  ? 90   GLU U N     1 
ATOM   2748  C  CA    . GLU D  4  90   ? 256.575 254.315 150.307 1.00 52.34  ? 90   GLU U CA    1 
ATOM   2749  C  C     . GLU D  4  90   ? 255.401 253.352 150.417 1.00 54.92  ? 90   GLU U C     1 
ATOM   2750  O  O     . GLU D  4  90   ? 254.305 253.748 150.831 1.00 53.16  ? 90   GLU U O     1 
ATOM   2751  C  CB    . GLU D  4  90   ? 256.698 254.852 148.881 1.00 52.37  ? 90   GLU U CB    1 
ATOM   2752  C  CG    . GLU D  4  90   ? 257.685 255.999 148.727 1.00 57.58  ? 90   GLU U CG    1 
ATOM   2753  C  CD    . GLU D  4  90   ? 259.121 255.532 148.594 1.00 80.03  ? 90   GLU U CD    1 
ATOM   2754  O  OE1   . GLU D  4  90   ? 259.364 254.309 148.675 1.00 75.48  ? 90   GLU U OE1   1 
ATOM   2755  O  OE2   . GLU D  4  90   ? 260.010 256.389 148.406 1.00 88.62  ? 90   GLU U OE2   1 
ATOM   2756  N  N     . ILE D  4  91   ? 255.604 252.086 150.051 1.00 49.40  ? 91   ILE U N     1 
ATOM   2757  C  CA    . ILE D  4  91   ? 254.544 251.095 150.210 1.00 42.93  ? 91   ILE U CA    1 
ATOM   2758  C  C     . ILE D  4  91   ? 254.224 250.907 151.686 1.00 41.10  ? 91   ILE U C     1 
ATOM   2759  O  O     . ILE D  4  91   ? 253.061 250.738 152.069 1.00 45.55  ? 91   ILE U O     1 
ATOM   2760  C  CB    . ILE D  4  91   ? 254.940 249.766 149.545 1.00 55.47  ? 91   ILE U CB    1 
ATOM   2761  C  CG1   . ILE D  4  91   ? 255.359 249.990 148.096 1.00 54.13  ? 91   ILE U CG1   1 
ATOM   2762  C  CG2   . ILE D  4  91   ? 253.760 248.819 149.543 1.00 50.59  ? 91   ILE U CG2   1 
ATOM   2763  C  CD1   . ILE D  4  91   ? 254.256 250.529 147.233 1.00 43.00  ? 91   ILE U CD1   1 
ATOM   2764  N  N     . GLN D  4  92   ? 255.252 250.949 152.537 1.00 37.22  ? 92   GLN U N     1 
ATOM   2765  C  CA    . GLN D  4  92   ? 255.038 250.806 153.975 1.00 47.61  ? 92   GLN U CA    1 
ATOM   2766  C  C     . GLN D  4  92   ? 254.191 251.950 154.519 1.00 51.35  ? 92   GLN U C     1 
ATOM   2767  O  O     . GLN D  4  92   ? 253.193 251.723 155.216 1.00 50.87  ? 92   GLN U O     1 
ATOM   2768  C  CB    . GLN D  4  92   ? 256.386 250.743 154.694 1.00 50.44  ? 92   GLN U CB    1 
ATOM   2769  C  CG    . GLN D  4  92   ? 256.290 250.485 156.184 1.00 52.85  ? 92   GLN U CG    1 
ATOM   2770  C  CD    . GLN D  4  92   ? 257.650 250.291 156.824 1.00 58.26  ? 92   GLN U CD    1 
ATOM   2771  O  OE1   . GLN D  4  92   ? 258.671 250.245 156.139 1.00 75.80  ? 92   GLN U OE1   1 
ATOM   2772  N  NE2   . GLN D  4  92   ? 257.672 250.184 158.148 1.00 56.59  ? 92   GLN U NE2   1 
ATOM   2773  N  N     . THR D  4  93   ? 254.574 253.189 154.205 1.00 51.68  ? 93   THR U N     1 
ATOM   2774  C  CA    . THR D  4  93   ? 253.807 254.339 154.669 1.00 46.12  ? 93   THR U CA    1 
ATOM   2775  C  C     . THR D  4  93   ? 252.387 254.313 154.113 1.00 51.97  ? 93   THR U C     1 
ATOM   2776  O  O     . THR D  4  93   ? 251.432 254.676 154.809 1.00 59.96  ? 93   THR U O     1 
ATOM   2777  C  CB    . THR D  4  93   ? 254.520 255.634 154.279 1.00 39.80  ? 93   THR U CB    1 
ATOM   2778  O  OG1   . THR D  4  93   ? 255.826 255.652 154.869 1.00 40.09  ? 93   THR U OG1   1 
ATOM   2779  C  CG2   . THR D  4  93   ? 253.746 256.845 154.768 1.00 40.86  ? 93   THR U CG2   1 
ATOM   2780  N  N     . ALA D  4  94   ? 252.230 253.871 152.861 1.00 43.69  ? 94   ALA U N     1 
ATOM   2781  C  CA    . ALA D  4  94   ? 250.895 253.766 152.279 1.00 44.60  ? 94   ALA U CA    1 
ATOM   2782  C  C     . ALA D  4  94   ? 250.046 252.747 153.028 1.00 54.92  ? 94   ALA U C     1 
ATOM   2783  O  O     . ALA D  4  94   ? 248.855 252.979 153.274 1.00 51.36  ? 94   ALA U O     1 
ATOM   2784  C  CB    . ALA D  4  94   ? 251.000 253.398 150.800 1.00 33.51  ? 94   ALA U CB    1 
ATOM   2785  N  N     . VAL D  4  95   ? 250.639 251.610 153.400 1.00 60.38  ? 95   VAL U N     1 
ATOM   2786  C  CA    . VAL D  4  95   ? 249.918 250.623 154.197 1.00 50.92  ? 95   VAL U CA    1 
ATOM   2787  C  C     . VAL D  4  95   ? 249.529 251.210 155.545 1.00 57.56  ? 95   VAL U C     1 
ATOM   2788  O  O     . VAL D  4  95   ? 248.409 251.001 156.029 1.00 55.30  ? 95   VAL U O     1 
ATOM   2789  C  CB    . VAL D  4  95   ? 250.761 249.344 154.357 1.00 53.03  ? 95   VAL U CB    1 
ATOM   2790  C  CG1   . VAL D  4  95   ? 250.108 248.400 155.345 1.00 48.42  ? 95   VAL U CG1   1 
ATOM   2791  C  CG2   . VAL D  4  95   ? 250.927 248.652 153.018 1.00 49.61  ? 95   VAL U CG2   1 
ATOM   2792  N  N     . ARG D  4  96   ? 250.436 251.964 156.168 1.00 50.69  ? 96   ARG U N     1 
ATOM   2793  C  CA    . ARG D  4  96   ? 250.117 252.587 157.447 1.00 54.69  ? 96   ARG U CA    1 
ATOM   2794  C  C     . ARG D  4  96   ? 249.036 253.652 157.320 1.00 58.15  ? 96   ARG U C     1 
ATOM   2795  O  O     . ARG D  4  96   ? 248.345 253.933 158.305 1.00 64.10  ? 96   ARG U O     1 
ATOM   2796  C  CB    . ARG D  4  96   ? 251.376 253.186 158.071 1.00 48.84  ? 96   ARG U CB    1 
ATOM   2797  C  CG    . ARG D  4  96   ? 252.417 252.148 158.454 1.00 59.03  ? 96   ARG U CG    1 
ATOM   2798  C  CD    . ARG D  4  96   ? 253.681 252.794 158.986 1.00 84.44  ? 96   ARG U CD    1 
ATOM   2799  N  NE    . ARG D  4  96   ? 253.441 253.539 160.217 1.00 103.54 ? 96   ARG U NE    1 
ATOM   2800  C  CZ    . ARG D  4  96   ? 254.358 254.280 160.830 1.00 99.94  ? 96   ARG U CZ    1 
ATOM   2801  N  NH1   . ARG D  4  96   ? 255.580 254.374 160.326 1.00 83.86  ? 96   ARG U NH1   1 
ATOM   2802  N  NH2   . ARG D  4  96   ? 254.052 254.926 161.946 1.00 99.43  ? 96   ARG U NH2   1 
ATOM   2803  N  N     . LEU D  4  97   ? 248.877 254.256 156.142 1.00 52.67  ? 97   LEU U N     1 
ATOM   2804  C  CA    . LEU D  4  97   ? 247.795 255.217 155.944 1.00 48.64  ? 97   LEU U CA    1 
ATOM   2805  C  C     . LEU D  4  97   ? 246.458 254.521 155.709 1.00 54.42  ? 97   LEU U C     1 
ATOM   2806  O  O     . LEU D  4  97   ? 245.447 254.883 156.319 1.00 62.69  ? 97   LEU U O     1 
ATOM   2807  C  CB    . LEU D  4  97   ? 248.119 256.148 154.775 1.00 41.87  ? 97   LEU U CB    1 
ATOM   2808  C  CG    . LEU D  4  97   ? 249.286 257.114 154.965 1.00 53.74  ? 97   LEU U CG    1 
ATOM   2809  C  CD1   . LEU D  4  97   ? 249.562 257.870 153.680 1.00 43.25  ? 97   LEU U CD1   1 
ATOM   2810  C  CD2   . LEU D  4  97   ? 248.986 258.077 156.097 1.00 56.16  ? 97   LEU U CD2   1 
ATOM   2811  N  N     . LEU D  4  98   ? 246.434 253.520 154.828 1.00 61.21  ? 98   LEU U N     1 
ATOM   2812  C  CA    . LEU D  4  98   ? 245.166 252.915 154.428 1.00 67.89  ? 98   LEU U CA    1 
ATOM   2813  C  C     . LEU D  4  98   ? 244.594 252.003 155.507 1.00 72.74  ? 98   LEU U C     1 
ATOM   2814  O  O     . LEU D  4  98   ? 243.412 252.117 155.859 1.00 79.48  ? 98   LEU U O     1 
ATOM   2815  C  CB    . LEU D  4  98   ? 245.345 252.141 153.122 1.00 60.33  ? 98   LEU U CB    1 
ATOM   2816  C  CG    . LEU D  4  98   ? 245.601 252.973 151.867 1.00 76.75  ? 98   LEU U CG    1 
ATOM   2817  C  CD1   . LEU D  4  98   ? 245.982 252.065 150.724 1.00 92.83  ? 98   LEU U CD1   1 
ATOM   2818  C  CD2   . LEU D  4  98   ? 244.355 253.757 151.512 1.00 84.82  ? 98   LEU U CD2   1 
ATOM   2819  N  N     . LEU D  4  99   ? 245.401 251.093 156.037 1.00 64.76  ? 99   LEU U N     1 
ATOM   2820  C  CA    . LEU D  4  99   ? 244.884 250.069 156.938 1.00 57.06  ? 99   LEU U CA    1 
ATOM   2821  C  C     . LEU D  4  99   ? 244.791 250.609 158.359 1.00 69.72  ? 99   LEU U C     1 
ATOM   2822  O  O     . LEU D  4  99   ? 245.803 251.046 158.911 1.00 83.95  ? 99   LEU U O     1 
ATOM   2823  C  CB    . LEU D  4  99   ? 245.771 248.833 156.903 1.00 48.50  ? 99   LEU U CB    1 
ATOM   2824  C  CG    . LEU D  4  99   ? 245.826 248.116 155.554 1.00 51.89  ? 99   LEU U CG    1 
ATOM   2825  C  CD1   . LEU D  4  99   ? 246.783 246.941 155.604 1.00 58.86  ? 99   LEU U CD1   1 
ATOM   2826  C  CD2   . LEU D  4  99   ? 244.443 247.665 155.128 1.00 52.30  ? 99   LEU U CD2   1 
ATOM   2827  N  N     . PRO D  4  100  ? 243.608 250.623 158.976 1.00 74.28  ? 100  PRO U N     1 
ATOM   2828  C  CA    . PRO D  4  100  ? 243.498 251.108 160.358 1.00 71.71  ? 100  PRO U CA    1 
ATOM   2829  C  C     . PRO D  4  100  ? 244.121 250.132 161.348 1.00 86.25  ? 100  PRO U C     1 
ATOM   2830  O  O     . PRO D  4  100  ? 243.867 248.926 161.299 1.00 102.22 ? 100  PRO U O     1 
ATOM   2831  C  CB    . PRO D  4  100  ? 241.982 251.223 160.569 1.00 76.62  ? 100  PRO U CB    1 
ATOM   2832  C  CG    . PRO D  4  100  ? 241.418 251.346 159.187 1.00 75.00  ? 100  PRO U CG    1 
ATOM   2833  C  CD    . PRO D  4  100  ? 242.286 250.454 158.348 1.00 71.67  ? 100  PRO U CD    1 
ATOM   2834  N  N     . GLY D  4  101  ? 244.926 250.672 162.259 1.00 76.98  ? 101  GLY U N     1 
ATOM   2835  C  CA    . GLY D  4  101  ? 245.311 249.956 163.466 1.00 75.28  ? 101  GLY U CA    1 
ATOM   2836  C  C     . GLY D  4  101  ? 246.020 248.634 163.228 1.00 82.73  ? 101  GLY U C     1 
ATOM   2837  O  O     . GLY D  4  101  ? 247.063 248.558 162.561 1.00 87.72  ? 101  GLY U O     1 
ATOM   2838  N  N     . GLU D  4  102  ? 245.447 247.573 163.808 1.00 79.44  ? 102  GLU U N     1 
ATOM   2839  C  CA    . GLU D  4  102  ? 246.112 246.274 163.841 1.00 76.81  ? 102  GLU U CA    1 
ATOM   2840  C  C     . GLU D  4  102  ? 246.363 245.723 162.444 1.00 82.29  ? 102  GLU U C     1 
ATOM   2841  O  O     . GLU D  4  102  ? 247.347 245.007 162.233 1.00 85.84  ? 102  GLU U O     1 
ATOM   2842  C  CB    . GLU D  4  102  ? 245.285 245.283 164.659 1.00 83.39  ? 102  GLU U CB    1 
ATOM   2843  C  CG    . GLU D  4  102  ? 245.158 245.649 166.128 1.00 96.56  ? 102  GLU U CG    1 
ATOM   2844  C  CD    . GLU D  4  102  ? 246.502 245.753 166.822 1.00 107.81 ? 102  GLU U CD    1 
ATOM   2845  O  OE1   . GLU D  4  102  ? 247.391 244.926 166.534 1.00 114.55 ? 102  GLU U OE1   1 
ATOM   2846  O  OE2   . GLU D  4  102  ? 246.670 246.667 167.658 1.00 110.13 ? 102  GLU U OE2   1 
ATOM   2847  N  N     . LEU D  4  103  ? 245.487 246.030 161.486 1.00 65.83  ? 103  LEU U N     1 
ATOM   2848  C  CA    . LEU D  4  103  ? 245.757 245.634 160.109 1.00 72.52  ? 103  LEU U CA    1 
ATOM   2849  C  C     . LEU D  4  103  ? 247.041 246.277 159.605 1.00 79.46  ? 103  LEU U C     1 
ATOM   2850  O  O     . LEU D  4  103  ? 247.833 245.638 158.901 1.00 82.24  ? 103  LEU U O     1 
ATOM   2851  C  CB    . LEU D  4  103  ? 244.577 246.003 159.210 1.00 72.13  ? 103  LEU U CB    1 
ATOM   2852  C  CG    . LEU D  4  103  ? 243.257 245.287 159.489 1.00 73.32  ? 103  LEU U CG    1 
ATOM   2853  C  CD1   . LEU D  4  103  ? 242.156 245.832 158.593 1.00 80.70  ? 103  LEU U CD1   1 
ATOM   2854  C  CD2   . LEU D  4  103  ? 243.409 243.787 159.304 1.00 56.19  ? 103  LEU U CD2   1 
ATOM   2855  N  N     . ALA D  4  104  ? 247.274 247.539 159.971 1.00 65.22  ? 104  ALA U N     1 
ATOM   2856  C  CA    . ALA D  4  104  ? 248.514 248.201 159.586 1.00 60.51  ? 104  ALA U CA    1 
ATOM   2857  C  C     . ALA D  4  104  ? 249.708 247.599 160.311 1.00 66.85  ? 104  ALA U C     1 
ATOM   2858  O  O     . ALA D  4  104  ? 250.750 247.356 159.696 1.00 75.43  ? 104  ALA U O     1 
ATOM   2859  C  CB    . ALA D  4  104  ? 248.425 249.699 159.864 1.00 62.79  ? 104  ALA U CB    1 
ATOM   2860  N  N     . LYS D  4  105  ? 249.580 247.352 161.615 1.00 71.32  ? 105  LYS U N     1 
ATOM   2861  C  CA    . LYS D  4  105  ? 250.715 246.840 162.380 1.00 68.22  ? 105  LYS U CA    1 
ATOM   2862  C  C     . LYS D  4  105  ? 251.125 245.452 161.898 1.00 72.16  ? 105  LYS U C     1 
ATOM   2863  O  O     . LYS D  4  105  ? 252.281 245.222 161.527 1.00 80.34  ? 105  LYS U O     1 
ATOM   2864  C  CB    . LYS D  4  105  ? 250.372 246.824 163.871 1.00 74.79  ? 105  LYS U CB    1 
ATOM   2865  C  CG    . LYS D  4  105  ? 250.189 248.211 164.467 1.00 93.47  ? 105  LYS U CG    1 
ATOM   2866  C  CD    . LYS D  4  105  ? 249.771 248.145 165.926 1.00 108.47 ? 105  LYS U CD    1 
ATOM   2867  C  CE    . LYS D  4  105  ? 249.616 249.539 166.515 1.00 110.60 ? 105  LYS U CE    1 
ATOM   2868  N  NZ    . LYS D  4  105  ? 249.148 249.498 167.927 1.00 106.62 ? 105  LYS U NZ    1 
ATOM   2869  N  N     . HIS D  4  106  ? 250.177 244.512 161.885 1.00 68.83  ? 106  HIS U N     1 
ATOM   2870  C  CA    . HIS D  4  106  ? 250.485 243.162 161.430 1.00 60.78  ? 106  HIS U CA    1 
ATOM   2871  C  C     . HIS D  4  106  ? 250.840 243.132 159.949 1.00 70.67  ? 106  HIS U C     1 
ATOM   2872  O  O     . HIS D  4  106  ? 251.659 242.307 159.528 1.00 75.01  ? 106  HIS U O     1 
ATOM   2873  C  CB    . HIS D  4  106  ? 249.310 242.225 161.713 1.00 73.10  ? 106  HIS U CB    1 
ATOM   2874  C  CG    . HIS D  4  106  ? 248.982 242.089 163.167 1.00 88.61  ? 106  HIS U CG    1 
ATOM   2875  N  ND1   . HIS D  4  106  ? 249.807 241.435 164.057 1.00 75.90  ? 106  HIS U ND1   1 
ATOM   2876  C  CD2   . HIS D  4  106  ? 247.917 242.515 163.885 1.00 98.17  ? 106  HIS U CD2   1 
ATOM   2877  C  CE1   . HIS D  4  106  ? 249.265 241.467 165.261 1.00 92.43  ? 106  HIS U CE1   1 
ATOM   2878  N  NE2   . HIS D  4  106  ? 248.118 242.118 165.185 1.00 96.19  ? 106  HIS U NE2   1 
ATOM   2879  N  N     . ALA D  4  107  ? 250.241 244.014 159.146 1.00 70.28  ? 107  ALA U N     1 
ATOM   2880  C  CA    . ALA D  4  107  ? 250.572 244.058 157.725 1.00 60.21  ? 107  ALA U CA    1 
ATOM   2881  C  C     . ALA D  4  107  ? 252.017 244.492 157.510 1.00 69.97  ? 107  ALA U C     1 
ATOM   2882  O  O     . ALA D  4  107  ? 252.753 243.872 156.734 1.00 72.46  ? 107  ALA U O     1 
ATOM   2883  C  CB    . ALA D  4  107  ? 249.610 244.993 156.991 1.00 64.25  ? 107  ALA U CB    1 
ATOM   2884  N  N     . VAL D  4  108  ? 252.438 245.559 158.192 1.00 56.46  ? 108  VAL U N     1 
ATOM   2885  C  CA    . VAL D  4  108  ? 253.824 246.008 158.098 1.00 54.78  ? 108  VAL U CA    1 
ATOM   2886  C  C     . VAL D  4  108  ? 254.765 244.945 158.647 1.00 64.00  ? 108  VAL U C     1 
ATOM   2887  O  O     . VAL D  4  108  ? 255.880 244.765 158.140 1.00 62.84  ? 108  VAL U O     1 
ATOM   2888  C  CB    . VAL D  4  108  ? 254.001 247.356 158.824 1.00 67.90  ? 108  VAL U CB    1 
ATOM   2889  C  CG1   . VAL D  4  108  ? 255.465 247.754 158.870 1.00 59.08  ? 108  VAL U CG1   1 
ATOM   2890  C  CG2   . VAL D  4  108  ? 253.191 248.440 158.132 1.00 63.55  ? 108  VAL U CG2   1 
ATOM   2891  N  N     . SER D  4  109  ? 254.336 244.216 159.680 1.00 67.73  ? 109  SER U N     1 
ATOM   2892  C  CA    . SER D  4  109  ? 255.167 243.144 160.217 1.00 67.87  ? 109  SER U CA    1 
ATOM   2893  C  C     . SER D  4  109  ? 255.384 242.045 159.181 1.00 68.84  ? 109  SER U C     1 
ATOM   2894  O  O     . SER D  4  109  ? 256.526 241.655 158.901 1.00 65.90  ? 109  SER U O     1 
ATOM   2895  C  CB    . SER D  4  109  ? 254.529 242.574 161.483 1.00 59.79  ? 109  SER U CB    1 
ATOM   2896  O  OG    . SER D  4  109  ? 255.297 241.502 162.001 1.00 70.08  ? 109  SER U OG    1 
ATOM   2897  N  N     . GLU D  4  110  ? 254.296 241.541 158.593 1.00 80.72  ? 110  GLU U N     1 
ATOM   2898  C  CA    . GLU D  4  110  ? 254.410 240.468 157.610 1.00 76.41  ? 110  GLU U CA    1 
ATOM   2899  C  C     . GLU D  4  110  ? 255.200 240.919 156.388 1.00 73.50  ? 110  GLU U C     1 
ATOM   2900  O  O     . GLU D  4  110  ? 256.051 240.178 155.882 1.00 80.55  ? 110  GLU U O     1 
ATOM   2901  C  CB    . GLU D  4  110  ? 253.021 239.984 157.196 1.00 80.51  ? 110  GLU U CB    1 
ATOM   2902  C  CG    . GLU D  4  110  ? 252.219 239.336 158.316 1.00 97.37  ? 110  GLU U CG    1 
ATOM   2903  C  CD    . GLU D  4  110  ? 252.907 238.120 158.905 1.00 111.68 ? 110  GLU U CD    1 
ATOM   2904  O  OE1   . GLU D  4  110  ? 253.516 237.347 158.135 1.00 119.14 ? 110  GLU U OE1   1 
ATOM   2905  O  OE2   . GLU D  4  110  ? 252.836 237.937 160.139 1.00 113.65 ? 110  GLU U OE2   1 
ATOM   2906  N  N     . GLY D  4  111  ? 254.932 242.130 155.898 1.00 60.61  ? 111  GLY U N     1 
ATOM   2907  C  CA    . GLY D  4  111  ? 255.649 242.616 154.731 1.00 66.12  ? 111  GLY U CA    1 
ATOM   2908  C  C     . GLY D  4  111  ? 257.131 242.800 154.994 1.00 66.27  ? 111  GLY U C     1 
ATOM   2909  O  O     . GLY D  4  111  ? 257.975 242.396 154.189 1.00 72.12  ? 111  GLY U O     1 
ATOM   2910  N  N     . THR D  4  112  ? 257.467 243.418 156.130 1.00 61.25  ? 112  THR U N     1 
ATOM   2911  C  CA    . THR D  4  112  ? 258.870 243.600 156.486 1.00 64.90  ? 112  THR U CA    1 
ATOM   2912  C  C     . THR D  4  112  ? 259.574 242.259 156.637 1.00 74.96  ? 112  THR U C     1 
ATOM   2913  O  O     . THR D  4  112  ? 260.733 242.108 156.234 1.00 74.19  ? 112  THR U O     1 
ATOM   2914  C  CB    . THR D  4  112  ? 258.980 244.415 157.776 1.00 76.58  ? 112  THR U CB    1 
ATOM   2915  O  OG1   . THR D  4  112  ? 258.370 245.697 157.583 1.00 78.62  ? 112  THR U OG1   1 
ATOM   2916  C  CG2   . THR D  4  112  ? 260.437 244.611 158.163 1.00 91.52  ? 112  THR U CG2   1 
ATOM   2917  N  N     . LYS D  4  113  ? 258.883 241.266 157.206 1.00 83.16  ? 113  LYS U N     1 
ATOM   2918  C  CA    . LYS D  4  113  ? 259.459 239.929 157.287 1.00 74.60  ? 113  LYS U CA    1 
ATOM   2919  C  C     . LYS D  4  113  ? 259.676 239.338 155.899 1.00 79.56  ? 113  LYS U C     1 
ATOM   2920  O  O     . LYS D  4  113  ? 260.676 238.652 155.655 1.00 88.30  ? 113  LYS U O     1 
ATOM   2921  C  CB    . LYS D  4  113  ? 258.557 239.022 158.123 1.00 73.46  ? 113  LYS U CB    1 
ATOM   2922  C  CG    . LYS D  4  113  ? 259.070 237.600 158.271 1.00 91.79  ? 113  LYS U CG    1 
ATOM   2923  C  CD    . LYS D  4  113  ? 258.133 236.762 159.125 1.00 103.10 ? 113  LYS U CD    1 
ATOM   2924  C  CE    . LYS D  4  113  ? 256.890 236.365 158.345 1.00 101.70 ? 113  LYS U CE    1 
ATOM   2925  N  NZ    . LYS D  4  113  ? 255.970 235.525 159.160 1.00 100.35 ? 113  LYS U NZ    1 
ATOM   2926  N  N     . ALA D  4  114  ? 258.753 239.608 154.971 1.00 69.38  ? 114  ALA U N     1 
ATOM   2927  C  CA    . ALA D  4  114  ? 258.867 239.045 153.629 1.00 72.03  ? 114  ALA U CA    1 
ATOM   2928  C  C     . ALA D  4  114  ? 260.031 239.657 152.861 1.00 76.44  ? 114  ALA U C     1 
ATOM   2929  O  O     . ALA D  4  114  ? 260.771 238.945 152.175 1.00 83.80  ? 114  ALA U O     1 
ATOM   2930  C  CB    . ALA D  4  114  ? 257.559 239.239 152.864 1.00 69.07  ? 114  ALA U CB    1 
ATOM   2931  N  N     . VAL D  4  115  ? 260.205 240.977 152.952 1.00 71.17  ? 115  VAL U N     1 
ATOM   2932  C  CA    . VAL D  4  115  ? 261.351 241.610 152.308 1.00 78.42  ? 115  VAL U CA    1 
ATOM   2933  C  C     . VAL D  4  115  ? 262.646 241.166 152.980 1.00 88.87  ? 115  VAL U C     1 
ATOM   2934  O  O     . VAL D  4  115  ? 263.660 240.932 152.311 1.00 95.55  ? 115  VAL U O     1 
ATOM   2935  C  CB    . VAL D  4  115  ? 261.198 243.141 152.323 1.00 73.80  ? 115  VAL U CB    1 
ATOM   2936  C  CG1   . VAL D  4  115  ? 262.439 243.809 151.753 1.00 66.48  ? 115  VAL U CG1   1 
ATOM   2937  C  CG2   . VAL D  4  115  ? 259.967 243.554 151.539 1.00 77.42  ? 115  VAL U CG2   1 
ATOM   2938  N  N     . THR D  4  116  ? 262.626 241.043 154.309 1.00 89.35  ? 116  THR U N     1 
ATOM   2939  C  CA    . THR D  4  116  ? 263.775 240.534 155.049 1.00 96.25  ? 116  THR U CA    1 
ATOM   2940  C  C     . THR D  4  116  ? 264.225 239.184 154.503 1.00 95.97  ? 116  THR U C     1 
ATOM   2941  O  O     . THR D  4  116  ? 265.359 239.032 154.036 1.00 101.10 ? 116  THR U O     1 
ATOM   2942  C  CB    . THR D  4  116  ? 263.434 240.430 156.536 1.00 116.20 ? 116  THR U CB    1 
ATOM   2943  O  OG1   . THR D  4  116  ? 263.103 241.728 157.043 1.00 105.10 ? 116  THR U OG1   1 
ATOM   2944  C  CG2   . THR D  4  116  ? 264.616 239.873 157.314 1.00 113.35 ? 116  THR U CG2   1 
ATOM   2945  N  N     . LYS D  4  117  ? 263.345 238.181 154.576 1.00 104.33 ? 117  LYS U N     1 
ATOM   2946  C  CA    . LYS D  4  117  ? 263.680 236.859 154.055 1.00 105.35 ? 117  LYS U CA    1 
ATOM   2947  C  C     . LYS D  4  117  ? 264.034 236.905 152.573 1.00 106.70 ? 117  LYS U C     1 
ATOM   2948  O  O     . LYS D  4  117  ? 264.878 236.127 152.114 1.00 108.65 ? 117  LYS U O     1 
ATOM   2949  C  CB    . LYS D  4  117  ? 262.515 235.896 154.294 1.00 94.27  ? 117  LYS U CB    1 
ATOM   2950  C  CG    . LYS D  4  117  ? 262.776 234.470 153.836 1.00 106.24 ? 117  LYS U CG    1 
ATOM   2951  C  CD    . LYS D  4  117  ? 261.572 233.578 154.100 1.00 113.53 ? 117  LYS U CD    1 
ATOM   2952  C  CE    . LYS D  4  117  ? 261.748 232.209 153.465 1.00 125.02 ? 117  LYS U CE    1 
ATOM   2953  N  NZ    . LYS D  4  117  ? 262.906 231.469 154.036 1.00 125.43 ? 117  LYS U NZ    1 
ATOM   2954  N  N     . TYR D  4  118  ? 263.407 237.805 151.813 1.00 95.25  ? 118  TYR U N     1 
ATOM   2955  C  CA    . TYR D  4  118  ? 263.674 237.895 150.381 1.00 89.51  ? 118  TYR U CA    1 
ATOM   2956  C  C     . TYR D  4  118  ? 265.121 238.296 150.113 1.00 100.77 ? 118  TYR U C     1 
ATOM   2957  O  O     . TYR D  4  118  ? 265.859 237.585 149.421 1.00 104.83 ? 118  TYR U O     1 
ATOM   2958  C  CB    . TYR D  4  118  ? 262.711 238.889 149.731 1.00 84.59  ? 118  TYR U CB    1 
ATOM   2959  C  CG    . TYR D  4  118  ? 262.978 239.131 148.263 1.00 87.06  ? 118  TYR U CG    1 
ATOM   2960  C  CD1   . TYR D  4  118  ? 262.576 238.211 147.303 1.00 85.82  ? 118  TYR U CD1   1 
ATOM   2961  C  CD2   . TYR D  4  118  ? 263.627 240.280 147.836 1.00 81.62  ? 118  TYR U CD2   1 
ATOM   2962  C  CE1   . TYR D  4  118  ? 262.818 238.430 145.962 1.00 83.01  ? 118  TYR U CE1   1 
ATOM   2963  C  CE2   . TYR D  4  118  ? 263.873 240.506 146.496 1.00 87.52  ? 118  TYR U CE2   1 
ATOM   2964  C  CZ    . TYR D  4  118  ? 263.465 239.579 145.564 1.00 93.14  ? 118  TYR U CZ    1 
ATOM   2965  O  OH    . TYR D  4  118  ? 263.708 239.801 144.228 1.00 101.19 ? 118  TYR U OH    1 
ATOM   2966  N  N     . THR D  4  119  ? 265.545 239.437 150.657 1.00 100.54 ? 119  THR U N     1 
ATOM   2967  C  CA    . THR D  4  119  ? 266.891 239.931 150.394 1.00 109.22 ? 119  THR U CA    1 
ATOM   2968  C  C     . THR D  4  119  ? 267.960 239.190 151.185 1.00 108.59 ? 119  THR U C     1 
ATOM   2969  O  O     . THR D  4  119  ? 269.136 239.248 150.814 1.00 106.57 ? 119  THR U O     1 
ATOM   2970  C  CB    . THR D  4  119  ? 266.979 241.426 150.703 1.00 109.79 ? 119  THR U CB    1 
ATOM   2971  O  OG1   . THR D  4  119  ? 266.640 241.654 152.076 1.00 118.58 ? 119  THR U OG1   1 
ATOM   2972  C  CG2   . THR D  4  119  ? 266.025 242.211 149.814 1.00 96.38  ? 119  THR U CG2   1 
ATOM   2973  N  N     . SER D  4  120  ? 267.580 238.500 152.263 1.00 113.13 ? 120  SER U N     1 
ATOM   2974  C  CA    . SER D  4  120  ? 268.565 237.793 153.075 1.00 111.60 ? 120  SER U CA    1 
ATOM   2975  C  C     . SER D  4  120  ? 269.115 236.578 152.339 1.00 120.70 ? 120  SER U C     1 
ATOM   2976  O  O     . SER D  4  120  ? 270.335 236.409 152.223 1.00 124.39 ? 120  SER U O     1 
ATOM   2977  C  CB    . SER D  4  120  ? 267.945 237.382 154.411 1.00 106.73 ? 120  SER U CB    1 
ATOM   2978  O  OG    . SER D  4  120  ? 267.587 238.519 155.177 1.00 105.41 ? 120  SER U OG    1 
ATOM   2979  N  N     . ALA D  4  121  ? 268.232 235.722 151.835 1.00 132.88 ? 121  ALA U N     1 
ATOM   2980  C  CA    . ALA D  4  121  ? 268.653 234.524 151.121 1.00 127.21 ? 121  ALA U CA    1 
ATOM   2981  C  C     . ALA D  4  121  ? 269.118 234.865 149.710 1.00 132.16 ? 121  ALA U C     1 
ATOM   2982  O  O     . ALA D  4  121  ? 268.997 236.007 149.265 1.00 128.86 ? 121  ALA U O     1 
ATOM   2983  C  CB    . ALA D  4  121  ? 267.521 233.509 151.076 1.00 125.76 ? 121  ALA U CB    1 
ATOM   2984  N  N     . ARG E  1  40   ? 193.895 235.698 164.662 1.00 171.95 ? 40   ARG V N     1 
ATOM   2985  C  CA    . ARG E  1  40   ? 194.634 236.788 164.045 1.00 188.05 ? 40   ARG V CA    1 
ATOM   2986  C  C     . ARG E  1  40   ? 195.794 237.201 164.940 1.00 186.48 ? 40   ARG V C     1 
ATOM   2987  O  O     . ARG E  1  40   ? 195.662 237.235 166.166 1.00 184.86 ? 40   ARG V O     1 
ATOM   2988  C  CB    . ARG E  1  40   ? 193.723 237.992 163.785 1.00 160.27 ? 40   ARG V CB    1 
ATOM   2989  C  CG    . ARG E  1  40   ? 192.674 237.761 162.712 1.00 168.45 ? 40   ARG V CG    1 
ATOM   2990  C  CD    . ARG E  1  40   ? 191.755 238.965 162.580 1.00 168.23 ? 40   ARG V CD    1 
ATOM   2991  N  NE    . ARG E  1  40   ? 192.471 240.161 162.145 1.00 160.46 ? 40   ARG V NE    1 
ATOM   2992  C  CZ    . ARG E  1  40   ? 192.712 240.468 160.875 1.00 156.16 ? 40   ARG V CZ    1 
ATOM   2993  N  NH1   . ARG E  1  40   ? 192.289 239.668 159.906 1.00 151.35 ? 40   ARG V NH1   1 
ATOM   2994  N  NH2   . ARG E  1  40   ? 193.373 241.577 160.573 1.00 160.37 ? 40   ARG V NH2   1 
ATOM   2995  N  N     . TYR E  1  41   ? 196.930 237.514 164.323 1.00 203.86 ? 41   TYR V N     1 
ATOM   2996  C  CA    . TYR E  1  41   ? 198.086 237.983 165.068 1.00 190.72 ? 41   TYR V CA    1 
ATOM   2997  C  C     . TYR E  1  41   ? 197.909 239.445 165.463 1.00 186.49 ? 41   TYR V C     1 
ATOM   2998  O  O     . TYR E  1  41   ? 197.268 240.230 164.756 1.00 185.22 ? 41   TYR V O     1 
ATOM   2999  C  CB    . TYR E  1  41   ? 199.365 237.822 164.245 1.00 211.51 ? 41   TYR V CB    1 
ATOM   3000  C  CG    . TYR E  1  41   ? 199.737 236.389 163.950 1.00 211.55 ? 41   TYR V CG    1 
ATOM   3001  C  CD1   . TYR E  1  41   ? 199.597 235.400 164.913 1.00 205.51 ? 41   TYR V CD1   1 
ATOM   3002  C  CD2   . TYR E  1  41   ? 200.240 236.026 162.707 1.00 210.11 ? 41   TYR V CD2   1 
ATOM   3003  C  CE1   . TYR E  1  41   ? 199.940 234.089 164.646 1.00 199.08 ? 41   TYR V CE1   1 
ATOM   3004  C  CE2   . TYR E  1  41   ? 200.585 234.717 162.431 1.00 210.10 ? 41   TYR V CE2   1 
ATOM   3005  C  CZ    . TYR E  1  41   ? 200.433 233.754 163.405 1.00 206.67 ? 41   TYR V CZ    1 
ATOM   3006  O  OH    . TYR E  1  41   ? 200.776 232.449 163.134 1.00 210.25 ? 41   TYR V OH    1 
ATOM   3007  N  N     . ARG E  1  42   ? 198.480 239.801 166.610 1.00 177.26 ? 42   ARG V N     1 
ATOM   3008  C  CA    . ARG E  1  42   ? 198.476 241.192 167.029 1.00 178.76 ? 42   ARG V CA    1 
ATOM   3009  C  C     . ARG E  1  42   ? 199.281 242.024 166.034 1.00 178.63 ? 42   ARG V C     1 
ATOM   3010  O  O     . ARG E  1  42   ? 200.345 241.584 165.579 1.00 177.68 ? 42   ARG V O     1 
ATOM   3011  C  CB    . ARG E  1  42   ? 199.060 241.327 168.436 1.00 179.19 ? 42   ARG V CB    1 
ATOM   3012  C  CG    . ARG E  1  42   ? 199.104 242.750 168.968 1.00 188.81 ? 42   ARG V CG    1 
ATOM   3013  C  CD    . ARG E  1  42   ? 199.725 242.806 170.353 1.00 200.17 ? 42   ARG V CD    1 
ATOM   3014  N  NE    . ARG E  1  42   ? 198.903 242.130 171.351 1.00 219.58 ? 42   ARG V NE    1 
ATOM   3015  C  CZ    . ARG E  1  42   ? 199.249 241.985 172.626 1.00 229.58 ? 42   ARG V CZ    1 
ATOM   3016  N  NH1   . ARG E  1  42   ? 200.405 242.468 173.062 1.00 228.09 ? 42   ARG V NH1   1 
ATOM   3017  N  NH2   . ARG E  1  42   ? 198.439 241.356 173.467 1.00 231.73 ? 42   ARG V NH2   1 
ATOM   3018  N  N     . PRO E  1  43   ? 198.796 243.206 165.654 1.00 153.37 ? 43   PRO V N     1 
ATOM   3019  C  CA    . PRO E  1  43   ? 199.521 244.020 164.667 1.00 154.72 ? 43   PRO V CA    1 
ATOM   3020  C  C     . PRO E  1  43   ? 200.945 244.312 165.118 1.00 155.05 ? 43   PRO V C     1 
ATOM   3021  O  O     . PRO E  1  43   ? 201.189 244.720 166.258 1.00 146.91 ? 43   PRO V O     1 
ATOM   3022  C  CB    . PRO E  1  43   ? 198.679 245.296 164.586 1.00 155.10 ? 43   PRO V CB    1 
ATOM   3023  C  CG    . PRO E  1  43   ? 197.305 244.851 164.943 1.00 151.89 ? 43   PRO V CG    1 
ATOM   3024  C  CD    . PRO E  1  43   ? 197.480 243.782 165.988 1.00 157.05 ? 43   PRO V CD    1 
ATOM   3025  N  N     . GLY E  1  44   ? 201.890 244.099 164.204 1.00 134.60 ? 44   GLY V N     1 
ATOM   3026  C  CA    . GLY E  1  44   ? 203.300 244.305 164.458 1.00 123.93 ? 44   GLY V CA    1 
ATOM   3027  C  C     . GLY E  1  44   ? 204.106 243.033 164.594 1.00 127.37 ? 44   GLY V C     1 
ATOM   3028  O  O     . GLY E  1  44   ? 205.339 243.091 164.521 1.00 128.87 ? 44   GLY V O     1 
ATOM   3029  N  N     . THR E  1  45   ? 203.452 241.887 164.787 1.00 127.80 ? 45   THR V N     1 
ATOM   3030  C  CA    . THR E  1  45   ? 204.178 240.624 164.876 1.00 122.08 ? 45   THR V CA    1 
ATOM   3031  C  C     . THR E  1  45   ? 204.595 240.127 163.497 1.00 117.79 ? 45   THR V C     1 
ATOM   3032  O  O     . THR E  1  45   ? 205.742 239.711 163.294 1.00 126.26 ? 45   THR V O     1 
ATOM   3033  C  CB    . THR E  1  45   ? 203.322 239.573 165.584 1.00 160.41 ? 45   THR V CB    1 
ATOM   3034  O  OG1   . THR E  1  45   ? 203.018 240.022 166.912 1.00 169.70 ? 45   THR V OG1   1 
ATOM   3035  C  CG2   . THR E  1  45   ? 204.066 238.250 165.663 1.00 150.85 ? 45   THR V CG2   1 
ATOM   3036  N  N     . VAL E  1  46   ? 203.669 240.167 162.535 1.00 109.41 ? 46   VAL V N     1 
ATOM   3037  C  CA    . VAL E  1  46   ? 203.988 239.759 161.170 1.00 115.50 ? 46   VAL V CA    1 
ATOM   3038  C  C     . VAL E  1  46   ? 205.101 240.632 160.603 1.00 120.25 ? 46   VAL V C     1 
ATOM   3039  O  O     . VAL E  1  46   ? 205.968 240.153 159.863 1.00 118.73 ? 46   VAL V O     1 
ATOM   3040  C  CB    . VAL E  1  46   ? 202.724 239.807 160.293 1.00 127.58 ? 46   VAL V CB    1 
ATOM   3041  C  CG1   . VAL E  1  46   ? 203.056 239.474 158.846 1.00 124.06 ? 46   VAL V CG1   1 
ATOM   3042  C  CG2   . VAL E  1  46   ? 201.667 238.861 160.834 1.00 130.37 ? 46   VAL V CG2   1 
ATOM   3043  N  N     . ALA E  1  47   ? 205.099 241.921 160.952 1.00 100.84 ? 47   ALA V N     1 
ATOM   3044  C  CA    . ALA E  1  47   ? 206.154 242.811 160.482 1.00 96.90  ? 47   ALA V CA    1 
ATOM   3045  C  C     . ALA E  1  47   ? 207.516 242.378 161.006 1.00 99.23  ? 47   ALA V C     1 
ATOM   3046  O  O     . ALA E  1  47   ? 208.503 242.381 160.261 1.00 95.17  ? 47   ALA V O     1 
ATOM   3047  C  CB    . ALA E  1  47   ? 205.850 244.250 160.901 1.00 79.81  ? 47   ALA V CB    1 
ATOM   3048  N  N     . LEU E  1  48   ? 207.592 241.995 162.282 1.00 95.56  ? 48   LEU V N     1 
ATOM   3049  C  CA    . LEU E  1  48   ? 208.861 241.544 162.842 1.00 96.14  ? 48   LEU V CA    1 
ATOM   3050  C  C     . LEU E  1  48   ? 209.302 240.223 162.221 1.00 98.84  ? 48   LEU V C     1 
ATOM   3051  O  O     . LEU E  1  48   ? 210.484 240.046 161.897 1.00 112.29 ? 48   LEU V O     1 
ATOM   3052  C  CB    . LEU E  1  48   ? 208.751 241.415 164.359 1.00 95.51  ? 48   LEU V CB    1 
ATOM   3053  C  CG    . LEU E  1  48   ? 208.497 242.719 165.115 1.00 105.57 ? 48   LEU V CG    1 
ATOM   3054  C  CD1   . LEU E  1  48   ? 208.277 242.445 166.591 1.00 104.61 ? 48   LEU V CD1   1 
ATOM   3055  C  CD2   . LEU E  1  48   ? 209.649 243.688 164.911 1.00 111.53 ? 48   LEU V CD2   1 
ATOM   3056  N  N     . ARG E  1  49   ? 208.366 239.286 162.048 1.00 98.68  ? 49   ARG V N     1 
ATOM   3057  C  CA    . ARG E  1  49   ? 208.713 238.022 161.409 1.00 104.95 ? 49   ARG V CA    1 
ATOM   3058  C  C     . ARG E  1  49   ? 209.226 238.251 159.991 1.00 107.69 ? 49   ARG V C     1 
ATOM   3059  O  O     . ARG E  1  49   ? 210.141 237.558 159.532 1.00 103.59 ? 49   ARG V O     1 
ATOM   3060  C  CB    . ARG E  1  49   ? 207.508 237.081 161.408 1.00 134.54 ? 49   ARG V CB    1 
ATOM   3061  C  CG    . ARG E  1  49   ? 207.806 235.696 160.855 1.00 147.41 ? 49   ARG V CG    1 
ATOM   3062  C  CD    . ARG E  1  49   ? 206.589 234.784 160.920 1.00 167.51 ? 49   ARG V CD    1 
ATOM   3063  N  NE    . ARG E  1  49   ? 205.500 235.238 160.062 1.00 173.85 ? 49   ARG V NE    1 
ATOM   3064  C  CZ    . ARG E  1  49   ? 204.400 235.837 160.506 1.00 170.45 ? 49   ARG V CZ    1 
ATOM   3065  N  NH1   . ARG E  1  49   ? 204.237 236.055 161.804 1.00 150.16 ? 49   ARG V NH1   1 
ATOM   3066  N  NH2   . ARG E  1  49   ? 203.459 236.216 159.652 1.00 177.08 ? 49   ARG V NH2   1 
ATOM   3067  N  N     . GLU E  1  50   ? 208.657 239.234 159.289 1.00 96.80  ? 50   GLU V N     1 
ATOM   3068  C  CA    . GLU E  1  50   ? 209.183 239.596 157.978 1.00 94.33  ? 50   GLU V CA    1 
ATOM   3069  C  C     . GLU E  1  50   ? 210.567 240.222 158.090 1.00 95.64  ? 50   GLU V C     1 
ATOM   3070  O  O     . GLU E  1  50   ? 211.423 239.997 157.231 1.00 92.84  ? 50   GLU V O     1 
ATOM   3071  C  CB    . GLU E  1  50   ? 208.223 240.545 157.259 1.00 90.54  ? 50   GLU V CB    1 
ATOM   3072  C  CG    . GLU E  1  50   ? 206.910 239.910 156.842 1.00 88.57  ? 50   GLU V CG    1 
ATOM   3073  C  CD    . GLU E  1  50   ? 205.981 240.897 156.161 1.00 115.89 ? 50   GLU V CD    1 
ATOM   3074  O  OE1   . GLU E  1  50   ? 206.288 242.108 156.174 1.00 118.18 ? 50   GLU V OE1   1 
ATOM   3075  O  OE2   . GLU E  1  50   ? 204.946 240.464 155.614 1.00 127.11 ? 50   GLU V OE2   1 
ATOM   3076  N  N     . ILE E  1  51   ? 210.804 241.016 159.138 1.00 87.89  ? 51   ILE V N     1 
ATOM   3077  C  CA    . ILE E  1  51   ? 212.130 241.594 159.337 1.00 86.09  ? 51   ILE V CA    1 
ATOM   3078  C  C     . ILE E  1  51   ? 213.173 240.492 159.459 1.00 85.35  ? 51   ILE V C     1 
ATOM   3079  O  O     . ILE E  1  51   ? 214.202 240.506 158.769 1.00 95.99  ? 51   ILE V O     1 
ATOM   3080  C  CB    . ILE E  1  51   ? 212.142 242.521 160.567 1.00 78.82  ? 51   ILE V CB    1 
ATOM   3081  C  CG1   . ILE E  1  51   ? 211.321 243.782 160.298 1.00 80.14  ? 51   ILE V CG1   1 
ATOM   3082  C  CG2   . ILE E  1  51   ? 213.568 242.878 160.948 1.00 71.23  ? 51   ILE V CG2   1 
ATOM   3083  C  CD1   . ILE E  1  51   ? 211.118 244.647 161.523 1.00 80.18  ? 51   ILE V CD1   1 
ATOM   3084  N  N     . ARG E  1  52   ? 212.920 239.513 160.330 1.00 79.75  ? 52   ARG V N     1 
ATOM   3085  C  CA    . ARG E  1  52   ? 213.863 238.407 160.476 1.00 90.57  ? 52   ARG V CA    1 
ATOM   3086  C  C     . ARG E  1  52   ? 213.983 237.611 159.180 1.00 96.41  ? 52   ARG V C     1 
ATOM   3087  O  O     . ARG E  1  52   ? 215.087 237.202 158.794 1.00 97.71  ? 52   ARG V O     1 
ATOM   3088  C  CB    . ARG E  1  52   ? 213.434 237.502 161.627 1.00 115.02 ? 52   ARG V CB    1 
ATOM   3089  C  CG    . ARG E  1  52   ? 213.516 238.160 162.993 1.00 127.11 ? 52   ARG V CG    1 
ATOM   3090  C  CD    . ARG E  1  52   ? 213.046 237.222 164.092 1.00 136.51 ? 52   ARG V CD    1 
ATOM   3091  N  NE    . ARG E  1  52   ? 213.143 237.835 165.413 1.00 147.63 ? 52   ARG V NE    1 
ATOM   3092  C  CZ    . ARG E  1  52   ? 212.216 238.631 165.936 1.00 156.44 ? 52   ARG V CZ    1 
ATOM   3093  N  NH1   . ARG E  1  52   ? 211.118 238.913 165.251 1.00 148.96 ? 52   ARG V NH1   1 
ATOM   3094  N  NH2   . ARG E  1  52   ? 212.390 239.148 167.147 1.00 161.11 ? 52   ARG V NH2   1 
ATOM   3095  N  N     . ARG E  1  53   ? 212.864 237.398 158.487 1.00 86.76  ? 53   ARG V N     1 
ATOM   3096  C  CA    . ARG E  1  53   ? 212.884 236.595 157.268 1.00 83.18  ? 53   ARG V CA    1 
ATOM   3097  C  C     . ARG E  1  53   ? 213.747 237.240 156.190 1.00 87.87  ? 53   ARG V C     1 
ATOM   3098  O  O     . ARG E  1  53   ? 214.663 236.606 155.651 1.00 90.43  ? 53   ARG V O     1 
ATOM   3099  C  CB    . ARG E  1  53   ? 211.460 236.379 156.757 1.00 99.67  ? 53   ARG V CB    1 
ATOM   3100  C  CG    . ARG E  1  53   ? 211.386 235.557 155.483 1.00 106.42 ? 53   ARG V CG    1 
ATOM   3101  C  CD    . ARG E  1  53   ? 209.948 235.332 155.047 1.00 108.48 ? 53   ARG V CD    1 
ATOM   3102  N  NE    . ARG E  1  53   ? 209.871 234.542 153.822 1.00 119.37 ? 53   ARG V NE    1 
ATOM   3103  C  CZ    . ARG E  1  53   ? 208.742 234.063 153.311 1.00 120.32 ? 53   ARG V CZ    1 
ATOM   3104  N  NH1   . ARG E  1  53   ? 207.587 234.294 153.919 1.00 114.18 ? 53   ARG V NH1   1 
ATOM   3105  N  NH2   . ARG E  1  53   ? 208.765 233.355 152.192 1.00 119.81 ? 53   ARG V NH2   1 
ATOM   3106  N  N     . TYR E  1  54   ? 213.469 238.503 155.856 1.00 77.19  ? 54   TYR V N     1 
ATOM   3107  C  CA    . TYR E  1  54   ? 214.204 239.148 154.774 1.00 70.90  ? 54   TYR V CA    1 
ATOM   3108  C  C     . TYR E  1  54   ? 215.628 239.504 155.181 1.00 76.38  ? 54   TYR V C     1 
ATOM   3109  O  O     . TYR E  1  54   ? 216.532 239.474 154.339 1.00 90.95  ? 54   TYR V O     1 
ATOM   3110  C  CB    . TYR E  1  54   ? 213.461 240.390 154.285 1.00 69.23  ? 54   TYR V CB    1 
ATOM   3111  C  CG    . TYR E  1  54   ? 212.142 240.083 153.613 1.00 64.52  ? 54   TYR V CG    1 
ATOM   3112  C  CD1   . TYR E  1  54   ? 212.095 239.688 152.287 1.00 64.52  ? 54   TYR V CD1   1 
ATOM   3113  C  CD2   . TYR E  1  54   ? 210.943 240.209 154.298 1.00 61.77  ? 54   TYR V CD2   1 
ATOM   3114  C  CE1   . TYR E  1  54   ? 210.896 239.407 151.666 1.00 65.07  ? 54   TYR V CE1   1 
ATOM   3115  C  CE2   . TYR E  1  54   ? 209.738 239.934 153.687 1.00 72.62  ? 54   TYR V CE2   1 
ATOM   3116  C  CZ    . TYR E  1  54   ? 209.719 239.535 152.369 1.00 73.45  ? 54   TYR V CZ    1 
ATOM   3117  O  OH    . TYR E  1  54   ? 208.521 239.259 151.753 1.00 67.94  ? 54   TYR V OH    1 
ATOM   3118  N  N     . GLN E  1  55   ? 215.855 239.844 156.452 1.00 71.79  ? 55   GLN V N     1 
ATOM   3119  C  CA    . GLN E  1  55   ? 217.229 240.040 156.898 1.00 71.87  ? 55   GLN V CA    1 
ATOM   3120  C  C     . GLN E  1  55   ? 218.001 238.731 156.971 1.00 75.49  ? 55   GLN V C     1 
ATOM   3121  O  O     . GLN E  1  55   ? 219.231 238.757 157.078 1.00 85.25  ? 55   GLN V O     1 
ATOM   3122  C  CB    . GLN E  1  55   ? 217.271 240.732 158.260 1.00 51.55  ? 55   GLN V CB    1 
ATOM   3123  C  CG    . GLN E  1  55   ? 216.843 242.186 158.237 1.00 57.48  ? 55   GLN V CG    1 
ATOM   3124  C  CD    . GLN E  1  55   ? 216.900 242.825 159.608 1.00 69.93  ? 55   GLN V CD    1 
ATOM   3125  O  OE1   . GLN E  1  55   ? 216.820 242.142 160.628 1.00 77.71  ? 55   GLN V OE1   1 
ATOM   3126  N  NE2   . GLN E  1  55   ? 217.044 244.144 159.641 1.00 64.47  ? 55   GLN V NE2   1 
ATOM   3127  N  N     . LYS E  1  56   ? 217.312 237.591 156.919 1.00 82.59  ? 56   LYS V N     1 
ATOM   3128  C  CA    . LYS E  1  56   ? 218.003 236.309 156.985 1.00 87.45  ? 56   LYS V CA    1 
ATOM   3129  C  C     . LYS E  1  56   ? 218.618 235.915 155.645 1.00 96.64  ? 56   LYS V C     1 
ATOM   3130  O  O     . LYS E  1  56   ? 219.728 235.375 155.609 1.00 96.32  ? 56   LYS V O     1 
ATOM   3131  C  CB    . LYS E  1  56   ? 217.041 235.223 157.470 1.00 88.05  ? 56   LYS V CB    1 
ATOM   3132  C  CG    . LYS E  1  56   ? 217.691 233.861 157.658 1.00 101.79 ? 56   LYS V CG    1 
ATOM   3133  C  CD    . LYS E  1  56   ? 216.687 232.832 158.153 1.00 123.61 ? 56   LYS V CD    1 
ATOM   3134  C  CE    . LYS E  1  56   ? 217.293 231.438 158.163 1.00 138.24 ? 56   LYS V CE    1 
ATOM   3135  N  NZ    . LYS E  1  56   ? 218.450 231.339 159.096 1.00 144.23 ? 56   LYS V NZ    1 
ATOM   3136  N  N     . SER E  1  57   ? 217.925 236.173 154.540 1.00 92.63  ? 57   SER V N     1 
ATOM   3137  C  CA    . SER E  1  57   ? 218.347 235.670 153.239 1.00 88.98  ? 57   SER V CA    1 
ATOM   3138  C  C     . SER E  1  57   ? 218.999 236.760 152.393 1.00 90.57  ? 57   SER V C     1 
ATOM   3139  O  O     . SER E  1  57   ? 219.043 237.937 152.758 1.00 97.81  ? 57   SER V O     1 
ATOM   3140  C  CB    . SER E  1  57   ? 217.153 235.070 152.491 1.00 79.97  ? 57   SER V CB    1 
ATOM   3141  O  OG    . SER E  1  57   ? 216.183 236.061 152.203 1.00 93.67  ? 57   SER V OG    1 
ATOM   3142  N  N     . THR E  1  58   ? 219.514 236.336 151.238 1.00 86.78  ? 58   THR V N     1 
ATOM   3143  C  CA    . THR E  1  58   ? 220.162 237.205 150.264 1.00 81.88  ? 58   THR V CA    1 
ATOM   3144  C  C     . THR E  1  58   ? 219.259 237.588 149.097 1.00 80.58  ? 58   THR V C     1 
ATOM   3145  O  O     . THR E  1  58   ? 219.721 238.265 148.175 1.00 89.30  ? 58   THR V O     1 
ATOM   3146  C  CB    . THR E  1  58   ? 221.430 236.536 149.725 1.00 80.78  ? 58   THR V CB    1 
ATOM   3147  O  OG1   . THR E  1  58   ? 221.087 235.292 149.101 1.00 82.37  ? 58   THR V OG1   1 
ATOM   3148  C  CG2   . THR E  1  58   ? 222.413 236.272 150.856 1.00 74.10  ? 58   THR V CG2   1 
ATOM   3149  N  N     . GLU E  1  59   ? 217.999 237.158 149.110 1.00 76.77  ? 59   GLU V N     1 
ATOM   3150  C  CA    . GLU E  1  59   ? 217.124 237.290 147.950 1.00 77.84  ? 59   GLU V CA    1 
ATOM   3151  C  C     . GLU E  1  59   ? 216.997 238.743 147.503 1.00 78.51  ? 59   GLU V C     1 
ATOM   3152  O  O     . GLU E  1  59   ? 217.015 239.672 148.314 1.00 73.90  ? 59   GLU V O     1 
ATOM   3153  C  CB    . GLU E  1  59   ? 215.740 236.723 148.274 1.00 75.25  ? 59   GLU V CB    1 
ATOM   3154  C  CG    . GLU E  1  59   ? 214.756 236.739 147.117 1.00 90.60  ? 59   GLU V CG    1 
ATOM   3155  C  CD    . GLU E  1  59   ? 213.406 236.165 147.495 1.00 107.71 ? 59   GLU V CD    1 
ATOM   3156  O  OE1   . GLU E  1  59   ? 213.226 235.796 148.674 1.00 107.33 ? 59   GLU V OE1   1 
ATOM   3157  O  OE2   . GLU E  1  59   ? 212.525 236.085 146.614 1.00 115.86 ? 59   GLU V OE2   1 
ATOM   3158  N  N     . LEU E  1  60   ? 216.873 238.934 146.190 1.00 63.97  ? 60   LEU V N     1 
ATOM   3159  C  CA    . LEU E  1  60   ? 216.641 240.256 145.625 1.00 64.98  ? 60   LEU V CA    1 
ATOM   3160  C  C     . LEU E  1  60   ? 215.165 240.613 145.749 1.00 63.12  ? 60   LEU V C     1 
ATOM   3161  O  O     . LEU E  1  60   ? 214.292 239.798 145.435 1.00 79.34  ? 60   LEU V O     1 
ATOM   3162  C  CB    . LEU E  1  60   ? 217.080 240.297 144.162 1.00 53.61  ? 60   LEU V CB    1 
ATOM   3163  C  CG    . LEU E  1  60   ? 218.569 240.047 143.930 1.00 57.99  ? 60   LEU V CG    1 
ATOM   3164  C  CD1   . LEU E  1  60   ? 218.889 240.035 142.443 1.00 53.70  ? 60   LEU V CD1   1 
ATOM   3165  C  CD2   . LEU E  1  60   ? 219.405 241.082 144.659 1.00 48.52  ? 60   LEU V CD2   1 
ATOM   3166  N  N     . LEU E  1  61   ? 214.889 241.832 146.206 1.00 59.53  ? 61   LEU V N     1 
ATOM   3167  C  CA    . LEU E  1  61   ? 213.545 242.223 146.601 1.00 67.21  ? 61   LEU V CA    1 
ATOM   3168  C  C     . LEU E  1  61   ? 212.772 242.962 145.516 1.00 76.38  ? 61   LEU V C     1 
ATOM   3169  O  O     . LEU E  1  61   ? 211.605 243.300 145.733 1.00 77.22  ? 61   LEU V O     1 
ATOM   3170  C  CB    . LEU E  1  61   ? 213.612 243.086 147.863 1.00 80.77  ? 61   LEU V CB    1 
ATOM   3171  C  CG    . LEU E  1  61   ? 214.230 242.361 149.060 1.00 73.57  ? 61   LEU V CG    1 
ATOM   3172  C  CD1   . LEU E  1  61   ? 214.344 243.281 150.266 1.00 67.53  ? 61   LEU V CD1   1 
ATOM   3173  C  CD2   . LEU E  1  61   ? 213.432 241.114 149.393 1.00 58.28  ? 61   LEU V CD2   1 
ATOM   3174  N  N     . ILE E  1  62   ? 213.377 243.218 144.359 1.00 63.39  ? 62   ILE V N     1 
ATOM   3175  C  CA    . ILE E  1  62   ? 212.715 243.923 143.270 1.00 61.71  ? 62   ILE V CA    1 
ATOM   3176  C  C     . ILE E  1  62   ? 212.665 243.007 142.057 1.00 68.49  ? 62   ILE V C     1 
ATOM   3177  O  O     . ILE E  1  62   ? 213.656 242.351 141.719 1.00 65.75  ? 62   ILE V O     1 
ATOM   3178  C  CB    . ILE E  1  62   ? 213.428 245.249 142.931 1.00 69.96  ? 62   ILE V CB    1 
ATOM   3179  C  CG1   . ILE E  1  62   ? 213.326 246.222 144.106 1.00 77.49  ? 62   ILE V CG1   1 
ATOM   3180  C  CG2   . ILE E  1  62   ? 212.838 245.876 141.679 1.00 69.55  ? 62   ILE V CG2   1 
ATOM   3181  C  CD1   . ILE E  1  62   ? 214.170 247.462 143.945 1.00 62.49  ? 62   ILE V CD1   1 
ATOM   3182  N  N     . ARG E  1  63   ? 211.505 242.963 141.402 1.00 51.36  ? 63   ARG V N     1 
ATOM   3183  C  CA    . ARG E  1  63   ? 211.334 242.089 140.251 1.00 55.65  ? 63   ARG V CA    1 
ATOM   3184  C  C     . ARG E  1  63   ? 212.109 242.613 139.049 1.00 59.79  ? 63   ARG V C     1 
ATOM   3185  O  O     . ARG E  1  63   ? 212.181 243.823 138.812 1.00 60.96  ? 63   ARG V O     1 
ATOM   3186  C  CB    . ARG E  1  63   ? 209.852 241.939 139.915 1.00 89.88  ? 63   ARG V CB    1 
ATOM   3187  C  CG    . ARG E  1  63   ? 209.077 241.256 141.023 1.00 72.32  ? 63   ARG V CG    1 
ATOM   3188  C  CD    . ARG E  1  63   ? 209.618 239.853 141.232 1.00 68.77  ? 63   ARG V CD    1 
ATOM   3189  N  NE    . ARG E  1  63   ? 208.966 239.149 142.329 1.00 92.88  ? 63   ARG V NE    1 
ATOM   3190  C  CZ    . ARG E  1  63   ? 209.419 238.014 142.852 1.00 92.50  ? 63   ARG V CZ    1 
ATOM   3191  N  NH1   . ARG E  1  63   ? 210.526 237.458 142.376 1.00 86.89  ? 63   ARG V NH1   1 
ATOM   3192  N  NH2   . ARG E  1  63   ? 208.771 237.435 143.849 1.00 98.67  ? 63   ARG V NH2   1 
ATOM   3193  N  N     . LYS E  1  64   ? 212.691 241.682 138.292 1.00 53.29  ? 64   LYS V N     1 
ATOM   3194  C  CA    . LYS E  1  64   ? 213.611 241.993 137.202 1.00 59.80  ? 64   LYS V CA    1 
ATOM   3195  C  C     . LYS E  1  64   ? 212.997 242.899 136.141 1.00 68.36  ? 64   LYS V C     1 
ATOM   3196  O  O     . LYS E  1  64   ? 213.451 244.031 135.957 1.00 84.52  ? 64   LYS V O     1 
ATOM   3197  C  CB    . LYS E  1  64   ? 214.108 240.701 136.550 1.00 51.91  ? 64   LYS V CB    1 
ATOM   3198  C  CG    . LYS E  1  64   ? 215.368 240.121 137.182 1.00 74.82  ? 64   LYS V CG    1 
ATOM   3199  C  CD    . LYS E  1  64   ? 215.109 239.603 138.584 1.00 97.05  ? 64   LYS V CD    1 
ATOM   3200  C  CE    . LYS E  1  64   ? 216.370 239.024 139.199 1.00 94.35  ? 64   LYS V CE    1 
ATOM   3201  N  NZ    . LYS E  1  64   ? 216.129 238.511 140.575 1.00 81.54  ? 64   LYS V NZ    1 
ATOM   3202  N  N     . LEU E  1  65   ? 211.977 242.405 135.436 1.00 60.10  ? 65   LEU V N     1 
ATOM   3203  C  CA    . LEU E  1  65   ? 211.468 243.110 134.260 1.00 57.49  ? 65   LEU V CA    1 
ATOM   3204  C  C     . LEU E  1  65   ? 211.037 244.545 134.540 1.00 64.01  ? 65   LEU V C     1 
ATOM   3205  O  O     . LEU E  1  65   ? 211.400 245.437 133.750 1.00 76.34  ? 65   LEU V O     1 
ATOM   3206  C  CB    . LEU E  1  65   ? 210.331 242.298 133.632 1.00 63.85  ? 65   LEU V CB    1 
ATOM   3207  C  CG    . LEU E  1  65   ? 210.726 240.930 133.077 1.00 73.20  ? 65   LEU V CG    1 
ATOM   3208  C  CD1   . LEU E  1  65   ? 209.501 240.175 132.582 1.00 66.50  ? 65   LEU V CD1   1 
ATOM   3209  C  CD2   . LEU E  1  65   ? 211.758 241.077 131.970 1.00 68.05  ? 65   LEU V CD2   1 
ATOM   3210  N  N     . PRO E  1  66   ? 210.279 244.852 135.602 1.00 60.98  ? 66   PRO V N     1 
ATOM   3211  C  CA    . PRO E  1  66   ? 209.948 246.266 135.851 1.00 58.05  ? 66   PRO V CA    1 
ATOM   3212  C  C     . PRO E  1  66   ? 211.172 247.139 136.055 1.00 60.08  ? 66   PRO V C     1 
ATOM   3213  O  O     . PRO E  1  66   ? 211.246 248.245 135.502 1.00 66.61  ? 66   PRO V O     1 
ATOM   3214  C  CB    . PRO E  1  66   ? 209.080 246.201 137.116 1.00 51.46  ? 66   PRO V CB    1 
ATOM   3215  C  CG    . PRO E  1  66   ? 208.498 244.843 137.097 1.00 62.70  ? 66   PRO V CG    1 
ATOM   3216  C  CD    . PRO E  1  66   ? 209.582 243.965 136.551 1.00 67.48  ? 66   PRO V CD    1 
ATOM   3217  N  N     . PHE E  1  67   ? 212.147 246.660 136.831 1.00 50.13  ? 67   PHE V N     1 
ATOM   3218  C  CA    . PHE E  1  67   ? 213.363 247.433 137.055 1.00 51.11  ? 67   PHE V CA    1 
ATOM   3219  C  C     . PHE E  1  67   ? 214.134 247.636 135.757 1.00 52.27  ? 67   PHE V C     1 
ATOM   3220  O  O     . PHE E  1  67   ? 214.694 248.712 135.521 1.00 50.85  ? 67   PHE V O     1 
ATOM   3221  C  CB    . PHE E  1  67   ? 214.236 246.739 138.099 1.00 53.22  ? 67   PHE V CB    1 
ATOM   3222  C  CG    . PHE E  1  67   ? 215.537 247.433 138.360 1.00 37.66  ? 67   PHE V CG    1 
ATOM   3223  C  CD1   . PHE E  1  67   ? 215.592 248.540 139.189 1.00 37.04  ? 67   PHE V CD1   1 
ATOM   3224  C  CD2   . PHE E  1  67   ? 216.709 246.976 137.783 1.00 42.88  ? 67   PHE V CD2   1 
ATOM   3225  C  CE1   . PHE E  1  67   ? 216.788 249.181 139.433 1.00 39.20  ? 67   PHE V CE1   1 
ATOM   3226  C  CE2   . PHE E  1  67   ? 217.909 247.616 138.022 1.00 42.74  ? 67   PHE V CE2   1 
ATOM   3227  C  CZ    . PHE E  1  67   ? 217.948 248.718 138.847 1.00 40.37  ? 67   PHE V CZ    1 
ATOM   3228  N  N     . GLN E  1  68   ? 214.169 246.613 134.899 1.00 45.59  ? 68   GLN V N     1 
ATOM   3229  C  CA    . GLN E  1  68   ? 214.872 246.739 133.629 1.00 52.08  ? 68   GLN V CA    1 
ATOM   3230  C  C     . GLN E  1  68   ? 214.192 247.754 132.719 1.00 62.08  ? 68   GLN V C     1 
ATOM   3231  O  O     . GLN E  1  68   ? 214.865 248.583 132.095 1.00 70.82  ? 68   GLN V O     1 
ATOM   3232  C  CB    . GLN E  1  68   ? 214.963 245.377 132.943 1.00 56.65  ? 68   GLN V CB    1 
ATOM   3233  C  CG    . GLN E  1  68   ? 215.779 245.380 131.664 1.00 69.96  ? 68   GLN V CG    1 
ATOM   3234  C  CD    . GLN E  1  68   ? 215.983 243.989 131.099 1.00 92.83  ? 68   GLN V CD    1 
ATOM   3235  O  OE1   . GLN E  1  68   ? 215.595 242.995 131.713 1.00 97.72  ? 68   GLN V OE1   1 
ATOM   3236  N  NE2   . GLN E  1  68   ? 216.591 243.911 129.924 1.00 100.55 ? 68   GLN V NE2   1 
ATOM   3237  N  N     . ARG E  1  69   ? 212.861 247.710 132.636 1.00 43.78  ? 69   ARG V N     1 
ATOM   3238  C  CA    . ARG E  1  69   ? 212.148 248.713 131.851 1.00 47.38  ? 69   ARG V CA    1 
ATOM   3239  C  C     . ARG E  1  69   ? 212.360 250.111 132.413 1.00 55.91  ? 69   ARG V C     1 
ATOM   3240  O  O     . ARG E  1  69   ? 212.437 251.082 131.648 1.00 68.57  ? 69   ARG V O     1 
ATOM   3241  C  CB    . ARG E  1  69   ? 210.657 248.381 131.796 1.00 66.22  ? 69   ARG V CB    1 
ATOM   3242  C  CG    . ARG E  1  69   ? 210.326 247.135 130.995 1.00 65.09  ? 69   ARG V CG    1 
ATOM   3243  C  CD    . ARG E  1  69   ? 208.835 247.043 130.726 1.00 70.47  ? 69   ARG V CD    1 
ATOM   3244  N  NE    . ARG E  1  69   ? 208.064 246.942 131.961 1.00 68.64  ? 69   ARG V NE    1 
ATOM   3245  C  CZ    . ARG E  1  69   ? 207.801 245.799 132.584 1.00 65.25  ? 69   ARG V CZ    1 
ATOM   3246  N  NH1   . ARG E  1  69   ? 208.246 244.652 132.085 1.00 56.45  ? 69   ARG V NH1   1 
ATOM   3247  N  NH2   . ARG E  1  69   ? 207.091 245.798 133.703 1.00 69.28  ? 69   ARG V NH2   1 
ATOM   3248  N  N     . LEU E  1  70   ? 212.460 250.238 133.738 1.00 63.43  ? 70   LEU V N     1 
ATOM   3249  C  CA    . LEU E  1  70   ? 212.749 251.537 134.336 1.00 58.09  ? 70   LEU V CA    1 
ATOM   3250  C  C     . LEU E  1  70   ? 214.131 252.032 133.933 1.00 60.04  ? 70   LEU V C     1 
ATOM   3251  O  O     . LEU E  1  70   ? 214.300 253.197 133.548 1.00 69.46  ? 70   LEU V O     1 
ATOM   3252  C  CB    . LEU E  1  70   ? 212.627 251.450 135.856 1.00 76.69  ? 70   LEU V CB    1 
ATOM   3253  C  CG    . LEU E  1  70   ? 212.989 252.719 136.628 1.00 75.75  ? 70   LEU V CG    1 
ATOM   3254  C  CD1   . LEU E  1  70   ? 212.065 253.858 136.239 1.00 70.55  ? 70   LEU V CD1   1 
ATOM   3255  C  CD2   . LEU E  1  70   ? 212.927 252.463 138.122 1.00 68.46  ? 70   LEU V CD2   1 
ATOM   3256  N  N     . VAL E  1  71   ? 215.138 251.157 134.018 1.00 44.85  ? 71   VAL V N     1 
ATOM   3257  C  CA    . VAL E  1  71   ? 216.491 251.527 133.612 1.00 52.76  ? 71   VAL V CA    1 
ATOM   3258  C  C     . VAL E  1  71   ? 216.509 251.964 132.154 1.00 52.97  ? 71   VAL V C     1 
ATOM   3259  O  O     . VAL E  1  71   ? 217.151 252.960 131.797 1.00 53.35  ? 71   VAL V O     1 
ATOM   3260  C  CB    . VAL E  1  71   ? 217.462 250.358 133.858 1.00 43.15  ? 71   VAL V CB    1 
ATOM   3261  C  CG1   . VAL E  1  71   ? 218.822 250.669 133.267 1.00 36.68  ? 71   VAL V CG1   1 
ATOM   3262  C  CG2   . VAL E  1  71   ? 217.586 250.082 135.346 1.00 48.84  ? 71   VAL V CG2   1 
ATOM   3263  N  N     . ARG E  1  72   ? 215.801 251.237 131.289 1.00 48.16  ? 72   ARG V N     1 
ATOM   3264  C  CA    . ARG E  1  72   ? 215.781 251.603 129.877 1.00 57.12  ? 72   ARG V CA    1 
ATOM   3265  C  C     . ARG E  1  72   ? 215.100 252.949 129.662 1.00 63.21  ? 72   ARG V C     1 
ATOM   3266  O  O     . ARG E  1  72   ? 215.595 253.782 128.891 1.00 62.23  ? 72   ARG V O     1 
ATOM   3267  C  CB    . ARG E  1  72   ? 215.100 250.507 129.060 1.00 66.78  ? 72   ARG V CB    1 
ATOM   3268  C  CG    . ARG E  1  72   ? 215.869 249.195 129.061 1.00 56.22  ? 72   ARG V CG    1 
ATOM   3269  C  CD    . ARG E  1  72   ? 215.211 248.148 128.182 1.00 71.27  ? 72   ARG V CD    1 
ATOM   3270  N  NE    . ARG E  1  72   ? 215.943 246.885 128.210 1.00 84.25  ? 72   ARG V NE    1 
ATOM   3271  C  CZ    . ARG E  1  72   ? 216.998 246.617 127.449 1.00 84.69  ? 72   ARG V CZ    1 
ATOM   3272  N  NH1   . ARG E  1  72   ? 217.449 247.521 126.594 1.00 68.05  ? 72   ARG V NH1   1 
ATOM   3273  N  NH2   . ARG E  1  72   ? 217.602 245.441 127.541 1.00 96.89  ? 72   ARG V NH2   1 
ATOM   3274  N  N     . GLU E  1  73   ? 213.976 253.190 130.341 1.00 58.74  ? 73   GLU V N     1 
ATOM   3275  C  CA    . GLU E  1  73   ? 213.307 254.483 130.225 1.00 59.27  ? 73   GLU V CA    1 
ATOM   3276  C  C     . GLU E  1  73   ? 214.228 255.618 130.652 1.00 64.62  ? 73   GLU V C     1 
ATOM   3277  O  O     . GLU E  1  73   ? 214.335 256.640 129.963 1.00 69.49  ? 73   GLU V O     1 
ATOM   3278  C  CB    . GLU E  1  73   ? 212.030 254.507 131.065 1.00 94.58  ? 73   GLU V CB    1 
ATOM   3279  C  CG    . GLU E  1  73   ? 211.296 255.839 130.974 1.00 110.78 ? 73   GLU V CG    1 
ATOM   3280  C  CD    . GLU E  1  73   ? 210.058 255.894 131.845 1.00 127.72 ? 73   GLU V CD    1 
ATOM   3281  O  OE1   . GLU E  1  73   ? 209.795 254.914 132.564 1.00 120.98 ? 73   GLU V OE1   1 
ATOM   3282  O  OE2   . GLU E  1  73   ? 209.352 256.925 131.815 1.00 137.83 ? 73   GLU V OE2   1 
ATOM   3283  N  N     . ILE E  1  74   ? 214.897 255.459 131.794 1.00 63.75  ? 74   ILE V N     1 
ATOM   3284  C  CA    . ILE E  1  74   ? 215.789 256.509 132.282 1.00 53.40  ? 74   ILE V CA    1 
ATOM   3285  C  C     . ILE E  1  74   ? 216.948 256.714 131.316 1.00 53.62  ? 74   ILE V C     1 
ATOM   3286  O  O     . ILE E  1  74   ? 217.416 257.841 131.113 1.00 56.81  ? 74   ILE V O     1 
ATOM   3287  C  CB    . ILE E  1  74   ? 216.275 256.172 133.703 1.00 36.04  ? 74   ILE V CB    1 
ATOM   3288  C  CG1   . ILE E  1  74   ? 215.097 256.186 134.677 1.00 38.80  ? 74   ILE V CG1   1 
ATOM   3289  C  CG2   . ILE E  1  74   ? 217.342 257.150 134.157 1.00 39.18  ? 74   ILE V CG2   1 
ATOM   3290  C  CD1   . ILE E  1  74   ? 215.430 255.652 136.043 1.00 45.17  ? 74   ILE V CD1   1 
ATOM   3291  N  N     . ALA E  1  75   ? 217.418 255.635 130.690 1.00 48.67  ? 75   ALA V N     1 
ATOM   3292  C  CA    . ALA E  1  75   ? 218.523 255.741 129.750 1.00 50.82  ? 75   ALA V CA    1 
ATOM   3293  C  C     . ALA E  1  75   ? 218.107 256.316 128.403 1.00 61.75  ? 75   ALA V C     1 
ATOM   3294  O  O     . ALA E  1  75   ? 218.975 256.746 127.637 1.00 68.30  ? 75   ALA V O     1 
ATOM   3295  C  CB    . ALA E  1  75   ? 219.171 254.373 129.543 1.00 50.84  ? 75   ALA V CB    1 
ATOM   3296  N  N     . GLN E  1  76   ? 216.807 256.330 128.091 1.00 59.61  ? 76   GLN V N     1 
ATOM   3297  C  CA    . GLN E  1  76   ? 216.365 256.912 126.825 1.00 55.09  ? 76   GLN V CA    1 
ATOM   3298  C  C     . GLN E  1  76   ? 216.671 258.402 126.745 1.00 66.25  ? 76   GLN V C     1 
ATOM   3299  O  O     . GLN E  1  76   ? 216.940 258.921 125.655 1.00 81.75  ? 76   GLN V O     1 
ATOM   3300  C  CB    . GLN E  1  76   ? 214.868 256.680 126.620 1.00 77.95  ? 76   GLN V CB    1 
ATOM   3301  C  CG    . GLN E  1  76   ? 214.480 255.239 126.363 1.00 89.22  ? 76   GLN V CG    1 
ATOM   3302  C  CD    . GLN E  1  76   ? 212.983 255.057 126.222 1.00 96.19  ? 76   GLN V CD    1 
ATOM   3303  O  OE1   . GLN E  1  76   ? 212.198 255.855 126.736 1.00 93.76  ? 76   GLN V OE1   1 
ATOM   3304  N  NE2   . GLN E  1  76   ? 212.578 254.005 125.522 1.00 89.69  ? 76   GLN V NE2   1 
ATOM   3305  N  N     . ASP E  1  77   ? 216.639 259.105 127.876 1.00 66.10  ? 77   ASP V N     1 
ATOM   3306  C  CA    . ASP E  1  77   ? 216.831 260.550 127.882 1.00 68.64  ? 77   ASP V CA    1 
ATOM   3307  C  C     . ASP E  1  77   ? 218.277 260.967 127.649 1.00 64.67  ? 77   ASP V C     1 
ATOM   3308  O  O     . ASP E  1  77   ? 218.538 262.164 127.489 1.00 77.60  ? 77   ASP V O     1 
ATOM   3309  C  CB    . ASP E  1  77   ? 216.341 261.137 129.207 1.00 71.38  ? 77   ASP V CB    1 
ATOM   3310  C  CG    . ASP E  1  77   ? 214.836 261.062 129.358 1.00 83.17  ? 77   ASP V CG    1 
ATOM   3311  O  OD1   . ASP E  1  77   ? 214.147 260.843 128.339 1.00 87.40  ? 77   ASP V OD1   1 
ATOM   3312  O  OD2   . ASP E  1  77   ? 214.341 261.224 130.492 1.00 87.53  ? 77   ASP V OD2   1 
ATOM   3313  N  N     . PHE E  1  78   ? 219.215 260.022 127.625 1.00 58.37  ? 78   PHE V N     1 
ATOM   3314  C  CA    . PHE E  1  78   ? 220.627 260.353 127.481 1.00 58.49  ? 78   PHE V CA    1 
ATOM   3315  C  C     . PHE E  1  78   ? 221.104 260.076 126.062 1.00 63.71  ? 78   PHE V C     1 
ATOM   3316  O  O     . PHE E  1  78   ? 221.457 261.004 125.329 1.00 76.68  ? 78   PHE V O     1 
ATOM   3317  C  CB    . PHE E  1  78   ? 221.454 259.567 128.497 1.00 45.63  ? 78   PHE V CB    1 
ATOM   3318  C  CG    . PHE E  1  78   ? 221.128 259.899 129.924 1.00 46.79  ? 78   PHE V CG    1 
ATOM   3319  C  CD1   . PHE E  1  78   ? 220.547 261.112 130.250 1.00 62.17  ? 78   PHE V CD1   1 
ATOM   3320  C  CD2   . PHE E  1  78   ? 221.379 258.990 130.936 1.00 47.98  ? 78   PHE V CD2   1 
ATOM   3321  C  CE1   . PHE E  1  78   ? 220.239 261.420 131.559 1.00 54.71  ? 78   PHE V CE1   1 
ATOM   3322  C  CE2   . PHE E  1  78   ? 221.067 259.292 132.247 1.00 52.44  ? 78   PHE V CE2   1 
ATOM   3323  C  CZ    . PHE E  1  78   ? 220.499 260.509 132.558 1.00 37.05  ? 78   PHE V CZ    1 
ATOM   3324  N  N     . LYS E  1  79   ? 221.119 258.805 125.668 1.00 55.60  ? 79   LYS V N     1 
ATOM   3325  C  CA    . LYS E  1  79   ? 221.450 258.408 124.307 1.00 67.56  ? 79   LYS V CA    1 
ATOM   3326  C  C     . LYS E  1  79   ? 220.440 257.370 123.845 1.00 81.54  ? 79   LYS V C     1 
ATOM   3327  O  O     . LYS E  1  79   ? 220.181 256.394 124.554 1.00 91.51  ? 79   LYS V O     1 
ATOM   3328  C  CB    . LYS E  1  79   ? 222.871 257.845 124.211 1.00 76.35  ? 79   LYS V CB    1 
ATOM   3329  C  CG    . LYS E  1  79   ? 223.282 257.469 122.796 1.00 89.87  ? 79   LYS V CG    1 
ATOM   3330  C  CD    . LYS E  1  79   ? 224.698 256.919 122.750 1.00 92.73  ? 79   LYS V CD    1 
ATOM   3331  C  CE    . LYS E  1  79   ? 225.027 256.366 121.373 1.00 97.70  ? 79   LYS V CE    1 
ATOM   3332  N  NZ    . LYS E  1  79   ? 224.977 257.420 120.323 1.00 101.09 ? 79   LYS V NZ    1 
ATOM   3333  N  N     . THR E  1  80   ? 219.871 257.584 122.664 1.00 92.12  ? 80   THR V N     1 
ATOM   3334  C  CA    . THR E  1  80   ? 218.870 256.672 122.139 1.00 99.32  ? 80   THR V CA    1 
ATOM   3335  C  C     . THR E  1  80   ? 219.523 255.414 121.579 1.00 99.29  ? 80   THR V C     1 
ATOM   3336  O  O     . THR E  1  80   ? 220.677 255.428 121.138 1.00 88.76  ? 80   THR V O     1 
ATOM   3337  C  CB    . THR E  1  80   ? 218.043 257.350 121.047 1.00 119.43 ? 80   THR V CB    1 
ATOM   3338  O  OG1   . THR E  1  80   ? 218.905 257.773 119.984 1.00 128.00 ? 80   THR V OG1   1 
ATOM   3339  C  CG2   . THR E  1  80   ? 217.309 258.561 121.609 1.00 103.97 ? 80   THR V CG2   1 
ATOM   3340  N  N     . ASP E  1  81   ? 218.766 254.315 121.606 1.00 99.26  ? 81   ASP V N     1 
ATOM   3341  C  CA    . ASP E  1  81   ? 219.171 253.031 121.036 1.00 102.56 ? 81   ASP V CA    1 
ATOM   3342  C  C     . ASP E  1  81   ? 220.461 252.521 121.691 1.00 89.37  ? 81   ASP V C     1 
ATOM   3343  O  O     . ASP E  1  81   ? 221.532 252.466 121.085 1.00 86.48  ? 81   ASP V O     1 
ATOM   3344  C  CB    . ASP E  1  81   ? 219.328 253.143 119.515 1.00 141.21 ? 81   ASP V CB    1 
ATOM   3345  C  CG    . ASP E  1  81   ? 218.013 253.420 118.815 1.00 148.61 ? 81   ASP V CG    1 
ATOM   3346  O  OD1   . ASP E  1  81   ? 216.953 253.237 119.447 1.00 150.56 ? 81   ASP V OD1   1 
ATOM   3347  O  OD2   . ASP E  1  81   ? 218.039 253.825 117.632 1.00 147.63 ? 81   ASP V OD2   1 
ATOM   3348  N  N     . LEU E  1  82   ? 220.319 252.150 122.960 1.00 75.71  ? 82   LEU V N     1 
ATOM   3349  C  CA    . LEU E  1  82   ? 221.413 251.594 123.743 1.00 60.68  ? 82   LEU V CA    1 
ATOM   3350  C  C     . LEU E  1  82   ? 221.169 250.118 124.029 1.00 66.73  ? 82   LEU V C     1 
ATOM   3351  O  O     . LEU E  1  82   ? 220.026 249.670 124.152 1.00 60.66  ? 82   LEU V O     1 
ATOM   3352  C  CB    . LEU E  1  82   ? 221.594 252.346 125.065 1.00 53.79  ? 82   LEU V CB    1 
ATOM   3353  C  CG    . LEU E  1  82   ? 222.081 253.790 124.979 1.00 73.00  ? 82   LEU V CG    1 
ATOM   3354  C  CD1   . LEU E  1  82   ? 222.084 254.427 126.356 1.00 80.82  ? 82   LEU V CD1   1 
ATOM   3355  C  CD2   . LEU E  1  82   ? 223.467 253.840 124.363 1.00 63.96  ? 82   LEU V CD2   1 
ATOM   3356  N  N     . ARG E  1  83   ? 222.261 249.369 124.134 1.00 53.37  ? 83   ARG V N     1 
ATOM   3357  C  CA    . ARG E  1  83   ? 222.223 247.952 124.460 1.00 53.35  ? 83   ARG V CA    1 
ATOM   3358  C  C     . ARG E  1  83   ? 222.748 247.740 125.873 1.00 52.83  ? 83   ARG V C     1 
ATOM   3359  O  O     . ARG E  1  83   ? 223.760 248.329 126.266 1.00 48.53  ? 83   ARG V O     1 
ATOM   3360  C  CB    . ARG E  1  83   ? 223.057 247.137 123.467 1.00 56.66  ? 83   ARG V CB    1 
ATOM   3361  C  CG    . ARG E  1  83   ? 222.580 247.235 122.030 1.00 60.47  ? 83   ARG V CG    1 
ATOM   3362  C  CD    . ARG E  1  83   ? 221.207 246.611 121.867 1.00 76.80  ? 83   ARG V CD    1 
ATOM   3363  N  NE    . ARG E  1  83   ? 220.729 246.682 120.490 1.00 99.82  ? 83   ARG V NE    1 
ATOM   3364  C  CZ    . ARG E  1  83   ? 221.003 245.776 119.559 1.00 109.17 ? 83   ARG V CZ    1 
ATOM   3365  N  NH1   . ARG E  1  83   ? 221.754 244.724 119.856 1.00 105.75 ? 83   ARG V NH1   1 
ATOM   3366  N  NH2   . ARG E  1  83   ? 220.525 245.919 118.331 1.00 110.01 ? 83   ARG V NH2   1 
ATOM   3367  N  N     . PHE E  1  84   ? 222.054 246.901 126.637 1.00 57.86  ? 84   PHE V N     1 
ATOM   3368  C  CA    . PHE E  1  84   ? 222.413 246.611 128.019 1.00 47.89  ? 84   PHE V CA    1 
ATOM   3369  C  C     . PHE E  1  84   ? 222.726 245.132 128.165 1.00 45.26  ? 84   PHE V C     1 
ATOM   3370  O  O     . PHE E  1  84   ? 221.949 244.280 127.716 1.00 52.27  ? 84   PHE V O     1 
ATOM   3371  C  CB    . PHE E  1  84   ? 221.284 246.997 128.976 1.00 59.55  ? 84   PHE V CB    1 
ATOM   3372  C  CG    . PHE E  1  84   ? 221.015 248.469 129.035 1.00 71.40  ? 84   PHE V CG    1 
ATOM   3373  C  CD1   . PHE E  1  84   ? 221.739 249.283 129.888 1.00 73.83  ? 84   PHE V CD1   1 
ATOM   3374  C  CD2   . PHE E  1  84   ? 220.038 249.041 128.238 1.00 66.80  ? 84   PHE V CD2   1 
ATOM   3375  C  CE1   . PHE E  1  84   ? 221.493 250.638 129.946 1.00 79.15  ? 84   PHE V CE1   1 
ATOM   3376  C  CE2   . PHE E  1  84   ? 219.789 250.396 128.292 1.00 62.68  ? 84   PHE V CE2   1 
ATOM   3377  C  CZ    . PHE E  1  84   ? 220.519 251.195 129.148 1.00 73.58  ? 84   PHE V CZ    1 
ATOM   3378  N  N     . GLN E  1  85   ? 223.856 244.828 128.792 1.00 45.71  ? 85   GLN V N     1 
ATOM   3379  C  CA    . GLN E  1  85   ? 224.142 243.459 129.187 1.00 43.02  ? 85   GLN V CA    1 
ATOM   3380  C  C     . GLN E  1  85   ? 223.363 243.117 130.450 1.00 51.14  ? 85   GLN V C     1 
ATOM   3381  O  O     . GLN E  1  85   ? 223.042 243.990 131.261 1.00 52.76  ? 85   GLN V O     1 
ATOM   3382  C  CB    . GLN E  1  85   ? 225.639 243.259 129.419 1.00 52.37  ? 85   GLN V CB    1 
ATOM   3383  C  CG    . GLN E  1  85   ? 226.485 243.406 128.166 1.00 54.97  ? 85   GLN V CG    1 
ATOM   3384  C  CD    . GLN E  1  85   ? 227.961 243.216 128.439 1.00 67.89  ? 85   GLN V CD    1 
ATOM   3385  O  OE1   . GLN E  1  85   ? 228.424 243.386 129.567 1.00 57.01  ? 85   GLN V OE1   1 
ATOM   3386  N  NE2   . GLN E  1  85   ? 228.713 242.859 127.404 1.00 69.23  ? 85   GLN V NE2   1 
ATOM   3387  N  N     . SER E  1  86   ? 223.055 241.829 130.611 1.00 73.63  ? 86   SER V N     1 
ATOM   3388  C  CA    . SER E  1  86   ? 222.288 241.396 131.775 1.00 66.82  ? 86   SER V CA    1 
ATOM   3389  C  C     . SER E  1  86   ? 223.027 241.704 133.070 1.00 71.13  ? 86   SER V C     1 
ATOM   3390  O  O     . SER E  1  86   ? 222.414 242.123 134.061 1.00 79.10  ? 86   SER V O     1 
ATOM   3391  C  CB    . SER E  1  86   ? 221.981 239.902 131.674 1.00 75.87  ? 86   SER V CB    1 
ATOM   3392  O  OG    . SER E  1  86   ? 223.174 239.139 131.700 1.00 91.64  ? 86   SER V OG    1 
ATOM   3393  N  N     . SER E  1  87   ? 224.348 241.516 133.079 1.00 53.49  ? 87   SER V N     1 
ATOM   3394  C  CA    . SER E  1  87   ? 225.129 241.791 134.279 1.00 58.31  ? 87   SER V CA    1 
ATOM   3395  C  C     . SER E  1  87   ? 225.118 243.271 134.639 1.00 58.26  ? 87   SER V C     1 
ATOM   3396  O  O     . SER E  1  87   ? 225.296 243.623 135.812 1.00 51.15  ? 87   SER V O     1 
ATOM   3397  C  CB    . SER E  1  87   ? 226.563 241.295 134.092 1.00 37.47  ? 87   SER V CB    1 
ATOM   3398  O  OG    . SER E  1  87   ? 227.193 241.965 133.014 1.00 56.88  ? 87   SER V OG    1 
ATOM   3399  N  N     . ALA E  1  88   ? 224.910 244.149 133.658 1.00 47.26  ? 88   ALA V N     1 
ATOM   3400  C  CA    . ALA E  1  88   ? 224.817 245.577 133.955 1.00 44.39  ? 88   ALA V CA    1 
ATOM   3401  C  C     . ALA E  1  88   ? 223.520 245.897 134.685 1.00 49.97  ? 88   ALA V C     1 
ATOM   3402  O  O     . ALA E  1  88   ? 223.525 246.602 135.705 1.00 54.83  ? 88   ALA V O     1 
ATOM   3403  C  CB    . ALA E  1  88   ? 224.925 246.389 132.665 1.00 35.78  ? 88   ALA V CB    1 
ATOM   3404  N  N     . VAL E  1  89   ? 222.395 245.386 134.179 1.00 38.10  ? 89   VAL V N     1 
ATOM   3405  C  CA    . VAL E  1  89   ? 221.117 245.582 134.856 1.00 39.75  ? 89   VAL V CA    1 
ATOM   3406  C  C     . VAL E  1  89   ? 221.156 244.967 136.247 1.00 46.69  ? 89   VAL V C     1 
ATOM   3407  O  O     . VAL E  1  89   ? 220.648 245.547 137.216 1.00 58.23  ? 89   VAL V O     1 
ATOM   3408  C  CB    . VAL E  1  89   ? 219.970 245.002 134.007 1.00 45.96  ? 89   VAL V CB    1 
ATOM   3409  C  CG1   . VAL E  1  89   ? 218.650 245.117 134.746 1.00 48.94  ? 89   VAL V CG1   1 
ATOM   3410  C  CG2   . VAL E  1  89   ? 219.899 245.707 132.665 1.00 53.87  ? 89   VAL V CG2   1 
ATOM   3411  N  N     . MET E  1  90   ? 221.771 243.789 136.374 1.00 41.06  ? 90   MET V N     1 
ATOM   3412  C  CA    . MET E  1  90   ? 221.941 243.187 137.691 1.00 49.53  ? 90   MET V CA    1 
ATOM   3413  C  C     . MET E  1  90   ? 222.791 244.070 138.595 1.00 54.44  ? 90   MET V C     1 
ATOM   3414  O  O     . MET E  1  90   ? 222.550 244.150 139.804 1.00 65.20  ? 90   MET V O     1 
ATOM   3415  C  CB    . MET E  1  90   ? 222.561 241.797 137.559 1.00 62.60  ? 90   MET V CB    1 
ATOM   3416  C  CG    . MET E  1  90   ? 221.668 240.787 136.863 1.00 71.58  ? 90   MET V CG    1 
ATOM   3417  S  SD    . MET E  1  90   ? 220.109 240.534 137.728 1.00 83.91  ? 90   MET V SD    1 
ATOM   3418  C  CE    . MET E  1  90   ? 220.690 239.781 139.244 1.00 316.06 ? 90   MET V CE    1 
ATOM   3419  N  N     . ALA E  1  91   ? 223.789 244.749 138.024 1.00 40.83  ? 91   ALA V N     1 
ATOM   3420  C  CA    . ALA E  1  91   ? 224.616 245.654 138.818 1.00 39.51  ? 91   ALA V CA    1 
ATOM   3421  C  C     . ALA E  1  91   ? 223.798 246.826 139.340 1.00 49.88  ? 91   ALA V C     1 
ATOM   3422  O  O     . ALA E  1  91   ? 223.853 247.158 140.533 1.00 44.71  ? 91   ALA V O     1 
ATOM   3423  C  CB    . ALA E  1  91   ? 225.800 246.147 137.988 1.00 41.32  ? 91   ALA V CB    1 
ATOM   3424  N  N     . LEU E  1  92   ? 223.024 247.467 138.457 1.00 36.03  ? 92   LEU V N     1 
ATOM   3425  C  CA    . LEU E  1  92   ? 222.163 248.559 138.897 1.00 29.61  ? 92   LEU V CA    1 
ATOM   3426  C  C     . LEU E  1  92   ? 221.147 248.094 139.929 1.00 35.89  ? 92   LEU V C     1 
ATOM   3427  O  O     . LEU E  1  92   ? 220.774 248.863 140.823 1.00 45.46  ? 92   LEU V O     1 
ATOM   3428  C  CB    . LEU E  1  92   ? 221.456 249.183 137.696 1.00 31.81  ? 92   LEU V CB    1 
ATOM   3429  C  CG    . LEU E  1  92   ? 222.381 249.880 136.703 1.00 27.99  ? 92   LEU V CG    1 
ATOM   3430  C  CD1   . LEU E  1  92   ? 221.610 250.357 135.491 1.00 20.79  ? 92   LEU V CD1   1 
ATOM   3431  C  CD2   . LEU E  1  92   ? 223.080 251.038 137.380 1.00 12.18  ? 92   LEU V CD2   1 
ATOM   3432  N  N     . GLN E  1  93   ? 220.692 246.844 139.833 1.00 39.62  ? 93   GLN V N     1 
ATOM   3433  C  CA    . GLN E  1  93   ? 219.756 246.335 140.829 1.00 31.30  ? 93   GLN V CA    1 
ATOM   3434  C  C     . GLN E  1  93   ? 220.443 246.127 142.175 1.00 35.54  ? 93   GLN V C     1 
ATOM   3435  O  O     . GLN E  1  93   ? 219.872 246.453 143.222 1.00 35.81  ? 93   GLN V O     1 
ATOM   3436  C  CB    . GLN E  1  93   ? 219.117 245.038 140.339 1.00 34.00  ? 93   GLN V CB    1 
ATOM   3437  C  CG    . GLN E  1  93   ? 218.024 244.510 141.250 1.00 40.75  ? 93   GLN V CG    1 
ATOM   3438  C  CD    . GLN E  1  93   ? 217.286 243.334 140.650 1.00 51.02  ? 93   GLN V CD    1 
ATOM   3439  O  OE1   . GLN E  1  93   ? 217.518 242.964 139.499 1.00 51.99  ? 93   GLN V OE1   1 
ATOM   3440  N  NE2   . GLN E  1  93   ? 216.391 242.737 141.426 1.00 56.77  ? 93   GLN V NE2   1 
ATOM   3441  N  N     . GLU E  1  94   ? 221.666 245.592 142.167 1.00 34.89  ? 94   GLU V N     1 
ATOM   3442  C  CA    . GLU E  1  94   ? 222.411 245.434 143.412 1.00 31.73  ? 94   GLU V CA    1 
ATOM   3443  C  C     . GLU E  1  94   ? 222.645 246.781 144.086 1.00 35.01  ? 94   GLU V C     1 
ATOM   3444  O  O     . GLU E  1  94   ? 222.301 246.972 145.259 1.00 38.62  ? 94   GLU V O     1 
ATOM   3445  C  CB    . GLU E  1  94   ? 223.745 244.738 143.146 1.00 49.02  ? 94   GLU V CB    1 
ATOM   3446  C  CG    . GLU E  1  94   ? 223.637 243.307 142.655 1.00 59.67  ? 94   GLU V CG    1 
ATOM   3447  C  CD    . GLU E  1  94   ? 222.904 242.408 143.627 1.00 69.45  ? 94   GLU V CD    1 
ATOM   3448  O  OE1   . GLU E  1  94   ? 223.083 242.578 144.850 1.00 68.80  ? 94   GLU V OE1   1 
ATOM   3449  O  OE2   . GLU E  1  94   ? 222.157 241.522 143.163 1.00 59.80  ? 94   GLU V OE2   1 
ATOM   3450  N  N     . ALA E  1  95   ? 223.224 247.731 143.347 1.00 23.90  ? 95   ALA V N     1 
ATOM   3451  C  CA    . ALA E  1  95   ? 223.537 249.032 143.932 1.00 28.95  ? 95   ALA V CA    1 
ATOM   3452  C  C     . ALA E  1  95   ? 222.277 249.758 144.378 1.00 34.87  ? 95   ALA V C     1 
ATOM   3453  O  O     . ALA E  1  95   ? 222.254 250.376 145.450 1.00 35.60  ? 95   ALA V O     1 
ATOM   3454  C  CB    . ALA E  1  95   ? 224.318 249.880 142.930 1.00 27.31  ? 95   ALA V CB    1 
ATOM   3455  N  N     . SER E  1  96   ? 221.215 249.696 143.572 1.00 29.25  ? 96   SER V N     1 
ATOM   3456  C  CA    . SER E  1  96   ? 219.981 250.391 143.922 1.00 37.34  ? 96   SER V CA    1 
ATOM   3457  C  C     . SER E  1  96   ? 219.351 249.801 145.177 1.00 43.52  ? 96   SER V C     1 
ATOM   3458  O  O     . SER E  1  96   ? 218.983 250.533 146.104 1.00 40.18  ? 96   SER V O     1 
ATOM   3459  C  CB    . SER E  1  96   ? 219.000 250.339 142.752 1.00 25.97  ? 96   SER V CB    1 
ATOM   3460  O  OG    . SER E  1  96   ? 219.509 251.049 141.639 1.00 38.14  ? 96   SER V OG    1 
ATOM   3461  N  N     . GLU E  1  97   ? 219.223 248.472 145.229 1.00 33.97  ? 97   GLU V N     1 
ATOM   3462  C  CA    . GLU E  1  97   ? 218.599 247.850 146.390 1.00 36.42  ? 97   GLU V CA    1 
ATOM   3463  C  C     . GLU E  1  97   ? 219.420 248.077 147.651 1.00 34.00  ? 97   GLU V C     1 
ATOM   3464  O  O     . GLU E  1  97   ? 218.864 248.395 148.707 1.00 39.26  ? 97   GLU V O     1 
ATOM   3465  C  CB    . GLU E  1  97   ? 218.386 246.359 146.147 1.00 38.45  ? 97   GLU V CB    1 
ATOM   3466  C  CG    . GLU E  1  97   ? 217.343 246.055 145.086 1.00 51.50  ? 97   GLU V CG    1 
ATOM   3467  C  CD    . GLU E  1  97   ? 217.177 244.571 144.850 1.00 64.70  ? 97   GLU V CD    1 
ATOM   3468  O  OE1   . GLU E  1  97   ? 217.982 243.793 145.400 1.00 69.62  ? 97   GLU V OE1   1 
ATOM   3469  O  OE2   . GLU E  1  97   ? 216.244 244.180 144.119 1.00 55.49  ? 97   GLU V OE2   1 
ATOM   3470  N  N     . ALA E  1  98   ? 220.744 247.933 147.564 1.00 37.00  ? 98   ALA V N     1 
ATOM   3471  C  CA    . ALA E  1  98   ? 221.576 248.180 148.739 1.00 31.73  ? 98   ALA V CA    1 
ATOM   3472  C  C     . ALA E  1  98   ? 221.468 249.630 149.198 1.00 37.76  ? 98   ALA V C     1 
ATOM   3473  O  O     . ALA E  1  98   ? 221.376 249.908 150.402 1.00 37.75  ? 98   ALA V O     1 
ATOM   3474  C  CB    . ALA E  1  98   ? 223.029 247.817 148.442 1.00 20.51  ? 98   ALA V CB    1 
ATOM   3475  N  N     . TYR E  1  99   ? 221.464 250.569 148.245 1.00 40.58  ? 99   TYR V N     1 
ATOM   3476  C  CA    . TYR E  1  99   ? 221.331 251.979 148.593 1.00 36.81  ? 99   TYR V CA    1 
ATOM   3477  C  C     . TYR E  1  99   ? 220.008 252.256 149.295 1.00 45.22  ? 99   TYR V C     1 
ATOM   3478  O  O     . TYR E  1  99   ? 219.969 252.985 150.294 1.00 41.03  ? 99   TYR V O     1 
ATOM   3479  C  CB    . TYR E  1  99   ? 221.465 252.838 147.336 1.00 37.36  ? 99   TYR V CB    1 
ATOM   3480  C  CG    . TYR E  1  99   ? 221.209 254.308 147.564 1.00 44.28  ? 99   TYR V CG    1 
ATOM   3481  C  CD1   . TYR E  1  99   ? 222.154 255.108 148.189 1.00 33.01  ? 99   TYR V CD1   1 
ATOM   3482  C  CD2   . TYR E  1  99   ? 220.028 254.900 147.138 1.00 42.75  ? 99   TYR V CD2   1 
ATOM   3483  C  CE1   . TYR E  1  99   ? 221.926 256.453 148.394 1.00 40.83  ? 99   TYR V CE1   1 
ATOM   3484  C  CE2   . TYR E  1  99   ? 219.792 256.243 147.337 1.00 43.90  ? 99   TYR V CE2   1 
ATOM   3485  C  CZ    . TYR E  1  99   ? 220.745 257.015 147.966 1.00 58.11  ? 99   TYR V CZ    1 
ATOM   3486  O  OH    . TYR E  1  99   ? 220.513 258.357 148.169 1.00 69.71  ? 99   TYR V OH    1 
ATOM   3487  N  N     . LEU E  1  100  ? 218.912 251.680 148.796 1.00 28.27  ? 100  LEU V N     1 
ATOM   3488  C  CA    . LEU E  1  100  ? 217.622 251.896 149.444 1.00 34.99  ? 100  LEU V CA    1 
ATOM   3489  C  C     . LEU E  1  100  ? 217.555 251.227 150.809 1.00 30.41  ? 100  LEU V C     1 
ATOM   3490  O  O     . LEU E  1  100  ? 216.900 251.748 151.719 1.00 21.69  ? 100  LEU V O     1 
ATOM   3491  C  CB    . LEU E  1  100  ? 216.490 251.399 148.548 1.00 32.25  ? 100  LEU V CB    1 
ATOM   3492  C  CG    . LEU E  1  100  ? 216.315 252.169 147.239 1.00 29.89  ? 100  LEU V CG    1 
ATOM   3493  C  CD1   . LEU E  1  100  ? 215.237 251.536 146.379 1.00 23.10  ? 100  LEU V CD1   1 
ATOM   3494  C  CD2   . LEU E  1  100  ? 215.995 253.625 147.522 1.00 27.08  ? 100  LEU V CD2   1 
ATOM   3495  N  N     . VAL E  1  101  ? 218.222 250.084 150.978 1.00 26.78  ? 101  VAL V N     1 
ATOM   3496  C  CA    . VAL E  1  101  ? 218.252 249.432 152.285 1.00 23.78  ? 101  VAL V CA    1 
ATOM   3497  C  C     . VAL E  1  101  ? 218.973 250.312 153.299 1.00 34.59  ? 101  VAL V C     1 
ATOM   3498  O  O     . VAL E  1  101  ? 218.486 250.528 154.416 1.00 45.57  ? 101  VAL V O     1 
ATOM   3499  C  CB    . VAL E  1  101  ? 218.897 248.039 152.186 1.00 27.29  ? 101  VAL V CB    1 
ATOM   3500  C  CG1   . VAL E  1  101  ? 219.121 247.469 153.572 1.00 23.57  ? 101  VAL V CG1   1 
ATOM   3501  C  CG2   . VAL E  1  101  ? 218.008 247.108 151.389 1.00 23.91  ? 101  VAL V CG2   1 
ATOM   3502  N  N     . ALA E  1  102  ? 220.144 250.838 152.925 1.00 26.80  ? 102  ALA V N     1 
ATOM   3503  C  CA    . ALA E  1  102  ? 220.855 251.738 153.829 1.00 18.74  ? 102  ALA V CA    1 
ATOM   3504  C  C     . ALA E  1  102  ? 220.032 252.989 154.119 1.00 28.61  ? 102  ALA V C     1 
ATOM   3505  O  O     . ALA E  1  102  ? 219.975 253.455 155.266 1.00 23.21  ? 102  ALA V O     1 
ATOM   3506  C  CB    . ALA E  1  102  ? 222.213 252.113 153.236 1.00 31.23  ? 102  ALA V CB    1 
ATOM   3507  N  N     . LEU E  1  103  ? 219.379 253.535 153.091 1.00 33.95  ? 103  LEU V N     1 
ATOM   3508  C  CA    . LEU E  1  103  ? 218.549 254.723 153.278 1.00 21.01  ? 103  LEU V CA    1 
ATOM   3509  C  C     . LEU E  1  103  ? 217.420 254.458 154.266 1.00 28.23  ? 103  LEU V C     1 
ATOM   3510  O  O     . LEU E  1  103  ? 217.083 255.325 155.079 1.00 33.64  ? 103  LEU V O     1 
ATOM   3511  C  CB    . LEU E  1  103  ? 217.992 255.187 151.934 1.00 23.81  ? 103  LEU V CB    1 
ATOM   3512  C  CG    . LEU E  1  103  ? 217.062 256.398 151.964 1.00 19.93  ? 103  LEU V CG    1 
ATOM   3513  C  CD1   . LEU E  1  103  ? 217.807 257.618 152.470 1.00 18.42  ? 103  LEU V CD1   1 
ATOM   3514  C  CD2   . LEU E  1  103  ? 216.475 256.655 150.588 1.00 24.86  ? 103  LEU V CD2   1 
ATOM   3515  N  N     . PHE E  1  104  ? 216.821 253.266 154.210 1.00 21.12  ? 104  PHE V N     1 
ATOM   3516  C  CA    . PHE E  1  104  ? 215.784 252.923 155.177 1.00 23.40  ? 104  PHE V CA    1 
ATOM   3517  C  C     . PHE E  1  104  ? 216.351 252.611 156.553 1.00 27.69  ? 104  PHE V C     1 
ATOM   3518  O  O     . PHE E  1  104  ? 215.635 252.760 157.549 1.00 29.53  ? 104  PHE V O     1 
ATOM   3519  C  CB    . PHE E  1  104  ? 214.954 251.747 154.663 1.00 23.10  ? 104  PHE V CB    1 
ATOM   3520  C  CG    . PHE E  1  104  ? 214.081 252.090 153.492 1.00 34.19  ? 104  PHE V CG    1 
ATOM   3521  C  CD1   . PHE E  1  104  ? 213.712 253.402 153.251 1.00 31.32  ? 104  PHE V CD1   1 
ATOM   3522  C  CD2   . PHE E  1  104  ? 213.639 251.108 152.626 1.00 32.92  ? 104  PHE V CD2   1 
ATOM   3523  C  CE1   . PHE E  1  104  ? 212.910 253.725 152.175 1.00 27.82  ? 104  PHE V CE1   1 
ATOM   3524  C  CE2   . PHE E  1  104  ? 212.837 251.426 151.548 1.00 24.31  ? 104  PHE V CE2   1 
ATOM   3525  C  CZ    . PHE E  1  104  ? 212.473 252.737 151.323 1.00 20.66  ? 104  PHE V CZ    1 
ATOM   3526  N  N     . GLU E  1  105  ? 217.613 252.187 156.640 1.00 24.59  ? 105  GLU V N     1 
ATOM   3527  C  CA    . GLU E  1  105  ? 218.247 252.049 157.947 1.00 26.10  ? 105  GLU V CA    1 
ATOM   3528  C  C     . GLU E  1  105  ? 218.400 253.408 158.617 1.00 39.46  ? 105  GLU V C     1 
ATOM   3529  O  O     . GLU E  1  105  ? 217.976 253.600 159.766 1.00 39.03  ? 105  GLU V O     1 
ATOM   3530  C  CB    . GLU E  1  105  ? 219.606 251.364 157.809 1.00 24.01  ? 105  GLU V CB    1 
ATOM   3531  C  CG    . GLU E  1  105  ? 219.539 249.906 157.390 1.00 42.40  ? 105  GLU V CG    1 
ATOM   3532  C  CD    . GLU E  1  105  ? 220.913 249.290 157.210 1.00 58.46  ? 105  GLU V CD    1 
ATOM   3533  O  OE1   . GLU E  1  105  ? 221.909 250.043 157.224 1.00 63.33  ? 105  GLU V OE1   1 
ATOM   3534  O  OE2   . GLU E  1  105  ? 220.997 248.054 157.054 1.00 60.02  ? 105  GLU V OE2   1 
ATOM   3535  N  N     . ASP E  1  106  ? 219.000 254.370 157.912 1.00 37.96  ? 106  ASP V N     1 
ATOM   3536  C  CA    . ASP E  1  106  ? 219.183 255.695 158.495 1.00 30.73  ? 106  ASP V CA    1 
ATOM   3537  C  C     . ASP E  1  106  ? 217.843 256.378 158.748 1.00 36.40  ? 106  ASP V C     1 
ATOM   3538  O  O     . ASP E  1  106  ? 217.664 257.054 159.770 1.00 44.70  ? 106  ASP V O     1 
ATOM   3539  C  CB    . ASP E  1  106  ? 220.065 256.548 157.584 1.00 52.30  ? 106  ASP V CB    1 
ATOM   3540  C  CG    . ASP E  1  106  ? 221.500 256.059 157.543 1.00 75.45  ? 106  ASP V CG    1 
ATOM   3541  O  OD1   . ASP E  1  106  ? 221.881 255.261 158.424 1.00 84.95  ? 106  ASP V OD1   1 
ATOM   3542  O  OD2   . ASP E  1  106  ? 222.245 256.469 156.630 1.00 74.96  ? 106  ASP V OD2   1 
ATOM   3543  N  N     . THR E  1  107  ? 216.886 256.202 157.835 1.00 37.22  ? 107  THR V N     1 
ATOM   3544  C  CA    . THR E  1  107  ? 215.547 256.737 158.052 1.00 33.57  ? 107  THR V CA    1 
ATOM   3545  C  C     . THR E  1  107  ? 214.916 256.136 159.301 1.00 41.17  ? 107  THR V C     1 
ATOM   3546  O  O     . THR E  1  107  ? 214.267 256.844 160.082 1.00 33.36  ? 107  THR V O     1 
ATOM   3547  C  CB    . THR E  1  107  ? 214.671 256.474 156.828 1.00 25.50  ? 107  THR V CB    1 
ATOM   3548  O  OG1   . THR E  1  107  ? 215.232 257.134 155.688 1.00 33.77  ? 107  THR V OG1   1 
ATOM   3549  C  CG2   . THR E  1  107  ? 213.263 256.991 157.058 1.00 30.45  ? 107  THR V CG2   1 
ATOM   3550  N  N     . ASN E  1  108  ? 215.106 254.832 159.517 1.00 42.94  ? 108  ASN V N     1 
ATOM   3551  C  CA    . ASN E  1  108  ? 214.618 254.212 160.743 1.00 33.70  ? 108  ASN V CA    1 
ATOM   3552  C  C     . ASN E  1  108  ? 215.292 254.815 161.965 1.00 41.51  ? 108  ASN V C     1 
ATOM   3553  O  O     . ASN E  1  108  ? 214.649 255.007 163.006 1.00 41.01  ? 108  ASN V O     1 
ATOM   3554  C  CB    . ASN E  1  108  ? 214.845 252.702 160.697 1.00 33.30  ? 108  ASN V CB    1 
ATOM   3555  C  CG    . ASN E  1  108  ? 214.160 251.981 161.838 1.00 45.44  ? 108  ASN V CG    1 
ATOM   3556  O  OD1   . ASN E  1  108  ? 213.120 252.419 162.329 1.00 43.52  ? 108  ASN V OD1   1 
ATOM   3557  N  ND2   . ASN E  1  108  ? 214.745 250.871 162.272 1.00 56.22  ? 108  ASN V ND2   1 
ATOM   3558  N  N     . LEU E  1  109  ? 216.589 255.121 161.866 1.00 29.06  ? 109  LEU V N     1 
ATOM   3559  C  CA    . LEU E  1  109  ? 217.271 255.778 162.975 1.00 31.91  ? 109  LEU V CA    1 
ATOM   3560  C  C     . LEU E  1  109  ? 216.662 257.143 163.267 1.00 46.18  ? 109  LEU V C     1 
ATOM   3561  O  O     . LEU E  1  109  ? 216.527 257.535 164.432 1.00 47.62  ? 109  LEU V O     1 
ATOM   3562  C  CB    . LEU E  1  109  ? 218.764 255.908 162.677 1.00 45.16  ? 109  LEU V CB    1 
ATOM   3563  C  CG    . LEU E  1  109  ? 219.550 254.598 162.586 1.00 50.82  ? 109  LEU V CG    1 
ATOM   3564  C  CD1   . LEU E  1  109  ? 220.985 254.864 162.160 1.00 39.51  ? 109  LEU V CD1   1 
ATOM   3565  C  CD2   . LEU E  1  109  ? 219.509 253.864 163.915 1.00 27.87  ? 109  LEU V CD2   1 
ATOM   3566  N  N     . CYS E  1  110  ? 216.283 257.882 162.221 1.00 39.29  ? 110  CYS V N     1 
ATOM   3567  C  CA    . CYS E  1  110  ? 215.650 259.181 162.429 1.00 30.85  ? 110  CYS V CA    1 
ATOM   3568  C  C     . CYS E  1  110  ? 214.286 259.029 163.093 1.00 34.64  ? 110  CYS V C     1 
ATOM   3569  O  O     . CYS E  1  110  ? 213.984 259.714 164.080 1.00 34.25  ? 110  CYS V O     1 
ATOM   3570  C  CB    . CYS E  1  110  ? 215.521 259.921 161.100 1.00 58.67  ? 110  CYS V CB    1 
ATOM   3571  S  SG    . CYS E  1  110  ? 217.092 260.360 160.330 1.00 66.63  ? 110  CYS V SG    1 
ATOM   3572  N  N     . ALA E  1  111  ? 213.449 258.132 162.565 1.00 31.28  ? 111  ALA V N     1 
ATOM   3573  C  CA    . ALA E  1  111  ? 212.120 257.931 163.132 1.00 30.71  ? 111  ALA V CA    1 
ATOM   3574  C  C     . ALA E  1  111  ? 212.201 257.507 164.592 1.00 35.40  ? 111  ALA V C     1 
ATOM   3575  O  O     . ALA E  1  111  ? 211.448 258.008 165.434 1.00 37.71  ? 111  ALA V O     1 
ATOM   3576  C  CB    . ALA E  1  111  ? 211.352 256.893 162.316 1.00 36.30  ? 111  ALA V CB    1 
ATOM   3577  N  N     . ILE E  1  112  ? 213.113 256.588 164.912 1.00 32.79  ? 112  ILE V N     1 
ATOM   3578  C  CA    . ILE E  1  112  ? 213.272 256.165 166.299 1.00 34.04  ? 112  ILE V CA    1 
ATOM   3579  C  C     . ILE E  1  112  ? 213.807 257.305 167.153 1.00 37.15  ? 112  ILE V C     1 
ATOM   3580  O  O     . ILE E  1  112  ? 213.445 257.432 168.330 1.00 43.81  ? 112  ILE V O     1 
ATOM   3581  C  CB    . ILE E  1  112  ? 214.173 254.918 166.365 1.00 55.71  ? 112  ILE V CB    1 
ATOM   3582  C  CG1   . ILE E  1  112  ? 213.468 253.738 165.698 1.00 48.41  ? 112  ILE V CG1   1 
ATOM   3583  C  CG2   . ILE E  1  112  ? 214.531 254.581 167.804 1.00 41.56  ? 112  ILE V CG2   1 
ATOM   3584  C  CD1   . ILE E  1  112  ? 214.352 252.539 165.491 1.00 48.99  ? 112  ILE V CD1   1 
ATOM   3585  N  N     . HIS E  1  113  ? 214.656 258.167 166.584 1.00 38.34  ? 113  HIS V N     1 
ATOM   3586  C  CA    . HIS E  1  113  ? 215.110 259.333 167.333 1.00 36.30  ? 113  HIS V CA    1 
ATOM   3587  C  C     . HIS E  1  113  ? 213.964 260.290 167.631 1.00 41.05  ? 113  HIS V C     1 
ATOM   3588  O  O     . HIS E  1  113  ? 214.011 261.028 168.622 1.00 48.99  ? 113  HIS V O     1 
ATOM   3589  C  CB    . HIS E  1  113  ? 216.209 260.069 166.571 1.00 17.17  ? 113  HIS V CB    1 
ATOM   3590  C  CG    . HIS E  1  113  ? 216.747 261.258 167.305 1.00 26.62  ? 113  HIS V CG    1 
ATOM   3591  N  ND1   . HIS E  1  113  ? 217.412 261.150 168.506 1.00 28.21  ? 113  HIS V ND1   1 
ATOM   3592  C  CD2   . HIS E  1  113  ? 216.694 262.580 167.022 1.00 33.04  ? 113  HIS V CD2   1 
ATOM   3593  C  CE1   . HIS E  1  113  ? 217.760 262.354 168.924 1.00 34.61  ? 113  HIS V CE1   1 
ATOM   3594  N  NE2   . HIS E  1  113  ? 217.338 263.240 168.040 1.00 35.64  ? 113  HIS V NE2   1 
ATOM   3595  N  N     . ALA E  1  114  ? 212.928 260.288 166.798 1.00 58.10  ? 114  ALA V N     1 
ATOM   3596  C  CA    . ALA E  1  114  ? 211.765 261.137 167.022 1.00 51.64  ? 114  ALA V CA    1 
ATOM   3597  C  C     . ALA E  1  114  ? 210.765 260.521 167.989 1.00 63.78  ? 114  ALA V C     1 
ATOM   3598  O  O     . ALA E  1  114  ? 209.691 261.098 168.189 1.00 54.40  ? 114  ALA V O     1 
ATOM   3599  C  CB    . ALA E  1  114  ? 211.076 261.451 165.693 1.00 40.96  ? 114  ALA V CB    1 
ATOM   3600  N  N     . LYS E  1  115  ? 211.087 259.361 168.568 1.00 67.82  ? 115  LYS V N     1 
ATOM   3601  C  CA    . LYS E  1  115  ? 210.184 258.625 169.456 1.00 60.12  ? 115  LYS V CA    1 
ATOM   3602  C  C     . LYS E  1  115  ? 208.927 258.181 168.714 1.00 55.08  ? 115  LYS V C     1 
ATOM   3603  O  O     . LYS E  1  115  ? 207.809 258.283 169.223 1.00 48.30  ? 115  LYS V O     1 
ATOM   3604  C  CB    . LYS E  1  115  ? 209.829 259.438 170.703 1.00 70.12  ? 115  LYS V CB    1 
ATOM   3605  C  CG    . LYS E  1  115  ? 211.001 259.683 171.635 1.00 86.75  ? 115  LYS V CG    1 
ATOM   3606  C  CD    . LYS E  1  115  ? 210.577 260.470 172.864 1.00 104.70 ? 115  LYS V CD    1 
ATOM   3607  C  CE    . LYS E  1  115  ? 211.755 260.731 173.785 1.00 106.44 ? 115  LYS V CE    1 
ATOM   3608  N  NZ    . LYS E  1  115  ? 212.340 259.467 174.308 1.00 96.80  ? 115  LYS V NZ    1 
ATOM   3609  N  N     . ARG E  1  116  ? 209.115 257.685 167.494 1.00 53.97  ? 116  ARG V N     1 
ATOM   3610  C  CA    . ARG E  1  116  ? 208.038 257.145 166.681 1.00 48.60  ? 116  ARG V CA    1 
ATOM   3611  C  C     . ARG E  1  116  ? 208.534 255.889 165.984 1.00 49.06  ? 116  ARG V C     1 
ATOM   3612  O  O     . ARG E  1  116  ? 209.694 255.815 165.575 1.00 62.72  ? 116  ARG V O     1 
ATOM   3613  C  CB    . ARG E  1  116  ? 207.545 258.160 165.643 1.00 49.56  ? 116  ARG V CB    1 
ATOM   3614  C  CG    . ARG E  1  116  ? 206.860 259.377 166.235 1.00 60.94  ? 116  ARG V CG    1 
ATOM   3615  C  CD    . ARG E  1  116  ? 206.371 260.326 165.153 1.00 59.93  ? 116  ARG V CD    1 
ATOM   3616  N  NE    . ARG E  1  116  ? 207.471 260.900 164.384 1.00 62.66  ? 116  ARG V NE    1 
ATOM   3617  C  CZ    . ARG E  1  116  ? 207.825 260.494 163.171 1.00 66.06  ? 116  ARG V CZ    1 
ATOM   3618  N  NH1   . ARG E  1  116  ? 207.166 259.508 162.582 1.00 67.02  ? 116  ARG V NH1   1 
ATOM   3619  N  NH2   . ARG E  1  116  ? 208.840 261.073 162.543 1.00 60.05  ? 116  ARG V NH2   1 
ATOM   3620  N  N     . VAL E  1  117  ? 207.648 254.896 165.854 1.00 49.29  ? 117  VAL V N     1 
ATOM   3621  C  CA    . VAL E  1  117  ? 208.000 253.653 165.179 1.00 57.75  ? 117  VAL V CA    1 
ATOM   3622  C  C     . VAL E  1  117  ? 207.623 253.664 163.707 1.00 57.64  ? 117  VAL V C     1 
ATOM   3623  O  O     . VAL E  1  117  ? 207.834 252.659 163.014 1.00 58.59  ? 117  VAL V O     1 
ATOM   3624  C  CB    . VAL E  1  117  ? 207.341 252.444 165.871 1.00 67.97  ? 117  VAL V CB    1 
ATOM   3625  C  CG1   . VAL E  1  117  ? 207.859 252.306 167.293 1.00 66.13  ? 117  VAL V CG1   1 
ATOM   3626  C  CG2   . VAL E  1  117  ? 205.831 252.588 165.862 1.00 77.84  ? 117  VAL V CG2   1 
ATOM   3627  N  N     . THR E  1  118  ? 207.074 254.765 163.203 1.00 39.71  ? 118  THR V N     1 
ATOM   3628  C  CA    . THR E  1  118  ? 206.621 254.868 161.821 1.00 41.56  ? 118  THR V CA    1 
ATOM   3629  C  C     . THR E  1  118  ? 207.474 255.896 161.092 1.00 44.94  ? 118  THR V C     1 
ATOM   3630  O  O     . THR E  1  118  ? 207.465 257.079 161.447 1.00 50.30  ? 118  THR V O     1 
ATOM   3631  C  CB    . THR E  1  118  ? 205.146 255.264 161.758 1.00 64.48  ? 118  THR V CB    1 
ATOM   3632  O  OG1   . THR E  1  118  ? 204.356 254.267 162.416 1.00 68.94  ? 118  THR V OG1   1 
ATOM   3633  C  CG2   . THR E  1  118  ? 204.694 255.390 160.315 1.00 71.69  ? 118  THR V CG2   1 
ATOM   3634  N  N     . ILE E  1  119  ? 208.206 255.444 160.072 1.00 35.99  ? 119  ILE V N     1 
ATOM   3635  C  CA    . ILE E  1  119  ? 209.016 256.359 159.279 1.00 37.59  ? 119  ILE V CA    1 
ATOM   3636  C  C     . ILE E  1  119  ? 208.107 257.259 158.448 1.00 41.96  ? 119  ILE V C     1 
ATOM   3637  O  O     . ILE E  1  119  ? 207.028 256.853 158.001 1.00 45.93  ? 119  ILE V O     1 
ATOM   3638  C  CB    . ILE E  1  119  ? 210.000 255.580 158.388 1.00 27.95  ? 119  ILE V CB    1 
ATOM   3639  C  CG1   . ILE E  1  119  ? 209.247 254.672 157.418 1.00 34.98  ? 119  ILE V CG1   1 
ATOM   3640  C  CG2   . ILE E  1  119  ? 210.953 254.759 159.240 1.00 23.18  ? 119  ILE V CG2   1 
ATOM   3641  C  CD1   . ILE E  1  119  ? 210.135 254.008 156.393 1.00 23.57  ? 119  ILE V CD1   1 
ATOM   3642  N  N     . MET E  1  120  ? 208.545 258.493 158.246 1.00 32.46  ? 120  MET V N     1 
ATOM   3643  C  CA    . MET E  1  120  ? 207.792 259.503 157.521 1.00 29.74  ? 120  MET V CA    1 
ATOM   3644  C  C     . MET E  1  120  ? 208.675 260.121 156.450 1.00 33.62  ? 120  MET V C     1 
ATOM   3645  O  O     . MET E  1  120  ? 209.904 260.012 156.510 1.00 26.25  ? 120  MET V O     1 
ATOM   3646  C  CB    . MET E  1  120  ? 207.272 260.592 158.473 1.00 49.95  ? 120  MET V CB    1 
ATOM   3647  C  CG    . MET E  1  120  ? 206.203 260.108 159.437 1.00 43.88  ? 120  MET V CG    1 
ATOM   3648  S  SD    . MET E  1  120  ? 205.647 261.400 160.561 1.00 83.20  ? 120  MET V SD    1 
ATOM   3649  C  CE    . MET E  1  120  ? 204.739 262.452 159.430 1.00 88.39  ? 120  MET V CE    1 
ATOM   3650  N  N     . PRO E  1  121  ? 208.078 260.761 155.436 1.00 45.81  ? 121  PRO V N     1 
ATOM   3651  C  CA    . PRO E  1  121  ? 208.903 261.379 154.382 1.00 38.57  ? 121  PRO V CA    1 
ATOM   3652  C  C     . PRO E  1  121  ? 209.913 262.380 154.909 1.00 38.17  ? 121  PRO V C     1 
ATOM   3653  O  O     . PRO E  1  121  ? 211.032 262.458 154.385 1.00 38.08  ? 121  PRO V O     1 
ATOM   3654  C  CB    . PRO E  1  121  ? 207.857 262.045 153.479 1.00 18.31  ? 121  PRO V CB    1 
ATOM   3655  C  CG    . PRO E  1  121  ? 206.637 261.233 153.670 1.00 23.53  ? 121  PRO V CG    1 
ATOM   3656  C  CD    . PRO E  1  121  ? 206.641 260.814 155.109 1.00 29.24  ? 121  PRO V CD    1 
ATOM   3657  N  N     . LYS E  1  122  ? 209.548 263.153 155.934 1.00 27.12  ? 122  LYS V N     1 
ATOM   3658  C  CA    . LYS E  1  122  ? 210.495 264.091 156.521 1.00 35.44  ? 122  LYS V CA    1 
ATOM   3659  C  C     . LYS E  1  122  ? 211.693 263.381 157.139 1.00 40.84  ? 122  LYS V C     1 
ATOM   3660  O  O     . LYS E  1  122  ? 212.772 263.978 157.233 1.00 37.62  ? 122  LYS V O     1 
ATOM   3661  C  CB    . LYS E  1  122  ? 209.793 264.964 157.563 1.00 37.26  ? 122  LYS V CB    1 
ATOM   3662  C  CG    . LYS E  1  122  ? 209.193 264.200 158.725 1.00 60.09  ? 122  LYS V CG    1 
ATOM   3663  C  CD    . LYS E  1  122  ? 208.468 265.141 159.674 1.00 64.25  ? 122  LYS V CD    1 
ATOM   3664  C  CE    . LYS E  1  122  ? 207.824 264.386 160.822 1.00 61.21  ? 122  LYS V CE    1 
ATOM   3665  N  NZ    . LYS E  1  122  ? 207.098 265.301 161.745 1.00 65.59  ? 122  LYS V NZ    1 
ATOM   3666  N  N     . ASP E  1  123  ? 211.534 262.120 157.544 1.00 45.60  ? 123  ASP V N     1 
ATOM   3667  C  CA    . ASP E  1  123  ? 212.681 261.345 158.007 1.00 39.10  ? 123  ASP V CA    1 
ATOM   3668  C  C     . ASP E  1  123  ? 213.608 261.005 156.847 1.00 43.40  ? 123  ASP V C     1 
ATOM   3669  O  O     . ASP E  1  123  ? 214.833 261.132 156.959 1.00 44.94  ? 123  ASP V O     1 
ATOM   3670  C  CB    . ASP E  1  123  ? 212.202 260.073 158.706 1.00 28.15  ? 123  ASP V CB    1 
ATOM   3671  C  CG    . ASP E  1  123  ? 211.497 260.356 160.011 1.00 42.55  ? 123  ASP V CG    1 
ATOM   3672  O  OD1   . ASP E  1  123  ? 211.656 261.473 160.542 1.00 51.00  ? 123  ASP V OD1   1 
ATOM   3673  O  OD2   . ASP E  1  123  ? 210.772 259.467 160.506 1.00 41.73  ? 123  ASP V OD2   1 
ATOM   3674  N  N     . ILE E  1  124  ? 213.035 260.558 155.726 1.00 35.47  ? 124  ILE V N     1 
ATOM   3675  C  CA    . ILE E  1  124  ? 213.830 260.273 154.530 1.00 30.38  ? 124  ILE V CA    1 
ATOM   3676  C  C     . ILE E  1  124  ? 214.599 261.515 154.100 1.00 34.73  ? 124  ILE V C     1 
ATOM   3677  O  O     . ILE E  1  124  ? 215.836 261.531 154.095 1.00 40.04  ? 124  ILE V O     1 
ATOM   3678  C  CB    . ILE E  1  124  ? 212.935 259.749 153.396 1.00 27.71  ? 124  ILE V CB    1 
ATOM   3679  C  CG1   . ILE E  1  124  ? 212.354 258.383 153.755 1.00 24.05  ? 124  ILE V CG1   1 
ATOM   3680  C  CG2   . ILE E  1  124  ? 213.716 259.664 152.097 1.00 19.37  ? 124  ILE V CG2   1 
ATOM   3681  C  CD1   . ILE E  1  124  ? 211.314 257.896 152.779 1.00 30.15  ? 124  ILE V CD1   1 
ATOM   3682  N  N     . GLN E  1  125  ? 213.875 262.573 153.724 1.00 37.88  ? 125  GLN V N     1 
ATOM   3683  C  CA    . GLN E  1  125  ? 214.533 263.790 153.259 1.00 31.44  ? 125  GLN V CA    1 
ATOM   3684  C  C     . GLN E  1  125  ? 215.432 264.403 154.325 1.00 30.72  ? 125  GLN V C     1 
ATOM   3685  O  O     . GLN E  1  125  ? 216.368 265.135 153.980 1.00 34.22  ? 125  GLN V O     1 
ATOM   3686  C  CB    . GLN E  1  125  ? 213.492 264.805 152.786 1.00 34.25  ? 125  GLN V CB    1 
ATOM   3687  C  CG    . GLN E  1  125  ? 212.559 265.299 153.871 1.00 43.59  ? 125  GLN V CG    1 
ATOM   3688  C  CD    . GLN E  1  125  ? 211.514 266.263 153.343 1.00 58.46  ? 125  GLN V CD    1 
ATOM   3689  O  OE1   . GLN E  1  125  ? 211.243 266.305 152.145 1.00 70.18  ? 125  GLN V OE1   1 
ATOM   3690  N  NE2   . GLN E  1  125  ? 210.924 267.044 154.239 1.00 47.50  ? 125  GLN V NE2   1 
ATOM   3691  N  N     . LEU E  1  126  ? 215.183 264.118 155.605 1.00 27.39  ? 126  LEU V N     1 
ATOM   3692  C  CA    . LEU E  1  126  ? 216.130 264.521 156.637 1.00 23.02  ? 126  LEU V CA    1 
ATOM   3693  C  C     . LEU E  1  126  ? 217.441 263.758 156.503 1.00 28.12  ? 126  LEU V C     1 
ATOM   3694  O  O     . LEU E  1  126  ? 218.523 264.353 156.543 1.00 38.60  ? 126  LEU V O     1 
ATOM   3695  C  CB    . LEU E  1  126  ? 215.540 264.303 158.029 1.00 21.84  ? 126  LEU V CB    1 
ATOM   3696  C  CG    . LEU E  1  126  ? 216.566 264.598 159.125 1.00 25.28  ? 126  LEU V CG    1 
ATOM   3697  C  CD1   . LEU E  1  126  ? 216.947 266.070 159.126 1.00 19.00  ? 126  LEU V CD1   1 
ATOM   3698  C  CD2   . LEU E  1  126  ? 216.074 264.156 160.490 1.00 28.19  ? 126  LEU V CD2   1 
ATOM   3699  N  N     . ALA E  1  127  ? 217.361 262.433 156.354 1.00 26.72  ? 127  ALA V N     1 
ATOM   3700  C  CA    . ALA E  1  127  ? 218.573 261.634 156.203 1.00 26.59  ? 127  ALA V CA    1 
ATOM   3701  C  C     . ALA E  1  127  ? 219.348 262.041 154.955 1.00 34.80  ? 127  ALA V C     1 
ATOM   3702  O  O     . ALA E  1  127  ? 220.576 262.174 154.993 1.00 40.82  ? 127  ALA V O     1 
ATOM   3703  C  CB    . ALA E  1  127  ? 218.223 260.148 156.158 1.00 26.99  ? 127  ALA V CB    1 
ATOM   3704  N  N     . ARG E  1  128  ? 218.643 262.255 153.843 1.00 37.68  ? 128  ARG V N     1 
ATOM   3705  C  CA    . ARG E  1  128  ? 219.303 262.718 152.629 1.00 37.46  ? 128  ARG V CA    1 
ATOM   3706  C  C     . ARG E  1  128  ? 219.810 264.148 152.760 1.00 42.27  ? 128  ARG V C     1 
ATOM   3707  O  O     . ARG E  1  128  ? 220.703 264.544 152.003 1.00 33.49  ? 128  ARG V O     1 
ATOM   3708  C  CB    . ARG E  1  128  ? 218.352 262.604 151.440 1.00 18.09  ? 128  ARG V CB    1 
ATOM   3709  C  CG    . ARG E  1  128  ? 217.918 261.185 151.137 1.00 29.76  ? 128  ARG V CG    1 
ATOM   3710  C  CD    . ARG E  1  128  ? 216.968 261.140 149.959 1.00 45.26  ? 128  ARG V CD    1 
ATOM   3711  N  NE    . ARG E  1  128  ? 217.619 261.547 148.718 1.00 48.55  ? 128  ARG V NE    1 
ATOM   3712  C  CZ    . ARG E  1  128  ? 217.355 262.678 148.073 1.00 51.86  ? 128  ARG V CZ    1 
ATOM   3713  N  NH1   . ARG E  1  128  ? 216.448 263.519 148.548 1.00 61.31  ? 128  ARG V NH1   1 
ATOM   3714  N  NH2   . ARG E  1  128  ? 217.997 262.966 146.949 1.00 49.03  ? 128  ARG V NH2   1 
ATOM   3715  N  N     . ARG E  1  129  ? 219.261 264.927 153.691 1.00 35.38  ? 129  ARG V N     1 
ATOM   3716  C  CA    . ARG E  1  129  ? 219.790 266.261 153.949 1.00 28.56  ? 129  ARG V CA    1 
ATOM   3717  C  C     . ARG E  1  129  ? 221.056 266.215 154.794 1.00 33.89  ? 129  ARG V C     1 
ATOM   3718  O  O     . ARG E  1  129  ? 221.963 267.028 154.588 1.00 41.26  ? 129  ARG V O     1 
ATOM   3719  C  CB    . ARG E  1  129  ? 218.726 267.122 154.631 1.00 54.89  ? 129  ARG V CB    1 
ATOM   3720  C  CG    . ARG E  1  129  ? 219.190 268.518 155.006 1.00 58.36  ? 129  ARG V CG    1 
ATOM   3721  C  CD    . ARG E  1  129  ? 219.559 269.327 153.775 1.00 72.64  ? 129  ARG V CD    1 
ATOM   3722  N  NE    . ARG E  1  129  ? 220.002 270.674 154.125 1.00 87.16  ? 129  ARG V NE    1 
ATOM   3723  C  CZ    . ARG E  1  129  ? 221.252 270.990 154.449 1.00 82.81  ? 129  ARG V CZ    1 
ATOM   3724  N  NH1   . ARG E  1  129  ? 222.190 270.055 154.473 1.00 63.21  ? 129  ARG V NH1   1 
ATOM   3725  N  NH2   . ARG E  1  129  ? 221.561 272.243 154.752 1.00 91.37  ? 129  ARG V NH2   1 
ATOM   3726  N  N     . ILE E  1  130  ? 221.139 265.272 155.733 1.00 36.92  ? 130  ILE V N     1 
ATOM   3727  C  CA    . ILE E  1  130  ? 222.315 265.174 156.594 1.00 47.88  ? 130  ILE V CA    1 
ATOM   3728  C  C     . ILE E  1  130  ? 223.469 264.503 155.859 1.00 50.68  ? 130  ILE V C     1 
ATOM   3729  O  O     . ILE E  1  130  ? 224.630 264.887 156.028 1.00 51.93  ? 130  ILE V O     1 
ATOM   3730  C  CB    . ILE E  1  130  ? 221.952 264.436 157.893 1.00 29.35  ? 130  ILE V CB    1 
ATOM   3731  C  CG1   . ILE E  1  130  ? 220.953 265.257 158.704 1.00 28.07  ? 130  ILE V CG1   1 
ATOM   3732  C  CG2   . ILE E  1  130  ? 223.195 264.155 158.719 1.00 34.01  ? 130  ILE V CG2   1 
ATOM   3733  C  CD1   . ILE E  1  130  ? 220.371 264.516 159.883 1.00 34.51  ? 130  ILE V CD1   1 
ATOM   3734  N  N     . ARG E  1  131  ? 223.173 263.498 155.029 1.00 50.14  ? 131  ARG V N     1 
ATOM   3735  C  CA    . ARG E  1  131  ? 224.227 262.846 154.257 1.00 40.90  ? 131  ARG V CA    1 
ATOM   3736  C  C     . ARG E  1  131  ? 224.899 263.793 153.274 1.00 43.45  ? 131  ARG V C     1 
ATOM   3737  O  O     . ARG E  1  131  ? 226.012 263.508 152.818 1.00 46.09  ? 131  ARG V O     1 
ATOM   3738  C  CB    . ARG E  1  131  ? 223.669 261.649 153.489 1.00 58.35  ? 131  ARG V CB    1 
ATOM   3739  C  CG    . ARG E  1  131  ? 223.253 260.469 154.341 1.00 49.55  ? 131  ARG V CG    1 
ATOM   3740  C  CD    . ARG E  1  131  ? 222.797 259.330 153.448 1.00 54.62  ? 131  ARG V CD    1 
ATOM   3741  N  NE    . ARG E  1  131  ? 222.372 258.155 154.201 1.00 55.63  ? 131  ARG V NE    1 
ATOM   3742  C  CZ    . ARG E  1  131  ? 221.846 257.071 153.645 1.00 66.85  ? 131  ARG V CZ    1 
ATOM   3743  N  NH1   . ARG E  1  131  ? 221.679 257.014 152.332 1.00 73.05  ? 131  ARG V NH1   1 
ATOM   3744  N  NH2   . ARG E  1  131  ? 221.487 256.042 154.402 1.00 72.41  ? 131  ARG V NH2   1 
ATOM   3745  N  N     . GLY E  1  132  ? 224.257 264.905 152.935 1.00 53.46  ? 132  GLY V N     1 
ATOM   3746  C  CA    . GLY E  1  132  ? 224.803 265.823 151.957 1.00 55.22  ? 132  GLY V CA    1 
ATOM   3747  C  C     . GLY E  1  132  ? 224.422 265.525 150.528 1.00 61.23  ? 132  GLY V C     1 
ATOM   3748  O  O     . GLY E  1  132  ? 225.093 266.010 149.610 1.00 54.21  ? 132  GLY V O     1 
ATOM   3749  N  N     . GLU E  1  133  ? 223.370 264.742 150.306 1.00 48.68  ? 133  GLU V N     1 
ATOM   3750  C  CA    . GLU E  1  133  ? 222.932 264.377 148.966 1.00 52.55  ? 133  GLU V CA    1 
ATOM   3751  C  C     . GLU E  1  133  ? 221.992 265.404 148.351 1.00 68.07  ? 133  GLU V C     1 
ATOM   3752  O  O     . GLU E  1  133  ? 221.552 265.215 147.212 1.00 74.51  ? 133  GLU V O     1 
ATOM   3753  C  CB    . GLU E  1  133  ? 222.251 263.006 148.997 1.00 61.51  ? 133  GLU V CB    1 
ATOM   3754  C  CG    . GLU E  1  133  ? 223.177 261.869 149.396 1.00 65.34  ? 133  GLU V CG    1 
ATOM   3755  C  CD    . GLU E  1  133  ? 222.461 260.538 149.491 1.00 67.19  ? 133  GLU V CD    1 
ATOM   3756  O  OE1   . GLU E  1  133  ? 221.214 260.524 149.407 1.00 64.55  ? 133  GLU V OE1   1 
ATOM   3757  O  OE2   . GLU E  1  133  ? 223.143 259.505 149.658 1.00 65.47  ? 133  GLU V OE2   1 
ATOM   3758  N  N     . ARG E  1  134  ? 221.674 266.477 149.068 1.00 86.29  ? 134  ARG V N     1 
ATOM   3759  C  CA    . ARG E  1  134  ? 220.784 267.508 148.552 1.00 93.75  ? 134  ARG V CA    1 
ATOM   3760  C  C     . ARG E  1  134  ? 221.157 268.879 149.105 1.00 97.38  ? 134  ARG V C     1 
ATOM   3761  O  O     . ARG E  1  134  ? 220.289 269.664 149.488 1.00 94.07  ? 134  ARG V O     1 
ATOM   3762  C  CB    . ARG E  1  134  ? 219.329 267.182 148.893 1.00 95.36  ? 134  ARG V CB    1 
ATOM   3763  N  N     . ASP F  2  24   ? 203.046 253.228 132.801 1.00 137.01 ? 24   ASP W N     1 
ATOM   3764  C  CA    . ASP F  2  24   ? 204.464 253.476 132.554 1.00 140.04 ? 24   ASP W CA    1 
ATOM   3765  C  C     . ASP F  2  24   ? 205.349 252.482 133.295 1.00 134.10 ? 24   ASP W C     1 
ATOM   3766  O  O     . ASP F  2  24   ? 205.075 251.277 133.283 1.00 137.08 ? 24   ASP W O     1 
ATOM   3767  C  CB    . ASP F  2  24   ? 204.850 254.909 132.939 1.00 141.27 ? 24   ASP W CB    1 
ATOM   3768  C  CG    . ASP F  2  24   ? 204.239 255.945 132.017 1.00 151.91 ? 24   ASP W CG    1 
ATOM   3769  O  OD1   . ASP F  2  24   ? 203.781 255.570 130.918 1.00 155.31 ? 24   ASP W OD1   1 
ATOM   3770  O  OD2   . ASP F  2  24   ? 204.218 257.136 132.396 1.00 152.34 ? 24   ASP W OD2   1 
ATOM   3771  N  N     . ASN F  2  25   ? 206.406 252.966 133.941 1.00 120.18 ? 25   ASN W N     1 
ATOM   3772  C  CA    . ASN F  2  25   ? 207.467 252.071 134.386 1.00 111.03 ? 25   ASN W CA    1 
ATOM   3773  C  C     . ASN F  2  25   ? 207.795 252.248 135.860 1.00 115.44 ? 25   ASN W C     1 
ATOM   3774  O  O     . ASN F  2  25   ? 207.719 251.287 136.631 1.00 115.21 ? 25   ASN W O     1 
ATOM   3775  C  CB    . ASN F  2  25   ? 208.720 252.272 133.537 1.00 107.11 ? 25   ASN W CB    1 
ATOM   3776  C  CG    . ASN F  2  25   ? 208.511 251.867 132.091 1.00 106.50 ? 25   ASN W CG    1 
ATOM   3777  O  OD1   . ASN F  2  25   ? 208.476 250.681 131.765 1.00 112.33 ? 25   ASN W OD1   1 
ATOM   3778  N  ND2   . ASN F  2  25   ? 208.376 252.855 131.216 1.00 111.28 ? 25   ASN W ND2   1 
ATOM   3779  N  N     . ILE F  2  26   ? 208.215 253.456 136.255 1.00 103.80 ? 26   ILE W N     1 
ATOM   3780  C  CA    . ILE F  2  26   ? 208.599 253.708 137.644 1.00 97.60  ? 26   ILE W CA    1 
ATOM   3781  C  C     . ILE F  2  26   ? 207.501 253.277 138.608 1.00 100.27 ? 26   ILE W C     1 
ATOM   3782  O  O     . ILE F  2  26   ? 207.782 252.902 139.754 1.00 106.47 ? 26   ILE W O     1 
ATOM   3783  C  CB    . ILE F  2  26   ? 208.972 255.195 137.830 1.00 88.48  ? 26   ILE W CB    1 
ATOM   3784  C  CG1   . ILE F  2  26   ? 209.533 255.438 139.234 1.00 90.43  ? 26   ILE W CG1   1 
ATOM   3785  C  CG2   . ILE F  2  26   ? 207.774 256.092 137.559 1.00 88.33  ? 26   ILE W CG2   1 
ATOM   3786  C  CD1   . ILE F  2  26   ? 210.181 256.792 139.406 1.00 84.59  ? 26   ILE W CD1   1 
ATOM   3787  N  N     . GLN F  2  27   ? 206.242 253.302 138.163 1.00 93.03  ? 27   GLN W N     1 
ATOM   3788  C  CA    . GLN F  2  27   ? 205.167 252.722 138.955 1.00 105.08 ? 27   GLN W CA    1 
ATOM   3789  C  C     . GLN F  2  27   ? 205.262 251.203 139.027 1.00 95.04  ? 27   GLN W C     1 
ATOM   3790  O  O     . GLN F  2  27   ? 204.636 250.596 139.902 1.00 85.02  ? 27   GLN W O     1 
ATOM   3791  C  CB    . GLN F  2  27   ? 203.808 253.131 138.385 1.00 93.62  ? 27   GLN W CB    1 
ATOM   3792  C  CG    . GLN F  2  27   ? 203.521 254.618 138.485 1.00 101.83 ? 27   GLN W CG    1 
ATOM   3793  C  CD    . GLN F  2  27   ? 203.416 255.091 139.920 1.00 109.96 ? 27   GLN W CD    1 
ATOM   3794  O  OE1   . GLN F  2  27   ? 204.355 255.668 140.467 1.00 115.97 ? 27   GLN W OE1   1 
ATOM   3795  N  NE2   . GLN F  2  27   ? 202.269 254.843 140.541 1.00 100.54 ? 27   GLN W NE2   1 
ATOM   3796  N  N     . GLY F  2  28   ? 206.027 250.579 138.126 1.00 97.64  ? 28   GLY W N     1 
ATOM   3797  C  CA    . GLY F  2  28   ? 206.249 249.146 138.197 1.00 99.55  ? 28   GLY W CA    1 
ATOM   3798  C  C     . GLY F  2  28   ? 206.980 248.710 139.446 1.00 99.00  ? 28   GLY W C     1 
ATOM   3799  O  O     . GLY F  2  28   ? 206.928 247.528 139.805 1.00 100.25 ? 28   GLY W O     1 
ATOM   3800  N  N     . ILE F  2  29   ? 207.666 249.632 140.117 1.00 89.41  ? 29   ILE W N     1 
ATOM   3801  C  CA    . ILE F  2  29   ? 208.156 249.355 141.460 1.00 76.13  ? 29   ILE W CA    1 
ATOM   3802  C  C     . ILE F  2  29   ? 206.956 249.382 142.394 1.00 88.20  ? 29   ILE W C     1 
ATOM   3803  O  O     . ILE F  2  29   ? 206.250 250.392 142.495 1.00 83.31  ? 29   ILE W O     1 
ATOM   3804  C  CB    . ILE F  2  29   ? 209.227 250.367 141.881 1.00 80.28  ? 29   ILE W CB    1 
ATOM   3805  C  CG1   . ILE F  2  29   ? 210.380 250.362 140.877 1.00 77.98  ? 29   ILE W CG1   1 
ATOM   3806  C  CG2   . ILE F  2  29   ? 209.740 250.049 143.274 1.00 80.49  ? 29   ILE W CG2   1 
ATOM   3807  C  CD1   . ILE F  2  29   ? 211.050 249.015 140.733 1.00 72.46  ? 29   ILE W CD1   1 
ATOM   3808  N  N     . THR F  2  30   ? 206.722 248.274 143.080 1.00 69.72  ? 30   THR W N     1 
ATOM   3809  C  CA    . THR F  2  30   ? 205.444 248.014 143.718 1.00 68.66  ? 30   THR W CA    1 
ATOM   3810  C  C     . THR F  2  30   ? 205.504 248.310 145.209 1.00 68.41  ? 30   THR W C     1 
ATOM   3811  O  O     . THR F  2  30   ? 206.552 248.182 145.849 1.00 72.85  ? 30   THR W O     1 
ATOM   3812  C  CB    . THR F  2  30   ? 205.013 246.562 143.498 1.00 86.24  ? 30   THR W CB    1 
ATOM   3813  O  OG1   . THR F  2  30   ? 206.015 245.681 144.020 1.00 90.56  ? 30   THR W OG1   1 
ATOM   3814  C  CG2   . THR F  2  30   ? 204.831 246.287 142.015 1.00 74.73  ? 30   THR W CG2   1 
ATOM   3815  N  N     . LYS F  2  31   ? 204.369 248.745 145.743 1.00 59.49  ? 31   LYS W N     1 
ATOM   3816  C  CA    . LYS F  2  31   ? 204.165 248.948 147.171 1.00 59.98  ? 31   LYS W CA    1 
ATOM   3817  C  C     . LYS F  2  31   ? 204.696 247.760 147.976 1.00 72.57  ? 31   LYS W C     1 
ATOM   3818  O  O     . LYS F  2  31   ? 205.388 247.971 148.983 1.00 70.57  ? 31   LYS W O     1 
ATOM   3819  C  CB    . LYS F  2  31   ? 202.677 249.195 147.450 1.00 48.60  ? 31   LYS W CB    1 
ATOM   3820  C  CG    . LYS F  2  31   ? 202.317 249.460 148.896 1.00 56.43  ? 31   LYS W CG    1 
ATOM   3821  C  CD    . LYS F  2  31   ? 200.823 249.723 149.025 1.00 70.86  ? 31   LYS W CD    1 
ATOM   3822  C  CE    . LYS F  2  31   ? 200.409 249.972 150.464 1.00 83.89  ? 31   LYS W CE    1 
ATOM   3823  N  NZ    . LYS F  2  31   ? 198.947 250.228 150.580 1.00 81.42  ? 31   LYS W NZ    1 
ATOM   3824  N  N     . PRO F  2  32   ? 204.422 246.507 147.583 1.00 58.68  ? 32   PRO W N     1 
ATOM   3825  C  CA    . PRO F  2  32   ? 205.056 245.388 148.297 1.00 56.54  ? 32   PRO W CA    1 
ATOM   3826  C  C     . PRO F  2  32   ? 206.564 245.344 148.141 1.00 61.58  ? 32   PRO W C     1 
ATOM   3827  O  O     . PRO F  2  32   ? 207.249 244.923 149.080 1.00 71.14  ? 32   PRO W O     1 
ATOM   3828  C  CB    . PRO F  2  32   ? 204.392 244.152 147.672 1.00 82.22  ? 32   PRO W CB    1 
ATOM   3829  C  CG    . PRO F  2  32   ? 203.086 244.642 147.196 1.00 80.43  ? 32   PRO W CG    1 
ATOM   3830  C  CD    . PRO F  2  32   ? 203.368 246.017 146.674 1.00 70.40  ? 32   PRO W CD    1 
ATOM   3831  N  N     . ALA F  2  33   ? 207.104 245.730 146.984 1.00 60.29  ? 33   ALA W N     1 
ATOM   3832  C  CA    . ALA F  2  33   ? 208.554 245.765 146.806 1.00 48.14  ? 33   ALA W CA    1 
ATOM   3833  C  C     . ALA F  2  33   ? 209.207 246.697 147.819 1.00 56.61  ? 33   ALA W C     1 
ATOM   3834  O  O     . ALA F  2  33   ? 210.015 246.268 148.652 1.00 67.44  ? 33   ALA W O     1 
ATOM   3835  C  CB    . ALA F  2  33   ? 208.904 246.183 145.376 1.00 73.92  ? 33   ALA W CB    1 
ATOM   3836  N  N     . ILE F  2  34   ? 208.885 247.993 147.740 1.00 51.33  ? 34   ILE W N     1 
ATOM   3837  C  CA    . ILE F  2  34   ? 209.415 248.972 148.687 1.00 53.27  ? 34   ILE W CA    1 
ATOM   3838  C  C     . ILE F  2  34   ? 209.148 248.526 150.118 1.00 56.82  ? 34   ILE W C     1 
ATOM   3839  O  O     . ILE F  2  34   ? 209.983 248.714 151.014 1.00 69.97  ? 34   ILE W O     1 
ATOM   3840  C  CB    . ILE F  2  34   ? 208.811 250.361 148.409 1.00 45.31  ? 34   ILE W CB    1 
ATOM   3841  C  CG1   . ILE F  2  34   ? 209.224 250.857 147.024 1.00 46.50  ? 34   ILE W CG1   1 
ATOM   3842  C  CG2   . ILE F  2  34   ? 209.235 251.357 149.472 1.00 32.22  ? 34   ILE W CG2   1 
ATOM   3843  C  CD1   . ILE F  2  34   ? 208.482 252.097 146.580 1.00 52.83  ? 34   ILE W CD1   1 
ATOM   3844  N  N     . ARG F  2  35   ? 207.983 247.920 150.352 1.00 55.77  ? 35   ARG W N     1 
ATOM   3845  C  CA    . ARG F  2  35   ? 207.679 247.367 151.667 1.00 56.95  ? 35   ARG W CA    1 
ATOM   3846  C  C     . ARG F  2  35   ? 208.731 246.351 152.095 1.00 54.72  ? 35   ARG W C     1 
ATOM   3847  O  O     . ARG F  2  35   ? 209.204 246.380 153.237 1.00 64.28  ? 35   ARG W O     1 
ATOM   3848  C  CB    . ARG F  2  35   ? 206.286 246.740 151.642 1.00 72.96  ? 35   ARG W CB    1 
ATOM   3849  C  CG    . ARG F  2  35   ? 205.801 246.161 152.955 1.00 89.70  ? 35   ARG W CG    1 
ATOM   3850  C  CD    . ARG F  2  35   ? 204.384 245.638 152.788 1.00 107.49 ? 35   ARG W CD    1 
ATOM   3851  N  NE    . ARG F  2  35   ? 203.833 245.082 154.017 1.00 106.00 ? 35   ARG W NE    1 
ATOM   3852  C  CZ    . ARG F  2  35   ? 202.564 244.713 154.162 1.00 108.85 ? 35   ARG W CZ    1 
ATOM   3853  N  NH1   . ARG F  2  35   ? 201.716 244.845 153.151 1.00 112.81 ? 35   ARG W NH1   1 
ATOM   3854  N  NH2   . ARG F  2  35   ? 202.143 244.215 155.315 1.00 114.24 ? 35   ARG W NH2   1 
ATOM   3855  N  N     . ARG F  2  36   ? 209.125 245.456 151.184 1.00 45.44  ? 36   ARG W N     1 
ATOM   3856  C  CA    . ARG F  2  36   ? 210.136 244.454 151.507 1.00 54.91  ? 36   ARG W CA    1 
ATOM   3857  C  C     . ARG F  2  36   ? 211.497 245.097 151.742 1.00 53.34  ? 36   ARG W C     1 
ATOM   3858  O  O     . ARG F  2  36   ? 212.203 244.738 152.693 1.00 51.05  ? 36   ARG W O     1 
ATOM   3859  C  CB    . ARG F  2  36   ? 210.223 243.415 150.388 1.00 52.05  ? 36   ARG W CB    1 
ATOM   3860  C  CG    . ARG F  2  36   ? 208.990 242.536 150.246 1.00 60.56  ? 36   ARG W CG    1 
ATOM   3861  C  CD    . ARG F  2  36   ? 209.256 241.352 149.327 1.00 57.30  ? 36   ARG W CD    1 
ATOM   3862  N  NE    . ARG F  2  36   ? 209.577 241.768 147.964 1.00 57.33  ? 36   ARG W NE    1 
ATOM   3863  C  CZ    . ARG F  2  36   ? 208.671 241.979 147.016 1.00 58.88  ? 36   ARG W CZ    1 
ATOM   3864  N  NH1   . ARG F  2  36   ? 207.383 241.813 147.278 1.00 53.60  ? 36   ARG W NH1   1 
ATOM   3865  N  NH2   . ARG F  2  36   ? 209.053 242.355 145.802 1.00 58.52  ? 36   ARG W NH2   1 
ATOM   3866  N  N     . LEU F  2  37   ? 211.884 246.043 150.880 1.00 54.09  ? 37   LEU W N     1 
ATOM   3867  C  CA    . LEU F  2  37   ? 213.139 246.760 151.081 1.00 54.59  ? 37   LEU W CA    1 
ATOM   3868  C  C     . LEU F  2  37   ? 213.181 247.442 152.441 1.00 55.76  ? 37   LEU W C     1 
ATOM   3869  O  O     . LEU F  2  37   ? 214.249 247.526 153.057 1.00 55.72  ? 37   LEU W O     1 
ATOM   3870  C  CB    . LEU F  2  37   ? 213.345 247.790 149.972 1.00 57.38  ? 37   LEU W CB    1 
ATOM   3871  C  CG    . LEU F  2  37   ? 213.600 247.252 148.566 1.00 55.34  ? 37   LEU W CG    1 
ATOM   3872  C  CD1   . LEU F  2  37   ? 213.619 248.387 147.558 1.00 47.71  ? 37   LEU W CD1   1 
ATOM   3873  C  CD2   . LEU F  2  37   ? 214.913 246.491 148.535 1.00 49.75  ? 37   LEU W CD2   1 
ATOM   3874  N  N     . ALA F  2  38   ? 212.039 247.930 152.924 1.00 36.08  ? 38   ALA W N     1 
ATOM   3875  C  CA    . ALA F  2  38   ? 212.009 248.525 154.254 1.00 42.09  ? 38   ALA W CA    1 
ATOM   3876  C  C     . ALA F  2  38   ? 212.076 247.457 155.336 1.00 46.18  ? 38   ALA W C     1 
ATOM   3877  O  O     . ALA F  2  38   ? 212.703 247.664 156.381 1.00 35.40  ? 38   ALA W O     1 
ATOM   3878  C  CB    . ALA F  2  38   ? 210.760 249.385 154.418 1.00 45.89  ? 38   ALA W CB    1 
ATOM   3879  N  N     . ARG F  2  39   ? 211.433 246.306 155.108 1.00 47.48  ? 39   ARG W N     1 
ATOM   3880  C  CA    . ARG F  2  39   ? 211.522 245.217 156.075 1.00 47.08  ? 39   ARG W CA    1 
ATOM   3881  C  C     . ARG F  2  39   ? 212.956 244.740 156.246 1.00 49.63  ? 39   ARG W C     1 
ATOM   3882  O  O     . ARG F  2  39   ? 213.348 244.343 157.350 1.00 63.91  ? 39   ARG W O     1 
ATOM   3883  C  CB    . ARG F  2  39   ? 210.626 244.052 155.657 1.00 54.59  ? 39   ARG W CB    1 
ATOM   3884  C  CG    . ARG F  2  39   ? 209.145 244.380 155.609 1.00 56.64  ? 39   ARG W CG    1 
ATOM   3885  C  CD    . ARG F  2  39   ? 208.566 244.560 157.001 1.00 60.90  ? 39   ARG W CD    1 
ATOM   3886  N  NE    . ARG F  2  39   ? 207.131 244.824 156.954 1.00 69.17  ? 39   ARG W NE    1 
ATOM   3887  C  CZ    . ARG F  2  39   ? 206.598 246.040 156.909 1.00 70.75  ? 39   ARG W CZ    1 
ATOM   3888  N  NH1   . ARG F  2  39   ? 207.383 247.107 156.908 1.00 64.38  ? 39   ARG W NH1   1 
ATOM   3889  N  NH2   . ARG F  2  39   ? 205.281 246.188 156.865 1.00 68.15  ? 39   ARG W NH2   1 
ATOM   3890  N  N     . ARG F  2  40   ? 213.755 244.770 155.177 1.00 31.98  ? 40   ARG W N     1 
ATOM   3891  C  CA    . ARG F  2  40   ? 215.154 244.379 155.310 1.00 33.39  ? 40   ARG W CA    1 
ATOM   3892  C  C     . ARG F  2  40   ? 215.947 245.421 156.091 1.00 40.64  ? 40   ARG W C     1 
ATOM   3893  O  O     . ARG F  2  40   ? 216.827 245.071 156.883 1.00 56.76  ? 40   ARG W O     1 
ATOM   3894  C  CB    . ARG F  2  40   ? 215.780 244.151 153.938 1.00 36.96  ? 40   ARG W CB    1 
ATOM   3895  C  CG    . ARG F  2  40   ? 217.251 243.775 154.008 1.00 44.69  ? 40   ARG W CG    1 
ATOM   3896  C  CD    . ARG F  2  40   ? 217.854 243.560 152.635 1.00 40.49  ? 40   ARG W CD    1 
ATOM   3897  N  NE    . ARG F  2  40   ? 217.296 242.386 151.976 1.00 41.53  ? 40   ARG W NE    1 
ATOM   3898  C  CZ    . ARG F  2  40   ? 217.623 241.997 150.749 1.00 53.97  ? 40   ARG W CZ    1 
ATOM   3899  N  NH1   . ARG F  2  40   ? 218.508 242.686 150.046 1.00 54.79  ? 40   ARG W NH1   1 
ATOM   3900  N  NH2   . ARG F  2  40   ? 217.063 240.913 150.227 1.00 55.01  ? 40   ARG W NH2   1 
ATOM   3901  N  N     . GLY F  2  41   ? 215.648 246.701 155.883 1.00 33.47  ? 41   GLY W N     1 
ATOM   3902  C  CA    . GLY F  2  41   ? 216.380 247.755 156.566 1.00 24.49  ? 41   GLY W CA    1 
ATOM   3903  C  C     . GLY F  2  41   ? 216.130 247.834 158.056 1.00 29.17  ? 41   GLY W C     1 
ATOM   3904  O  O     . GLY F  2  41   ? 216.854 248.557 158.748 1.00 41.03  ? 41   GLY W O     1 
ATOM   3905  N  N     . GLY F  2  42   ? 215.134 247.112 158.566 1.00 33.26  ? 42   GLY W N     1 
ATOM   3906  C  CA    . GLY F  2  42   ? 214.790 247.158 159.970 1.00 28.39  ? 42   GLY W CA    1 
ATOM   3907  C  C     . GLY F  2  42   ? 213.567 247.982 160.298 1.00 38.78  ? 42   GLY W C     1 
ATOM   3908  O  O     . GLY F  2  42   ? 213.227 248.107 161.481 1.00 45.20  ? 42   GLY W O     1 
ATOM   3909  N  N     . VAL F  2  43   ? 212.899 248.549 159.294 1.00 37.68  ? 43   VAL W N     1 
ATOM   3910  C  CA    . VAL F  2  43   ? 211.711 249.354 159.540 1.00 34.44  ? 43   VAL W CA    1 
ATOM   3911  C  C     . VAL F  2  43   ? 210.569 248.458 159.994 1.00 44.27  ? 43   VAL W C     1 
ATOM   3912  O  O     . VAL F  2  43   ? 210.328 247.386 159.422 1.00 43.67  ? 43   VAL W O     1 
ATOM   3913  C  CB    . VAL F  2  43   ? 211.332 250.146 158.276 1.00 36.87  ? 43   VAL W CB    1 
ATOM   3914  C  CG1   . VAL F  2  43   ? 210.045 250.919 158.497 1.00 41.03  ? 43   VAL W CG1   1 
ATOM   3915  C  CG2   . VAL F  2  43   ? 212.461 251.081 157.884 1.00 34.01  ? 43   VAL W CG2   1 
ATOM   3916  N  N     . LYS F  2  44   ? 209.856 248.893 161.032 1.00 48.75  ? 44   LYS W N     1 
ATOM   3917  C  CA    . LYS F  2  44   ? 208.732 248.134 161.565 1.00 48.16  ? 44   LYS W CA    1 
ATOM   3918  C  C     . LYS F  2  44   ? 207.424 248.527 160.883 1.00 53.69  ? 44   LYS W C     1 
ATOM   3919  O  O     . LYS F  2  44   ? 206.798 247.704 160.205 1.00 57.63  ? 44   LYS W O     1 
ATOM   3920  C  CB    . LYS F  2  44   ? 208.636 248.332 163.081 1.00 74.12  ? 44   LYS W CB    1 
ATOM   3921  C  CG    . LYS F  2  44   ? 207.542 247.514 163.745 1.00 77.24  ? 44   LYS W CG    1 
ATOM   3922  C  CD    . LYS F  2  44   ? 207.540 247.719 165.251 1.00 80.52  ? 44   LYS W CD    1 
ATOM   3923  C  CE    . LYS F  2  44   ? 206.434 246.916 165.918 1.00 87.11  ? 44   LYS W CE    1 
ATOM   3924  N  NZ    . LYS F  2  44   ? 206.423 247.105 167.395 1.00 82.18  ? 44   LYS W NZ    1 
ATOM   3925  N  N     . ARG F  2  45   ? 207.001 249.775 161.054 1.00 46.49  ? 45   ARG W N     1 
ATOM   3926  C  CA    . ARG F  2  45   ? 205.761 250.275 160.481 1.00 42.80  ? 45   ARG W CA    1 
ATOM   3927  C  C     . ARG F  2  45   ? 206.071 251.411 159.514 1.00 41.77  ? 45   ARG W C     1 
ATOM   3928  O  O     . ARG F  2  45   ? 206.977 252.212 159.756 1.00 48.46  ? 45   ARG W O     1 
ATOM   3929  C  CB    . ARG F  2  45   ? 204.805 250.745 161.582 1.00 70.59  ? 45   ARG W CB    1 
ATOM   3930  C  CG    . ARG F  2  45   ? 203.468 251.256 161.083 1.00 78.18  ? 45   ARG W CG    1 
ATOM   3931  C  CD    . ARG F  2  45   ? 202.540 251.567 162.243 1.00 80.16  ? 45   ARG W CD    1 
ATOM   3932  N  NE    . ARG F  2  45   ? 201.250 252.068 161.784 1.00 85.15  ? 45   ARG W NE    1 
ATOM   3933  C  CZ    . ARG F  2  45   ? 200.189 252.221 162.567 1.00 87.46  ? 45   ARG W CZ    1 
ATOM   3934  N  NH1   . ARG F  2  45   ? 200.260 251.901 163.851 1.00 69.26  ? 45   ARG W NH1   1 
ATOM   3935  N  NH2   . ARG F  2  45   ? 199.054 252.686 162.065 1.00 93.53  ? 45   ARG W NH2   1 
ATOM   3936  N  N     . ILE F  2  46   ? 205.313 251.477 158.421 1.00 37.91  ? 46   ILE W N     1 
ATOM   3937  C  CA    . ILE F  2  46   ? 205.589 252.389 157.318 1.00 36.74  ? 46   ILE W CA    1 
ATOM   3938  C  C     . ILE F  2  46   ? 204.396 253.316 157.127 1.00 42.59  ? 46   ILE W C     1 
ATOM   3939  O  O     . ILE F  2  46   ? 203.245 252.870 157.139 1.00 38.71  ? 46   ILE W O     1 
ATOM   3940  C  CB    . ILE F  2  46   ? 205.879 251.617 156.016 1.00 49.35  ? 46   ILE W CB    1 
ATOM   3941  C  CG1   . ILE F  2  46   ? 207.115 250.736 156.173 1.00 44.24  ? 46   ILE W CG1   1 
ATOM   3942  C  CG2   . ILE F  2  46   ? 206.089 252.568 154.859 1.00 45.92  ? 46   ILE W CG2   1 
ATOM   3943  C  CD1   . ILE F  2  46   ? 207.305 249.792 155.015 1.00 45.79  ? 46   ILE W CD1   1 
ATOM   3944  N  N     . SER F  2  47   ? 204.674 254.604 156.949 1.00 30.12  ? 47   SER W N     1 
ATOM   3945  C  CA    . SER F  2  47   ? 203.634 255.559 156.608 1.00 35.31  ? 47   SER W CA    1 
ATOM   3946  C  C     . SER F  2  47   ? 203.225 255.400 155.146 1.00 35.50  ? 47   SER W C     1 
ATOM   3947  O  O     . SER F  2  47   ? 203.960 254.847 154.324 1.00 41.10  ? 47   SER W O     1 
ATOM   3948  C  CB    . SER F  2  47   ? 204.098 256.990 156.866 1.00 45.55  ? 47   SER W CB    1 
ATOM   3949  O  OG    . SER F  2  47   ? 203.101 257.922 156.486 1.00 53.82  ? 47   SER W OG    1 
ATOM   3950  N  N     . GLY F  2  48   ? 202.031 255.900 154.826 1.00 41.03  ? 48   GLY W N     1 
ATOM   3951  C  CA    . GLY F  2  48   ? 201.500 255.742 153.483 1.00 49.11  ? 48   GLY W CA    1 
ATOM   3952  C  C     . GLY F  2  48   ? 202.179 256.598 152.434 1.00 57.57  ? 48   GLY W C     1 
ATOM   3953  O  O     . GLY F  2  48   ? 202.009 256.339 151.238 1.00 59.70  ? 48   GLY W O     1 
ATOM   3954  N  N     . LEU F  2  49   ? 202.935 257.612 152.849 1.00 32.20  ? 49   LEU W N     1 
ATOM   3955  C  CA    . LEU F  2  49   ? 203.576 258.534 151.921 1.00 35.79  ? 49   LEU W CA    1 
ATOM   3956  C  C     . LEU F  2  49   ? 205.026 258.176 151.615 1.00 36.01  ? 49   LEU W C     1 
ATOM   3957  O  O     . LEU F  2  49   ? 205.678 258.895 150.854 1.00 35.88  ? 49   LEU W O     1 
ATOM   3958  C  CB    . LEU F  2  49   ? 203.501 259.961 152.469 1.00 52.67  ? 49   LEU W CB    1 
ATOM   3959  C  CG    . LEU F  2  49   ? 202.096 260.545 152.623 1.00 43.62  ? 49   LEU W CG    1 
ATOM   3960  C  CD1   . LEU F  2  49   ? 202.153 261.908 153.290 1.00 43.31  ? 49   LEU W CD1   1 
ATOM   3961  C  CD2   . LEU F  2  49   ? 201.397 260.633 151.275 1.00 32.15  ? 49   LEU W CD2   1 
ATOM   3962  N  N     . ILE F  2  50   ? 205.547 257.087 152.186 1.00 43.49  ? 50   ILE W N     1 
ATOM   3963  C  CA    . ILE F  2  50   ? 206.936 256.707 151.950 1.00 41.89  ? 50   ILE W CA    1 
ATOM   3964  C  C     . ILE F  2  50   ? 207.149 256.282 150.504 1.00 43.59  ? 50   ILE W C     1 
ATOM   3965  O  O     . ILE F  2  50   ? 208.257 256.404 149.965 1.00 41.91  ? 50   ILE W O     1 
ATOM   3966  C  CB    . ILE F  2  50   ? 207.343 255.589 152.930 1.00 25.35  ? 50   ILE W CB    1 
ATOM   3967  C  CG1   . ILE F  2  50   ? 207.171 256.061 154.372 1.00 32.89  ? 50   ILE W CG1   1 
ATOM   3968  C  CG2   . ILE F  2  50   ? 208.781 255.158 152.709 1.00 19.95  ? 50   ILE W CG2   1 
ATOM   3969  C  CD1   . ILE F  2  50   ? 208.021 257.254 154.707 1.00 29.23  ? 50   ILE W CD1   1 
ATOM   3970  N  N     . TYR F  2  51   ? 206.094 255.809 149.840 1.00 33.56  ? 51   TYR W N     1 
ATOM   3971  C  CA    . TYR F  2  51   ? 206.257 255.142 148.553 1.00 35.57  ? 51   TYR W CA    1 
ATOM   3972  C  C     . TYR F  2  51   ? 206.640 256.127 147.453 1.00 43.48  ? 51   TYR W C     1 
ATOM   3973  O  O     . TYR F  2  51   ? 207.593 255.889 146.700 1.00 50.56  ? 51   TYR W O     1 
ATOM   3974  C  CB    . TYR F  2  51   ? 204.969 254.395 148.213 1.00 45.48  ? 51   TYR W CB    1 
ATOM   3975  C  CG    . TYR F  2  51   ? 204.643 253.342 149.245 1.00 56.10  ? 51   TYR W CG    1 
ATOM   3976  C  CD1   . TYR F  2  51   ? 205.633 252.498 149.730 1.00 60.51  ? 51   TYR W CD1   1 
ATOM   3977  C  CD2   . TYR F  2  51   ? 203.365 253.225 149.773 1.00 61.22  ? 51   TYR W CD2   1 
ATOM   3978  C  CE1   . TYR F  2  51   ? 205.353 251.541 150.684 1.00 73.02  ? 51   TYR W CE1   1 
ATOM   3979  C  CE2   . TYR F  2  51   ? 203.077 252.274 150.732 1.00 68.46  ? 51   TYR W CE2   1 
ATOM   3980  C  CZ    . TYR F  2  51   ? 204.075 251.433 151.182 1.00 76.65  ? 51   TYR W CZ    1 
ATOM   3981  O  OH    . TYR F  2  51   ? 203.799 250.481 152.136 1.00 76.84  ? 51   TYR W OH    1 
ATOM   3982  N  N     . GLU F  2  52   ? 205.912 257.242 147.346 1.00 36.52  ? 52   GLU W N     1 
ATOM   3983  C  CA    . GLU F  2  52   ? 206.232 258.235 146.323 1.00 41.82  ? 52   GLU W CA    1 
ATOM   3984  C  C     . GLU F  2  52   ? 207.638 258.790 146.512 1.00 43.18  ? 52   GLU W C     1 
ATOM   3985  O  O     . GLU F  2  52   ? 208.398 258.928 145.543 1.00 41.75  ? 52   GLU W O     1 
ATOM   3986  C  CB    . GLU F  2  52   ? 205.201 259.363 146.347 1.00 55.90  ? 52   GLU W CB    1 
ATOM   3987  C  CG    . GLU F  2  52   ? 203.791 258.931 145.980 1.00 64.54  ? 52   GLU W CG    1 
ATOM   3988  C  CD    . GLU F  2  52   ? 203.705 258.332 144.590 1.00 64.58  ? 52   GLU W CD    1 
ATOM   3989  O  OE1   . GLU F  2  52   ? 204.391 258.841 143.681 1.00 68.60  ? 52   GLU W OE1   1 
ATOM   3990  O  OE2   . GLU F  2  52   ? 202.951 257.354 144.411 1.00 51.86  ? 52   GLU W OE2   1 
ATOM   3991  N  N     . GLU F  2  53   ? 208.004 259.112 147.755 1.00 36.54  ? 53   GLU W N     1 
ATOM   3992  C  CA    . GLU F  2  53   ? 209.343 259.625 148.023 1.00 30.09  ? 53   GLU W CA    1 
ATOM   3993  C  C     . GLU F  2  53   ? 210.409 258.598 147.663 1.00 33.78  ? 53   GLU W C     1 
ATOM   3994  O  O     . GLU F  2  53   ? 211.452 258.948 147.099 1.00 32.61  ? 53   GLU W O     1 
ATOM   3995  C  CB    . GLU F  2  53   ? 209.464 260.032 149.492 1.00 24.87  ? 53   GLU W CB    1 
ATOM   3996  C  CG    . GLU F  2  53   ? 210.811 260.641 149.864 1.00 32.76  ? 53   GLU W CG    1 
ATOM   3997  C  CD    . GLU F  2  53   ? 211.058 261.988 149.209 1.00 52.85  ? 53   GLU W CD    1 
ATOM   3998  O  OE1   . GLU F  2  53   ? 210.096 262.590 148.690 1.00 60.74  ? 53   GLU W OE1   1 
ATOM   3999  O  OE2   . GLU F  2  53   ? 212.220 262.445 149.213 1.00 56.45  ? 53   GLU W OE2   1 
ATOM   4000  N  N     . THR F  2  54   ? 210.160 257.324 147.974 1.00 37.02  ? 54   THR W N     1 
ATOM   4001  C  CA    . THR F  2  54   ? 211.123 256.284 147.634 1.00 29.00  ? 54   THR W CA    1 
ATOM   4002  C  C     . THR F  2  54   ? 211.281 256.151 146.124 1.00 23.71  ? 54   THR W C     1 
ATOM   4003  O  O     . THR F  2  54   ? 212.397 255.960 145.626 1.00 19.96  ? 54   THR W O     1 
ATOM   4004  C  CB    . THR F  2  54   ? 210.706 254.953 148.255 1.00 21.31  ? 54   THR W CB    1 
ATOM   4005  O  OG1   . THR F  2  54   ? 210.662 255.086 149.682 1.00 26.33  ? 54   THR W OG1   1 
ATOM   4006  C  CG2   . THR F  2  54   ? 211.693 253.859 147.888 1.00 10.10  ? 54   THR W CG2   1 
ATOM   4007  N  N     . ARG F  2  55   ? 210.178 256.258 145.377 1.00 26.77  ? 55   ARG W N     1 
ATOM   4008  C  CA    . ARG F  2  55   ? 210.285 256.226 143.921 1.00 30.77  ? 55   ARG W CA    1 
ATOM   4009  C  C     . ARG F  2  55   ? 211.082 257.416 143.403 1.00 25.43  ? 55   ARG W C     1 
ATOM   4010  O  O     . ARG F  2  55   ? 211.899 257.273 142.484 1.00 31.03  ? 55   ARG W O     1 
ATOM   4011  C  CB    . ARG F  2  55   ? 208.897 256.191 143.281 1.00 60.06  ? 55   ARG W CB    1 
ATOM   4012  C  CG    . ARG F  2  55   ? 208.122 254.909 143.530 1.00 55.40  ? 55   ARG W CG    1 
ATOM   4013  C  CD    . ARG F  2  55   ? 206.787 254.936 142.800 1.00 58.94  ? 55   ARG W CD    1 
ATOM   4014  N  NE    . ARG F  2  55   ? 206.024 253.708 142.995 1.00 62.95  ? 55   ARG W NE    1 
ATOM   4015  C  CZ    . ARG F  2  55   ? 205.200 253.497 144.014 1.00 66.22  ? 55   ARG W CZ    1 
ATOM   4016  N  NH1   . ARG F  2  55   ? 205.019 254.437 144.929 1.00 62.52  ? 55   ARG W NH1   1 
ATOM   4017  N  NH2   . ARG F  2  55   ? 204.546 252.347 144.111 1.00 78.02  ? 55   ARG W NH2   1 
ATOM   4018  N  N     . GLY F  2  56   ? 210.861 258.600 143.977 1.00 17.08  ? 56   GLY W N     1 
ATOM   4019  C  CA    . GLY F  2  56   ? 211.632 259.763 143.562 1.00 16.23  ? 56   GLY W CA    1 
ATOM   4020  C  C     . GLY F  2  56   ? 213.118 259.591 143.811 1.00 30.73  ? 56   GLY W C     1 
ATOM   4021  O  O     . GLY F  2  56   ? 213.943 259.852 142.930 1.00 38.34  ? 56   GLY W O     1 
ATOM   4022  N  N     . VAL F  2  57   ? 213.477 259.139 145.016 1.00 24.79  ? 57   VAL W N     1 
ATOM   4023  C  CA    . VAL F  2  57   ? 214.883 258.927 145.349 1.00 17.95  ? 57   VAL W CA    1 
ATOM   4024  C  C     . VAL F  2  57   ? 215.504 257.891 144.423 1.00 26.72  ? 57   VAL W C     1 
ATOM   4025  O  O     . VAL F  2  57   ? 216.624 258.069 143.920 1.00 42.21  ? 57   VAL W O     1 
ATOM   4026  C  CB    . VAL F  2  57   ? 215.022 258.518 146.827 1.00 31.85  ? 57   VAL W CB    1 
ATOM   4027  C  CG1   . VAL F  2  57   ? 216.463 258.170 147.151 1.00 32.36  ? 57   VAL W CG1   1 
ATOM   4028  C  CG2   . VAL F  2  57   ? 214.526 259.631 147.728 1.00 24.41  ? 57   VAL W CG2   1 
ATOM   4029  N  N     . LEU F  2  58   ? 214.788 256.790 144.175 1.00 20.30  ? 58   LEU W N     1 
ATOM   4030  C  CA    . LEU F  2  58   ? 215.304 255.759 143.282 1.00 29.46  ? 58   LEU W CA    1 
ATOM   4031  C  C     . LEU F  2  58   ? 215.539 256.310 141.883 1.00 29.71  ? 58   LEU W C     1 
ATOM   4032  O  O     . LEU F  2  58   ? 216.571 256.025 141.262 1.00 32.87  ? 58   LEU W O     1 
ATOM   4033  C  CB    . LEU F  2  58   ? 214.341 254.573 143.238 1.00 20.99  ? 58   LEU W CB    1 
ATOM   4034  C  CG    . LEU F  2  58   ? 214.730 253.436 142.297 1.00 20.57  ? 58   LEU W CG    1 
ATOM   4035  C  CD1   . LEU F  2  58   ? 216.040 252.811 142.741 1.00 15.74  ? 58   LEU W CD1   1 
ATOM   4036  C  CD2   . LEU F  2  58   ? 213.628 252.395 142.232 1.00 25.46  ? 58   LEU W CD2   1 
ATOM   4037  N  N     . LYS F  2  59   ? 214.600 257.107 141.373 1.00 31.17  ? 59   LYS W N     1 
ATOM   4038  C  CA    . LYS F  2  59   ? 214.783 257.708 140.056 1.00 34.21  ? 59   LYS W CA    1 
ATOM   4039  C  C     . LYS F  2  59   ? 216.002 258.622 140.033 1.00 33.89  ? 59   LYS W C     1 
ATOM   4040  O  O     . LYS F  2  59   ? 216.779 258.608 139.069 1.00 30.70  ? 59   LYS W O     1 
ATOM   4041  C  CB    . LYS F  2  59   ? 213.527 258.475 139.648 1.00 37.73  ? 59   LYS W CB    1 
ATOM   4042  C  CG    . LYS F  2  59   ? 213.603 259.077 138.256 1.00 51.36  ? 59   LYS W CG    1 
ATOM   4043  C  CD    . LYS F  2  59   ? 212.314 259.785 137.883 1.00 78.49  ? 59   LYS W CD    1 
ATOM   4044  C  CE    . LYS F  2  59   ? 212.411 260.402 136.496 1.00 89.15  ? 59   LYS W CE    1 
ATOM   4045  N  NZ    . LYS F  2  59   ? 211.156 261.102 136.105 1.00 90.47  ? 59   LYS W NZ    1 
ATOM   4046  N  N     . VAL F  2  60   ? 216.185 259.425 141.084 1.00 26.80  ? 60   VAL W N     1 
ATOM   4047  C  CA    . VAL F  2  60   ? 217.371 260.277 141.186 1.00 33.70  ? 60   VAL W CA    1 
ATOM   4048  C  C     . VAL F  2  60   ? 218.641 259.439 141.080 1.00 42.36  ? 60   VAL W C     1 
ATOM   4049  O  O     . VAL F  2  60   ? 219.457 259.629 140.169 1.00 43.16  ? 60   VAL W O     1 
ATOM   4050  C  CB    . VAL F  2  60   ? 217.343 261.093 142.489 1.00 42.09  ? 60   VAL W CB    1 
ATOM   4051  C  CG1   . VAL F  2  60   ? 218.656 261.832 142.671 1.00 33.52  ? 60   VAL W CG1   1 
ATOM   4052  C  CG2   . VAL F  2  60   ? 216.186 262.075 142.469 1.00 46.55  ? 60   VAL W CG2   1 
ATOM   4053  N  N     . PHE F  2  61   ? 218.830 258.514 142.026 1.00 23.80  ? 61   PHE W N     1 
ATOM   4054  C  CA    . PHE F  2  61   ? 220.040 257.695 142.046 1.00 22.63  ? 61   PHE W CA    1 
ATOM   4055  C  C     . PHE F  2  61   ? 220.280 257.001 140.708 1.00 26.34  ? 61   PHE W C     1 
ATOM   4056  O  O     . PHE F  2  61   ? 221.412 256.974 140.206 1.00 25.34  ? 61   PHE W O     1 
ATOM   4057  C  CB    . PHE F  2  61   ? 219.951 256.668 143.175 1.00 20.45  ? 61   PHE W CB    1 
ATOM   4058  C  CG    . PHE F  2  61   ? 221.117 255.727 143.238 1.00 19.35  ? 61   PHE W CG    1 
ATOM   4059  C  CD1   . PHE F  2  61   ? 222.305 256.113 143.831 1.00 18.63  ? 61   PHE W CD1   1 
ATOM   4060  C  CD2   . PHE F  2  61   ? 221.023 254.450 142.714 1.00 29.89  ? 61   PHE W CD2   1 
ATOM   4061  C  CE1   . PHE F  2  61   ? 223.378 255.247 143.895 1.00 25.06  ? 61   PHE W CE1   1 
ATOM   4062  C  CE2   . PHE F  2  61   ? 222.091 253.579 142.776 1.00 37.57  ? 61   PHE W CE2   1 
ATOM   4063  C  CZ    . PHE F  2  61   ? 223.270 253.978 143.367 1.00 31.36  ? 61   PHE W CZ    1 
ATOM   4064  N  N     . LEU F  2  62   ? 219.223 256.442 140.110 1.00 20.77  ? 62   LEU W N     1 
ATOM   4065  C  CA    . LEU F  2  62   ? 219.385 255.765 138.828 1.00 29.14  ? 62   LEU W CA    1 
ATOM   4066  C  C     . LEU F  2  62   ? 219.827 256.729 137.734 1.00 44.23  ? 62   LEU W C     1 
ATOM   4067  O  O     . LEU F  2  62   ? 220.659 256.376 136.893 1.00 45.88  ? 62   LEU W O     1 
ATOM   4068  C  CB    . LEU F  2  62   ? 218.093 255.056 138.427 1.00 27.12  ? 62   LEU W CB    1 
ATOM   4069  C  CG    . LEU F  2  62   ? 217.748 253.811 139.240 1.00 33.78  ? 62   LEU W CG    1 
ATOM   4070  C  CD1   . LEU F  2  62   ? 216.384 253.285 138.844 1.00 32.69  ? 62   LEU W CD1   1 
ATOM   4071  C  CD2   . LEU F  2  62   ? 218.809 252.751 139.020 1.00 30.25  ? 62   LEU W CD2   1 
ATOM   4072  N  N     . GLU F  2  63   ? 219.285 257.949 137.718 1.00 29.82  ? 63   GLU W N     1 
ATOM   4073  C  CA    . GLU F  2  63   ? 219.765 258.930 136.749 1.00 37.75  ? 63   GLU W CA    1 
ATOM   4074  C  C     . GLU F  2  63   ? 221.239 259.238 136.968 1.00 34.74  ? 63   GLU W C     1 
ATOM   4075  O  O     . GLU F  2  63   ? 222.018 259.309 136.008 1.00 32.82  ? 63   GLU W O     1 
ATOM   4076  C  CB    . GLU F  2  63   ? 218.934 260.211 136.821 1.00 54.79  ? 63   GLU W CB    1 
ATOM   4077  C  CG    . GLU F  2  63   ? 217.509 260.063 136.321 1.00 57.64  ? 63   GLU W CG    1 
ATOM   4078  C  CD    . GLU F  2  63   ? 216.715 261.349 136.435 1.00 65.83  ? 63   GLU W CD    1 
ATOM   4079  O  OE1   . GLU F  2  63   ? 217.210 262.301 137.072 1.00 63.65  ? 63   GLU W OE1   1 
ATOM   4080  O  OE2   . GLU F  2  63   ? 215.594 261.410 135.885 1.00 67.69  ? 63   GLU W OE2   1 
ATOM   4081  N  N     . ASN F  2  64   ? 221.645 259.397 138.231 1.00 37.21  ? 64   ASN W N     1 
ATOM   4082  C  CA    . ASN F  2  64   ? 223.029 259.747 138.528 1.00 34.99  ? 64   ASN W CA    1 
ATOM   4083  C  C     . ASN F  2  64   ? 223.994 258.655 138.078 1.00 29.16  ? 64   ASN W C     1 
ATOM   4084  O  O     . ASN F  2  64   ? 225.057 258.952 137.521 1.00 45.38  ? 64   ASN W O     1 
ATOM   4085  C  CB    . ASN F  2  64   ? 223.193 260.026 140.021 1.00 30.00  ? 64   ASN W CB    1 
ATOM   4086  C  CG    . ASN F  2  64   ? 222.520 261.313 140.449 1.00 42.91  ? 64   ASN W CG    1 
ATOM   4087  O  OD1   . ASN F  2  64   ? 222.296 262.209 139.636 1.00 58.05  ? 64   ASN W OD1   1 
ATOM   4088  N  ND2   . ASN F  2  64   ? 222.198 261.414 141.733 1.00 34.32  ? 64   ASN W ND2   1 
ATOM   4089  N  N     . VAL F  2  65   ? 223.649 257.388 138.312 1.00 30.99  ? 65   VAL W N     1 
ATOM   4090  C  CA    . VAL F  2  65   ? 224.557 256.314 137.915 1.00 35.87  ? 65   VAL W CA    1 
ATOM   4091  C  C     . VAL F  2  65   ? 224.517 256.108 136.404 1.00 41.93  ? 65   VAL W C     1 
ATOM   4092  O  O     . VAL F  2  65   ? 225.559 255.937 135.757 1.00 44.31  ? 65   VAL W O     1 
ATOM   4093  C  CB    . VAL F  2  65   ? 224.219 255.016 138.669 1.00 16.84  ? 65   VAL W CB    1 
ATOM   4094  C  CG1   . VAL F  2  65   ? 225.128 253.892 138.213 1.00 10.16  ? 65   VAL W CG1   1 
ATOM   4095  C  CG2   . VAL F  2  65   ? 224.339 255.227 140.164 1.00 26.60  ? 65   VAL W CG2   1 
ATOM   4096  N  N     . ILE F  2  66   ? 223.319 256.132 135.820 1.00 24.26  ? 66   ILE W N     1 
ATOM   4097  C  CA    . ILE F  2  66   ? 223.170 255.810 134.405 1.00 18.93  ? 66   ILE W CA    1 
ATOM   4098  C  C     . ILE F  2  66   ? 223.798 256.876 133.519 1.00 38.17  ? 66   ILE W C     1 
ATOM   4099  O  O     . ILE F  2  66   ? 224.347 256.556 132.459 1.00 40.73  ? 66   ILE W O     1 
ATOM   4100  C  CB    . ILE F  2  66   ? 221.685 255.578 134.066 1.00 31.49  ? 66   ILE W CB    1 
ATOM   4101  C  CG1   . ILE F  2  66   ? 221.203 254.267 134.689 1.00 26.67  ? 66   ILE W CG1   1 
ATOM   4102  C  CG2   . ILE F  2  66   ? 221.458 255.557 132.564 1.00 28.19  ? 66   ILE W CG2   1 
ATOM   4103  C  CD1   . ILE F  2  66   ? 219.713 254.057 134.586 1.00 37.26  ? 66   ILE W CD1   1 
ATOM   4104  N  N     . ARG F  2  67   ? 223.759 258.151 133.922 1.00 36.59  ? 67   ARG W N     1 
ATOM   4105  C  CA    . ARG F  2  67   ? 224.418 259.165 133.103 1.00 28.70  ? 67   ARG W CA    1 
ATOM   4106  C  C     . ARG F  2  67   ? 225.921 258.914 133.025 1.00 34.09  ? 67   ARG W C     1 
ATOM   4107  O  O     . ARG F  2  67   ? 226.537 259.083 131.963 1.00 41.97  ? 67   ARG W O     1 
ATOM   4108  C  CB    . ARG F  2  67   ? 224.118 260.568 133.634 1.00 49.67  ? 67   ARG W CB    1 
ATOM   4109  C  CG    . ARG F  2  67   ? 224.757 260.916 134.965 1.00 61.25  ? 67   ARG W CG    1 
ATOM   4110  C  CD    . ARG F  2  67   ? 224.583 262.392 135.278 1.00 76.85  ? 67   ARG W CD    1 
ATOM   4111  N  NE    . ARG F  2  67   ? 223.178 262.755 135.435 1.00 88.27  ? 67   ARG W NE    1 
ATOM   4112  C  CZ    . ARG F  2  67   ? 222.720 264.002 135.396 1.00 91.09  ? 67   ARG W CZ    1 
ATOM   4113  N  NH1   . ARG F  2  67   ? 223.557 265.011 135.202 1.00 92.99  ? 67   ARG W NH1   1 
ATOM   4114  N  NH2   . ARG F  2  67   ? 221.425 264.241 135.547 1.00 85.72  ? 67   ARG W NH2   1 
ATOM   4115  N  N     . ASP F  2  68   ? 226.523 258.472 134.130 1.00 30.27  ? 68   ASP W N     1 
ATOM   4116  C  CA    . ASP F  2  68   ? 227.947 258.158 134.118 1.00 29.23  ? 68   ASP W CA    1 
ATOM   4117  C  C     . ASP F  2  68   ? 228.226 256.914 133.286 1.00 33.31  ? 68   ASP W C     1 
ATOM   4118  O  O     . ASP F  2  68   ? 229.122 256.916 132.434 1.00 31.08  ? 68   ASP W O     1 
ATOM   4119  C  CB    . ASP F  2  68   ? 228.460 257.982 135.548 1.00 25.43  ? 68   ASP W CB    1 
ATOM   4120  C  CG    . ASP F  2  68   ? 228.499 259.287 136.315 1.00 51.07  ? 68   ASP W CG    1 
ATOM   4121  O  OD1   . ASP F  2  68   ? 228.420 260.357 135.677 1.00 71.03  ? 68   ASP W OD1   1 
ATOM   4122  O  OD2   . ASP F  2  68   ? 228.615 259.246 137.558 1.00 57.69  ? 68   ASP W OD2   1 
ATOM   4123  N  N     . ALA F  2  69   ? 227.461 255.839 133.511 1.00 22.09  ? 69   ALA W N     1 
ATOM   4124  C  CA    . ALA F  2  69   ? 227.670 254.615 132.741 1.00 25.95  ? 69   ALA W CA    1 
ATOM   4125  C  C     . ALA F  2  69   ? 227.541 254.872 131.243 1.00 21.75  ? 69   ALA W C     1 
ATOM   4126  O  O     . ALA F  2  69   ? 228.348 254.375 130.447 1.00 23.21  ? 69   ALA W O     1 
ATOM   4127  C  CB    . ALA F  2  69   ? 226.684 253.538 133.188 1.00 25.37  ? 69   ALA W CB    1 
ATOM   4128  N  N     . VAL F  2  70   ? 226.538 255.655 130.844 1.00 26.05  ? 70   VAL W N     1 
ATOM   4129  C  CA    . VAL F  2  70   ? 226.382 256.012 129.438 1.00 36.33  ? 70   VAL W CA    1 
ATOM   4130  C  C     . VAL F  2  70   ? 227.535 256.896 128.977 1.00 38.39  ? 70   VAL W C     1 
ATOM   4131  O  O     . VAL F  2  70   ? 227.932 256.843 127.807 1.00 29.10  ? 70   VAL W O     1 
ATOM   4132  C  CB    . VAL F  2  70   ? 225.014 256.681 129.212 1.00 25.12  ? 70   VAL W CB    1 
ATOM   4133  C  CG1   . VAL F  2  70   ? 224.897 257.215 127.796 1.00 25.24  ? 70   VAL W CG1   1 
ATOM   4134  C  CG2   . VAL F  2  70   ? 223.899 255.689 129.478 1.00 16.16  ? 70   VAL W CG2   1 
ATOM   4135  N  N     . THR F  2  71   ? 228.105 257.705 129.873 1.00 23.60  ? 71   THR W N     1 
ATOM   4136  C  CA    . THR F  2  71   ? 229.267 258.503 129.491 1.00 21.71  ? 71   THR W CA    1 
ATOM   4137  C  C     . THR F  2  71   ? 230.464 257.613 129.168 1.00 31.28  ? 71   THR W C     1 
ATOM   4138  O  O     . THR F  2  71   ? 231.078 257.741 128.100 1.00 44.13  ? 71   THR W O     1 
ATOM   4139  C  CB    . THR F  2  71   ? 229.616 259.497 130.595 1.00 39.23  ? 71   THR W CB    1 
ATOM   4140  O  OG1   . THR F  2  71   ? 228.508 260.380 130.812 1.00 37.19  ? 71   THR W OG1   1 
ATOM   4141  C  CG2   . THR F  2  71   ? 230.831 260.315 130.200 1.00 32.01  ? 71   THR W CG2   1 
ATOM   4142  N  N     . TYR F  2  72   ? 230.813 256.699 130.082 1.00 33.39  ? 72   TYR W N     1 
ATOM   4143  C  CA    . TYR F  2  72   ? 231.885 255.747 129.806 1.00 32.48  ? 72   TYR W CA    1 
ATOM   4144  C  C     . TYR F  2  72   ? 231.599 254.929 128.554 1.00 40.11  ? 72   TYR W C     1 
ATOM   4145  O  O     . TYR F  2  72   ? 232.527 254.586 127.812 1.00 50.25  ? 72   TYR W O     1 
ATOM   4146  C  CB    . TYR F  2  72   ? 232.095 254.807 130.995 1.00 22.93  ? 72   TYR W CB    1 
ATOM   4147  C  CG    . TYR F  2  72   ? 232.638 255.460 132.244 1.00 25.83  ? 72   TYR W CG    1 
ATOM   4148  C  CD1   . TYR F  2  72   ? 234.001 255.605 132.438 1.00 26.08  ? 72   TYR W CD1   1 
ATOM   4149  C  CD2   . TYR F  2  72   ? 231.786 255.906 133.243 1.00 26.89  ? 72   TYR W CD2   1 
ATOM   4150  C  CE1   . TYR F  2  72   ? 234.501 256.192 133.583 1.00 23.62  ? 72   TYR W CE1   1 
ATOM   4151  C  CE2   . TYR F  2  72   ? 232.277 256.495 134.389 1.00 25.79  ? 72   TYR W CE2   1 
ATOM   4152  C  CZ    . TYR F  2  72   ? 233.636 256.636 134.553 1.00 26.86  ? 72   TYR W CZ    1 
ATOM   4153  O  OH    . TYR F  2  72   ? 234.131 257.222 135.695 1.00 34.70  ? 72   TYR W OH    1 
ATOM   4154  N  N     . THR F  2  73   ? 230.329 254.606 128.306 1.00 38.38  ? 73   THR W N     1 
ATOM   4155  C  CA    . THR F  2  73   ? 229.977 253.849 127.110 1.00 48.96  ? 73   THR W CA    1 
ATOM   4156  C  C     . THR F  2  73   ? 230.242 254.661 125.848 1.00 55.56  ? 73   THR W C     1 
ATOM   4157  O  O     . THR F  2  73   ? 230.831 254.156 124.884 1.00 60.22  ? 73   THR W O     1 
ATOM   4158  C  CB    . THR F  2  73   ? 228.514 253.417 127.177 1.00 60.14  ? 73   THR W CB    1 
ATOM   4159  O  OG1   . THR F  2  73   ? 228.323 252.555 128.305 1.00 53.37  ? 73   THR W OG1   1 
ATOM   4160  C  CG2   . THR F  2  73   ? 228.118 252.681 125.913 1.00 50.15  ? 73   THR W CG2   1 
ATOM   4161  N  N     . GLU F  2  74   ? 229.818 255.926 125.836 1.00 35.91  ? 74   GLU W N     1 
ATOM   4162  C  CA    . GLU F  2  74   ? 230.023 256.765 124.659 1.00 43.59  ? 74   GLU W CA    1 
ATOM   4163  C  C     . GLU F  2  74   ? 231.496 257.071 124.427 1.00 41.30  ? 74   GLU W C     1 
ATOM   4164  O  O     . GLU F  2  74   ? 231.911 257.262 123.278 1.00 43.94  ? 74   GLU W O     1 
ATOM   4165  C  CB    . GLU F  2  74   ? 229.238 258.068 124.789 1.00 59.64  ? 74   GLU W CB    1 
ATOM   4166  C  CG    . GLU F  2  74   ? 227.731 257.906 124.738 1.00 81.30  ? 74   GLU W CG    1 
ATOM   4167  C  CD    . GLU F  2  74   ? 227.005 259.225 124.919 1.00 94.74  ? 74   GLU W CD    1 
ATOM   4168  O  OE1   . GLU F  2  74   ? 227.668 260.225 125.271 1.00 98.69  ? 74   GLU W OE1   1 
ATOM   4169  O  OE2   . GLU F  2  74   ? 225.777 259.266 124.705 1.00 95.03  ? 74   GLU W OE2   1 
ATOM   4170  N  N     . HIS F  2  75   ? 232.300 257.133 125.493 1.00 43.68  ? 75   HIS W N     1 
ATOM   4171  C  CA    . HIS F  2  75   ? 233.719 257.422 125.307 1.00 38.28  ? 75   HIS W CA    1 
ATOM   4172  C  C     . HIS F  2  75   ? 234.423 256.297 124.563 1.00 44.59  ? 75   HIS W C     1 
ATOM   4173  O  O     . HIS F  2  75   ? 235.277 256.551 123.705 1.00 60.35  ? 75   HIS W O     1 
ATOM   4174  C  CB    . HIS F  2  75   ? 234.394 257.672 126.652 1.00 29.92  ? 75   HIS W CB    1 
ATOM   4175  C  CG    . HIS F  2  75   ? 235.850 257.994 126.537 1.00 40.85  ? 75   HIS W CG    1 
ATOM   4176  N  ND1   . HIS F  2  75   ? 236.315 259.102 125.861 1.00 41.05  ? 75   HIS W ND1   1 
ATOM   4177  C  CD2   . HIS F  2  75   ? 236.947 257.348 126.998 1.00 54.00  ? 75   HIS W CD2   1 
ATOM   4178  C  CE1   . HIS F  2  75   ? 237.635 259.128 125.918 1.00 53.73  ? 75   HIS W CE1   1 
ATOM   4179  N  NE2   . HIS F  2  75   ? 238.043 258.074 126.602 1.00 55.49  ? 75   HIS W NE2   1 
ATOM   4180  N  N     . ALA F  2  76   ? 234.087 255.047 124.879 1.00 43.27  ? 76   ALA W N     1 
ATOM   4181  C  CA    . ALA F  2  76   ? 234.682 253.900 124.201 1.00 49.54  ? 76   ALA W CA    1 
ATOM   4182  C  C     . ALA F  2  76   ? 234.156 253.709 122.785 1.00 49.27  ? 76   ALA W C     1 
ATOM   4183  O  O     . ALA F  2  76   ? 234.647 252.814 122.085 1.00 57.54  ? 76   ALA W O     1 
ATOM   4184  C  CB    . ALA F  2  76   ? 234.446 252.627 125.015 1.00 66.08  ? 76   ALA W CB    1 
ATOM   4185  N  N     . LYS F  2  77   ? 233.177 254.508 122.360 1.00 56.86  ? 77   LYS W N     1 
ATOM   4186  C  CA    . LYS F  2  77   ? 232.545 254.376 121.046 1.00 65.37  ? 77   LYS W CA    1 
ATOM   4187  C  C     . LYS F  2  77   ? 231.892 253.004 120.890 1.00 69.56  ? 77   LYS W C     1 
ATOM   4188  O  O     . LYS F  2  77   ? 232.060 252.316 119.881 1.00 69.56  ? 77   LYS W O     1 
ATOM   4189  C  CB    . LYS F  2  77   ? 233.541 254.646 119.915 1.00 62.84  ? 77   LYS W CB    1 
ATOM   4190  C  CG    . LYS F  2  77   ? 234.021 256.085 119.842 1.00 68.43  ? 77   LYS W CG    1 
ATOM   4191  C  CD    . LYS F  2  77   ? 235.054 256.267 118.743 1.00 77.37  ? 77   LYS W CD    1 
ATOM   4192  C  CE    . LYS F  2  77   ? 235.509 257.713 118.649 1.00 90.56  ? 77   LYS W CE    1 
ATOM   4193  N  NZ    . LYS F  2  77   ? 236.562 257.898 117.612 1.00 97.56  ? 77   LYS W NZ    1 
ATOM   4194  N  N     . ARG F  2  78   ? 231.139 252.608 121.912 1.00 48.79  ? 78   ARG W N     1 
ATOM   4195  C  CA    . ARG F  2  78   ? 230.389 251.364 121.909 1.00 51.13  ? 78   ARG W CA    1 
ATOM   4196  C  C     . ARG F  2  78   ? 228.911 251.663 122.114 1.00 52.14  ? 78   ARG W C     1 
ATOM   4197  O  O     . ARG F  2  78   ? 228.543 252.653 122.752 1.00 56.28  ? 78   ARG W O     1 
ATOM   4198  C  CB    . ARG F  2  78   ? 230.884 250.410 123.000 1.00 65.80  ? 78   ARG W CB    1 
ATOM   4199  C  CG    . ARG F  2  78   ? 232.290 249.884 122.772 1.00 70.44  ? 78   ARG W CG    1 
ATOM   4200  C  CD    . ARG F  2  78   ? 232.715 248.910 123.860 1.00 58.72  ? 78   ARG W CD    1 
ATOM   4201  N  NE    . ARG F  2  78   ? 232.829 249.545 125.169 1.00 65.99  ? 78   ARG W NE    1 
ATOM   4202  C  CZ    . ARG F  2  78   ? 231.921 249.444 126.131 1.00 64.28  ? 78   ARG W CZ    1 
ATOM   4203  N  NH1   . ARG F  2  78   ? 230.821 248.731 125.934 1.00 63.89  ? 78   ARG W NH1   1 
ATOM   4204  N  NH2   . ARG F  2  78   ? 232.110 250.055 127.292 1.00 42.83  ? 78   ARG W NH2   1 
ATOM   4205  N  N     . LYS F  2  79   ? 228.063 250.805 121.554 1.00 53.17  ? 79   LYS W N     1 
ATOM   4206  C  CA    . LYS F  2  79   ? 226.621 250.923 121.712 1.00 53.36  ? 79   LYS W CA    1 
ATOM   4207  C  C     . LYS F  2  79   ? 226.076 250.055 122.836 1.00 56.61  ? 79   LYS W C     1 
ATOM   4208  O  O     . LYS F  2  79   ? 224.869 250.081 123.091 1.00 61.24  ? 79   LYS W O     1 
ATOM   4209  C  CB    . LYS F  2  79   ? 225.914 250.573 120.400 1.00 59.00  ? 79   LYS W CB    1 
ATOM   4210  C  CG    . LYS F  2  79   ? 226.260 251.496 119.246 1.00 74.93  ? 79   LYS W CG    1 
ATOM   4211  C  CD    . LYS F  2  79   ? 225.733 252.899 119.490 1.00 88.58  ? 79   LYS W CD    1 
ATOM   4212  C  CE    . LYS F  2  79   ? 226.070 253.824 118.335 1.00 92.97  ? 79   LYS W CE    1 
ATOM   4213  N  NZ    . LYS F  2  79   ? 225.396 253.402 117.076 1.00 97.70  ? 79   LYS W NZ    1 
ATOM   4214  N  N     . THR F  2  80   ? 226.930 249.289 123.508 1.00 52.63  ? 80   THR W N     1 
ATOM   4215  C  CA    . THR F  2  80   ? 226.515 248.379 124.567 1.00 47.75  ? 80   THR W CA    1 
ATOM   4216  C  C     . THR F  2  80   ? 227.027 248.886 125.905 1.00 53.26  ? 80   THR W C     1 
ATOM   4217  O  O     . THR F  2  80   ? 228.211 249.208 126.041 1.00 67.80  ? 80   THR W O     1 
ATOM   4218  C  CB    . THR F  2  80   ? 227.036 246.964 124.307 1.00 59.26  ? 80   THR W CB    1 
ATOM   4219  O  OG1   . THR F  2  80   ? 226.496 246.471 123.075 1.00 71.35  ? 80   THR W OG1   1 
ATOM   4220  C  CG2   . THR F  2  80   ? 226.637 246.030 125.438 1.00 61.22  ? 80   THR W CG2   1 
ATOM   4221  N  N     . VAL F  2  81   ? 226.139 248.947 126.891 1.00 44.57  ? 81   VAL W N     1 
ATOM   4222  C  CA    . VAL F  2  81   ? 226.505 249.335 128.246 1.00 45.66  ? 81   VAL W CA    1 
ATOM   4223  C  C     . VAL F  2  81   ? 226.825 248.057 129.010 1.00 47.47  ? 81   VAL W C     1 
ATOM   4224  O  O     . VAL F  2  81   ? 225.934 247.254 129.292 1.00 49.19  ? 81   VAL W O     1 
ATOM   4225  C  CB    . VAL F  2  81   ? 225.384 250.128 128.927 1.00 41.88  ? 81   VAL W CB    1 
ATOM   4226  C  CG1   . VAL F  2  81   ? 225.757 250.445 130.363 1.00 30.33  ? 81   VAL W CG1   1 
ATOM   4227  C  CG2   . VAL F  2  81   ? 225.086 251.397 128.151 1.00 43.69  ? 81   VAL W CG2   1 
ATOM   4228  N  N     . THR F  2  82   ? 228.095 247.870 129.350 1.00 33.17  ? 82   THR W N     1 
ATOM   4229  C  CA    . THR F  2  82   ? 228.544 246.629 129.956 1.00 39.33  ? 82   THR W CA    1 
ATOM   4230  C  C     . THR F  2  82   ? 228.469 246.721 131.478 1.00 40.11  ? 82   THR W C     1 
ATOM   4231  O  O     . THR F  2  82   ? 227.994 247.704 132.049 1.00 33.45  ? 82   THR W O     1 
ATOM   4232  C  CB    . THR F  2  82   ? 229.963 246.297 129.503 1.00 57.74  ? 82   THR W CB    1 
ATOM   4233  O  OG1   . THR F  2  82   ? 230.848 247.356 129.884 1.00 44.71  ? 82   THR W OG1   1 
ATOM   4234  C  CG2   . THR F  2  82   ? 230.011 246.123 127.993 1.00 50.69  ? 82   THR W CG2   1 
ATOM   4235  N  N     . ALA F  2  83   ? 228.946 245.669 132.146 1.00 51.45  ? 83   ALA W N     1 
ATOM   4236  C  CA    . ALA F  2  83   ? 229.001 245.689 133.603 1.00 45.93  ? 83   ALA W CA    1 
ATOM   4237  C  C     . ALA F  2  83   ? 230.151 246.556 134.092 1.00 36.09  ? 83   ALA W C     1 
ATOM   4238  O  O     . ALA F  2  83   ? 230.034 247.229 135.124 1.00 40.42  ? 83   ALA W O     1 
ATOM   4239  C  CB    . ALA F  2  83   ? 229.130 244.268 134.147 1.00 44.90  ? 83   ALA W CB    1 
ATOM   4240  N  N     . MET F  2  84   ? 231.270 246.555 133.366 1.00 25.51  ? 84   MET W N     1 
ATOM   4241  C  CA    . MET F  2  84   ? 232.420 247.354 133.776 1.00 34.56  ? 84   MET W CA    1 
ATOM   4242  C  C     . MET F  2  84   ? 232.106 248.842 133.767 1.00 44.05  ? 84   MET W C     1 
ATOM   4243  O  O     . MET F  2  84   ? 232.629 249.588 134.601 1.00 43.89  ? 84   MET W O     1 
ATOM   4244  C  CB    . MET F  2  84   ? 233.616 247.055 132.874 1.00 67.98  ? 84   MET W CB    1 
ATOM   4245  C  CG    . MET F  2  84   ? 234.125 245.629 132.978 1.00 79.14  ? 84   MET W CG    1 
ATOM   4246  S  SD    . MET F  2  84   ? 234.752 245.252 134.625 1.00 94.76  ? 84   MET W SD    1 
ATOM   4247  C  CE    . MET F  2  84   ? 235.264 243.549 134.416 1.00 83.47  ? 84   MET W CE    1 
ATOM   4248  N  N     . ASP F  2  85   ? 231.258 249.296 132.839 1.00 34.35  ? 85   ASP W N     1 
ATOM   4249  C  CA    . ASP F  2  85   ? 230.867 250.701 132.831 1.00 29.62  ? 85   ASP W CA    1 
ATOM   4250  C  C     . ASP F  2  85   ? 230.093 251.062 134.094 1.00 34.55  ? 85   ASP W C     1 
ATOM   4251  O  O     . ASP F  2  85   ? 230.326 252.119 134.694 1.00 33.89  ? 85   ASP W O     1 
ATOM   4252  C  CB    . ASP F  2  85   ? 230.034 251.009 131.589 1.00 46.49  ? 85   ASP W CB    1 
ATOM   4253  C  CG    . ASP F  2  85   ? 230.851 250.958 130.314 1.00 59.22  ? 85   ASP W CG    1 
ATOM   4254  O  OD1   . ASP F  2  85   ? 232.097 250.971 130.408 1.00 63.96  ? 85   ASP W OD1   1 
ATOM   4255  O  OD2   . ASP F  2  85   ? 230.252 250.912 129.220 1.00 40.21  ? 85   ASP W OD2   1 
ATOM   4256  N  N     . VAL F  2  86   ? 229.174 250.193 134.515 1.00 23.61  ? 86   VAL W N     1 
ATOM   4257  C  CA    . VAL F  2  86   ? 228.410 250.456 135.727 1.00 23.79  ? 86   VAL W CA    1 
ATOM   4258  C  C     . VAL F  2  86   ? 229.312 250.389 136.953 1.00 25.29  ? 86   VAL W C     1 
ATOM   4259  O  O     . VAL F  2  86   ? 229.156 251.174 137.895 1.00 23.16  ? 86   VAL W O     1 
ATOM   4260  C  CB    . VAL F  2  86   ? 227.229 249.475 135.832 1.00 20.89  ? 86   VAL W CB    1 
ATOM   4261  C  CG1   . VAL F  2  86   ? 226.494 249.668 137.146 1.00 17.05  ? 86   VAL W CG1   1 
ATOM   4262  C  CG2   . VAL F  2  86   ? 226.284 249.669 134.662 1.00 27.40  ? 86   VAL W CG2   1 
ATOM   4263  N  N     . VAL F  2  87   ? 230.273 249.465 136.961 1.00 15.99  ? 87   VAL W N     1 
ATOM   4264  C  CA    . VAL F  2  87   ? 231.200 249.373 138.085 1.00 27.97  ? 87   VAL W CA    1 
ATOM   4265  C  C     . VAL F  2  87   ? 232.051 250.633 138.178 1.00 31.82  ? 87   VAL W C     1 
ATOM   4266  O  O     . VAL F  2  87   ? 232.302 251.152 139.273 1.00 27.28  ? 87   VAL W O     1 
ATOM   4267  C  CB    . VAL F  2  87   ? 232.068 248.109 137.968 1.00 45.04  ? 87   VAL W CB    1 
ATOM   4268  C  CG1   . VAL F  2  87   ? 233.127 248.092 139.055 1.00 44.60  ? 87   VAL W CG1   1 
ATOM   4269  C  CG2   . VAL F  2  87   ? 231.203 246.867 138.063 1.00 45.63  ? 87   VAL W CG2   1 
ATOM   4270  N  N     . TYR F  2  88   ? 232.506 251.152 137.033 1.00 25.61  ? 88   TYR W N     1 
ATOM   4271  C  CA    . TYR F  2  88   ? 233.285 252.384 137.044 1.00 26.04  ? 88   TYR W CA    1 
ATOM   4272  C  C     . TYR F  2  88   ? 232.428 253.604 137.349 1.00 34.41  ? 88   TYR W C     1 
ATOM   4273  O  O     . TYR F  2  88   ? 232.966 254.625 137.793 1.00 33.37  ? 88   TYR W O     1 
ATOM   4274  C  CB    . TYR F  2  88   ? 234.005 252.578 135.710 1.00 35.02  ? 88   TYR W CB    1 
ATOM   4275  C  CG    . TYR F  2  88   ? 235.032 251.514 135.409 1.00 43.69  ? 88   TYR W CG    1 
ATOM   4276  C  CD1   . TYR F  2  88   ? 235.804 250.963 136.422 1.00 52.06  ? 88   TYR W CD1   1 
ATOM   4277  C  CD2   . TYR F  2  88   ? 235.247 251.075 134.110 1.00 52.51  ? 88   TYR W CD2   1 
ATOM   4278  C  CE1   . TYR F  2  88   ? 236.748 249.990 136.154 1.00 58.35  ? 88   TYR W CE1   1 
ATOM   4279  C  CE2   . TYR F  2  88   ? 236.189 250.104 133.830 1.00 62.70  ? 88   TYR W CE2   1 
ATOM   4280  C  CZ    . TYR F  2  88   ? 236.938 249.566 134.856 1.00 65.55  ? 88   TYR W CZ    1 
ATOM   4281  O  OH    . TYR F  2  88   ? 237.878 248.600 134.583 1.00 75.09  ? 88   TYR W OH    1 
ATOM   4282  N  N     . ALA F  2  89   ? 231.117 253.530 137.121 1.00 23.95  ? 89   ALA W N     1 
ATOM   4283  C  CA    . ALA F  2  89   ? 230.243 254.629 137.513 1.00 20.32  ? 89   ALA W CA    1 
ATOM   4284  C  C     . ALA F  2  89   ? 229.983 254.617 139.014 1.00 29.06  ? 89   ALA W C     1 
ATOM   4285  O  O     . ALA F  2  89   ? 229.966 255.674 139.655 1.00 42.47  ? 89   ALA W O     1 
ATOM   4286  C  CB    . ALA F  2  89   ? 228.926 254.556 136.741 1.00 23.44  ? 89   ALA W CB    1 
ATOM   4287  N  N     . LEU F  2  90   ? 229.783 253.430 139.589 1.00 24.93  ? 90   LEU W N     1 
ATOM   4288  C  CA    . LEU F  2  90   ? 229.574 253.328 141.029 1.00 19.74  ? 90   LEU W CA    1 
ATOM   4289  C  C     . LEU F  2  90   ? 230.846 253.688 141.789 1.00 40.52  ? 90   LEU W C     1 
ATOM   4290  O  O     . LEU F  2  90   ? 230.808 254.478 142.739 1.00 43.60  ? 90   LEU W O     1 
ATOM   4291  C  CB    . LEU F  2  90   ? 229.104 251.920 141.385 1.00 15.23  ? 90   LEU W CB    1 
ATOM   4292  C  CG    . LEU F  2  90   ? 227.746 251.506 140.820 1.00 26.97  ? 90   LEU W CG    1 
ATOM   4293  C  CD1   . LEU F  2  90   ? 227.462 250.051 141.135 1.00 28.73  ? 90   LEU W CD1   1 
ATOM   4294  C  CD2   . LEU F  2  90   ? 226.648 252.402 141.361 1.00 15.49  ? 90   LEU W CD2   1 
ATOM   4295  N  N     . LYS F  2  91   ? 231.982 253.110 141.388 1.00 29.72  ? 91   LYS W N     1 
ATOM   4296  C  CA    . LYS F  2  91   ? 233.258 253.529 141.958 1.00 25.49  ? 91   LYS W CA    1 
ATOM   4297  C  C     . LYS F  2  91   ? 233.528 254.998 141.669 1.00 38.46  ? 91   LYS W C     1 
ATOM   4298  O  O     . LYS F  2  91   ? 234.204 255.675 142.451 1.00 36.89  ? 91   LYS W O     1 
ATOM   4299  C  CB    . LYS F  2  91   ? 234.390 252.661 141.404 1.00 51.94  ? 91   LYS W CB    1 
ATOM   4300  C  CG    . LYS F  2  91   ? 235.764 252.972 141.977 1.00 60.99  ? 91   LYS W CG    1 
ATOM   4301  C  CD    . LYS F  2  91   ? 236.824 252.052 141.395 1.00 86.28  ? 91   LYS W CD    1 
ATOM   4302  C  CE    . LYS F  2  91   ? 238.203 252.374 141.948 1.00 100.76 ? 91   LYS W CE    1 
ATOM   4303  N  NZ    . LYS F  2  91   ? 239.251 251.483 141.377 1.00 114.88 ? 91   LYS W NZ    1 
ATOM   4304  N  N     . ARG F  2  92   ? 232.998 255.505 140.554 1.00 44.75  ? 92   ARG W N     1 
ATOM   4305  C  CA    . ARG F  2  92   ? 233.130 256.921 140.241 1.00 24.90  ? 92   ARG W CA    1 
ATOM   4306  C  C     . ARG F  2  92   ? 232.395 257.787 141.257 1.00 30.92  ? 92   ARG W C     1 
ATOM   4307  O  O     . ARG F  2  92   ? 232.886 258.853 141.644 1.00 49.14  ? 92   ARG W O     1 
ATOM   4308  C  CB    . ARG F  2  92   ? 232.611 257.183 138.826 1.00 33.19  ? 92   ARG W CB    1 
ATOM   4309  C  CG    . ARG F  2  92   ? 232.550 258.638 138.429 1.00 44.96  ? 92   ARG W CG    1 
ATOM   4310  C  CD    . ARG F  2  92   ? 233.919 259.274 138.389 1.00 59.17  ? 92   ARG W CD    1 
ATOM   4311  N  NE    . ARG F  2  92   ? 233.813 260.673 137.995 1.00 61.31  ? 92   ARG W NE    1 
ATOM   4312  C  CZ    . ARG F  2  92   ? 233.583 261.669 138.841 1.00 73.28  ? 92   ARG W CZ    1 
ATOM   4313  N  NH1   . ARG F  2  92   ? 233.443 261.424 140.137 1.00 78.77  ? 92   ARG W NH1   1 
ATOM   4314  N  NH2   . ARG F  2  92   ? 233.490 262.911 138.392 1.00 72.53  ? 92   ARG W NH2   1 
ATOM   4315  N  N     . GLN F  2  93   ? 231.225 257.342 141.712 1.00 24.93  ? 93   GLN W N     1 
ATOM   4316  C  CA    . GLN F  2  93   ? 230.435 258.122 142.657 1.00 27.66  ? 93   GLN W CA    1 
ATOM   4317  C  C     . GLN F  2  93   ? 230.745 257.804 144.115 1.00 36.12  ? 93   GLN W C     1 
ATOM   4318  O  O     . GLN F  2  93   ? 230.138 258.407 145.004 1.00 27.34  ? 93   GLN W O     1 
ATOM   4319  C  CB    . GLN F  2  93   ? 228.941 257.919 142.400 1.00 24.60  ? 93   GLN W CB    1 
ATOM   4320  C  CG    . GLN F  2  93   ? 228.470 258.479 141.077 1.00 40.52  ? 93   GLN W CG    1 
ATOM   4321  C  CD    . GLN F  2  93   ? 226.986 258.280 140.864 1.00 49.60  ? 93   GLN W CD    1 
ATOM   4322  O  OE1   . GLN F  2  93   ? 226.376 257.395 141.461 1.00 57.21  ? 93   GLN W OE1   1 
ATOM   4323  N  NE2   . GLN F  2  93   ? 226.398 259.106 140.008 1.00 46.31  ? 93   GLN W NE2   1 
ATOM   4324  N  N     . GLY F  2  94   ? 231.664 256.881 144.386 1.00 50.57  ? 94   GLY W N     1 
ATOM   4325  C  CA    . GLY F  2  94   ? 232.109 256.612 145.737 1.00 35.06  ? 94   GLY W CA    1 
ATOM   4326  C  C     . GLY F  2  94   ? 231.563 255.347 146.363 1.00 50.89  ? 94   GLY W C     1 
ATOM   4327  O  O     . GLY F  2  94   ? 231.973 255.007 147.480 1.00 51.99  ? 94   GLY W O     1 
ATOM   4328  N  N     . ARG F  2  95   ? 230.657 254.640 145.694 1.00 50.94  ? 95   ARG W N     1 
ATOM   4329  C  CA    . ARG F  2  95   ? 230.099 253.393 146.203 1.00 49.82  ? 95   ARG W CA    1 
ATOM   4330  C  C     . ARG F  2  95   ? 230.698 252.243 145.402 1.00 59.07  ? 95   ARG W C     1 
ATOM   4331  O  O     . ARG F  2  95   ? 230.360 252.051 144.231 1.00 59.30  ? 95   ARG W O     1 
ATOM   4332  C  CB    . ARG F  2  95   ? 228.575 253.400 146.109 1.00 65.67  ? 95   ARG W CB    1 
ATOM   4333  C  CG    . ARG F  2  95   ? 227.916 254.443 146.994 1.00 68.16  ? 95   ARG W CG    1 
ATOM   4334  C  CD    . ARG F  2  95   ? 226.402 254.367 146.917 1.00 78.15  ? 95   ARG W CD    1 
ATOM   4335  N  NE    . ARG F  2  95   ? 225.771 255.373 147.766 1.00 99.08  ? 95   ARG W NE    1 
ATOM   4336  C  CZ    . ARG F  2  95   ? 225.552 255.219 149.067 1.00 105.74 ? 95   ARG W CZ    1 
ATOM   4337  N  NH1   . ARG F  2  95   ? 225.913 254.098 149.675 1.00 104.33 ? 95   ARG W NH1   1 
ATOM   4338  N  NH2   . ARG F  2  95   ? 224.971 256.188 149.763 1.00 95.63  ? 95   ARG W NH2   1 
ATOM   4339  N  N     . THR F  2  96   ? 231.569 251.467 146.042 1.00 70.01  ? 96   THR W N     1 
ATOM   4340  C  CA    . THR F  2  96   ? 232.301 250.410 145.361 1.00 61.23  ? 96   THR W CA    1 
ATOM   4341  C  C     . THR F  2  96   ? 231.490 249.121 145.362 1.00 71.24  ? 96   THR W C     1 
ATOM   4342  O  O     . THR F  2  96   ? 230.859 248.772 146.365 1.00 82.69  ? 96   THR W O     1 
ATOM   4343  C  CB    . THR F  2  96   ? 233.658 250.184 146.030 1.00 72.49  ? 96   THR W CB    1 
ATOM   4344  O  OG1   . THR F  2  96   ? 234.402 251.409 146.026 1.00 74.83  ? 96   THR W OG1   1 
ATOM   4345  C  CG2   . THR F  2  96   ? 234.454 249.128 145.282 1.00 73.73  ? 96   THR W CG2   1 
ATOM   4346  N  N     . LEU F  2  97   ? 231.510 248.421 144.233 1.00 53.96  ? 97   LEU W N     1 
ATOM   4347  C  CA    . LEU F  2  97   ? 230.779 247.174 144.058 1.00 43.83  ? 97   LEU W CA    1 
ATOM   4348  C  C     . LEU F  2  97   ? 231.751 246.054 143.716 1.00 56.58  ? 97   LEU W C     1 
ATOM   4349  O  O     . LEU F  2  97   ? 232.666 246.239 142.908 1.00 63.11  ? 97   LEU W O     1 
ATOM   4350  C  CB    . LEU F  2  97   ? 229.722 247.317 142.958 1.00 53.60  ? 97   LEU W CB    1 
ATOM   4351  C  CG    . LEU F  2  97   ? 228.895 246.082 142.610 1.00 59.24  ? 97   LEU W CG    1 
ATOM   4352  C  CD1   . LEU F  2  97   ? 228.085 245.631 143.809 1.00 58.21  ? 97   LEU W CD1   1 
ATOM   4353  C  CD2   . LEU F  2  97   ? 227.987 246.382 141.432 1.00 60.88  ? 97   LEU W CD2   1 
ATOM   4354  N  N     . TYR F  2  98   ? 231.552 244.890 144.330 1.00 46.32  ? 98   TYR W N     1 
ATOM   4355  C  CA    . TYR F  2  98   ? 232.396 243.728 144.096 1.00 41.34  ? 98   TYR W CA    1 
ATOM   4356  C  C     . TYR F  2  98   ? 231.595 242.589 143.482 1.00 46.08  ? 98   TYR W C     1 
ATOM   4357  O  O     . TYR F  2  98   ? 230.366 242.527 143.586 1.00 41.66  ? 98   TYR W O     1 
ATOM   4358  C  CB    . TYR F  2  98   ? 233.059 243.218 145.381 1.00 24.50  ? 98   TYR W CB    1 
ATOM   4359  C  CG    . TYR F  2  98   ? 234.080 244.146 145.992 1.00 25.84  ? 98   TYR W CG    1 
ATOM   4360  C  CD1   . TYR F  2  98   ? 234.850 244.983 145.200 1.00 24.90  ? 98   TYR W CD1   1 
ATOM   4361  C  CD2   . TYR F  2  98   ? 234.324 244.132 147.357 1.00 19.28  ? 98   TYR W CD2   1 
ATOM   4362  C  CE1   . TYR F  2  98   ? 235.797 245.819 145.759 1.00 28.43  ? 98   TYR W CE1   1 
ATOM   4363  C  CE2   . TYR F  2  98   ? 235.271 244.957 147.920 1.00 21.34  ? 98   TYR W CE2   1 
ATOM   4364  C  CZ    . TYR F  2  98   ? 236.004 245.799 147.119 1.00 25.81  ? 98   TYR W CZ    1 
ATOM   4365  O  OH    . TYR F  2  98   ? 236.947 246.621 147.688 1.00 24.31  ? 98   TYR W OH    1 
ATOM   4366  N  N     . GLY F  2  99   ? 232.322 241.682 142.832 1.00 46.70  ? 99   GLY W N     1 
ATOM   4367  C  CA    . GLY F  2  99   ? 231.775 240.462 142.289 1.00 43.09  ? 99   GLY W CA    1 
ATOM   4368  C  C     . GLY F  2  99   ? 231.424 240.528 140.820 1.00 54.26  ? 99   GLY W C     1 
ATOM   4369  O  O     . GLY F  2  99   ? 231.383 239.481 140.159 1.00 70.92  ? 99   GLY W O     1 
ATOM   4370  N  N     . PHE F  2  100  ? 231.176 241.721 140.290 1.00 72.58  ? 100  PHE W N     1 
ATOM   4371  C  CA    . PHE F  2  100  ? 230.873 241.904 138.879 1.00 54.95  ? 100  PHE W CA    1 
ATOM   4372  C  C     . PHE F  2  100  ? 232.093 242.310 138.064 1.00 62.51  ? 100  PHE W C     1 
ATOM   4373  O  O     . PHE F  2  100  ? 231.959 242.586 136.867 1.00 80.25  ? 100  PHE W O     1 
ATOM   4374  C  CB    . PHE F  2  100  ? 229.753 242.934 138.715 1.00 60.86  ? 100  PHE W CB    1 
ATOM   4375  C  CG    . PHE F  2  100  ? 228.440 242.484 139.289 1.00 58.81  ? 100  PHE W CG    1 
ATOM   4376  C  CD1   . PHE F  2  100  ? 228.182 241.138 139.481 1.00 71.59  ? 100  PHE W CD1   1 
ATOM   4377  C  CD2   . PHE F  2  100  ? 227.472 243.401 139.649 1.00 53.26  ? 100  PHE W CD2   1 
ATOM   4378  C  CE1   . PHE F  2  100  ? 226.980 240.717 140.014 1.00 72.34  ? 100  PHE W CE1   1 
ATOM   4379  C  CE2   . PHE F  2  100  ? 226.268 242.984 140.185 1.00 52.32  ? 100  PHE W CE2   1 
ATOM   4380  C  CZ    . PHE F  2  100  ? 226.023 241.642 140.365 1.00 53.98  ? 100  PHE W CZ    1 
ATOM   4381  N  N     . GLY F  2  101  ? 233.265 242.353 138.676 1.00 79.38  ? 101  GLY W N     1 
ATOM   4382  C  CA    . GLY F  2  101  ? 234.489 242.739 138.008 1.00 70.86  ? 101  GLY W CA    1 
ATOM   4383  C  C     . GLY F  2  101  ? 234.982 244.101 138.473 1.00 89.61  ? 101  GLY W C     1 
ATOM   4384  O  O     . GLY F  2  101  ? 234.227 244.942 138.968 1.00 92.94  ? 101  GLY W O     1 
ATOM   4385  N  N     . GLY F  2  102  ? 236.284 244.310 138.306 1.00 100.41 ? 102  GLY W N     1 
ATOM   4386  C  CA    . GLY F  2  102  ? 236.921 245.547 138.719 1.00 106.79 ? 102  GLY W CA    1 
ATOM   4387  C  C     . GLY F  2  102  ? 238.431 245.442 138.812 1.00 121.32 ? 102  GLY W C     1 
ATOM   4388  O  O     . GLY F  2  102  ? 239.126 246.442 138.987 1.00 123.34 ? 102  GLY W O     1 
ATOM   4389  O  OXT   . GLY F  2  102  ? 238.997 244.353 138.718 1.00 92.50  ? 102  GLY W OXT   1 
ATOM   4390  N  N     . ALA G  3  12   ? 262.633 282.121 112.595 1.00 138.09 ? 12   ALA X N     1 
ATOM   4391  C  CA    . ALA G  3  12   ? 261.319 282.710 112.819 1.00 143.47 ? 12   ALA X CA    1 
ATOM   4392  C  C     . ALA G  3  12   ? 261.131 283.081 114.285 1.00 146.27 ? 12   ALA X C     1 
ATOM   4393  O  O     . ALA G  3  12   ? 261.761 282.501 115.168 1.00 146.16 ? 12   ALA X O     1 
ATOM   4394  C  CB    . ALA G  3  12   ? 260.226 281.754 112.369 1.00 159.94 ? 12   ALA X CB    1 
ATOM   4395  N  N     . LYS G  3  13   ? 260.258 284.055 114.539 1.00 148.94 ? 13   LYS X N     1 
ATOM   4396  C  CA    . LYS G  3  13   ? 259.982 284.487 115.902 1.00 140.98 ? 13   LYS X CA    1 
ATOM   4397  C  C     . LYS G  3  13   ? 259.000 283.526 116.562 1.00 142.85 ? 13   LYS X C     1 
ATOM   4398  O  O     . LYS G  3  13   ? 257.931 283.244 116.016 1.00 149.69 ? 13   LYS X O     1 
ATOM   4399  C  CB    . LYS G  3  13   ? 259.425 285.909 115.910 1.00 151.21 ? 13   LYS X CB    1 
ATOM   4400  C  CG    . LYS G  3  13   ? 259.204 286.473 117.304 1.00 147.40 ? 13   LYS X CG    1 
ATOM   4401  C  CD    . LYS G  3  13   ? 258.725 287.914 117.254 1.00 144.00 ? 13   LYS X CD    1 
ATOM   4402  C  CE    . LYS G  3  13   ? 258.506 288.468 118.653 1.00 137.62 ? 13   LYS X CE    1 
ATOM   4403  N  NZ    . LYS G  3  13   ? 258.046 289.885 118.627 1.00 125.99 ? 13   LYS X NZ    1 
ATOM   4404  N  N     . ALA G  3  14   ? 259.369 283.028 117.738 1.00 144.04 ? 14   ALA X N     1 
ATOM   4405  C  CA    . ALA G  3  14   ? 258.549 282.039 118.424 1.00 131.36 ? 14   ALA X CA    1 
ATOM   4406  C  C     . ALA G  3  14   ? 257.286 282.681 118.983 1.00 126.55 ? 14   ALA X C     1 
ATOM   4407  O  O     . ALA G  3  14   ? 257.347 283.698 119.682 1.00 120.13 ? 14   ALA X O     1 
ATOM   4408  C  CB    . ALA G  3  14   ? 259.346 281.379 119.548 1.00 114.75 ? 14   ALA X CB    1 
ATOM   4409  N  N     . LYS G  3  15   ? 256.139 282.086 118.670 1.00 110.11 ? 15   LYS X N     1 
ATOM   4410  C  CA    . LYS G  3  15   ? 254.848 282.528 119.179 1.00 112.51 ? 15   LYS X CA    1 
ATOM   4411  C  C     . LYS G  3  15   ? 254.338 281.505 120.180 1.00 106.78 ? 15   LYS X C     1 
ATOM   4412  O  O     . LYS G  3  15   ? 254.376 280.298 119.916 1.00 98.88  ? 15   LYS X O     1 
ATOM   4413  C  CB    . LYS G  3  15   ? 253.842 282.713 118.042 1.00 107.20 ? 15   LYS X CB    1 
ATOM   4414  C  CG    . LYS G  3  15   ? 252.504 283.279 118.486 1.00 115.11 ? 15   LYS X CG    1 
ATOM   4415  C  CD    . LYS G  3  15   ? 251.508 283.318 117.338 1.00 116.42 ? 15   LYS X CD    1 
ATOM   4416  C  CE    . LYS G  3  15   ? 251.919 284.333 116.284 1.00 118.85 ? 15   LYS X CE    1 
ATOM   4417  N  NZ    . LYS G  3  15   ? 250.961 284.369 115.145 1.00 118.81 ? 15   LYS X NZ    1 
ATOM   4418  N  N     . THR G  3  16   ? 253.871 281.986 121.330 1.00 98.30  ? 16   THR X N     1 
ATOM   4419  C  CA    . THR G  3  16   ? 253.405 281.091 122.379 1.00 88.04  ? 16   THR X CA    1 
ATOM   4420  C  C     . THR G  3  16   ? 252.134 280.368 121.947 1.00 96.33  ? 16   THR X C     1 
ATOM   4421  O  O     . THR G  3  16   ? 251.252 280.954 121.312 1.00 97.17  ? 16   THR X O     1 
ATOM   4422  C  CB    . THR G  3  16   ? 253.146 281.871 123.668 1.00 103.23 ? 16   THR X CB    1 
ATOM   4423  O  OG1   . THR G  3  16   ? 252.162 282.883 123.426 1.00 90.25  ? 16   THR X OG1   1 
ATOM   4424  C  CG2   . THR G  3  16   ? 254.428 282.524 124.158 1.00 94.76  ? 16   THR X CG2   1 
ATOM   4425  N  N     . ARG G  3  17   ? 252.048 279.082 122.294 1.00 102.83 ? 17   ARG X N     1 
ATOM   4426  C  CA    . ARG G  3  17   ? 250.857 278.305 121.973 1.00 87.98  ? 17   ARG X CA    1 
ATOM   4427  C  C     . ARG G  3  17   ? 249.624 278.807 122.707 1.00 84.65  ? 17   ARG X C     1 
ATOM   4428  O  O     . ARG G  3  17   ? 248.506 278.588 122.234 1.00 87.07  ? 17   ARG X O     1 
ATOM   4429  C  CB    . ARG G  3  17   ? 251.086 276.824 122.289 1.00 71.85  ? 17   ARG X CB    1 
ATOM   4430  C  CG    . ARG G  3  17   ? 252.078 276.139 121.362 1.00 77.80  ? 17   ARG X CG    1 
ATOM   4431  C  CD    . ARG G  3  17   ? 252.333 274.700 121.783 1.00 82.39  ? 17   ARG X CD    1 
ATOM   4432  N  NE    . ARG G  3  17   ? 252.989 274.606 123.083 1.00 90.69  ? 17   ARG X NE    1 
ATOM   4433  C  CZ    . ARG G  3  17   ? 253.310 273.461 123.674 1.00 88.43  ? 17   ARG X CZ    1 
ATOM   4434  N  NH1   . ARG G  3  17   ? 253.030 272.308 123.084 1.00 86.25  ? 17   ARG X NH1   1 
ATOM   4435  N  NH2   . ARG G  3  17   ? 253.908 273.466 124.858 1.00 88.97  ? 17   ARG X NH2   1 
ATOM   4436  N  N     . SER G  3  18   ? 249.799 279.469 123.854 1.00 84.09  ? 18   SER X N     1 
ATOM   4437  C  CA    . SER G  3  18   ? 248.655 280.050 124.546 1.00 91.56  ? 18   SER X CA    1 
ATOM   4438  C  C     . SER G  3  18   ? 248.024 281.172 123.735 1.00 101.28 ? 18   SER X C     1 
ATOM   4439  O  O     . SER G  3  18   ? 246.804 281.366 123.791 1.00 98.11  ? 18   SER X O     1 
ATOM   4440  C  CB    . SER G  3  18   ? 249.077 280.561 125.921 1.00 88.79  ? 18   SER X CB    1 
ATOM   4441  O  OG    . SER G  3  18   ? 249.500 279.496 126.754 1.00 95.94  ? 18   SER X OG    1 
ATOM   4442  N  N     . SER G  3  19   ? 248.831 281.917 122.977 1.00 97.80  ? 19   SER X N     1 
ATOM   4443  C  CA    . SER G  3  19   ? 248.311 282.997 122.151 1.00 96.23  ? 19   SER X CA    1 
ATOM   4444  C  C     . SER G  3  19   ? 247.655 282.495 120.871 1.00 94.31  ? 19   SER X C     1 
ATOM   4445  O  O     . SER G  3  19   ? 246.824 283.207 120.298 1.00 84.79  ? 19   SER X O     1 
ATOM   4446  C  CB    . SER G  3  19   ? 249.430 283.978 121.802 1.00 100.17 ? 19   SER X CB    1 
ATOM   4447  O  OG    . SER G  3  19   ? 250.435 283.347 121.028 1.00 110.79 ? 19   SER X OG    1 
ATOM   4448  N  N     . ARG G  3  20   ? 248.015 281.296 120.408 1.00 85.25  ? 20   ARG X N     1 
ATOM   4449  C  CA    . ARG G  3  20   ? 247.396 280.751 119.205 1.00 83.20  ? 20   ARG X CA    1 
ATOM   4450  C  C     . ARG G  3  20   ? 245.917 280.461 119.433 1.00 98.62  ? 20   ARG X C     1 
ATOM   4451  O  O     . ARG G  3  20   ? 245.060 280.916 118.669 1.00 110.83 ? 20   ARG X O     1 
ATOM   4452  C  CB    . ARG G  3  20   ? 248.130 279.484 118.765 1.00 82.88  ? 20   ARG X CB    1 
ATOM   4453  C  CG    . ARG G  3  20   ? 249.560 279.715 118.312 1.00 95.26  ? 20   ARG X CG    1 
ATOM   4454  C  CD    . ARG G  3  20   ? 250.198 278.421 117.839 1.00 106.96 ? 20   ARG X CD    1 
ATOM   4455  N  NE    . ARG G  3  20   ? 251.580 278.613 117.414 1.00 120.26 ? 20   ARG X NE    1 
ATOM   4456  C  CZ    . ARG G  3  20   ? 251.941 279.019 116.202 1.00 123.14 ? 20   ARG X CZ    1 
ATOM   4457  N  NH1   . ARG G  3  20   ? 251.017 279.278 115.285 1.00 125.38 ? 20   ARG X NH1   1 
ATOM   4458  N  NH2   . ARG G  3  20   ? 253.225 279.166 115.903 1.00 117.01 ? 20   ARG X NH2   1 
ATOM   4459  N  N     . ALA G  3  21   ? 245.603 279.704 120.483 1.00 94.57  ? 21   ALA X N     1 
ATOM   4460  C  CA    . ALA G  3  21   ? 244.221 279.373 120.799 1.00 93.71  ? 21   ALA X CA    1 
ATOM   4461  C  C     . ALA G  3  21   ? 243.471 280.518 121.464 1.00 91.09  ? 21   ALA X C     1 
ATOM   4462  O  O     . ALA G  3  21   ? 242.257 280.405 121.670 1.00 93.03  ? 21   ALA X O     1 
ATOM   4463  C  CB    . ALA G  3  21   ? 244.168 278.138 121.701 1.00 81.56  ? 21   ALA X CB    1 
ATOM   4464  N  N     . GLY G  3  22   ? 244.153 281.610 121.805 1.00 96.55  ? 22   GLY X N     1 
ATOM   4465  C  CA    . GLY G  3  22   ? 243.504 282.706 122.492 1.00 94.66  ? 22   GLY X CA    1 
ATOM   4466  C  C     . GLY G  3  22   ? 243.284 282.473 123.968 1.00 98.93  ? 22   GLY X C     1 
ATOM   4467  O  O     . GLY G  3  22   ? 242.297 282.961 124.526 1.00 104.25 ? 22   GLY X O     1 
ATOM   4468  N  N     . LEU G  3  23   ? 244.183 281.744 124.620 1.00 105.20 ? 23   LEU X N     1 
ATOM   4469  C  CA    . LEU G  3  23   ? 244.057 281.406 126.029 1.00 99.47  ? 23   LEU X CA    1 
ATOM   4470  C  C     . LEU G  3  23   ? 245.068 282.206 126.839 1.00 104.07 ? 23   LEU X C     1 
ATOM   4471  O  O     . LEU G  3  23   ? 246.199 282.425 126.395 1.00 93.81  ? 23   LEU X O     1 
ATOM   4472  C  CB    . LEU G  3  23   ? 244.283 279.909 126.253 1.00 85.17  ? 23   LEU X CB    1 
ATOM   4473  C  CG    . LEU G  3  23   ? 243.341 278.954 125.518 1.00 81.42  ? 23   LEU X CG    1 
ATOM   4474  C  CD1   . LEU G  3  23   ? 243.740 277.508 125.778 1.00 91.12  ? 23   LEU X CD1   1 
ATOM   4475  C  CD2   . LEU G  3  23   ? 241.898 279.199 125.910 1.00 77.45  ? 23   LEU X CD2   1 
ATOM   4476  N  N     . GLN G  3  24   ? 244.655 282.644 128.030 1.00 97.50  ? 24   GLN X N     1 
ATOM   4477  C  CA    . GLN G  3  24   ? 245.553 283.386 128.906 1.00 95.31  ? 24   GLN X CA    1 
ATOM   4478  C  C     . GLN G  3  24   ? 246.420 282.477 129.769 1.00 90.13  ? 24   GLN X C     1 
ATOM   4479  O  O     . GLN G  3  24   ? 247.410 282.948 130.335 1.00 95.50  ? 24   GLN X O     1 
ATOM   4480  C  CB    . GLN G  3  24   ? 244.751 284.329 129.804 1.00 106.62 ? 24   GLN X CB    1 
ATOM   4481  C  CG    . GLN G  3  24   ? 244.000 285.423 129.058 1.00 101.53 ? 24   GLN X CG    1 
ATOM   4482  C  CD    . GLN G  3  24   ? 244.916 286.341 128.275 1.00 105.94 ? 24   GLN X CD    1 
ATOM   4483  O  OE1   . GLN G  3  24   ? 246.003 286.694 128.735 1.00 111.70 ? 24   GLN X OE1   1 
ATOM   4484  N  NE2   . GLN G  3  24   ? 244.482 286.734 127.083 1.00 103.83 ? 24   GLN X NE2   1 
ATOM   4485  N  N     . PHE G  3  25   ? 246.075 281.184 129.876 1.00 73.68  ? 25   PHE X N     1 
ATOM   4486  C  CA    . PHE G  3  25   ? 246.766 280.218 130.716 1.00 74.71  ? 25   PHE X CA    1 
ATOM   4487  C  C     . PHE G  3  25   ? 247.911 279.536 129.970 1.00 78.48  ? 25   PHE X C     1 
ATOM   4488  O  O     . PHE G  3  25   ? 247.869 279.393 128.744 1.00 72.88  ? 25   PHE X O     1 
ATOM   4489  C  CB    . PHE G  3  25   ? 245.782 279.174 131.237 1.00 60.87  ? 25   PHE X CB    1 
ATOM   4490  C  CG    . PHE G  3  25   ? 244.891 279.686 132.334 1.00 63.66  ? 25   PHE X CG    1 
ATOM   4491  C  CD1   . PHE G  3  25   ? 245.308 279.618 133.652 1.00 64.93  ? 25   PHE X CD1   1 
ATOM   4492  C  CD2   . PHE G  3  25   ? 243.670 280.267 132.054 1.00 61.55  ? 25   PHE X CD2   1 
ATOM   4493  C  CE1   . PHE G  3  25   ? 244.515 280.095 134.675 1.00 71.41  ? 25   PHE X CE1   1 
ATOM   4494  C  CE2   . PHE G  3  25   ? 242.873 280.754 133.079 1.00 58.28  ? 25   PHE X CE2   1 
ATOM   4495  C  CZ    . PHE G  3  25   ? 243.298 280.664 134.388 1.00 68.45  ? 25   PHE X CZ    1 
ATOM   4496  N  N     . PRO G  3  26   ? 248.945 279.102 130.705 1.00 67.31  ? 26   PRO X N     1 
ATOM   4497  C  CA    . PRO G  3  26   ? 250.162 278.594 130.058 1.00 71.43  ? 26   PRO X CA    1 
ATOM   4498  C  C     . PRO G  3  26   ? 250.007 277.190 129.495 1.00 70.09  ? 26   PRO X C     1 
ATOM   4499  O  O     . PRO G  3  26   ? 250.314 276.208 130.182 1.00 78.77  ? 26   PRO X O     1 
ATOM   4500  C  CB    . PRO G  3  26   ? 251.194 278.626 131.190 1.00 80.10  ? 26   PRO X CB    1 
ATOM   4501  C  CG    . PRO G  3  26   ? 250.387 278.406 132.418 1.00 76.42  ? 26   PRO X CG    1 
ATOM   4502  C  CD    . PRO G  3  26   ? 249.061 279.077 132.175 1.00 68.97  ? 26   PRO X CD    1 
ATOM   4503  N  N     . VAL G  3  27   ? 249.507 277.087 128.260 1.00 57.40  ? 27   VAL X N     1 
ATOM   4504  C  CA    . VAL G  3  27   ? 249.361 275.789 127.605 1.00 54.76  ? 27   VAL X CA    1 
ATOM   4505  C  C     . VAL G  3  27   ? 250.645 274.975 127.720 1.00 61.68  ? 27   VAL X C     1 
ATOM   4506  O  O     . VAL G  3  27   ? 250.610 273.758 127.935 1.00 74.18  ? 27   VAL X O     1 
ATOM   4507  C  CB    . VAL G  3  27   ? 248.948 275.983 126.134 1.00 64.22  ? 27   VAL X CB    1 
ATOM   4508  C  CG1   . VAL G  3  27   ? 248.894 274.649 125.415 1.00 63.57  ? 27   VAL X CG1   1 
ATOM   4509  C  CG2   . VAL G  3  27   ? 247.608 276.696 126.049 1.00 65.27  ? 27   VAL X CG2   1 
ATOM   4510  N  N     . GLY G  3  28   ? 251.797 275.634 127.592 1.00 66.30  ? 28   GLY X N     1 
ATOM   4511  C  CA    . GLY G  3  28   ? 253.061 274.927 127.725 1.00 73.51  ? 28   GLY X CA    1 
ATOM   4512  C  C     . GLY G  3  28   ? 253.270 274.347 129.111 1.00 69.28  ? 28   GLY X C     1 
ATOM   4513  O  O     . GLY G  3  28   ? 253.717 273.206 129.257 1.00 52.82  ? 28   GLY X O     1 
ATOM   4514  N  N     . ARG G  3  29   ? 252.949 275.125 130.150 1.00 66.62  ? 29   ARG X N     1 
ATOM   4515  C  CA    . ARG G  3  29   ? 253.107 274.634 131.515 1.00 64.41  ? 29   ARG X CA    1 
ATOM   4516  C  C     . ARG G  3  29   ? 252.161 273.475 131.796 1.00 62.41  ? 29   ARG X C     1 
ATOM   4517  O  O     . ARG G  3  29   ? 252.547 272.491 132.439 1.00 52.93  ? 29   ARG X O     1 
ATOM   4518  C  CB    . ARG G  3  29   ? 252.878 275.767 132.513 1.00 67.47  ? 29   ARG X CB    1 
ATOM   4519  C  CG    . ARG G  3  29   ? 253.010 275.351 133.967 1.00 66.59  ? 29   ARG X CG    1 
ATOM   4520  C  CD    . ARG G  3  29   ? 252.707 276.508 134.903 1.00 57.54  ? 29   ARG X CD    1 
ATOM   4521  N  NE    . ARG G  3  29   ? 253.699 277.575 134.794 1.00 62.16  ? 29   ARG X NE    1 
ATOM   4522  C  CZ    . ARG G  3  29   ? 253.633 278.726 135.453 1.00 69.03  ? 29   ARG X CZ    1 
ATOM   4523  N  NH1   . ARG G  3  29   ? 252.622 278.966 136.276 1.00 60.88  ? 29   ARG X NH1   1 
ATOM   4524  N  NH2   . ARG G  3  29   ? 254.581 279.638 135.290 1.00 75.37  ? 29   ARG X NH2   1 
ATOM   4525  N  N     . VAL G  3  30   ? 250.917 273.576 131.324 1.00 55.39  ? 30   VAL X N     1 
ATOM   4526  C  CA    . VAL G  3  30   ? 249.972 272.474 131.482 1.00 45.12  ? 30   VAL X CA    1 
ATOM   4527  C  C     . VAL G  3  30   ? 250.483 271.231 130.766 1.00 44.86  ? 30   VAL X C     1 
ATOM   4528  O  O     . VAL G  3  30   ? 250.367 270.109 131.273 1.00 60.24  ? 30   VAL X O     1 
ATOM   4529  C  CB    . VAL G  3  30   ? 248.580 272.891 130.974 1.00 43.82  ? 30   VAL X CB    1 
ATOM   4530  C  CG1   . VAL G  3  30   ? 247.619 271.718 131.032 1.00 43.80  ? 30   VAL X CG1   1 
ATOM   4531  C  CG2   . VAL G  3  30   ? 248.050 274.058 131.787 1.00 46.63  ? 30   VAL X CG2   1 
ATOM   4532  N  N     . HIS G  3  31   ? 251.070 271.413 129.581 1.00 35.19  ? 31   HIS X N     1 
ATOM   4533  C  CA    . HIS G  3  31   ? 251.640 270.282 128.855 1.00 43.31  ? 31   HIS X CA    1 
ATOM   4534  C  C     . HIS G  3  31   ? 252.775 269.640 129.641 1.00 49.34  ? 31   HIS X C     1 
ATOM   4535  O  O     . HIS G  3  31   ? 252.864 268.408 129.722 1.00 56.75  ? 31   HIS X O     1 
ATOM   4536  C  CB    . HIS G  3  31   ? 252.126 270.740 127.479 1.00 37.05  ? 31   HIS X CB    1 
ATOM   4537  C  CG    . HIS G  3  31   ? 252.688 269.637 126.638 1.00 51.37  ? 31   HIS X CG    1 
ATOM   4538  N  ND1   . HIS G  3  31   ? 251.940 268.552 126.238 1.00 62.18  ? 31   HIS X ND1   1 
ATOM   4539  C  CD2   . HIS G  3  31   ? 253.924 269.456 126.116 1.00 55.38  ? 31   HIS X CD2   1 
ATOM   4540  C  CE1   . HIS G  3  31   ? 252.691 267.748 125.509 1.00 63.19  ? 31   HIS X CE1   1 
ATOM   4541  N  NE2   . HIS G  3  31   ? 253.899 268.273 125.420 1.00 57.58  ? 31   HIS X NE2   1 
ATOM   4542  N  N     . ARG G  3  32   ? 253.649 270.457 130.233 1.00 46.86  ? 32   ARG X N     1 
ATOM   4543  C  CA    . ARG G  3  32   ? 254.733 269.911 131.042 1.00 46.43  ? 32   ARG X CA    1 
ATOM   4544  C  C     . ARG G  3  32   ? 254.189 269.134 132.233 1.00 47.57  ? 32   ARG X C     1 
ATOM   4545  O  O     . ARG G  3  32   ? 254.663 268.034 132.539 1.00 52.87  ? 32   ARG X O     1 
ATOM   4546  C  CB    . ARG G  3  32   ? 255.655 271.030 131.525 1.00 48.93  ? 32   ARG X CB    1 
ATOM   4547  C  CG    . ARG G  3  32   ? 256.838 270.521 132.331 1.00 44.45  ? 32   ARG X CG    1 
ATOM   4548  C  CD    . ARG G  3  32   ? 257.622 271.666 132.925 1.00 61.70  ? 32   ARG X CD    1 
ATOM   4549  N  NE    . ARG G  3  32   ? 256.812 272.391 133.896 1.00 68.95  ? 32   ARG X NE    1 
ATOM   4550  C  CZ    . ARG G  3  32   ? 257.098 273.601 134.357 1.00 76.07  ? 32   ARG X CZ    1 
ATOM   4551  N  NH1   . ARG G  3  32   ? 258.183 274.236 133.937 1.00 87.11  ? 32   ARG X NH1   1 
ATOM   4552  N  NH2   . ARG G  3  32   ? 256.294 274.177 135.236 1.00 72.98  ? 32   ARG X NH2   1 
ATOM   4553  N  N     . LEU G  3  33   ? 253.194 269.696 132.922 1.00 48.69  ? 33   LEU X N     1 
ATOM   4554  C  CA    . LEU G  3  33   ? 252.628 269.014 134.080 1.00 43.79  ? 33   LEU X CA    1 
ATOM   4555  C  C     . LEU G  3  33   ? 251.945 267.712 133.686 1.00 55.21  ? 33   LEU X C     1 
ATOM   4556  O  O     . LEU G  3  33   ? 251.949 266.749 134.461 1.00 58.80  ? 33   LEU X O     1 
ATOM   4557  C  CB    . LEU G  3  33   ? 251.649 269.935 134.807 1.00 33.32  ? 33   LEU X CB    1 
ATOM   4558  C  CG    . LEU G  3  33   ? 252.262 271.184 135.439 1.00 53.03  ? 33   LEU X CG    1 
ATOM   4559  C  CD1   . LEU G  3  33   ? 251.182 272.077 136.022 1.00 54.75  ? 33   LEU X CD1   1 
ATOM   4560  C  CD2   . LEU G  3  33   ? 253.275 270.797 136.503 1.00 38.75  ? 33   LEU X CD2   1 
ATOM   4561  N  N     . LEU G  3  34   ? 251.358 267.657 132.488 1.00 35.31  ? 34   LEU X N     1 
ATOM   4562  C  CA    . LEU G  3  34   ? 250.795 266.399 132.014 1.00 38.21  ? 34   LEU X CA    1 
ATOM   4563  C  C     . LEU G  3  34   ? 251.882 265.395 131.656 1.00 43.81  ? 34   LEU X C     1 
ATOM   4564  O  O     . LEU G  3  34   ? 251.680 264.185 131.814 1.00 41.45  ? 34   LEU X O     1 
ATOM   4565  C  CB    . LEU G  3  34   ? 249.881 266.640 130.813 1.00 34.69  ? 34   LEU X CB    1 
ATOM   4566  C  CG    . LEU G  3  34   ? 248.594 267.423 131.075 1.00 33.22  ? 34   LEU X CG    1 
ATOM   4567  C  CD1   . LEU G  3  34   ? 247.861 267.688 129.774 1.00 23.81  ? 34   LEU X CD1   1 
ATOM   4568  C  CD2   . LEU G  3  34   ? 247.707 266.669 132.049 1.00 32.49  ? 34   LEU X CD2   1 
ATOM   4569  N  N     . ARG G  3  35   ? 253.035 265.867 131.178 1.00 53.51  ? 35   ARG X N     1 
ATOM   4570  C  CA    . ARG G  3  35   ? 254.110 264.943 130.825 1.00 54.69  ? 35   ARG X CA    1 
ATOM   4571  C  C     . ARG G  3  35   ? 254.782 264.370 132.067 1.00 56.66  ? 35   ARG X C     1 
ATOM   4572  O  O     . ARG G  3  35   ? 255.006 263.157 132.159 1.00 54.36  ? 35   ARG X O     1 
ATOM   4573  C  CB    . ARG G  3  35   ? 255.138 265.639 129.932 1.00 39.45  ? 35   ARG X CB    1 
ATOM   4574  C  CG    . ARG G  3  35   ? 254.631 265.971 128.539 1.00 47.55  ? 35   ARG X CG    1 
ATOM   4575  C  CD    . ARG G  3  35   ? 255.671 266.740 127.744 1.00 61.04  ? 35   ARG X CD    1 
ATOM   4576  N  NE    . ARG G  3  35   ? 255.968 268.040 128.338 1.00 77.69  ? 35   ARG X NE    1 
ATOM   4577  C  CZ    . ARG G  3  35   ? 256.847 268.904 127.838 1.00 89.09  ? 35   ARG X CZ    1 
ATOM   4578  N  NH1   . ARG G  3  35   ? 257.514 268.606 126.733 1.00 90.11  ? 35   ARG X NH1   1 
ATOM   4579  N  NH2   . ARG G  3  35   ? 257.055 270.065 128.442 1.00 90.31  ? 35   ARG X NH2   1 
ATOM   4580  N  N     . LYS G  3  36   ? 255.113 265.223 133.032 1.00 38.80  ? 36   LYS X N     1 
ATOM   4581  C  CA    . LYS G  3  36   ? 255.831 264.801 134.228 1.00 43.24  ? 36   LYS X CA    1 
ATOM   4582  C  C     . LYS G  3  36   ? 254.909 264.432 135.383 1.00 37.61  ? 36   LYS X C     1 
ATOM   4583  O  O     . LYS G  3  36   ? 255.402 264.106 136.467 1.00 41.84  ? 36   LYS X O     1 
ATOM   4584  C  CB    . LYS G  3  36   ? 256.797 265.902 134.676 1.00 58.25  ? 36   LYS X CB    1 
ATOM   4585  C  CG    . LYS G  3  36   ? 257.928 266.162 133.697 1.00 62.25  ? 36   LYS X CG    1 
ATOM   4586  C  CD    . LYS G  3  36   ? 258.871 267.235 134.210 1.00 75.18  ? 36   LYS X CD    1 
ATOM   4587  C  CE    . LYS G  3  36   ? 259.984 267.508 133.212 1.00 80.75  ? 36   LYS X CE    1 
ATOM   4588  N  NZ    . LYS G  3  36   ? 260.830 266.304 132.986 1.00 84.36  ? 36   LYS X NZ    1 
ATOM   4589  N  N     . GLY G  3  37   ? 253.595 264.474 135.184 1.00 28.20  ? 37   GLY X N     1 
ATOM   4590  C  CA    . GLY G  3  37   ? 252.662 264.141 136.238 1.00 34.37  ? 37   GLY X CA    1 
ATOM   4591  C  C     . GLY G  3  37   ? 252.391 262.669 136.438 1.00 33.68  ? 37   GLY X C     1 
ATOM   4592  O  O     . GLY G  3  37   ? 251.578 262.318 137.297 1.00 30.56  ? 37   GLY X O     1 
ATOM   4593  N  N     . ASN G  3  38   ? 253.049 261.796 135.669 1.00 38.42  ? 38   ASN X N     1 
ATOM   4594  C  CA    . ASN G  3  38   ? 252.840 260.349 135.749 1.00 40.47  ? 38   ASN X CA    1 
ATOM   4595  C  C     . ASN G  3  38   ? 251.371 259.989 135.544 1.00 39.29  ? 38   ASN X C     1 
ATOM   4596  O  O     . ASN G  3  38   ? 250.830 259.101 136.205 1.00 48.38  ? 38   ASN X O     1 
ATOM   4597  C  CB    . ASN G  3  38   ? 253.363 259.782 137.071 1.00 47.81  ? 38   ASN X CB    1 
ATOM   4598  C  CG    . ASN G  3  38   ? 254.876 259.799 137.151 1.00 60.45  ? 38   ASN X CG    1 
ATOM   4599  O  OD1   . ASN G  3  38   ? 255.549 258.960 136.552 1.00 72.46  ? 38   ASN X OD1   1 
ATOM   4600  N  ND2   . ASN G  3  38   ? 255.417 260.755 137.896 1.00 53.36  ? 38   ASN X ND2   1 
ATOM   4601  N  N     . TYR G  3  39   ? 250.720 260.693 134.619 1.00 34.35  ? 39   TYR X N     1 
ATOM   4602  C  CA    . TYR G  3  39   ? 249.320 260.421 134.313 1.00 35.73  ? 39   TYR X CA    1 
ATOM   4603  C  C     . TYR G  3  39   ? 249.197 259.298 133.291 1.00 44.23  ? 39   TYR X C     1 
ATOM   4604  O  O     . TYR G  3  39   ? 248.639 258.235 133.583 1.00 45.91  ? 39   TYR X O     1 
ATOM   4605  C  CB    . TYR G  3  39   ? 248.644 261.703 133.822 1.00 24.47  ? 39   TYR X CB    1 
ATOM   4606  C  CG    . TYR G  3  39   ? 248.639 262.790 134.870 1.00 23.35  ? 39   TYR X CG    1 
ATOM   4607  C  CD1   . TYR G  3  39   ? 248.323 262.500 136.191 1.00 31.32  ? 39   TYR X CD1   1 
ATOM   4608  C  CD2   . TYR G  3  39   ? 248.984 264.095 134.553 1.00 23.06  ? 39   TYR X CD2   1 
ATOM   4609  C  CE1   . TYR G  3  39   ? 248.327 263.483 137.160 1.00 34.75  ? 39   TYR X CE1   1 
ATOM   4610  C  CE2   . TYR G  3  39   ? 248.994 265.086 135.517 1.00 30.16  ? 39   TYR X CE2   1 
ATOM   4611  C  CZ    . TYR G  3  39   ? 248.663 264.774 136.818 1.00 37.34  ? 39   TYR X CZ    1 
ATOM   4612  O  OH    . TYR G  3  39   ? 248.667 265.754 137.783 1.00 42.75  ? 39   TYR X OH    1 
ATOM   4613  N  N     . ALA G  3  40   ? 249.710 259.519 132.084 1.00 54.13  ? 40   ALA X N     1 
ATOM   4614  C  CA    . ALA G  3  40   ? 249.866 258.469 131.092 1.00 50.52  ? 40   ALA X CA    1 
ATOM   4615  C  C     . ALA G  3  40   ? 251.299 258.495 130.577 1.00 55.72  ? 40   ALA X C     1 
ATOM   4616  O  O     . ALA G  3  40   ? 252.107 259.346 130.964 1.00 58.85  ? 40   ALA X O     1 
ATOM   4617  C  CB    . ALA G  3  40   ? 248.864 258.626 129.944 1.00 42.83  ? 40   ALA X CB    1 
ATOM   4618  N  N     . GLU G  3  41   ? 251.616 257.556 129.686 1.00 70.29  ? 41   GLU X N     1 
ATOM   4619  C  CA    . GLU G  3  41   ? 252.961 257.498 129.128 1.00 69.43  ? 41   GLU X CA    1 
ATOM   4620  C  C     . GLU G  3  41   ? 253.164 258.531 128.028 1.00 69.18  ? 41   GLU X C     1 
ATOM   4621  O  O     . GLU G  3  41   ? 254.282 259.028 127.847 1.00 84.80  ? 41   GLU X O     1 
ATOM   4622  C  CB    . GLU G  3  41   ? 253.250 256.092 128.601 1.00 73.71  ? 41   GLU X CB    1 
ATOM   4623  C  CG    . GLU G  3  41   ? 254.668 255.892 128.091 1.00 89.98  ? 41   GLU X CG    1 
ATOM   4624  C  CD    . GLU G  3  41   ? 254.928 254.467 127.644 1.00 100.93 ? 41   GLU X CD    1 
ATOM   4625  O  OE1   . GLU G  3  41   ? 253.992 253.643 127.700 1.00 104.62 ? 41   GLU X OE1   1 
ATOM   4626  O  OE2   . GLU G  3  41   ? 256.071 254.169 127.236 1.00 102.97 ? 41   GLU X OE2   1 
ATOM   4627  N  N     . ARG G  3  42   ? 252.106 258.872 127.296 1.00 58.75  ? 42   ARG X N     1 
ATOM   4628  C  CA    . ARG G  3  42   ? 252.177 259.850 126.221 1.00 57.55  ? 42   ARG X CA    1 
ATOM   4629  C  C     . ARG G  3  42   ? 251.025 260.837 126.359 1.00 56.61  ? 42   ARG X C     1 
ATOM   4630  O  O     . ARG G  3  42   ? 249.951 260.494 126.857 1.00 54.99  ? 42   ARG X O     1 
ATOM   4631  C  CB    . ARG G  3  42   ? 252.131 259.166 124.847 1.00 54.42  ? 42   ARG X CB    1 
ATOM   4632  C  CG    . ARG G  3  42   ? 253.315 258.246 124.588 1.00 62.05  ? 42   ARG X CG    1 
ATOM   4633  C  CD    . ARG G  3  42   ? 253.189 257.513 123.264 1.00 72.91  ? 42   ARG X CD    1 
ATOM   4634  N  NE    . ARG G  3  42   ? 253.214 258.422 122.124 1.00 79.69  ? 42   ARG X NE    1 
ATOM   4635  C  CZ    . ARG G  3  42   ? 253.050 258.038 120.862 1.00 88.91  ? 42   ARG X CZ    1 
ATOM   4636  N  NH1   . ARG G  3  42   ? 252.851 256.760 120.576 1.00 83.30  ? 42   ARG X NH1   1 
ATOM   4637  N  NH2   . ARG G  3  42   ? 253.087 258.931 119.884 1.00 96.04  ? 42   ARG X NH2   1 
ATOM   4638  N  N     . VAL G  3  43   ? 251.263 262.070 125.918 1.00 46.08  ? 43   VAL X N     1 
ATOM   4639  C  CA    . VAL G  3  43   ? 250.294 263.153 126.036 1.00 43.23  ? 43   VAL X CA    1 
ATOM   4640  C  C     . VAL G  3  43   ? 250.024 263.713 124.647 1.00 47.28  ? 43   VAL X C     1 
ATOM   4641  O  O     . VAL G  3  43   ? 250.963 263.988 123.891 1.00 52.97  ? 43   VAL X O     1 
ATOM   4642  C  CB    . VAL G  3  43   ? 250.792 264.258 126.986 1.00 41.24  ? 43   VAL X CB    1 
ATOM   4643  C  CG1   . VAL G  3  43   ? 249.806 265.414 127.022 1.00 43.38  ? 43   VAL X CG1   1 
ATOM   4644  C  CG2   . VAL G  3  43   ? 251.014 263.696 128.381 1.00 31.35  ? 43   VAL X CG2   1 
ATOM   4645  N  N     . GLY G  3  44   ? 248.748 263.882 124.318 1.00 40.96  ? 44   GLY X N     1 
ATOM   4646  C  CA    . GLY G  3  44   ? 248.374 264.414 123.025 1.00 43.73  ? 44   GLY X CA    1 
ATOM   4647  C  C     . GLY G  3  44   ? 248.618 265.907 122.916 1.00 38.44  ? 44   GLY X C     1 
ATOM   4648  O  O     . GLY G  3  44   ? 249.007 266.584 123.866 1.00 30.01  ? 44   GLY X O     1 
ATOM   4649  N  N     . ALA G  3  45   ? 248.385 266.425 121.712 1.00 33.45  ? 45   ALA X N     1 
ATOM   4650  C  CA    . ALA G  3  45   ? 248.611 267.833 121.422 1.00 40.57  ? 45   ALA X CA    1 
ATOM   4651  C  C     . ALA G  3  45   ? 247.410 268.717 121.735 1.00 44.98  ? 45   ALA X C     1 
ATOM   4652  O  O     . ALA G  3  45   ? 247.555 269.944 121.751 1.00 40.63  ? 45   ALA X O     1 
ATOM   4653  C  CB    . ALA G  3  45   ? 249.000 268.013 119.951 1.00 56.68  ? 45   ALA X CB    1 
ATOM   4654  N  N     . GLY G  3  46   ? 246.237 268.137 121.976 1.00 47.82  ? 46   GLY X N     1 
ATOM   4655  C  CA    . GLY G  3  46   ? 245.059 268.928 122.272 1.00 38.59  ? 46   GLY X CA    1 
ATOM   4656  C  C     . GLY G  3  46   ? 244.720 268.975 123.748 1.00 43.10  ? 46   GLY X C     1 
ATOM   4657  O  O     . GLY G  3  46   ? 243.897 269.791 124.181 1.00 38.50  ? 46   GLY X O     1 
ATOM   4658  N  N     . ALA G  3  47   ? 245.358 268.106 124.530 1.00 57.93  ? 47   ALA X N     1 
ATOM   4659  C  CA    . ALA G  3  47   ? 245.065 268.037 125.962 1.00 47.11  ? 47   ALA X CA    1 
ATOM   4660  C  C     . ALA G  3  47   ? 245.402 269.325 126.704 1.00 53.35  ? 47   ALA X C     1 
ATOM   4661  O  O     . ALA G  3  47   ? 244.538 269.821 127.448 1.00 55.17  ? 47   ALA X O     1 
ATOM   4662  C  CB    . ALA G  3  47   ? 245.785 266.831 126.575 1.00 39.81  ? 47   ALA X CB    1 
ATOM   4663  N  N     . PRO G  3  48   ? 246.597 269.915 126.570 1.00 40.06  ? 48   PRO X N     1 
ATOM   4664  C  CA    . PRO G  3  48   ? 246.861 271.153 127.317 1.00 38.11  ? 48   PRO X CA    1 
ATOM   4665  C  C     . PRO G  3  48   ? 246.005 272.322 126.863 1.00 46.89  ? 48   PRO X C     1 
ATOM   4666  O  O     . PRO G  3  48   ? 245.619 273.148 127.699 1.00 45.54  ? 48   PRO X O     1 
ATOM   4667  C  CB    . PRO G  3  48   ? 248.352 271.408 127.061 1.00 37.76  ? 48   PRO X CB    1 
ATOM   4668  C  CG    . PRO G  3  48   ? 248.610 270.762 125.757 1.00 43.45  ? 48   PRO X CG    1 
ATOM   4669  C  CD    . PRO G  3  48   ? 247.762 269.528 125.752 1.00 39.60  ? 48   PRO X CD    1 
ATOM   4670  N  N     . VAL G  3  49   ? 245.693 272.416 125.570 1.00 50.43  ? 49   VAL X N     1 
ATOM   4671  C  CA    . VAL G  3  49   ? 244.845 273.501 125.087 1.00 46.57  ? 49   VAL X CA    1 
ATOM   4672  C  C     . VAL G  3  49   ? 243.436 273.363 125.652 1.00 43.69  ? 49   VAL X C     1 
ATOM   4673  O  O     . VAL G  3  49   ? 242.890 274.303 126.244 1.00 46.18  ? 49   VAL X O     1 
ATOM   4674  C  CB    . VAL G  3  49   ? 244.832 273.525 123.549 1.00 66.64  ? 49   VAL X CB    1 
ATOM   4675  C  CG1   . VAL G  3  49   ? 243.860 274.579 123.046 1.00 55.73  ? 49   VAL X CG1   1 
ATOM   4676  C  CG2   . VAL G  3  49   ? 246.230 273.782 123.011 1.00 65.27  ? 49   VAL X CG2   1 
ATOM   4677  N  N     . TYR G  3  50   ? 242.830 272.187 125.478 1.00 40.92  ? 50   TYR X N     1 
ATOM   4678  C  CA    . TYR G  3  50   ? 241.465 271.971 125.951 1.00 40.06  ? 50   TYR X CA    1 
ATOM   4679  C  C     . TYR G  3  50   ? 241.379 272.148 127.463 1.00 44.29  ? 50   TYR X C     1 
ATOM   4680  O  O     . TYR G  3  50   ? 240.502 272.859 127.972 1.00 46.03  ? 50   TYR X O     1 
ATOM   4681  C  CB    . TYR G  3  50   ? 241.002 270.575 125.541 1.00 53.03  ? 50   TYR X CB    1 
ATOM   4682  C  CG    . TYR G  3  50   ? 239.587 270.237 125.937 1.00 50.26  ? 50   TYR X CG    1 
ATOM   4683  C  CD1   . TYR G  3  50   ? 238.515 270.622 125.147 1.00 43.96  ? 50   TYR X CD1   1 
ATOM   4684  C  CD2   . TYR G  3  50   ? 239.324 269.541 127.102 1.00 50.84  ? 50   TYR X CD2   1 
ATOM   4685  C  CE1   . TYR G  3  50   ? 237.221 270.312 125.507 1.00 52.92  ? 50   TYR X CE1   1 
ATOM   4686  C  CE2   . TYR G  3  50   ? 238.038 269.229 127.473 1.00 54.45  ? 50   TYR X CE2   1 
ATOM   4687  C  CZ    . TYR G  3  50   ? 236.988 269.616 126.673 1.00 56.55  ? 50   TYR X CZ    1 
ATOM   4688  O  OH    . TYR G  3  50   ? 235.703 269.304 127.043 1.00 60.09  ? 50   TYR X OH    1 
ATOM   4689  N  N     . LEU G  3  51   ? 242.300 271.518 128.195 1.00 32.23  ? 51   LEU X N     1 
ATOM   4690  C  CA    . LEU G  3  51   ? 242.292 271.608 129.651 1.00 32.61  ? 51   LEU X CA    1 
ATOM   4691  C  C     . LEU G  3  51   ? 242.494 273.044 130.121 1.00 41.63  ? 51   LEU X C     1 
ATOM   4692  O  O     . LEU G  3  51   ? 241.793 273.512 131.027 1.00 41.63  ? 51   LEU X O     1 
ATOM   4693  C  CB    . LEU G  3  51   ? 243.367 270.689 130.224 1.00 32.00  ? 51   LEU X CB    1 
ATOM   4694  C  CG    . LEU G  3  51   ? 243.581 270.721 131.732 1.00 26.82  ? 51   LEU X CG    1 
ATOM   4695  C  CD1   . LEU G  3  51   ? 242.299 270.363 132.440 1.00 22.52  ? 51   LEU X CD1   1 
ATOM   4696  C  CD2   . LEU G  3  51   ? 244.673 269.742 132.099 1.00 28.11  ? 51   LEU X CD2   1 
ATOM   4697  N  N     . ALA G  3  52   ? 243.447 273.756 129.516 1.00 36.14  ? 52   ALA X N     1 
ATOM   4698  C  CA    . ALA G  3  52   ? 243.664 275.153 129.876 1.00 35.47  ? 52   ALA X CA    1 
ATOM   4699  C  C     . ALA G  3  52   ? 242.419 275.988 129.614 1.00 45.32  ? 52   ALA X C     1 
ATOM   4700  O  O     . ALA G  3  52   ? 242.098 276.900 130.386 1.00 40.20  ? 52   ALA X O     1 
ATOM   4701  C  CB    . ALA G  3  52   ? 244.861 275.714 129.110 1.00 26.31  ? 52   ALA X CB    1 
ATOM   4702  N  N     . ALA G  3  53   ? 241.697 275.688 128.530 1.00 46.33  ? 53   ALA X N     1 
ATOM   4703  C  CA    . ALA G  3  53   ? 240.458 276.408 128.258 1.00 41.24  ? 53   ALA X CA    1 
ATOM   4704  C  C     . ALA G  3  53   ? 239.415 276.138 129.332 1.00 44.42  ? 53   ALA X C     1 
ATOM   4705  O  O     . ALA G  3  53   ? 238.735 277.064 129.794 1.00 45.44  ? 53   ALA X O     1 
ATOM   4706  C  CB    . ALA G  3  53   ? 239.923 276.028 126.880 1.00 56.48  ? 53   ALA X CB    1 
ATOM   4707  N  N     . VAL G  3  54   ? 239.269 274.876 129.742 1.00 53.51  ? 54   VAL X N     1 
ATOM   4708  C  CA    . VAL G  3  54   ? 238.311 274.543 130.796 1.00 48.67  ? 54   VAL X CA    1 
ATOM   4709  C  C     . VAL G  3  54   ? 238.655 275.290 132.081 1.00 45.84  ? 54   VAL X C     1 
ATOM   4710  O  O     . VAL G  3  54   ? 237.786 275.895 132.725 1.00 50.08  ? 54   VAL X O     1 
ATOM   4711  C  CB    . VAL G  3  54   ? 238.271 273.022 131.023 1.00 44.26  ? 54   VAL X CB    1 
ATOM   4712  C  CG1   . VAL G  3  54   ? 237.366 272.687 132.197 1.00 39.99  ? 54   VAL X CG1   1 
ATOM   4713  C  CG2   . VAL G  3  54   ? 237.802 272.315 129.765 1.00 36.55  ? 54   VAL X CG2   1 
ATOM   4714  N  N     . LEU G  3  55   ? 239.933 275.262 132.467 1.00 31.81  ? 55   LEU X N     1 
ATOM   4715  C  CA    . LEU G  3  55   ? 240.362 275.999 133.651 1.00 42.72  ? 55   LEU X CA    1 
ATOM   4716  C  C     . LEU G  3  55   ? 240.073 277.488 133.507 1.00 51.80  ? 55   LEU X C     1 
ATOM   4717  O  O     . LEU G  3  55   ? 239.716 278.156 134.488 1.00 43.77  ? 55   LEU X O     1 
ATOM   4718  C  CB    . LEU G  3  55   ? 241.849 275.762 133.907 1.00 41.56  ? 55   LEU X CB    1 
ATOM   4719  C  CG    . LEU G  3  55   ? 242.262 274.329 134.233 1.00 46.47  ? 55   LEU X CG    1 
ATOM   4720  C  CD1   . LEU G  3  55   ? 243.773 274.225 134.331 1.00 46.83  ? 55   LEU X CD1   1 
ATOM   4721  C  CD2   . LEU G  3  55   ? 241.607 273.875 135.520 1.00 30.24  ? 55   LEU X CD2   1 
ATOM   4722  N  N     . GLU G  3  56   ? 240.211 278.024 132.291 1.00 60.41  ? 56   GLU X N     1 
ATOM   4723  C  CA    . GLU G  3  56   ? 239.912 279.435 132.079 1.00 46.30  ? 56   GLU X CA    1 
ATOM   4724  C  C     . GLU G  3  56   ? 238.431 279.720 132.276 1.00 53.67  ? 56   GLU X C     1 
ATOM   4725  O  O     . GLU G  3  56   ? 238.064 280.757 132.838 1.00 51.91  ? 56   GLU X O     1 
ATOM   4726  C  CB    . GLU G  3  56   ? 240.351 279.881 130.686 1.00 70.09  ? 56   GLU X CB    1 
ATOM   4727  C  CG    . GLU G  3  56   ? 240.138 281.371 130.446 1.00 74.72  ? 56   GLU X CG    1 
ATOM   4728  C  CD    . GLU G  3  56   ? 240.645 281.831 129.096 1.00 99.43  ? 56   GLU X CD    1 
ATOM   4729  O  OE1   . GLU G  3  56   ? 241.165 280.987 128.345 1.00 110.67 ? 56   GLU X OE1   1 
ATOM   4730  O  OE2   . GLU G  3  56   ? 240.515 283.033 128.783 1.00 100.69 ? 56   GLU X OE2   1 
ATOM   4731  N  N     . TYR G  3  57   ? 237.566 278.816 131.819 1.00 59.95  ? 57   TYR X N     1 
ATOM   4732  C  CA    . TYR G  3  57   ? 236.136 279.013 132.023 1.00 53.03  ? 57   TYR X CA    1 
ATOM   4733  C  C     . TYR G  3  57   ? 235.786 278.976 133.505 1.00 61.41  ? 57   TYR X C     1 
ATOM   4734  O  O     . TYR G  3  57   ? 235.075 279.855 134.007 1.00 59.78  ? 57   TYR X O     1 
ATOM   4735  C  CB    . TYR G  3  57   ? 235.334 277.964 131.257 1.00 59.94  ? 57   TYR X CB    1 
ATOM   4736  C  CG    . TYR G  3  57   ? 233.851 278.077 131.521 1.00 71.60  ? 57   TYR X CG    1 
ATOM   4737  C  CD1   . TYR G  3  57   ? 233.093 279.061 130.905 1.00 70.65  ? 57   TYR X CD1   1 
ATOM   4738  C  CD2   . TYR G  3  57   ? 233.216 277.219 132.410 1.00 80.66  ? 57   TYR X CD2   1 
ATOM   4739  C  CE1   . TYR G  3  57   ? 231.740 279.178 131.151 1.00 73.74  ? 57   TYR X CE1   1 
ATOM   4740  C  CE2   . TYR G  3  57   ? 231.863 277.329 132.662 1.00 78.56  ? 57   TYR X CE2   1 
ATOM   4741  C  CZ    . TYR G  3  57   ? 231.129 278.311 132.031 1.00 82.81  ? 57   TYR X CZ    1 
ATOM   4742  O  OH    . TYR G  3  57   ? 229.781 278.425 132.278 1.00 93.80  ? 57   TYR X OH    1 
ATOM   4743  N  N     . LEU G  3  58   ? 236.278 277.962 134.222 1.00 48.24  ? 58   LEU X N     1 
ATOM   4744  C  CA    . LEU G  3  58   ? 235.963 277.852 135.644 1.00 46.12  ? 58   LEU X CA    1 
ATOM   4745  C  C     . LEU G  3  58   ? 236.470 279.066 136.417 1.00 53.48  ? 58   LEU X C     1 
ATOM   4746  O  O     . LEU G  3  58   ? 235.724 279.684 137.189 1.00 43.30  ? 58   LEU X O     1 
ATOM   4747  C  CB    . LEU G  3  58   ? 236.552 276.563 136.213 1.00 37.03  ? 58   LEU X CB    1 
ATOM   4748  C  CG    . LEU G  3  58   ? 235.980 275.264 135.645 1.00 37.22  ? 58   LEU X CG    1 
ATOM   4749  C  CD1   . LEU G  3  58   ? 236.728 274.066 136.199 1.00 40.19  ? 58   LEU X CD1   1 
ATOM   4750  C  CD2   . LEU G  3  58   ? 234.497 275.156 135.944 1.00 37.19  ? 58   LEU X CD2   1 
ATOM   4751  N  N     . THR G  3  59   ? 237.737 279.429 136.207 1.00 46.95  ? 59   THR X N     1 
ATOM   4752  C  CA    . THR G  3  59   ? 238.305 280.581 136.899 1.00 45.36  ? 59   THR X CA    1 
ATOM   4753  C  C     . THR G  3  59   ? 237.548 281.859 136.555 1.00 53.17  ? 59   THR X C     1 
ATOM   4754  O  O     . THR G  3  59   ? 237.286 282.691 137.433 1.00 54.82  ? 59   THR X O     1 
ATOM   4755  C  CB    . THR G  3  59   ? 239.785 280.719 136.547 1.00 51.36  ? 59   THR X CB    1 
ATOM   4756  O  OG1   . THR G  3  59   ? 240.487 279.549 136.982 1.00 51.18  ? 59   THR X OG1   1 
ATOM   4757  C  CG2   . THR G  3  59   ? 240.379 281.937 137.219 1.00 57.95  ? 59   THR X CG2   1 
ATOM   4758  N  N     . ALA G  3  60   ? 237.172 282.023 135.285 1.00 51.92  ? 60   ALA X N     1 
ATOM   4759  C  CA    . ALA G  3  60   ? 236.418 283.203 134.880 1.00 46.85  ? 60   ALA X CA    1 
ATOM   4760  C  C     . ALA G  3  60   ? 235.069 283.266 135.581 1.00 49.36  ? 60   ALA X C     1 
ATOM   4761  O  O     . ALA G  3  60   ? 234.623 284.344 135.992 1.00 57.03  ? 60   ALA X O     1 
ATOM   4762  C  CB    . ALA G  3  60   ? 236.239 283.212 133.362 1.00 49.31  ? 60   ALA X CB    1 
ATOM   4763  N  N     . GLU G  3  61   ? 234.403 282.120 135.736 1.00 41.59  ? 61   GLU X N     1 
ATOM   4764  C  CA    . GLU G  3  61   ? 233.106 282.114 136.406 1.00 41.76  ? 61   GLU X CA    1 
ATOM   4765  C  C     . GLU G  3  61   ? 233.246 282.443 137.889 1.00 54.03  ? 61   GLU X C     1 
ATOM   4766  O  O     . GLU G  3  61   ? 232.543 283.321 138.406 1.00 55.38  ? 61   GLU X O     1 
ATOM   4767  C  CB    . GLU G  3  61   ? 232.416 280.764 136.214 1.00 61.02  ? 61   GLU X CB    1 
ATOM   4768  C  CG    . GLU G  3  61   ? 232.015 280.473 134.777 1.00 81.89  ? 61   GLU X CG    1 
ATOM   4769  C  CD    . GLU G  3  61   ? 231.073 281.517 134.210 1.00 94.27  ? 61   GLU X CD    1 
ATOM   4770  O  OE1   . GLU G  3  61   ? 230.184 281.986 134.952 1.00 86.74  ? 61   GLU X OE1   1 
ATOM   4771  O  OE2   . GLU G  3  61   ? 231.218 281.868 133.021 1.00 105.42 ? 61   GLU X OE2   1 
ATOM   4772  N  N     . ILE G  3  62   ? 234.149 281.752 138.590 1.00 49.92  ? 62   ILE X N     1 
ATOM   4773  C  CA    . ILE G  3  62   ? 234.266 281.966 140.031 1.00 44.65  ? 62   ILE X CA    1 
ATOM   4774  C  C     . ILE G  3  62   ? 234.743 283.383 140.331 1.00 44.37  ? 62   ILE X C     1 
ATOM   4775  O  O     . ILE G  3  62   ? 234.306 284.006 141.308 1.00 34.41  ? 62   ILE X O     1 
ATOM   4776  C  CB    . ILE G  3  62   ? 235.179 280.898 140.668 1.00 47.95  ? 62   ILE X CB    1 
ATOM   4777  C  CG1   . ILE G  3  62   ? 235.237 281.076 142.187 1.00 60.97  ? 62   ILE X CG1   1 
ATOM   4778  C  CG2   . ILE G  3  62   ? 236.565 280.936 140.067 1.00 38.32  ? 62   ILE X CG2   1 
ATOM   4779  C  CD1   . ILE G  3  62   ? 235.905 279.925 142.910 1.00 72.38  ? 62   ILE X CD1   1 
ATOM   4780  N  N     . LEU G  3  63   ? 235.626 283.928 139.489 1.00 57.49  ? 63   LEU X N     1 
ATOM   4781  C  CA    . LEU G  3  63   ? 236.029 285.318 139.675 1.00 51.74  ? 63   LEU X CA    1 
ATOM   4782  C  C     . LEU G  3  63   ? 234.914 286.282 139.300 1.00 55.87  ? 63   LEU X C     1 
ATOM   4783  O  O     . LEU G  3  63   ? 234.862 287.398 139.827 1.00 57.11  ? 63   LEU X O     1 
ATOM   4784  C  CB    . LEU G  3  63   ? 237.287 285.631 138.867 1.00 49.11  ? 63   LEU X CB    1 
ATOM   4785  C  CG    . LEU G  3  63   ? 238.579 284.962 139.328 1.00 52.22  ? 63   LEU X CG    1 
ATOM   4786  C  CD1   . LEU G  3  63   ? 239.706 285.310 138.375 1.00 62.27  ? 63   LEU X CD1   1 
ATOM   4787  C  CD2   . LEU G  3  63   ? 238.918 285.387 140.745 1.00 39.76  ? 63   LEU X CD2   1 
ATOM   4788  N  N     . GLU G  3  64   ? 234.022 285.881 138.394 1.00 63.65  ? 64   GLU X N     1 
ATOM   4789  C  CA    . GLU G  3  64   ? 232.880 286.730 138.069 1.00 51.80  ? 64   GLU X CA    1 
ATOM   4790  C  C     . GLU G  3  64   ? 231.931 286.837 139.255 1.00 58.09  ? 64   GLU X C     1 
ATOM   4791  O  O     . GLU G  3  64   ? 231.535 287.939 139.654 1.00 67.39  ? 64   GLU X O     1 
ATOM   4792  C  CB    . GLU G  3  64   ? 232.153 286.190 136.840 1.00 60.62  ? 64   GLU X CB    1 
ATOM   4793  C  CG    . GLU G  3  64   ? 230.993 287.054 136.379 1.00 74.04  ? 64   GLU X CG    1 
ATOM   4794  C  CD    . GLU G  3  64   ? 230.325 286.517 135.128 1.00 85.19  ? 64   GLU X CD    1 
ATOM   4795  O  OE1   . GLU G  3  64   ? 230.743 285.444 134.645 1.00 90.35  ? 64   GLU X OE1   1 
ATOM   4796  O  OE2   . GLU G  3  64   ? 229.384 287.168 134.629 1.00 79.37  ? 64   GLU X OE2   1 
ATOM   4797  N  N     . LEU G  3  65   ? 231.561 285.694 139.841 1.00 50.66  ? 65   LEU X N     1 
ATOM   4798  C  CA    . LEU G  3  65   ? 230.691 285.725 141.012 1.00 51.60  ? 65   LEU X CA    1 
ATOM   4799  C  C     . LEU G  3  65   ? 231.372 286.418 142.186 1.00 56.21  ? 65   LEU X C     1 
ATOM   4800  O  O     . LEU G  3  65   ? 230.726 287.155 142.941 1.00 51.25  ? 65   LEU X O     1 
ATOM   4801  C  CB    . LEU G  3  65   ? 230.275 284.305 141.394 1.00 48.75  ? 65   LEU X CB    1 
ATOM   4802  C  CG    . LEU G  3  65   ? 229.416 283.568 140.367 1.00 58.08  ? 65   LEU X CG    1 
ATOM   4803  C  CD1   . LEU G  3  65   ? 229.166 282.138 140.813 1.00 66.10  ? 65   LEU X CD1   1 
ATOM   4804  C  CD2   . LEU G  3  65   ? 228.104 284.301 140.140 1.00 42.33  ? 65   LEU X CD2   1 
ATOM   4805  N  N     . ALA G  3  66   ? 232.679 286.197 142.353 1.00 50.53  ? 66   ALA X N     1 
ATOM   4806  C  CA    . ALA G  3  66   ? 233.406 286.875 143.421 1.00 59.78  ? 66   ALA X CA    1 
ATOM   4807  C  C     . ALA G  3  66   ? 233.397 288.384 143.223 1.00 67.98  ? 66   ALA X C     1 
ATOM   4808  O  O     . ALA G  3  66   ? 233.239 289.145 144.184 1.00 56.82  ? 66   ALA X O     1 
ATOM   4809  C  CB    . ALA G  3  66   ? 234.841 286.352 143.494 1.00 53.31  ? 66   ALA X CB    1 
ATOM   4810  N  N     . GLY G  3  67   ? 233.559 288.836 141.976 1.00 81.70  ? 67   GLY X N     1 
ATOM   4811  C  CA    . GLY G  3  67   ? 233.499 290.262 141.706 1.00 70.39  ? 67   GLY X CA    1 
ATOM   4812  C  C     . GLY G  3  67   ? 232.120 290.841 141.949 1.00 70.32  ? 67   GLY X C     1 
ATOM   4813  O  O     . GLY G  3  67   ? 231.988 291.960 142.452 1.00 70.33  ? 67   GLY X O     1 
ATOM   4814  N  N     . ASN G  3  68   ? 231.073 290.089 141.596 1.00 70.17  ? 68   ASN X N     1 
ATOM   4815  C  CA    . ASN G  3  68   ? 229.717 290.560 141.856 1.00 68.05  ? 68   ASN X CA    1 
ATOM   4816  C  C     . ASN G  3  68   ? 229.450 290.676 143.352 1.00 75.82  ? 68   ASN X C     1 
ATOM   4817  O  O     . ASN G  3  68   ? 228.851 291.656 143.810 1.00 84.07  ? 68   ASN X O     1 
ATOM   4818  C  CB    . ASN G  3  68   ? 228.699 289.625 141.201 1.00 76.33  ? 68   ASN X CB    1 
ATOM   4819  C  CG    . ASN G  3  68   ? 228.704 289.730 139.689 1.00 81.88  ? 68   ASN X CG    1 
ATOM   4820  O  OD1   . ASN G  3  68   ? 229.118 290.744 139.128 1.00 79.38  ? 68   ASN X OD1   1 
ATOM   4821  N  ND2   . ASN G  3  68   ? 228.235 288.682 139.022 1.00 79.58  ? 68   ASN X ND2   1 
ATOM   4822  N  N     . ALA G  3  69   ? 229.895 289.688 144.133 1.00 92.48  ? 69   ALA X N     1 
ATOM   4823  C  CA    . ALA G  3  69   ? 229.712 289.756 145.580 1.00 80.35  ? 69   ALA X CA    1 
ATOM   4824  C  C     . ALA G  3  69   ? 230.507 290.906 146.183 1.00 80.04  ? 69   ALA X C     1 
ATOM   4825  O  O     . ALA G  3  69   ? 230.014 291.613 147.071 1.00 76.25  ? 69   ALA X O     1 
ATOM   4826  C  CB    . ALA G  3  69   ? 230.110 288.431 146.224 1.00 66.16  ? 69   ALA X CB    1 
ATOM   4827  N  N     . ALA G  3  70   ? 231.742 291.107 145.715 1.00 67.89  ? 70   ALA X N     1 
ATOM   4828  C  CA    . ALA G  3  70   ? 232.543 292.228 146.200 1.00 66.80  ? 70   ALA X CA    1 
ATOM   4829  C  C     . ALA G  3  70   ? 231.873 293.558 145.886 1.00 87.07  ? 70   ALA X C     1 
ATOM   4830  O  O     . ALA G  3  70   ? 231.870 294.471 146.720 1.00 92.44  ? 70   ALA X O     1 
ATOM   4831  C  CB    . ALA G  3  70   ? 233.943 292.174 145.590 1.00 91.67  ? 70   ALA X CB    1 
ATOM   4832  N  N     . ARG G  3  71   ? 231.300 293.686 144.688 1.00 90.96  ? 71   ARG X N     1 
ATOM   4833  C  CA    . ARG G  3  71   ? 230.575 294.902 144.346 1.00 91.90  ? 71   ARG X CA    1 
ATOM   4834  C  C     . ARG G  3  71   ? 229.330 295.070 145.209 1.00 84.83  ? 71   ARG X C     1 
ATOM   4835  O  O     . ARG G  3  71   ? 228.959 296.201 145.544 1.00 87.16  ? 71   ARG X O     1 
ATOM   4836  C  CB    . ARG G  3  71   ? 230.199 294.887 142.864 1.00 99.00  ? 71   ARG X CB    1 
ATOM   4837  C  CG    . ARG G  3  71   ? 229.478 296.135 142.386 1.00 108.08 ? 71   ARG X CG    1 
ATOM   4838  C  CD    . ARG G  3  71   ? 229.099 296.017 140.922 1.00 112.58 ? 71   ARG X CD    1 
ATOM   4839  N  NE    . ARG G  3  71   ? 228.141 294.938 140.697 1.00 121.59 ? 71   ARG X NE    1 
ATOM   4840  C  CZ    . ARG G  3  71   ? 227.871 294.416 139.505 1.00 113.45 ? 71   ARG X CZ    1 
ATOM   4841  N  NH1   . ARG G  3  71   ? 228.485 294.875 138.423 1.00 121.78 ? 71   ARG X NH1   1 
ATOM   4842  N  NH2   . ARG G  3  71   ? 226.986 293.434 139.394 1.00 84.02  ? 71   ARG X NH2   1 
ATOM   4843  N  N     . ASP G  3  72   ? 228.680 293.965 145.585 1.00 78.67  ? 72   ASP X N     1 
ATOM   4844  C  CA    . ASP G  3  72   ? 227.502 294.063 146.439 1.00 89.60  ? 72   ASP X CA    1 
ATOM   4845  C  C     . ASP G  3  72   ? 227.869 294.459 147.863 1.00 105.98 ? 72   ASP X C     1 
ATOM   4846  O  O     . ASP G  3  72   ? 227.066 295.095 148.553 1.00 114.68 ? 72   ASP X O     1 
ATOM   4847  C  CB    . ASP G  3  72   ? 226.739 292.740 146.438 1.00 91.57  ? 72   ASP X CB    1 
ATOM   4848  C  CG    . ASP G  3  72   ? 226.065 292.458 145.110 1.00 114.18 ? 72   ASP X CG    1 
ATOM   4849  O  OD1   . ASP G  3  72   ? 225.932 293.398 144.300 1.00 125.34 ? 72   ASP X OD1   1 
ATOM   4850  O  OD2   . ASP G  3  72   ? 225.667 291.297 144.882 1.00 109.15 ? 72   ASP X OD2   1 
ATOM   4851  N  N     . ASN G  3  73   ? 229.067 294.101 148.320 1.00 96.41  ? 73   ASN X N     1 
ATOM   4852  C  CA    . ASN G  3  73   ? 229.519 294.442 149.662 1.00 97.89  ? 73   ASN X CA    1 
ATOM   4853  C  C     . ASN G  3  73   ? 230.244 295.779 149.723 1.00 87.50  ? 73   ASN X C     1 
ATOM   4854  O  O     . ASN G  3  73   ? 230.774 296.128 150.784 1.00 90.46  ? 73   ASN X O     1 
ATOM   4855  C  CB    . ASN G  3  73   ? 230.424 293.337 150.212 1.00 103.41 ? 73   ASN X CB    1 
ATOM   4856  C  CG    . ASN G  3  73   ? 229.660 292.072 150.544 1.00 112.50 ? 73   ASN X CG    1 
ATOM   4857  O  OD1   . ASN G  3  73   ? 228.982 291.994 151.568 1.00 112.72 ? 73   ASN X OD1   1 
ATOM   4858  N  ND2   . ASN G  3  73   ? 229.765 291.073 149.677 1.00 110.15 ? 73   ASN X ND2   1 
ATOM   4859  N  N     . LYS G  3  74   ? 230.297 296.520 148.614 1.00 98.96  ? 74   LYS X N     1 
ATOM   4860  C  CA    . LYS G  3  74   ? 230.927 297.841 148.561 1.00 98.01  ? 74   LYS X CA    1 
ATOM   4861  C  C     . LYS G  3  74   ? 232.421 297.759 148.872 1.00 102.89 ? 74   LYS X C     1 
ATOM   4862  O  O     . LYS G  3  74   ? 232.987 298.635 149.528 1.00 115.66 ? 74   LYS X O     1 
ATOM   4863  C  CB    . LYS G  3  74   ? 230.228 298.830 149.496 1.00 82.73  ? 74   LYS X CB    1 
ATOM   4864  N  N     . LYS G  3  75   ? 233.063 296.696 148.393 1.00 107.03 ? 75   LYS X N     1 
ATOM   4865  C  CA    . LYS G  3  75   ? 234.502 296.512 148.526 1.00 111.91 ? 75   LYS X CA    1 
ATOM   4866  C  C     . LYS G  3  75   ? 235.076 296.189 147.154 1.00 110.52 ? 75   LYS X C     1 
ATOM   4867  O  O     . LYS G  3  75   ? 234.591 295.280 146.475 1.00 122.38 ? 75   LYS X O     1 
ATOM   4868  C  CB    . LYS G  3  75   ? 234.831 295.392 149.518 1.00 108.43 ? 75   LYS X CB    1 
ATOM   4869  C  CG    . LYS G  3  75   ? 234.288 295.614 150.920 1.00 113.31 ? 75   LYS X CG    1 
ATOM   4870  C  CD    . LYS G  3  75   ? 234.874 296.864 151.551 1.00 125.78 ? 75   LYS X CD    1 
ATOM   4871  C  CE    . LYS G  3  75   ? 234.382 297.042 152.979 1.00 134.03 ? 75   LYS X CE    1 
ATOM   4872  N  NZ    . LYS G  3  75   ? 234.937 298.272 153.609 1.00 137.17 ? 75   LYS X NZ    1 
ATOM   4873  N  N     . THR G  3  76   ? 236.103 296.932 146.753 1.00 91.17  ? 76   THR X N     1 
ATOM   4874  C  CA    . THR G  3  76   ? 236.711 296.757 145.441 1.00 110.02 ? 76   THR X CA    1 
ATOM   4875  C  C     . THR G  3  76   ? 237.844 295.740 145.436 1.00 112.28 ? 76   THR X C     1 
ATOM   4876  O  O     . THR G  3  76   ? 238.477 295.545 144.393 1.00 114.20 ? 76   THR X O     1 
ATOM   4877  C  CB    . THR G  3  76   ? 237.230 298.099 144.914 1.00 124.07 ? 76   THR X CB    1 
ATOM   4878  O  OG1   . THR G  3  76   ? 238.200 298.628 145.824 1.00 109.36 ? 76   THR X OG1   1 
ATOM   4879  C  CG2   . THR G  3  76   ? 236.085 299.090 144.769 1.00 135.73 ? 76   THR X CG2   1 
ATOM   4880  N  N     . ARG G  3  77   ? 238.118 295.093 146.566 1.00 107.34 ? 77   ARG X N     1 
ATOM   4881  C  CA    . ARG G  3  77   ? 239.160 294.078 146.667 1.00 100.03 ? 77   ARG X CA    1 
ATOM   4882  C  C     . ARG G  3  77   ? 238.526 292.775 147.127 1.00 93.67  ? 77   ARG X C     1 
ATOM   4883  O  O     . ARG G  3  77   ? 237.875 292.733 148.177 1.00 103.95 ? 77   ARG X O     1 
ATOM   4884  C  CB    . ARG G  3  77   ? 240.263 294.518 147.630 1.00 79.78  ? 77   ARG X CB    1 
ATOM   4885  C  CG    . ARG G  3  77   ? 241.392 293.515 147.776 1.00 97.72  ? 77   ARG X CG    1 
ATOM   4886  C  CD    . ARG G  3  77   ? 242.572 294.106 148.534 1.00 104.36 ? 77   ARG X CD    1 
ATOM   4887  N  NE    . ARG G  3  77   ? 243.222 295.174 147.781 1.00 104.27 ? 77   ARG X NE    1 
ATOM   4888  C  CZ    . ARG G  3  77   ? 243.108 296.467 148.062 1.00 105.70 ? 77   ARG X CZ    1 
ATOM   4889  N  NH1   . ARG G  3  77   ? 242.367 296.861 149.087 1.00 100.61 ? 77   ARG X NH1   1 
ATOM   4890  N  NH2   . ARG G  3  77   ? 243.739 297.367 147.320 1.00 107.26 ? 77   ARG X NH2   1 
ATOM   4891  N  N     . ILE G  3  78   ? 238.719 291.713 146.344 1.00 73.64  ? 78   ILE X N     1 
ATOM   4892  C  CA    . ILE G  3  78   ? 238.102 290.428 146.650 1.00 82.78  ? 78   ILE X CA    1 
ATOM   4893  C  C     . ILE G  3  78   ? 238.792 289.799 147.851 1.00 82.78  ? 78   ILE X C     1 
ATOM   4894  O  O     . ILE G  3  78   ? 240.027 289.745 147.925 1.00 78.86  ? 78   ILE X O     1 
ATOM   4895  C  CB    . ILE G  3  78   ? 238.155 289.503 145.425 1.00 68.72  ? 78   ILE X CB    1 
ATOM   4896  C  CG1   . ILE G  3  78   ? 237.275 290.059 144.304 1.00 71.32  ? 78   ILE X CG1   1 
ATOM   4897  C  CG2   . ILE G  3  78   ? 237.718 288.095 145.794 1.00 52.15  ? 78   ILE X CG2   1 
ATOM   4898  C  CD1   . ILE G  3  78   ? 237.425 289.330 142.993 1.00 58.68  ? 78   ILE X CD1   1 
ATOM   4899  N  N     . ILE G  3  79   ? 237.997 289.319 148.794 1.00 59.24  ? 79   ILE X N     1 
ATOM   4900  C  CA    . ILE G  3  79   ? 238.500 288.693 150.015 1.00 58.01  ? 79   ILE X CA    1 
ATOM   4901  C  C     . ILE G  3  79   ? 237.935 287.281 150.071 1.00 63.37  ? 79   ILE X C     1 
ATOM   4902  O  O     . ILE G  3  79   ? 236.951 286.965 149.381 1.00 60.82  ? 79   ILE X O     1 
ATOM   4903  C  CB    . ILE G  3  79   ? 238.131 289.511 151.273 1.00 55.67  ? 79   ILE X CB    1 
ATOM   4904  C  CG1   . ILE G  3  79   ? 236.615 289.651 151.396 1.00 51.16  ? 79   ILE X CG1   1 
ATOM   4905  C  CG2   . ILE G  3  79   ? 238.803 290.875 151.235 1.00 58.94  ? 79   ILE X CG2   1 
ATOM   4906  C  CD1   . ILE G  3  79   ? 236.166 290.289 152.692 1.00 41.02  ? 79   ILE X CD1   1 
ATOM   4907  N  N     . PRO G  3  80   ? 238.547 286.393 150.863 1.00 59.65  ? 80   PRO X N     1 
ATOM   4908  C  CA    . PRO G  3  80   ? 238.026 285.018 150.965 1.00 51.57  ? 80   PRO X CA    1 
ATOM   4909  C  C     . PRO G  3  80   ? 236.553 284.935 151.320 1.00 46.94  ? 80   PRO X C     1 
ATOM   4910  O  O     . PRO G  3  80   ? 235.882 283.978 150.912 1.00 36.07  ? 80   PRO X O     1 
ATOM   4911  C  CB    . PRO G  3  80   ? 238.907 284.400 152.059 1.00 66.71  ? 80   PRO X CB    1 
ATOM   4912  C  CG    . PRO G  3  80   ? 240.188 285.134 151.949 1.00 67.48  ? 80   PRO X CG    1 
ATOM   4913  C  CD    . PRO G  3  80   ? 239.831 286.542 151.571 1.00 62.22  ? 80   PRO X CD    1 
ATOM   4914  N  N     . ARG G  3  81   ? 236.028 285.902 152.071 1.00 52.40  ? 81   ARG X N     1 
ATOM   4915  C  CA    . ARG G  3  81   ? 234.595 285.930 152.344 1.00 37.69  ? 81   ARG X CA    1 
ATOM   4916  C  C     . ARG G  3  81   ? 233.792 286.030 151.054 1.00 38.85  ? 81   ARG X C     1 
ATOM   4917  O  O     . ARG G  3  81   ? 232.753 285.375 150.903 1.00 35.56  ? 81   ARG X O     1 
ATOM   4918  C  CB    . ARG G  3  81   ? 234.260 287.098 153.276 1.00 47.18  ? 81   ARG X CB    1 
ATOM   4919  C  CG    . ARG G  3  81   ? 232.782 287.244 153.588 1.00 32.87  ? 81   ARG X CG    1 
ATOM   4920  C  CD    . ARG G  3  81   ? 232.236 286.014 154.288 1.00 39.28  ? 81   ARG X CD    1 
ATOM   4921  N  NE    . ARG G  3  81   ? 230.825 286.158 154.629 1.00 54.76  ? 81   ARG X NE    1 
ATOM   4922  C  CZ    . ARG G  3  81   ? 230.041 285.154 155.004 1.00 48.77  ? 81   ARG X CZ    1 
ATOM   4923  N  NH1   . ARG G  3  81   ? 230.531 283.925 155.090 1.00 44.22  ? 81   ARG X NH1   1 
ATOM   4924  N  NH2   . ARG G  3  81   ? 228.767 285.377 155.295 1.00 48.08  ? 81   ARG X NH2   1 
ATOM   4925  N  N     . HIS G  3  82   ? 234.266 286.841 150.105 1.00 26.64  ? 82   HIS X N     1 
ATOM   4926  C  CA    . HIS G  3  82   ? 233.566 286.981 148.835 1.00 30.30  ? 82   HIS X CA    1 
ATOM   4927  C  C     . HIS G  3  82   ? 233.648 285.708 148.005 1.00 32.33  ? 82   HIS X C     1 
ATOM   4928  O  O     . HIS G  3  82   ? 232.767 285.451 147.177 1.00 45.08  ? 82   HIS X O     1 
ATOM   4929  C  CB    . HIS G  3  82   ? 234.131 288.167 148.056 1.00 52.36  ? 82   HIS X CB    1 
ATOM   4930  C  CG    . HIS G  3  82   ? 233.978 289.476 148.764 1.00 58.89  ? 82   HIS X CG    1 
ATOM   4931  N  ND1   . HIS G  3  82   ? 234.675 290.607 148.399 1.00 66.28  ? 82   HIS X ND1   1 
ATOM   4932  C  CD2   . HIS G  3  82   ? 233.205 289.835 149.816 1.00 57.72  ? 82   HIS X CD2   1 
ATOM   4933  C  CE1   . HIS G  3  82   ? 234.341 291.606 149.196 1.00 56.59  ? 82   HIS X CE1   1 
ATOM   4934  N  NE2   . HIS G  3  82   ? 233.449 291.163 150.064 1.00 59.88  ? 82   HIS X NE2   1 
ATOM   4935  N  N     . LEU G  3  83   ? 234.695 284.903 148.205 1.00 28.23  ? 83   LEU X N     1 
ATOM   4936  C  CA    . LEU G  3  83   ? 234.759 283.607 147.541 1.00 27.17  ? 83   LEU X CA    1 
ATOM   4937  C  C     . LEU G  3  83   ? 233.801 282.615 148.188 1.00 28.80  ? 83   LEU X C     1 
ATOM   4938  O  O     . LEU G  3  83   ? 233.139 281.838 147.493 1.00 25.43  ? 83   LEU X O     1 
ATOM   4939  C  CB    . LEU G  3  83   ? 236.188 283.068 147.567 1.00 27.54  ? 83   LEU X CB    1 
ATOM   4940  C  CG    . LEU G  3  83   ? 237.221 283.865 146.772 1.00 33.95  ? 83   LEU X CG    1 
ATOM   4941  C  CD1   . LEU G  3  83   ? 238.611 283.297 146.984 1.00 42.21  ? 83   LEU X CD1   1 
ATOM   4942  C  CD2   . LEU G  3  83   ? 236.863 283.867 145.297 1.00 41.96  ? 83   LEU X CD2   1 
ATOM   4943  N  N     . GLN G  3  84   ? 233.715 282.631 149.519 1.00 26.93  ? 84   GLN X N     1 
ATOM   4944  C  CA    . GLN G  3  84   ? 232.762 281.773 150.218 1.00 28.98  ? 84   GLN X CA    1 
ATOM   4945  C  C     . GLN G  3  84   ? 231.338 282.076 149.769 1.00 27.83  ? 84   GLN X C     1 
ATOM   4946  O  O     . GLN G  3  84   ? 230.582 281.170 149.393 1.00 31.50  ? 84   GLN X O     1 
ATOM   4947  C  CB    . GLN G  3  84   ? 232.906 281.970 151.727 1.00 36.92  ? 84   GLN X CB    1 
ATOM   4948  C  CG    . GLN G  3  84   ? 232.135 280.980 152.579 1.00 43.52  ? 84   GLN X CG    1 
ATOM   4949  C  CD    . GLN G  3  84   ? 232.713 279.579 152.506 1.00 41.76  ? 84   GLN X CD    1 
ATOM   4950  O  OE1   . GLN G  3  84   ? 233.875 279.359 152.837 1.00 42.73  ? 84   GLN X OE1   1 
ATOM   4951  N  NE2   . GLN G  3  84   ? 231.902 278.627 152.077 1.00 36.79  ? 84   GLN X NE2   1 
ATOM   4952  N  N     . LEU G  3  85   ? 230.962 283.358 149.788 1.00 22.92  ? 85   LEU X N     1 
ATOM   4953  C  CA    . LEU G  3  85   ? 229.625 283.752 149.356 1.00 27.47  ? 85   LEU X CA    1 
ATOM   4954  C  C     . LEU G  3  85   ? 229.414 283.451 147.877 1.00 33.70  ? 85   LEU X C     1 
ATOM   4955  O  O     . LEU G  3  85   ? 228.376 282.907 147.483 1.00 38.86  ? 85   LEU X O     1 
ATOM   4956  C  CB    . LEU G  3  85   ? 229.408 285.241 149.629 1.00 30.28  ? 85   LEU X CB    1 
ATOM   4957  C  CG    . LEU G  3  85   ? 229.463 285.713 151.083 1.00 34.46  ? 85   LEU X CG    1 
ATOM   4958  C  CD1   . LEU G  3  85   ? 229.368 287.228 151.152 1.00 32.45  ? 85   LEU X CD1   1 
ATOM   4959  C  CD2   . LEU G  3  85   ? 228.357 285.076 151.899 1.00 27.39  ? 85   LEU X CD2   1 
ATOM   4960  N  N     . ALA G  3  86   ? 230.398 283.794 147.042 1.00 24.71  ? 86   ALA X N     1 
ATOM   4961  C  CA    . ALA G  3  86   ? 230.248 283.630 145.599 1.00 28.89  ? 86   ALA X CA    1 
ATOM   4962  C  C     . ALA G  3  86   ? 230.079 282.167 145.216 1.00 42.09  ? 86   ALA X C     1 
ATOM   4963  O  O     . ALA G  3  86   ? 229.336 281.843 144.282 1.00 52.97  ? 86   ALA X O     1 
ATOM   4964  C  CB    . ALA G  3  86   ? 231.451 284.234 144.877 1.00 50.51  ? 86   ALA X CB    1 
ATOM   4965  N  N     . VAL G  3  87   ? 230.763 281.269 145.920 1.00 46.59  ? 87   VAL X N     1 
ATOM   4966  C  CA    . VAL G  3  87   ? 230.623 279.844 145.649 1.00 42.57  ? 87   VAL X CA    1 
ATOM   4967  C  C     . VAL G  3  87   ? 229.311 279.316 146.214 1.00 32.73  ? 87   VAL X C     1 
ATOM   4968  O  O     . VAL G  3  87   ? 228.452 278.820 145.473 1.00 46.73  ? 87   VAL X O     1 
ATOM   4969  C  CB    . VAL G  3  87   ? 231.828 279.063 146.203 1.00 47.72  ? 87   VAL X CB    1 
ATOM   4970  C  CG1   . VAL G  3  87   ? 231.572 277.575 146.091 1.00 45.40  ? 87   VAL X CG1   1 
ATOM   4971  C  CG2   . VAL G  3  87   ? 233.087 279.434 145.441 1.00 31.02  ? 87   VAL X CG2   1 
ATOM   4972  N  N     . ARG G  3  88   ? 229.142 279.406 147.536 1.00 32.04  ? 88   ARG X N     1 
ATOM   4973  C  CA    . ARG G  3  88   ? 227.997 278.767 148.181 1.00 35.37  ? 88   ARG X CA    1 
ATOM   4974  C  C     . ARG G  3  88   ? 226.665 279.317 147.684 1.00 43.15  ? 88   ARG X C     1 
ATOM   4975  O  O     . ARG G  3  88   ? 225.659 278.601 147.704 1.00 56.46  ? 88   ARG X O     1 
ATOM   4976  C  CB    . ARG G  3  88   ? 228.097 278.919 149.695 1.00 50.25  ? 88   ARG X CB    1 
ATOM   4977  C  CG    . ARG G  3  88   ? 229.314 278.265 150.303 1.00 55.14  ? 88   ARG X CG    1 
ATOM   4978  C  CD    . ARG G  3  88   ? 229.212 276.749 150.262 1.00 54.31  ? 88   ARG X CD    1 
ATOM   4979  N  NE    . ARG G  3  88   ? 230.350 276.113 150.917 1.00 60.87  ? 88   ARG X NE    1 
ATOM   4980  C  CZ    . ARG G  3  88   ? 231.465 275.748 150.293 1.00 55.00  ? 88   ARG X CZ    1 
ATOM   4981  N  NH1   . ARG G  3  88   ? 231.595 275.955 148.993 1.00 51.58  ? 88   ARG X NH1   1 
ATOM   4982  N  NH2   . ARG G  3  88   ? 232.449 275.177 150.972 1.00 51.53  ? 88   ARG X NH2   1 
ATOM   4983  N  N     . ASN G  3  89   ? 226.625 280.577 147.239 1.00 53.95  ? 89   ASN X N     1 
ATOM   4984  C  CA    . ASN G  3  89   ? 225.379 281.105 146.687 1.00 49.77  ? 89   ASN X CA    1 
ATOM   4985  C  C     . ASN G  3  89   ? 225.045 280.502 145.329 1.00 51.85  ? 89   ASN X C     1 
ATOM   4986  O  O     . ASN G  3  89   ? 223.877 280.515 144.932 1.00 65.93  ? 89   ASN X O     1 
ATOM   4987  C  CB    . ASN G  3  89   ? 225.438 282.630 146.581 1.00 52.90  ? 89   ASN X CB    1 
ATOM   4988  C  CG    . ASN G  3  89   ? 225.345 283.312 147.930 1.00 61.44  ? 89   ASN X CG    1 
ATOM   4989  O  OD1   . ASN G  3  89   ? 224.819 282.745 148.886 1.00 60.77  ? 89   ASN X OD1   1 
ATOM   4990  N  ND2   . ASN G  3  89   ? 225.854 284.535 148.013 1.00 57.20  ? 89   ASN X ND2   1 
ATOM   4991  N  N     . ASP G  3  90   ? 226.036 279.974 144.616 1.00 69.23  ? 90   ASP X N     1 
ATOM   4992  C  CA    . ASP G  3  90   ? 225.800 279.316 143.339 1.00 58.48  ? 90   ASP X CA    1 
ATOM   4993  C  C     . ASP G  3  90   ? 225.600 277.822 143.558 1.00 64.49  ? 90   ASP X C     1 
ATOM   4994  O  O     . ASP G  3  90   ? 226.312 277.199 144.347 1.00 84.55  ? 90   ASP X O     1 
ATOM   4995  C  CB    . ASP G  3  90   ? 226.967 279.557 142.381 1.00 56.39  ? 90   ASP X CB    1 
ATOM   4996  C  CG    . ASP G  3  90   ? 226.738 278.936 141.018 1.00 76.63  ? 90   ASP X CG    1 
ATOM   4997  O  OD1   . ASP G  3  90   ? 225.828 279.398 140.300 1.00 99.45  ? 90   ASP X OD1   1 
ATOM   4998  O  OD2   . ASP G  3  90   ? 227.467 277.986 140.666 1.00 75.21  ? 90   ASP X OD2   1 
ATOM   4999  N  N     . GLU G  3  91   ? 224.622 277.254 142.851 1.00 82.39  ? 91   GLU X N     1 
ATOM   5000  C  CA    . GLU G  3  91   ? 224.261 275.858 143.077 1.00 82.11  ? 91   GLU X CA    1 
ATOM   5001  C  C     . GLU G  3  91   ? 225.327 274.912 142.536 1.00 78.92  ? 91   GLU X C     1 
ATOM   5002  O  O     . GLU G  3  91   ? 225.778 274.001 143.239 1.00 79.34  ? 91   GLU X O     1 
ATOM   5003  C  CB    . GLU G  3  91   ? 222.902 275.563 142.438 1.00 87.76  ? 91   GLU X CB    1 
ATOM   5004  C  CG    . GLU G  3  91   ? 222.401 274.147 142.664 1.00 122.88 ? 91   GLU X CG    1 
ATOM   5005  C  CD    . GLU G  3  91   ? 221.032 273.910 142.053 1.00 145.90 ? 91   GLU X CD    1 
ATOM   5006  O  OE1   . GLU G  3  91   ? 220.493 274.841 141.418 1.00 156.52 ? 91   GLU X OE1   1 
ATOM   5007  O  OE2   . GLU G  3  91   ? 220.493 272.795 142.209 1.00 141.69 ? 91   GLU X OE2   1 
ATOM   5008  N  N     . GLU G  3  92   ? 225.745 275.118 141.286 1.00 54.18  ? 92   GLU X N     1 
ATOM   5009  C  CA    . GLU G  3  92   ? 226.636 274.162 140.635 1.00 56.26  ? 92   GLU X CA    1 
ATOM   5010  C  C     . GLU G  3  92   ? 228.025 274.179 141.262 1.00 54.51  ? 92   GLU X C     1 
ATOM   5011  O  O     . GLU G  3  92   ? 228.606 273.122 141.535 1.00 64.98  ? 92   GLU X O     1 
ATOM   5012  C  CB    . GLU G  3  92   ? 226.704 274.458 139.138 1.00 67.89  ? 92   GLU X CB    1 
ATOM   5013  C  CG    . GLU G  3  92   ? 225.379 274.235 138.427 1.00 82.59  ? 92   GLU X CG    1 
ATOM   5014  C  CD    . GLU G  3  92   ? 225.429 274.600 136.959 1.00 104.25 ? 92   GLU X CD    1 
ATOM   5015  O  OE1   . GLU G  3  92   ? 226.436 275.198 136.523 1.00 113.87 ? 92   GLU X OE1   1 
ATOM   5016  O  OE2   . GLU G  3  92   ? 224.455 274.291 136.239 1.00 103.59 ? 92   GLU X OE2   1 
ATOM   5017  N  N     . LEU G  3  93   ? 228.576 275.372 141.501 1.00 59.95  ? 93   LEU X N     1 
ATOM   5018  C  CA    . LEU G  3  93   ? 229.874 275.454 142.159 1.00 56.52  ? 93   LEU X CA    1 
ATOM   5019  C  C     . LEU G  3  93   ? 229.816 274.913 143.581 1.00 59.42  ? 93   LEU X C     1 
ATOM   5020  O  O     . LEU G  3  93   ? 230.816 274.394 144.088 1.00 61.52  ? 93   LEU X O     1 
ATOM   5021  C  CB    . LEU G  3  93   ? 230.382 276.895 142.157 1.00 61.33  ? 93   LEU X CB    1 
ATOM   5022  C  CG    . LEU G  3  93   ? 230.729 277.476 140.787 1.00 58.41  ? 93   LEU X CG    1 
ATOM   5023  C  CD1   . LEU G  3  93   ? 231.086 278.945 140.904 1.00 56.11  ? 93   LEU X CD1   1 
ATOM   5024  C  CD2   . LEU G  3  93   ? 231.867 276.694 140.154 1.00 43.56  ? 93   LEU X CD2   1 
ATOM   5025  N  N     . ASN G  3  94   ? 228.658 275.021 144.237 1.00 54.15  ? 94   ASN X N     1 
ATOM   5026  C  CA    . ASN G  3  94   ? 228.499 274.391 145.543 1.00 54.08  ? 94   ASN X CA    1 
ATOM   5027  C  C     . ASN G  3  94   ? 228.491 272.875 145.422 1.00 57.97  ? 94   ASN X C     1 
ATOM   5028  O  O     . ASN G  3  94   ? 228.994 272.176 146.306 1.00 62.82  ? 94   ASN X O     1 
ATOM   5029  C  CB    . ASN G  3  94   ? 227.220 274.879 146.217 1.00 74.38  ? 94   ASN X CB    1 
ATOM   5030  C  CG    . ASN G  3  94   ? 227.108 274.414 147.654 1.00 79.82  ? 94   ASN X CG    1 
ATOM   5031  O  OD1   . ASN G  3  94   ? 228.113 274.216 148.333 1.00 78.32  ? 94   ASN X OD1   1 
ATOM   5032  N  ND2   . ASN G  3  94   ? 225.880 274.236 148.123 1.00 80.95  ? 94   ASN X ND2   1 
ATOM   5033  N  N     . LYS G  3  95   ? 227.919 272.350 144.336 1.00 54.18  ? 95   LYS X N     1 
ATOM   5034  C  CA    . LYS G  3  95   ? 227.938 270.907 144.132 1.00 55.40  ? 95   LYS X CA    1 
ATOM   5035  C  C     . LYS G  3  95   ? 229.341 270.406 143.821 1.00 54.40  ? 95   LYS X C     1 
ATOM   5036  O  O     . LYS G  3  95   ? 229.709 269.300 144.230 1.00 58.81  ? 95   LYS X O     1 
ATOM   5037  C  CB    . LYS G  3  95   ? 226.970 270.520 143.015 1.00 71.99  ? 95   LYS X CB    1 
ATOM   5038  C  CG    . LYS G  3  95   ? 226.861 269.022 142.789 1.00 81.98  ? 95   LYS X CG    1 
ATOM   5039  C  CD    . LYS G  3  95   ? 226.231 268.331 143.989 1.00 106.72 ? 95   LYS X CD    1 
ATOM   5040  C  CE    . LYS G  3  95   ? 226.127 266.829 143.779 1.00 118.80 ? 95   LYS X CE    1 
ATOM   5041  N  NZ    . LYS G  3  95   ? 225.211 266.488 142.655 1.00 113.26 ? 95   LYS X NZ    1 
ATOM   5042  N  N     . LEU G  3  96   ? 230.140 271.204 143.108 1.00 52.83  ? 96   LEU X N     1 
ATOM   5043  C  CA    . LEU G  3  96   ? 231.510 270.803 142.806 1.00 43.78  ? 96   LEU X CA    1 
ATOM   5044  C  C     . LEU G  3  96   ? 232.400 270.910 144.040 1.00 47.52  ? 96   LEU X C     1 
ATOM   5045  O  O     . LEU G  3  96   ? 233.187 270.002 144.332 1.00 50.38  ? 96   LEU X O     1 
ATOM   5046  C  CB    . LEU G  3  96   ? 232.066 271.657 141.668 1.00 38.54  ? 96   LEU X CB    1 
ATOM   5047  C  CG    . LEU G  3  96   ? 233.534 271.437 141.299 1.00 42.27  ? 96   LEU X CG    1 
ATOM   5048  C  CD1   . LEU G  3  96   ? 233.756 270.022 140.797 1.00 34.25  ? 96   LEU X CD1   1 
ATOM   5049  C  CD2   . LEU G  3  96   ? 233.983 272.456 140.267 1.00 37.19  ? 96   LEU X CD2   1 
ATOM   5050  N  N     . LEU G  3  97   ? 232.291 272.014 144.771 1.00 41.46  ? 97   LEU X N     1 
ATOM   5051  C  CA    . LEU G  3  97   ? 233.154 272.310 145.906 1.00 52.89  ? 97   LEU X CA    1 
ATOM   5052  C  C     . LEU G  3  97   ? 232.572 271.857 147.240 1.00 58.76  ? 97   LEU X C     1 
ATOM   5053  O  O     . LEU G  3  97   ? 233.117 272.214 148.288 1.00 47.99  ? 97   LEU X O     1 
ATOM   5054  C  CB    . LEU G  3  97   ? 233.466 273.808 145.953 1.00 44.13  ? 97   LEU X CB    1 
ATOM   5055  C  CG    . LEU G  3  97   ? 234.251 274.336 144.750 1.00 44.87  ? 97   LEU X CG    1 
ATOM   5056  C  CD1   . LEU G  3  97   ? 234.449 275.841 144.835 1.00 35.94  ? 97   LEU X CD1   1 
ATOM   5057  C  CD2   . LEU G  3  97   ? 235.586 273.627 144.624 1.00 55.11  ? 97   LEU X CD2   1 
ATOM   5058  N  N     . GLY G  3  98   ? 231.463 271.110 147.225 1.00 46.31  ? 98   GLY X N     1 
ATOM   5059  C  CA    . GLY G  3  98   ? 230.793 270.733 148.462 1.00 34.13  ? 98   GLY X CA    1 
ATOM   5060  C  C     . GLY G  3  98   ? 231.700 270.120 149.515 1.00 45.71  ? 98   GLY X C     1 
ATOM   5061  O  O     . GLY G  3  98   ? 231.442 270.255 150.713 1.00 47.70  ? 98   GLY X O     1 
ATOM   5062  N  N     . ARG G  3  99   ? 232.760 269.439 149.092 1.00 40.22  ? 99   ARG X N     1 
ATOM   5063  C  CA    . ARG G  3  99   ? 233.703 268.827 150.022 1.00 42.75  ? 99   ARG X CA    1 
ATOM   5064  C  C     . ARG G  3  99   ? 234.835 269.758 150.432 1.00 41.95  ? 99   ARG X C     1 
ATOM   5065  O  O     . ARG G  3  99   ? 235.738 269.326 151.154 1.00 50.03  ? 99   ARG X O     1 
ATOM   5066  C  CB    . ARG G  3  99   ? 234.298 267.557 149.411 1.00 44.46  ? 99   ARG X CB    1 
ATOM   5067  C  CG    . ARG G  3  99   ? 233.305 266.431 149.209 1.00 50.85  ? 99   ARG X CG    1 
ATOM   5068  C  CD    . ARG G  3  99   ? 233.999 265.198 148.654 1.00 71.71  ? 99   ARG X CD    1 
ATOM   5069  N  NE    . ARG G  3  99   ? 233.074 264.091 148.443 1.00 96.51  ? 99   ARG X NE    1 
ATOM   5070  C  CZ    . ARG G  3  99   ? 232.722 263.218 149.384 1.00 101.49 ? 99   ARG X CZ    1 
ATOM   5071  N  NH1   . ARG G  3  99   ? 233.225 263.319 150.606 1.00 97.78  ? 99   ARG X NH1   1 
ATOM   5072  N  NH2   . ARG G  3  99   ? 231.873 262.242 149.098 1.00 99.64  ? 99   ARG X NH2   1 
ATOM   5073  N  N     . VAL G  3  100  ? 234.818 271.012 149.993 1.00 63.48  ? 100  VAL X N     1 
ATOM   5074  C  CA    . VAL G  3  100  ? 235.931 271.933 150.194 1.00 54.11  ? 100  VAL X CA    1 
ATOM   5075  C  C     . VAL G  3  100  ? 235.676 272.785 151.428 1.00 60.08  ? 100  VAL X C     1 
ATOM   5076  O  O     . VAL G  3  100  ? 234.546 273.220 151.680 1.00 55.53  ? 100  VAL X O     1 
ATOM   5077  C  CB    . VAL G  3  100  ? 236.144 272.822 148.956 1.00 41.16  ? 100  VAL X CB    1 
ATOM   5078  C  CG1   . VAL G  3  100  ? 237.226 273.839 149.222 1.00 52.24  ? 100  VAL X CG1   1 
ATOM   5079  C  CG2   . VAL G  3  100  ? 236.490 271.972 147.748 1.00 39.01  ? 100  VAL X CG2   1 
ATOM   5080  N  N     . THR G  3  101  ? 236.735 273.018 152.205 1.00 36.74  ? 101  THR X N     1 
ATOM   5081  C  CA    . THR G  3  101  ? 236.735 273.977 153.305 1.00 43.00  ? 101  THR X CA    1 
ATOM   5082  C  C     . THR G  3  101  ? 237.628 275.144 152.902 1.00 55.30  ? 101  THR X C     1 
ATOM   5083  O  O     . THR G  3  101  ? 238.845 274.979 152.758 1.00 59.10  ? 101  THR X O     1 
ATOM   5084  C  CB    . THR G  3  101  ? 237.228 273.333 154.598 1.00 63.74  ? 101  THR X CB    1 
ATOM   5085  O  OG1   . THR G  3  101  ? 236.320 272.296 154.996 1.00 62.98  ? 101  THR X OG1   1 
ATOM   5086  C  CG2   . THR G  3  101  ? 237.342 274.371 155.701 1.00 46.84  ? 101  THR X CG2   1 
ATOM   5087  N  N     . ILE G  3  102  ? 237.031 276.314 152.719 1.00 60.89  ? 102  ILE X N     1 
ATOM   5088  C  CA    . ILE G  3  102  ? 237.762 277.505 152.309 1.00 53.55  ? 102  ILE X CA    1 
ATOM   5089  C  C     . ILE G  3  102  ? 238.231 278.250 153.551 1.00 55.31  ? 102  ILE X C     1 
ATOM   5090  O  O     . ILE G  3  102  ? 237.435 278.531 154.454 1.00 59.81  ? 102  ILE X O     1 
ATOM   5091  C  CB    . ILE G  3  102  ? 236.893 278.406 151.419 1.00 37.48  ? 102  ILE X CB    1 
ATOM   5092  C  CG1   . ILE G  3  102  ? 236.582 277.704 150.098 1.00 32.17  ? 102  ILE X CG1   1 
ATOM   5093  C  CG2   . ILE G  3  102  ? 237.578 279.734 151.168 1.00 27.06  ? 102  ILE X CG2   1 
ATOM   5094  C  CD1   . ILE G  3  102  ? 235.555 278.419 149.255 1.00 34.41  ? 102  ILE X CD1   1 
ATOM   5095  N  N     . ALA G  3  103  ? 239.523 278.567 153.599 1.00 43.38  ? 103  ALA X N     1 
ATOM   5096  C  CA    . ALA G  3  103  ? 240.071 279.296 154.734 1.00 49.45  ? 103  ALA X CA    1 
ATOM   5097  C  C     . ALA G  3  103  ? 239.538 280.722 154.761 1.00 67.46  ? 103  ALA X C     1 
ATOM   5098  O  O     . ALA G  3  103  ? 239.406 281.372 153.720 1.00 75.25  ? 103  ALA X O     1 
ATOM   5099  C  CB    . ALA G  3  103  ? 241.597 279.305 154.673 1.00 48.53  ? 103  ALA X CB    1 
ATOM   5100  N  N     . GLN G  3  104  ? 239.223 281.203 155.963 1.00 58.44  ? 104  GLN X N     1 
ATOM   5101  C  CA    . GLN G  3  104  ? 238.665 282.536 156.189 1.00 52.79  ? 104  GLN X CA    1 
ATOM   5102  C  C     . GLN G  3  104  ? 237.351 282.745 155.446 1.00 61.59  ? 104  GLN X C     1 
ATOM   5103  O  O     . GLN G  3  104  ? 236.970 283.884 155.161 1.00 79.34  ? 104  GLN X O     1 
ATOM   5104  C  CB    . GLN G  3  104  ? 239.665 283.633 155.805 1.00 53.17  ? 104  GLN X CB    1 
ATOM   5105  C  CG    . GLN G  3  104  ? 240.920 283.661 156.657 1.00 72.44  ? 104  GLN X CG    1 
ATOM   5106  C  CD    . GLN G  3  104  ? 240.623 283.902 158.123 1.00 96.55  ? 104  GLN X CD    1 
ATOM   5107  O  OE1   . GLN G  3  104  ? 239.746 284.693 158.466 1.00 108.32 ? 104  GLN X OE1   1 
ATOM   5108  N  NE2   . GLN G  3  104  ? 241.356 283.222 158.996 1.00 91.53  ? 104  GLN X NE2   1 
ATOM   5109  N  N     . GLY G  3  105  ? 236.650 281.662 155.127 1.00 56.96  ? 105  GLY X N     1 
ATOM   5110  C  CA    . GLY G  3  105  ? 235.428 281.754 154.357 1.00 53.07  ? 105  GLY X CA    1 
ATOM   5111  C  C     . GLY G  3  105  ? 234.225 282.221 155.144 1.00 49.06  ? 105  GLY X C     1 
ATOM   5112  O  O     . GLY G  3  105  ? 233.486 283.100 154.695 1.00 58.91  ? 105  GLY X O     1 
ATOM   5113  N  N     . GLY G  3  106  ? 234.017 281.644 156.321 1.00 38.05  ? 106  GLY X N     1 
ATOM   5114  C  CA    . GLY G  3  106  ? 232.812 281.922 157.074 1.00 37.99  ? 106  GLY X CA    1 
ATOM   5115  C  C     . GLY G  3  106  ? 231.665 281.029 156.634 1.00 47.64  ? 106  GLY X C     1 
ATOM   5116  O  O     . GLY G  3  106  ? 231.850 280.004 155.973 1.00 46.89  ? 106  GLY X O     1 
ATOM   5117  N  N     . VAL G  3  107  ? 230.456 281.433 157.016 1.00 41.58  ? 107  VAL X N     1 
ATOM   5118  C  CA    . VAL G  3  107  ? 229.243 280.685 156.720 1.00 30.30  ? 107  VAL X CA    1 
ATOM   5119  C  C     . VAL G  3  107  ? 228.207 281.643 156.150 1.00 37.71  ? 107  VAL X C     1 
ATOM   5120  O  O     . VAL G  3  107  ? 228.117 282.798 156.582 1.00 52.10  ? 107  VAL X O     1 
ATOM   5121  C  CB    . VAL G  3  107  ? 228.696 279.972 157.975 1.00 39.15  ? 107  VAL X CB    1 
ATOM   5122  C  CG1   . VAL G  3  107  ? 227.391 279.254 157.669 1.00 62.62  ? 107  VAL X CG1   1 
ATOM   5123  C  CG2   . VAL G  3  107  ? 229.725 278.995 158.524 1.00 32.84  ? 107  VAL X CG2   1 
ATOM   5124  N  N     . LEU G  3  108  ? 227.445 281.170 155.164 1.00 53.65  ? 108  LEU X N     1 
ATOM   5125  C  CA    . LEU G  3  108  ? 226.318 281.942 154.669 1.00 47.03  ? 108  LEU X CA    1 
ATOM   5126  C  C     . LEU G  3  108  ? 225.386 282.285 155.828 1.00 49.60  ? 108  LEU X C     1 
ATOM   5127  O  O     . LEU G  3  108  ? 225.098 281.421 156.666 1.00 62.57  ? 108  LEU X O     1 
ATOM   5128  C  CB    . LEU G  3  108  ? 225.541 281.157 153.614 1.00 36.57  ? 108  LEU X CB    1 
ATOM   5129  C  CG    . LEU G  3  108  ? 226.197 280.760 152.298 1.00 30.18  ? 108  LEU X CG    1 
ATOM   5130  C  CD1   . LEU G  3  108  ? 225.234 279.896 151.501 1.00 29.75  ? 108  LEU X CD1   1 
ATOM   5131  C  CD2   . LEU G  3  108  ? 226.594 281.986 151.509 1.00 38.80  ? 108  LEU X CD2   1 
ATOM   5132  N  N     . PRO G  3  109  ? 224.908 283.524 155.921 1.00 68.33  ? 109  PRO X N     1 
ATOM   5133  C  CA    . PRO G  3  109  ? 223.926 283.844 156.970 1.00 73.45  ? 109  PRO X CA    1 
ATOM   5134  C  C     . PRO G  3  109  ? 222.666 283.019 156.765 1.00 72.79  ? 109  PRO X C     1 
ATOM   5135  O  O     . PRO G  3  109  ? 222.059 283.031 155.692 1.00 64.47  ? 109  PRO X O     1 
ATOM   5136  C  CB    . PRO G  3  109  ? 223.670 285.340 156.763 1.00 51.23  ? 109  PRO X CB    1 
ATOM   5137  C  CG    . PRO G  3  109  ? 224.907 285.841 156.086 1.00 56.26  ? 109  PRO X CG    1 
ATOM   5138  C  CD    . PRO G  3  109  ? 225.334 284.722 155.180 1.00 54.10  ? 109  PRO X CD    1 
ATOM   5139  N  N     . ASN G  3  110  ? 222.274 282.293 157.808 1.00 94.92  ? 110  ASN X N     1 
ATOM   5140  C  CA    . ASN G  3  110  ? 221.097 281.444 157.724 1.00 92.75  ? 110  ASN X CA    1 
ATOM   5141  C  C     . ASN G  3  110  ? 220.499 281.291 159.114 1.00 89.22  ? 110  ASN X C     1 
ATOM   5142  O  O     . ASN G  3  110  ? 221.228 281.162 160.101 1.00 86.30  ? 110  ASN X O     1 
ATOM   5143  C  CB    . ASN G  3  110  ? 221.453 280.071 157.136 1.00 99.75  ? 110  ASN X CB    1 
ATOM   5144  C  CG    . ASN G  3  110  ? 220.229 279.238 156.797 1.00 116.77 ? 110  ASN X CG    1 
ATOM   5145  O  OD1   . ASN G  3  110  ? 219.133 279.477 157.303 1.00 123.32 ? 110  ASN X OD1   1 
ATOM   5146  N  ND2   . ASN G  3  110  ? 220.416 278.245 155.933 1.00 119.48 ? 110  ASN X ND2   1 
ATOM   5147  N  N     . ILE G  3  111  ? 219.170 281.297 159.177 1.00 113.64 ? 111  ILE X N     1 
ATOM   5148  C  CA    . ILE G  3  111  ? 218.426 281.010 160.398 1.00 109.64 ? 111  ILE X CA    1 
ATOM   5149  C  C     . ILE G  3  111  ? 217.197 280.204 160.007 1.00 108.06 ? 111  ILE X C     1 
ATOM   5150  O  O     . ILE G  3  111  ? 216.472 280.580 159.081 1.00 112.73 ? 111  ILE X O     1 
ATOM   5151  C  CB    . ILE G  3  111  ? 218.012 282.293 161.149 1.00 114.17 ? 111  ILE X CB    1 
ATOM   5152  C  CG1   . ILE G  3  111  ? 219.236 283.027 161.697 1.00 119.67 ? 111  ILE X CG1   1 
ATOM   5153  C  CG2   . ILE G  3  111  ? 217.051 281.962 162.279 1.00 108.56 ? 111  ILE X CG2   1 
ATOM   5154  C  CD1   . ILE G  3  111  ? 218.930 284.400 162.252 1.00 123.54 ? 111  ILE X CD1   1 
ATOM   5155  N  N     . GLN G  3  112  ? 216.965 279.095 160.705 1.00 114.02 ? 112  GLN X N     1 
ATOM   5156  C  CA    . GLN G  3  112  ? 215.781 278.291 160.445 1.00 109.51 ? 112  GLN X CA    1 
ATOM   5157  C  C     . GLN G  3  112  ? 214.534 279.073 160.838 1.00 117.43 ? 112  GLN X C     1 
ATOM   5158  O  O     . GLN G  3  112  ? 214.481 279.681 161.912 1.00 127.32 ? 112  GLN X O     1 
ATOM   5159  C  CB    . GLN G  3  112  ? 215.858 276.972 161.208 1.00 105.83 ? 112  GLN X CB    1 
ATOM   5160  C  CG    . GLN G  3  112  ? 216.999 276.071 160.758 1.00 92.37  ? 112  GLN X CG    1 
ATOM   5161  C  CD    . GLN G  3  112  ? 216.838 275.591 159.330 1.00 103.23 ? 112  GLN X CD    1 
ATOM   5162  O  OE1   . GLN G  3  112  ? 217.461 276.122 158.410 1.00 109.16 ? 112  GLN X OE1   1 
ATOM   5163  N  NE2   . GLN G  3  112  ? 216.000 274.580 159.136 1.00 99.11  ? 112  GLN X NE2   1 
ATOM   5164  N  N     . SER G  3  113  ? 213.529 279.063 159.957 1.00 132.27 ? 113  SER X N     1 
ATOM   5165  C  CA    . SER G  3  113  ? 212.347 279.897 160.147 1.00 132.22 ? 113  SER X CA    1 
ATOM   5166  C  C     . SER G  3  113  ? 211.604 279.581 161.437 1.00 133.73 ? 113  SER X C     1 
ATOM   5167  O  O     . SER G  3  113  ? 210.880 280.442 161.948 1.00 147.11 ? 113  SER X O     1 
ATOM   5168  C  CB    . SER G  3  113  ? 211.404 279.745 158.953 1.00 142.20 ? 113  SER X CB    1 
ATOM   5169  O  OG    . SER G  3  113  ? 212.005 280.227 157.765 1.00 142.85 ? 113  SER X OG    1 
ATOM   5170  N  N     . VAL G  3  114  ? 211.763 278.371 161.978 1.00 119.20 ? 114  VAL X N     1 
ATOM   5171  C  CA    . VAL G  3  114  ? 211.089 278.024 163.221 1.00 122.15 ? 114  VAL X CA    1 
ATOM   5172  C  C     . VAL G  3  114  ? 211.726 278.723 164.418 1.00 130.60 ? 114  VAL X C     1 
ATOM   5173  O  O     . VAL G  3  114  ? 211.054 278.954 165.428 1.00 140.83 ? 114  VAL X O     1 
ATOM   5174  C  CB    . VAL G  3  114  ? 211.080 276.492 163.405 1.00 116.98 ? 114  VAL X CB    1 
ATOM   5175  C  CG1   . VAL G  3  114  ? 212.497 275.961 163.552 1.00 115.12 ? 114  VAL X CG1   1 
ATOM   5176  C  CG2   . VAL G  3  114  ? 210.212 276.086 164.589 1.00 118.65 ? 114  VAL X CG2   1 
ATOM   5177  N  N     . LEU G  3  115  ? 213.004 279.090 164.320 1.00 111.02 ? 115  LEU X N     1 
ATOM   5178  C  CA    . LEU G  3  115  ? 213.704 279.725 165.431 1.00 115.05 ? 115  LEU X CA    1 
ATOM   5179  C  C     . LEU G  3  115  ? 213.384 281.206 165.572 1.00 116.94 ? 115  LEU X C     1 
ATOM   5180  O  O     . LEU G  3  115  ? 213.711 281.795 166.606 1.00 114.00 ? 115  LEU X O     1 
ATOM   5181  C  CB    . LEU G  3  115  ? 215.215 279.547 165.271 1.00 107.56 ? 115  LEU X CB    1 
ATOM   5182  C  CG    . LEU G  3  115  ? 215.739 278.112 165.334 1.00 98.72  ? 115  LEU X CG    1 
ATOM   5183  C  CD1   . LEU G  3  115  ? 217.231 278.069 165.042 1.00 104.97 ? 115  LEU X CD1   1 
ATOM   5184  C  CD2   . LEU G  3  115  ? 215.438 277.490 166.685 1.00 92.20  ? 115  LEU X CD2   1 
ATOM   5185  N  N     . LEU G  3  116  ? 212.756 281.820 164.572 1.00 129.17 ? 116  LEU X N     1 
ATOM   5186  C  CA    . LEU G  3  116  ? 212.457 283.241 164.653 1.00 130.31 ? 116  LEU X CA    1 
ATOM   5187  C  C     . LEU G  3  116  ? 211.235 283.476 165.537 1.00 145.09 ? 116  LEU X C     1 
ATOM   5188  O  O     . LEU G  3  116  ? 210.291 282.677 165.522 1.00 140.82 ? 116  LEU X O     1 
ATOM   5189  C  CB    . LEU G  3  116  ? 212.209 283.818 163.261 1.00 134.99 ? 116  LEU X CB    1 
ATOM   5190  C  CG    . LEU G  3  116  ? 213.410 283.799 162.311 1.00 135.99 ? 116  LEU X CG    1 
ATOM   5191  C  CD1   . LEU G  3  116  ? 213.007 284.274 160.924 1.00 134.51 ? 116  LEU X CD1   1 
ATOM   5192  C  CD2   . LEU G  3  116  ? 214.543 284.646 162.865 1.00 142.38 ? 116  LEU X CD2   1 
ATOM   5193  N  N     . PRO G  3  117  ? 211.227 284.550 166.319 1.00 141.34 ? 117  PRO X N     1 
ATOM   5194  C  CA    . PRO G  3  117  ? 210.078 284.832 167.185 1.00 143.37 ? 117  PRO X CA    1 
ATOM   5195  C  C     . PRO G  3  117  ? 208.824 285.138 166.380 1.00 145.65 ? 117  PRO X C     1 
ATOM   5196  O  O     . PRO G  3  117  ? 208.871 285.463 165.192 1.00 137.21 ? 117  PRO X O     1 
ATOM   5197  C  CB    . PRO G  3  117  ? 210.527 286.060 167.987 1.00 133.39 ? 117  PRO X CB    1 
ATOM   5198  C  CG    . PRO G  3  117  ? 212.019 285.996 167.955 1.00 130.97 ? 117  PRO X CG    1 
ATOM   5199  C  CD    . PRO G  3  117  ? 212.351 285.458 166.592 1.00 134.02 ? 117  PRO X CD    1 
ATOM   5200  N  N     . LYS G  3  118  ? 207.686 285.029 167.058 1.00 157.78 ? 118  LYS X N     1 
ATOM   5201  C  CA    . LYS G  3  118  ? 206.393 285.300 166.439 1.00 154.29 ? 118  LYS X CA    1 
ATOM   5202  C  C     . LYS G  3  118  ? 205.390 285.782 167.480 1.00 159.92 ? 118  LYS X C     1 
ATOM   5203  O  O     . LYS G  3  118  ? 205.691 285.835 168.671 1.00 164.39 ? 118  LYS X O     1 
ATOM   5204  C  CB    . LYS G  3  118  ? 205.866 284.056 165.729 1.00 154.96 ? 118  LYS X CB    1 
ATOM   5205  N  N     . THR H  4  29   ? 265.860 279.412 144.530 1.00 122.01 ? 29   THR Y N     1 
ATOM   5206  C  CA    . THR H  4  29   ? 264.661 278.602 144.338 1.00 136.88 ? 29   THR Y CA    1 
ATOM   5207  C  C     . THR H  4  29   ? 263.498 279.449 143.840 1.00 146.32 ? 29   THR Y C     1 
ATOM   5208  O  O     . THR H  4  29   ? 263.125 280.440 144.467 1.00 146.32 ? 29   THR Y O     1 
ATOM   5209  C  CB    . THR H  4  29   ? 264.246 277.892 145.639 1.00 134.27 ? 29   THR Y CB    1 
ATOM   5210  O  OG1   . THR H  4  29   ? 265.295 277.014 146.065 1.00 142.07 ? 29   THR Y OG1   1 
ATOM   5211  C  CG2   . THR H  4  29   ? 262.972 277.090 145.424 1.00 120.80 ? 29   THR Y CG2   1 
ATOM   5212  N  N     . ARG H  4  30   ? 262.926 279.051 142.707 1.00 144.16 ? 30   ARG Y N     1 
ATOM   5213  C  CA    . ARG H  4  30   ? 261.793 279.744 142.102 1.00 129.31 ? 30   ARG Y CA    1 
ATOM   5214  C  C     . ARG H  4  30   ? 260.586 278.817 142.142 1.00 119.56 ? 30   ARG Y C     1 
ATOM   5215  O  O     . ARG H  4  30   ? 260.580 277.766 141.493 1.00 116.65 ? 30   ARG Y O     1 
ATOM   5216  C  CB    . ARG H  4  30   ? 262.112 280.168 140.670 1.00 123.71 ? 30   ARG Y CB    1 
ATOM   5217  C  CG    . ARG H  4  30   ? 263.201 281.221 140.563 1.00 130.75 ? 30   ARG Y CG    1 
ATOM   5218  C  CD    . ARG H  4  30   ? 263.497 281.563 139.112 1.00 140.76 ? 30   ARG Y CD    1 
ATOM   5219  N  NE    . ARG H  4  30   ? 264.528 282.590 138.997 1.00 146.85 ? 30   ARG Y NE    1 
ATOM   5220  C  CZ    . ARG H  4  30   ? 265.834 282.345 139.026 1.00 149.54 ? 30   ARG Y CZ    1 
ATOM   5221  N  NH1   . ARG H  4  30   ? 266.275 281.104 139.168 1.00 155.38 ? 30   ARG Y NH1   1 
ATOM   5222  N  NH2   . ARG H  4  30   ? 266.700 283.344 138.914 1.00 146.85 ? 30   ARG Y NH2   1 
ATOM   5223  N  N     . LYS H  4  31   ? 259.566 279.204 142.905 1.00 106.76 ? 31   LYS Y N     1 
ATOM   5224  C  CA    . LYS H  4  31   ? 258.327 278.442 143.008 1.00 107.58 ? 31   LYS Y CA    1 
ATOM   5225  C  C     . LYS H  4  31   ? 257.268 279.134 142.157 1.00 109.34 ? 31   LYS Y C     1 
ATOM   5226  O  O     . LYS H  4  31   ? 256.790 280.218 142.507 1.00 111.68 ? 31   LYS Y O     1 
ATOM   5227  C  CB    . LYS H  4  31   ? 257.878 278.328 144.463 1.00 83.41  ? 31   LYS Y CB    1 
ATOM   5228  C  CG    . LYS H  4  31   ? 256.583 277.559 144.653 1.00 95.81  ? 31   LYS Y CG    1 
ATOM   5229  C  CD    . LYS H  4  31   ? 256.711 276.123 144.170 1.00 96.06  ? 31   LYS Y CD    1 
ATOM   5230  C  CE    . LYS H  4  31   ? 255.463 275.319 144.498 1.00 88.67  ? 31   LYS Y CE    1 
ATOM   5231  N  NZ    . LYS H  4  31   ? 255.488 273.968 143.872 1.00 89.59  ? 31   LYS Y NZ    1 
ATOM   5232  N  N     . GLU H  4  32   ? 256.907 278.507 141.043 1.00 84.38  ? 32   GLU Y N     1 
ATOM   5233  C  CA    . GLU H  4  32   ? 255.934 279.070 140.123 1.00 79.03  ? 32   GLU Y CA    1 
ATOM   5234  C  C     . GLU H  4  32   ? 254.515 278.883 140.652 1.00 70.69  ? 32   GLU Y C     1 
ATOM   5235  O  O     . GLU H  4  32   ? 254.235 278.001 141.468 1.00 71.87  ? 32   GLU Y O     1 
ATOM   5236  C  CB    . GLU H  4  32   ? 256.066 278.425 138.746 1.00 77.99  ? 32   GLU Y CB    1 
ATOM   5237  C  CG    . GLU H  4  32   ? 255.779 276.938 138.749 1.00 88.38  ? 32   GLU Y CG    1 
ATOM   5238  C  CD    . GLU H  4  32   ? 256.038 276.296 137.405 1.00 89.26  ? 32   GLU Y CD    1 
ATOM   5239  O  OE1   . GLU H  4  32   ? 256.123 277.030 136.398 1.00 85.99  ? 32   GLU Y OE1   1 
ATOM   5240  O  OE2   . GLU H  4  32   ? 256.157 275.055 137.356 1.00 77.73  ? 32   GLU Y OE2   1 
ATOM   5241  N  N     . SER H  4  33   ? 253.613 279.734 140.170 1.00 71.94  ? 33   SER Y N     1 
ATOM   5242  C  CA    . SER H  4  33   ? 252.209 279.659 140.545 1.00 60.35  ? 33   SER Y CA    1 
ATOM   5243  C  C     . SER H  4  33   ? 251.358 280.169 139.388 1.00 73.65  ? 33   SER Y C     1 
ATOM   5244  O  O     . SER H  4  33   ? 251.871 280.587 138.347 1.00 87.07  ? 33   SER Y O     1 
ATOM   5245  C  CB    . SER H  4  33   ? 251.941 280.453 141.826 1.00 57.70  ? 33   SER Y CB    1 
ATOM   5246  O  OG    . SER H  4  33   ? 250.565 280.424 142.164 1.00 70.40  ? 33   SER Y OG    1 
ATOM   5247  N  N     . TYR H  4  34   ? 250.044 280.125 139.584 1.00 41.98  ? 34   TYR Y N     1 
ATOM   5248  C  CA    . TYR H  4  34   ? 249.069 280.616 138.621 1.00 41.79  ? 34   TYR Y CA    1 
ATOM   5249  C  C     . TYR H  4  34   ? 248.641 282.052 138.900 1.00 48.47  ? 34   TYR Y C     1 
ATOM   5250  O  O     . TYR H  4  34   ? 247.711 282.542 138.251 1.00 54.70  ? 34   TYR Y O     1 
ATOM   5251  C  CB    . TYR H  4  34   ? 247.839 279.702 138.605 1.00 38.76  ? 34   TYR Y CB    1 
ATOM   5252  C  CG    . TYR H  4  34   ? 248.120 278.300 138.116 1.00 40.70  ? 34   TYR Y CG    1 
ATOM   5253  C  CD1   . TYR H  4  34   ? 248.045 277.986 136.766 1.00 39.09  ? 34   TYR Y CD1   1 
ATOM   5254  C  CD2   . TYR H  4  34   ? 248.462 277.291 139.005 1.00 37.71  ? 34   TYR Y CD2   1 
ATOM   5255  C  CE1   . TYR H  4  34   ? 248.301 276.706 136.316 1.00 44.06  ? 34   TYR Y CE1   1 
ATOM   5256  C  CE2   . TYR H  4  34   ? 248.720 276.008 138.565 1.00 31.72  ? 34   TYR Y CE2   1 
ATOM   5257  C  CZ    . TYR H  4  34   ? 248.639 275.721 137.220 1.00 37.11  ? 34   TYR Y CZ    1 
ATOM   5258  O  OH    . TYR H  4  34   ? 248.895 274.445 136.778 1.00 40.37  ? 34   TYR Y OH    1 
ATOM   5259  N  N     . ALA H  4  35   ? 249.287 282.719 139.859 1.00 61.59  ? 35   ALA Y N     1 
ATOM   5260  C  CA    . ALA H  4  35   ? 248.810 284.002 140.367 1.00 61.73  ? 35   ALA Y CA    1 
ATOM   5261  C  C     . ALA H  4  35   ? 248.569 285.017 139.254 1.00 69.72  ? 35   ALA Y C     1 
ATOM   5262  O  O     . ALA H  4  35   ? 247.488 285.611 139.165 1.00 73.70  ? 35   ALA Y O     1 
ATOM   5263  C  CB    . ALA H  4  35   ? 249.805 284.554 141.389 1.00 62.68  ? 35   ALA Y CB    1 
ATOM   5264  N  N     . ILE H  4  36   ? 249.570 285.233 138.397 1.00 64.68  ? 36   ILE Y N     1 
ATOM   5265  C  CA    . ILE H  4  36   ? 249.453 286.277 137.380 1.00 62.87  ? 36   ILE Y CA    1 
ATOM   5266  C  C     . ILE H  4  36   ? 248.350 285.952 136.383 1.00 64.24  ? 36   ILE Y C     1 
ATOM   5267  O  O     . ILE H  4  36   ? 247.745 286.857 135.795 1.00 77.27  ? 36   ILE Y O     1 
ATOM   5268  C  CB    . ILE H  4  36   ? 250.804 286.491 136.672 1.00 54.18  ? 36   ILE Y CB    1 
ATOM   5269  C  CG1   . ILE H  4  36   ? 251.253 285.209 135.969 1.00 58.56  ? 36   ILE Y CG1   1 
ATOM   5270  C  CG2   . ILE H  4  36   ? 251.859 286.947 137.667 1.00 65.01  ? 36   ILE Y CG2   1 
ATOM   5271  C  CD1   . ILE H  4  36   ? 252.467 285.395 135.091 1.00 55.83  ? 36   ILE Y CD1   1 
ATOM   5272  N  N     . TYR H  4  37   ? 248.059 284.667 136.184 1.00 62.99  ? 37   TYR Y N     1 
ATOM   5273  C  CA    . TYR H  4  37   ? 247.038 284.266 135.221 1.00 66.22  ? 37   TYR Y CA    1 
ATOM   5274  C  C     . TYR H  4  37   ? 245.639 284.507 135.771 1.00 69.38  ? 37   TYR Y C     1 
ATOM   5275  O  O     . TYR H  4  37   ? 244.774 285.054 135.075 1.00 68.71  ? 37   TYR Y O     1 
ATOM   5276  C  CB    . TYR H  4  37   ? 247.248 282.800 134.853 1.00 56.32  ? 37   TYR Y CB    1 
ATOM   5277  C  CG    . TYR H  4  37   ? 248.591 282.567 134.205 1.00 66.70  ? 37   TYR Y CG    1 
ATOM   5278  C  CD1   . TYR H  4  37   ? 249.032 283.385 133.175 1.00 72.21  ? 37   TYR Y CD1   1 
ATOM   5279  C  CD2   . TYR H  4  37   ? 249.444 281.575 134.664 1.00 76.56  ? 37   TYR Y CD2   1 
ATOM   5280  C  CE1   . TYR H  4  37   ? 250.262 283.194 132.589 1.00 78.28  ? 37   TYR Y CE1   1 
ATOM   5281  C  CE2   . TYR H  4  37   ? 250.684 281.382 134.089 1.00 77.60  ? 37   TYR Y CE2   1 
ATOM   5282  C  CZ    . TYR H  4  37   ? 251.085 282.191 133.049 1.00 76.18  ? 37   TYR Y CZ    1 
ATOM   5283  O  OH    . TYR H  4  37   ? 252.316 281.999 132.469 1.00 77.09  ? 37   TYR Y OH    1 
ATOM   5284  N  N     . VAL H  4  38   ? 245.402 284.107 137.022 1.00 65.20  ? 38   VAL Y N     1 
ATOM   5285  C  CA    . VAL H  4  38   ? 244.163 284.466 137.702 1.00 62.96  ? 38   VAL Y CA    1 
ATOM   5286  C  C     . VAL H  4  38   ? 244.007 285.977 137.746 1.00 57.12  ? 38   VAL Y C     1 
ATOM   5287  O  O     . VAL H  4  38   ? 242.891 286.503 137.647 1.00 68.23  ? 38   VAL Y O     1 
ATOM   5288  C  CB    . VAL H  4  38   ? 244.141 283.848 139.116 1.00 56.67  ? 38   VAL Y CB    1 
ATOM   5289  C  CG1   . VAL H  4  38   ? 242.902 284.282 139.876 1.00 54.54  ? 38   VAL Y CG1   1 
ATOM   5290  C  CG2   . VAL H  4  38   ? 244.219 282.334 139.031 1.00 60.03  ? 38   VAL Y CG2   1 
ATOM   5291  N  N     . TYR H  4  39   ? 245.122 286.701 137.874 1.00 77.80  ? 39   TYR Y N     1 
ATOM   5292  C  CA    . TYR H  4  39   ? 245.078 288.158 137.844 1.00 84.78  ? 39   TYR Y CA    1 
ATOM   5293  C  C     . TYR H  4  39   ? 244.613 288.671 136.486 1.00 82.36  ? 39   TYR Y C     1 
ATOM   5294  O  O     . TYR H  4  39   ? 243.772 289.576 136.411 1.00 78.46  ? 39   TYR Y O     1 
ATOM   5295  C  CB    . TYR H  4  39   ? 246.457 288.714 138.198 1.00 93.95  ? 39   TYR Y CB    1 
ATOM   5296  C  CG    . TYR H  4  39   ? 246.562 290.219 138.165 1.00 103.87 ? 39   TYR Y CG    1 
ATOM   5297  C  CD1   . TYR H  4  39   ? 246.082 290.988 139.215 1.00 95.30  ? 39   TYR Y CD1   1 
ATOM   5298  C  CD2   . TYR H  4  39   ? 247.152 290.871 137.091 1.00 120.41 ? 39   TYR Y CD2   1 
ATOM   5299  C  CE1   . TYR H  4  39   ? 246.184 292.362 139.195 1.00 108.86 ? 39   TYR Y CE1   1 
ATOM   5300  C  CE2   . TYR H  4  39   ? 247.256 292.246 137.060 1.00 126.40 ? 39   TYR Y CE2   1 
ATOM   5301  C  CZ    . TYR H  4  39   ? 246.770 292.988 138.114 1.00 125.39 ? 39   TYR Y CZ    1 
ATOM   5302  O  OH    . TYR H  4  39   ? 246.871 294.360 138.088 1.00 130.35 ? 39   TYR Y OH    1 
ATOM   5303  N  N     . LYS H  4  40   ? 245.142 288.095 135.400 1.00 76.72  ? 40   LYS Y N     1 
ATOM   5304  C  CA    . LYS H  4  40   ? 244.736 288.522 134.063 1.00 69.71  ? 40   LYS Y CA    1 
ATOM   5305  C  C     . LYS H  4  40   ? 243.261 288.236 133.816 1.00 72.70  ? 40   LYS Y C     1 
ATOM   5306  O  O     . LYS H  4  40   ? 242.526 289.093 133.312 1.00 87.16  ? 40   LYS Y O     1 
ATOM   5307  C  CB    . LYS H  4  40   ? 245.597 287.832 133.006 1.00 69.00  ? 40   LYS Y CB    1 
ATOM   5308  C  CG    . LYS H  4  40   ? 247.054 288.258 133.002 1.00 81.26  ? 40   LYS Y CG    1 
ATOM   5309  C  CD    . LYS H  4  40   ? 247.848 287.462 131.980 1.00 96.62  ? 40   LYS Y CD    1 
ATOM   5310  C  CE    . LYS H  4  40   ? 249.302 287.897 131.949 1.00 104.62 ? 40   LYS Y CE    1 
ATOM   5311  N  NZ    . LYS H  4  40   ? 250.100 287.079 130.992 1.00 109.73 ? 40   LYS Y NZ    1 
ATOM   5312  N  N     . VAL H  4  41   ? 242.808 287.027 134.158 1.00 64.16  ? 41   VAL Y N     1 
ATOM   5313  C  CA    . VAL H  4  41   ? 241.401 286.682 133.969 1.00 73.74  ? 41   VAL Y CA    1 
ATOM   5314  C  C     . VAL H  4  41   ? 240.514 287.598 134.804 1.00 78.95  ? 41   VAL Y C     1 
ATOM   5315  O  O     . VAL H  4  41   ? 239.440 288.024 134.361 1.00 82.81  ? 41   VAL Y O     1 
ATOM   5316  C  CB    . VAL H  4  41   ? 241.165 285.199 134.304 1.00 82.07  ? 41   VAL Y CB    1 
ATOM   5317  C  CG1   . VAL H  4  41   ? 239.690 284.856 134.195 1.00 71.14  ? 41   VAL Y CG1   1 
ATOM   5318  C  CG2   . VAL H  4  41   ? 241.989 284.314 133.385 1.00 75.69  ? 41   VAL Y CG2   1 
ATOM   5319  N  N     . LEU H  4  42   ? 240.955 287.925 136.022 1.00 70.94  ? 42   LEU Y N     1 
ATOM   5320  C  CA    . LEU H  4  42   ? 240.205 288.859 136.853 1.00 77.56  ? 42   LEU Y CA    1 
ATOM   5321  C  C     . LEU H  4  42   ? 240.106 290.226 136.193 1.00 79.72  ? 42   LEU Y C     1 
ATOM   5322  O  O     . LEU H  4  42   ? 239.045 290.861 136.218 1.00 81.39  ? 42   LEU Y O     1 
ATOM   5323  C  CB    . LEU H  4  42   ? 240.855 288.978 138.231 1.00 83.40  ? 42   LEU Y CB    1 
ATOM   5324  C  CG    . LEU H  4  42   ? 240.208 289.999 139.167 1.00 81.25  ? 42   LEU Y CG    1 
ATOM   5325  C  CD1   . LEU H  4  42   ? 238.774 289.611 139.475 1.00 68.60  ? 42   LEU Y CD1   1 
ATOM   5326  C  CD2   . LEU H  4  42   ? 241.014 290.142 140.444 1.00 79.35  ? 42   LEU Y CD2   1 
ATOM   5327  N  N     . LYS H  4  43   ? 241.201 290.696 135.590 1.00 77.76  ? 43   LYS Y N     1 
ATOM   5328  C  CA    . LYS H  4  43   ? 241.153 291.970 134.883 1.00 81.14  ? 43   LYS Y CA    1 
ATOM   5329  C  C     . LYS H  4  43   ? 240.341 291.894 133.600 1.00 81.01  ? 43   LYS Y C     1 
ATOM   5330  O  O     . LYS H  4  43   ? 239.925 292.937 133.086 1.00 91.02  ? 43   LYS Y O     1 
ATOM   5331  C  CB    . LYS H  4  43   ? 242.569 292.466 134.586 1.00 81.35  ? 43   LYS Y CB    1 
ATOM   5332  C  CG    . LYS H  4  43   ? 243.384 292.750 135.832 1.00 90.90  ? 43   LYS Y CG    1 
ATOM   5333  C  CD    . LYS H  4  43   ? 242.702 293.812 136.681 1.00 107.29 ? 43   LYS Y CD    1 
ATOM   5334  C  CE    . LYS H  4  43   ? 243.527 294.167 137.902 1.00 104.93 ? 43   LYS Y CE    1 
ATOM   5335  N  NZ    . LYS H  4  43   ? 242.859 295.178 138.761 1.00 95.14  ? 43   LYS Y NZ    1 
ATOM   5336  N  N     . GLN H  4  44   ? 240.104 290.693 133.068 1.00 73.55  ? 44   GLN Y N     1 
ATOM   5337  C  CA    . GLN H  4  44   ? 239.184 290.565 131.945 1.00 69.20  ? 44   GLN Y CA    1 
ATOM   5338  C  C     . GLN H  4  44   ? 237.734 290.644 132.407 1.00 64.87  ? 44   GLN Y C     1 
ATOM   5339  O  O     . GLN H  4  44   ? 236.924 291.359 131.810 1.00 85.96  ? 44   GLN Y O     1 
ATOM   5340  C  CB    . GLN H  4  44   ? 239.431 289.254 131.197 1.00 76.22  ? 44   GLN Y CB    1 
ATOM   5341  C  CG    . GLN H  4  44   ? 240.760 289.185 130.472 1.00 93.26  ? 44   GLN Y CG    1 
ATOM   5342  C  CD    . GLN H  4  44   ? 240.968 287.860 129.767 1.00 120.02 ? 44   GLN Y CD    1 
ATOM   5343  O  OE1   . GLN H  4  44   ? 240.378 286.846 130.137 1.00 122.90 ? 44   GLN Y OE1   1 
ATOM   5344  N  NE2   . GLN H  4  44   ? 241.812 287.864 128.741 1.00 127.23 ? 44   GLN Y NE2   1 
ATOM   5345  N  N     . VAL H  4  45   ? 237.390 289.913 133.469 1.00 78.00  ? 45   VAL Y N     1 
ATOM   5346  C  CA    . VAL H  4  45   ? 236.009 289.899 133.941 1.00 82.34  ? 45   VAL Y CA    1 
ATOM   5347  C  C     . VAL H  4  45   ? 235.660 291.217 134.622 1.00 75.08  ? 45   VAL Y C     1 
ATOM   5348  O  O     . VAL H  4  45   ? 234.677 291.877 134.268 1.00 82.87  ? 45   VAL Y O     1 
ATOM   5349  C  CB    . VAL H  4  45   ? 235.776 288.700 134.877 1.00 82.48  ? 45   VAL Y CB    1 
ATOM   5350  C  CG1   . VAL H  4  45   ? 234.364 288.730 135.427 1.00 82.29  ? 45   VAL Y CG1   1 
ATOM   5351  C  CG2   . VAL H  4  45   ? 236.042 287.398 134.143 1.00 77.49  ? 45   VAL Y CG2   1 
ATOM   5352  N  N     . HIS H  4  46   ? 236.462 291.623 135.609 1.00 82.10  ? 46   HIS Y N     1 
ATOM   5353  C  CA    . HIS H  4  46   ? 236.241 292.859 136.364 1.00 90.37  ? 46   HIS Y CA    1 
ATOM   5354  C  C     . HIS H  4  46   ? 237.514 293.691 136.335 1.00 97.08  ? 46   HIS Y C     1 
ATOM   5355  O  O     . HIS H  4  46   ? 238.398 293.529 137.187 1.00 103.50 ? 46   HIS Y O     1 
ATOM   5356  C  CB    . HIS H  4  46   ? 235.820 292.567 137.802 1.00 76.08  ? 46   HIS Y CB    1 
ATOM   5357  C  CG    . HIS H  4  46   ? 234.523 291.829 137.915 1.00 82.55  ? 46   HIS Y CG    1 
ATOM   5358  N  ND1   . HIS H  4  46   ? 233.312 292.401 137.595 1.00 98.88  ? 46   HIS Y ND1   1 
ATOM   5359  C  CD2   . HIS H  4  46   ? 234.245 290.571 138.330 1.00 77.91  ? 46   HIS Y CD2   1 
ATOM   5360  C  CE1   . HIS H  4  46   ? 232.344 291.524 137.795 1.00 91.38  ? 46   HIS Y CE1   1 
ATOM   5361  N  NE2   . HIS H  4  46   ? 232.884 290.404 138.241 1.00 85.49  ? 46   HIS Y NE2   1 
ATOM   5362  N  N     . PRO H  4  47   ? 237.646 294.594 135.361 1.00 103.02 ? 47   PRO Y N     1 
ATOM   5363  C  CA    . PRO H  4  47   ? 238.873 295.401 135.277 1.00 98.48  ? 47   PRO Y CA    1 
ATOM   5364  C  C     . PRO H  4  47   ? 239.098 296.302 136.481 1.00 96.21  ? 47   PRO Y C     1 
ATOM   5365  O  O     . PRO H  4  47   ? 240.248 296.638 136.784 1.00 97.98  ? 47   PRO Y O     1 
ATOM   5366  C  CB    . PRO H  4  47   ? 238.659 296.224 133.997 1.00 94.76  ? 47   PRO Y CB    1 
ATOM   5367  C  CG    . PRO H  4  47   ? 237.698 295.412 133.189 1.00 87.45  ? 47   PRO Y CG    1 
ATOM   5368  C  CD    . PRO H  4  47   ? 236.770 294.799 134.197 1.00 92.41  ? 47   PRO Y CD    1 
ATOM   5369  N  N     . ASP H  4  48   ? 238.036 296.699 137.176 1.00 99.12  ? 48   ASP Y N     1 
ATOM   5370  C  CA    . ASP H  4  48   ? 238.143 297.652 138.270 1.00 114.77 ? 48   ASP Y CA    1 
ATOM   5371  C  C     . ASP H  4  48   ? 238.372 296.997 139.626 1.00 110.73 ? 48   ASP Y C     1 
ATOM   5372  O  O     . ASP H  4  48   ? 238.628 297.711 140.603 1.00 102.62 ? 48   ASP Y O     1 
ATOM   5373  C  CB    . ASP H  4  48   ? 236.878 298.516 138.340 1.00 127.66 ? 48   ASP Y CB    1 
ATOM   5374  C  CG    . ASP H  4  48   ? 236.750 299.457 137.158 1.00 134.86 ? 48   ASP Y CG    1 
ATOM   5375  O  OD1   . ASP H  4  48   ? 237.760 299.678 136.461 1.00 130.81 ? 48   ASP Y OD1   1 
ATOM   5376  O  OD2   . ASP H  4  48   ? 235.635 299.973 136.930 1.00 134.25 ? 48   ASP Y OD2   1 
ATOM   5377  N  N     . THR H  4  49   ? 238.291 295.674 139.715 1.00 107.87 ? 49   THR Y N     1 
ATOM   5378  C  CA    . THR H  4  49   ? 238.332 294.971 140.992 1.00 87.79  ? 49   THR Y CA    1 
ATOM   5379  C  C     . THR H  4  49   ? 239.679 294.290 141.180 1.00 89.56  ? 49   THR Y C     1 
ATOM   5380  O  O     . THR H  4  49   ? 240.168 293.605 140.273 1.00 93.68  ? 49   THR Y O     1 
ATOM   5381  C  CB    . THR H  4  49   ? 237.205 293.941 141.077 1.00 103.19 ? 49   THR Y CB    1 
ATOM   5382  O  OG1   . THR H  4  49   ? 235.941 294.606 140.968 1.00 104.79 ? 49   THR Y OG1   1 
ATOM   5383  C  CG2   . THR H  4  49   ? 237.265 293.193 142.399 1.00 108.12 ? 49   THR Y CG2   1 
ATOM   5384  N  N     . GLY H  4  50   ? 240.277 294.481 142.357 1.00 74.98  ? 50   GLY Y N     1 
ATOM   5385  C  CA    . GLY H  4  50   ? 241.490 293.793 142.731 1.00 74.14  ? 50   GLY Y CA    1 
ATOM   5386  C  C     . GLY H  4  50   ? 241.204 292.567 143.587 1.00 82.45  ? 50   GLY Y C     1 
ATOM   5387  O  O     . GLY H  4  50   ? 240.069 292.264 143.943 1.00 88.60  ? 50   GLY Y O     1 
ATOM   5388  N  N     . ILE H  4  51   ? 242.278 291.855 143.921 1.00 78.35  ? 51   ILE Y N     1 
ATOM   5389  C  CA    . ILE H  4  51   ? 242.188 290.612 144.674 1.00 69.94  ? 51   ILE Y CA    1 
ATOM   5390  C  C     . ILE H  4  51   ? 243.264 290.596 145.751 1.00 69.50  ? 51   ILE Y C     1 
ATOM   5391  O  O     . ILE H  4  51   ? 244.403 291.011 145.514 1.00 73.22  ? 51   ILE Y O     1 
ATOM   5392  C  CB    . ILE H  4  51   ? 242.309 289.382 143.746 1.00 70.57  ? 51   ILE Y CB    1 
ATOM   5393  C  CG1   . ILE H  4  51   ? 242.127 288.084 144.536 1.00 67.70  ? 51   ILE Y CG1   1 
ATOM   5394  C  CG2   . ILE H  4  51   ? 243.630 289.395 142.994 1.00 49.60  ? 51   ILE Y CG2   1 
ATOM   5395  C  CD1   . ILE H  4  51   ? 241.969 286.861 143.662 1.00 60.28  ? 51   ILE Y CD1   1 
ATOM   5396  N  N     . SER H  4  52   ? 242.890 290.133 146.941 1.00 54.17  ? 52   SER Y N     1 
ATOM   5397  C  CA    . SER H  4  52   ? 243.839 289.999 148.033 1.00 55.66  ? 52   SER Y CA    1 
ATOM   5398  C  C     . SER H  4  52   ? 244.757 288.802 147.798 1.00 54.85  ? 52   SER Y C     1 
ATOM   5399  O  O     . SER H  4  52   ? 244.464 287.902 147.008 1.00 55.64  ? 52   SER Y O     1 
ATOM   5400  C  CB    . SER H  4  52   ? 243.106 289.850 149.365 1.00 81.70  ? 52   SER Y CB    1 
ATOM   5401  O  OG    . SER H  4  52   ? 242.328 288.668 149.391 1.00 80.02  ? 52   SER Y OG    1 
ATOM   5402  N  N     . SER H  4  53   ? 245.893 288.808 148.499 1.00 59.88  ? 53   SER Y N     1 
ATOM   5403  C  CA    . SER H  4  53   ? 246.864 287.729 148.343 1.00 58.85  ? 53   SER Y CA    1 
ATOM   5404  C  C     . SER H  4  53   ? 246.293 286.395 148.806 1.00 66.33  ? 53   SER Y C     1 
ATOM   5405  O  O     . SER H  4  53   ? 246.521 285.359 148.171 1.00 65.43  ? 53   SER Y O     1 
ATOM   5406  C  CB    . SER H  4  53   ? 248.143 288.060 149.110 1.00 37.24  ? 53   SER Y CB    1 
ATOM   5407  O  OG    . SER H  4  53   ? 247.891 288.141 150.501 1.00 50.21  ? 53   SER Y OG    1 
ATOM   5408  N  N     . LYS H  4  54   ? 245.548 286.399 149.917 1.00 53.09  ? 54   LYS Y N     1 
ATOM   5409  C  CA    . LYS H  4  54   ? 244.975 285.157 150.424 1.00 50.40  ? 54   LYS Y CA    1 
ATOM   5410  C  C     . LYS H  4  54   ? 243.979 284.567 149.435 1.00 53.50  ? 54   LYS Y C     1 
ATOM   5411  O  O     . LYS H  4  54   ? 243.998 283.359 149.167 1.00 54.44  ? 54   LYS Y O     1 
ATOM   5412  C  CB    . LYS H  4  54   ? 244.310 285.399 151.777 1.00 57.24  ? 54   LYS Y CB    1 
ATOM   5413  C  CG    . LYS H  4  54   ? 243.765 284.142 152.429 1.00 73.59  ? 54   LYS Y CG    1 
ATOM   5414  C  CD    . LYS H  4  54   ? 244.887 283.204 152.835 1.00 79.01  ? 54   LYS Y CD    1 
ATOM   5415  C  CE    . LYS H  4  54   ? 244.345 281.948 153.496 1.00 77.80  ? 54   LYS Y CE    1 
ATOM   5416  N  NZ    . LYS H  4  54   ? 243.646 282.253 154.774 1.00 67.40  ? 54   LYS Y NZ    1 
ATOM   5417  N  N     . ALA H  4  55   ? 243.102 285.406 148.877 1.00 52.08  ? 55   ALA Y N     1 
ATOM   5418  C  CA    . ALA H  4  55   ? 242.179 284.931 147.853 1.00 40.12  ? 55   ALA Y CA    1 
ATOM   5419  C  C     . ALA H  4  55   ? 242.925 284.418 146.630 1.00 44.65  ? 55   ALA Y C     1 
ATOM   5420  O  O     . ALA H  4  55   ? 242.466 283.475 145.974 1.00 51.90  ? 55   ALA Y O     1 
ATOM   5421  C  CB    . ALA H  4  55   ? 241.210 286.045 147.459 1.00 40.50  ? 55   ALA Y CB    1 
ATOM   5422  N  N     . MET H  4  56   ? 244.072 285.017 146.310 1.00 34.43  ? 56   MET Y N     1 
ATOM   5423  C  CA    . MET H  4  56   ? 244.888 284.501 145.218 1.00 39.11  ? 56   MET Y CA    1 
ATOM   5424  C  C     . MET H  4  56   ? 245.431 283.117 145.546 1.00 41.02  ? 56   MET Y C     1 
ATOM   5425  O  O     . MET H  4  56   ? 245.525 282.257 144.665 1.00 50.46  ? 56   MET Y O     1 
ATOM   5426  C  CB    . MET H  4  56   ? 246.030 285.468 144.909 1.00 36.16  ? 56   MET Y CB    1 
ATOM   5427  C  CG    . MET H  4  56   ? 246.892 285.034 143.741 1.00 34.13  ? 56   MET Y CG    1 
ATOM   5428  S  SD    . MET H  4  56   ? 245.961 285.011 142.200 1.00 70.99  ? 56   MET Y SD    1 
ATOM   5429  C  CE    . MET H  4  56   ? 245.824 286.762 141.862 1.00 43.17  ? 56   MET Y CE    1 
ATOM   5430  N  N     . SER H  4  57   ? 245.794 282.885 146.810 1.00 41.75  ? 57   SER Y N     1 
ATOM   5431  C  CA    . SER H  4  57   ? 246.227 281.552 147.214 1.00 49.10  ? 57   SER Y CA    1 
ATOM   5432  C  C     . SER H  4  57   ? 245.087 280.548 147.109 1.00 49.31  ? 57   SER Y C     1 
ATOM   5433  O  O     . SER H  4  57   ? 245.291 279.409 146.670 1.00 36.26  ? 57   SER Y O     1 
ATOM   5434  C  CB    . SER H  4  57   ? 246.779 281.590 148.638 1.00 37.09  ? 57   SER Y CB    1 
ATOM   5435  O  OG    . SER H  4  57   ? 247.169 280.298 149.067 1.00 55.26  ? 57   SER Y OG    1 
ATOM   5436  N  N     . ILE H  4  58   ? 243.876 280.954 147.500 1.00 44.45  ? 58   ILE Y N     1 
ATOM   5437  C  CA    . ILE H  4  58   ? 242.720 280.070 147.372 1.00 34.87  ? 58   ILE Y CA    1 
ATOM   5438  C  C     . ILE H  4  58   ? 242.467 279.732 145.908 1.00 44.58  ? 58   ILE Y C     1 
ATOM   5439  O  O     . ILE H  4  58   ? 242.182 278.580 145.560 1.00 53.44  ? 58   ILE Y O     1 
ATOM   5440  C  CB    . ILE H  4  58   ? 241.483 280.707 148.029 1.00 38.15  ? 58   ILE Y CB    1 
ATOM   5441  C  CG1   . ILE H  4  58   ? 241.690 280.836 149.537 1.00 38.85  ? 58   ILE Y CG1   1 
ATOM   5442  C  CG2   . ILE H  4  58   ? 240.240 279.886 147.737 1.00 45.26  ? 58   ILE Y CG2   1 
ATOM   5443  C  CD1   . ILE H  4  58   ? 240.621 281.643 150.228 1.00 52.19  ? 58   ILE Y CD1   1 
ATOM   5444  N  N     . MET H  4  59   ? 242.575 280.730 145.027 1.00 40.94  ? 59   MET Y N     1 
ATOM   5445  C  CA    . MET H  4  59   ? 242.409 280.472 143.600 1.00 39.11  ? 59   MET Y CA    1 
ATOM   5446  C  C     . MET H  4  59   ? 243.491 279.535 143.078 1.00 38.41  ? 59   MET Y C     1 
ATOM   5447  O  O     . MET H  4  59   ? 243.220 278.668 142.237 1.00 34.82  ? 59   MET Y O     1 
ATOM   5448  C  CB    . MET H  4  59   ? 242.421 281.787 142.826 1.00 45.60  ? 59   MET Y CB    1 
ATOM   5449  C  CG    . MET H  4  59   ? 241.225 282.676 143.103 1.00 44.40  ? 59   MET Y CG    1 
ATOM   5450  S  SD    . MET H  4  59   ? 239.688 281.854 142.669 1.00 49.69  ? 59   MET Y SD    1 
ATOM   5451  C  CE    . MET H  4  59   ? 239.914 281.682 140.903 1.00 37.83  ? 59   MET Y CE    1 
ATOM   5452  N  N     . ASN H  4  60   ? 244.722 279.694 143.565 1.00 39.80  ? 60   ASN Y N     1 
ATOM   5453  C  CA    . ASN H  4  60   ? 245.808 278.812 143.150 1.00 34.83  ? 60   ASN Y CA    1 
ATOM   5454  C  C     . ASN H  4  60   ? 245.519 277.368 143.542 1.00 47.28  ? 60   ASN Y C     1 
ATOM   5455  O  O     . ASN H  4  60   ? 245.600 276.455 142.709 1.00 50.46  ? 60   ASN Y O     1 
ATOM   5456  C  CB    . ASN H  4  60   ? 247.124 279.286 143.762 1.00 23.23  ? 60   ASN Y CB    1 
ATOM   5457  C  CG    . ASN H  4  60   ? 248.323 278.558 143.201 1.00 36.82  ? 60   ASN Y CG    1 
ATOM   5458  O  OD1   . ASN H  4  60   ? 248.316 278.128 142.047 1.00 39.54  ? 60   ASN Y OD1   1 
ATOM   5459  N  ND2   . ASN H  4  60   ? 249.362 278.412 144.011 1.00 50.75  ? 60   ASN Y ND2   1 
ATOM   5460  N  N     . SER H  4  61   ? 245.175 277.141 144.812 1.00 33.99  ? 61   SER Y N     1 
ATOM   5461  C  CA    . SER H  4  61   ? 244.852 275.789 145.257 1.00 26.55  ? 61   SER Y CA    1 
ATOM   5462  C  C     . SER H  4  61   ? 243.629 275.240 144.528 1.00 33.52  ? 61   SER Y C     1 
ATOM   5463  O  O     . SER H  4  61   ? 243.517 274.024 144.338 1.00 40.07  ? 61   SER Y O     1 
ATOM   5464  C  CB    . SER H  4  61   ? 244.626 275.771 146.766 1.00 38.28  ? 61   SER Y CB    1 
ATOM   5465  O  OG    . SER H  4  61   ? 245.817 276.101 147.460 1.00 64.93  ? 61   SER Y OG    1 
ATOM   5466  N  N     . PHE H  4  62   ? 242.712 276.115 144.115 1.00 38.88  ? 62   PHE Y N     1 
ATOM   5467  C  CA    . PHE H  4  62   ? 241.562 275.671 143.337 1.00 30.01  ? 62   PHE Y CA    1 
ATOM   5468  C  C     . PHE H  4  62   ? 241.990 275.172 141.962 1.00 29.36  ? 62   PHE Y C     1 
ATOM   5469  O  O     . PHE H  4  62   ? 241.578 274.089 141.527 1.00 36.06  ? 62   PHE Y O     1 
ATOM   5470  C  CB    . PHE H  4  62   ? 240.549 276.808 143.208 1.00 28.77  ? 62   PHE Y CB    1 
ATOM   5471  C  CG    . PHE H  4  62   ? 239.374 276.478 142.336 1.00 32.61  ? 62   PHE Y CG    1 
ATOM   5472  C  CD1   . PHE H  4  62   ? 238.320 275.727 142.829 1.00 34.61  ? 62   PHE Y CD1   1 
ATOM   5473  C  CD2   . PHE H  4  62   ? 239.319 276.923 141.028 1.00 29.48  ? 62   PHE Y CD2   1 
ATOM   5474  C  CE1   . PHE H  4  62   ? 237.236 275.425 142.028 1.00 33.91  ? 62   PHE Y CE1   1 
ATOM   5475  C  CE2   . PHE H  4  62   ? 238.239 276.625 140.224 1.00 24.89  ? 62   PHE Y CE2   1 
ATOM   5476  C  CZ    . PHE H  4  62   ? 237.196 275.874 140.724 1.00 32.96  ? 62   PHE Y CZ    1 
ATOM   5477  N  N     . VAL H  4  63   ? 242.820 275.949 141.265 1.00 22.25  ? 63   VAL Y N     1 
ATOM   5478  C  CA    . VAL H  4  63   ? 243.269 275.552 139.931 1.00 29.57  ? 63   VAL Y CA    1 
ATOM   5479  C  C     . VAL H  4  63   ? 244.077 274.263 140.002 1.00 32.18  ? 63   VAL Y C     1 
ATOM   5480  O  O     . VAL H  4  63   ? 243.913 273.365 139.168 1.00 39.28  ? 63   VAL Y O     1 
ATOM   5481  C  CB    . VAL H  4  63   ? 244.068 276.691 139.275 1.00 20.26  ? 63   VAL Y CB    1 
ATOM   5482  C  CG1   . VAL H  4  63   ? 244.650 276.235 137.951 1.00 15.32  ? 63   VAL Y CG1   1 
ATOM   5483  C  CG2   . VAL H  4  63   ? 243.181 277.907 139.072 1.00 15.81  ? 63   VAL Y CG2   1 
ATOM   5484  N  N     . ASN H  4  64   ? 244.958 274.146 141.001 1.00 31.25  ? 64   ASN Y N     1 
ATOM   5485  C  CA    . ASN H  4  64   ? 245.710 272.904 141.163 1.00 33.99  ? 64   ASN Y CA    1 
ATOM   5486  C  C     . ASN H  4  64   ? 244.783 271.732 141.455 1.00 32.05  ? 64   ASN Y C     1 
ATOM   5487  O  O     . ASN H  4  64   ? 244.963 270.635 140.912 1.00 39.17  ? 64   ASN Y O     1 
ATOM   5488  C  CB    . ASN H  4  64   ? 246.750 273.059 142.271 1.00 18.09  ? 64   ASN Y CB    1 
ATOM   5489  C  CG    . ASN H  4  64   ? 247.889 273.975 141.878 1.00 41.47  ? 64   ASN Y CG    1 
ATOM   5490  O  OD1   . ASN H  4  64   ? 248.780 273.589 141.123 1.00 49.12  ? 64   ASN Y OD1   1 
ATOM   5491  N  ND2   . ASN H  4  64   ? 247.865 275.201 142.389 1.00 45.92  ? 64   ASN Y ND2   1 
ATOM   5492  N  N     . ASP H  4  65   ? 243.786 271.945 142.319 1.00 30.96  ? 65   ASP Y N     1 
ATOM   5493  C  CA    . ASP H  4  65   ? 242.816 270.898 142.628 1.00 38.07  ? 65   ASP Y CA    1 
ATOM   5494  C  C     . ASP H  4  65   ? 242.121 270.401 141.365 1.00 50.27  ? 65   ASP Y C     1 
ATOM   5495  O  O     . ASP H  4  65   ? 242.225 269.222 141.005 1.00 56.52  ? 65   ASP Y O     1 
ATOM   5496  C  CB    . ASP H  4  65   ? 241.796 271.417 143.643 1.00 41.74  ? 65   ASP Y CB    1 
ATOM   5497  C  CG    . ASP H  4  65   ? 240.856 270.332 144.135 1.00 62.21  ? 65   ASP Y CG    1 
ATOM   5498  O  OD1   . ASP H  4  65   ? 241.054 269.153 143.777 1.00 81.10  ? 65   ASP Y OD1   1 
ATOM   5499  O  OD2   . ASP H  4  65   ? 239.913 270.662 144.885 1.00 53.06  ? 65   ASP Y OD2   1 
ATOM   5500  N  N     . VAL H  4  66   ? 241.386 271.291 140.691 1.00 33.22  ? 66   VAL Y N     1 
ATOM   5501  C  CA    . VAL H  4  66   ? 240.636 270.901 139.499 1.00 31.80  ? 66   VAL Y CA    1 
ATOM   5502  C  C     . VAL H  4  66   ? 241.560 270.275 138.461 1.00 33.18  ? 66   VAL Y C     1 
ATOM   5503  O  O     . VAL H  4  66   ? 241.195 269.300 137.788 1.00 36.03  ? 66   VAL Y O     1 
ATOM   5504  C  CB    . VAL H  4  66   ? 239.880 272.113 138.930 1.00 38.66  ? 66   VAL Y CB    1 
ATOM   5505  C  CG1   . VAL H  4  66   ? 239.178 271.743 137.635 1.00 29.52  ? 66   VAL Y CG1   1 
ATOM   5506  C  CG2   . VAL H  4  66   ? 238.884 272.638 139.945 1.00 29.24  ? 66   VAL Y CG2   1 
ATOM   5507  N  N     . PHE H  4  67   ? 242.773 270.818 138.320 1.00 27.00  ? 67   PHE Y N     1 
ATOM   5508  C  CA    . PHE H  4  67   ? 243.741 270.242 137.392 1.00 31.38  ? 67   PHE Y CA    1 
ATOM   5509  C  C     . PHE H  4  67   ? 244.035 268.788 137.735 1.00 44.10  ? 67   PHE Y C     1 
ATOM   5510  O  O     . PHE H  4  67   ? 243.995 267.911 136.863 1.00 49.90  ? 67   PHE Y O     1 
ATOM   5511  C  CB    . PHE H  4  67   ? 245.026 271.068 137.400 1.00 42.17  ? 67   PHE Y CB    1 
ATOM   5512  C  CG    . PHE H  4  67   ? 246.124 270.485 136.564 1.00 53.71  ? 67   PHE Y CG    1 
ATOM   5513  C  CD1   . PHE H  4  67   ? 246.141 270.670 135.195 1.00 47.46  ? 67   PHE Y CD1   1 
ATOM   5514  C  CD2   . PHE H  4  67   ? 247.139 269.749 137.148 1.00 62.54  ? 67   PHE Y CD2   1 
ATOM   5515  C  CE1   . PHE H  4  67   ? 247.153 270.135 134.427 1.00 53.88  ? 67   PHE Y CE1   1 
ATOM   5516  C  CE2   . PHE H  4  67   ? 248.151 269.211 136.383 1.00 52.10  ? 67   PHE Y CE2   1 
ATOM   5517  C  CZ    . PHE H  4  67   ? 248.156 269.402 135.020 1.00 53.24  ? 67   PHE Y CZ    1 
ATOM   5518  N  N     . GLU H  4  68   ? 244.330 268.509 139.007 1.00 36.91  ? 68   GLU Y N     1 
ATOM   5519  C  CA    . GLU H  4  68   ? 244.618 267.134 139.405 1.00 38.81  ? 68   GLU Y CA    1 
ATOM   5520  C  C     . GLU H  4  68   ? 243.402 266.233 139.236 1.00 29.59  ? 68   GLU Y C     1 
ATOM   5521  O  O     . GLU H  4  68   ? 243.551 265.040 138.946 1.00 30.65  ? 68   GLU Y O     1 
ATOM   5522  C  CB    . GLU H  4  68   ? 245.113 267.091 140.850 1.00 58.68  ? 68   GLU Y CB    1 
ATOM   5523  C  CG    . GLU H  4  68   ? 246.465 267.748 141.059 1.00 85.88  ? 68   GLU Y CG    1 
ATOM   5524  C  CD    . GLU H  4  68   ? 246.903 267.724 142.509 1.00 106.93 ? 68   GLU Y CD    1 
ATOM   5525  O  OE1   . GLU H  4  68   ? 246.083 267.348 143.374 1.00 117.04 ? 68   GLU Y OE1   1 
ATOM   5526  O  OE2   . GLU H  4  68   ? 248.067 268.081 142.788 1.00 102.82 ? 68   GLU Y OE2   1 
ATOM   5527  N  N     . ARG H  4  69   ? 242.196 266.779 139.409 1.00 21.65  ? 69   ARG Y N     1 
ATOM   5528  C  CA    . ARG H  4  69   ? 240.994 265.978 139.199 1.00 26.60  ? 69   ARG Y CA    1 
ATOM   5529  C  C     . ARG H  4  69   ? 240.852 265.570 137.738 1.00 35.96  ? 69   ARG Y C     1 
ATOM   5530  O  O     . ARG H  4  69   ? 240.713 264.381 137.427 1.00 37.85  ? 69   ARG Y O     1 
ATOM   5531  C  CB    . ARG H  4  69   ? 239.756 266.747 139.660 1.00 24.17  ? 69   ARG Y CB    1 
ATOM   5532  C  CG    . ARG H  4  69   ? 239.668 266.970 141.156 1.00 34.91  ? 69   ARG Y CG    1 
ATOM   5533  C  CD    . ARG H  4  69   ? 238.371 267.679 141.515 1.00 40.54  ? 69   ARG Y CD    1 
ATOM   5534  N  NE    . ARG H  4  69   ? 238.268 267.947 142.945 1.00 42.89  ? 69   ARG Y NE    1 
ATOM   5535  C  CZ    . ARG H  4  69   ? 237.281 268.639 143.504 1.00 52.43  ? 69   ARG Y CZ    1 
ATOM   5536  N  NH1   . ARG H  4  69   ? 236.309 269.134 142.752 1.00 50.52  ? 69   ARG Y NH1   1 
ATOM   5537  N  NH2   . ARG H  4  69   ? 237.265 268.837 144.814 1.00 49.27  ? 69   ARG Y NH2   1 
ATOM   5538  N  N     . ILE H  4  70   ? 240.888 266.546 136.826 1.00 21.59  ? 70   ILE Y N     1 
ATOM   5539  C  CA    . ILE H  4  70   ? 240.694 266.237 135.410 1.00 29.08  ? 70   ILE Y CA    1 
ATOM   5540  C  C     . ILE H  4  70   ? 241.817 265.342 134.900 1.00 25.84  ? 70   ILE Y C     1 
ATOM   5541  O  O     . ILE H  4  70   ? 241.581 264.409 134.123 1.00 27.09  ? 70   ILE Y O     1 
ATOM   5542  C  CB    . ILE H  4  70   ? 240.582 267.535 134.589 1.00 32.21  ? 70   ILE Y CB    1 
ATOM   5543  C  CG1   . ILE H  4  70   ? 239.332 268.314 134.996 1.00 29.56  ? 70   ILE Y CG1   1 
ATOM   5544  C  CG2   . ILE H  4  70   ? 240.529 267.221 133.106 1.00 25.25  ? 70   ILE Y CG2   1 
ATOM   5545  C  CD1   . ILE H  4  70   ? 239.246 269.694 134.390 1.00 19.89  ? 70   ILE Y CD1   1 
ATOM   5546  N  N     . ALA H  4  71   ? 243.049 265.601 135.335 1.00 23.96  ? 71   ALA Y N     1 
ATOM   5547  C  CA    . ALA H  4  71   ? 244.164 264.758 134.914 1.00 25.52  ? 71   ALA Y CA    1 
ATOM   5548  C  C     . ALA H  4  71   ? 244.016 263.338 135.448 1.00 37.65  ? 71   ALA Y C     1 
ATOM   5549  O  O     . ALA H  4  71   ? 244.315 262.367 134.742 1.00 32.37  ? 71   ALA Y O     1 
ATOM   5550  C  CB    . ALA H  4  71   ? 245.485 265.370 135.367 1.00 23.77  ? 71   ALA Y CB    1 
ATOM   5551  N  N     . GLY H  4  72   ? 243.551 263.197 136.691 1.00 39.93  ? 72   GLY Y N     1 
ATOM   5552  C  CA    . GLY H  4  72   ? 243.354 261.866 137.246 1.00 34.13  ? 72   GLY Y CA    1 
ATOM   5553  C  C     . GLY H  4  72   ? 242.280 261.087 136.513 1.00 35.39  ? 72   GLY Y C     1 
ATOM   5554  O  O     . GLY H  4  72   ? 242.472 259.922 136.153 1.00 32.09  ? 72   GLY Y O     1 
ATOM   5555  N  N     . GLU H  4  73   ? 241.128 261.724 136.278 1.00 26.75  ? 73   GLU Y N     1 
ATOM   5556  C  CA    . GLU H  4  73   ? 240.064 261.066 135.526 1.00 25.10  ? 73   GLU Y CA    1 
ATOM   5557  C  C     . GLU H  4  73   ? 240.524 260.711 134.118 1.00 31.68  ? 73   GLU Y C     1 
ATOM   5558  O  O     . GLU H  4  73   ? 240.138 259.671 133.575 1.00 49.50  ? 73   GLU Y O     1 
ATOM   5559  C  CB    . GLU H  4  73   ? 238.824 261.957 135.477 1.00 56.79  ? 73   GLU Y CB    1 
ATOM   5560  C  CG    . GLU H  4  73   ? 238.172 262.190 136.827 1.00 80.69  ? 73   GLU Y CG    1 
ATOM   5561  C  CD    . GLU H  4  73   ? 237.735 260.900 137.493 1.00 93.04  ? 73   GLU Y CD    1 
ATOM   5562  O  OE1   . GLU H  4  73   ? 237.250 259.996 136.783 1.00 73.74  ? 73   GLU Y OE1   1 
ATOM   5563  O  OE2   . GLU H  4  73   ? 237.875 260.791 138.730 1.00 100.70 ? 73   GLU Y OE2   1 
ATOM   5564  N  N     . ALA H  4  74   ? 241.352 261.566 133.513 1.00 18.98  ? 74   ALA Y N     1 
ATOM   5565  C  CA    . ALA H  4  74   ? 241.899 261.249 132.198 1.00 27.07  ? 74   ALA Y CA    1 
ATOM   5566  C  C     . ALA H  4  74   ? 242.817 260.036 132.261 1.00 31.83  ? 74   ALA Y C     1 
ATOM   5567  O  O     . ALA H  4  74   ? 242.829 259.212 131.340 1.00 37.55  ? 74   ALA Y O     1 
ATOM   5568  C  CB    . ALA H  4  74   ? 242.643 262.454 131.634 1.00 26.33  ? 74   ALA Y CB    1 
ATOM   5569  N  N     . SER H  4  75   ? 243.594 259.911 133.340 1.00 33.02  ? 75   SER Y N     1 
ATOM   5570  C  CA    . SER H  4  75   ? 244.443 258.736 133.499 1.00 43.08  ? 75   SER Y CA    1 
ATOM   5571  C  C     . SER H  4  75   ? 243.610 257.471 133.657 1.00 38.85  ? 75   SER Y C     1 
ATOM   5572  O  O     . SER H  4  75   ? 243.938 256.428 133.080 1.00 26.41  ? 75   SER Y O     1 
ATOM   5573  C  CB    . SER H  4  75   ? 245.374 258.919 134.696 1.00 24.03  ? 75   SER Y CB    1 
ATOM   5574  O  OG    . SER H  4  75   ? 246.173 257.766 134.896 1.00 26.18  ? 75   SER Y OG    1 
ATOM   5575  N  N     . ARG H  4  76   ? 242.526 257.545 134.433 1.00 47.09  ? 76   ARG Y N     1 
ATOM   5576  C  CA    . ARG H  4  76   ? 241.664 256.381 134.608 1.00 44.24  ? 76   ARG Y CA    1 
ATOM   5577  C  C     . ARG H  4  76   ? 241.002 255.985 133.295 1.00 46.76  ? 76   ARG Y C     1 
ATOM   5578  O  O     . ARG H  4  76   ? 240.968 254.802 132.936 1.00 43.21  ? 76   ARG Y O     1 
ATOM   5579  C  CB    . ARG H  4  76   ? 240.612 256.664 135.681 1.00 70.94  ? 76   ARG Y CB    1 
ATOM   5580  C  CG    . ARG H  4  76   ? 241.185 256.840 137.077 1.00 81.49  ? 76   ARG Y CG    1 
ATOM   5581  C  CD    . ARG H  4  76   ? 240.083 257.072 138.097 1.00 77.92  ? 76   ARG Y CD    1 
ATOM   5582  N  NE    . ARG H  4  76   ? 240.617 257.251 139.444 1.00 92.47  ? 76   ARG Y NE    1 
ATOM   5583  C  CZ    . ARG H  4  76   ? 240.912 256.252 140.269 1.00 98.12  ? 76   ARG Y CZ    1 
ATOM   5584  N  NH1   . ARG H  4  76   ? 240.726 254.996 139.886 1.00 87.72  ? 76   ARG Y NH1   1 
ATOM   5585  N  NH2   . ARG H  4  76   ? 241.394 256.510 141.477 1.00 108.35 ? 76   ARG Y NH2   1 
ATOM   5586  N  N     . LEU H  4  77   ? 240.471 256.965 132.559 1.00 42.49  ? 77   LEU Y N     1 
ATOM   5587  C  CA    . LEU H  4  77   ? 239.842 256.666 131.274 1.00 37.56  ? 77   LEU Y CA    1 
ATOM   5588  C  C     . LEU H  4  77   ? 240.850 256.104 130.281 1.00 48.12  ? 77   LEU Y C     1 
ATOM   5589  O  O     . LEU H  4  77   ? 240.511 255.238 129.465 1.00 51.00  ? 77   LEU Y O     1 
ATOM   5590  C  CB    . LEU H  4  77   ? 239.179 257.919 130.706 1.00 23.19  ? 77   LEU Y CB    1 
ATOM   5591  C  CG    . LEU H  4  77   ? 237.960 258.426 131.471 1.00 30.68  ? 77   LEU Y CG    1 
ATOM   5592  C  CD1   . LEU H  4  77   ? 237.502 259.755 130.910 1.00 28.04  ? 77   LEU Y CD1   1 
ATOM   5593  C  CD2   . LEU H  4  77   ? 236.850 257.403 131.381 1.00 20.97  ? 77   LEU Y CD2   1 
ATOM   5594  N  N     . ALA H  4  78   ? 242.093 256.586 130.328 1.00 40.18  ? 78   ALA Y N     1 
ATOM   5595  C  CA    . ALA H  4  78   ? 243.111 256.052 129.433 1.00 43.38  ? 78   ALA Y CA    1 
ATOM   5596  C  C     . ALA H  4  78   ? 243.517 254.638 129.827 1.00 51.74  ? 78   ALA Y C     1 
ATOM   5597  O  O     . ALA H  4  78   ? 243.874 253.835 128.957 1.00 52.71  ? 78   ALA Y O     1 
ATOM   5598  C  CB    . ALA H  4  78   ? 244.332 256.970 129.416 1.00 43.43  ? 78   ALA Y CB    1 
ATOM   5599  N  N     . HIS H  4  79   ? 243.470 254.314 131.118 1.00 51.92  ? 79   HIS Y N     1 
ATOM   5600  C  CA    . HIS H  4  79   ? 243.872 252.981 131.556 1.00 44.47  ? 79   HIS Y CA    1 
ATOM   5601  C  C     . HIS H  4  79   ? 242.777 251.946 131.320 1.00 45.55  ? 79   HIS Y C     1 
ATOM   5602  O  O     . HIS H  4  79   ? 243.073 250.808 130.941 1.00 42.51  ? 79   HIS Y O     1 
ATOM   5603  C  CB    . HIS H  4  79   ? 244.265 253.005 133.032 1.00 52.88  ? 79   HIS Y CB    1 
ATOM   5604  C  CG    . HIS H  4  79   ? 244.718 251.678 133.553 1.00 79.96  ? 79   HIS Y CG    1 
ATOM   5605  N  ND1   . HIS H  4  79   ? 245.823 251.021 133.056 1.00 87.32  ? 79   HIS Y ND1   1 
ATOM   5606  C  CD2   . HIS H  4  79   ? 244.213 250.879 134.523 1.00 85.86  ? 79   HIS Y CD2   1 
ATOM   5607  C  CE1   . HIS H  4  79   ? 245.982 249.879 133.701 1.00 83.46  ? 79   HIS Y CE1   1 
ATOM   5608  N  NE2   . HIS H  4  79   ? 245.018 249.769 134.595 1.00 81.54  ? 79   HIS Y NE2   1 
ATOM   5609  N  N     . TYR H  4  80   ? 241.513 252.315 131.543 1.00 56.67  ? 80   TYR Y N     1 
ATOM   5610  C  CA    . TYR H  4  80   ? 240.432 251.343 131.395 1.00 55.07  ? 80   TYR Y CA    1 
ATOM   5611  C  C     . TYR H  4  80   ? 240.239 250.942 129.936 1.00 56.43  ? 80   TYR Y C     1 
ATOM   5612  O  O     . TYR H  4  80   ? 239.953 249.776 129.641 1.00 59.51  ? 80   TYR Y O     1 
ATOM   5613  C  CB    . TYR H  4  80   ? 239.129 251.900 131.966 1.00 54.13  ? 80   TYR Y CB    1 
ATOM   5614  C  CG    . TYR H  4  80   ? 239.166 252.161 133.455 1.00 71.71  ? 80   TYR Y CG    1 
ATOM   5615  C  CD1   . TYR H  4  80   ? 239.856 251.315 134.312 1.00 74.94  ? 80   TYR Y CD1   1 
ATOM   5616  C  CD2   . TYR H  4  80   ? 238.491 253.243 134.006 1.00 69.74  ? 80   TYR Y CD2   1 
ATOM   5617  C  CE1   . TYR H  4  80   ? 239.890 251.550 135.674 1.00 70.49  ? 80   TYR Y CE1   1 
ATOM   5618  C  CE2   . TYR H  4  80   ? 238.516 253.484 135.366 1.00 71.20  ? 80   TYR Y CE2   1 
ATOM   5619  C  CZ    . TYR H  4  80   ? 239.215 252.635 136.196 1.00 74.30  ? 80   TYR Y CZ    1 
ATOM   5620  O  OH    . TYR H  4  80   ? 239.244 252.870 137.550 1.00 80.52  ? 80   TYR Y OH    1 
ATOM   5621  N  N     . ASN H  4  81   ? 240.394 251.888 129.015 1.00 56.32  ? 81   ASN Y N     1 
ATOM   5622  C  CA    . ASN H  4  81   ? 240.226 251.616 127.593 1.00 53.30  ? 81   ASN Y CA    1 
ATOM   5623  C  C     . ASN H  4  81   ? 241.494 251.086 126.936 1.00 60.92  ? 81   ASN Y C     1 
ATOM   5624  O  O     . ASN H  4  81   ? 241.493 250.852 125.724 1.00 60.03  ? 81   ASN Y O     1 
ATOM   5625  C  CB    . ASN H  4  81   ? 239.756 252.879 126.868 1.00 47.68  ? 81   ASN Y CB    1 
ATOM   5626  C  CG    . ASN H  4  81   ? 238.330 253.251 127.216 1.00 58.16  ? 81   ASN Y CG    1 
ATOM   5627  O  OD1   . ASN H  4  81   ? 237.381 252.641 126.727 1.00 71.59  ? 81   ASN Y OD1   1 
ATOM   5628  N  ND2   . ASN H  4  81   ? 238.172 254.256 128.069 1.00 49.89  ? 81   ASN Y ND2   1 
ATOM   5629  N  N     . LYS H  4  82   ? 242.565 250.899 127.708 1.00 76.50  ? 82   LYS Y N     1 
ATOM   5630  C  CA    . LYS H  4  82   ? 243.833 250.364 127.213 1.00 75.50  ? 82   LYS Y CA    1 
ATOM   5631  C  C     . LYS H  4  82   ? 244.402 251.239 126.092 1.00 72.13  ? 82   LYS Y C     1 
ATOM   5632  O  O     . LYS H  4  82   ? 244.532 250.825 124.938 1.00 68.76  ? 82   LYS Y O     1 
ATOM   5633  C  CB    . LYS H  4  82   ? 243.671 248.910 126.756 1.00 51.87  ? 82   LYS Y CB    1 
ATOM   5634  C  CG    . LYS H  4  82   ? 243.380 247.939 127.889 1.00 62.79  ? 82   LYS Y CG    1 
ATOM   5635  C  CD    . LYS H  4  82   ? 242.886 246.598 127.366 1.00 81.56  ? 82   LYS Y CD    1 
ATOM   5636  C  CE    . LYS H  4  82   ? 243.940 245.918 126.507 1.00 95.83  ? 82   LYS Y CE    1 
ATOM   5637  N  NZ    . LYS H  4  82   ? 243.468 244.610 125.979 1.00 99.65  ? 82   LYS Y NZ    1 
ATOM   5638  N  N     . ARG H  4  83   ? 244.742 252.473 126.462 1.00 62.93  ? 83   ARG Y N     1 
ATOM   5639  C  CA    . ARG H  4  83   ? 245.446 253.394 125.583 1.00 62.18  ? 83   ARG Y CA    1 
ATOM   5640  C  C     . ARG H  4  83   ? 246.509 254.124 126.385 1.00 70.27  ? 83   ARG Y C     1 
ATOM   5641  O  O     . ARG H  4  83   ? 246.281 254.489 127.542 1.00 75.61  ? 83   ARG Y O     1 
ATOM   5642  C  CB    . ARG H  4  83   ? 244.501 254.410 124.926 1.00 79.71  ? 83   ARG Y CB    1 
ATOM   5643  C  CG    . ARG H  4  83   ? 243.556 253.831 123.889 1.00 82.36  ? 83   ARG Y CG    1 
ATOM   5644  C  CD    . ARG H  4  83   ? 242.712 254.935 123.270 1.00 100.89 ? 83   ARG Y CD    1 
ATOM   5645  N  NE    . ARG H  4  83   ? 241.822 254.438 122.225 1.00 121.68 ? 83   ARG Y NE    1 
ATOM   5646  C  CZ    . ARG H  4  83   ? 240.614 253.931 122.448 1.00 128.90 ? 83   ARG Y CZ    1 
ATOM   5647  N  NH1   . ARG H  4  83   ? 240.142 253.856 123.685 1.00 131.53 ? 83   ARG Y NH1   1 
ATOM   5648  N  NH2   . ARG H  4  83   ? 239.877 253.503 121.433 1.00 119.58 ? 83   ARG Y NH2   1 
ATOM   5649  N  N     . SER H  4  84   ? 247.667 254.334 125.765 1.00 69.50  ? 84   SER Y N     1 
ATOM   5650  C  CA    . SER H  4  84   ? 248.809 254.951 126.425 1.00 73.27  ? 84   SER Y CA    1 
ATOM   5651  C  C     . SER H  4  84   ? 248.912 256.449 126.176 1.00 72.08  ? 84   SER Y C     1 
ATOM   5652  O  O     . SER H  4  84   ? 249.870 257.073 126.642 1.00 66.93  ? 84   SER Y O     1 
ATOM   5653  C  CB    . SER H  4  84   ? 250.103 254.266 125.977 1.00 73.51  ? 84   SER Y CB    1 
ATOM   5654  O  OG    . SER H  4  84   ? 250.308 254.429 124.584 1.00 85.08  ? 84   SER Y OG    1 
ATOM   5655  N  N     . THR H  4  85   ? 247.961 257.045 125.460 1.00 69.03  ? 85   THR Y N     1 
ATOM   5656  C  CA    . THR H  4  85   ? 248.033 258.453 125.088 1.00 54.56  ? 85   THR Y CA    1 
ATOM   5657  C  C     . THR H  4  85   ? 246.784 259.182 125.557 1.00 48.84  ? 85   THR Y C     1 
ATOM   5658  O  O     . THR H  4  85   ? 245.664 258.734 125.290 1.00 71.61  ? 85   THR Y O     1 
ATOM   5659  C  CB    . THR H  4  85   ? 248.196 258.616 123.571 1.00 57.50  ? 85   THR Y CB    1 
ATOM   5660  O  OG1   . THR H  4  85   ? 249.415 257.991 123.149 1.00 74.13  ? 85   THR Y OG1   1 
ATOM   5661  C  CG2   . THR H  4  85   ? 248.229 260.086 123.190 1.00 49.53  ? 85   THR Y CG2   1 
ATOM   5662  N  N     . ILE H  4  86   ? 246.978 260.300 126.249 1.00 43.58  ? 86   ILE Y N     1 
ATOM   5663  C  CA    . ILE H  4  86   ? 245.883 261.177 126.650 1.00 50.52  ? 86   ILE Y CA    1 
ATOM   5664  C  C     . ILE H  4  86   ? 245.669 262.211 125.553 1.00 50.21  ? 86   ILE Y C     1 
ATOM   5665  O  O     . ILE H  4  86   ? 246.563 263.010 125.258 1.00 50.82  ? 86   ILE Y O     1 
ATOM   5666  C  CB    . ILE H  4  86   ? 246.178 261.863 127.991 1.00 35.49  ? 86   ILE Y CB    1 
ATOM   5667  C  CG1   . ILE H  4  86   ? 246.183 260.849 129.132 1.00 37.96  ? 86   ILE Y CG1   1 
ATOM   5668  C  CG2   . ILE H  4  86   ? 245.166 262.962 128.259 1.00 23.99  ? 86   ILE Y CG2   1 
ATOM   5669  C  CD1   . ILE H  4  86   ? 246.659 261.431 130.443 1.00 31.56  ? 86   ILE Y CD1   1 
ATOM   5670  N  N     . THR H  4  87   ? 244.483 262.204 124.957 1.00 39.64  ? 87   THR Y N     1 
ATOM   5671  C  CA    . THR H  4  87   ? 244.116 263.155 123.920 1.00 47.74  ? 87   THR Y CA    1 
ATOM   5672  C  C     . THR H  4  87   ? 242.993 264.055 124.424 1.00 42.28  ? 87   THR Y C     1 
ATOM   5673  O  O     . THR H  4  87   ? 242.562 263.967 125.576 1.00 36.97  ? 87   THR Y O     1 
ATOM   5674  C  CB    . THR H  4  87   ? 243.706 262.430 122.637 1.00 51.20  ? 87   THR Y CB    1 
ATOM   5675  O  OG1   . THR H  4  87   ? 242.598 261.566 122.909 1.00 48.48  ? 87   THR Y OG1   1 
ATOM   5676  C  CG2   . THR H  4  87   ? 244.866 261.605 122.101 1.00 47.00  ? 87   THR Y CG2   1 
ATOM   5677  N  N     . SER H  4  88   ? 242.518 264.933 123.540 1.00 48.11  ? 88   SER Y N     1 
ATOM   5678  C  CA    . SER H  4  88   ? 241.442 265.847 123.904 1.00 51.16  ? 88   SER Y CA    1 
ATOM   5679  C  C     . SER H  4  88   ? 240.138 265.122 124.200 1.00 46.57  ? 88   SER Y C     1 
ATOM   5680  O  O     . SER H  4  88   ? 239.292 265.663 124.919 1.00 46.27  ? 88   SER Y O     1 
ATOM   5681  C  CB    . SER H  4  88   ? 241.223 266.871 122.790 1.00 60.16  ? 88   SER Y CB    1 
ATOM   5682  O  OG    . SER H  4  88   ? 240.788 266.239 121.599 1.00 73.82  ? 88   SER Y OG    1 
ATOM   5683  N  N     . ARG H  4  89   ? 239.955 263.912 123.665 1.00 32.90  ? 89   ARG Y N     1 
ATOM   5684  C  CA    . ARG H  4  89   ? 238.722 263.175 123.912 1.00 33.71  ? 89   ARG Y CA    1 
ATOM   5685  C  C     . ARG H  4  89   ? 238.632 262.717 125.364 1.00 45.55  ? 89   ARG Y C     1 
ATOM   5686  O  O     . ARG H  4  89   ? 237.577 262.845 125.996 1.00 50.01  ? 89   ARG Y O     1 
ATOM   5687  C  CB    . ARG H  4  89   ? 238.631 261.982 122.961 1.00 62.58  ? 89   ARG Y CB    1 
ATOM   5688  C  CG    . ARG H  4  89   ? 237.319 261.224 123.032 1.00 65.62  ? 89   ARG Y CG    1 
ATOM   5689  C  CD    . ARG H  4  89   ? 237.266 260.121 121.985 1.00 68.86  ? 89   ARG Y CD    1 
ATOM   5690  N  NE    . ARG H  4  89   ? 236.010 259.382 122.034 1.00 72.33  ? 89   ARG Y NE    1 
ATOM   5691  C  CZ    . ARG H  4  89   ? 234.891 259.770 121.432 1.00 77.37  ? 89   ARG Y CZ    1 
ATOM   5692  N  NH1   . ARG H  4  89   ? 234.871 260.892 120.728 1.00 78.80  ? 89   ARG Y NH1   1 
ATOM   5693  N  NH2   . ARG H  4  89   ? 233.793 259.035 121.532 1.00 90.37  ? 89   ARG Y NH2   1 
ATOM   5694  N  N     . GLU H  4  90   ? 239.730 262.187 125.908 1.00 39.74  ? 90   GLU Y N     1 
ATOM   5695  C  CA    . GLU H  4  90   ? 239.728 261.756 127.301 1.00 34.61  ? 90   GLU Y CA    1 
ATOM   5696  C  C     . GLU H  4  90   ? 239.546 262.935 128.247 1.00 42.38  ? 90   GLU Y C     1 
ATOM   5697  O  O     . GLU H  4  90   ? 238.834 262.827 129.253 1.00 43.02  ? 90   GLU Y O     1 
ATOM   5698  C  CB    . GLU H  4  90   ? 241.019 261.003 127.623 1.00 33.88  ? 90   GLU Y CB    1 
ATOM   5699  C  CG    . GLU H  4  90   ? 241.163 259.673 126.896 1.00 47.39  ? 90   GLU Y CG    1 
ATOM   5700  C  CD    . GLU H  4  90   ? 241.695 259.826 125.485 1.00 61.56  ? 90   GLU Y CD    1 
ATOM   5701  O  OE1   . GLU H  4  90   ? 241.900 260.976 125.043 1.00 59.81  ? 90   GLU Y OE1   1 
ATOM   5702  O  OE2   . GLU H  4  90   ? 241.906 258.793 124.814 1.00 72.66  ? 90   GLU Y OE2   1 
ATOM   5703  N  N     . ILE H  4  91   ? 240.181 264.070 127.946 1.00 31.06  ? 91   ILE Y N     1 
ATOM   5704  C  CA    . ILE H  4  91   ? 239.983 265.261 128.767 1.00 23.98  ? 91   ILE Y CA    1 
ATOM   5705  C  C     . ILE H  4  91   ? 238.535 265.723 128.674 1.00 31.55  ? 91   ILE Y C     1 
ATOM   5706  O  O     . ILE H  4  91   ? 237.947 266.171 129.664 1.00 33.54  ? 91   ILE Y O     1 
ATOM   5707  C  CB    . ILE H  4  91   ? 240.958 266.376 128.346 1.00 38.73  ? 91   ILE Y CB    1 
ATOM   5708  C  CG1   . ILE H  4  91   ? 242.393 265.863 128.341 1.00 38.94  ? 91   ILE Y CG1   1 
ATOM   5709  C  CG2   . ILE H  4  91   ? 240.880 267.525 129.326 1.00 32.03  ? 91   ILE Y CG2   1 
ATOM   5710  C  CD1   . ILE H  4  91   ? 242.878 265.430 129.695 1.00 28.04  ? 91   ILE Y CD1   1 
ATOM   5711  N  N     . GLN H  4  92   ? 237.937 265.606 127.487 1.00 31.85  ? 92   GLN Y N     1 
ATOM   5712  C  CA    . GLN H  4  92   ? 236.543 265.996 127.310 1.00 32.73  ? 92   GLN Y CA    1 
ATOM   5713  C  C     . GLN H  4  92   ? 235.620 265.134 128.164 1.00 35.34  ? 92   GLN Y C     1 
ATOM   5714  O  O     . GLN H  4  92   ? 234.777 265.651 128.907 1.00 37.47  ? 92   GLN Y O     1 
ATOM   5715  C  CB    . GLN H  4  92   ? 236.163 265.900 125.833 1.00 51.48  ? 92   GLN Y CB    1 
ATOM   5716  C  CG    . GLN H  4  92   ? 234.762 266.387 125.512 1.00 47.15  ? 92   GLN Y CG    1 
ATOM   5717  C  CD    . GLN H  4  92   ? 234.483 266.402 124.023 1.00 51.33  ? 92   GLN Y CD    1 
ATOM   5718  O  OE1   . GLN H  4  92   ? 235.373 266.146 123.211 1.00 64.39  ? 92   GLN Y OE1   1 
ATOM   5719  N  NE2   . GLN H  4  92   ? 233.242 266.696 123.656 1.00 52.02  ? 92   GLN Y NE2   1 
ATOM   5720  N  N     . THR H  4  93   ? 235.770 263.811 128.067 1.00 36.81  ? 93   THR Y N     1 
ATOM   5721  C  CA    . THR H  4  93   ? 234.939 262.914 128.863 1.00 34.87  ? 93   THR Y CA    1 
ATOM   5722  C  C     . THR H  4  93   ? 235.168 263.135 130.354 1.00 35.66  ? 93   THR Y C     1 
ATOM   5723  O  O     . THR H  4  93   ? 234.222 263.074 131.152 1.00 36.69  ? 93   THR Y O     1 
ATOM   5724  C  CB    . THR H  4  93   ? 235.225 261.462 128.480 1.00 24.78  ? 93   THR Y CB    1 
ATOM   5725  O  OG1   . THR H  4  93   ? 234.944 261.275 127.088 1.00 37.80  ? 93   THR Y OG1   1 
ATOM   5726  C  CG2   . THR H  4  93   ? 234.358 260.513 129.288 1.00 20.65  ? 93   THR Y CG2   1 
ATOM   5727  N  N     . ALA H  4  94   ? 236.414 263.412 130.750 1.00 29.61  ? 94   ALA Y N     1 
ATOM   5728  C  CA    . ALA H  4  94   ? 236.699 263.691 132.153 1.00 24.67  ? 94   ALA Y CA    1 
ATOM   5729  C  C     . ALA H  4  94   ? 235.988 264.955 132.620 1.00 32.71  ? 94   ALA Y C     1 
ATOM   5730  O  O     . ALA H  4  94   ? 235.448 264.998 133.734 1.00 28.06  ? 94   ALA Y O     1 
ATOM   5731  C  CB    . ALA H  4  94   ? 238.207 263.810 132.366 1.00 30.82  ? 94   ALA Y CB    1 
ATOM   5732  N  N     . VAL H  4  95   ? 235.978 265.996 131.783 1.00 35.76  ? 95   VAL Y N     1 
ATOM   5733  C  CA    . VAL H  4  95   ? 235.244 267.212 132.118 1.00 32.84  ? 95   VAL Y CA    1 
ATOM   5734  C  C     . VAL H  4  95   ? 233.757 266.915 132.247 1.00 34.20  ? 95   VAL Y C     1 
ATOM   5735  O  O     . VAL H  4  95   ? 233.087 267.407 133.163 1.00 34.28  ? 95   VAL Y O     1 
ATOM   5736  C  CB    . VAL H  4  95   ? 235.516 268.310 131.074 1.00 29.42  ? 95   VAL Y CB    1 
ATOM   5737  C  CG1   . VAL H  4  95   ? 234.605 269.498 131.306 1.00 30.33  ? 95   VAL Y CG1   1 
ATOM   5738  C  CG2   . VAL H  4  95   ? 236.966 268.751 131.144 1.00 33.88  ? 95   VAL Y CG2   1 
ATOM   5739  N  N     . ARG H  4  96   ? 233.217 266.098 131.342 1.00 30.57  ? 96   ARG Y N     1 
ATOM   5740  C  CA    . ARG H  4  96   ? 231.804 265.744 131.425 1.00 36.11  ? 96   ARG Y CA    1 
ATOM   5741  C  C     . ARG H  4  96   ? 231.488 264.904 132.657 1.00 41.24  ? 96   ARG Y C     1 
ATOM   5742  O  O     . ARG H  4  96   ? 230.341 264.912 133.115 1.00 44.52  ? 96   ARG Y O     1 
ATOM   5743  C  CB    . ARG H  4  96   ? 231.370 265.008 130.160 1.00 45.34  ? 96   ARG Y CB    1 
ATOM   5744  C  CG    . ARG H  4  96   ? 231.426 265.866 128.907 1.00 50.47  ? 96   ARG Y CG    1 
ATOM   5745  C  CD    . ARG H  4  96   ? 231.074 265.069 127.667 1.00 62.62  ? 96   ARG Y CD    1 
ATOM   5746  N  NE    . ARG H  4  96   ? 229.702 264.574 127.705 1.00 85.76  ? 96   ARG Y NE    1 
ATOM   5747  C  CZ    . ARG H  4  96   ? 229.175 263.767 126.791 1.00 90.89  ? 96   ARG Y CZ    1 
ATOM   5748  N  NH1   . ARG H  4  96   ? 229.907 263.361 125.762 1.00 90.23  ? 96   ARG Y NH1   1 
ATOM   5749  N  NH2   . ARG H  4  96   ? 227.917 263.363 126.905 1.00 79.90  ? 96   ARG Y NH2   1 
ATOM   5750  N  N     . LEU H  4  97   ? 232.468 264.177 133.196 1.00 25.70  ? 97   LEU Y N     1 
ATOM   5751  C  CA    . LEU H  4  97   ? 232.238 263.429 134.428 1.00 27.72  ? 97   LEU Y CA    1 
ATOM   5752  C  C     . LEU H  4  97   ? 232.302 264.331 135.656 1.00 28.73  ? 97   LEU Y C     1 
ATOM   5753  O  O     . LEU H  4  97   ? 231.428 264.269 136.527 1.00 39.67  ? 97   LEU Y O     1 
ATOM   5754  C  CB    . LEU H  4  97   ? 233.252 262.291 134.555 1.00 31.74  ? 97   LEU Y CB    1 
ATOM   5755  C  CG    . LEU H  4  97   ? 233.142 261.153 133.541 1.00 31.88  ? 97   LEU Y CG    1 
ATOM   5756  C  CD1   . LEU H  4  97   ? 234.290 260.177 133.717 1.00 25.92  ? 97   LEU Y CD1   1 
ATOM   5757  C  CD2   . LEU H  4  97   ? 231.811 260.443 133.697 1.00 26.55  ? 97   LEU Y CD2   1 
ATOM   5758  N  N     . LEU H  4  98   ? 233.330 265.177 135.745 1.00 29.13  ? 98   LEU Y N     1 
ATOM   5759  C  CA    . LEU H  4  98   ? 233.549 265.955 136.961 1.00 44.40  ? 98   LEU Y CA    1 
ATOM   5760  C  C     . LEU H  4  98   ? 232.562 267.110 137.098 1.00 45.12  ? 98   LEU Y C     1 
ATOM   5761  O  O     . LEU H  4  98   ? 231.944 267.282 138.156 1.00 59.99  ? 98   LEU Y O     1 
ATOM   5762  C  CB    . LEU H  4  98   ? 234.984 266.477 136.996 1.00 44.72  ? 98   LEU Y CB    1 
ATOM   5763  C  CG    . LEU H  4  98   ? 236.084 265.438 137.191 1.00 51.03  ? 98   LEU Y CG    1 
ATOM   5764  C  CD1   . LEU H  4  98   ? 237.432 266.077 136.973 1.00 65.48  ? 98   LEU Y CD1   1 
ATOM   5765  C  CD2   . LEU H  4  98   ? 236.004 264.869 138.593 1.00 54.75  ? 98   LEU Y CD2   1 
ATOM   5766  N  N     . LEU H  4  99   ? 232.405 267.910 136.052 1.00 33.00  ? 99   LEU Y N     1 
ATOM   5767  C  CA    . LEU H  4  99   ? 231.622 269.137 136.163 1.00 22.05  ? 99   LEU Y CA    1 
ATOM   5768  C  C     . LEU H  4  99   ? 230.138 268.840 135.981 1.00 33.20  ? 99   LEU Y C     1 
ATOM   5769  O  O     . LEU H  4  99   ? 229.750 268.298 134.943 1.00 43.27  ? 99   LEU Y O     1 
ATOM   5770  C  CB    . LEU H  4  99   ? 232.082 270.157 135.131 1.00 20.65  ? 99   LEU Y CB    1 
ATOM   5771  C  CG    . LEU H  4  99   ? 233.520 270.643 135.303 1.00 24.03  ? 99   LEU Y CG    1 
ATOM   5772  C  CD1   . LEU H  4  99   ? 233.906 271.601 134.191 1.00 27.39  ? 99   LEU Y CD1   1 
ATOM   5773  C  CD2   . LEU H  4  99   ? 233.711 271.288 136.661 1.00 27.56  ? 99   LEU Y CD2   1 
ATOM   5774  N  N     . PRO H  4  100  ? 229.287 269.149 136.960 1.00 40.19  ? 100  PRO Y N     1 
ATOM   5775  C  CA    . PRO H  4  100  ? 227.848 268.903 136.796 1.00 44.72  ? 100  PRO Y CA    1 
ATOM   5776  C  C     . PRO H  4  100  ? 227.219 269.872 135.801 1.00 59.11  ? 100  PRO Y C     1 
ATOM   5777  O  O     . PRO H  4  100  ? 227.441 271.083 135.868 1.00 67.34  ? 100  PRO Y O     1 
ATOM   5778  C  CB    . PRO H  4  100  ? 227.293 269.118 138.210 1.00 37.72  ? 100  PRO Y CB    1 
ATOM   5779  C  CG    . PRO H  4  100  ? 228.467 268.908 139.113 1.00 36.33  ? 100  PRO Y CG    1 
ATOM   5780  C  CD    . PRO H  4  100  ? 229.630 269.479 138.353 1.00 38.10  ? 100  PRO Y CD    1 
ATOM   5781  N  N     . GLY H  4  101  ? 226.424 269.322 134.889 1.00 59.33  ? 101  GLY Y N     1 
ATOM   5782  C  CA    . GLY H  4  101  ? 225.488 270.120 134.108 1.00 47.21  ? 101  GLY Y CA    1 
ATOM   5783  C  C     . GLY H  4  101  ? 226.119 271.227 133.285 1.00 61.56  ? 101  GLY Y C     1 
ATOM   5784  O  O     . GLY H  4  101  ? 227.001 270.998 132.440 1.00 73.44  ? 101  GLY Y O     1 
ATOM   5785  N  N     . GLU H  4  102  ? 225.639 272.453 133.523 1.00 59.96  ? 102  GLU Y N     1 
ATOM   5786  C  CA    . GLU H  4  102  ? 226.000 273.586 132.676 1.00 58.72  ? 102  GLU Y CA    1 
ATOM   5787  C  C     . GLU H  4  102  ? 227.495 273.867 132.700 1.00 66.76  ? 102  GLU Y C     1 
ATOM   5788  O  O     . GLU H  4  102  ? 228.049 274.336 131.701 1.00 74.60  ? 102  GLU Y O     1 
ATOM   5789  C  CB    . GLU H  4  102  ? 225.223 274.829 133.110 1.00 67.86  ? 102  GLU Y CB    1 
ATOM   5790  C  CG    . GLU H  4  102  ? 223.719 274.716 132.921 1.00 66.72  ? 102  GLU Y CG    1 
ATOM   5791  C  CD    . GLU H  4  102  ? 223.329 274.452 131.479 1.00 79.86  ? 102  GLU Y CD    1 
ATOM   5792  O  OE1   . GLU H  4  102  ? 223.957 275.039 130.573 1.00 83.51  ? 102  GLU Y OE1   1 
ATOM   5793  O  OE2   . GLU H  4  102  ? 222.394 273.656 131.252 1.00 93.23  ? 102  GLU Y OE2   1 
ATOM   5794  N  N     . LEU H  4  103  ? 228.164 273.601 133.823 1.00 47.87  ? 103  LEU Y N     1 
ATOM   5795  C  CA    . LEU H  4  103  ? 229.616 273.730 133.848 1.00 47.39  ? 103  LEU Y CA    1 
ATOM   5796  C  C     . LEU H  4  103  ? 230.257 272.782 132.845 1.00 52.33  ? 103  LEU Y C     1 
ATOM   5797  O  O     . LEU H  4  103  ? 231.226 273.142 132.165 1.00 47.53  ? 103  LEU Y O     1 
ATOM   5798  C  CB    . LEU H  4  103  ? 230.147 273.471 135.256 1.00 50.89  ? 103  LEU Y CB    1 
ATOM   5799  C  CG    . LEU H  4  103  ? 229.726 274.466 136.338 1.00 52.77  ? 103  LEU Y CG    1 
ATOM   5800  C  CD1   . LEU H  4  103  ? 230.240 274.021 137.696 1.00 55.78  ? 103  LEU Y CD1   1 
ATOM   5801  C  CD2   . LEU H  4  103  ? 230.222 275.864 136.003 1.00 48.85  ? 103  LEU Y CD2   1 
ATOM   5802  N  N     . ALA H  4  104  ? 229.718 271.566 132.727 1.00 43.79  ? 104  ALA Y N     1 
ATOM   5803  C  CA    . ALA H  4  104  ? 230.234 270.626 131.742 1.00 42.65  ? 104  ALA Y CA    1 
ATOM   5804  C  C     . ALA H  4  104  ? 229.916 271.080 130.325 1.00 45.00  ? 104  ALA Y C     1 
ATOM   5805  O  O     . ALA H  4  104  ? 230.779 271.021 129.445 1.00 41.06  ? 104  ALA Y O     1 
ATOM   5806  C  CB    . ALA H  4  104  ? 229.667 269.230 131.991 1.00 41.38  ? 104  ALA Y CB    1 
ATOM   5807  N  N     . LYS H  4  105  ? 228.686 271.537 130.084 1.00 56.15  ? 105  LYS Y N     1 
ATOM   5808  C  CA    . LYS H  4  105  ? 228.297 271.921 128.730 1.00 56.31  ? 105  LYS Y CA    1 
ATOM   5809  C  C     . LYS H  4  105  ? 229.111 273.116 128.242 1.00 56.72  ? 105  LYS Y C     1 
ATOM   5810  O  O     . LYS H  4  105  ? 229.765 273.058 127.193 1.00 46.26  ? 105  LYS Y O     1 
ATOM   5811  C  CB    . LYS H  4  105  ? 226.799 272.223 128.683 1.00 58.03  ? 105  LYS Y CB    1 
ATOM   5812  C  CG    . LYS H  4  105  ? 225.927 271.001 128.925 1.00 74.69  ? 105  LYS Y CG    1 
ATOM   5813  C  CD    . LYS H  4  105  ? 224.451 271.361 128.951 1.00 89.84  ? 105  LYS Y CD    1 
ATOM   5814  C  CE    . LYS H  4  105  ? 223.590 270.126 129.169 1.00 99.16  ? 105  LYS Y CE    1 
ATOM   5815  N  NZ    . LYS H  4  105  ? 222.144 270.465 129.257 1.00 104.21 ? 105  LYS Y NZ    1 
ATOM   5816  N  N     . HIS H  4  106  ? 229.093 274.213 129.005 1.00 53.41  ? 106  HIS Y N     1 
ATOM   5817  C  CA    . HIS H  4  106  ? 229.853 275.394 128.612 1.00 55.32  ? 106  HIS Y CA    1 
ATOM   5818  C  C     . HIS H  4  106  ? 231.354 275.137 128.639 1.00 55.19  ? 106  HIS Y C     1 
ATOM   5819  O  O     . HIS H  4  106  ? 232.092 275.714 127.832 1.00 55.73  ? 106  HIS Y O     1 
ATOM   5820  C  CB    . HIS H  4  106  ? 229.503 276.573 129.520 1.00 45.49  ? 106  HIS Y CB    1 
ATOM   5821  C  CG    . HIS H  4  106  ? 228.064 276.984 129.450 1.00 65.39  ? 106  HIS Y CG    1 
ATOM   5822  N  ND1   . HIS H  4  106  ? 227.516 277.585 128.338 1.00 62.90  ? 106  HIS Y ND1   1 
ATOM   5823  C  CD2   . HIS H  4  106  ? 227.062 276.884 130.355 1.00 75.01  ? 106  HIS Y CD2   1 
ATOM   5824  C  CE1   . HIS H  4  106  ? 226.238 277.837 128.560 1.00 65.10  ? 106  HIS Y CE1   1 
ATOM   5825  N  NE2   . HIS H  4  106  ? 225.938 277.421 129.778 1.00 66.44  ? 106  HIS Y NE2   1 
ATOM   5826  N  N     . ALA H  4  107  ? 231.826 274.280 129.548 1.00 55.50  ? 107  ALA Y N     1 
ATOM   5827  C  CA    . ALA H  4  107  ? 233.250 273.965 129.594 1.00 52.22  ? 107  ALA Y CA    1 
ATOM   5828  C  C     . ALA H  4  107  ? 233.689 273.229 128.334 1.00 56.85  ? 107  ALA Y C     1 
ATOM   5829  O  O     . ALA H  4  107  ? 234.711 273.572 127.727 1.00 56.94  ? 107  ALA Y O     1 
ATOM   5830  C  CB    . ALA H  4  107  ? 233.564 273.139 130.841 1.00 57.24  ? 107  ALA Y CB    1 
ATOM   5831  N  N     . VAL H  4  108  ? 232.928 272.210 127.929 1.00 40.50  ? 108  VAL Y N     1 
ATOM   5832  C  CA    . VAL H  4  108  ? 233.236 271.491 126.696 1.00 47.22  ? 108  VAL Y CA    1 
ATOM   5833  C  C     . VAL H  4  108  ? 233.118 272.418 125.493 1.00 56.52  ? 108  VAL Y C     1 
ATOM   5834  O  O     . VAL H  4  108  ? 233.880 272.299 124.525 1.00 50.53  ? 108  VAL Y O     1 
ATOM   5835  C  CB    . VAL H  4  108  ? 232.326 270.255 126.555 1.00 43.41  ? 108  VAL Y CB    1 
ATOM   5836  C  CG1   . VAL H  4  108  ? 232.528 269.589 125.206 1.00 41.76  ? 108  VAL Y CG1   1 
ATOM   5837  C  CG2   . VAL H  4  108  ? 232.606 269.262 127.672 1.00 42.95  ? 108  VAL Y CG2   1 
ATOM   5838  N  N     . SER H  4  109  ? 232.172 273.359 125.533 1.00 60.55  ? 109  SER Y N     1 
ATOM   5839  C  CA    . SER H  4  109  ? 232.043 274.316 124.438 1.00 50.05  ? 109  SER Y CA    1 
ATOM   5840  C  C     . SER H  4  109  ? 233.289 275.186 124.318 1.00 61.44  ? 109  SER Y C     1 
ATOM   5841  O  O     . SER H  4  109  ? 233.881 275.299 123.237 1.00 68.21  ? 109  SER Y O     1 
ATOM   5842  C  CB    . SER H  4  109  ? 230.798 275.179 124.643 1.00 41.99  ? 109  SER Y CB    1 
ATOM   5843  O  OG    . SER H  4  109  ? 230.674 276.144 123.614 1.00 68.88  ? 109  SER Y OG    1 
ATOM   5844  N  N     . GLU H  4  110  ? 233.709 275.801 125.426 1.00 66.45  ? 110  GLU Y N     1 
ATOM   5845  C  CA    . GLU H  4  110  ? 234.879 276.675 125.396 1.00 68.05  ? 110  GLU Y CA    1 
ATOM   5846  C  C     . GLU H  4  110  ? 236.137 275.905 125.015 1.00 70.54  ? 110  GLU Y C     1 
ATOM   5847  O  O     . GLU H  4  110  ? 236.946 276.382 124.213 1.00 76.30  ? 110  GLU Y O     1 
ATOM   5848  C  CB    . GLU H  4  110  ? 235.062 277.357 126.751 1.00 61.15  ? 110  GLU Y CB    1 
ATOM   5849  C  CG    . GLU H  4  110  ? 233.937 278.306 127.138 1.00 76.25  ? 110  GLU Y CG    1 
ATOM   5850  C  CD    . GLU H  4  110  ? 233.752 279.437 126.143 1.00 100.12 ? 110  GLU Y CD    1 
ATOM   5851  O  OE1   . GLU H  4  110  ? 234.768 279.955 125.633 1.00 109.72 ? 110  GLU Y OE1   1 
ATOM   5852  O  OE2   . GLU H  4  110  ? 232.591 279.809 125.875 1.00 102.22 ? 110  GLU Y OE2   1 
ATOM   5853  N  N     . GLY H  4  111  ? 236.317 274.711 125.581 1.00 62.87  ? 111  GLY Y N     1 
ATOM   5854  C  CA    . GLY H  4  111  ? 237.500 273.929 125.262 1.00 64.77  ? 111  GLY Y CA    1 
ATOM   5855  C  C     . GLY H  4  111  ? 237.537 273.499 123.809 1.00 67.23  ? 111  GLY Y C     1 
ATOM   5856  O  O     . GLY H  4  111  ? 238.570 273.606 123.142 1.00 71.67  ? 111  GLY Y O     1 
ATOM   5857  N  N     . THR H  4  112  ? 236.408 272.999 123.301 1.00 68.03  ? 112  THR Y N     1 
ATOM   5858  C  CA    . THR H  4  112  ? 236.337 272.600 121.901 1.00 71.09  ? 112  THR Y CA    1 
ATOM   5859  C  C     . THR H  4  112  ? 236.602 273.785 120.981 1.00 79.91  ? 112  THR Y C     1 
ATOM   5860  O  O     . THR H  4  112  ? 237.269 273.645 119.949 1.00 80.50  ? 112  THR Y O     1 
ATOM   5861  C  CB    . THR H  4  112  ? 234.975 271.978 121.601 1.00 81.44  ? 112  THR Y CB    1 
ATOM   5862  O  OG1   . THR H  4  112  ? 234.783 270.825 122.430 1.00 80.07  ? 112  THR Y OG1   1 
ATOM   5863  C  CG2   . THR H  4  112  ? 234.885 271.559 120.141 1.00 87.22  ? 112  THR Y CG2   1 
ATOM   5864  N  N     . LYS H  4  113  ? 236.093 274.965 121.344 1.00 81.88  ? 113  LYS Y N     1 
ATOM   5865  C  CA    . LYS H  4  113  ? 236.395 276.162 120.566 1.00 77.23  ? 113  LYS Y CA    1 
ATOM   5866  C  C     . LYS H  4  113  ? 237.882 276.488 120.613 1.00 74.02  ? 113  LYS Y C     1 
ATOM   5867  O  O     . LYS H  4  113  ? 238.464 276.923 119.611 1.00 67.40  ? 113  LYS Y O     1 
ATOM   5868  C  CB    . LYS H  4  113  ? 235.568 277.341 121.078 1.00 65.31  ? 113  LYS Y CB    1 
ATOM   5869  C  CG    . LYS H  4  113  ? 235.807 278.640 120.330 1.00 81.61  ? 113  LYS Y CG    1 
ATOM   5870  C  CD    . LYS H  4  113  ? 234.944 279.760 120.882 1.00 96.73  ? 113  LYS Y CD    1 
ATOM   5871  C  CE    . LYS H  4  113  ? 235.493 280.276 122.203 1.00 107.63 ? 113  LYS Y CE    1 
ATOM   5872  N  NZ    . LYS H  4  113  ? 234.669 281.390 122.749 1.00 108.99 ? 113  LYS Y NZ    1 
ATOM   5873  N  N     . ALA H  4  114  ? 238.518 276.273 121.768 1.00 66.56  ? 114  ALA Y N     1 
ATOM   5874  C  CA    . ALA H  4  114  ? 239.934 276.599 121.906 1.00 59.43  ? 114  ALA Y CA    1 
ATOM   5875  C  C     . ALA H  4  114  ? 240.807 275.663 121.080 1.00 65.45  ? 114  ALA Y C     1 
ATOM   5876  O  O     . ALA H  4  114  ? 241.761 276.110 120.433 1.00 73.31  ? 114  ALA Y O     1 
ATOM   5877  C  CB    . ALA H  4  114  ? 240.344 276.555 123.377 1.00 57.99  ? 114  ALA Y CB    1 
ATOM   5878  N  N     . VAL H  4  115  ? 240.509 274.363 121.098 1.00 65.10  ? 115  VAL Y N     1 
ATOM   5879  C  CA    . VAL H  4  115  ? 241.258 273.431 120.260 1.00 75.89  ? 115  VAL Y CA    1 
ATOM   5880  C  C     . VAL H  4  115  ? 240.982 273.706 118.787 1.00 85.00  ? 115  VAL Y C     1 
ATOM   5881  O  O     . VAL H  4  115  ? 241.888 273.636 117.946 1.00 81.62  ? 115  VAL Y O     1 
ATOM   5882  C  CB    . VAL H  4  115  ? 240.920 271.978 120.640 1.00 71.86  ? 115  VAL Y CB    1 
ATOM   5883  C  CG1   . VAL H  4  115  ? 241.611 271.006 119.700 1.00 53.20  ? 115  VAL Y CG1   1 
ATOM   5884  C  CG2   . VAL H  4  115  ? 241.324 271.705 122.077 1.00 80.60  ? 115  VAL Y CG2   1 
ATOM   5885  N  N     . THR H  4  116  ? 239.729 274.024 118.454 1.00 72.98  ? 116  THR Y N     1 
ATOM   5886  C  CA    . THR H  4  116  ? 239.368 274.399 117.092 1.00 70.00  ? 116  THR Y CA    1 
ATOM   5887  C  C     . THR H  4  116  ? 240.243 275.541 116.588 1.00 75.14  ? 116  THR Y C     1 
ATOM   5888  O  O     . THR H  4  116  ? 240.968 275.397 115.598 1.00 80.30  ? 116  THR Y O     1 
ATOM   5889  C  CB    . THR H  4  116  ? 237.889 274.786 117.032 1.00 91.62  ? 116  THR Y CB    1 
ATOM   5890  O  OG1   . THR H  4  116  ? 237.085 273.666 117.423 1.00 92.09  ? 116  THR Y OG1   1 
ATOM   5891  C  CG2   . THR H  4  116  ? 237.510 275.208 115.621 1.00 99.99  ? 116  THR Y CG2   1 
ATOM   5892  N  N     . LYS H  4  117  ? 240.171 276.695 117.256 1.00 79.98  ? 117  LYS Y N     1 
ATOM   5893  C  CA    . LYS H  4  117  ? 240.992 277.837 116.860 1.00 64.50  ? 117  LYS Y CA    1 
ATOM   5894  C  C     . LYS H  4  117  ? 242.480 277.506 116.898 1.00 69.92  ? 117  LYS Y C     1 
ATOM   5895  O  O     . LYS H  4  117  ? 243.251 278.027 116.085 1.00 82.28  ? 117  LYS Y O     1 
ATOM   5896  C  CB    . LYS H  4  117  ? 240.692 279.033 117.763 1.00 75.35  ? 117  LYS Y CB    1 
ATOM   5897  C  CG    . LYS H  4  117  ? 241.456 280.298 117.407 1.00 83.46  ? 117  LYS Y CG    1 
ATOM   5898  C  CD    . LYS H  4  117  ? 241.109 281.438 118.353 1.00 96.04  ? 117  LYS Y CD    1 
ATOM   5899  C  CE    . LYS H  4  117  ? 242.014 282.638 118.131 1.00 113.56 ? 117  LYS Y CE    1 
ATOM   5900  N  NZ    . LYS H  4  117  ? 241.859 283.211 116.766 1.00 114.49 ? 117  LYS Y NZ    1 
ATOM   5901  N  N     . TYR H  4  118  ? 242.900 276.644 117.827 1.00 68.11  ? 118  TYR Y N     1 
ATOM   5902  C  CA    . TYR H  4  118  ? 244.313 276.295 117.942 1.00 68.58  ? 118  TYR Y CA    1 
ATOM   5903  C  C     . TYR H  4  118  ? 244.811 275.585 116.689 1.00 77.35  ? 118  TYR Y C     1 
ATOM   5904  O  O     . TYR H  4  118  ? 245.769 276.026 116.045 1.00 84.41  ? 118  TYR Y O     1 
ATOM   5905  C  CB    . TYR H  4  118  ? 244.537 275.427 119.180 1.00 74.09  ? 118  TYR Y CB    1 
ATOM   5906  C  CG    . TYR H  4  118  ? 245.954 274.924 119.328 1.00 70.89  ? 118  TYR Y CG    1 
ATOM   5907  C  CD1   . TYR H  4  118  ? 246.958 275.753 119.808 1.00 68.77  ? 118  TYR Y CD1   1 
ATOM   5908  C  CD2   . TYR H  4  118  ? 246.288 273.619 118.992 1.00 65.17  ? 118  TYR Y CD2   1 
ATOM   5909  C  CE1   . TYR H  4  118  ? 248.255 275.297 119.946 1.00 76.39  ? 118  TYR Y CE1   1 
ATOM   5910  C  CE2   . TYR H  4  118  ? 247.581 273.156 119.127 1.00 72.64  ? 118  TYR Y CE2   1 
ATOM   5911  C  CZ    . TYR H  4  118  ? 248.559 273.998 119.605 1.00 86.67  ? 118  TYR Y CZ    1 
ATOM   5912  O  OH    . TYR H  4  118  ? 249.850 273.541 119.742 1.00 90.42  ? 118  TYR Y OH    1 
ATOM   5913  N  N     . THR H  4  119  ? 244.167 274.474 116.325 1.00 69.68  ? 119  THR Y N     1 
ATOM   5914  C  CA    . THR H  4  119  ? 244.620 273.693 115.181 1.00 74.66  ? 119  THR Y CA    1 
ATOM   5915  C  C     . THR H  4  119  ? 244.236 274.319 113.847 1.00 77.99  ? 119  THR Y C     1 
ATOM   5916  O  O     . THR H  4  119  ? 244.838 273.976 112.825 1.00 83.28  ? 119  THR Y O     1 
ATOM   5917  C  CB    . THR H  4  119  ? 244.060 272.270 115.253 1.00 68.16  ? 119  THR Y CB    1 
ATOM   5918  O  OG1   . THR H  4  119  ? 242.628 272.318 115.269 1.00 60.58  ? 119  THR Y OG1   1 
ATOM   5919  C  CG2   . THR H  4  119  ? 244.556 271.567 116.508 1.00 67.63  ? 119  THR Y CG2   1 
ATOM   5920  N  N     . SER H  4  120  ? 243.253 275.219 113.834 1.00 72.62  ? 120  SER Y N     1 
ATOM   5921  C  CA    . SER H  4  120  ? 242.824 275.830 112.581 1.00 78.95  ? 120  SER Y CA    1 
ATOM   5922  C  C     . SER H  4  120  ? 243.879 276.792 112.049 1.00 89.71  ? 120  SER Y C     1 
ATOM   5923  O  O     . SER H  4  120  ? 244.289 276.701 110.886 1.00 92.96  ? 120  SER Y O     1 
ATOM   5924  C  CB    . SER H  4  120  ? 241.487 276.546 112.777 1.00 63.89  ? 120  SER Y CB    1 
ATOM   5925  O  OG    . SER H  4  120  ? 240.460 275.627 113.104 1.00 67.08  ? 120  SER Y OG    1 
ATOM   5926  N  N     . ALA H  4  121  ? 244.329 277.722 112.885 1.00 95.85  ? 121  ALA Y N     1 
ATOM   5927  C  CA    . ALA H  4  121  ? 245.331 278.697 112.475 1.00 91.01  ? 121  ALA Y CA    1 
ATOM   5928  C  C     . ALA H  4  121  ? 246.719 278.067 112.434 1.00 97.51  ? 121  ALA Y C     1 
ATOM   5929  O  O     . ALA H  4  121  ? 246.903 276.918 112.839 1.00 96.06  ? 121  ALA Y O     1 
ATOM   5930  C  CB    . ALA H  4  121  ? 245.319 279.895 113.409 1.00 100.99 ? 121  ALA Y CB    1 
ATOM   5931  P  P     . DA  I  5  1    ? 195.770 298.858 165.237 1.00 233.36 ? 1    DA  a P     1 
ATOM   5932  O  OP1   . DA  I  5  1    ? 196.013 297.457 165.641 1.00 228.80 ? 1    DA  a OP1   1 
ATOM   5933  O  OP2   . DA  I  5  1    ? 194.414 299.285 164.824 1.00 230.28 ? 1    DA  a OP2   1 
ATOM   5934  O  "O5'" . DA  I  5  1    ? 196.264 299.832 166.406 1.00 255.92 ? 1    DA  a "O5'" 1 
ATOM   5935  C  "C5'" . DA  I  5  1    ? 197.491 300.539 166.274 1.00 259.95 ? 1    DA  a "C5'" 1 
ATOM   5936  C  "C4'" . DA  I  5  1    ? 197.877 301.204 167.583 1.00 269.80 ? 1    DA  a "C4'" 1 
ATOM   5937  O  "O4'" . DA  I  5  1    ? 197.627 300.289 168.686 1.00 273.14 ? 1    DA  a "O4'" 1 
ATOM   5938  C  "C3'" . DA  I  5  1    ? 199.348 301.590 167.693 1.00 274.65 ? 1    DA  a "C3'" 1 
ATOM   5939  O  "O3'" . DA  I  5  1    ? 199.485 302.761 168.489 1.00 278.36 ? 1    DA  a "O3'" 1 
ATOM   5940  C  "C2'" . DA  I  5  1    ? 199.953 300.373 168.382 1.00 273.71 ? 1    DA  a "C2'" 1 
ATOM   5941  C  "C1'" . DA  I  5  1    ? 198.840 300.007 169.354 1.00 272.58 ? 1    DA  a "C1'" 1 
ATOM   5942  N  N9    . DA  I  5  1    ? 198.852 298.658 169.756 1.00 20.00  ? 1    DA  a N9    1 
ATOM   5943  C  C8    . DA  I  5  1    ? 199.258 298.164 170.970 1.00 20.00  ? 1    DA  a C8    1 
ATOM   5944  N  N7    . DA  I  5  1    ? 199.158 296.863 171.068 1.00 20.00  ? 1    DA  a N7    1 
ATOM   5945  C  C5    . DA  I  5  1    ? 198.647 296.462 169.842 1.00 20.00  ? 1    DA  a C5    1 
ATOM   5946  C  C6    . DA  I  5  1    ? 198.321 295.186 169.311 1.00 20.00  ? 1    DA  a C6    1 
ATOM   5947  N  N6    . DA  I  5  1    ? 198.479 294.042 169.987 1.00 20.00  ? 1    DA  a N6    1 
ATOM   5948  N  N1    . DA  I  5  1    ? 197.832 295.130 168.051 1.00 20.00  ? 1    DA  a N1    1 
ATOM   5949  C  C2    . DA  I  5  1    ? 197.688 296.275 167.371 1.00 20.00  ? 1    DA  a C2    1 
ATOM   5950  N  N3    . DA  I  5  1    ? 197.968 297.534 167.758 1.00 20.00  ? 1    DA  a N3    1 
ATOM   5951  C  C4    . DA  I  5  1    ? 198.449 297.556 169.019 1.00 20.00  ? 1    DA  a C4    1 
ATOM   5952  P  P     . DT  I  5  2    ? 200.123 304.095 167.859 1.00 286.75 ? 2    DT  a P     1 
ATOM   5953  O  OP1   . DT  I  5  2    ? 199.042 305.098 167.742 1.00 284.11 ? 2    DT  a OP1   1 
ATOM   5954  O  OP2   . DT  I  5  2    ? 200.893 303.699 166.657 1.00 285.88 ? 2    DT  a OP2   1 
ATOM   5955  O  "O5'" . DT  I  5  2    ? 201.166 304.587 168.966 1.00 241.63 ? 2    DT  a "O5'" 1 
ATOM   5956  C  "C5'" . DT  I  5  2    ? 200.701 305.226 170.151 1.00 241.59 ? 2    DT  a "C5'" 1 
ATOM   5957  C  "C4'" . DT  I  5  2    ? 201.816 305.350 171.180 1.00 243.26 ? 2    DT  a "C4'" 1 
ATOM   5958  O  "O4'" . DT  I  5  2    ? 201.954 304.099 171.905 1.00 242.80 ? 2    DT  a "O4'" 1 
ATOM   5959  C  "C3'" . DT  I  5  2    ? 203.201 305.654 170.607 1.00 243.69 ? 2    DT  a "C3'" 1 
ATOM   5960  O  "O3'" . DT  I  5  2    ? 203.915 306.497 171.505 1.00 247.23 ? 2    DT  a "O3'" 1 
ATOM   5961  C  "C2'" . DT  I  5  2    ? 203.835 304.268 170.530 1.00 241.78 ? 2    DT  a "C2'" 1 
ATOM   5962  C  "C1'" . DT  I  5  2    ? 203.281 303.634 171.795 1.00 240.00 ? 2    DT  a "C1'" 1 
ATOM   5963  N  N1    . DT  I  5  2    ? 203.263 302.160 171.795 1.00 20.00  ? 2    DT  a N1    1 
ATOM   5964  C  C2    . DT  I  5  2    ? 203.789 301.481 172.885 1.00 20.00  ? 2    DT  a C2    1 
ATOM   5965  O  O2    . DT  I  5  2    ? 204.279 302.041 173.867 1.00 20.00  ? 2    DT  a O2    1 
ATOM   5966  N  N3    . DT  I  5  2    ? 203.716 300.113 172.785 1.00 20.00  ? 2    DT  a N3    1 
ATOM   5967  C  C4    . DT  I  5  2    ? 203.203 299.371 171.752 1.00 20.00  ? 2    DT  a C4    1 
ATOM   5968  O  O4    . DT  I  5  2    ? 203.205 298.143 171.826 1.00 20.00  ? 2    DT  a O4    1 
ATOM   5969  C  C5    . DT  I  5  2    ? 202.688 300.140 170.637 1.00 20.00  ? 2    DT  a C5    1 
ATOM   5970  C  C7    . DT  I  5  2    ? 202.109 299.417 169.464 1.00 20.00  ? 2    DT  a C7    1 
ATOM   5971  C  C6    . DT  I  5  2    ? 202.750 301.481 170.711 1.00 20.00  ? 2    DT  a C6    1 
ATOM   5972  P  P     . DC  I  5  3    ? 204.809 307.710 170.944 1.00 240.91 ? 3    DC  a P     1 
ATOM   5973  O  OP1   . DC  I  5  3    ? 203.952 308.916 170.907 1.00 236.76 ? 3    DC  a OP1   1 
ATOM   5974  O  OP2   . DC  I  5  3    ? 205.476 307.244 169.709 1.00 237.59 ? 3    DC  a OP2   1 
ATOM   5975  O  "O5'" . DC  I  5  3    ? 205.932 307.912 172.066 1.00 242.89 ? 3    DC  a "O5'" 1 
ATOM   5976  C  "C5'" . DC  I  5  3    ? 205.589 308.495 173.322 1.00 241.00 ? 3    DC  a "C5'" 1 
ATOM   5977  C  "C4'" . DC  I  5  3    ? 206.448 307.932 174.445 1.00 241.95 ? 3    DC  a "C4'" 1 
ATOM   5978  O  "O4'" . DC  I  5  3    ? 206.383 306.482 174.431 1.00 244.18 ? 3    DC  a "O4'" 1 
ATOM   5979  C  "C3'" . DC  I  5  3    ? 207.929 308.275 174.376 1.00 241.10 ? 3    DC  a "C3'" 1 
ATOM   5980  O  "O3'" . DC  I  5  3    ? 208.461 308.346 175.694 1.00 242.97 ? 3    DC  a "O3'" 1 
ATOM   5981  C  "C2'" . DC  I  5  3    ? 208.501 307.091 173.604 1.00 241.36 ? 3    DC  a "C2'" 1 
ATOM   5982  C  "C1'" . DC  I  5  3    ? 207.661 305.943 174.148 1.00 240.89 ? 3    DC  a "C1'" 1 
ATOM   5983  N  N1    . DC  I  5  3    ? 207.473 304.793 173.134 1.00 20.00  ? 3    DC  a N1    1 
ATOM   5984  C  C2    . DC  I  5  3    ? 207.856 303.496 173.468 1.00 20.00  ? 3    DC  a C2    1 
ATOM   5985  O  O2    . DC  I  5  3    ? 208.370 303.290 174.575 1.00 20.00  ? 3    DC  a O2    1 
ATOM   5986  N  N3    . DC  I  5  3    ? 207.658 302.504 172.566 1.00 20.00  ? 3    DC  a N3    1 
ATOM   5987  C  C4    . DC  I  5  3    ? 207.100 302.759 171.376 1.00 20.00  ? 3    DC  a C4    1 
ATOM   5988  N  N4    . DC  I  5  3    ? 206.927 301.753 170.534 1.00 20.00  ? 3    DC  a N4    1 
ATOM   5989  C  C5    . DC  I  5  3    ? 206.702 304.083 171.007 1.00 20.00  ? 3    DC  a C5    1 
ATOM   5990  C  C6    . DC  I  5  3    ? 206.906 305.061 171.930 1.00 20.00  ? 3    DC  a C6    1 
ATOM   5991  P  P     . DA  I  5  4    ? 209.948 308.899 175.953 1.00 240.94 ? 4    DA  a P     1 
ATOM   5992  O  OP1   . DA  I  5  4    ? 209.858 309.922 177.017 1.00 241.71 ? 4    DA  a OP1   1 
ATOM   5993  O  OP2   . DA  I  5  4    ? 210.553 309.249 174.650 1.00 237.35 ? 4    DA  a OP2   1 
ATOM   5994  O  "O5'" . DA  I  5  4    ? 210.727 307.631 176.535 1.00 248.49 ? 4    DA  a "O5'" 1 
ATOM   5995  C  "C5'" . DA  I  5  4    ? 210.232 306.963 177.694 1.00 246.89 ? 4    DA  a "C5'" 1 
ATOM   5996  C  "C4'" . DA  I  5  4    ? 211.258 305.989 178.257 1.00 240.32 ? 4    DA  a "C4'" 1 
ATOM   5997  O  "O4'" . DA  I  5  4    ? 211.202 304.735 177.541 1.00 238.09 ? 4    DA  a "O4'" 1 
ATOM   5998  C  "C3'" . DA  I  5  4    ? 212.706 306.439 178.180 1.00 238.34 ? 4    DA  a "C3'" 1 
ATOM   5999  O  "O3'" . DA  I  5  4    ? 213.430 305.890 179.269 1.00 240.49 ? 4    DA  a "O3'" 1 
ATOM   6000  C  "C2'" . DA  I  5  4    ? 213.172 305.866 176.840 1.00 235.59 ? 4    DA  a "C2'" 1 
ATOM   6001  C  "C1'" . DA  I  5  4    ? 212.334 304.594 176.701 1.00 235.74 ? 4    DA  a "C1'" 1 
ATOM   6002  N  N9    . DA  I  5  4    ? 211.847 304.357 175.345 1.00 234.78 ? 4    DA  a N9    1 
ATOM   6003  C  C8    . DA  I  5  4    ? 211.204 305.250 174.538 1.00 231.16 ? 4    DA  a C8    1 
ATOM   6004  N  N7    . DA  I  5  4    ? 210.858 304.757 173.372 1.00 227.39 ? 4    DA  a N7    1 
ATOM   6005  C  C5    . DA  I  5  4    ? 211.294 303.445 173.424 1.00 224.80 ? 4    DA  a C5    1 
ATOM   6006  C  C6    . DA  I  5  4    ? 211.222 302.385 172.500 1.00 218.32 ? 4    DA  a C6    1 
ATOM   6007  N  N6    . DA  I  5  4    ? 210.668 302.503 171.290 1.00 211.75 ? 4    DA  a N6    1 
ATOM   6008  N  N1    . DA  I  5  4    ? 211.759 301.203 172.864 1.00 220.37 ? 4    DA  a N1    1 
ATOM   6009  C  C2    . DA  I  5  4    ? 212.314 301.090 174.076 1.00 221.26 ? 4    DA  a C2    1 
ATOM   6010  N  N3    . DA  I  5  4    ? 212.439 302.012 175.030 1.00 224.54 ? 4    DA  a N3    1 
ATOM   6011  C  C4    . DA  I  5  4    ? 211.908 303.180 174.634 1.00 228.86 ? 4    DA  a C4    1 
ATOM   6012  P  P     . DG  I  5  5    ? 214.981 306.254 179.482 1.00 240.44 ? 5    DG  a P     1 
ATOM   6013  O  OP1   . DG  I  5  5    ? 215.284 306.097 180.923 1.00 235.32 ? 5    DG  a OP1   1 
ATOM   6014  O  OP2   . DG  I  5  5    ? 215.237 307.546 178.808 1.00 239.03 ? 5    DG  a OP2   1 
ATOM   6015  O  "O5'" . DG  I  5  5    ? 215.746 305.112 178.671 1.00 244.28 ? 5    DG  a "O5'" 1 
ATOM   6016  C  "C5'" . DG  I  5  5    ? 215.363 303.754 178.834 1.00 237.08 ? 5    DG  a "C5'" 1 
ATOM   6017  C  "C4'" . DG  I  5  5    ? 216.057 302.873 177.815 1.00 224.03 ? 5    DG  a "C4'" 1 
ATOM   6018  O  "O4'" . DG  I  5  5    ? 215.287 302.847 176.577 1.00 214.21 ? 5    DG  a "O4'" 1 
ATOM   6019  C  "C3'" . DG  I  5  5    ? 217.467 303.328 177.416 1.00 219.06 ? 5    DG  a "C3'" 1 
ATOM   6020  O  "O3'" . DG  I  5  5    ? 218.311 302.195 177.288 1.00 218.42 ? 5    DG  a "O3'" 1 
ATOM   6021  C  "C2'" . DG  I  5  5    ? 217.225 303.978 176.060 1.00 211.18 ? 5    DG  a "C2'" 1 
ATOM   6022  C  "C1'" . DG  I  5  5    ? 216.185 303.025 175.514 1.00 212.20 ? 5    DG  a "C1'" 1 
ATOM   6023  N  N9    . DG  I  5  5    ? 215.474 303.506 174.331 1.00 216.52 ? 5    DG  a N9    1 
ATOM   6024  C  C8    . DG  I  5  5    ? 214.949 304.756 174.114 1.00 224.29 ? 5    DG  a C8    1 
ATOM   6025  N  N7    . DG  I  5  5    ? 214.378 304.882 172.946 1.00 226.29 ? 5    DG  a N7    1 
ATOM   6026  C  C5    . DG  I  5  5    ? 214.539 303.634 172.353 1.00 222.03 ? 5    DG  a C5    1 
ATOM   6027  C  C6    . DG  I  5  5    ? 214.125 303.160 171.084 1.00 222.08 ? 5    DG  a C6    1 
ATOM   6028  O  O6    . DG  I  5  5    ? 213.517 303.770 170.195 1.00 223.62 ? 5    DG  a O6    1 
ATOM   6029  N  N1    . DG  I  5  5    ? 214.500 301.832 170.883 1.00 214.17 ? 5    DG  a N1    1 
ATOM   6030  C  C2    . DG  I  5  5    ? 215.180 301.063 171.795 1.00 211.24 ? 5    DG  a C2    1 
ATOM   6031  N  N2    . DG  I  5  5    ? 215.454 299.800 171.438 1.00 217.33 ? 5    DG  a N2    1 
ATOM   6032  N  N3    . DG  I  5  5    ? 215.568 301.495 172.984 1.00 205.26 ? 5    DG  a N3    1 
ATOM   6033  C  C4    . DG  I  5  5    ? 215.217 302.784 173.192 1.00 212.59 ? 5    DG  a C4    1 
ATOM   6034  P  P     . DA  I  5  6    ? 219.587 302.011 178.243 1.00 219.03 ? 6    DA  a P     1 
ATOM   6035  O  OP1   . DA  I  5  6    ? 219.091 301.550 179.559 1.00 215.94 ? 6    DA  a OP1   1 
ATOM   6036  O  OP2   . DA  I  5  6    ? 220.405 303.240 178.155 1.00 215.75 ? 6    DA  a OP2   1 
ATOM   6037  O  "O5'" . DA  I  5  6    ? 220.404 300.819 177.555 1.00 214.71 ? 6    DA  a "O5'" 1 
ATOM   6038  C  "C5'" . DA  I  5  6    ? 219.836 299.516 177.494 1.00 206.78 ? 6    DA  a "C5'" 1 
ATOM   6039  C  "C4'" . DA  I  5  6    ? 220.071 298.876 176.135 1.00 198.27 ? 6    DA  a "C4'" 1 
ATOM   6040  O  "O4'" . DA  I  5  6    ? 219.236 299.521 175.134 1.00 197.81 ? 6    DA  a "O4'" 1 
ATOM   6041  C  "C3'" . DA  I  5  6    ? 221.506 298.960 175.611 1.00 197.43 ? 6    DA  a "C3'" 1 
ATOM   6042  O  "O3'" . DA  I  5  6    ? 221.876 297.714 175.036 1.00 202.38 ? 6    DA  a "O3'" 1 
ATOM   6043  C  "C2'" . DA  I  5  6    ? 221.431 300.066 174.561 1.00 192.24 ? 6    DA  a "C2'" 1 
ATOM   6044  C  "C1'" . DA  I  5  6    ? 220.021 299.891 174.025 1.00 201.90 ? 6    DA  a "C1'" 1 
ATOM   6045  N  N9    . DA  I  5  6    ? 219.461 301.113 173.460 1.00 202.90 ? 6    DA  a N9    1 
ATOM   6046  C  C8    . DA  I  5  6    ? 219.354 302.324 174.078 1.00 208.77 ? 6    DA  a C8    1 
ATOM   6047  N  N7    . DA  I  5  6    ? 218.807 303.254 173.337 1.00 206.43 ? 6    DA  a N7    1 
ATOM   6048  C  C5    . DA  I  5  6    ? 218.534 302.611 172.144 1.00 206.73 ? 6    DA  a C5    1 
ATOM   6049  C  C6    . DA  I  5  6    ? 217.940 303.052 170.948 1.00 207.92 ? 6    DA  a C6    1 
ATOM   6050  N  N6    . DA  I  5  6    ? 217.525 304.307 170.756 1.00 205.76 ? 6    DA  a N6    1 
ATOM   6051  N  N1    . DA  I  5  6    ? 217.822 302.162 169.940 1.00 210.45 ? 6    DA  a N1    1 
ATOM   6052  C  C2    . DA  I  5  6    ? 218.259 300.912 170.132 1.00 211.87 ? 6    DA  a C2    1 
ATOM   6053  N  N3    . DA  I  5  6    ? 218.817 300.375 171.220 1.00 212.12 ? 6    DA  a N3    1 
ATOM   6054  C  C4    . DA  I  5  6    ? 218.932 301.290 172.198 1.00 208.70 ? 6    DA  a C4    1 
ATOM   6055  P  P     . DA  I  5  7    ? 223.411 297.398 174.683 1.00 214.02 ? 7    DA  a P     1 
ATOM   6056  O  OP1   . DA  I  5  7    ? 223.796 296.182 175.433 1.00 206.05 ? 7    DA  a OP1   1 
ATOM   6057  O  OP2   . DA  I  5  7    ? 224.201 298.637 174.848 1.00 212.59 ? 7    DA  a OP2   1 
ATOM   6058  O  "O5'" . DA  I  5  7    ? 223.368 297.043 173.126 1.00 190.06 ? 7    DA  a "O5'" 1 
ATOM   6059  C  "C5'" . DA  I  5  7    ? 222.442 296.073 172.650 1.00 190.06 ? 7    DA  a "C5'" 1 
ATOM   6060  C  "C4'" . DA  I  5  7    ? 222.195 296.243 171.163 1.00 195.31 ? 7    DA  a "C4'" 1 
ATOM   6061  O  "O4'" . DA  I  5  7    ? 221.482 297.483 170.927 1.00 195.55 ? 7    DA  a "O4'" 1 
ATOM   6062  C  "C3'" . DA  I  5  7    ? 223.457 296.293 170.303 1.00 200.19 ? 7    DA  a "C3'" 1 
ATOM   6063  O  "O3'" . DA  I  5  7    ? 223.340 295.389 169.215 1.00 204.17 ? 7    DA  a "O3'" 1 
ATOM   6064  C  "C2'" . DA  I  5  7    ? 223.533 297.747 169.833 1.00 203.56 ? 7    DA  a "C2'" 1 
ATOM   6065  C  "C1'" . DA  I  5  7    ? 222.076 298.185 169.863 1.00 201.70 ? 7    DA  a "C1'" 1 
ATOM   6066  N  N9    . DA  I  5  7    ? 221.904 299.615 170.113 1.00 205.92 ? 7    DA  a N9    1 
ATOM   6067  C  C8    . DA  I  5  7    ? 222.211 300.287 171.264 1.00 206.17 ? 7    DA  a C8    1 
ATOM   6068  N  N7    . DA  I  5  7    ? 221.946 301.571 171.214 1.00 206.49 ? 7    DA  a N7    1 
ATOM   6069  C  C5    . DA  I  5  7    ? 221.430 301.756 169.945 1.00 208.68 ? 7    DA  a C5    1 
ATOM   6070  C  C6    . DA  I  5  7    ? 220.944 302.900 169.277 1.00 212.87 ? 7    DA  a C6    1 
ATOM   6071  N  N6    . DA  I  5  7    ? 220.930 304.117 169.822 1.00 217.52 ? 7    DA  a N6    1 
ATOM   6072  N  N1    . DA  I  5  7    ? 220.504 302.745 168.010 1.00 210.29 ? 7    DA  a N1    1 
ATOM   6073  C  C2    . DA  I  5  7    ? 220.539 301.523 167.460 1.00 204.39 ? 7    DA  a C2    1 
ATOM   6074  N  N3    . DA  I  5  7    ? 220.952 300.373 167.995 1.00 201.86 ? 7    DA  a N3    1 
ATOM   6075  C  C4    . DA  I  5  7    ? 221.397 300.563 169.250 1.00 206.53 ? 7    DA  a C4    1 
ATOM   6076  P  P     . DT  I  5  8    ? 224.557 295.195 168.184 1.00 221.68 ? 8    DT  a P     1 
ATOM   6077  O  OP1   . DT  I  5  8    ? 224.557 293.783 167.744 1.00 222.88 ? 8    DT  a OP1   1 
ATOM   6078  O  OP2   . DT  I  5  8    ? 225.778 295.768 168.798 1.00 208.83 ? 8    DT  a OP2   1 
ATOM   6079  O  "O5'" . DT  I  5  8    ? 224.146 296.116 166.945 1.00 187.54 ? 8    DT  a "O5'" 1 
ATOM   6080  C  "C5'" . DT  I  5  8    ? 222.840 296.009 166.396 1.00 190.75 ? 8    DT  a "C5'" 1 
ATOM   6081  C  "C4'" . DT  I  5  8    ? 222.674 296.932 165.202 1.00 206.31 ? 8    DT  a "C4'" 1 
ATOM   6082  O  "O4'" . DT  I  5  8    ? 222.409 298.287 165.656 1.00 207.03 ? 8    DT  a "O4'" 1 
ATOM   6083  C  "C3'" . DT  I  5  8    ? 223.892 297.025 164.282 1.00 213.58 ? 8    DT  a "C3'" 1 
ATOM   6084  O  "O3'" . DT  I  5  8    ? 223.456 297.077 162.932 1.00 219.31 ? 8    DT  a "O3'" 1 
ATOM   6085  C  "C2'" . DT  I  5  8    ? 224.533 298.342 164.717 1.00 209.59 ? 8    DT  a "C2'" 1 
ATOM   6086  C  "C1'" . DT  I  5  8    ? 223.299 299.172 165.013 1.00 207.17 ? 8    DT  a "C1'" 1 
ATOM   6087  N  N1    . DT  I  5  8    ? 223.545 300.339 165.916 1.00 214.93 ? 8    DT  a N1    1 
ATOM   6088  C  C2    . DT  I  5  8    ? 223.179 301.602 165.499 1.00 217.31 ? 8    DT  a C2    1 
ATOM   6089  O  O2    . DT  I  5  8    ? 222.654 301.823 164.422 1.00 228.24 ? 8    DT  a O2    1 
ATOM   6090  N  N3    . DT  I  5  8    ? 223.434 302.599 166.404 1.00 206.65 ? 8    DT  a N3    1 
ATOM   6091  C  C4    . DT  I  5  8    ? 224.006 302.465 167.653 1.00 208.41 ? 8    DT  a C4    1 
ATOM   6092  O  O4    . DT  I  5  8    ? 224.208 303.424 168.390 1.00 212.59 ? 8    DT  a O4    1 
ATOM   6093  C  C5    . DT  I  5  8    ? 224.378 301.123 168.022 1.00 211.72 ? 8    DT  a C5    1 
ATOM   6094  C  C7    . DT  I  5  8    ? 225.019 300.864 169.353 1.00 210.54 ? 8    DT  a C7    1 
ATOM   6095  C  C6    . DT  I  5  8    ? 224.131 300.135 167.148 1.00 211.62 ? 8    DT  a C6    1 
ATOM   6096  P  P     . DC  I  5  9    ? 224.498 296.930 161.716 1.00 232.13 ? 9    DC  a P     1 
ATOM   6097  O  OP1   . DC  I  5  9    ? 224.133 295.703 160.976 1.00 235.76 ? 9    DC  a OP1   1 
ATOM   6098  O  OP2   . DC  I  5  9    ? 225.875 297.087 162.234 1.00 222.29 ? 9    DC  a OP2   1 
ATOM   6099  O  "O5'" . DC  I  5  9    ? 224.168 298.195 160.798 1.00 221.15 ? 9    DC  a "O5'" 1 
ATOM   6100  C  "C5'" . DC  I  5  9    ? 222.815 298.496 160.478 1.00 218.04 ? 9    DC  a "C5'" 1 
ATOM   6101  C  "C4'" . DC  I  5  9    ? 222.689 299.882 159.868 1.00 223.92 ? 9    DC  a "C4'" 1 
ATOM   6102  O  "O4'" . DC  I  5  9    ? 222.843 300.894 160.896 1.00 225.15 ? 9    DC  a "O4'" 1 
ATOM   6103  C  "C3'" . DC  I  5  9    ? 223.708 300.213 158.787 1.00 233.42 ? 9    DC  a "C3'" 1 
ATOM   6104  O  "O3'" . DC  I  5  9    ? 223.077 300.947 157.752 1.00 246.50 ? 9    DC  a "O3'" 1 
ATOM   6105  C  "C2'" . DC  I  5  9    ? 224.754 301.050 159.529 1.00 230.70 ? 9    DC  a "C2'" 1 
ATOM   6106  C  "C1'" . DC  I  5  9    ? 223.909 301.766 160.576 1.00 230.03 ? 9    DC  a "C1'" 1 
ATOM   6107  N  N1    . DC  I  5  9    ? 224.645 302.063 161.841 1.00 238.56 ? 9    DC  a N1    1 
ATOM   6108  C  C2    . DC  I  5  9    ? 224.741 303.383 162.307 1.00 236.32 ? 9    DC  a C2    1 
ATOM   6109  O  O2    . DC  I  5  9    ? 224.215 304.293 161.655 1.00 244.60 ? 9    DC  a O2    1 
ATOM   6110  N  N3    . DC  I  5  9    ? 225.399 303.619 163.473 1.00 218.83 ? 9    DC  a N3    1 
ATOM   6111  C  C4    . DC  I  5  9    ? 225.935 302.604 164.152 1.00 219.82 ? 9    DC  a C4    1 
ATOM   6112  N  N4    . DC  I  5  9    ? 226.590 302.878 165.285 1.00 223.87 ? 9    DC  a N4    1 
ATOM   6113  C  C5    . DC  I  5  9    ? 225.859 301.264 163.683 1.00 225.60 ? 9    DC  a C5    1 
ATOM   6114  C  C6    . DC  I  5  9    ? 225.206 301.039 162.541 1.00 232.13 ? 9    DC  a C6    1 
ATOM   6115  P  P     . DC  I  5  10   ? 223.887 301.344 156.426 1.00 224.33 ? 10   DC  a P     1 
ATOM   6116  O  OP1   . DC  I  5  10   ? 222.932 301.336 155.296 1.00 211.57 ? 10   DC  a OP1   1 
ATOM   6117  O  OP2   . DC  I  5  10   ? 225.107 300.506 156.363 1.00 219.64 ? 10   DC  a OP2   1 
ATOM   6118  O  "O5'" . DC  I  5  10   ? 224.337 302.850 156.708 1.00 243.36 ? 10   DC  a "O5'" 1 
ATOM   6119  C  "C5'" . DC  I  5  10   ? 223.421 303.757 157.303 1.00 243.25 ? 10   DC  a "C5'" 1 
ATOM   6120  C  "C4'" . DC  I  5  10   ? 224.011 305.151 157.365 1.00 247.57 ? 10   DC  a "C4'" 1 
ATOM   6121  O  "O4'" . DC  I  5  10   ? 224.586 305.383 158.676 1.00 249.65 ? 10   DC  a "O4'" 1 
ATOM   6122  C  "C3'" . DC  I  5  10   ? 225.119 305.418 156.352 1.00 249.09 ? 10   DC  a "C3'" 1 
ATOM   6123  O  "O3'" . DC  I  5  10   ? 224.957 306.713 155.803 1.00 251.77 ? 10   DC  a "O3'" 1 
ATOM   6124  C  "C2'" . DC  I  5  10   ? 226.397 305.308 157.188 1.00 247.75 ? 10   DC  a "C2'" 1 
ATOM   6125  C  "C1'" . DC  I  5  10   ? 225.929 305.801 158.548 1.00 246.01 ? 10   DC  a "C1'" 1 
ATOM   6126  N  N1    . DC  I  5  10   ? 226.698 305.226 159.690 1.00 245.26 ? 10   DC  a N1    1 
ATOM   6127  C  C2    . DC  I  5  10   ? 227.202 306.072 160.685 1.00 239.95 ? 10   DC  a C2    1 
ATOM   6128  O  O2    . DC  I  5  10   ? 227.014 307.289 160.587 1.00 236.43 ? 10   DC  a O2    1 
ATOM   6129  N  N3    . DC  I  5  10   ? 227.895 305.528 161.718 1.00 239.76 ? 10   DC  a N3    1 
ATOM   6130  C  C4    . DC  I  5  10   ? 228.073 304.206 161.779 1.00 236.31 ? 10   DC  a C4    1 
ATOM   6131  N  N4    . DC  I  5  10   ? 228.758 303.709 162.815 1.00 231.49 ? 10   DC  a N4    1 
ATOM   6132  C  C5    . DC  I  5  10   ? 227.564 303.331 160.776 1.00 236.32 ? 10   DC  a C5    1 
ATOM   6133  C  C6    . DC  I  5  10   ? 226.889 303.879 159.761 1.00 238.94 ? 10   DC  a C6    1 
ATOM   6134  P  P     . DC  I  5  11   ? 225.809 307.165 154.521 1.00 217.33 ? 11   DC  a P     1 
ATOM   6135  O  OP1   . DC  I  5  11   ? 224.873 307.777 153.552 1.00 212.48 ? 11   DC  a OP1   1 
ATOM   6136  O  OP2   . DC  I  5  11   ? 226.656 306.027 154.104 1.00 215.51 ? 11   DC  a OP2   1 
ATOM   6137  O  "O5'" . DC  I  5  11   ? 226.763 308.306 155.101 1.00 238.78 ? 11   DC  a "O5'" 1 
ATOM   6138  C  "C5'" . DC  I  5  11   ? 226.226 309.290 155.974 1.00 243.86 ? 11   DC  a "C5'" 1 
ATOM   6139  C  "C4'" . DC  I  5  11   ? 227.337 310.077 156.639 1.00 250.54 ? 11   DC  a "C4'" 1 
ATOM   6140  O  "O4'" . DC  I  5  11   ? 227.808 309.364 157.814 1.00 248.06 ? 11   DC  a "O4'" 1 
ATOM   6141  C  "C3'" . DC  I  5  11   ? 228.566 310.310 155.758 1.00 256.81 ? 11   DC  a "C3'" 1 
ATOM   6142  O  "O3'" . DC  I  5  11   ? 228.998 311.656 155.878 1.00 266.41 ? 11   DC  a "O3'" 1 
ATOM   6143  C  "C2'" . DC  I  5  11   ? 229.595 309.338 156.331 1.00 251.36 ? 11   DC  a "C2'" 1 
ATOM   6144  C  "C1'" . DC  I  5  11   ? 229.215 309.335 157.799 1.00 248.03 ? 11   DC  a "C1'" 1 
ATOM   6145  N  N1    . DC  I  5  11   ? 229.676 308.123 158.535 1.00 244.27 ? 11   DC  a N1    1 
ATOM   6146  C  C2    . DC  I  5  11   ? 230.367 308.269 159.742 1.00 243.54 ? 11   DC  a C2    1 
ATOM   6147  O  O2    . DC  I  5  11   ? 230.588 309.408 160.170 1.00 245.67 ? 11   DC  a O2    1 
ATOM   6148  N  N3    . DC  I  5  11   ? 230.789 307.157 160.397 1.00 237.90 ? 11   DC  a N3    1 
ATOM   6149  C  C4    . DC  I  5  11   ? 230.536 305.950 159.889 1.00 235.10 ? 11   DC  a C4    1 
ATOM   6150  N  N4    . DC  I  5  11   ? 230.961 304.880 160.569 1.00 236.03 ? 11   DC  a N4    1 
ATOM   6151  C  C5    . DC  I  5  11   ? 229.826 305.782 158.663 1.00 235.08 ? 11   DC  a C5    1 
ATOM   6152  C  C6    . DC  I  5  11   ? 229.425 306.884 158.024 1.00 237.61 ? 11   DC  a C6    1 
ATOM   6153  P  P     . DG  I  5  12   ? 229.754 312.373 154.655 1.00 239.19 ? 12   DG  a P     1 
ATOM   6154  O  OP1   . DG  I  5  12   ? 228.886 313.469 154.172 1.00 227.84 ? 12   DG  a OP1   1 
ATOM   6155  O  OP2   . DG  I  5  12   ? 230.194 311.317 153.717 1.00 236.64 ? 12   DG  a OP2   1 
ATOM   6156  O  "O5'" . DG  I  5  12   ? 231.057 313.002 155.332 1.00 211.10 ? 12   DG  a "O5'" 1 
ATOM   6157  C  "C5'" . DG  I  5  12   ? 230.922 313.882 156.441 1.00 217.30 ? 12   DG  a "C5'" 1 
ATOM   6158  C  "C4'" . DG  I  5  12   ? 232.093 313.729 157.395 1.00 232.30 ? 12   DG  a "C4'" 1 
ATOM   6159  O  "O4'" . DG  I  5  12   ? 232.050 312.421 158.003 1.00 236.92 ? 12   DG  a "O4'" 1 
ATOM   6160  C  "C3'" . DG  I  5  12   ? 233.473 313.860 156.744 1.00 239.96 ? 12   DG  a "C3'" 1 
ATOM   6161  O  "O3'" . DG  I  5  12   ? 234.180 314.950 157.317 1.00 245.52 ? 12   DG  a "O3'" 1 
ATOM   6162  C  "C2'" . DG  I  5  12   ? 234.167 312.520 157.031 1.00 242.91 ? 12   DG  a "C2'" 1 
ATOM   6163  C  "C1'" . DG  I  5  12   ? 233.360 311.963 158.196 1.00 239.55 ? 12   DG  a "C1'" 1 
ATOM   6164  N  N9    . DG  I  5  12   ? 233.335 310.503 158.229 1.00 234.36 ? 12   DG  a N9    1 
ATOM   6165  C  C8    . DG  I  5  12   ? 232.749 309.668 157.311 1.00 234.97 ? 12   DG  a C8    1 
ATOM   6166  N  N7    . DG  I  5  12   ? 232.884 308.404 157.595 1.00 230.74 ? 12   DG  a N7    1 
ATOM   6167  C  C5    . DG  I  5  12   ? 233.610 308.397 158.776 1.00 228.24 ? 12   DG  a C5    1 
ATOM   6168  C  C6    . DG  I  5  12   ? 234.069 307.311 159.558 1.00 226.87 ? 12   DG  a C6    1 
ATOM   6169  O  O6    . DG  I  5  12   ? 233.901 306.101 159.357 1.00 222.01 ? 12   DG  a O6    1 
ATOM   6170  N  N1    . DG  I  5  12   ? 234.767 307.743 160.681 1.00 227.29 ? 12   DG  a N1    1 
ATOM   6171  C  C2    . DG  I  5  12   ? 234.995 309.059 161.007 1.00 222.98 ? 12   DG  a C2    1 
ATOM   6172  N  N2    . DG  I  5  12   ? 235.702 309.286 162.123 1.00 223.70 ? 12   DG  a N2    1 
ATOM   6173  N  N3    . DG  I  5  12   ? 234.586 310.086 160.274 1.00 218.51 ? 12   DG  a N3    1 
ATOM   6174  C  C4    . DG  I  5  12   ? 233.901 309.682 159.179 1.00 226.46 ? 12   DG  a C4    1 
ATOM   6175  P  P     . DG  I  5  13   ? 235.529 315.486 156.627 1.00 241.48 ? 13   DG  a P     1 
ATOM   6176  O  OP1   . DG  I  5  13   ? 235.595 316.948 156.840 1.00 243.06 ? 13   DG  a OP1   1 
ATOM   6177  O  OP2   . DG  I  5  13   ? 235.580 314.940 155.253 1.00 238.33 ? 13   DG  a OP2   1 
ATOM   6178  O  "O5'" . DG  I  5  13   ? 236.692 314.788 157.473 1.00 184.53 ? 13   DG  a "O5'" 1 
ATOM   6179  C  "C5'" . DG  I  5  13   ? 236.776 315.009 158.874 1.00 198.43 ? 13   DG  a "C5'" 1 
ATOM   6180  C  "C4'" . DG  I  5  13   ? 237.732 314.024 159.518 1.00 216.54 ? 13   DG  a "C4'" 1 
ATOM   6181  O  "O4'" . DG  I  5  13   ? 237.162 312.701 159.478 1.00 222.42 ? 13   DG  a "O4'" 1 
ATOM   6182  C  "C3'" . DG  I  5  13   ? 239.101 313.917 158.839 1.00 225.66 ? 13   DG  a "C3'" 1 
ATOM   6183  O  "O3'" . DG  I  5  13   ? 240.113 314.424 159.698 1.00 231.82 ? 13   DG  a "O3'" 1 
ATOM   6184  C  "C2'" . DG  I  5  13   ? 239.286 312.414 158.568 1.00 225.38 ? 13   DG  a "C2'" 1 
ATOM   6185  C  "C1'" . DG  I  5  13   ? 238.207 311.770 159.427 1.00 222.94 ? 13   DG  a "C1'" 1 
ATOM   6186  N  N9    . DG  I  5  13   ? 237.690 310.523 158.874 1.00 218.03 ? 13   DG  a N9    1 
ATOM   6187  C  C8    . DG  I  5  13   ? 236.874 310.377 157.778 1.00 210.15 ? 13   DG  a C8    1 
ATOM   6188  N  N7    . DG  I  5  13   ? 236.574 309.135 157.517 1.00 207.06 ? 13   DG  a N7    1 
ATOM   6189  C  C5    . DG  I  5  13   ? 237.234 308.412 158.501 1.00 211.56 ? 13   DG  a C5    1 
ATOM   6190  C  C6    . DG  I  5  13   ? 237.285 307.016 158.726 1.00 213.78 ? 13   DG  a C6    1 
ATOM   6191  O  O6    . DG  I  5  13   ? 236.728 306.113 158.084 1.00 214.44 ? 13   DG  a O6    1 
ATOM   6192  N  N1    . DG  I  5  13   ? 238.065 306.701 159.836 1.00 216.93 ? 13   DG  a N1    1 
ATOM   6193  C  C2    . DG  I  5  13   ? 238.716 307.620 160.624 1.00 220.03 ? 13   DG  a C2    1 
ATOM   6194  N  N2    . DG  I  5  13   ? 239.433 307.134 161.649 1.00 221.78 ? 13   DG  a N2    1 
ATOM   6195  N  N3    . DG  I  5  13   ? 238.684 308.929 160.417 1.00 220.85 ? 13   DG  a N3    1 
ATOM   6196  C  C4    . DG  I  5  13   ? 237.923 309.251 159.344 1.00 216.87 ? 13   DG  a C4    1 
ATOM   6197  P  P     . DT  I  5  14   ? 241.628 314.540 159.177 1.00 210.64 ? 14   DT  a P     1 
ATOM   6198  O  OP1   . DT  I  5  14   ? 242.275 315.641 159.925 1.00 206.10 ? 14   DT  a OP1   1 
ATOM   6199  O  OP2   . DT  I  5  14   ? 241.597 314.573 157.698 1.00 207.96 ? 14   DT  a OP2   1 
ATOM   6200  O  "O5'" . DT  I  5  14   ? 242.293 313.157 159.624 1.00 213.89 ? 14   DT  a "O5'" 1 
ATOM   6201  C  "C5'" . DT  I  5  14   ? 242.257 312.765 160.990 1.00 215.39 ? 14   DT  a "C5'" 1 
ATOM   6202  C  "C4'" . DT  I  5  14   ? 243.022 311.470 161.200 1.00 218.88 ? 14   DT  a "C4'" 1 
ATOM   6203  O  "O4'" . DT  I  5  14   ? 242.214 310.347 160.758 1.00 220.84 ? 14   DT  a "O4'" 1 
ATOM   6204  C  "C3'" . DT  I  5  14   ? 244.348 311.370 160.444 1.00 218.83 ? 14   DT  a "C3'" 1 
ATOM   6205  O  "O3'" . DT  I  5  14   ? 245.355 310.858 161.303 1.00 220.10 ? 14   DT  a "O3'" 1 
ATOM   6206  C  "C2'" . DT  I  5  14   ? 244.033 310.400 159.306 1.00 218.10 ? 14   DT  a "C2'" 1 
ATOM   6207  C  "C1'" . DT  I  5  14   ? 243.002 309.496 159.960 1.00 214.38 ? 14   DT  a "C1'" 1 
ATOM   6208  N  N1    . DT  I  5  14   ? 242.114 308.802 158.987 1.00 216.53 ? 14   DT  a N1    1 
ATOM   6209  C  C2    . DT  I  5  14   ? 241.977 307.436 159.058 1.00 204.88 ? 14   DT  a C2    1 
ATOM   6210  O  O2    . DT  I  5  14   ? 242.551 306.751 159.884 1.00 195.02 ? 14   DT  a O2    1 
ATOM   6211  N  N3    . DT  I  5  14   ? 241.138 306.894 158.122 1.00 205.79 ? 14   DT  a N3    1 
ATOM   6212  C  C4    . DT  I  5  14   ? 240.440 307.569 157.139 1.00 208.60 ? 14   DT  a C4    1 
ATOM   6213  O  O4    . DT  I  5  14   ? 239.704 306.995 156.343 1.00 204.78 ? 14   DT  a O4    1 
ATOM   6214  C  C5    . DT  I  5  14   ? 240.625 309.000 157.121 1.00 213.53 ? 14   DT  a C5    1 
ATOM   6215  C  C7    . DT  I  5  14   ? 239.916 309.838 156.099 1.00 213.11 ? 14   DT  a C7    1 
ATOM   6216  C  C6    . DT  I  5  14   ? 241.442 309.542 158.036 1.00 213.90 ? 14   DT  a C6    1 
ATOM   6217  P  P     . DG  I  5  15   ? 246.907 311.074 160.952 1.00 198.16 ? 15   DG  a P     1 
ATOM   6218  O  OP1   . DG  I  5  15   ? 247.527 311.801 162.082 1.00 192.01 ? 15   DG  a OP1   1 
ATOM   6219  O  OP2   . DG  I  5  15   ? 246.996 311.629 159.584 1.00 181.41 ? 15   DG  a OP2   1 
ATOM   6220  O  "O5'" . DG  I  5  15   ? 247.494 309.588 160.917 1.00 239.48 ? 15   DG  a "O5'" 1 
ATOM   6221  C  "C5'" . DG  I  5  15   ? 247.317 308.730 162.038 1.00 232.91 ? 15   DG  a "C5'" 1 
ATOM   6222  C  "C4'" . DG  I  5  15   ? 247.545 307.279 161.654 1.00 222.90 ? 15   DG  a "C4'" 1 
ATOM   6223  O  "O4'" . DG  I  5  15   ? 246.481 306.832 160.772 1.00 220.73 ? 15   DG  a "O4'" 1 
ATOM   6224  C  "C3'" . DG  I  5  15   ? 248.851 307.001 160.914 1.00 215.46 ? 15   DG  a "C3'" 1 
ATOM   6225  O  "O3'" . DG  I  5  15   ? 249.381 305.754 161.336 1.00 214.13 ? 15   DG  a "O3'" 1 
ATOM   6226  C  "C2'" . DG  I  5  15   ? 248.412 306.957 159.455 1.00 212.09 ? 15   DG  a "C2'" 1 
ATOM   6227  C  "C1'" . DG  I  5  15   ? 247.034 306.325 159.575 1.00 215.07 ? 15   DG  a "C1'" 1 
ATOM   6228  N  N9    . DG  I  5  15   ? 246.134 306.664 158.477 1.00 191.36 ? 15   DG  a N9    1 
ATOM   6229  C  C8    . DG  I  5  15   ? 245.907 307.913 157.952 1.00 192.01 ? 15   DG  a C8    1 
ATOM   6230  N  N7    . DG  I  5  15   ? 245.041 307.918 156.976 1.00 188.11 ? 15   DG  a N7    1 
ATOM   6231  C  C5    . DG  I  5  15   ? 244.666 306.588 156.846 1.00 188.00 ? 15   DG  a C5    1 
ATOM   6232  C  C6    . DG  I  5  15   ? 243.752 305.982 155.951 1.00 193.29 ? 15   DG  a C6    1 
ATOM   6233  O  O6    . DG  I  5  15   ? 243.073 306.524 155.069 1.00 196.22 ? 15   DG  a O6    1 
ATOM   6234  N  N1    . DG  I  5  15   ? 243.665 304.608 156.153 1.00 196.38 ? 15   DG  a N1    1 
ATOM   6235  C  C2    . DG  I  5  15   ? 244.369 303.906 157.106 1.00 195.61 ? 15   DG  a C2    1 
ATOM   6236  N  N2    . DG  I  5  15   ? 244.160 302.584 157.154 1.00 189.69 ? 15   DG  a N2    1 
ATOM   6237  N  N3    . DG  I  5  15   ? 245.232 304.463 157.948 1.00 194.56 ? 15   DG  a N3    1 
ATOM   6238  C  C4    . DG  I  5  15   ? 245.330 305.801 157.761 1.00 190.79 ? 15   DG  a C4    1 
ATOM   6239  P  P     . DC  I  5  16   ? 250.933 305.411 161.114 1.00 198.55 ? 16   DC  a P     1 
ATOM   6240  O  OP1   . DC  I  5  16   ? 251.554 305.252 162.448 1.00 196.80 ? 16   DC  a OP1   1 
ATOM   6241  O  OP2   . DC  I  5  16   ? 251.490 306.392 160.157 1.00 185.92 ? 16   DC  a OP2   1 
ATOM   6242  O  "O5'" . DC  I  5  16   ? 250.897 303.986 160.392 1.00 216.99 ? 16   DC  a "O5'" 1 
ATOM   6243  C  "C5'" . DC  I  5  16   ? 250.045 302.962 160.891 1.00 211.02 ? 16   DC  a "C5'" 1 
ATOM   6244  C  "C4'" . DC  I  5  16   ? 249.786 301.910 159.828 1.00 200.11 ? 16   DC  a "C4'" 1 
ATOM   6245  O  "O4'" . DC  I  5  16   ? 248.760 302.380 158.911 1.00 198.04 ? 16   DC  a "O4'" 1 
ATOM   6246  C  "C3'" . DC  I  5  16   ? 250.997 301.556 158.967 1.00 185.87 ? 16   DC  a "C3'" 1 
ATOM   6247  O  "O3'" . DC  I  5  16   ? 251.033 300.159 158.738 1.00 172.61 ? 16   DC  a "O3'" 1 
ATOM   6248  C  "C2'" . DC  I  5  16   ? 250.736 302.326 157.674 1.00 184.15 ? 16   DC  a "C2'" 1 
ATOM   6249  C  "C1'" . DC  I  5  16   ? 249.222 302.247 157.586 1.00 188.97 ? 16   DC  a "C1'" 1 
ATOM   6250  N  N1    . DC  I  5  16   ? 248.618 303.330 156.765 1.00 191.60 ? 16   DC  a N1    1 
ATOM   6251  C  C2    . DC  I  5  16   ? 247.670 303.012 155.788 1.00 187.07 ? 16   DC  a C2    1 
ATOM   6252  O  O2    . DC  I  5  16   ? 247.349 301.830 155.628 1.00 190.20 ? 16   DC  a O2    1 
ATOM   6253  N  N3    . DC  I  5  16   ? 247.131 304.015 155.049 1.00 180.93 ? 16   DC  a N3    1 
ATOM   6254  C  C4    . DC  I  5  16   ? 247.508 305.278 155.262 1.00 181.67 ? 16   DC  a C4    1 
ATOM   6255  N  N4    . DC  I  5  16   ? 246.955 306.235 154.511 1.00 170.31 ? 16   DC  a N4    1 
ATOM   6256  C  C5    . DC  I  5  16   ? 248.476 305.616 156.249 1.00 192.67 ? 16   DC  a C5    1 
ATOM   6257  C  C6    . DC  I  5  16   ? 249.000 304.622 156.971 1.00 191.58 ? 16   DC  a C6    1 
ATOM   6258  P  P     . DC  I  5  17   ? 251.913 299.207 159.687 1.00 195.20 ? 17   DC  a P     1 
ATOM   6259  O  OP1   . DC  I  5  17   ? 251.255 299.169 161.013 1.00 194.53 ? 17   DC  a OP1   1 
ATOM   6260  O  OP2   . DC  I  5  17   ? 253.324 299.637 159.579 1.00 190.58 ? 17   DC  a OP2   1 
ATOM   6261  O  "O5'" . DC  I  5  17   ? 251.782 297.767 159.007 1.00 189.18 ? 17   DC  a "O5'" 1 
ATOM   6262  C  "C5'" . DC  I  5  17   ? 250.501 297.172 158.849 1.00 178.78 ? 17   DC  a "C5'" 1 
ATOM   6263  C  "C4'" . DC  I  5  17   ? 250.242 296.807 157.397 1.00 164.47 ? 17   DC  a "C4'" 1 
ATOM   6264  O  "O4'" . DC  I  5  17   ? 250.094 298.017 156.603 1.00 164.97 ? 17   DC  a "O4'" 1 
ATOM   6265  C  "C3'" . DC  I  5  17   ? 251.348 295.997 156.718 1.00 162.02 ? 17   DC  a "C3'" 1 
ATOM   6266  O  "O3'" . DC  I  5  17   ? 250.763 295.055 155.833 1.00 170.43 ? 17   DC  a "O3'" 1 
ATOM   6267  C  "C2'" . DC  I  5  17   ? 252.113 297.069 155.950 1.00 160.49 ? 17   DC  a "C2'" 1 
ATOM   6268  C  "C1'" . DC  I  5  17   ? 250.961 297.945 155.494 1.00 169.06 ? 17   DC  a "C1'" 1 
ATOM   6269  N  N1    . DC  I  5  17   ? 251.359 299.326 155.108 1.00 165.10 ? 17   DC  a N1    1 
ATOM   6270  C  C2    . DC  I  5  17   ? 250.577 300.031 154.188 1.00 169.06 ? 17   DC  a C2    1 
ATOM   6271  O  O2    . DC  I  5  17   ? 249.563 299.491 153.732 1.00 168.20 ? 17   DC  a O2    1 
ATOM   6272  N  N3    . DC  I  5  17   ? 250.939 301.292 153.849 1.00 170.44 ? 17   DC  a N3    1 
ATOM   6273  C  C4    . DC  I  5  17   ? 252.033 301.838 154.384 1.00 179.26 ? 17   DC  a C4    1 
ATOM   6274  N  N4    . DC  I  5  17   ? 252.363 303.078 154.010 1.00 185.79 ? 17   DC  a N4    1 
ATOM   6275  C  C5    . DC  I  5  17   ? 252.855 301.126 155.308 1.00 179.20 ? 17   DC  a C5    1 
ATOM   6276  C  C6    . DC  I  5  17   ? 252.478 299.888 155.646 1.00 165.56 ? 17   DC  a C6    1 
ATOM   6277  P  P     . DG  I  5  18   ? 251.462 293.632 155.576 1.00 166.67 ? 18   DG  a P     1 
ATOM   6278  O  OP1   . DG  I  5  18   ? 251.252 292.799 156.781 1.00 174.80 ? 18   DG  a OP1   1 
ATOM   6279  O  OP2   . DG  I  5  18   ? 252.833 293.889 155.085 1.00 157.16 ? 18   DG  a OP2   1 
ATOM   6280  O  "O5'" . DG  I  5  18   ? 250.618 293.013 154.367 1.00 180.64 ? 18   DG  a "O5'" 1 
ATOM   6281  C  "C5'" . DG  I  5  18   ? 249.194 293.051 154.400 1.00 166.23 ? 18   DG  a "C5'" 1 
ATOM   6282  C  "C4'" . DG  I  5  18   ? 248.632 293.635 153.113 1.00 155.69 ? 18   DG  a "C4'" 1 
ATOM   6283  O  "O4'" . DG  I  5  18   ? 249.065 295.015 152.973 1.00 158.85 ? 18   DG  a "O4'" 1 
ATOM   6284  C  "C3'" . DG  I  5  18   ? 249.071 292.929 151.833 1.00 156.25 ? 18   DG  a "C3'" 1 
ATOM   6285  O  "O3'" . DG  I  5  18   ? 248.011 292.948 150.883 1.00 175.70 ? 18   DG  a "O3'" 1 
ATOM   6286  C  "C2'" . DG  I  5  18   ? 250.243 293.786 151.371 1.00 151.19 ? 18   DG  a "C2'" 1 
ATOM   6287  C  "C1'" . DG  I  5  18   ? 249.758 295.174 151.753 1.00 161.10 ? 18   DG  a "C1'" 1 
ATOM   6288  N  N9    . DG  I  5  18   ? 250.839 296.134 151.956 1.00 150.54 ? 18   DG  a N9    1 
ATOM   6289  C  C8    . DG  I  5  18   ? 251.951 295.969 152.742 1.00 155.62 ? 18   DG  a C8    1 
ATOM   6290  N  N7    . DG  I  5  18   ? 252.750 296.999 152.734 1.00 164.15 ? 18   DG  a N7    1 
ATOM   6291  C  C5    . DG  I  5  18   ? 252.126 297.907 151.890 1.00 171.94 ? 18   DG  a C5    1 
ATOM   6292  C  C6    . DG  I  5  18   ? 252.521 299.210 151.504 1.00 173.99 ? 18   DG  a C6    1 
ATOM   6293  O  O6    . DG  I  5  18   ? 253.542 299.829 151.830 1.00 172.33 ? 18   DG  a O6    1 
ATOM   6294  N  N1    . DG  I  5  18   ? 251.606 299.785 150.626 1.00 177.86 ? 18   DG  a N1    1 
ATOM   6295  C  C2    . DG  I  5  18   ? 250.443 299.187 150.198 1.00 181.22 ? 18   DG  a C2    1 
ATOM   6296  N  N2    . DG  I  5  18   ? 249.681 299.895 149.354 1.00 189.27 ? 18   DG  a N2    1 
ATOM   6297  N  N3    . DG  I  5  18   ? 250.064 297.966 150.554 1.00 175.67 ? 18   DG  a N3    1 
ATOM   6298  C  C4    . DG  I  5  18   ? 250.955 297.385 151.392 1.00 167.36 ? 18   DG  a C4    1 
ATOM   6299  P  P     . DA  I  5  19   ? 248.005 291.916 149.652 1.00 130.98 ? 19   DA  a P     1 
ATOM   6300  O  OP1   . DA  I  5  19   ? 246.870 290.991 149.862 1.00 112.92 ? 19   DA  a OP1   1 
ATOM   6301  O  OP2   . DA  I  5  19   ? 249.372 291.376 149.490 1.00 124.55 ? 19   DA  a OP2   1 
ATOM   6302  O  "O5'" . DA  I  5  19   ? 247.684 292.834 148.383 1.00 137.66 ? 19   DA  a "O5'" 1 
ATOM   6303  C  "C5'" . DA  I  5  19   ? 246.374 293.353 148.198 1.00 137.35 ? 19   DA  a "C5'" 1 
ATOM   6304  C  "C4'" . DA  I  5  19   ? 246.363 294.479 147.178 1.00 129.02 ? 19   DA  a "C4'" 1 
ATOM   6305  O  "O4'" . DA  I  5  19   ? 247.331 295.491 147.551 1.00 132.60 ? 19   DA  a "O4'" 1 
ATOM   6306  C  "C3'" . DA  I  5  19   ? 246.716 294.080 145.753 1.00 125.35 ? 19   DA  a "C3'" 1 
ATOM   6307  O  "O3'" . DA  I  5  19   ? 246.012 294.911 144.843 1.00 121.85 ? 19   DA  a "O3'" 1 
ATOM   6308  C  "C2'" . DA  I  5  19   ? 248.216 294.339 145.699 1.00 130.47 ? 19   DA  a "C2'" 1 
ATOM   6309  C  "C1'" . DA  I  5  19   ? 248.340 295.587 146.565 1.00 139.65 ? 19   DA  a "C1'" 1 
ATOM   6310  N  N9    . DA  I  5  19   ? 249.621 295.702 147.252 1.00 155.91 ? 19   DA  a N9    1 
ATOM   6311  C  C8    . DA  I  5  19   ? 250.136 294.836 148.170 1.00 165.32 ? 19   DA  a C8    1 
ATOM   6312  N  N7    . DA  I  5  19   ? 251.303 295.198 148.644 1.00 168.85 ? 19   DA  a N7    1 
ATOM   6313  C  C5    . DA  I  5  19   ? 251.568 296.390 147.997 1.00 163.68 ? 19   DA  a C5    1 
ATOM   6314  C  C6    . DA  I  5  19   ? 252.654 297.281 148.065 1.00 165.89 ? 19   DA  a C6    1 
ATOM   6315  N  N6    . DA  I  5  19   ? 253.716 297.083 148.851 1.00 164.45 ? 19   DA  a N6    1 
ATOM   6316  N  N1    . DA  I  5  19   ? 252.610 298.380 147.286 1.00 168.88 ? 19   DA  a N1    1 
ATOM   6317  C  C2    . DA  I  5  19   ? 251.543 298.576 146.503 1.00 156.90 ? 19   DA  a C2    1 
ATOM   6318  N  N3    . DA  I  5  19   ? 250.464 297.806 146.352 1.00 144.62 ? 19   DA  a N3    1 
ATOM   6319  C  C4    . DA  I  5  19   ? 250.545 296.715 147.129 1.00 155.60 ? 19   DA  a C4    1 
ATOM   6320  P  P     . DG  I  5  20   ? 245.828 294.468 143.313 1.00 157.59 ? 20   DG  a P     1 
ATOM   6321  O  OP1   . DG  I  5  20   ? 244.490 294.921 142.879 1.00 161.61 ? 20   DG  a OP1   1 
ATOM   6322  O  OP2   . DG  I  5  20   ? 246.197 293.040 143.204 1.00 139.66 ? 20   DG  a OP2   1 
ATOM   6323  O  "O5'" . DG  I  5  20   ? 246.926 295.326 142.535 1.00 147.06 ? 20   DG  a "O5'" 1 
ATOM   6324  C  "C5'" . DG  I  5  20   ? 246.839 296.744 142.531 1.00 139.81 ? 20   DG  a "C5'" 1 
ATOM   6325  C  "C4'" . DG  I  5  20   ? 248.069 297.356 141.895 1.00 144.51 ? 20   DG  a "C4'" 1 
ATOM   6326  O  "O4'" . DG  I  5  20   ? 249.156 297.383 142.857 1.00 150.69 ? 20   DG  a "O4'" 1 
ATOM   6327  C  "C3'" . DG  I  5  20   ? 248.599 296.613 140.665 1.00 151.54 ? 20   DG  a "C3'" 1 
ATOM   6328  O  "O3'" . DG  I  5  20   ? 248.864 297.537 139.621 1.00 167.58 ? 20   DG  a "O3'" 1 
ATOM   6329  C  "C2'" . DG  I  5  20   ? 249.882 295.957 141.175 1.00 142.33 ? 20   DG  a "C2'" 1 
ATOM   6330  C  "C1'" . DG  I  5  20   ? 250.335 296.953 142.227 1.00 156.34 ? 20   DG  a "C1'" 1 
ATOM   6331  N  N9    . DG  I  5  20   ? 251.220 296.376 143.231 1.00 151.71 ? 20   DG  a N9    1 
ATOM   6332  C  C8    . DG  I  5  20   ? 250.994 295.253 143.987 1.00 149.74 ? 20   DG  a C8    1 
ATOM   6333  N  N7    . DG  I  5  20   ? 251.968 294.970 144.805 1.00 152.45 ? 20   DG  a N7    1 
ATOM   6334  C  C5    . DG  I  5  20   ? 252.905 295.970 144.576 1.00 158.60 ? 20   DG  a C5    1 
ATOM   6335  C  C6    . DG  I  5  20   ? 254.166 296.187 145.172 1.00 158.74 ? 20   DG  a C6    1 
ATOM   6336  O  O6    . DG  I  5  20   ? 254.726 295.514 146.046 1.00 159.64 ? 20   DG  a O6    1 
ATOM   6337  N  N1    . DG  I  5  20   ? 254.798 297.316 144.650 1.00 167.49 ? 20   DG  a N1    1 
ATOM   6338  C  C2    . DG  I  5  20   ? 254.266 298.133 143.680 1.00 180.07 ? 20   DG  a C2    1 
ATOM   6339  N  N2    . DG  I  5  20   ? 255.016 299.178 143.299 1.00 194.66 ? 20   DG  a N2    1 
ATOM   6340  N  N3    . DG  I  5  20   ? 253.083 297.938 143.113 1.00 171.05 ? 20   DG  a N3    1 
ATOM   6341  C  C4    . DG  I  5  20   ? 252.461 296.841 143.607 1.00 161.36 ? 20   DG  a C4    1 
ATOM   6342  P  P     . DG  I  5  21   ? 249.059 297.030 138.110 1.00 168.39 ? 21   DG  a P     1 
ATOM   6343  O  OP1   . DG  I  5  21   ? 247.953 297.596 137.309 1.00 157.66 ? 21   DG  a OP1   1 
ATOM   6344  O  OP2   . DG  I  5  21   ? 249.275 295.566 138.124 1.00 157.63 ? 21   DG  a OP2   1 
ATOM   6345  O  "O5'" . DG  I  5  21   ? 250.426 297.726 137.659 1.00 166.36 ? 21   DG  a "O5'" 1 
ATOM   6346  C  "C5'" . DG  I  5  21   ? 250.593 299.125 137.837 1.00 166.96 ? 21   DG  a "C5'" 1 
ATOM   6347  C  "C4'" . DG  I  5  21   ? 252.061 299.487 137.977 1.00 176.49 ? 21   DG  a "C4'" 1 
ATOM   6348  O  "O4'" . DG  I  5  21   ? 252.596 298.912 139.200 1.00 176.73 ? 21   DG  a "O4'" 1 
ATOM   6349  C  "C3'" . DG  I  5  21   ? 252.962 298.998 136.842 1.00 184.61 ? 21   DG  a "C3'" 1 
ATOM   6350  O  "O3'" . DG  I  5  21   ? 253.827 300.051 136.436 1.00 191.84 ? 21   DG  a "O3'" 1 
ATOM   6351  C  "C2'" . DG  I  5  21   ? 253.737 297.842 137.477 1.00 182.44 ? 21   DG  a "C2'" 1 
ATOM   6352  C  "C1'" . DG  I  5  21   ? 253.831 298.294 138.923 1.00 181.10 ? 21   DG  a "C1'" 1 
ATOM   6353  N  N9    . DG  I  5  21   ? 254.023 297.198 139.869 1.00 166.27 ? 21   DG  a N9    1 
ATOM   6354  C  C8    . DG  I  5  21   ? 253.122 296.208 140.173 1.00 170.46 ? 21   DG  a C8    1 
ATOM   6355  N  N7    . DG  I  5  21   ? 253.559 295.360 141.059 1.00 171.74 ? 21   DG  a N7    1 
ATOM   6356  C  C5    . DG  I  5  21   ? 254.835 295.815 141.365 1.00 170.53 ? 21   DG  a C5    1 
ATOM   6357  C  C6    . DG  I  5  21   ? 255.795 295.295 142.262 1.00 174.74 ? 21   DG  a C6    1 
ATOM   6358  O  O6    . DG  I  5  21   ? 255.700 294.298 142.990 1.00 173.75 ? 21   DG  a O6    1 
ATOM   6359  N  N1    . DG  I  5  21   ? 256.961 296.056 142.273 1.00 180.10 ? 21   DG  a N1    1 
ATOM   6360  C  C2    . DG  I  5  21   ? 257.170 297.182 141.510 1.00 174.93 ? 21   DG  a C2    1 
ATOM   6361  N  N2    . DG  I  5  21   ? 258.360 297.787 141.649 1.00 159.95 ? 21   DG  a N2    1 
ATOM   6362  N  N3    . DG  I  5  21   ? 256.278 297.678 140.660 1.00 175.73 ? 21   DG  a N3    1 
ATOM   6363  C  C4    . DG  I  5  21   ? 255.137 296.945 140.639 1.00 170.14 ? 21   DG  a C4    1 
ATOM   6364  P  P     . DC  I  5  22   ? 254.605 299.981 135.031 1.00 197.59 ? 22   DC  a P     1 
ATOM   6365  O  OP1   . DC  I  5  22   ? 254.125 301.109 134.203 1.00 202.21 ? 22   DC  a OP1   1 
ATOM   6366  O  OP2   . DC  I  5  22   ? 254.510 298.599 134.510 1.00 183.05 ? 22   DC  a OP2   1 
ATOM   6367  O  "O5'" . DC  I  5  22   ? 256.124 300.256 135.438 1.00 178.55 ? 22   DC  a "O5'" 1 
ATOM   6368  C  "C5'" . DC  I  5  22   ? 256.605 299.797 136.694 1.00 174.68 ? 22   DC  a "C5'" 1 
ATOM   6369  C  "C4'" . DC  I  5  22   ? 258.101 300.002 136.809 1.00 173.55 ? 22   DC  a "C4'" 1 
ATOM   6370  O  "O4'" . DC  I  5  22   ? 258.607 299.201 137.903 1.00 175.52 ? 22   DC  a "O4'" 1 
ATOM   6371  C  "C3'" . DC  I  5  22   ? 258.897 299.554 135.600 1.00 182.34 ? 22   DC  a "C3'" 1 
ATOM   6372  O  "O3'" . DC  I  5  22   ? 260.142 300.234 135.566 1.00 193.53 ? 22   DC  a "O3'" 1 
ATOM   6373  C  "C2'" . DC  I  5  22   ? 259.076 298.067 135.876 1.00 183.27 ? 22   DC  a "C2'" 1 
ATOM   6374  C  "C1'" . DC  I  5  22   ? 259.245 298.040 137.396 1.00 183.32 ? 22   DC  a "C1'" 1 
ATOM   6375  N  N1    . DC  I  5  22   ? 258.627 296.847 138.041 1.00 178.90 ? 22   DC  a N1    1 
ATOM   6376  C  C2    . DC  I  5  22   ? 259.362 296.100 138.970 1.00 172.77 ? 22   DC  a C2    1 
ATOM   6377  O  O2    . DC  I  5  22   ? 260.516 296.449 139.237 1.00 177.84 ? 22   DC  a O2    1 
ATOM   6378  N  N3    . DC  I  5  22   ? 258.783 295.017 139.545 1.00 164.65 ? 22   DC  a N3    1 
ATOM   6379  C  C4    . DC  I  5  22   ? 257.532 294.679 139.223 1.00 162.65 ? 22   DC  a C4    1 
ATOM   6380  N  N4    . DC  I  5  22   ? 256.997 293.604 139.812 1.00 150.51 ? 22   DC  a N4    1 
ATOM   6381  C  C5    . DC  I  5  22   ? 256.771 295.428 138.278 1.00 166.30 ? 22   DC  a C5    1 
ATOM   6382  C  C6    . DC  I  5  22   ? 257.352 296.491 137.719 1.00 169.49 ? 22   DC  a C6    1 
ATOM   6383  P  P     . DC  I  5  23   ? 261.153 300.014 134.338 1.00 204.91 ? 23   DC  a P     1 
ATOM   6384  O  OP1   . DC  I  5  23   ? 261.823 301.306 134.074 1.00 205.19 ? 23   DC  a OP1   1 
ATOM   6385  O  OP2   . DC  I  5  23   ? 260.414 299.335 133.251 1.00 200.63 ? 23   DC  a OP2   1 
ATOM   6386  O  "O5'" . DC  I  5  23   ? 262.231 298.987 134.918 1.00 160.08 ? 23   DC  a "O5'" 1 
ATOM   6387  C  "C5'" . DC  I  5  23   ? 262.946 299.307 136.105 1.00 163.73 ? 23   DC  a "C5'" 1 
ATOM   6388  C  "C4'" . DC  I  5  23   ? 263.966 298.231 136.429 1.00 176.22 ? 23   DC  a "C4'" 1 
ATOM   6389  O  "O4'" . DC  I  5  23   ? 263.326 297.147 137.152 1.00 182.90 ? 23   DC  a "O4'" 1 
ATOM   6390  C  "C3'" . DC  I  5  23   ? 264.639 297.594 135.218 1.00 181.68 ? 23   DC  a "C3'" 1 
ATOM   6391  O  "O3'" . DC  I  5  23   ? 266.008 297.348 135.500 1.00 181.92 ? 23   DC  a "O3'" 1 
ATOM   6392  C  "C2'" . DC  I  5  23   ? 263.861 296.294 135.040 1.00 186.89 ? 23   DC  a "C2'" 1 
ATOM   6393  C  "C1'" . DC  I  5  23   ? 263.553 295.925 136.483 1.00 184.16 ? 23   DC  a "C1'" 1 
ATOM   6394  N  N1    . DC  I  5  23   ? 262.340 295.077 136.637 1.00 176.99 ? 23   DC  a N1    1 
ATOM   6395  C  C2    . DC  I  5  23   ? 262.357 293.990 137.520 1.00 175.49 ? 23   DC  a C2    1 
ATOM   6396  O  O2    . DC  I  5  23   ? 263.390 293.752 138.154 1.00 170.47 ? 23   DC  a O2    1 
ATOM   6397  N  N3    . DC  I  5  23   ? 261.238 293.233 137.647 1.00 175.13 ? 23   DC  a N3    1 
ATOM   6398  C  C4    . DC  I  5  23   ? 260.145 293.533 136.940 1.00 166.25 ? 23   DC  a C4    1 
ATOM   6399  N  N4    . DC  I  5  23   ? 259.064 292.762 137.094 1.00 161.55 ? 23   DC  a N4    1 
ATOM   6400  C  C5    . DC  I  5  23   ? 260.113 294.635 136.039 1.00 160.06 ? 23   DC  a C5    1 
ATOM   6401  C  C6    . DC  I  5  23   ? 261.221 295.372 135.920 1.00 164.03 ? 23   DC  a C6    1 
ATOM   6402  P  P     . DG  I  5  24   ? 267.079 297.273 134.305 1.00 204.93 ? 24   DG  a P     1 
ATOM   6403  O  OP1   . DG  I  5  24   ? 268.368 297.782 134.820 1.00 209.37 ? 24   DG  a OP1   1 
ATOM   6404  O  OP2   . DG  I  5  24   ? 266.464 297.899 133.113 1.00 207.94 ? 24   DG  a OP2   1 
ATOM   6405  O  "O5'" . DG  I  5  24   ? 267.218 295.709 134.016 1.00 164.00 ? 24   DG  a "O5'" 1 
ATOM   6406  C  "C5'" . DG  I  5  24   ? 268.503 295.103 133.983 1.00 163.15 ? 24   DG  a "C5'" 1 
ATOM   6407  C  "C4'" . DG  I  5  24   ? 268.784 294.359 135.276 1.00 156.13 ? 24   DG  a "C4'" 1 
ATOM   6408  O  "O4'" . DG  I  5  24   ? 267.533 294.034 135.930 1.00 157.08 ? 24   DG  a "O4'" 1 
ATOM   6409  C  "C3'" . DG  I  5  24   ? 269.476 293.023 135.097 1.00 160.35 ? 24   DG  a "C3'" 1 
ATOM   6410  O  "O3'" . DG  I  5  24   ? 270.104 292.640 136.310 1.00 161.45 ? 24   DG  a "O3'" 1 
ATOM   6411  C  "C2'" . DG  I  5  24   ? 268.291 292.123 134.779 1.00 170.58 ? 24   DG  a "C2'" 1 
ATOM   6412  C  "C1'" . DG  I  5  24   ? 267.242 292.658 135.748 1.00 165.02 ? 24   DG  a "C1'" 1 
ATOM   6413  N  N9    . DG  I  5  24   ? 265.867 292.547 135.264 1.00 167.51 ? 24   DG  a N9    1 
ATOM   6414  C  C8    . DG  I  5  24   ? 265.248 293.371 134.358 1.00 161.02 ? 24   DG  a C8    1 
ATOM   6415  N  N7    . DG  I  5  24   ? 264.006 293.054 134.126 1.00 154.53 ? 24   DG  a N7    1 
ATOM   6416  C  C5    . DG  I  5  24   ? 263.778 291.951 134.936 1.00 156.01 ? 24   DG  a C5    1 
ATOM   6417  C  C6    . DG  I  5  24   ? 262.607 291.178 135.107 1.00 150.14 ? 24   DG  a C6    1 
ATOM   6418  O  O6    . DG  I  5  24   ? 261.509 291.322 134.551 1.00 146.02 ? 24   DG  a O6    1 
ATOM   6419  N  N1    . DG  I  5  24   ? 262.798 290.143 136.018 1.00 145.59 ? 24   DG  a N1    1 
ATOM   6420  C  C2    . DG  I  5  24   ? 263.974 289.890 136.684 1.00 151.64 ? 24   DG  a C2    1 
ATOM   6421  N  N2    . DG  I  5  24   ? 263.971 288.851 137.534 1.00 153.01 ? 24   DG  a N2    1 
ATOM   6422  N  N3    . DG  I  5  24   ? 265.081 290.615 136.538 1.00 152.92 ? 24   DG  a N3    1 
ATOM   6423  C  C4    . DG  I  5  24   ? 264.911 291.624 135.648 1.00 157.99 ? 24   DG  a C4    1 
ATOM   6424  P  P     . DC  I  5  25   ? 271.301 291.570 136.296 1.00 163.08 ? 25   DC  a P     1 
ATOM   6425  O  OP1   . DC  I  5  25   ? 271.964 291.617 137.620 1.00 161.05 ? 25   DC  a OP1   1 
ATOM   6426  O  OP2   . DC  I  5  25   ? 272.092 291.800 135.068 1.00 166.43 ? 25   DC  a OP2   1 
ATOM   6427  O  "O5'" . DC  I  5  25   ? 270.560 290.162 136.146 1.00 165.10 ? 25   DC  a "O5'" 1 
ATOM   6428  C  "C5'" . DC  I  5  25   ? 269.755 289.660 137.208 1.00 166.92 ? 25   DC  a "C5'" 1 
ATOM   6429  C  "C4'" . DC  I  5  25   ? 269.308 288.238 136.920 1.00 162.84 ? 25   DC  a "C4'" 1 
ATOM   6430  O  "O4'" . DC  I  5  25   ? 267.959 288.249 136.380 1.00 165.76 ? 25   DC  a "O4'" 1 
ATOM   6431  C  "C3'" . DC  I  5  25   ? 270.164 287.493 135.899 1.00 157.02 ? 25   DC  a "C3'" 1 
ATOM   6432  O  "O3'" . DC  I  5  25   ? 270.299 286.128 136.277 1.00 150.25 ? 25   DC  a "O3'" 1 
ATOM   6433  C  "C2'" . DC  I  5  25   ? 269.358 287.642 134.613 1.00 159.40 ? 25   DC  a "C2'" 1 
ATOM   6434  C  "C1'" . DC  I  5  25   ? 267.936 287.573 135.143 1.00 160.74 ? 25   DC  a "C1'" 1 
ATOM   6435  N  N1    . DC  I  5  25   ? 266.931 288.237 134.262 1.00 157.48 ? 25   DC  a N1    1 
ATOM   6436  C  C2    . DC  I  5  25   ? 265.614 287.770 134.236 1.00 155.68 ? 25   DC  a C2    1 
ATOM   6437  O  O2    . DC  I  5  25   ? 265.306 286.817 134.960 1.00 157.16 ? 25   DC  a O2    1 
ATOM   6438  N  N3    . DC  I  5  25   ? 264.710 288.395 133.440 1.00 148.31 ? 25   DC  a N3    1 
ATOM   6439  C  C4    . DC  I  5  25   ? 265.088 289.431 132.688 1.00 146.28 ? 25   DC  a C4    1 
ATOM   6440  N  N4    . DC  I  5  25   ? 264.170 290.011 131.907 1.00 147.06 ? 25   DC  a N4    1 
ATOM   6441  C  C5    . DC  I  5  25   ? 266.428 289.910 132.693 1.00 143.40 ? 25   DC  a C5    1 
ATOM   6442  C  C6    . DC  I  5  25   ? 267.305 289.291 133.487 1.00 147.47 ? 25   DC  a C6    1 
ATOM   6443  P  P     . DT  I  5  26   ? 271.542 285.264 135.739 1.00 165.94 ? 26   DT  a P     1 
ATOM   6444  O  OP1   . DT  I  5  26   ? 271.797 284.177 136.710 1.00 147.76 ? 26   DT  a OP1   1 
ATOM   6445  O  OP2   . DT  I  5  26   ? 272.627 286.215 135.409 1.00 173.96 ? 26   DT  a OP2   1 
ATOM   6446  O  "O5'" . DT  I  5  26   ? 271.013 284.645 134.360 1.00 146.88 ? 26   DT  a "O5'" 1 
ATOM   6447  C  "C5'" . DT  I  5  26   ? 270.670 283.263 134.274 1.00 149.54 ? 26   DT  a "C5'" 1 
ATOM   6448  C  "C4'" . DT  I  5  26   ? 269.387 282.969 135.032 1.00 143.69 ? 26   DT  a "C4'" 1 
ATOM   6449  O  "O4'" . DT  I  5  26   ? 268.423 284.023 134.789 1.00 140.33 ? 26   DT  a "O4'" 1 
ATOM   6450  C  "C3'" . DT  I  5  26   ? 268.685 281.683 134.627 1.00 130.48 ? 26   DT  a "C3'" 1 
ATOM   6451  O  "O3'" . DT  I  5  26   ? 267.940 281.177 135.726 1.00 134.05 ? 26   DT  a "O3'" 1 
ATOM   6452  C  "C2'" . DT  I  5  26   ? 267.773 282.167 133.508 1.00 118.92 ? 26   DT  a "C2'" 1 
ATOM   6453  C  "C1'" . DT  I  5  26   ? 267.325 283.507 134.055 1.00 126.33 ? 26   DT  a "C1'" 1 
ATOM   6454  N  N1    . DT  I  5  26   ? 266.952 284.508 133.020 1.00 127.63 ? 26   DT  a N1    1 
ATOM   6455  C  C2    . DT  I  5  26   ? 265.647 284.588 132.590 1.00 139.03 ? 26   DT  a C2    1 
ATOM   6456  O  O2    . DT  I  5  26   ? 264.756 283.883 133.028 1.00 145.73 ? 26   DT  a O2    1 
ATOM   6457  N  N3    . DT  I  5  26   ? 265.409 285.575 131.672 1.00 146.59 ? 26   DT  a N3    1 
ATOM   6458  C  C4    . DT  I  5  26   ? 266.332 286.452 131.131 1.00 149.13 ? 26   DT  a C4    1 
ATOM   6459  O  O4    . DT  I  5  26   ? 266.029 287.289 130.288 1.00 148.23 ? 26   DT  a O4    1 
ATOM   6460  C  C5    . DT  I  5  26   ? 267.682 286.299 131.609 1.00 147.39 ? 26   DT  a C5    1 
ATOM   6461  C  C7    . DT  I  5  26   ? 268.773 287.187 131.087 1.00 141.62 ? 26   DT  a C7    1 
ATOM   6462  C  C6    . DT  I  5  26   ? 267.920 285.357 132.531 1.00 142.08 ? 26   DT  a C6    1 
ATOM   6463  P  P     . DC  I  5  27   ? 268.219 279.697 136.282 1.00 127.17 ? 27   DC  a P     1 
ATOM   6464  O  OP1   . DC  I  5  27   ? 267.835 279.672 137.710 1.00 129.00 ? 27   DC  a OP1   1 
ATOM   6465  O  OP2   . DC  I  5  27   ? 269.593 279.319 135.881 1.00 100.29 ? 27   DC  a OP2   1 
ATOM   6466  O  "O5'" . DC  I  5  27   ? 267.201 278.780 135.458 1.00 144.80 ? 27   DC  a "O5'" 1 
ATOM   6467  C  "C5'" . DC  I  5  27   ? 265.799 278.944 135.629 1.00 141.34 ? 27   DC  a "C5'" 1 
ATOM   6468  C  "C4'" . DC  I  5  27   ? 265.032 278.380 134.443 1.00 139.03 ? 27   DC  a "C4'" 1 
ATOM   6469  O  "O4'" . DC  I  5  27   ? 265.125 279.294 133.318 1.00 138.54 ? 27   DC  a "O4'" 1 
ATOM   6470  C  "C3'" . DC  I  5  27   ? 265.531 277.035 133.920 1.00 136.19 ? 27   DC  a "C3'" 1 
ATOM   6471  O  "O3'" . DC  I  5  27   ? 264.429 276.290 133.425 1.00 133.51 ? 27   DC  a "O3'" 1 
ATOM   6472  C  "C2'" . DC  I  5  27   ? 266.458 277.458 132.785 1.00 134.63 ? 27   DC  a "C2'" 1 
ATOM   6473  C  "C1'" . DC  I  5  27   ? 265.660 278.611 132.204 1.00 134.28 ? 27   DC  a "C1'" 1 
ATOM   6474  N  N1    . DC  I  5  27   ? 266.460 279.576 131.401 1.00 123.01 ? 27   DC  a N1    1 
ATOM   6475  C  C2    . DC  I  5  27   ? 265.791 280.502 130.601 1.00 124.44 ? 27   DC  a C2    1 
ATOM   6476  O  O2    . DC  I  5  27   ? 264.556 280.494 130.590 1.00 116.87 ? 27   DC  a O2    1 
ATOM   6477  N  N3    . DC  I  5  27   ? 266.516 281.395 129.882 1.00 134.61 ? 27   DC  a N3    1 
ATOM   6478  C  C4    . DC  I  5  27   ? 267.848 281.374 129.944 1.00 137.11 ? 27   DC  a C4    1 
ATOM   6479  N  N4    . DC  I  5  27   ? 268.525 282.261 129.205 1.00 136.64 ? 27   DC  a N4    1 
ATOM   6480  C  C5    . DC  I  5  27   ? 268.549 280.420 130.741 1.00 134.54 ? 27   DC  a C5    1 
ATOM   6481  C  C6    . DC  I  5  27   ? 267.822 279.549 131.452 1.00 124.72 ? 27   DC  a C6    1 
ATOM   6482  P  P     . DA  I  5  28   ? 263.759 275.126 134.304 1.00 135.62 ? 28   DA  a P     1 
ATOM   6483  O  OP1   . DA  I  5  28   ? 263.625 275.627 135.689 1.00 130.59 ? 28   DA  a OP1   1 
ATOM   6484  O  OP2   . DA  I  5  28   ? 264.507 273.878 134.044 1.00 124.74 ? 28   DA  a OP2   1 
ATOM   6485  O  "O5'" . DA  I  5  28   ? 262.299 274.965 133.668 1.00 109.79 ? 28   DA  a "O5'" 1 
ATOM   6486  C  "C5'" . DA  I  5  28   ? 261.305 275.957 133.905 1.00 95.14  ? 28   DA  a "C5'" 1 
ATOM   6487  C  "C4'" . DA  I  5  28   ? 260.759 276.521 132.601 1.00 99.49  ? 28   DA  a "C4'" 1 
ATOM   6488  O  "O4'" . DA  I  5  28   ? 261.820 277.189 131.869 1.00 104.57 ? 28   DA  a "O4'" 1 
ATOM   6489  C  "C3'" . DA  I  5  28   ? 260.171 275.494 131.633 1.00 105.54 ? 28   DA  a "C3'" 1 
ATOM   6490  O  "O3'" . DA  I  5  28   ? 259.061 276.068 130.960 1.00 106.79 ? 28   DA  a "O3'" 1 
ATOM   6491  C  "C2'" . DA  I  5  28   ? 261.330 275.255 130.673 1.00 109.17 ? 28   DA  a "C2'" 1 
ATOM   6492  C  "C1'" . DA  I  5  28   ? 261.877 276.666 130.559 1.00 113.35 ? 28   DA  a "C1'" 1 
ATOM   6493  N  N9    . DA  I  5  28   ? 263.257 276.740 130.092 1.00 117.13 ? 28   DA  a N9    1 
ATOM   6494  C  C8    . DA  I  5  28   ? 264.312 275.977 130.503 1.00 113.24 ? 28   DA  a C8    1 
ATOM   6495  N  N7    . DA  I  5  28   ? 265.445 276.281 129.914 1.00 109.94 ? 28   DA  a N7    1 
ATOM   6496  C  C5    . DA  I  5  28   ? 265.108 277.317 129.060 1.00 114.54 ? 28   DA  a C5    1 
ATOM   6497  C  C6    . DA  I  5  28   ? 265.866 278.094 128.164 1.00 113.11 ? 28   DA  a C6    1 
ATOM   6498  N  N6    . DA  I  5  28   ? 267.172 277.910 127.954 1.00 114.51 ? 28   DA  a N6    1 
ATOM   6499  N  N1    . DA  I  5  28   ? 265.218 279.041 127.456 1.00 116.69 ? 28   DA  a N1    1 
ATOM   6500  C  C2    . DA  I  5  28   ? 263.907 279.212 127.658 1.00 114.92 ? 28   DA  a C2    1 
ATOM   6501  N  N3    . DA  I  5  28   ? 263.094 278.557 128.481 1.00 122.43 ? 28   DA  a N3    1 
ATOM   6502  C  C4    . DA  I  5  28   ? 263.762 277.607 129.152 1.00 121.47 ? 28   DA  a C4    1 
ATOM   6503  P  P     . DA  I  5  29   ? 257.804 275.165 130.540 1.00 87.45  ? 29   DA  a P     1 
ATOM   6504  O  OP1   . DA  I  5  29   ? 256.776 275.321 131.590 1.00 80.79  ? 29   DA  a OP1   1 
ATOM   6505  O  OP2   . DA  I  5  29   ? 258.310 273.818 130.197 1.00 85.53  ? 29   DA  a OP2   1 
ATOM   6506  O  "O5'" . DA  I  5  29   ? 257.277 275.854 129.194 1.00 72.64  ? 29   DA  a "O5'" 1 
ATOM   6507  C  "C5'" . DA  I  5  29   ? 256.857 277.214 129.211 1.00 79.20  ? 29   DA  a "C5'" 1 
ATOM   6508  C  "C4'" . DA  I  5  29   ? 257.081 277.872 127.858 1.00 85.33  ? 29   DA  a "C4'" 1 
ATOM   6509  O  "O4'" . DA  I  5  29   ? 258.505 278.017 127.617 1.00 93.36  ? 29   DA  a "O4'" 1 
ATOM   6510  C  "C3'" . DA  I  5  29   ? 256.521 277.105 126.663 1.00 82.52  ? 29   DA  a "C3'" 1 
ATOM   6511  O  "O3'" . DA  I  5  29   ? 255.967 278.010 125.719 1.00 89.40  ? 29   DA  a "O3'" 1 
ATOM   6512  C  "C2'" . DA  I  5  29   ? 257.748 276.394 126.103 1.00 77.66  ? 29   DA  a "C2'" 1 
ATOM   6513  C  "C1'" . DA  I  5  29   ? 258.856 277.394 126.401 1.00 86.29  ? 29   DA  a "C1'" 1 
ATOM   6514  N  N9    . DA  I  5  29   ? 260.170 276.776 126.569 1.00 104.62 ? 29   DA  a N9    1 
ATOM   6515  C  C8    . DA  I  5  29   ? 260.510 275.804 127.466 1.00 105.22 ? 29   DA  a C8    1 
ATOM   6516  N  N7    . DA  I  5  29   ? 261.767 275.436 127.397 1.00 111.28 ? 29   DA  a N7    1 
ATOM   6517  C  C5    . DA  I  5  29   ? 262.291 276.225 126.389 1.00 110.67 ? 29   DA  a C5    1 
ATOM   6518  C  C6    . DA  I  5  29   ? 263.583 276.318 125.833 1.00 109.90 ? 29   DA  a C6    1 
ATOM   6519  N  N6    . DA  I  5  29   ? 264.615 275.571 126.239 1.00 116.75 ? 29   DA  a N6    1 
ATOM   6520  N  N1    . DA  I  5  29   ? 263.771 277.207 124.836 1.00 109.70 ? 29   DA  a N1    1 
ATOM   6521  C  C2    . DA  I  5  29   ? 262.735 277.951 124.432 1.00 106.89 ? 29   DA  a C2    1 
ATOM   6522  N  N3    . DA  I  5  29   ? 261.479 277.952 124.879 1.00 113.37 ? 29   DA  a N3    1 
ATOM   6523  C  C4    . DA  I  5  29   ? 261.321 277.055 125.864 1.00 112.63 ? 29   DA  a C4    1 
ATOM   6524  P  P     . DT  I  5  30   ? 255.034 277.465 124.531 1.00 89.97  ? 30   DT  a P     1 
ATOM   6525  O  OP1   . DT  I  5  30   ? 253.874 278.376 124.420 1.00 68.75  ? 30   DT  a OP1   1 
ATOM   6526  O  OP2   . DT  I  5  30   ? 254.816 276.019 124.753 1.00 74.48  ? 30   DT  a OP2   1 
ATOM   6527  O  "O5'" . DT  I  5  30   ? 255.944 277.628 123.226 1.00 122.34 ? 30   DT  a "O5'" 1 
ATOM   6528  C  "C5'" . DT  I  5  30   ? 256.359 278.922 122.813 1.00 105.37 ? 30   DT  a "C5'" 1 
ATOM   6529  C  "C4'" . DT  I  5  30   ? 257.407 278.835 121.719 1.00 87.24  ? 30   DT  a "C4'" 1 
ATOM   6530  O  "O4'" . DT  I  5  30   ? 258.631 278.282 122.255 1.00 92.08  ? 30   DT  a "O4'" 1 
ATOM   6531  C  "C3'" . DT  I  5  30   ? 257.029 277.960 120.519 1.00 80.04  ? 30   DT  a "C3'" 1 
ATOM   6532  O  "O3'" . DT  I  5  30   ? 257.078 278.730 119.327 1.00 90.66  ? 30   DT  a "O3'" 1 
ATOM   6533  C  "C2'" . DT  I  5  30   ? 258.081 276.843 120.519 1.00 79.68  ? 30   DT  a "C2'" 1 
ATOM   6534  C  "C1'" . DT  I  5  30   ? 259.233 277.484 121.274 1.00 86.30  ? 30   DT  a "C1'" 1 
ATOM   6535  N  N1    . DT  I  5  30   ? 260.133 276.504 121.951 1.00 79.53  ? 30   DT  a N1    1 
ATOM   6536  C  C2    . DT  I  5  30   ? 261.446 276.412 121.552 1.00 89.04  ? 30   DT  a C2    1 
ATOM   6537  O  O2    . DT  I  5  30   ? 261.922 277.090 120.660 1.00 85.71  ? 30   DT  a O2    1 
ATOM   6538  N  N3    . DT  I  5  30   ? 262.187 275.488 122.237 1.00 103.00 ? 30   DT  a N3    1 
ATOM   6539  C  C4    . DT  I  5  30   ? 261.760 274.668 123.263 1.00 115.90 ? 30   DT  a C4    1 
ATOM   6540  O  O4    . DT  I  5  30   ? 262.502 273.867 123.820 1.00 121.36 ? 30   DT  a O4    1 
ATOM   6541  C  C5    . DT  I  5  30   ? 260.377 274.814 123.633 1.00 113.90 ? 30   DT  a C5    1 
ATOM   6542  C  C7    . DT  I  5  30   ? 259.804 273.969 124.729 1.00 118.66 ? 30   DT  a C7    1 
ATOM   6543  C  C6    . DT  I  5  30   ? 259.637 275.717 122.970 1.00 95.43  ? 30   DT  a C6    1 
ATOM   6544  P  P     . DT  I  5  31   ? 256.586 278.103 117.933 1.00 130.48 ? 31   DT  a P     1 
ATOM   6545  O  OP1   . DT  I  5  31   ? 256.015 279.204 117.126 1.00 133.44 ? 31   DT  a OP1   1 
ATOM   6546  O  OP2   . DT  I  5  31   ? 255.763 276.912 118.235 1.00 127.24 ? 31   DT  a OP2   1 
ATOM   6547  O  "O5'" . DT  I  5  31   ? 257.939 277.607 117.242 1.00 117.78 ? 31   DT  a "O5'" 1 
ATOM   6548  C  "C5'" . DT  I  5  31   ? 259.007 278.525 117.046 1.00 116.19 ? 31   DT  a "C5'" 1 
ATOM   6549  C  "C4'" . DT  I  5  31   ? 260.176 277.856 116.346 1.00 121.11 ? 31   DT  a "C4'" 1 
ATOM   6550  O  "O4'" . DT  I  5  31   ? 260.944 277.085 117.304 1.00 121.63 ? 31   DT  a "O4'" 1 
ATOM   6551  C  "C3'" . DT  I  5  31   ? 259.792 276.892 115.223 1.00 131.90 ? 31   DT  a "C3'" 1 
ATOM   6552  O  "O3'" . DT  I  5  31   ? 260.565 277.173 114.065 1.00 152.56 ? 31   DT  a "O3'" 1 
ATOM   6553  C  "C2'" . DT  I  5  31   ? 260.117 275.511 115.801 1.00 123.17 ? 31   DT  a "C2'" 1 
ATOM   6554  C  "C1'" . DT  I  5  31   ? 261.261 275.832 116.745 1.00 119.90 ? 31   DT  a "C1'" 1 
ATOM   6555  N  N1    . DT  I  5  31   ? 261.414 274.852 117.858 1.00 116.26 ? 31   DT  a N1    1 
ATOM   6556  C  C2    . DT  I  5  31   ? 262.635 274.257 118.072 1.00 118.35 ? 31   DT  a C2    1 
ATOM   6557  O  O2    . DT  I  5  31   ? 263.614 274.472 117.382 1.00 119.59 ? 31   DT  a O2    1 
ATOM   6558  N  N3    . DT  I  5  31   ? 262.665 273.373 119.119 1.00 118.74 ? 31   DT  a N3    1 
ATOM   6559  C  C4    . DT  I  5  31   ? 261.620 273.044 119.963 1.00 120.11 ? 31   DT  a C4    1 
ATOM   6560  O  O4    . DT  I  5  31   ? 261.745 272.243 120.880 1.00 121.27 ? 31   DT  a O4    1 
ATOM   6561  C  C5    . DT  I  5  31   ? 260.372 273.711 119.688 1.00 115.12 ? 31   DT  a C5    1 
ATOM   6562  C  C7    . DT  I  5  31   ? 259.169 273.430 120.535 1.00 114.76 ? 31   DT  a C7    1 
ATOM   6563  C  C6    . DT  I  5  31   ? 260.328 274.571 118.660 1.00 113.05 ? 31   DT  a C6    1 
ATOM   6564  P  P     . DG  I  5  32   ? 260.242 276.440 112.674 1.00 155.30 ? 32   DG  a P     1 
ATOM   6565  O  OP1   . DG  I  5  32   ? 260.403 277.441 111.596 1.00 151.90 ? 32   DG  a OP1   1 
ATOM   6566  O  OP2   . DG  I  5  32   ? 258.959 275.717 112.818 1.00 153.95 ? 32   DG  a OP2   1 
ATOM   6567  O  "O5'" . DG  I  5  32   ? 261.407 275.357 112.542 1.00 121.06 ? 32   DG  a "O5'" 1 
ATOM   6568  C  "C5'" . DG  I  5  32   ? 262.765 275.767 112.644 1.00 134.38 ? 32   DG  a "C5'" 1 
ATOM   6569  C  "C4'" . DG  I  5  32   ? 263.689 274.567 112.702 1.00 149.18 ? 32   DG  a "C4'" 1 
ATOM   6570  O  "O4'" . DG  I  5  32   ? 263.652 273.982 114.032 1.00 151.51 ? 32   DG  a "O4'" 1 
ATOM   6571  C  "C3'" . DG  I  5  32   ? 263.342 273.437 111.732 1.00 160.12 ? 32   DG  a "C3'" 1 
ATOM   6572  O  "O3'" . DG  I  5  32   ? 264.527 272.932 111.137 1.00 173.33 ? 32   DG  a "O3'" 1 
ATOM   6573  C  "C2'" . DG  I  5  32   ? 262.685 272.398 112.636 1.00 153.19 ? 32   DG  a "C2'" 1 
ATOM   6574  C  "C1'" . DG  I  5  32   ? 263.480 272.591 113.915 1.00 151.45 ? 32   DG  a "C1'" 1 
ATOM   6575  N  N9    . DG  I  5  32   ? 262.804 272.099 115.112 1.00 136.61 ? 32   DG  a N9    1 
ATOM   6576  C  C8    . DG  I  5  32   ? 261.535 272.406 115.538 1.00 137.44 ? 32   DG  a C8    1 
ATOM   6577  N  N7    . DG  I  5  32   ? 261.206 271.815 116.653 1.00 135.01 ? 32   DG  a N7    1 
ATOM   6578  C  C5    . DG  I  5  32   ? 262.329 271.069 116.988 1.00 130.60 ? 32   DG  a C5    1 
ATOM   6579  C  C6    . DG  I  5  32   ? 262.567 270.221 118.095 1.00 132.68 ? 32   DG  a C6    1 
ATOM   6580  O  O6    . DG  I  5  32   ? 261.802 269.950 119.032 1.00 141.94 ? 32   DG  a O6    1 
ATOM   6581  N  N1    . DG  I  5  32   ? 263.839 269.658 118.049 1.00 118.12 ? 32   DG  a N1    1 
ATOM   6582  C  C2    . DG  I  5  32   ? 264.766 269.892 117.062 1.00 107.40 ? 32   DG  a C2    1 
ATOM   6583  N  N2    . DG  I  5  32   ? 265.942 269.262 117.178 1.00 110.54 ? 32   DG  a N2    1 
ATOM   6584  N  N3    . DG  I  5  32   ? 264.554 270.682 116.020 1.00 109.11 ? 32   DG  a N3    1 
ATOM   6585  C  C4    . DG  I  5  32   ? 263.319 271.232 116.046 1.00 123.25 ? 32   DG  a C4    1 
ATOM   6586  P  P     . DG  I  5  33   ? 264.693 272.927 109.539 1.00 164.91 ? 33   DG  a P     1 
ATOM   6587  O  OP1   . DG  I  5  33   ? 265.922 273.684 109.218 1.00 164.00 ? 33   DG  a OP1   1 
ATOM   6588  O  OP2   . DG  I  5  33   ? 263.397 273.337 108.954 1.00 157.90 ? 33   DG  a OP2   1 
ATOM   6589  O  "O5'" . DG  I  5  33   ? 264.927 271.386 109.181 1.00 148.33 ? 33   DG  a "O5'" 1 
ATOM   6590  C  "C5'" . DG  I  5  33   ? 264.022 270.399 109.658 1.00 146.79 ? 33   DG  a "C5'" 1 
ATOM   6591  C  "C4'" . DG  I  5  33   ? 264.756 269.353 110.477 1.00 148.88 ? 33   DG  a "C4'" 1 
ATOM   6592  O  "O4'" . DG  I  5  33   ? 264.607 269.645 111.880 1.00 154.19 ? 33   DG  a "O4'" 1 
ATOM   6593  C  "C3'" . DG  I  5  33   ? 264.236 267.939 110.314 1.00 152.12 ? 33   DG  a "C3'" 1 
ATOM   6594  O  "O3'" . DG  I  5  33   ? 264.872 267.327 109.195 1.00 153.03 ? 33   DG  a "O3'" 1 
ATOM   6595  C  "C2'" . DG  I  5  33   ? 264.648 267.278 111.630 1.00 157.08 ? 33   DG  a "C2'" 1 
ATOM   6596  C  "C1'" . DG  I  5  33   ? 264.628 268.442 112.625 1.00 158.74 ? 33   DG  a "C1'" 1 
ATOM   6597  N  N9    . DG  I  5  33   ? 263.481 268.443 113.532 1.00 131.94 ? 33   DG  a N9    1 
ATOM   6598  C  C8    . DG  I  5  33   ? 262.318 269.158 113.390 1.00 125.30 ? 33   DG  a C8    1 
ATOM   6599  N  N7    . DG  I  5  33   ? 261.473 268.977 114.364 1.00 121.69 ? 33   DG  a N7    1 
ATOM   6600  C  C5    . DG  I  5  33   ? 262.116 268.088 115.212 1.00 131.21 ? 33   DG  a C5    1 
ATOM   6601  C  C6    . DG  I  5  33   ? 261.684 267.521 116.435 1.00 135.98 ? 33   DG  a C6    1 
ATOM   6602  O  O6    . DG  I  5  33   ? 260.613 267.709 117.028 1.00 131.46 ? 33   DG  a O6    1 
ATOM   6603  N  N1    . DG  I  5  33   ? 262.640 266.668 116.974 1.00 138.85 ? 33   DG  a N1    1 
ATOM   6604  C  C2    . DG  I  5  33   ? 263.862 266.393 116.404 1.00 136.50 ? 33   DG  a C2    1 
ATOM   6605  N  N2    . DG  I  5  33   ? 264.655 265.540 117.067 1.00 132.00 ? 33   DG  a N2    1 
ATOM   6606  N  N3    . DG  I  5  33   ? 264.276 266.914 115.255 1.00 137.24 ? 33   DG  a N3    1 
ATOM   6607  C  C4    . DG  I  5  33   ? 263.356 267.750 114.718 1.00 134.51 ? 33   DG  a C4    1 
ATOM   6608  P  P     . DT  I  5  34   ? 264.653 265.767 108.878 1.00 154.80 ? 34   DT  a P     1 
ATOM   6609  O  OP1   . DT  I  5  34   ? 264.883 265.579 107.428 1.00 152.16 ? 34   DT  a OP1   1 
ATOM   6610  O  OP2   . DT  I  5  34   ? 263.370 265.341 109.476 1.00 154.51 ? 34   DT  a OP2   1 
ATOM   6611  O  "O5'" . DT  I  5  34   ? 265.841 265.048 109.671 1.00 159.12 ? 34   DT  a "O5'" 1 
ATOM   6612  C  "C5'" . DT  I  5  34   ? 265.896 263.632 109.728 1.00 157.08 ? 34   DT  a "C5'" 1 
ATOM   6613  C  "C4'" . DT  I  5  34   ? 265.897 263.153 111.167 1.00 150.52 ? 34   DT  a "C4'" 1 
ATOM   6614  O  "O4'" . DT  I  5  34   ? 265.008 263.970 111.946 1.00 149.70 ? 34   DT  a "O4'" 1 
ATOM   6615  C  "C3'" . DT  I  5  34   ? 265.416 261.719 111.363 1.00 149.65 ? 34   DT  a "C3'" 1 
ATOM   6616  O  "O3'" . DT  I  5  34   ? 266.533 260.863 111.566 1.00 150.80 ? 34   DT  a "O3'" 1 
ATOM   6617  C  "C2'" . DT  I  5  34   ? 264.501 261.774 112.600 1.00 151.66 ? 34   DT  a "C2'" 1 
ATOM   6618  C  "C1'" . DT  I  5  34   ? 264.568 263.230 113.053 1.00 150.49 ? 34   DT  a "C1'" 1 
ATOM   6619  N  N1    . DT  I  5  34   ? 263.255 263.791 113.491 1.00 138.08 ? 34   DT  a N1    1 
ATOM   6620  C  C2    . DT  I  5  34   ? 262.716 263.411 114.700 1.00 134.99 ? 34   DT  a C2    1 
ATOM   6621  O  O2    . DT  I  5  34   ? 263.253 262.621 115.455 1.00 133.74 ? 34   DT  a O2    1 
ATOM   6622  N  N3    . DT  I  5  34   ? 261.513 264.004 114.998 1.00 132.74 ? 34   DT  a N3    1 
ATOM   6623  C  C4    . DT  I  5  34   ? 260.812 264.906 114.219 1.00 132.35 ? 34   DT  a C4    1 
ATOM   6624  O  O4    . DT  I  5  34   ? 259.743 265.392 114.571 1.00 131.46 ? 34   DT  a O4    1 
ATOM   6625  C  C5    . DT  I  5  34   ? 261.440 265.267 112.973 1.00 131.36 ? 34   DT  a C5    1 
ATOM   6626  C  C7    . DT  I  5  34   ? 260.778 266.244 112.050 1.00 130.73 ? 34   DT  a C7    1 
ATOM   6627  C  C6    . DT  I  5  34   ? 262.618 264.704 112.678 1.00 133.88 ? 34   DT  a C6    1 
ATOM   6628  P  P     . DC  I  5  35   ? 266.319 259.306 111.894 1.00 150.74 ? 35   DC  a P     1 
ATOM   6629  O  OP1   . DC  I  5  35   ? 267.546 258.588 111.490 1.00 147.65 ? 35   DC  a OP1   1 
ATOM   6630  O  OP2   . DC  I  5  35   ? 265.012 258.897 111.330 1.00 145.45 ? 35   DC  a OP2   1 
ATOM   6631  O  "O5'" . DC  I  5  35   ? 266.206 259.272 113.489 1.00 167.98 ? 35   DC  a "O5'" 1 
ATOM   6632  C  "C5'" . DC  I  5  35   ? 266.290 258.040 114.182 1.00 162.07 ? 35   DC  a "C5'" 1 
ATOM   6633  C  "C4'" . DC  I  5  35   ? 264.906 257.501 114.498 1.00 152.31 ? 35   DC  a "C4'" 1 
ATOM   6634  O  "O4'" . DC  I  5  35   ? 263.962 258.582 114.547 1.00 146.90 ? 35   DC  a "O4'" 1 
ATOM   6635  C  "C3'" . DC  I  5  35   ? 264.335 256.543 113.464 1.00 146.89 ? 35   DC  a "C3'" 1 
ATOM   6636  O  "O3'" . DC  I  5  35   ? 264.687 255.195 113.817 1.00 149.46 ? 35   DC  a "O3'" 1 
ATOM   6637  C  "C2'" . DC  I  5  35   ? 262.816 256.793 113.534 1.00 138.40 ? 35   DC  a "C2'" 1 
ATOM   6638  C  "C1'" . DC  I  5  35   ? 262.677 258.031 114.426 1.00 137.47 ? 35   DC  a "C1'" 1 
ATOM   6639  N  N1    . DC  I  5  35   ? 261.752 259.068 113.877 1.00 127.86 ? 35   DC  a N1    1 
ATOM   6640  C  C2    . DC  I  5  35   ? 260.689 259.530 114.659 1.00 123.59 ? 35   DC  a C2    1 
ATOM   6641  O  O2    . DC  I  5  35   ? 260.548 259.075 115.800 1.00 121.58 ? 35   DC  a O2    1 
ATOM   6642  N  N3    . DC  I  5  35   ? 259.859 260.475 114.150 1.00 125.54 ? 35   DC  a N3    1 
ATOM   6643  C  C4    . DC  I  5  35   ? 260.058 260.940 112.914 1.00 131.08 ? 35   DC  a C4    1 
ATOM   6644  N  N4    . DC  I  5  35   ? 259.213 261.866 112.448 1.00 134.70 ? 35   DC  a N4    1 
ATOM   6645  C  C5    . DC  I  5  35   ? 261.131 260.474 112.099 1.00 130.00 ? 35   DC  a C5    1 
ATOM   6646  C  C6    . DC  I  5  35   ? 261.947 259.549 112.617 1.00 130.38 ? 35   DC  a C6    1 
ATOM   6647  P  P     . DG  I  5  36   ? 263.798 253.936 113.352 1.00 153.46 ? 36   DG  a P     1 
ATOM   6648  O  OP1   . DG  I  5  36   ? 264.666 252.747 113.479 1.00 153.26 ? 36   DG  a OP1   1 
ATOM   6649  O  OP2   . DG  I  5  36   ? 263.165 254.213 112.043 1.00 147.44 ? 36   DG  a OP2   1 
ATOM   6650  O  "O5'" . DG  I  5  36   ? 262.668 253.835 114.481 1.00 153.57 ? 36   DG  a "O5'" 1 
ATOM   6651  C  "C5'" . DG  I  5  36   ? 263.041 253.902 115.854 1.00 145.98 ? 36   DG  a "C5'" 1 
ATOM   6652  C  "C4'" . DG  I  5  36   ? 261.832 253.798 116.769 1.00 136.42 ? 36   DG  a "C4'" 1 
ATOM   6653  O  "O4'" . DG  I  5  36   ? 260.918 254.894 116.508 1.00 133.03 ? 36   DG  a "O4'" 1 
ATOM   6654  C  "C3'" . DG  I  5  36   ? 261.012 252.526 116.624 1.00 132.95 ? 36   DG  a "C3'" 1 
ATOM   6655  O  "O3'" . DG  I  5  36   ? 260.488 252.149 117.887 1.00 134.12 ? 36   DG  a "O3'" 1 
ATOM   6656  C  "C2'" . DG  I  5  36   ? 259.910 252.936 115.652 1.00 130.33 ? 36   DG  a "C2'" 1 
ATOM   6657  C  "C1'" . DG  I  5  36   ? 259.691 254.406 115.993 1.00 133.17 ? 36   DG  a "C1'" 1 
ATOM   6658  N  N9    . DG  I  5  36   ? 259.339 255.231 114.840 1.00 118.16 ? 36   DG  a N9    1 
ATOM   6659  C  C8    . DG  I  5  36   ? 259.968 255.248 113.620 1.00 121.99 ? 36   DG  a C8    1 
ATOM   6660  N  N7    . DG  I  5  36   ? 259.454 256.101 112.781 1.00 125.67 ? 36   DG  a N7    1 
ATOM   6661  C  C5    . DG  I  5  36   ? 258.415 256.690 113.486 1.00 126.13 ? 36   DG  a C5    1 
ATOM   6662  C  C6    . DG  I  5  36   ? 257.503 257.695 113.090 1.00 126.32 ? 36   DG  a C6    1 
ATOM   6663  O  O6    . DG  I  5  36   ? 257.424 258.265 111.994 1.00 136.17 ? 36   DG  a O6    1 
ATOM   6664  N  N1    . DG  I  5  36   ? 256.604 258.004 114.106 1.00 113.69 ? 36   DG  a N1    1 
ATOM   6665  C  C2    . DG  I  5  36   ? 256.597 257.425 115.354 1.00 108.10 ? 36   DG  a C2    1 
ATOM   6666  N  N2    . DG  I  5  36   ? 255.660 257.859 116.210 1.00 99.67  ? 36   DG  a N2    1 
ATOM   6667  N  N3    . DG  I  5  36   ? 257.454 256.488 115.741 1.00 114.94 ? 36   DG  a N3    1 
ATOM   6668  C  C4    . DG  I  5  36   ? 258.331 256.168 114.757 1.00 121.50 ? 36   DG  a C4    1 
ATOM   6669  P  P     . DT  I  5  37   ? 259.628 250.801 118.047 1.00 124.69 ? 37   DT  a P     1 
ATOM   6670  O  OP1   . DT  I  5  37   ? 260.001 250.192 119.343 1.00 122.41 ? 37   DT  a OP1   1 
ATOM   6671  O  OP2   . DT  I  5  37   ? 259.761 250.012 116.803 1.00 120.36 ? 37   DT  a OP2   1 
ATOM   6672  O  "O5'" . DT  I  5  37   ? 258.124 251.329 118.143 1.00 131.63 ? 37   DT  a "O5'" 1 
ATOM   6673  C  "C5'" . DT  I  5  37   ? 257.813 252.411 119.014 1.00 122.12 ? 37   DT  a "C5'" 1 
ATOM   6674  C  "C4'" . DT  I  5  37   ? 256.364 252.839 118.862 1.00 119.98 ? 37   DT  a "C4'" 1 
ATOM   6675  O  "O4'" . DT  I  5  37   ? 256.218 253.702 117.697 1.00 124.75 ? 37   DT  a "O4'" 1 
ATOM   6676  C  "C3'" . DT  I  5  37   ? 255.366 251.703 118.655 1.00 118.05 ? 37   DT  a "C3'" 1 
ATOM   6677  O  "O3'" . DT  I  5  37   ? 254.139 252.050 119.277 1.00 113.65 ? 37   DT  a "O3'" 1 
ATOM   6678  C  "C2'" . DT  I  5  37   ? 255.227 251.684 117.134 1.00 122.15 ? 37   DT  a "C2'" 1 
ATOM   6679  C  "C1'" . DT  I  5  37   ? 255.211 253.175 116.860 1.00 123.12 ? 37   DT  a "C1'" 1 
ATOM   6680  N  N1    . DT  I  5  37   ? 255.511 253.559 115.447 1.00 116.97 ? 37   DT  a N1    1 
ATOM   6681  C  C2    . DT  I  5  37   ? 254.755 254.540 114.844 1.00 119.66 ? 37   DT  a C2    1 
ATOM   6682  O  O2    . DT  I  5  37   ? 253.843 255.118 115.406 1.00 118.16 ? 37   DT  a O2    1 
ATOM   6683  N  N3    . DT  I  5  37   ? 255.119 254.835 113.559 1.00 124.42 ? 37   DT  a N3    1 
ATOM   6684  C  C4    . DT  I  5  37   ? 256.143 254.262 112.829 1.00 128.08 ? 37   DT  a C4    1 
ATOM   6685  O  O4    . DT  I  5  37   ? 256.383 254.582 111.670 1.00 129.32 ? 37   DT  a O4    1 
ATOM   6686  C  C5    . DT  I  5  37   ? 256.885 253.232 113.511 1.00 124.68 ? 37   DT  a C5    1 
ATOM   6687  C  C7    . DT  I  5  37   ? 258.009 252.530 112.807 1.00 116.45 ? 37   DT  a C7    1 
ATOM   6688  C  C6    . DT  I  5  37   ? 256.543 252.936 114.775 1.00 122.20 ? 37   DT  a C6    1 
ATOM   6689  P  P     . DA  I  5  38   ? 253.569 251.206 120.520 1.00 109.31 ? 38   DA  a P     1 
ATOM   6690  O  OP1   . DA  I  5  38   ? 254.503 251.383 121.654 1.00 104.98 ? 38   DA  a OP1   1 
ATOM   6691  O  OP2   . DA  I  5  38   ? 253.252 249.847 120.031 1.00 110.00 ? 38   DA  a OP2   1 
ATOM   6692  O  "O5'" . DA  I  5  38   ? 252.186 251.936 120.868 1.00 96.73  ? 38   DA  a "O5'" 1 
ATOM   6693  C  "C5'" . DA  I  5  38   ? 252.190 253.265 121.388 1.00 96.68  ? 38   DA  a "C5'" 1 
ATOM   6694  C  "C4'" . DA  I  5  38   ? 250.995 254.080 120.897 1.00 94.85  ? 38   DA  a "C4'" 1 
ATOM   6695  O  "O4'" . DA  I  5  38   ? 251.109 254.337 119.476 1.00 91.42  ? 38   DA  a "O4'" 1 
ATOM   6696  C  "C3'" . DA  I  5  38   ? 249.630 253.448 121.075 1.00 94.57  ? 38   DA  a "C3'" 1 
ATOM   6697  O  "O3'" . DA  I  5  38   ? 248.656 254.473 121.185 1.00 96.79  ? 38   DA  a "O3'" 1 
ATOM   6698  C  "C2'" . DA  I  5  38   ? 249.466 252.662 119.777 1.00 93.75  ? 38   DA  a "C2'" 1 
ATOM   6699  C  "C1'" . DA  I  5  38   ? 250.147 253.578 118.760 1.00 92.98  ? 38   DA  a "C1'" 1 
ATOM   6700  N  N9    . DA  I  5  38   ? 250.865 252.867 117.710 1.00 108.83 ? 38   DA  a N9    1 
ATOM   6701  C  C8    . DA  I  5  38   ? 251.645 251.761 117.862 1.00 105.30 ? 38   DA  a C8    1 
ATOM   6702  N  N7    . DA  I  5  38   ? 252.203 251.346 116.756 1.00 107.61 ? 38   DA  a N7    1 
ATOM   6703  C  C5    . DA  I  5  38   ? 251.775 252.254 115.807 1.00 114.22 ? 38   DA  a C5    1 
ATOM   6704  C  C6    . DA  I  5  38   ? 252.031 252.369 114.430 1.00 124.23 ? 38   DA  a C6    1 
ATOM   6705  N  N6    . DA  I  5  38   ? 252.797 251.509 113.753 1.00 126.79 ? 38   DA  a N6    1 
ATOM   6706  N  N1    . DA  I  5  38   ? 251.435 253.380 113.766 1.00 121.45 ? 38   DA  a N1    1 
ATOM   6707  C  C2    . DA  I  5  38   ? 250.656 254.228 114.447 1.00 111.11 ? 38   DA  a C2    1 
ATOM   6708  N  N3    . DA  I  5  38   ? 250.353 254.230 115.747 1.00 111.10 ? 38   DA  a N3    1 
ATOM   6709  C  C4    . DA  I  5  38   ? 250.944 253.200 116.374 1.00 112.91 ? 38   DA  a C4    1 
ATOM   6710  P  P     . DG  I  5  39   ? 247.168 254.141 121.685 1.00 90.75  ? 39   DG  a P     1 
ATOM   6711  O  OP1   . DG  I  5  39   ? 246.789 255.184 122.662 1.00 79.33  ? 39   DG  a OP1   1 
ATOM   6712  O  OP2   . DG  I  5  39   ? 247.128 252.714 122.077 1.00 95.14  ? 39   DG  a OP2   1 
ATOM   6713  O  "O5'" . DG  I  5  39   ? 246.276 254.322 120.371 1.00 91.76  ? 39   DG  a "O5'" 1 
ATOM   6714  C  "C5'" . DG  I  5  39   ? 246.218 255.588 119.722 1.00 104.08 ? 39   DG  a "C5'" 1 
ATOM   6715  C  "C4'" . DG  I  5  39   ? 245.748 255.444 118.285 1.00 110.68 ? 39   DG  a "C4'" 1 
ATOM   6716  O  "O4'" . DG  I  5  39   ? 246.742 254.714 117.511 1.00 108.65 ? 39   DG  a "O4'" 1 
ATOM   6717  C  "C3'" . DG  I  5  39   ? 244.434 254.674 118.096 1.00 115.57 ? 39   DG  a "C3'" 1 
ATOM   6718  O  "O3'" . DG  I  5  39   ? 243.718 255.225 117.005 1.00 113.96 ? 39   DG  a "O3'" 1 
ATOM   6719  C  "C2'" . DG  I  5  39   ? 244.940 253.286 117.733 1.00 110.78 ? 39   DG  a "C2'" 1 
ATOM   6720  C  "C1'" . DG  I  5  39   ? 246.080 253.684 116.818 1.00 111.81 ? 39   DG  a "C1'" 1 
ATOM   6721  N  N9    . DG  I  5  39   ? 247.020 252.613 116.507 1.00 108.80 ? 39   DG  a N9    1 
ATOM   6722  C  C8    . DG  I  5  39   ? 247.551 251.687 117.366 1.00 116.32 ? 39   DG  a C8    1 
ATOM   6723  N  N7    . DG  I  5  39   ? 248.371 250.850 116.788 1.00 119.25 ? 39   DG  a N7    1 
ATOM   6724  C  C5    . DG  I  5  39   ? 248.371 251.247 115.457 1.00 115.52 ? 39   DG  a C5    1 
ATOM   6725  C  C6    . DG  I  5  39   ? 249.071 250.716 114.347 1.00 115.96 ? 39   DG  a C6    1 
ATOM   6726  O  O6    . DG  I  5  39   ? 249.849 249.754 114.316 1.00 117.57 ? 39   DG  a O6    1 
ATOM   6727  N  N1    . DG  I  5  39   ? 248.783 251.416 113.178 1.00 115.59 ? 39   DG  a N1    1 
ATOM   6728  C  C2    . DG  I  5  39   ? 247.930 252.490 113.096 1.00 113.04 ? 39   DG  a C2    1 
ATOM   6729  N  N2    . DG  I  5  39   ? 247.776 253.048 111.890 1.00 110.15 ? 39   DG  a N2    1 
ATOM   6730  N  N3    . DG  I  5  39   ? 247.279 252.998 114.130 1.00 114.48 ? 39   DG  a N3    1 
ATOM   6731  C  C4    . DG  I  5  39   ? 247.546 252.329 115.272 1.00 111.48 ? 39   DG  a C4    1 
ATOM   6732  P  P     . DA  I  5  40   ? 242.659 256.414 117.209 1.00 127.85 ? 40   DA  a P     1 
ATOM   6733  O  OP1   . DA  I  5  40   ? 243.302 257.479 118.010 1.00 118.39 ? 40   DA  a OP1   1 
ATOM   6734  O  OP2   . DA  I  5  40   ? 241.388 255.814 117.668 1.00 125.83 ? 40   DA  a OP2   1 
ATOM   6735  O  "O5'" . DA  I  5  40   ? 242.438 256.954 115.719 1.00 132.47 ? 40   DA  a "O5'" 1 
ATOM   6736  C  "C5'" . DA  I  5  40   ? 243.536 256.960 114.811 1.00 129.76 ? 40   DA  a "C5'" 1 
ATOM   6737  C  "C4'" . DA  I  5  40   ? 243.060 256.937 113.368 1.00 125.46 ? 40   DA  a "C4'" 1 
ATOM   6738  O  "O4'" . DA  I  5  40   ? 243.724 255.866 112.656 1.00 121.55 ? 40   DA  a "O4'" 1 
ATOM   6739  C  "C3'" . DA  I  5  40   ? 241.581 256.677 113.172 1.00 132.76 ? 40   DA  a "C3'" 1 
ATOM   6740  O  "O3'" . DA  I  5  40   ? 241.165 257.230 111.931 1.00 146.85 ? 40   DA  a "O3'" 1 
ATOM   6741  C  "C2'" . DA  I  5  40   ? 241.518 255.151 113.162 1.00 124.16 ? 40   DA  a "C2'" 1 
ATOM   6742  C  "C1'" . DA  I  5  40   ? 242.843 254.764 112.501 1.00 116.46 ? 40   DA  a "C1'" 1 
ATOM   6743  N  N9    . DA  I  5  40   ? 243.475 253.597 113.108 1.00 110.15 ? 40   DA  a N9    1 
ATOM   6744  C  C8    . DA  I  5  40   ? 243.532 253.298 114.438 1.00 113.09 ? 40   DA  a C8    1 
ATOM   6745  N  N7    . DA  I  5  40   ? 244.174 252.187 114.706 1.00 118.97 ? 40   DA  a N7    1 
ATOM   6746  C  C5    . DA  I  5  40   ? 244.574 251.728 113.464 1.00 120.77 ? 40   DA  a C5    1 
ATOM   6747  C  C6    . DA  I  5  40   ? 245.306 250.593 113.070 1.00 128.73 ? 40   DA  a C6    1 
ATOM   6748  N  N6    . DA  I  5  40   ? 245.766 249.682 113.933 1.00 133.24 ? 40   DA  a N6    1 
ATOM   6749  N  N1    . DA  I  5  40   ? 245.532 250.420 111.753 1.00 127.24 ? 40   DA  a N1    1 
ATOM   6750  C  C2    . DA  I  5  40   ? 245.067 251.337 110.894 1.00 126.96 ? 40   DA  a C2    1 
ATOM   6751  N  N3    . DA  I  5  40   ? 244.368 252.446 111.148 1.00 126.45 ? 40   DA  a N3    1 
ATOM   6752  C  C4    . DA  I  5  40   ? 244.148 252.578 112.466 1.00 116.94 ? 40   DA  a C4    1 
ATOM   6753  P  P     . DC  I  5  41   ? 239.664 257.020 111.397 1.00 166.47 ? 41   DC  a P     1 
ATOM   6754  O  OP1   . DC  I  5  41   ? 239.309 258.220 110.610 1.00 158.79 ? 41   DC  a OP1   1 
ATOM   6755  O  OP2   . DC  I  5  41   ? 238.811 256.616 112.539 1.00 162.91 ? 41   DC  a OP2   1 
ATOM   6756  O  "O5'" . DC  I  5  41   ? 239.791 255.778 110.397 1.00 154.54 ? 41   DC  a "O5'" 1 
ATOM   6757  C  "C5'" . DC  I  5  41   ? 240.711 255.840 109.316 1.00 154.31 ? 41   DC  a "C5'" 1 
ATOM   6758  C  "C4'" . DC  I  5  41   ? 240.678 254.561 108.497 1.00 157.96 ? 41   DC  a "C4'" 1 
ATOM   6759  O  "O4'" . DC  I  5  41   ? 241.434 253.523 109.175 1.00 154.66 ? 41   DC  a "O4'" 1 
ATOM   6760  C  "C3'" . DC  I  5  41   ? 239.284 253.982 108.254 1.00 162.41 ? 41   DC  a "C3'" 1 
ATOM   6761  O  "O3'" . DC  I  5  41   ? 239.177 253.544 106.910 1.00 176.42 ? 41   DC  a "O3'" 1 
ATOM   6762  C  "C2'" . DC  I  5  41   ? 239.219 252.808 109.231 1.00 151.72 ? 41   DC  a "C2'" 1 
ATOM   6763  C  "C1'" . DC  I  5  41   ? 240.665 252.347 109.229 1.00 149.42 ? 41   DC  a "C1'" 1 
ATOM   6764  N  N1    . DC  I  5  41   ? 241.056 251.584 110.445 1.00 141.02 ? 41   DC  a N1    1 
ATOM   6765  C  C2    . DC  I  5  41   ? 241.770 250.391 110.309 1.00 135.49 ? 41   DC  a C2    1 
ATOM   6766  O  O2    . DC  I  5  41   ? 242.048 249.988 109.175 1.00 135.00 ? 41   DC  a O2    1 
ATOM   6767  N  N3    . DC  I  5  41   ? 242.118 249.704 111.427 1.00 134.27 ? 41   DC  a N3    1 
ATOM   6768  C  C4    . DC  I  5  41   ? 241.788 250.178 112.630 1.00 135.51 ? 41   DC  a C4    1 
ATOM   6769  N  N4    . DC  I  5  41   ? 242.156 249.475 113.705 1.00 138.79 ? 41   DC  a N4    1 
ATOM   6770  C  C5    . DC  I  5  41   ? 241.066 251.397 112.786 1.00 136.85 ? 41   DC  a C5    1 
ATOM   6771  C  C6    . DC  I  5  41   ? 240.719 252.057 111.677 1.00 141.35 ? 41   DC  a C6    1 
ATOM   6772  P  P     . DA  I  5  42   ? 237.739 253.433 106.204 1.00 190.22 ? 42   DA  a P     1 
ATOM   6773  O  OP1   . DA  I  5  42   ? 237.730 254.372 105.061 1.00 185.19 ? 42   DA  a OP1   1 
ATOM   6774  O  OP2   . DA  I  5  42   ? 236.706 253.548 107.257 1.00 186.14 ? 42   DA  a OP2   1 
ATOM   6775  O  "O5'" . DA  I  5  42   ? 237.709 251.936 105.642 1.00 150.21 ? 42   DA  a "O5'" 1 
ATOM   6776  C  "C5'" . DA  I  5  42   ? 238.736 251.487 104.766 1.00 152.05 ? 42   DA  a "C5'" 1 
ATOM   6777  C  "C4'" . DA  I  5  42   ? 238.963 249.994 104.921 1.00 158.31 ? 42   DA  a "C4'" 1 
ATOM   6778  O  "O4'" . DA  I  5  42   ? 239.521 249.722 106.227 1.00 160.55 ? 42   DA  a "O4'" 1 
ATOM   6779  C  "C3'" . DA  I  5  42   ? 237.702 249.135 104.801 1.00 164.88 ? 42   DA  a "C3'" 1 
ATOM   6780  O  "O3'" . DA  I  5  42   ? 237.808 248.261 103.686 1.00 170.97 ? 42   DA  a "O3'" 1 
ATOM   6781  C  "C2'" . DA  I  5  42   ? 237.632 248.357 106.126 1.00 164.82 ? 42   DA  a "C2'" 1 
ATOM   6782  C  "C1'" . DA  I  5  42   ? 239.043 248.485 106.679 1.00 164.77 ? 42   DA  a "C1'" 1 
ATOM   6783  N  N9    . DA  I  5  42   ? 239.083 248.486 108.138 1.00 149.32 ? 42   DA  a N9    1 
ATOM   6784  C  C8    . DA  I  5  42   ? 238.581 249.448 108.967 1.00 146.55 ? 42   DA  a C8    1 
ATOM   6785  N  N7    . DA  I  5  42   ? 238.751 249.191 110.240 1.00 145.92 ? 42   DA  a N7    1 
ATOM   6786  C  C5    . DA  I  5  42   ? 239.407 247.972 110.248 1.00 146.06 ? 42   DA  a C5    1 
ATOM   6787  C  C6    . DA  I  5  42   ? 239.869 247.156 111.296 1.00 140.83 ? 42   DA  a C6    1 
ATOM   6788  N  N6    . DA  I  5  42   ? 239.734 247.475 112.586 1.00 141.14 ? 42   DA  a N6    1 
ATOM   6789  N  N1    . DA  I  5  42   ? 240.488 246.004 110.966 1.00 133.34 ? 42   DA  a N1    1 
ATOM   6790  C  C2    . DA  I  5  42   ? 240.625 245.694 109.671 1.00 133.51 ? 42   DA  a C2    1 
ATOM   6791  N  N3    . DA  I  5  42   ? 240.228 246.381 108.598 1.00 143.79 ? 42   DA  a N3    1 
ATOM   6792  C  C4    . DA  I  5  42   ? 239.622 247.523 108.960 1.00 148.14 ? 42   DA  a C4    1 
ATOM   6793  P  P     . DG  I  5  43   ? 236.591 247.286 103.301 1.00 171.56 ? 43   DG  a P     1 
ATOM   6794  O  OP1   . DG  I  5  43   ? 236.693 246.990 101.856 1.00 174.43 ? 43   DG  a OP1   1 
ATOM   6795  O  OP2   . DG  I  5  43   ? 235.347 247.876 103.843 1.00 163.91 ? 43   DG  a OP2   1 
ATOM   6796  O  "O5'" . DG  I  5  43   ? 236.900 245.951 104.123 1.00 161.47 ? 43   DG  a "O5'" 1 
ATOM   6797  C  "C5'" . DG  I  5  43   ? 238.186 245.352 104.038 1.00 167.40 ? 43   DG  a "C5'" 1 
ATOM   6798  C  "C4'" . DG  I  5  43   ? 238.264 244.105 104.899 1.00 172.52 ? 43   DG  a "C4'" 1 
ATOM   6799  O  "O4'" . DG  I  5  43   ? 238.427 244.477 106.290 1.00 174.01 ? 43   DG  a "O4'" 1 
ATOM   6800  C  "C3'" . DG  I  5  43   ? 237.030 243.198 104.838 1.00 172.64 ? 43   DG  a "C3'" 1 
ATOM   6801  O  "O3'" . DG  I  5  43   ? 237.429 241.862 104.567 1.00 172.72 ? 43   DG  a "O3'" 1 
ATOM   6802  C  "C2'" . DG  I  5  43   ? 236.412 243.330 106.232 1.00 174.42 ? 43   DG  a "C2'" 1 
ATOM   6803  C  "C1'" . DG  I  5  43   ? 237.633 243.632 107.079 1.00 173.36 ? 43   DG  a "C1'" 1 
ATOM   6804  N  N9    . DG  I  5  43   ? 237.328 244.315 108.333 1.00 155.28 ? 43   DG  a N9    1 
ATOM   6805  C  C8    . DG  I  5  43   ? 236.706 245.530 108.486 1.00 149.60 ? 43   DG  a C8    1 
ATOM   6806  N  N7    . DG  I  5  43   ? 236.570 245.892 109.731 1.00 146.12 ? 43   DG  a N7    1 
ATOM   6807  C  C5    . DG  I  5  43   ? 237.141 244.850 110.451 1.00 145.13 ? 43   DG  a C5    1 
ATOM   6808  C  C6    . DG  I  5  43   ? 237.284 244.679 111.847 1.00 131.19 ? 43   DG  a C6    1 
ATOM   6809  O  O6    . DG  I  5  43   ? 236.929 245.444 112.753 1.00 116.41 ? 43   DG  a O6    1 
ATOM   6810  N  N1    . DG  I  5  43   ? 237.921 243.480 112.156 1.00 132.41 ? 43   DG  a N1    1 
ATOM   6811  C  C2    . DG  I  5  43   ? 238.361 242.562 111.233 1.00 136.50 ? 43   DG  a C2    1 
ATOM   6812  N  N2    . DG  I  5  43   ? 238.949 241.459 111.714 1.00 136.70 ? 43   DG  a N2    1 
ATOM   6813  N  N3    . DG  I  5  43   ? 238.226 242.710 109.921 1.00 142.60 ? 43   DG  a N3    1 
ATOM   6814  C  C4    . DG  I  5  43   ? 237.611 243.874 109.604 1.00 149.11 ? 43   DG  a C4    1 
ATOM   6815  P  P     . DC  I  5  44   ? 236.375 240.808 103.970 1.00 156.41 ? 44   DC  a P     1 
ATOM   6816  O  OP1   . DC  I  5  44   ? 237.037 240.099 102.852 1.00 157.23 ? 44   DC  a OP1   1 
ATOM   6817  O  OP2   . DC  I  5  44   ? 235.100 241.521 103.741 1.00 150.77 ? 44   DC  a OP2   1 
ATOM   6818  O  "O5'" . DC  I  5  44   ? 236.151 239.776 105.167 1.00 154.55 ? 44   DC  a "O5'" 1 
ATOM   6819  C  "C5'" . DC  I  5  44   ? 237.254 239.053 105.691 1.00 150.32 ? 44   DC  a "C5'" 1 
ATOM   6820  C  "C4'" . DC  I  5  44   ? 236.947 238.539 107.085 1.00 146.37 ? 44   DC  a "C4'" 1 
ATOM   6821  O  "O4'" . DC  I  5  44   ? 236.847 239.651 107.995 1.00 145.45 ? 44   DC  a "O4'" 1 
ATOM   6822  C  "C3'" . DC  I  5  44   ? 235.625 237.777 107.209 1.00 145.00 ? 44   DC  a "C3'" 1 
ATOM   6823  O  "O3'" . DC  I  5  44   ? 235.875 236.391 107.412 1.00 147.27 ? 44   DC  a "O3'" 1 
ATOM   6824  C  "C2'" . DC  I  5  44   ? 234.922 238.407 108.425 1.00 145.39 ? 44   DC  a "C2'" 1 
ATOM   6825  C  "C1'" . DC  I  5  44   ? 235.999 239.284 109.046 1.00 140.67 ? 44   DC  a "C1'" 1 
ATOM   6826  N  N1    . DC  I  5  44   ? 235.465 240.523 109.680 1.00 139.88 ? 44   DC  a N1    1 
ATOM   6827  C  C2    . DC  I  5  44   ? 235.497 240.653 111.071 1.00 127.65 ? 44   DC  a C2    1 
ATOM   6828  O  O2    . DC  I  5  44   ? 235.966 239.730 111.744 1.00 126.28 ? 44   DC  a O2    1 
ATOM   6829  N  N3    . DC  I  5  44   ? 235.002 241.783 111.636 1.00 124.50 ? 44   DC  a N3    1 
ATOM   6830  C  C4    . DC  I  5  44   ? 234.496 242.748 110.866 1.00 135.14 ? 44   DC  a C4    1 
ATOM   6831  N  N4    . DC  I  5  44   ? 234.028 243.849 111.462 1.00 140.92 ? 44   DC  a N4    1 
ATOM   6832  C  C5    . DC  I  5  44   ? 234.463 242.635 109.444 1.00 139.16 ? 44   DC  a C5    1 
ATOM   6833  C  C6    . DC  I  5  44   ? 234.953 241.517 108.899 1.00 143.43 ? 44   DC  a C6    1 
ATOM   6834  P  P     . DT  I  5  45   ? 234.652 235.364 107.598 1.00 142.52 ? 45   DT  a P     1 
ATOM   6835  O  OP1   . DT  I  5  45   ? 235.107 234.039 107.124 1.00 142.29 ? 45   DT  a OP1   1 
ATOM   6836  O  OP2   . DT  I  5  45   ? 233.441 235.978 107.010 1.00 134.49 ? 45   DT  a OP2   1 
ATOM   6837  O  "O5'" . DT  I  5  45   ? 234.453 235.294 109.182 1.00 152.49 ? 45   DT  a "O5'" 1 
ATOM   6838  C  "C5'" . DT  I  5  45   ? 235.551 234.954 110.016 1.00 146.81 ? 45   DT  a "C5'" 1 
ATOM   6839  C  "C4'" . DT  I  5  45   ? 235.127 234.861 111.471 1.00 137.68 ? 45   DT  a "C4'" 1 
ATOM   6840  O  "O4'" . DT  I  5  45   ? 234.878 236.191 112.000 1.00 137.16 ? 45   DT  a "O4'" 1 
ATOM   6841  C  "C3'" . DT  I  5  45   ? 233.856 234.057 111.732 1.00 133.02 ? 45   DT  a "C3'" 1 
ATOM   6842  O  "O3'" . DT  I  5  45   ? 234.030 233.277 112.903 1.00 135.37 ? 45   DT  a "O3'" 1 
ATOM   6843  C  "C2'" . DT  I  5  45   ? 232.798 235.144 111.932 1.00 134.67 ? 45   DT  a "C2'" 1 
ATOM   6844  C  "C1'" . DT  I  5  45   ? 233.615 236.218 112.627 1.00 133.75 ? 45   DT  a "C1'" 1 
ATOM   6845  N  N1    . DT  I  5  45   ? 233.058 237.596 112.492 1.00 114.19 ? 45   DT  a N1    1 
ATOM   6846  C  C2    . DT  I  5  45   ? 232.863 238.354 113.622 1.00 112.71 ? 45   DT  a C2    1 
ATOM   6847  O  O2    . DT  I  5  45   ? 233.113 237.955 114.743 1.00 116.52 ? 45   DT  a O2    1 
ATOM   6848  N  N3    . DT  I  5  45   ? 232.368 239.609 113.390 1.00 114.02 ? 45   DT  a N3    1 
ATOM   6849  C  C4    . DT  I  5  45   ? 232.050 240.167 112.166 1.00 119.72 ? 45   DT  a C4    1 
ATOM   6850  O  O4    . DT  I  5  45   ? 231.608 241.306 112.058 1.00 116.54 ? 45   DT  a O4    1 
ATOM   6851  C  C5    . DT  I  5  45   ? 232.281 239.322 111.023 1.00 124.65 ? 45   DT  a C5    1 
ATOM   6852  C  C7    . DT  I  5  45   ? 231.970 239.826 109.646 1.00 130.89 ? 45   DT  a C7    1 
ATOM   6853  C  C6    . DT  I  5  45   ? 232.777 238.093 111.237 1.00 118.56 ? 45   DT  a C6    1 
ATOM   6854  P  P     . DC  I  5  46   ? 233.092 232.006 113.190 1.00 145.57 ? 46   DC  a P     1 
ATOM   6855  O  OP1   . DC  I  5  46   ? 233.930 230.794 113.040 1.00 140.36 ? 46   DC  a OP1   1 
ATOM   6856  O  OP2   . DC  I  5  46   ? 231.855 232.146 112.389 1.00 137.98 ? 46   DC  a OP2   1 
ATOM   6857  O  "O5'" . DC  I  5  46   ? 232.704 232.175 114.732 1.00 128.09 ? 46   DC  a "O5'" 1 
ATOM   6858  C  "C5'" . DC  I  5  46   ? 232.896 233.435 115.371 1.00 119.84 ? 46   DC  a "C5'" 1 
ATOM   6859  C  "C4'" . DC  I  5  46   ? 231.725 233.759 116.277 1.00 115.78 ? 46   DC  a "C4'" 1 
ATOM   6860  O  "O4'" . DC  I  5  46   ? 231.185 235.064 115.924 1.00 122.54 ? 46   DC  a "O4'" 1 
ATOM   6861  C  "C3'" . DC  I  5  46   ? 230.548 232.796 116.165 1.00 109.63 ? 46   DC  a "C3'" 1 
ATOM   6862  O  "O3'" . DC  I  5  46   ? 229.826 232.771 117.393 1.00 107.84 ? 46   DC  a "O3'" 1 
ATOM   6863  C  "C2'" . DC  I  5  46   ? 229.731 233.463 115.068 1.00 117.85 ? 46   DC  a "C2'" 1 
ATOM   6864  C  "C1'" . DC  I  5  46   ? 229.843 234.909 115.517 1.00 120.21 ? 46   DC  a "C1'" 1 
ATOM   6865  N  N1    . DC  I  5  46   ? 229.539 235.914 114.458 1.00 112.06 ? 46   DC  a N1    1 
ATOM   6866  C  C2    . DC  I  5  46   ? 229.266 237.233 114.829 1.00 121.14 ? 46   DC  a C2    1 
ATOM   6867  O  O2    . DC  I  5  46   ? 229.291 237.530 116.029 1.00 131.23 ? 46   DC  a O2    1 
ATOM   6868  N  N3    . DC  I  5  46   ? 228.989 238.144 113.864 1.00 117.46 ? 46   DC  a N3    1 
ATOM   6869  C  C4    . DC  I  5  46   ? 228.978 237.774 112.583 1.00 113.28 ? 46   DC  a C4    1 
ATOM   6870  N  N4    . DC  I  5  46   ? 228.698 238.704 111.663 1.00 113.55 ? 46   DC  a N4    1 
ATOM   6871  C  C5    . DC  I  5  46   ? 229.249 236.431 112.186 1.00 109.99 ? 46   DC  a C5    1 
ATOM   6872  C  C6    . DC  I  5  46   ? 229.521 235.543 113.147 1.00 107.22 ? 46   DC  a C6    1 
ATOM   6873  P  P     . DT  I  5  47   ? 230.376 231.958 118.666 1.00 114.60 ? 47   DT  a P     1 
ATOM   6874  O  OP1   . DT  I  5  47   ? 231.765 231.519 118.405 1.00 115.16 ? 47   DT  a OP1   1 
ATOM   6875  O  OP2   . DT  I  5  47   ? 229.350 230.950 119.014 1.00 109.51 ? 47   DT  a OP2   1 
ATOM   6876  O  "O5'" . DT  I  5  47   ? 230.384 233.053 119.833 1.00 104.38 ? 47   DT  a "O5'" 1 
ATOM   6877  C  "C5'" . DT  I  5  47   ? 230.074 234.409 119.528 1.00 93.79  ? 47   DT  a "C5'" 1 
ATOM   6878  C  "C4'" . DT  I  5  47   ? 229.684 235.177 120.778 1.00 90.23  ? 47   DT  a "C4'" 1 
ATOM   6879  O  "O4'" . DT  I  5  47   ? 228.863 236.307 120.411 1.00 99.70  ? 47   DT  a "O4'" 1 
ATOM   6880  C  "C3'" . DT  I  5  47   ? 228.813 234.424 121.751 1.00 88.97  ? 47   DT  a "C3'" 1 
ATOM   6881  O  "O3'" . DT  I  5  47   ? 228.825 235.120 122.991 1.00 99.58  ? 47   DT  a "O3'" 1 
ATOM   6882  C  "C2'" . DT  I  5  47   ? 227.451 234.518 121.061 1.00 93.01  ? 47   DT  a "C2'" 1 
ATOM   6883  C  "C1'" . DT  I  5  47   ? 227.495 235.923 120.447 1.00 102.61 ? 47   DT  a "C1'" 1 
ATOM   6884  N  N1    . DT  I  5  47   ? 226.983 235.993 119.054 1.00 98.04  ? 47   DT  a N1    1 
ATOM   6885  C  C2    . DT  I  5  47   ? 226.580 237.206 118.552 1.00 102.94 ? 47   DT  a C2    1 
ATOM   6886  O  O2    . DT  I  5  47   ? 226.650 238.244 119.183 1.00 110.05 ? 47   DT  a O2    1 
ATOM   6887  N  N3    . DT  I  5  47   ? 226.184 237.181 117.245 1.00 108.04 ? 47   DT  a N3    1 
ATOM   6888  C  C4    . DT  I  5  47   ? 226.120 236.078 116.413 1.00 109.31 ? 47   DT  a C4    1 
ATOM   6889  O  O4    . DT  I  5  47   ? 225.699 236.147 115.264 1.00 108.11 ? 47   DT  a O4    1 
ATOM   6890  C  C5    . DT  I  5  47   ? 226.512 234.829 117.016 1.00 105.62 ? 47   DT  a C5    1 
ATOM   6891  C  C7    . DT  I  5  47   ? 226.459 233.559 116.220 1.00 112.25 ? 47   DT  a C7    1 
ATOM   6892  C  C6    . DT  I  5  47   ? 226.940 234.849 118.287 1.00 104.37 ? 47   DT  a C6    1 
ATOM   6893  P  P     . DA  I  5  48   ? 228.070 234.545 124.288 1.00 131.31 ? 48   DA  a P     1 
ATOM   6894  O  OP1   . DA  I  5  48   ? 229.095 234.384 125.342 1.00 117.33 ? 48   DA  a OP1   1 
ATOM   6895  O  OP2   . DA  I  5  48   ? 227.225 233.392 123.909 1.00 126.16 ? 48   DA  a OP2   1 
ATOM   6896  O  "O5'" . DA  I  5  48   ? 227.113 235.752 124.708 1.00 126.89 ? 48   DA  a "O5'" 1 
ATOM   6897  C  "C5'" . DA  I  5  48   ? 227.637 237.073 124.755 1.00 108.00 ? 48   DA  a "C5'" 1 
ATOM   6898  C  "C4'" . DA  I  5  48   ? 226.600 238.091 124.317 1.00 114.83 ? 48   DA  a "C4'" 1 
ATOM   6899  O  "O4'" . DA  I  5  48   ? 226.166 237.803 122.961 1.00 122.23 ? 48   DA  a "O4'" 1 
ATOM   6900  C  "C3'" . DA  I  5  48   ? 225.332 238.130 125.168 1.00 106.66 ? 48   DA  a "C3'" 1 
ATOM   6901  O  "O3'" . DA  I  5  48   ? 224.950 239.474 125.382 1.00 102.49 ? 48   DA  a "O3'" 1 
ATOM   6902  C  "C2'" . DA  I  5  48   ? 224.313 237.391 124.303 1.00 109.99 ? 48   DA  a "C2'" 1 
ATOM   6903  C  "C1'" . DA  I  5  48   ? 224.758 237.804 122.913 1.00 117.85 ? 48   DA  a "C1'" 1 
ATOM   6904  N  N9    . DA  I  5  48   ? 224.329 236.884 121.862 1.00 98.94  ? 48   DA  a N9    1 
ATOM   6905  C  C8    . DA  I  5  48   ? 224.333 235.520 121.914 1.00 97.53  ? 48   DA  a C8    1 
ATOM   6906  N  N7    . DA  I  5  48   ? 223.895 234.948 120.819 1.00 97.27  ? 48   DA  a N7    1 
ATOM   6907  C  C5    . DA  I  5  48   ? 223.578 236.011 119.991 1.00 113.01 ? 48   DA  a C5    1 
ATOM   6908  C  C6    . DA  I  5  48   ? 223.062 236.072 118.681 1.00 120.33 ? 48   DA  a C6    1 
ATOM   6909  N  N6    . DA  I  5  48   ? 222.762 234.989 117.960 1.00 102.92 ? 48   DA  a N6    1 
ATOM   6910  N  N1    . DA  I  5  48   ? 222.862 237.292 118.143 1.00 127.85 ? 48   DA  a N1    1 
ATOM   6911  C  C2    . DA  I  5  48   ? 223.167 238.374 118.870 1.00 113.02 ? 48   DA  a C2    1 
ATOM   6912  N  N3    . DA  I  5  48   ? 223.653 238.442 120.111 1.00 110.11 ? 48   DA  a N3    1 
ATOM   6913  C  C4    . DA  I  5  48   ? 223.834 237.212 120.619 1.00 111.00 ? 48   DA  a C4    1 
ATOM   6914  P  P     . DG  I  5  49   ? 224.060 239.878 126.653 1.00 90.88  ? 49   DG  a P     1 
ATOM   6915  O  OP1   . DG  I  5  49   ? 224.970 240.434 127.679 1.00 90.93  ? 49   DG  a OP1   1 
ATOM   6916  O  OP2   . DG  I  5  49   ? 223.189 238.731 126.993 1.00 99.39  ? 49   DG  a OP2   1 
ATOM   6917  O  "O5'" . DG  I  5  49   ? 223.131 241.048 126.092 1.00 100.96 ? 49   DG  a "O5'" 1 
ATOM   6918  C  "C5'" . DG  I  5  49   ? 223.670 242.003 125.188 1.00 96.45  ? 49   DG  a "C5'" 1 
ATOM   6919  C  "C4'" . DG  I  5  49   ? 222.658 242.354 124.115 1.00 88.61  ? 49   DG  a "C4'" 1 
ATOM   6920  O  "O4'" . DG  I  5  49   ? 222.603 241.289 123.133 1.00 89.18  ? 49   DG  a "O4'" 1 
ATOM   6921  C  "C3'" . DG  I  5  49   ? 221.226 242.543 124.626 1.00 83.36  ? 49   DG  a "C3'" 1 
ATOM   6922  O  "O3'" . DG  I  5  49   ? 220.722 243.811 124.240 1.00 88.20  ? 49   DG  a "O3'" 1 
ATOM   6923  C  "C2'" . DG  I  5  49   ? 220.443 241.406 123.974 1.00 89.74  ? 49   DG  a "C2'" 1 
ATOM   6924  C  "C1'" . DG  I  5  49   ? 221.272 241.107 122.735 1.00 96.82  ? 49   DG  a "C1'" 1 
ATOM   6925  N  N9    . DG  I  5  49   ? 221.102 239.737 122.259 1.00 93.38  ? 49   DG  a N9    1 
ATOM   6926  C  C8    . DG  I  5  49   ? 221.429 238.584 122.929 1.00 106.03 ? 49   DG  a C8    1 
ATOM   6927  N  N7    . DG  I  5  49   ? 221.151 237.500 122.266 1.00 112.09 ? 49   DG  a N7    1 
ATOM   6928  C  C5    . DG  I  5  49   ? 220.595 237.958 121.080 1.00 107.69 ? 49   DG  a C5    1 
ATOM   6929  C  C6    . DG  I  5  49   ? 220.098 237.236 119.970 1.00 115.04 ? 49   DG  a C6    1 
ATOM   6930  O  O6    . DG  I  5  49   ? 220.060 236.009 119.811 1.00 111.09 ? 49   DG  a O6    1 
ATOM   6931  N  N1    . DG  I  5  49   ? 219.623 238.085 118.973 1.00 127.83 ? 49   DG  a N1    1 
ATOM   6932  C  C2    . DG  I  5  49   ? 219.626 239.458 119.044 1.00 115.50 ? 49   DG  a C2    1 
ATOM   6933  N  N2    . DG  I  5  49   ? 219.120 240.114 117.988 1.00 114.17 ? 49   DG  a N2    1 
ATOM   6934  N  N3    . DG  I  5  49   ? 220.084 240.146 120.084 1.00 93.96  ? 49   DG  a N3    1 
ATOM   6935  C  C4    . DG  I  5  49   ? 220.556 239.333 121.059 1.00 95.90  ? 49   DG  a C4    1 
ATOM   6936  P  P     . DC  I  5  50   ? 219.450 244.428 125.004 1.00 102.70 ? 50   DC  a P     1 
ATOM   6937  O  OP1   . DC  I  5  50   ? 219.670 245.884 125.144 1.00 94.77  ? 50   DC  a OP1   1 
ATOM   6938  O  OP2   . DC  I  5  50   ? 219.205 243.602 126.205 1.00 108.85 ? 50   DC  a OP2   1 
ATOM   6939  O  "O5'" . DC  I  5  50   ? 218.239 244.197 123.989 1.00 78.98  ? 50   DC  a "O5'" 1 
ATOM   6940  C  "C5'" . DC  I  5  50   ? 218.006 245.133 122.949 1.00 91.31  ? 50   DC  a "C5'" 1 
ATOM   6941  C  "C4'" . DC  I  5  50   ? 217.187 244.514 121.832 1.00 99.40  ? 50   DC  a "C4'" 1 
ATOM   6942  O  "O4'" . DC  I  5  50   ? 217.768 243.258 121.445 1.00 99.82  ? 50   DC  a "O4'" 1 
ATOM   6943  C  "C3'" . DC  I  5  50   ? 215.759 244.160 122.197 1.00 98.47  ? 50   DC  a "C3'" 1 
ATOM   6944  O  "O3'" . DC  I  5  50   ? 214.923 245.294 122.031 1.00 115.99 ? 50   DC  a "O3'" 1 
ATOM   6945  C  "C2'" . DC  I  5  50   ? 215.416 243.067 121.181 1.00 98.26  ? 50   DC  a "C2'" 1 
ATOM   6946  C  "C1'" . DC  I  5  50   ? 216.783 242.500 120.778 1.00 96.96  ? 50   DC  a "C1'" 1 
ATOM   6947  N  N1    . DC  I  5  50   ? 216.971 241.056 121.114 1.00 110.44 ? 50   DC  a N1    1 
ATOM   6948  C  C2    . DC  I  5  50   ? 216.512 240.079 120.227 1.00 110.79 ? 50   DC  a C2    1 
ATOM   6949  O  O2    . DC  I  5  50   ? 215.937 240.439 119.195 1.00 108.86 ? 50   DC  a O2    1 
ATOM   6950  N  N3    . DC  I  5  50   ? 216.691 238.771 120.539 1.00 109.08 ? 50   DC  a N3    1 
ATOM   6951  C  C4    . DC  I  5  50   ? 217.312 238.436 121.671 1.00 109.43 ? 50   DC  a C4    1 
ATOM   6952  N  N4    . DC  I  5  50   ? 217.476 237.134 121.938 1.00 113.77 ? 50   DC  a N4    1 
ATOM   6953  C  C5    . DC  I  5  50   ? 217.792 239.420 122.584 1.00 111.26 ? 50   DC  a C5    1 
ATOM   6954  C  C6    . DC  I  5  50   ? 217.603 240.705 122.266 1.00 116.34 ? 50   DC  a C6    1 
ATOM   6955  P  P     . DA  I  5  51   ? 213.607 245.480 122.934 1.00 138.09 ? 51   DA  a P     1 
ATOM   6956  O  OP1   . DA  I  5  51   ? 213.271 246.920 122.944 1.00 124.23 ? 51   DA  a OP1   1 
ATOM   6957  O  OP2   . DA  I  5  51   ? 213.832 244.765 124.210 1.00 124.77 ? 51   DA  a OP2   1 
ATOM   6958  O  "O5'" . DA  I  5  51   ? 212.471 244.696 122.126 1.00 133.61 ? 51   DA  a "O5'" 1 
ATOM   6959  C  "C5'" . DA  I  5  51   ? 212.119 245.111 120.812 1.00 133.85 ? 51   DA  a "C5'" 1 
ATOM   6960  C  "C4'" . DA  I  5  51   ? 211.549 243.950 120.017 1.00 139.72 ? 51   DA  a "C4'" 1 
ATOM   6961  O  "O4'" . DA  I  5  51   ? 212.496 242.869 120.018 1.00 143.00 ? 51   DA  a "O4'" 1 
ATOM   6962  C  "C3'" . DA  I  5  51   ? 210.274 243.356 120.587 1.00 143.89 ? 51   DA  a "C3'" 1 
ATOM   6963  O  "O3'" . DA  I  5  51   ? 209.143 244.005 120.012 1.00 149.41 ? 51   DA  a "O3'" 1 
ATOM   6964  C  "C2'" . DA  I  5  51   ? 210.343 241.881 120.170 1.00 146.80 ? 51   DA  a "C2'" 1 
ATOM   6965  C  "C1'" . DA  I  5  51   ? 211.818 241.651 119.824 1.00 145.49 ? 51   DA  a "C1'" 1 
ATOM   6966  N  N9    . DA  I  5  51   ? 212.463 240.628 120.642 1.00 124.87 ? 51   DA  a N9    1 
ATOM   6967  C  C8    . DA  I  5  51   ? 213.209 240.827 121.769 1.00 123.25 ? 51   DA  a C8    1 
ATOM   6968  N  N7    . DA  I  5  51   ? 213.683 239.725 122.295 1.00 130.65 ? 51   DA  a N7    1 
ATOM   6969  C  C5    . DA  I  5  51   ? 213.209 238.732 121.459 1.00 134.83 ? 51   DA  a C5    1 
ATOM   6970  C  C6    . DA  I  5  51   ? 213.358 237.335 121.477 1.00 136.24 ? 51   DA  a C6    1 
ATOM   6971  N  N6    . DA  I  5  51   ? 214.059 236.685 122.410 1.00 142.16 ? 51   DA  a N6    1 
ATOM   6972  N  N1    . DA  I  5  51   ? 212.758 236.630 120.497 1.00 136.83 ? 51   DA  a N1    1 
ATOM   6973  C  C2    . DA  I  5  51   ? 212.061 237.288 119.564 1.00 122.46 ? 51   DA  a C2    1 
ATOM   6974  N  N3    . DA  I  5  51   ? 211.849 238.598 119.445 1.00 120.55 ? 51   DA  a N3    1 
ATOM   6975  C  C4    . DA  I  5  51   ? 212.459 239.269 120.432 1.00 127.93 ? 51   DA  a C4    1 
ATOM   6976  P  P     . DC  I  5  52   ? 207.734 244.025 120.786 1.00 141.04 ? 52   DC  a P     1 
ATOM   6977  O  OP1   . DC  I  5  52   ? 206.823 244.906 120.023 1.00 141.59 ? 52   DC  a OP1   1 
ATOM   6978  O  OP2   . DC  I  5  52   ? 208.003 244.302 122.213 1.00 119.59 ? 52   DC  a OP2   1 
ATOM   6979  O  "O5'" . DC  I  5  52   ? 207.207 242.520 120.664 1.00 151.10 ? 52   DC  a "O5'" 1 
ATOM   6980  C  "C5'" . DC  I  5  52   ? 206.893 241.980 119.388 1.00 149.60 ? 52   DC  a "C5'" 1 
ATOM   6981  C  "C4'" . DC  I  5  52   ? 206.765 240.469 119.452 1.00 143.81 ? 52   DC  a "C4'" 1 
ATOM   6982  O  "O4'" . DC  I  5  52   ? 208.022 239.887 119.837 1.00 153.47 ? 52   DC  a "O4'" 1 
ATOM   6983  C  "C3'" . DC  I  5  52   ? 205.794 239.953 120.490 1.00 133.00 ? 52   DC  a "C3'" 1 
ATOM   6984  O  "O3'" . DC  I  5  52   ? 204.479 239.942 119.960 1.00 136.79 ? 52   DC  a "O3'" 1 
ATOM   6985  C  "C2'" . DC  I  5  52   ? 206.302 238.530 120.748 1.00 145.77 ? 52   DC  a "C2'" 1 
ATOM   6986  C  "C1'" . DC  I  5  52   ? 207.777 238.589 120.328 1.00 157.00 ? 52   DC  a "C1'" 1 
ATOM   6987  N  N1    . DC  I  5  52   ? 208.718 238.296 121.441 1.00 126.05 ? 52   DC  a N1    1 
ATOM   6988  C  C2    . DC  I  5  52   ? 209.090 236.973 121.687 1.00 130.92 ? 52   DC  a C2    1 
ATOM   6989  O  O2    . DC  I  5  52   ? 208.620 236.084 120.971 1.00 141.24 ? 52   DC  a O2    1 
ATOM   6990  N  N3    . DC  I  5  52   ? 209.939 236.705 122.710 1.00 127.26 ? 52   DC  a N3    1 
ATOM   6991  C  C4    . DC  I  5  52   ? 210.405 237.701 123.464 1.00 132.38 ? 52   DC  a C4    1 
ATOM   6992  N  N4    . DC  I  5  52   ? 211.253 237.395 124.453 1.00 123.63 ? 52   DC  a N4    1 
ATOM   6993  C  C5    . DC  I  5  52   ? 210.047 239.060 123.221 1.00 135.43 ? 52   DC  a C5    1 
ATOM   6994  C  C6    . DC  I  5  52   ? 209.206 239.308 122.213 1.00 120.91 ? 52   DC  a C6    1 
ATOM   6995  P  P     . DC  I  5  53   ? 203.218 239.709 120.927 1.00 140.57 ? 53   DC  a P     1 
ATOM   6996  O  OP1   . DC  I  5  53   ? 202.025 240.240 120.236 1.00 137.69 ? 53   DC  a OP1   1 
ATOM   6997  O  OP2   . DC  I  5  53   ? 203.577 240.225 122.265 1.00 131.61 ? 53   DC  a OP2   1 
ATOM   6998  O  "O5'" . DC  I  5  53   ? 203.107 238.115 121.037 1.00 137.72 ? 53   DC  a "O5'" 1 
ATOM   6999  C  "C5'" . DC  I  5  53   ? 203.194 237.313 119.864 1.00 141.57 ? 53   DC  a "C5'" 1 
ATOM   7000  C  "C4'" . DC  I  5  53   ? 203.372 235.850 120.221 1.00 142.64 ? 53   DC  a "C4'" 1 
ATOM   7001  O  "O4'" . DC  I  5  53   ? 204.608 235.676 120.962 1.00 141.92 ? 53   DC  a "O4'" 1 
ATOM   7002  C  "C3'" . DC  I  5  53   ? 202.262 235.258 121.092 1.00 134.15 ? 53   DC  a "C3'" 1 
ATOM   7003  O  "O3'" . DC  I  5  53   ? 201.878 233.987 120.586 1.00 128.28 ? 53   DC  a "O3'" 1 
ATOM   7004  C  "C2'" . DC  I  5  53   ? 202.913 235.143 122.468 1.00 127.77 ? 53   DC  a "C2'" 1 
ATOM   7005  C  "C1'" . DC  I  5  53   ? 204.365 234.891 122.103 1.00 141.49 ? 53   DC  a "C1'" 1 
ATOM   7006  N  N1    . DC  I  5  53   ? 205.315 235.302 123.168 1.00 121.80 ? 53   DC  a N1    1 
ATOM   7007  C  C2    . DC  I  5  53   ? 206.062 234.333 123.842 1.00 116.62 ? 53   DC  a C2    1 
ATOM   7008  O  O2    . DC  I  5  53   ? 205.919 233.144 123.533 1.00 123.04 ? 53   DC  a O2    1 
ATOM   7009  N  N3    . DC  I  5  53   ? 206.920 234.727 124.817 1.00 115.34 ? 53   DC  a N3    1 
ATOM   7010  C  C4    . DC  I  5  53   ? 207.038 236.023 125.115 1.00 112.07 ? 53   DC  a C4    1 
ATOM   7011  N  N4    . DC  I  5  53   ? 207.895 236.371 126.079 1.00 106.77 ? 53   DC  a N4    1 
ATOM   7012  C  C5    . DC  I  5  53   ? 206.283 237.022 124.438 1.00 116.67 ? 53   DC  a C5    1 
ATOM   7013  C  C6    . DC  I  5  53   ? 205.442 236.620 123.483 1.00 126.36 ? 53   DC  a C6    1 
ATOM   7014  P  P     . DG  I  5  54   ? 200.460 233.346 120.991 1.00 138.51 ? 54   DG  a P     1 
ATOM   7015  O  OP1   . DG  I  5  54   ? 199.636 233.275 119.768 1.00 121.43 ? 54   DG  a OP1   1 
ATOM   7016  O  OP2   . DG  I  5  54   ? 199.953 234.062 122.182 1.00 134.19 ? 54   DG  a OP2   1 
ATOM   7017  O  "O5'" . DG  I  5  54   ? 200.837 231.862 121.445 1.00 153.51 ? 54   DG  a "O5'" 1 
ATOM   7018  C  "C5'" . DG  I  5  54   ? 201.981 231.649 122.253 1.00 148.11 ? 54   DG  a "C5'" 1 
ATOM   7019  C  "C4'" . DG  I  5  54   ? 201.970 230.259 122.854 1.00 136.00 ? 54   DG  a "C4'" 1 
ATOM   7020  O  "O4'" . DG  I  5  54   ? 203.060 230.150 123.794 1.00 139.09 ? 54   DG  a "O4'" 1 
ATOM   7021  C  "C3'" . DG  I  5  54   ? 200.739 229.928 123.670 1.00 123.44 ? 54   DG  a "C3'" 1 
ATOM   7022  O  "O3'" . DG  I  5  54   ? 200.612 228.520 123.803 1.00 130.69 ? 54   DG  a "O3'" 1 
ATOM   7023  C  "C2'" . DG  I  5  54   ? 201.064 230.586 125.005 1.00 120.35 ? 54   DG  a "C2'" 1 
ATOM   7024  C  "C1'" . DG  I  5  54   ? 202.581 230.392 125.104 1.00 133.50 ? 54   DG  a "C1'" 1 
ATOM   7025  N  N9    . DG  I  5  54   ? 203.275 231.558 125.639 1.00 111.66 ? 54   DG  a N9    1 
ATOM   7026  C  C8    . DG  I  5  54   ? 203.057 232.874 125.310 1.00 111.35 ? 54   DG  a C8    1 
ATOM   7027  N  N7    . DG  I  5  54   ? 203.826 233.706 125.952 1.00 111.63 ? 54   DG  a N7    1 
ATOM   7028  C  C5    . DG  I  5  54   ? 204.606 232.890 126.762 1.00 110.67 ? 54   DG  a C5    1 
ATOM   7029  C  C6    . DG  I  5  54   ? 205.614 233.228 127.691 1.00 104.01 ? 54   DG  a C6    1 
ATOM   7030  O  O6    . DG  I  5  54   ? 206.047 234.353 127.975 1.00 99.34  ? 54   DG  a O6    1 
ATOM   7031  N  N1    . DG  I  5  54   ? 206.156 232.098 128.295 1.00 103.85 ? 54   DG  a N1    1 
ATOM   7032  C  C2    . DG  I  5  54   ? 205.765 230.806 128.041 1.00 109.79 ? 54   DG  a C2    1 
ATOM   7033  N  N2    . DG  I  5  54   ? 206.389 229.841 128.732 1.00 109.48 ? 54   DG  a N2    1 
ATOM   7034  N  N3    . DG  I  5  54   ? 204.808 230.478 127.184 1.00 115.12 ? 54   DG  a N3    1 
ATOM   7035  C  C4    . DG  I  5  54   ? 204.279 231.567 126.579 1.00 113.03 ? 54   DG  a C4    1 
ATOM   7036  P  P     . DC  I  5  55   ? 199.387 227.890 124.627 1.00 138.51 ? 55   DC  a P     1 
ATOM   7037  O  OP1   . DC  I  5  55   ? 199.196 226.504 124.148 1.00 115.30 ? 55   DC  a OP1   1 
ATOM   7038  O  OP2   . DC  I  5  55   ? 198.262 228.847 124.573 1.00 131.58 ? 55   DC  a OP2   1 
ATOM   7039  O  "O5'" . DC  I  5  55   ? 199.922 227.842 126.134 1.00 158.48 ? 55   DC  a "O5'" 1 
ATOM   7040  C  "C5'" . DC  I  5  55   ? 201.122 227.146 126.436 1.00 142.23 ? 55   DC  a "C5'" 1 
ATOM   7041  C  "C4'" . DC  I  5  55   ? 201.425 227.212 127.921 1.00 125.74 ? 55   DC  a "C4'" 1 
ATOM   7042  O  "O4'" . DC  I  5  55   ? 202.214 228.395 128.212 1.00 125.90 ? 55   DC  a "O4'" 1 
ATOM   7043  C  "C3'" . DC  I  5  55   ? 200.195 227.284 128.832 1.00 127.57 ? 55   DC  a "C3'" 1 
ATOM   7044  O  "O3'" . DC  I  5  55   ? 200.315 226.334 129.884 1.00 145.14 ? 55   DC  a "O3'" 1 
ATOM   7045  C  "C2'" . DC  I  5  55   ? 200.229 228.715 129.360 1.00 121.12 ? 55   DC  a "C2'" 1 
ATOM   7046  C  "C1'" . DC  I  5  55   ? 201.717 228.992 129.383 1.00 118.02 ? 55   DC  a "C1'" 1 
ATOM   7047  N  N1    . DC  I  5  55   ? 202.047 230.442 129.363 1.00 105.65 ? 55   DC  a N1    1 
ATOM   7048  C  C2    . DC  I  5  55   ? 203.051 230.935 130.201 1.00 124.69 ? 55   DC  a C2    1 
ATOM   7049  O  O2    . DC  I  5  55   ? 203.650 230.147 130.944 1.00 141.89 ? 55   DC  a O2    1 
ATOM   7050  N  N3    . DC  I  5  55   ? 203.333 232.261 130.178 1.00 112.43 ? 55   DC  a N3    1 
ATOM   7051  C  C4    . DC  I  5  55   ? 202.649 233.073 129.368 1.00 108.67 ? 55   DC  a C4    1 
ATOM   7052  N  N4    . DC  I  5  55   ? 202.965 234.372 129.367 1.00 92.06  ? 55   DC  a N4    1 
ATOM   7053  C  C5    . DC  I  5  55   ? 201.627 232.586 128.501 1.00 104.50 ? 55   DC  a C5    1 
ATOM   7054  C  C6    . DC  I  5  55   ? 201.362 231.278 128.532 1.00 98.85  ? 55   DC  a C6    1 
ATOM   7055  P  P     . DT  I  5  56   ? 199.084 226.035 130.877 1.00 119.66 ? 56   DT  a P     1 
ATOM   7056  O  OP1   . DT  I  5  56   ? 198.775 224.592 130.777 1.00 113.73 ? 56   DT  a OP1   1 
ATOM   7057  O  OP2   . DT  I  5  56   ? 198.010 227.024 130.642 1.00 114.83 ? 56   DT  a OP2   1 
ATOM   7058  O  "O5'" . DT  I  5  56   ? 199.707 226.302 132.321 1.00 118.59 ? 56   DT  a "O5'" 1 
ATOM   7059  C  "C5'" . DT  I  5  56   ? 200.890 225.619 132.704 1.00 117.02 ? 56   DT  a "C5'" 1 
ATOM   7060  C  "C4'" . DT  I  5  56   ? 201.592 226.334 133.842 1.00 110.57 ? 56   DT  a "C4'" 1 
ATOM   7061  O  "O4'" . DT  I  5  56   ? 201.954 227.679 133.435 1.00 111.01 ? 56   DT  a "O4'" 1 
ATOM   7062  C  "C3'" . DT  I  5  56   ? 200.772 226.482 135.124 1.00 118.74 ? 56   DT  a "C3'" 1 
ATOM   7063  O  "O3'" . DT  I  5  56   ? 201.579 226.141 136.235 1.00 144.55 ? 56   DT  a "O3'" 1 
ATOM   7064  C  "C2'" . DT  I  5  56   ? 200.395 227.965 135.135 1.00 116.19 ? 56   DT  a "C2'" 1 
ATOM   7065  C  "C1'" . DT  I  5  56   ? 201.605 228.581 134.457 1.00 118.34 ? 56   DT  a "C1'" 1 
ATOM   7066  N  N1    . DT  I  5  56   ? 201.352 229.915 133.840 1.00 113.46 ? 56   DT  a N1    1 
ATOM   7067  C  C2    . DT  I  5  56   ? 202.128 230.987 134.212 1.00 114.40 ? 56   DT  a C2    1 
ATOM   7068  O  O2    . DT  I  5  56   ? 203.027 230.907 135.028 1.00 126.49 ? 56   DT  a O2    1 
ATOM   7069  N  N3    . DT  I  5  56   ? 201.832 232.160 133.570 1.00 111.29 ? 56   DT  a N3    1 
ATOM   7070  C  C4    . DT  I  5  56   ? 200.846 232.364 132.622 1.00 110.48 ? 56   DT  a C4    1 
ATOM   7071  O  O4    . DT  I  5  56   ? 200.645 233.457 132.106 1.00 108.73 ? 56   DT  a O4    1 
ATOM   7072  C  C5    . DT  I  5  56   ? 200.064 231.203 132.281 1.00 99.99  ? 56   DT  a C5    1 
ATOM   7073  C  C7    . DT  I  5  56   ? 198.966 231.312 131.269 1.00 86.76  ? 56   DT  a C7    1 
ATOM   7074  C  C6    . DT  I  5  56   ? 200.358 230.043 132.889 1.00 104.51 ? 56   DT  a C6    1 
ATOM   7075  P  P     . DT  I  5  57   ? 200.908 225.654 137.609 1.00 116.11 ? 57   DT  a P     1 
ATOM   7076  O  OP1   . DT  I  5  57   ? 201.557 224.381 137.997 1.00 101.21 ? 57   DT  a OP1   1 
ATOM   7077  O  OP2   . DT  I  5  57   ? 199.440 225.716 137.441 1.00 98.61  ? 57   DT  a OP2   1 
ATOM   7078  O  "O5'" . DT  I  5  57   ? 201.334 226.787 138.650 1.00 125.41 ? 57   DT  a "O5'" 1 
ATOM   7079  C  "C5'" . DT  I  5  57   ? 202.645 227.335 138.602 1.00 102.21 ? 57   DT  a "C5'" 1 
ATOM   7080  C  "C4'" . DT  I  5  57   ? 202.707 228.652 139.350 1.00 106.94 ? 57   DT  a "C4'" 1 
ATOM   7081  O  "O4'" . DT  I  5  57   ? 202.313 229.741 138.469 1.00 113.36 ? 57   DT  a "O4'" 1 
ATOM   7082  C  "C3'" . DT  I  5  57   ? 201.787 228.744 140.565 1.00 103.56 ? 57   DT  a "C3'" 1 
ATOM   7083  O  "O3'" . DT  I  5  57   ? 202.435 229.469 141.594 1.00 114.40 ? 57   DT  a "O3'" 1 
ATOM   7084  C  "C2'" . DT  I  5  57   ? 200.594 229.517 140.011 1.00 91.52  ? 57   DT  a "C2'" 1 
ATOM   7085  C  "C1'" . DT  I  5  57   ? 201.304 230.499 139.097 1.00 105.58 ? 57   DT  a "C1'" 1 
ATOM   7086  N  N1    . DT  I  5  57   ? 200.427 231.102 138.047 1.00 98.14  ? 57   DT  a N1    1 
ATOM   7087  C  C2    . DT  I  5  57   ? 200.659 232.397 137.638 1.00 102.30 ? 57   DT  a C2    1 
ATOM   7088  O  O2    . DT  I  5  57   ? 201.558 233.087 138.083 1.00 103.85 ? 57   DT  a O2    1 
ATOM   7089  N  N3    . DT  I  5  57   ? 199.802 232.854 136.669 1.00 105.48 ? 57   DT  a N3    1 
ATOM   7090  C  C4    . DT  I  5  57   ? 198.757 232.160 136.088 1.00 109.27 ? 57   DT  a C4    1 
ATOM   7091  O  O4    . DT  I  5  57   ? 198.035 232.656 135.229 1.00 106.59 ? 57   DT  a O4    1 
ATOM   7092  C  C5    . DT  I  5  57   ? 198.564 230.814 136.571 1.00 95.23  ? 57   DT  a C5    1 
ATOM   7093  C  C7    . DT  I  5  57   ? 197.459 229.967 136.016 1.00 87.44  ? 57   DT  a C7    1 
ATOM   7094  C  C6    . DT  I  5  57   ? 199.397 230.356 137.517 1.00 95.79  ? 57   DT  a C6    1 
ATOM   7095  P  P     . DA  I  5  58   ? 203.015 228.714 142.887 1.00 109.49 ? 58   DA  a P     1 
ATOM   7096  O  OP1   . DA  I  5  58   ? 203.988 227.706 142.413 1.00 93.14  ? 58   DA  a OP1   1 
ATOM   7097  O  OP2   . DA  I  5  58   ? 201.866 228.296 143.721 1.00 104.88 ? 58   DA  a OP2   1 
ATOM   7098  O  "O5'" . DA  I  5  58   ? 203.803 229.866 143.670 1.00 106.57 ? 58   DA  a "O5'" 1 
ATOM   7099  C  "C5'" . DA  I  5  58   ? 205.045 230.339 143.166 1.00 106.95 ? 58   DA  a "C5'" 1 
ATOM   7100  C  "C4'" . DA  I  5  58   ? 205.119 231.858 143.213 1.00 102.77 ? 58   DA  a "C4'" 1 
ATOM   7101  O  "O4'" . DA  I  5  58   ? 204.213 232.430 142.235 1.00 114.42 ? 58   DA  a "O4'" 1 
ATOM   7102  C  "C3'" . DA  I  5  58   ? 204.766 232.496 144.554 1.00 102.38 ? 58   DA  a "C3'" 1 
ATOM   7103  O  "O3'" . DA  I  5  58   ? 205.665 233.569 144.815 1.00 109.52 ? 58   DA  a "O3'" 1 
ATOM   7104  C  "C2'" . DA  I  5  58   ? 203.330 232.980 144.344 1.00 99.22  ? 58   DA  a "C2'" 1 
ATOM   7105  C  "C1'" . DA  I  5  58   ? 203.307 233.319 142.861 1.00 106.68 ? 58   DA  a "C1'" 1 
ATOM   7106  N  N9    . DA  I  5  58   ? 201.999 233.118 142.245 1.00 98.23  ? 58   DA  a N9    1 
ATOM   7107  C  C8    . DA  I  5  58   ? 201.210 232.014 142.365 1.00 108.25 ? 58   DA  a C8    1 
ATOM   7108  N  N7    . DA  I  5  58   ? 200.086 232.088 141.697 1.00 104.93 ? 58   DA  a N7    1 
ATOM   7109  C  C5    . DA  I  5  58   ? 200.141 233.325 141.088 1.00 92.82  ? 58   DA  a C5    1 
ATOM   7110  C  C6    . DA  I  5  58   ? 199.256 233.987 140.223 1.00 91.42  ? 58   DA  a C6    1 
ATOM   7111  N  N6    . DA  I  5  58   ? 198.081 233.473 139.855 1.00 87.72  ? 58   DA  a N6    1 
ATOM   7112  N  N1    . DA  I  5  58   ? 199.589 235.223 139.808 1.00 81.64  ? 58   DA  a N1    1 
ATOM   7113  C  C2    . DA  I  5  58   ? 200.755 235.744 140.210 1.00 87.50  ? 58   DA  a C2    1 
ATOM   7114  N  N3    . DA  I  5  58   ? 201.688 235.202 140.999 1.00 88.56  ? 58   DA  a N3    1 
ATOM   7115  C  C4    . DA  I  5  58   ? 201.309 233.984 141.419 1.00 90.52  ? 58   DA  a C4    1 
ATOM   7116  P  P     . DA  I  5  59   ? 205.496 234.509 146.107 1.00 117.33 ? 59   DA  a P     1 
ATOM   7117  O  OP1   . DA  I  5  59   ? 206.851 234.714 146.664 1.00 89.35  ? 59   DA  a OP1   1 
ATOM   7118  O  OP2   . DA  I  5  59   ? 204.431 233.979 146.986 1.00 118.93 ? 59   DA  a OP2   1 
ATOM   7119  O  "O5'" . DA  I  5  59   ? 205.006 235.895 145.483 1.00 113.55 ? 59   DA  a "O5'" 1 
ATOM   7120  C  "C5'" . DA  I  5  59   ? 205.701 236.440 144.368 1.00 106.80 ? 59   DA  a "C5'" 1 
ATOM   7121  C  "C4'" . DA  I  5  59   ? 204.975 237.648 143.804 1.00 106.49 ? 59   DA  a "C4'" 1 
ATOM   7122  O  "O4'" . DA  I  5  59   ? 203.755 237.223 143.141 1.00 119.39 ? 59   DA  a "O4'" 1 
ATOM   7123  C  "C3'" . DA  I  5  59   ? 204.554 238.690 144.834 1.00 95.34  ? 59   DA  a "C3'" 1 
ATOM   7124  O  "O3'" . DA  I  5  59   ? 204.687 239.987 144.275 1.00 105.54 ? 59   DA  a "O3'" 1 
ATOM   7125  C  "C2'" . DA  I  5  59   ? 203.091 238.336 145.085 1.00 98.26  ? 59   DA  a "C2'" 1 
ATOM   7126  C  "C1'" . DA  I  5  59   ? 202.651 237.905 143.695 1.00 110.74 ? 59   DA  a "C1'" 1 
ATOM   7127  N  N9    . DA  I  5  59   ? 201.508 236.998 143.692 1.00 105.26 ? 59   DA  a N9    1 
ATOM   7128  C  C8    . DA  I  5  59   ? 201.424 235.785 144.312 1.00 99.29  ? 59   DA  a C8    1 
ATOM   7129  N  N7    . DA  I  5  59   ? 200.279 235.174 144.128 1.00 99.67  ? 59   DA  a N7    1 
ATOM   7130  C  C5    . DA  I  5  59   ? 199.561 236.048 143.329 1.00 110.18 ? 59   DA  a C5    1 
ATOM   7131  C  C6    . DA  I  5  59   ? 198.274 235.974 142.766 1.00 114.35 ? 59   DA  a C6    1 
ATOM   7132  N  N6    . DA  I  5  59   ? 197.443 234.950 142.973 1.00 119.98 ? 59   DA  a N6    1 
ATOM   7133  N  N1    . DA  I  5  59   ? 197.852 237.019 142.026 1.00 115.58 ? 59   DA  a N1    1 
ATOM   7134  C  C2    . DA  I  5  59   ? 198.679 238.055 141.844 1.00 102.73 ? 59   DA  a C2    1 
ATOM   7135  N  N3    . DA  I  5  59   ? 199.923 238.225 142.300 1.00 106.00 ? 59   DA  a N3    1 
ATOM   7136  C  C4    . DA  I  5  59   ? 200.302 237.180 143.053 1.00 113.37 ? 59   DA  a C4    1 
ATOM   7137  P  P     . DA  I  5  60   ? 204.670 241.287 145.218 1.00 95.37  ? 60   DA  a P     1 
ATOM   7138  O  OP1   . DA  I  5  60   ? 205.950 241.999 145.006 1.00 95.04  ? 60   DA  a OP1   1 
ATOM   7139  O  OP2   . DA  I  5  60   ? 204.280 240.865 146.581 1.00 84.76  ? 60   DA  a OP2   1 
ATOM   7140  O  "O5'" . DA  I  5  60   ? 203.488 242.174 144.611 1.00 92.80  ? 60   DA  a "O5'" 1 
ATOM   7141  C  "C5'" . DA  I  5  60   ? 203.549 242.590 143.255 1.00 94.46  ? 60   DA  a "C5'" 1 
ATOM   7142  C  "C4'" . DA  I  5  60   ? 202.185 243.026 142.750 1.00 85.58  ? 60   DA  a "C4'" 1 
ATOM   7143  O  "O4'" . DA  I  5  60   ? 201.269 241.899 142.750 1.00 78.85  ? 60   DA  a "O4'" 1 
ATOM   7144  C  "C3'" . DA  I  5  60   ? 201.501 244.119 143.566 1.00 85.36  ? 60   DA  a "C3'" 1 
ATOM   7145  O  "O3'" . DA  I  5  60   ? 200.795 244.974 142.688 1.00 94.68  ? 60   DA  a "O3'" 1 
ATOM   7146  C  "C2'" . DA  I  5  60   ? 200.548 243.321 144.455 1.00 73.01  ? 60   DA  a "C2'" 1 
ATOM   7147  C  "C1'" . DA  I  5  60   ? 200.114 242.228 143.494 1.00 77.26  ? 60   DA  a "C1'" 1 
ATOM   7148  N  N9    . DA  I  5  60   ? 199.637 241.007 144.140 1.00 99.55  ? 60   DA  a N9    1 
ATOM   7149  C  C8    . DA  I  5  60   ? 200.352 240.174 144.948 1.00 99.81  ? 60   DA  a C8    1 
ATOM   7150  N  N7    . DA  I  5  60   ? 199.676 239.130 145.368 1.00 106.24 ? 60   DA  a N7    1 
ATOM   7151  C  C5    . DA  I  5  60   ? 198.429 239.289 144.791 1.00 114.98 ? 60   DA  a C5    1 
ATOM   7152  C  C6    . DA  I  5  60   ? 197.260 238.505 144.828 1.00 119.56 ? 60   DA  a C6    1 
ATOM   7153  N  N6    . DA  I  5  60   ? 197.151 237.378 145.540 1.00 106.06 ? 60   DA  a N6    1 
ATOM   7154  N  N1    . DA  I  5  60   ? 196.187 238.951 144.143 1.00 120.85 ? 60   DA  a N1    1 
ATOM   7155  C  C2    . DA  I  5  60   ? 196.295 240.088 143.447 1.00 110.30 ? 60   DA  a C2    1 
ATOM   7156  N  N3    . DA  I  5  60   ? 197.345 240.897 143.316 1.00 108.72 ? 60   DA  a N3    1 
ATOM   7157  C  C4    . DA  I  5  60   ? 198.387 240.439 144.027 1.00 109.95 ? 60   DA  a C4    1 
ATOM   7158  P  P     . DC  I  5  61   ? 200.407 246.468 143.130 1.00 107.68 ? 61   DC  a P     1 
ATOM   7159  O  OP1   . DC  I  5  61   ? 201.143 247.398 142.246 1.00 100.94 ? 61   DC  a OP1   1 
ATOM   7160  O  OP2   . DC  I  5  61   ? 200.562 246.567 144.596 1.00 94.00  ? 61   DC  a OP2   1 
ATOM   7161  O  "O5'" . DC  I  5  61   ? 198.851 246.561 142.787 1.00 100.44 ? 61   DC  a "O5'" 1 
ATOM   7162  C  "C5'" . DC  I  5  61   ? 198.219 245.488 142.095 1.00 103.58 ? 61   DC  a "C5'" 1 
ATOM   7163  C  "C4'" . DC  I  5  61   ? 196.709 245.591 142.202 1.00 108.19 ? 61   DC  a "C4'" 1 
ATOM   7164  O  "O4'" . DC  I  5  61   ? 196.177 244.366 142.773 1.00 115.61 ? 61   DC  a "O4'" 1 
ATOM   7165  C  "C3'" . DC  I  5  61   ? 196.206 246.701 143.108 1.00 111.83 ? 61   DC  a "C3'" 1 
ATOM   7166  O  "O3'" . DC  I  5  61   ? 194.914 247.096 142.687 1.00 129.18 ? 61   DC  a "O3'" 1 
ATOM   7167  C  "C2'" . DC  I  5  61   ? 196.155 245.995 144.457 1.00 110.42 ? 61   DC  a "C2'" 1 
ATOM   7168  C  "C1'" . DC  I  5  61   ? 195.606 244.640 144.039 1.00 113.92 ? 61   DC  a "C1'" 1 
ATOM   7169  N  N1    . DC  I  5  61   ? 195.959 243.526 144.962 1.00 116.27 ? 61   DC  a N1    1 
ATOM   7170  C  C2    . DC  I  5  61   ? 194.997 242.559 145.276 1.00 126.38 ? 61   DC  a C2    1 
ATOM   7171  O  O2    . DC  I  5  61   ? 193.868 242.663 144.784 1.00 139.49 ? 61   DC  a O2    1 
ATOM   7172  N  N3    . DC  I  5  61   ? 195.333 241.544 146.109 1.00 114.46 ? 61   DC  a N3    1 
ATOM   7173  C  C4    . DC  I  5  61   ? 196.570 241.472 146.605 1.00 111.92 ? 61   DC  a C4    1 
ATOM   7174  N  N4    . DC  I  5  61   ? 196.858 240.457 147.429 1.00 119.90 ? 61   DC  a N4    1 
ATOM   7175  C  C5    . DC  I  5  61   ? 197.559 242.454 146.304 1.00 101.89 ? 61   DC  a C5    1 
ATOM   7176  C  C6    . DC  I  5  61   ? 197.214 243.451 145.485 1.00 103.92 ? 61   DC  a C6    1 
ATOM   7177  P  P     . DG  I  5  62   ? 194.412 248.607 142.902 1.00 120.05 ? 62   DG  a P     1 
ATOM   7178  O  OP1   . DG  I  5  62   ? 194.361 249.253 141.574 1.00 127.15 ? 62   DG  a OP1   1 
ATOM   7179  O  OP2   . DG  I  5  62   ? 195.225 249.203 143.983 1.00 115.14 ? 62   DG  a OP2   1 
ATOM   7180  O  "O5'" . DG  I  5  62   ? 192.923 248.428 143.448 1.00 102.17 ? 62   DG  a "O5'" 1 
ATOM   7181  C  "C5'" . DG  I  5  62   ? 192.030 247.542 142.786 1.00 110.93 ? 62   DG  a "C5'" 1 
ATOM   7182  C  "C4'" . DG  I  5  62   ? 191.030 246.958 143.764 1.00 126.53 ? 62   DG  a "C4'" 1 
ATOM   7183  O  "O4'" . DG  I  5  62   ? 191.627 245.839 144.462 1.00 122.17 ? 62   DG  a "O4'" 1 
ATOM   7184  C  "C3'" . DG  I  5  62   ? 190.541 247.932 144.836 1.00 139.73 ? 62   DG  a "C3'" 1 
ATOM   7185  O  "O3'" . DG  I  5  62   ? 189.123 247.990 144.824 1.00 152.82 ? 62   DG  a "O3'" 1 
ATOM   7186  C  "C2'" . DG  I  5  62   ? 191.083 247.358 146.152 1.00 130.88 ? 62   DG  a "C2'" 1 
ATOM   7187  C  "C1'" . DG  I  5  62   ? 191.280 245.887 145.824 1.00 128.90 ? 62   DG  a "C1'" 1 
ATOM   7188  N  N9    . DG  I  5  62   ? 192.363 245.267 146.581 1.00 113.46 ? 62   DG  a N9    1 
ATOM   7189  C  C8    . DG  I  5  62   ? 193.661 245.701 146.658 1.00 115.11 ? 62   DG  a C8    1 
ATOM   7190  N  N7    . DG  I  5  62   ? 194.421 244.950 147.401 1.00 117.52 ? 62   DG  a N7    1 
ATOM   7191  C  C5    . DG  I  5  62   ? 193.571 243.951 147.853 1.00 122.20 ? 62   DG  a C5    1 
ATOM   7192  C  C6    . DG  I  5  62   ? 193.834 242.852 148.702 1.00 130.90 ? 62   DG  a C6    1 
ATOM   7193  O  O6    . DG  I  5  62   ? 194.908 242.536 149.232 1.00 131.35 ? 62   DG  a O6    1 
ATOM   7194  N  N1    . DG  I  5  62   ? 192.699 242.077 148.909 1.00 136.34 ? 62   DG  a N1    1 
ATOM   7195  C  C2    . DG  I  5  62   ? 191.463 242.331 148.359 1.00 128.82 ? 62   DG  a C2    1 
ATOM   7196  N  N2    . DG  I  5  62   ? 190.480 241.479 148.679 1.00 125.73 ? 62   DG  a N2    1 
ATOM   7197  N  N3    . DG  I  5  62   ? 191.201 243.366 147.569 1.00 119.30 ? 62   DG  a N3    1 
ATOM   7198  C  C4    . DG  I  5  62   ? 192.300 244.130 147.360 1.00 117.92 ? 62   DG  a C4    1 
ATOM   7199  P  P     . DC  I  5  63   ? 188.346 248.971 145.832 1.00 137.14 ? 63   DC  a P     1 
ATOM   7200  O  OP1   . DC  I  5  63   ? 187.073 249.360 145.184 1.00 135.69 ? 63   DC  a OP1   1 
ATOM   7201  O  OP2   . DC  I  5  63   ? 189.292 250.016 146.279 1.00 124.91 ? 63   DC  a OP2   1 
ATOM   7202  O  "O5'" . DC  I  5  63   ? 188.017 248.033 147.079 1.00 142.42 ? 63   DC  a "O5'" 1 
ATOM   7203  C  "C5'" . DC  I  5  63   ? 187.469 246.741 146.861 1.00 142.91 ? 63   DC  a "C5'" 1 
ATOM   7204  C  "C4'" . DC  I  5  63   ? 187.180 246.054 148.180 1.00 144.37 ? 63   DC  a "C4'" 1 
ATOM   7205  O  "O4'" . DC  I  5  63   ? 188.384 245.407 148.668 1.00 146.77 ? 63   DC  a "O4'" 1 
ATOM   7206  C  "C3'" . DC  I  5  63   ? 186.713 246.986 149.297 1.00 149.13 ? 63   DC  a "C3'" 1 
ATOM   7207  O  "O3'" . DC  I  5  63   ? 185.653 246.378 150.017 1.00 161.58 ? 63   DC  a "O3'" 1 
ATOM   7208  C  "C2'" . DC  I  5  63   ? 187.961 247.138 150.162 1.00 142.80 ? 63   DC  a "C2'" 1 
ATOM   7209  C  "C1'" . DC  I  5  63   ? 188.587 245.765 150.014 1.00 149.61 ? 63   DC  a "C1'" 1 
ATOM   7210  N  N1    . DC  I  5  63   ? 190.046 245.740 150.293 1.00 126.98 ? 63   DC  a N1    1 
ATOM   7211  C  C2    . DC  I  5  63   ? 190.567 244.744 151.124 1.00 127.40 ? 63   DC  a C2    1 
ATOM   7212  O  O2    . DC  I  5  63   ? 189.795 243.920 151.624 1.00 131.24 ? 63   DC  a O2    1 
ATOM   7213  N  N3    . DC  I  5  63   ? 191.897 244.738 151.385 1.00 122.63 ? 63   DC  a N3    1 
ATOM   7214  C  C4    . DC  I  5  63   ? 192.688 245.663 150.835 1.00 122.68 ? 63   DC  a C4    1 
ATOM   7215  N  N4    . DC  I  5  63   ? 193.996 245.611 151.105 1.00 123.47 ? 63   DC  a N4    1 
ATOM   7216  C  C5    . DC  I  5  63   ? 192.173 246.676 149.973 1.00 122.72 ? 63   DC  a C5    1 
ATOM   7217  C  C6    . DC  I  5  63   ? 190.859 246.680 149.739 1.00 121.64 ? 63   DC  a C6    1 
ATOM   7218  P  P     . DA  I  5  64   ? 184.550 247.283 150.751 1.00 140.83 ? 64   DA  a P     1 
ATOM   7219  O  OP1   . DA  I  5  64   ? 183.291 247.171 149.981 1.00 143.29 ? 64   DA  a OP1   1 
ATOM   7220  O  OP2   . DA  I  5  64   ? 185.146 248.614 151.001 1.00 130.01 ? 64   DA  a OP2   1 
ATOM   7221  O  "O5'" . DA  I  5  64   ? 184.356 246.563 152.161 1.00 128.74 ? 64   DA  a "O5'" 1 
ATOM   7222  C  "C5'" . DA  I  5  64   ? 184.164 245.157 152.214 1.00 132.58 ? 64   DA  a "C5'" 1 
ATOM   7223  C  "C4'" . DA  I  5  64   ? 184.588 244.614 153.563 1.00 142.77 ? 64   DA  a "C4'" 1 
ATOM   7224  O  "O4'" . DA  I  5  64   ? 186.030 244.456 153.591 1.00 137.38 ? 64   DA  a "O4'" 1 
ATOM   7225  C  "C3'" . DA  I  5  64   ? 184.221 245.499 154.751 1.00 154.60 ? 64   DA  a "C3'" 1 
ATOM   7226  O  "O3'" . DA  I  5  64   ? 183.651 244.715 155.787 1.00 170.35 ? 64   DA  a "O3'" 1 
ATOM   7227  C  "C2'" . DA  I  5  64   ? 185.552 246.124 155.172 1.00 143.88 ? 64   DA  a "C2'" 1 
ATOM   7228  C  "C1'" . DA  I  5  64   ? 186.565 245.073 154.739 1.00 139.13 ? 64   DA  a "C1'" 1 
ATOM   7229  N  N9    . DA  I  5  64   ? 187.861 245.644 154.382 1.00 132.03 ? 64   DA  a N9    1 
ATOM   7230  C  C8    . DA  I  5  64   ? 188.090 246.668 153.508 1.00 132.75 ? 64   DA  a C8    1 
ATOM   7231  N  N7    . DA  I  5  64   ? 189.358 246.975 153.371 1.00 126.35 ? 64   DA  a N7    1 
ATOM   7232  C  C5    . DA  I  5  64   ? 190.006 246.089 154.213 1.00 126.41 ? 64   DA  a C5    1 
ATOM   7233  C  C6    . DA  I  5  64   ? 191.365 245.906 154.528 1.00 131.15 ? 64   DA  a C6    1 
ATOM   7234  N  N6    . DA  I  5  64   ? 192.347 246.631 153.985 1.00 132.57 ? 64   DA  a N6    1 
ATOM   7235  N  N1    . DA  I  5  64   ? 191.679 244.930 155.405 1.00 133.34 ? 64   DA  a N1    1 
ATOM   7236  C  C2    . DA  I  5  64   ? 190.693 244.197 155.935 1.00 129.19 ? 64   DA  a C2    1 
ATOM   7237  N  N3    . DA  I  5  64   ? 189.378 244.286 155.728 1.00 128.36 ? 64   DA  a N3    1 
ATOM   7238  C  C4    . DA  I  5  64   ? 189.098 245.258 154.845 1.00 128.76 ? 64   DA  a C4    1 
ATOM   7239  P  P     . DC  I  5  65   ? 183.031 245.425 157.087 1.00 159.88 ? 65   DC  a P     1 
ATOM   7240  O  OP1   . DC  I  5  65   ? 181.934 244.570 157.587 1.00 155.13 ? 65   DC  a OP1   1 
ATOM   7241  O  OP2   . DC  I  5  65   ? 182.768 246.841 156.746 1.00 152.75 ? 65   DC  a OP2   1 
ATOM   7242  O  "O5'" . DC  I  5  65   ? 184.230 245.387 158.138 1.00 150.11 ? 65   DC  a "O5'" 1 
ATOM   7243  C  "C5'" . DC  I  5  65   ? 184.953 244.181 158.334 1.00 142.19 ? 65   DC  a "C5'" 1 
ATOM   7244  C  "C4'" . DC  I  5  65   ? 186.003 244.357 159.410 1.00 141.57 ? 65   DC  a "C4'" 1 
ATOM   7245  O  "O4'" . DC  I  5  65   ? 187.247 244.817 158.815 1.00 143.55 ? 65   DC  a "O4'" 1 
ATOM   7246  C  "C3'" . DC  I  5  65   ? 185.647 245.376 160.495 1.00 143.22 ? 65   DC  a "C3'" 1 
ATOM   7247  O  "O3'" . DC  I  5  65   ? 185.973 244.847 161.767 1.00 147.31 ? 65   DC  a "O3'" 1 
ATOM   7248  C  "C2'" . DC  I  5  65   ? 186.530 246.573 160.147 1.00 144.20 ? 65   DC  a "C2'" 1 
ATOM   7249  C  "C1'" . DC  I  5  65   ? 187.755 245.874 159.589 1.00 143.85 ? 65   DC  a "C1'" 1 
ATOM   7250  N  N1    . DC  I  5  65   ? 188.598 246.745 158.726 1.00 134.88 ? 65   DC  a N1    1 
ATOM   7251  C  C2    . DC  I  5  65   ? 189.992 246.687 158.842 1.00 129.70 ? 65   DC  a C2    1 
ATOM   7252  O  O2    . DC  I  5  65   ? 190.495 245.910 159.660 1.00 118.11 ? 65   DC  a O2    1 
ATOM   7253  N  N3    . DC  I  5  65   ? 190.749 247.495 158.055 1.00 133.49 ? 65   DC  a N3    1 
ATOM   7254  C  C4    . DC  I  5  65   ? 190.160 248.326 157.192 1.00 135.80 ? 65   DC  a C4    1 
ATOM   7255  N  N4    . DC  I  5  65   ? 190.941 249.098 156.430 1.00 129.31 ? 65   DC  a N4    1 
ATOM   7256  C  C5    . DC  I  5  65   ? 188.743 248.393 157.061 1.00 138.44 ? 65   DC  a C5    1 
ATOM   7257  C  C6    . DC  I  5  65   ? 188.009 247.594 157.839 1.00 138.72 ? 65   DC  a C6    1 
ATOM   7258  P  P     . DG  I  5  66   ? 185.311 245.451 163.100 1.00 137.39 ? 66   DG  a P     1 
ATOM   7259  O  OP1   . DG  I  5  66   ? 184.242 244.521 163.529 1.00 125.51 ? 66   DG  a OP1   1 
ATOM   7260  O  OP2   . DG  I  5  66   ? 184.990 246.876 162.867 1.00 135.23 ? 66   DG  a OP2   1 
ATOM   7261  O  "O5'" . DG  I  5  66   ? 186.503 245.382 164.160 1.00 166.63 ? 66   DG  a "O5'" 1 
ATOM   7262  C  "C5'" . DG  I  5  66   ? 187.336 244.229 164.203 1.00 161.59 ? 66   DG  a "C5'" 1 
ATOM   7263  C  "C4'" . DG  I  5  66   ? 188.772 244.608 164.522 1.00 155.05 ? 66   DG  a "C4'" 1 
ATOM   7264  O  "O4'" . DG  I  5  66   ? 189.351 245.336 163.404 1.00 156.18 ? 66   DG  a "O4'" 1 
ATOM   7265  C  "C3'" . DG  I  5  66   ? 188.946 245.502 165.747 1.00 150.97 ? 66   DG  a "C3'" 1 
ATOM   7266  O  "O3'" . DG  I  5  66   ? 190.075 245.079 166.485 1.00 145.75 ? 66   DG  a "O3'" 1 
ATOM   7267  C  "C2'" . DG  I  5  66   ? 189.164 246.883 165.135 1.00 154.42 ? 66   DG  a "C2'" 1 
ATOM   7268  C  "C1'" . DG  I  5  66   ? 189.929 246.535 163.871 1.00 150.94 ? 66   DG  a "C1'" 1 
ATOM   7269  N  N9    . DG  I  5  66   ? 189.818 247.541 162.814 1.00 140.00 ? 66   DG  a N9    1 
ATOM   7270  C  C8    . DG  I  5  66   ? 188.660 248.040 162.272 1.00 137.63 ? 66   DG  a C8    1 
ATOM   7271  N  N7    . DG  I  5  66   ? 188.862 248.917 161.328 1.00 135.73 ? 66   DG  a N7    1 
ATOM   7272  C  C5    . DG  I  5  66   ? 190.244 249.006 161.236 1.00 137.46 ? 66   DG  a C5    1 
ATOM   7273  C  C6    . DG  I  5  66   ? 191.051 249.799 160.384 1.00 129.75 ? 66   DG  a C6    1 
ATOM   7274  O  O6    . DG  I  5  66   ? 190.687 250.606 159.519 1.00 124.78 ? 66   DG  a O6    1 
ATOM   7275  N  N1    . DG  I  5  66   ? 192.409 249.589 160.615 1.00 129.60 ? 66   DG  a N1    1 
ATOM   7276  C  C2    . DG  I  5  66   ? 192.922 248.721 161.552 1.00 129.25 ? 66   DG  a C2    1 
ATOM   7277  N  N2    . DG  I  5  66   ? 194.258 248.647 161.629 1.00 123.54 ? 66   DG  a N2    1 
ATOM   7278  N  N3    . DG  I  5  66   ? 192.174 247.969 162.353 1.00 138.85 ? 66   DG  a N3    1 
ATOM   7279  C  C4    . DG  I  5  66   ? 190.850 248.164 162.141 1.00 139.64 ? 66   DG  a C4    1 
ATOM   7280  P  P     . DT  I  5  67   ? 190.047 245.097 168.091 1.00 125.73 ? 67   DT  a P     1 
ATOM   7281  O  OP1   . DT  I  5  67   ? 190.144 243.697 168.562 1.00 121.78 ? 67   DT  a OP1   1 
ATOM   7282  O  OP2   . DT  I  5  67   ? 188.906 245.940 168.513 1.00 127.41 ? 67   DT  a OP2   1 
ATOM   7283  O  "O5'" . DT  I  5  67   ? 191.392 245.866 168.478 1.00 160.19 ? 67   DT  a "O5'" 1 
ATOM   7284  C  "C5'" . DT  I  5  67   ? 192.582 245.617 167.743 1.00 145.55 ? 67   DT  a "C5'" 1 
ATOM   7285  C  "C4'" . DT  I  5  67   ? 193.473 246.844 167.728 1.00 127.76 ? 67   DT  a "C4'" 1 
ATOM   7286  O  "O4'" . DT  I  5  67   ? 193.086 247.720 166.633 1.00 121.38 ? 67   DT  a "O4'" 1 
ATOM   7287  C  "C3'" . DT  I  5  67   ? 193.409 247.703 168.994 1.00 124.95 ? 67   DT  a "C3'" 1 
ATOM   7288  O  "O3'" . DT  I  5  67   ? 194.699 248.216 169.291 1.00 122.36 ? 67   DT  a "O3'" 1 
ATOM   7289  C  "C2'" . DT  I  5  67   ? 192.467 248.828 168.570 1.00 125.66 ? 67   DT  a "C2'" 1 
ATOM   7290  C  "C1'" . DT  I  5  67   ? 192.927 249.024 167.136 1.00 129.18 ? 67   DT  a "C1'" 1 
ATOM   7291  N  N1    . DT  I  5  67   ? 191.971 249.772 166.271 1.00 129.50 ? 67   DT  a N1    1 
ATOM   7292  C  C2    . DT  I  5  67   ? 192.469 250.582 165.278 1.00 125.98 ? 67   DT  a C2    1 
ATOM   7293  O  O2    . DT  I  5  67   ? 193.660 250.712 165.060 1.00 116.75 ? 67   DT  a O2    1 
ATOM   7294  N  N3    . DT  I  5  67   ? 191.521 251.222 164.530 1.00 129.03 ? 67   DT  a N3    1 
ATOM   7295  C  C4    . DT  I  5  67   ? 190.151 251.143 164.674 1.00 141.64 ? 67   DT  a C4    1 
ATOM   7296  O  O4    . DT  I  5  67   ? 189.379 251.769 163.957 1.00 147.20 ? 67   DT  a O4    1 
ATOM   7297  C  C5    . DT  I  5  67   ? 189.690 250.289 165.742 1.00 141.70 ? 67   DT  a C5    1 
ATOM   7298  C  C7    . DT  I  5  67   ? 188.221 250.131 165.998 1.00 143.59 ? 67   DT  a C7    1 
ATOM   7299  C  C6    . DT  I  5  67   ? 190.614 249.648 166.479 1.00 135.67 ? 67   DT  a C6    1 
ATOM   7300  P  P     . DA  I  5  68   ? 195.797 247.332 170.066 1.00 126.02 ? 68   DA  a P     1 
ATOM   7301  O  OP1   . DA  I  5  68   ? 195.538 245.895 169.822 1.00 121.84 ? 68   DA  a OP1   1 
ATOM   7302  O  OP2   . DA  I  5  68   ? 195.859 247.834 171.456 1.00 126.13 ? 68   DA  a OP2   1 
ATOM   7303  O  "O5'" . DA  I  5  68   ? 197.166 247.740 169.346 1.00 154.67 ? 68   DA  a "O5'" 1 
ATOM   7304  C  "C5'" . DA  I  5  68   ? 197.183 247.936 167.933 1.00 142.25 ? 68   DA  a "C5'" 1 
ATOM   7305  C  "C4'" . DA  I  5  68   ? 198.375 248.776 167.501 1.00 123.56 ? 68   DA  a "C4'" 1 
ATOM   7306  O  "O4'" . DA  I  5  68   ? 197.912 249.953 166.805 1.00 116.50 ? 68   DA  a "O4'" 1 
ATOM   7307  C  "C3'" . DA  I  5  68   ? 199.242 249.312 168.622 1.00 116.35 ? 68   DA  a "C3'" 1 
ATOM   7308  O  "O3'" . DA  I  5  68   ? 200.555 249.568 168.122 1.00 112.43 ? 68   DA  a "O3'" 1 
ATOM   7309  C  "C2'" . DA  I  5  68   ? 198.515 250.601 169.012 1.00 113.85 ? 68   DA  a "C2'" 1 
ATOM   7310  C  "C1'" . DA  I  5  68   ? 197.850 251.047 167.705 1.00 117.56 ? 68   DA  a "C1'" 1 
ATOM   7311  N  N9    . DA  I  5  68   ? 196.446 251.411 167.868 1.00 110.63 ? 68   DA  a N9    1 
ATOM   7312  C  C8    . DA  I  5  68   ? 195.589 250.938 168.817 1.00 115.34 ? 68   DA  a C8    1 
ATOM   7313  N  N7    . DA  I  5  68   ? 194.376 251.425 168.725 1.00 118.52 ? 68   DA  a N7    1 
ATOM   7314  C  C5    . DA  I  5  68   ? 194.438 252.271 167.634 1.00 115.73 ? 68   DA  a C5    1 
ATOM   7315  C  C6    . DA  I  5  68   ? 193.471 253.079 167.010 1.00 115.64 ? 68   DA  a C6    1 
ATOM   7316  N  N6    . DA  I  5  68   ? 192.211 253.179 167.442 1.00 120.20 ? 68   DA  a N6    1 
ATOM   7317  N  N1    . DA  I  5  68   ? 193.860 253.815 165.951 1.00 110.80 ? 68   DA  a N1    1 
ATOM   7318  C  C2    . DA  I  5  68   ? 195.129 253.727 165.537 1.00 104.72 ? 68   DA  a C2    1 
ATOM   7319  N  N3    . DA  I  5  68   ? 196.124 252.986 166.029 1.00 104.71 ? 68   DA  a N3    1 
ATOM   7320  C  C4    . DA  I  5  68   ? 195.709 252.284 167.095 1.00 111.84 ? 68   DA  a C4    1 
ATOM   7321  P  P     . DC  I  5  69   ? 201.620 250.429 168.965 1.00 101.52 ? 69   DC  a P     1 
ATOM   7322  O  OP1   . DC  I  5  69   ? 202.959 249.917 168.604 1.00 97.90  ? 69   DC  a OP1   1 
ATOM   7323  O  OP2   . DC  I  5  69   ? 201.222 250.456 170.392 1.00 95.22  ? 69   DC  a OP2   1 
ATOM   7324  O  "O5'" . DC  I  5  69   ? 201.473 251.903 168.361 1.00 105.33 ? 69   DC  a "O5'" 1 
ATOM   7325  C  "C5'" . DC  I  5  69   ? 201.697 252.116 166.971 1.00 103.09 ? 69   DC  a "C5'" 1 
ATOM   7326  C  "C4'" . DC  I  5  69   ? 201.330 253.532 166.557 1.00 100.10 ? 69   DC  a "C4'" 1 
ATOM   7327  O  "O4'" . DC  I  5  69   ? 199.912 253.765 166.774 1.00 104.78 ? 69   DC  a "O4'" 1 
ATOM   7328  C  "C3'" . DC  I  5  69   ? 202.050 254.645 167.314 1.00 93.94  ? 69   DC  a "C3'" 1 
ATOM   7329  O  "O3'" . DC  I  5  69   ? 202.275 255.732 166.434 1.00 84.09  ? 69   DC  a "O3'" 1 
ATOM   7330  C  "C2'" . DC  I  5  69   ? 201.028 255.015 168.381 1.00 99.94  ? 69   DC  a "C2'" 1 
ATOM   7331  C  "C1'" . DC  I  5  69   ? 199.753 254.924 167.563 1.00 105.59 ? 69   DC  a "C1'" 1 
ATOM   7332  N  N1    . DC  I  5  69   ? 198.512 254.780 168.372 1.00 104.31 ? 69   DC  a N1    1 
ATOM   7333  C  C2    . DC  I  5  69   ? 197.364 255.485 167.998 1.00 104.31 ? 69   DC  a C2    1 
ATOM   7334  O  O2    . DC  I  5  69   ? 197.409 256.214 167.002 1.00 98.29  ? 69   DC  a O2    1 
ATOM   7335  N  N3    . DC  I  5  69   ? 196.234 255.336 168.732 1.00 107.82 ? 69   DC  a N3    1 
ATOM   7336  C  C4    . DC  I  5  69   ? 196.230 254.526 169.793 1.00 113.09 ? 69   DC  a C4    1 
ATOM   7337  N  N4    . DC  I  5  69   ? 195.100 254.416 170.498 1.00 116.00 ? 69   DC  a N4    1 
ATOM   7338  C  C5    . DC  I  5  69   ? 197.396 253.808 170.194 1.00 111.74 ? 69   DC  a C5    1 
ATOM   7339  C  C6    . DC  I  5  69   ? 198.501 253.966 169.462 1.00 107.13 ? 69   DC  a C6    1 
ATOM   7340  P  P     . DG  I  5  70   ? 203.710 256.448 166.360 1.00 83.53  ? 70   DG  a P     1 
ATOM   7341  O  OP1   . DG  I  5  70   ? 204.577 255.622 165.494 1.00 81.96  ? 70   DG  a OP1   1 
ATOM   7342  O  OP2   . DG  I  5  70   ? 204.133 256.766 167.740 1.00 80.97  ? 70   DG  a OP2   1 
ATOM   7343  O  "O5'" . DG  I  5  70   ? 203.395 257.822 165.608 1.00 72.80  ? 70   DG  a "O5'" 1 
ATOM   7344  C  "C5'" . DG  I  5  70   ? 202.707 257.804 164.364 1.00 79.41  ? 70   DG  a "C5'" 1 
ATOM   7345  C  "C4'" . DG  I  5  70   ? 201.831 259.035 164.198 1.00 90.33  ? 70   DG  a "C4'" 1 
ATOM   7346  O  "O4'" . DG  I  5  70   ? 200.608 258.880 164.962 1.00 96.26  ? 70   DG  a "O4'" 1 
ATOM   7347  C  "C3'" . DG  I  5  70   ? 202.452 260.346 164.657 1.00 93.93  ? 70   DG  a "C3'" 1 
ATOM   7348  O  "O3'" . DG  I  5  70   ? 202.030 261.391 163.795 1.00 96.42  ? 70   DG  a "O3'" 1 
ATOM   7349  C  "C2'" . DG  I  5  70   ? 201.893 260.516 166.070 1.00 91.61  ? 70   DG  a "C2'" 1 
ATOM   7350  C  "C1'" . DG  I  5  70   ? 200.505 259.903 165.937 1.00 95.52  ? 70   DG  a "C1'" 1 
ATOM   7351  N  N9    . DG  I  5  70   ? 200.009 259.288 167.166 1.00 101.19 ? 70   DG  a N9    1 
ATOM   7352  C  C8    . DG  I  5  70   ? 200.679 258.398 167.968 1.00 97.99  ? 70   DG  a C8    1 
ATOM   7353  N  N7    . DG  I  5  70   ? 199.982 257.994 168.994 1.00 99.04  ? 70   DG  a N7    1 
ATOM   7354  C  C5    . DG  I  5  70   ? 198.767 258.650 168.859 1.00 103.21 ? 70   DG  a C5    1 
ATOM   7355  C  C6    . DG  I  5  70   ? 197.612 258.598 169.674 1.00 107.85 ? 70   DG  a C6    1 
ATOM   7356  O  O6    . DG  I  5  70   ? 197.438 257.947 170.713 1.00 107.50 ? 70   DG  a O6    1 
ATOM   7357  N  N1    . DG  I  5  70   ? 196.601 259.420 169.186 1.00 114.10 ? 70   DG  a N1    1 
ATOM   7358  C  C2    . DG  I  5  70   ? 196.692 260.188 168.048 1.00 114.37 ? 70   DG  a C2    1 
ATOM   7359  N  N2    . DG  I  5  70   ? 195.614 260.914 167.727 1.00 124.20 ? 70   DG  a N2    1 
ATOM   7360  N  N3    . DG  I  5  70   ? 197.768 260.240 167.271 1.00 103.48 ? 70   DG  a N3    1 
ATOM   7361  C  C4    . DG  I  5  70   ? 198.766 259.452 167.740 1.00 102.44 ? 70   DG  a C4    1 
ATOM   7362  P  P     . DC  I  5  71   ? 202.752 262.824 163.842 1.00 101.59 ? 71   DC  a P     1 
ATOM   7363  O  OP1   . DC  I  5  71   ? 202.932 263.282 162.448 1.00 88.84  ? 71   DC  a OP1   1 
ATOM   7364  O  OP2   . DC  I  5  71   ? 203.920 262.719 164.742 1.00 97.72  ? 71   DC  a OP2   1 
ATOM   7365  O  "O5'" . DC  I  5  71   ? 201.670 263.758 164.548 1.00 131.07 ? 71   DC  a "O5'" 1 
ATOM   7366  C  "C5'" . DC  I  5  71   ? 200.313 263.698 164.137 1.00 122.31 ? 71   DC  a "C5'" 1 
ATOM   7367  C  "C4'" . DC  I  5  71   ? 199.423 264.435 165.116 1.00 120.89 ? 71   DC  a "C4'" 1 
ATOM   7368  O  "O4'" . DC  I  5  71   ? 199.089 263.563 166.229 1.00 126.11 ? 71   DC  a "O4'" 1 
ATOM   7369  C  "C3'" . DC  I  5  71   ? 200.054 265.687 165.733 1.00 125.90 ? 71   DC  a "C3'" 1 
ATOM   7370  O  "O3'" . DC  I  5  71   ? 199.101 266.732 165.769 1.00 136.99 ? 71   DC  a "O3'" 1 
ATOM   7371  C  "C2'" . DC  I  5  71   ? 200.424 265.225 167.141 1.00 121.92 ? 71   DC  a "C2'" 1 
ATOM   7372  C  "C1'" . DC  I  5  71   ? 199.287 264.264 167.432 1.00 124.65 ? 71   DC  a "C1'" 1 
ATOM   7373  N  N1    . DC  I  5  71   ? 199.582 263.290 168.519 1.00 115.21 ? 71   DC  a N1    1 
ATOM   7374  C  C2    . DC  I  5  71   ? 198.605 263.018 169.481 1.00 116.07 ? 71   DC  a C2    1 
ATOM   7375  O  O2    . DC  I  5  71   ? 197.513 263.591 169.398 1.00 112.77 ? 71   DC  a O2    1 
ATOM   7376  N  N3    . DC  I  5  71   ? 198.884 262.132 170.471 1.00 117.91 ? 71   DC  a N3    1 
ATOM   7377  C  C4    . DC  I  5  71   ? 200.080 261.540 170.516 1.00 116.28 ? 71   DC  a C4    1 
ATOM   7378  N  N4    . DC  I  5  71   ? 200.314 260.673 171.505 1.00 113.68 ? 71   DC  a N4    1 
ATOM   7379  C  C5    . DC  I  5  71   ? 201.087 261.808 169.545 1.00 117.70 ? 71   DC  a C5    1 
ATOM   7380  C  C6    . DC  I  5  71   ? 200.800 262.683 168.576 1.00 118.82 ? 71   DC  a C6    1 
ATOM   7381  P  P     . DG  I  5  72   ? 199.572 268.263 165.690 1.00 110.28 ? 72   DG  a P     1 
ATOM   7382  O  OP1   . DG  I  5  72   ? 199.466 268.694 164.278 1.00 85.84  ? 72   DG  a OP1   1 
ATOM   7383  O  OP2   . DG  I  5  72   ? 200.864 268.381 166.402 1.00 109.91 ? 72   DG  a OP2   1 
ATOM   7384  O  "O5'" . DG  I  5  72   ? 198.467 269.032 166.550 1.00 141.86 ? 72   DG  a "O5'" 1 
ATOM   7385  C  "C5'" . DG  I  5  72   ? 197.105 268.647 166.451 1.00 139.77 ? 72   DG  a "C5'" 1 
ATOM   7386  C  "C4'" . DG  I  5  72   ? 196.436 268.691 167.812 1.00 141.24 ? 72   DG  a "C4'" 1 
ATOM   7387  O  "O4'" . DG  I  5  72   ? 196.808 267.518 168.579 1.00 140.66 ? 72   DG  a "O4'" 1 
ATOM   7388  C  "C3'" . DG  I  5  72   ? 196.803 269.903 168.668 1.00 146.11 ? 72   DG  a "C3'" 1 
ATOM   7389  O  "O3'" . DG  I  5  72   ? 195.625 270.547 169.122 1.00 157.39 ? 72   DG  a "O3'" 1 
ATOM   7390  C  "C2'" . DG  I  5  72   ? 197.615 269.313 169.826 1.00 140.48 ? 72   DG  a "C2'" 1 
ATOM   7391  C  "C1'" . DG  I  5  72   ? 197.080 267.893 169.906 1.00 140.68 ? 72   DG  a "C1'" 1 
ATOM   7392  N  N9    . DG  I  5  72   ? 198.041 266.940 170.460 1.00 123.39 ? 72   DG  a N9    1 
ATOM   7393  C  C8    . DG  I  5  72   ? 199.277 266.633 169.955 1.00 123.27 ? 72   DG  a C8    1 
ATOM   7394  N  N7    . DG  I  5  72   ? 199.919 265.740 170.652 1.00 124.71 ? 72   DG  a N7    1 
ATOM   7395  C  C5    . DG  I  5  72   ? 199.052 265.433 171.691 1.00 123.22 ? 72   DG  a C5    1 
ATOM   7396  C  C6    . DG  I  5  72   ? 199.208 264.529 172.767 1.00 124.72 ? 72   DG  a C6    1 
ATOM   7397  O  O6    . DG  I  5  72   ? 200.174 263.795 173.017 1.00 124.48 ? 72   DG  a O6    1 
ATOM   7398  N  N1    . DG  I  5  72   ? 198.090 264.516 173.596 1.00 129.21 ? 72   DG  a N1    1 
ATOM   7399  C  C2    . DG  I  5  72   ? 196.963 265.283 173.408 1.00 133.85 ? 72   DG  a C2    1 
ATOM   7400  N  N2    . DG  I  5  72   ? 195.988 265.145 174.315 1.00 144.21 ? 72   DG  a N2    1 
ATOM   7401  N  N3    . DG  I  5  72   ? 196.810 266.140 172.407 1.00 124.95 ? 72   DG  a N3    1 
ATOM   7402  C  C4    . DG  I  5  72   ? 197.888 266.161 171.588 1.00 121.14 ? 72   DG  a C4    1 
ATOM   7403  P  P     . DC  I  5  73   ? 195.691 272.056 169.663 1.00 132.13 ? 73   DC  a P     1 
ATOM   7404  O  OP1   . DC  I  5  73   ? 194.508 272.774 169.137 1.00 123.68 ? 73   DC  a OP1   1 
ATOM   7405  O  OP2   . DC  I  5  73   ? 197.049 272.575 169.395 1.00 130.89 ? 73   DC  a OP2   1 
ATOM   7406  O  "O5'" . DC  I  5  73   ? 195.531 271.893 171.244 1.00 121.14 ? 73   DC  a "O5'" 1 
ATOM   7407  C  "C5'" . DC  I  5  73   ? 194.463 271.118 171.766 1.00 124.11 ? 73   DC  a "C5'" 1 
ATOM   7408  C  "C4'" . DC  I  5  73   ? 194.744 270.711 173.199 1.00 133.15 ? 73   DC  a "C4'" 1 
ATOM   7409  O  "O4'" . DC  I  5  73   ? 195.700 269.637 173.221 1.00 138.09 ? 73   DC  a "O4'" 1 
ATOM   7410  C  "C3'" . DC  I  5  73   ? 195.333 271.818 174.076 1.00 143.09 ? 73   DC  a "C3'" 1 
ATOM   7411  O  "O3'" . DC  I  5  73   ? 194.376 272.224 175.043 1.00 149.97 ? 73   DC  a "O3'" 1 
ATOM   7412  C  "C2'" . DC  I  5  73   ? 196.574 271.180 174.731 1.00 143.92 ? 73   DC  a "C2'" 1 
ATOM   7413  C  "C1'" . DC  I  5  73   ? 196.401 269.697 174.431 1.00 144.10 ? 73   DC  a "C1'" 1 
ATOM   7414  N  N1    . DC  I  5  73   ? 197.688 268.965 174.268 1.00 134.80 ? 73   DC  a N1    1 
ATOM   7415  C  C2    . DC  I  5  73   ? 198.064 268.007 175.215 1.00 136.35 ? 73   DC  a C2    1 
ATOM   7416  O  O2    . DC  I  5  73   ? 197.326 267.801 176.182 1.00 138.37 ? 73   DC  a O2    1 
ATOM   7417  N  N3    . DC  I  5  73   ? 199.242 267.354 175.051 1.00 132.83 ? 73   DC  a N3    1 
ATOM   7418  C  C4    . DC  I  5  73   ? 200.013 267.621 173.994 1.00 131.36 ? 73   DC  a C4    1 
ATOM   7419  N  N4    . DC  I  5  73   ? 201.160 266.945 173.866 1.00 133.42 ? 73   DC  a N4    1 
ATOM   7420  C  C5    . DC  I  5  73   ? 199.635 268.585 173.015 1.00 129.00 ? 73   DC  a C5    1 
ATOM   7421  C  C6    . DC  I  5  73   ? 198.479 269.229 173.191 1.00 130.00 ? 73   DC  a C6    1 
ATOM   7422  P  P     . DT  I  5  74   ? 194.694 273.446 176.034 1.00 146.77 ? 74   DT  a P     1 
ATOM   7423  O  OP1   . DT  I  5  74   ? 193.402 274.040 176.439 1.00 148.35 ? 74   DT  a OP1   1 
ATOM   7424  O  OP2   . DT  I  5  74   ? 195.725 274.292 175.395 1.00 138.42 ? 74   DT  a OP2   1 
ATOM   7425  O  "O5'" . DT  I  5  74   ? 195.353 272.737 177.305 1.00 138.96 ? 74   DT  a "O5'" 1 
ATOM   7426  C  "C5'" . DT  I  5  74   ? 194.703 271.627 177.907 1.00 145.01 ? 74   DT  a "C5'" 1 
ATOM   7427  C  "C4'" . DT  I  5  74   ? 195.453 271.175 179.145 1.00 156.14 ? 74   DT  a "C4'" 1 
ATOM   7428  O  "O4'" . DT  I  5  74   ? 196.547 270.305 178.764 1.00 155.67 ? 74   DT  a "O4'" 1 
ATOM   7429  C  "C3'" . DT  I  5  74   ? 196.062 272.306 179.973 1.00 163.73 ? 74   DT  a "C3'" 1 
ATOM   7430  O  "O3'" . DT  I  5  74   ? 195.683 272.166 181.335 1.00 170.18 ? 74   DT  a "O3'" 1 
ATOM   7431  C  "C2'" . DT  I  5  74   ? 197.570 272.137 179.780 1.00 161.14 ? 74   DT  a "C2'" 1 
ATOM   7432  C  "C1'" . DT  I  5  74   ? 197.699 270.651 179.491 1.00 156.04 ? 74   DT  a "C1'" 1 
ATOM   7433  N  N1    . DT  I  5  74   ? 198.888 270.317 178.661 1.00 143.01 ? 74   DT  a N1    1 
ATOM   7434  C  C2    . DT  I  5  74   ? 199.777 269.360 179.099 1.00 142.51 ? 74   DT  a C2    1 
ATOM   7435  O  O2    . DT  I  5  74   ? 199.646 268.758 180.149 1.00 143.10 ? 74   DT  a O2    1 
ATOM   7436  N  N3    . DT  I  5  74   ? 200.831 269.132 178.253 1.00 140.12 ? 74   DT  a N3    1 
ATOM   7437  C  C4    . DT  I  5  74   ? 201.079 269.752 177.041 1.00 135.69 ? 74   DT  a C4    1 
ATOM   7438  O  O4    . DT  I  5  74   ? 202.054 269.481 176.349 1.00 126.78 ? 74   DT  a O4    1 
ATOM   7439  C  C5    . DT  I  5  74   ? 200.108 270.742 176.646 1.00 137.59 ? 74   DT  a C5    1 
ATOM   7440  C  C7    . DT  I  5  74   ? 200.270 271.482 175.350 1.00 129.06 ? 74   DT  a C7    1 
ATOM   7441  C  C6    . DT  I  5  74   ? 199.074 270.974 177.464 1.00 141.09 ? 74   DT  a C6    1 
ATOM   7442  P  P     . DG  I  5  75   ? 196.030 273.316 182.401 1.00 189.28 ? 75   DG  a P     1 
ATOM   7443  O  OP1   . DG  I  5  75   ? 194.815 273.554 183.208 1.00 191.73 ? 75   DG  a OP1   1 
ATOM   7444  O  OP2   . DG  I  5  75   ? 196.660 274.449 181.685 1.00 183.55 ? 75   DG  a OP2   1 
ATOM   7445  O  "O5'" . DG  I  5  75   ? 197.136 272.639 183.329 1.00 111.64 ? 75   DG  a "O5'" 1 
ATOM   7446  C  "C5'" . DG  I  5  75   ? 196.899 271.350 183.875 1.00 121.29 ? 75   DG  a "C5'" 1 
ATOM   7447  C  "C4'" . DG  I  5  75   ? 198.171 270.768 184.456 1.00 134.59 ? 75   DG  a "C4'" 1 
ATOM   7448  O  "O4'" . DG  I  5  75   ? 199.051 270.354 183.380 1.00 142.42 ? 75   DG  a "O4'" 1 
ATOM   7449  C  "C3'" . DG  I  5  75   ? 198.972 271.729 185.333 1.00 142.31 ? 75   DG  a "C3'" 1 
ATOM   7450  O  "O3'" . DG  I  5  75   ? 199.333 271.089 186.547 1.00 145.12 ? 75   DG  a "O3'" 1 
ATOM   7451  C  "C2'" . DG  I  5  75   ? 200.195 272.075 184.480 1.00 143.83 ? 75   DG  a "C2'" 1 
ATOM   7452  C  "C1'" . DG  I  5  75   ? 200.353 270.839 183.609 1.00 147.15 ? 75   DG  a "C1'" 1 
ATOM   7453  N  N9    . DG  I  5  75   ? 200.966 271.120 182.313 1.00 139.02 ? 75   DG  a N9    1 
ATOM   7454  C  C8    . DG  I  5  75   ? 200.543 272.038 181.384 1.00 137.22 ? 75   DG  a C8    1 
ATOM   7455  N  N7    . DG  I  5  75   ? 201.279 272.071 180.310 1.00 130.88 ? 75   DG  a N7    1 
ATOM   7456  C  C5    . DG  I  5  75   ? 202.254 271.109 180.536 1.00 127.23 ? 75   DG  a C5    1 
ATOM   7457  C  C6    . DG  I  5  75   ? 203.331 270.696 179.720 1.00 121.40 ? 75   DG  a C6    1 
ATOM   7458  O  O6    . DG  I  5  75   ? 203.646 271.116 178.598 1.00 123.65 ? 75   DG  a O6    1 
ATOM   7459  N  N1    . DG  I  5  75   ? 204.084 269.695 180.325 1.00 122.78 ? 75   DG  a N1    1 
ATOM   7460  C  C2    . DG  I  5  75   ? 203.824 269.156 181.563 1.00 128.49 ? 75   DG  a C2    1 
ATOM   7461  N  N2    . DG  I  5  75   ? 204.658 268.197 181.988 1.00 127.38 ? 75   DG  a N2    1 
ATOM   7462  N  N3    . DG  I  5  75   ? 202.816 269.537 182.341 1.00 135.00 ? 75   DG  a N3    1 
ATOM   7463  C  C4    . DG  I  5  75   ? 202.077 270.514 181.766 1.00 135.76 ? 75   DG  a C4    1 
ATOM   7464  P  P     . DT  I  5  76   ? 200.045 271.917 187.725 1.00 145.95 ? 76   DT  a P     1 
ATOM   7465  O  OP1   . DT  I  5  76   ? 199.418 271.502 189.000 1.00 145.08 ? 76   DT  a OP1   1 
ATOM   7466  O  OP2   . DT  I  5  76   ? 200.059 273.350 187.352 1.00 144.53 ? 76   DT  a OP2   1 
ATOM   7467  O  "O5'" . DT  I  5  76   ? 201.548 271.379 187.698 1.00 134.82 ? 76   DT  a "O5'" 1 
ATOM   7468  C  "C5'" . DT  I  5  76   ? 201.786 269.982 187.634 1.00 134.37 ? 76   DT  a "C5'" 1 
ATOM   7469  C  "C4'" . DT  I  5  76   ? 203.254 269.689 187.396 1.00 136.84 ? 76   DT  a "C4'" 1 
ATOM   7470  O  "O4'" . DT  I  5  76   ? 203.587 269.914 185.998 1.00 139.22 ? 76   DT  a "O4'" 1 
ATOM   7471  C  "C3'" . DT  I  5  76   ? 204.228 270.549 188.201 1.00 142.43 ? 76   DT  a "C3'" 1 
ATOM   7472  O  "O3'" . DT  I  5  76   ? 205.304 269.744 188.641 1.00 144.54 ? 76   DT  a "O3'" 1 
ATOM   7473  C  "C2'" . DT  I  5  76   ? 204.693 271.576 187.171 1.00 143.28 ? 76   DT  a "C2'" 1 
ATOM   7474  C  "C1'" . DT  I  5  76   ? 204.749 270.707 185.931 1.00 140.59 ? 76   DT  a "C1'" 1 
ATOM   7475  N  N1    . DT  I  5  76   ? 204.747 271.458 184.639 1.00 138.27 ? 76   DT  a N1    1 
ATOM   7476  C  C2    . DT  I  5  76   ? 205.709 271.170 183.702 1.00 136.91 ? 76   DT  a C2    1 
ATOM   7477  O  O2    . DT  I  5  76   ? 206.571 270.328 183.868 1.00 132.95 ? 76   DT  a O2    1 
ATOM   7478  N  N3    . DT  I  5  76   ? 205.618 271.895 182.545 1.00 135.17 ? 76   DT  a N3    1 
ATOM   7479  C  C4    . DT  I  5  76   ? 204.684 272.867 182.243 1.00 129.89 ? 76   DT  a C4    1 
ATOM   7480  O  O4    . DT  I  5  76   ? 204.687 273.470 181.175 1.00 127.04 ? 76   DT  a O4    1 
ATOM   7481  C  C5    . DT  I  5  76   ? 203.704 273.123 183.269 1.00 128.96 ? 76   DT  a C5    1 
ATOM   7482  C  C7    . DT  I  5  76   ? 202.644 274.160 183.051 1.00 129.38 ? 76   DT  a C7    1 
ATOM   7483  C  C6    . DT  I  5  76   ? 203.774 272.409 184.404 1.00 133.19 ? 76   DT  a C6    1 
ATOM   7484  P  P     . DC  I  5  77   ? 205.951 269.966 190.094 1.00 138.72 ? 77   DC  a P     1 
ATOM   7485  O  OP1   . DC  I  5  77   ? 205.579 268.807 190.935 1.00 139.44 ? 77   DC  a OP1   1 
ATOM   7486  O  OP2   . DC  I  5  77   ? 205.615 271.338 190.536 1.00 130.94 ? 77   DC  a OP2   1 
ATOM   7487  O  "O5'" . DC  I  5  77   ? 207.521 269.910 189.808 1.00 160.88 ? 77   DC  a "O5'" 1 
ATOM   7488  C  "C5'" . DC  I  5  77   ? 208.027 269.029 188.809 1.00 149.56 ? 77   DC  a "C5'" 1 
ATOM   7489  C  "C4'" . DC  I  5  77   ? 209.229 269.640 188.108 1.00 139.91 ? 77   DC  a "C4'" 1 
ATOM   7490  O  "O4'" . DC  I  5  77   ? 208.785 270.448 186.978 1.00 136.10 ? 77   DC  a "O4'" 1 
ATOM   7491  C  "C3'" . DC  I  5  77   ? 210.074 270.578 188.974 1.00 139.34 ? 77   DC  a "C3'" 1 
ATOM   7492  O  "O3'" . DC  I  5  77   ? 211.435 270.480 188.590 1.00 141.34 ? 77   DC  a "O3'" 1 
ATOM   7493  C  "C2'" . DC  I  5  77   ? 209.516 271.937 188.582 1.00 136.79 ? 77   DC  a "C2'" 1 
ATOM   7494  C  "C1'" . DC  I  5  77   ? 209.388 271.716 187.088 1.00 138.88 ? 77   DC  a "C1'" 1 
ATOM   7495  N  N1    . DC  I  5  77   ? 208.566 272.733 186.375 1.00 123.57 ? 77   DC  a N1    1 
ATOM   7496  C  C2    . DC  I  5  77   ? 208.873 273.055 185.050 1.00 129.47 ? 77   DC  a C2    1 
ATOM   7497  O  O2    . DC  I  5  77   ? 209.801 272.457 184.493 1.00 135.08 ? 77   DC  a O2    1 
ATOM   7498  N  N3    . DC  I  5  77   ? 208.121 273.981 184.405 1.00 123.81 ? 77   DC  a N3    1 
ATOM   7499  C  C4    . DC  I  5  77   ? 207.121 274.587 185.046 1.00 123.99 ? 77   DC  a C4    1 
ATOM   7500  N  N4    . DC  I  5  77   ? 206.412 275.506 184.379 1.00 124.64 ? 77   DC  a N4    1 
ATOM   7501  C  C5    . DC  I  5  77   ? 206.809 274.288 186.404 1.00 123.11 ? 77   DC  a C5    1 
ATOM   7502  C  C6    . DC  I  5  77   ? 207.548 273.362 187.024 1.00 120.42 ? 77   DC  a C6    1 
ATOM   7503  P  P     . DC  I  5  78   ? 212.419 269.417 189.279 1.00 137.28 ? 78   DC  a P     1 
ATOM   7504  O  OP1   . DC  I  5  78   ? 211.700 268.131 189.425 1.00 138.33 ? 78   DC  a OP1   1 
ATOM   7505  O  OP2   . DC  I  5  78   ? 213.009 270.066 190.471 1.00 140.25 ? 78   DC  a OP2   1 
ATOM   7506  O  "O5'" . DC  I  5  78   ? 213.581 269.241 188.195 1.00 149.60 ? 78   DC  a "O5'" 1 
ATOM   7507  C  "C5'" . DC  I  5  78   ? 213.252 269.210 186.805 1.00 150.34 ? 78   DC  a "C5'" 1 
ATOM   7508  C  "C4'" . DC  I  5  78   ? 214.132 270.164 186.010 1.00 151.36 ? 78   DC  a "C4'" 1 
ATOM   7509  O  "O4'" . DC  I  5  78   ? 213.351 271.310 185.567 1.00 145.72 ? 78   DC  a "O4'" 1 
ATOM   7510  C  "C3'" . DC  I  5  78   ? 215.309 270.756 186.783 1.00 155.43 ? 78   DC  a "C3'" 1 
ATOM   7511  O  "O3'" . DC  I  5  78   ? 216.371 271.048 185.881 1.00 155.27 ? 78   DC  a "O3'" 1 
ATOM   7512  C  "C2'" . DC  I  5  78   ? 214.696 272.046 187.306 1.00 153.04 ? 78   DC  a "C2'" 1 
ATOM   7513  C  "C1'" . DC  I  5  78   ? 213.958 272.487 186.055 1.00 143.57 ? 78   DC  a "C1'" 1 
ATOM   7514  N  N1    . DC  I  5  78   ? 212.903 273.519 186.282 1.00 130.27 ? 78   DC  a N1    1 
ATOM   7515  C  C2    . DC  I  5  78   ? 212.521 274.359 185.229 1.00 130.18 ? 78   DC  a C2    1 
ATOM   7516  O  O2    . DC  I  5  78   ? 213.053 274.210 184.123 1.00 127.39 ? 78   DC  a O2    1 
ATOM   7517  N  N3    . DC  I  5  78   ? 211.549 275.280 185.443 1.00 136.03 ? 78   DC  a N3    1 
ATOM   7518  C  C4    . DC  I  5  78   ? 210.982 275.384 186.645 1.00 140.56 ? 78   DC  a C4    1 
ATOM   7519  N  N4    . DC  I  5  78   ? 210.046 276.321 186.822 1.00 142.84 ? 78   DC  a N4    1 
ATOM   7520  C  C5    . DC  I  5  78   ? 211.383 274.561 187.736 1.00 139.24 ? 78   DC  a C5    1 
ATOM   7521  C  C6    . DC  I  5  78   ? 212.330 273.645 187.512 1.00 134.45 ? 78   DC  a C6    1 
ATOM   7522  P  P     . DC  I  5  79   ? 217.413 269.916 185.415 1.00 157.98 ? 79   DC  a P     1 
ATOM   7523  O  OP1   . DC  I  5  79   ? 216.689 268.652 185.150 1.00 151.48 ? 79   DC  a OP1   1 
ATOM   7524  O  OP2   . DC  I  5  79   ? 218.533 269.926 186.380 1.00 157.17 ? 79   DC  a OP2   1 
ATOM   7525  O  "O5'" . DC  I  5  79   ? 217.965 270.482 184.027 1.00 127.56 ? 79   DC  a "O5'" 1 
ATOM   7526  C  "C5'" . DC  I  5  79   ? 217.069 271.110 183.110 1.00 121.66 ? 79   DC  a "C5'" 1 
ATOM   7527  C  "C4'" . DC  I  5  79   ? 217.669 272.390 182.552 1.00 118.62 ? 79   DC  a "C4'" 1 
ATOM   7528  O  "O4'" . DC  I  5  79   ? 216.852 273.529 182.945 1.00 120.77 ? 79   DC  a "O4'" 1 
ATOM   7529  C  "C3'" . DC  I  5  79   ? 219.073 272.712 183.053 1.00 114.32 ? 79   DC  a "C3'" 1 
ATOM   7530  O  "O3'" . DC  I  5  79   ? 219.763 273.468 182.070 1.00 114.71 ? 79   DC  a "O3'" 1 
ATOM   7531  C  "C2'" . DC  I  5  79   ? 218.766 273.569 184.274 1.00 116.39 ? 79   DC  a "C2'" 1 
ATOM   7532  C  "C1'" . DC  I  5  79   ? 217.633 274.417 183.720 1.00 121.51 ? 79   DC  a "C1'" 1 
ATOM   7533  N  N1    . DC  I  5  79   ? 216.764 275.030 184.760 1.00 115.01 ? 79   DC  a N1    1 
ATOM   7534  C  C2    . DC  I  5  79   ? 215.922 276.092 184.417 1.00 119.02 ? 79   DC  a C2    1 
ATOM   7535  O  O2    . DC  I  5  79   ? 215.910 276.489 183.246 1.00 112.72 ? 79   DC  a O2    1 
ATOM   7536  N  N3    . DC  I  5  79   ? 215.126 276.634 185.371 1.00 123.28 ? 79   DC  a N3    1 
ATOM   7537  C  C4    . DC  I  5  79   ? 215.160 276.158 186.616 1.00 127.01 ? 79   DC  a C4    1 
ATOM   7538  N  N4    . DC  I  5  79   ? 214.373 276.732 187.531 1.00 125.14 ? 79   DC  a N4    1 
ATOM   7539  C  C5    . DC  I  5  79   ? 216.030 275.096 186.989 1.00 126.40 ? 79   DC  a C5    1 
ATOM   7540  C  C6    . DC  I  5  79   ? 216.801 274.561 186.037 1.00 117.39 ? 79   DC  a C6    1 
ATOM   7541  P  P     . DC  I  5  80   ? 220.716 272.744 180.999 1.00 104.19 ? 80   DC  a P     1 
ATOM   7542  O  OP1   . DC  I  5  80   ? 219.993 271.572 180.460 1.00 90.56  ? 80   DC  a OP1   1 
ATOM   7543  O  OP2   . DC  I  5  80   ? 222.046 272.568 181.619 1.00 85.62  ? 80   DC  a OP2   1 
ATOM   7544  O  "O5'" . DC  I  5  80   ? 220.857 273.830 179.835 1.00 99.11  ? 80   DC  a "O5'" 1 
ATOM   7545  C  "C5'" . DC  I  5  80   ? 219.732 274.150 179.029 1.00 83.32  ? 80   DC  a "C5'" 1 
ATOM   7546  C  "C4'" . DC  I  5  80   ? 219.519 275.652 178.957 1.00 73.12  ? 80   DC  a "C4'" 1 
ATOM   7547  O  "O4'" . DC  I  5  80   ? 218.957 276.134 180.209 1.00 77.55  ? 80   DC  a "O4'" 1 
ATOM   7548  C  "C3'" . DC  I  5  80   ? 220.778 276.487 178.713 1.00 69.99  ? 80   DC  a "C3'" 1 
ATOM   7549  O  "O3'" . DC  I  5  80   ? 220.475 277.538 177.812 1.00 66.91  ? 80   DC  a "O3'" 1 
ATOM   7550  C  "C2'" . DC  I  5  80   ? 221.098 277.025 180.105 1.00 78.30  ? 80   DC  a "C2'" 1 
ATOM   7551  C  "C1'" . DC  I  5  80   ? 219.700 277.248 180.647 1.00 80.27  ? 80   DC  a "C1'" 1 
ATOM   7552  N  N1    . DC  I  5  80   ? 219.629 277.314 182.132 1.00 105.61 ? 80   DC  a N1    1 
ATOM   7553  C  C2    . DC  I  5  80   ? 218.744 278.208 182.737 1.00 108.87 ? 80   DC  a C2    1 
ATOM   7554  O  O2    . DC  I  5  80   ? 218.043 278.931 182.020 1.00 109.30 ? 80   DC  a O2    1 
ATOM   7555  N  N3    . DC  I  5  80   ? 218.687 278.261 184.091 1.00 109.85 ? 80   DC  a N3    1 
ATOM   7556  C  C4    . DC  I  5  80   ? 219.462 277.457 184.822 1.00 108.39 ? 80   DC  a C4    1 
ATOM   7557  N  N4    . DC  I  5  80   ? 219.377 277.544 186.153 1.00 110.79 ? 80   DC  a N4    1 
ATOM   7558  C  C5    . DC  I  5  80   ? 220.377 276.547 184.219 1.00 107.76 ? 80   DC  a C5    1 
ATOM   7559  C  C6    . DC  I  5  80   ? 220.428 276.510 182.884 1.00 103.79 ? 80   DC  a C6    1 
ATOM   7560  P  P     . DC  I  5  81   ? 221.644 278.304 177.020 1.00 87.69  ? 81   DC  a P     1 
ATOM   7561  O  OP1   . DC  I  5  81   ? 221.638 277.799 175.630 1.00 90.09  ? 81   DC  a OP1   1 
ATOM   7562  O  OP2   . DC  I  5  81   ? 222.884 278.232 177.820 1.00 72.90  ? 81   DC  a OP2   1 
ATOM   7563  O  "O5'" . DC  I  5  81   ? 221.149 279.825 177.010 1.00 109.28 ? 81   DC  a "O5'" 1 
ATOM   7564  C  "C5'" . DC  I  5  81   ? 219.838 280.135 176.549 1.00 99.17  ? 81   DC  a "C5'" 1 
ATOM   7565  C  "C4'" . DC  I  5  81   ? 219.314 281.401 177.202 1.00 83.07  ? 81   DC  a "C4'" 1 
ATOM   7566  O  "O4'" . DC  I  5  81   ? 219.132 281.183 178.628 1.00 84.19  ? 81   DC  a "O4'" 1 
ATOM   7567  C  "C3'" . DC  I  5  81   ? 220.221 282.621 177.072 1.00 76.54  ? 81   DC  a "C3'" 1 
ATOM   7568  O  "O3'" . DC  I  5  81   ? 219.436 283.774 176.807 1.00 76.47  ? 81   DC  a "O3'" 1 
ATOM   7569  C  "C2'" . DC  I  5  81   ? 220.889 282.702 178.442 1.00 82.57  ? 81   DC  a "C2'" 1 
ATOM   7570  C  "C1'" . DC  I  5  81   ? 219.771 282.214 179.347 1.00 84.32  ? 81   DC  a "C1'" 1 
ATOM   7571  N  N1    . DC  I  5  81   ? 220.248 281.654 180.644 1.00 94.74  ? 81   DC  a N1    1 
ATOM   7572  C  C2    . DC  I  5  81   ? 219.788 282.198 181.852 1.00 102.39 ? 81   DC  a C2    1 
ATOM   7573  O  O2    . DC  I  5  81   ? 219.003 283.152 181.823 1.00 102.37 ? 81   DC  a O2    1 
ATOM   7574  N  N3    . DC  I  5  81   ? 220.236 281.667 183.021 1.00 106.33 ? 81   DC  a N3    1 
ATOM   7575  C  C4    . DC  I  5  81   ? 221.091 280.644 183.003 1.00 108.31 ? 81   DC  a C4    1 
ATOM   7576  N  N4    . DC  I  5  81   ? 221.501 280.145 184.174 1.00 108.59 ? 81   DC  a N4    1 
ATOM   7577  C  C5    . DC  I  5  81   ? 221.558 280.075 181.784 1.00 103.58 ? 81   DC  a C5    1 
ATOM   7578  C  C6    . DC  I  5  81   ? 221.117 280.608 180.641 1.00 97.43  ? 81   DC  a C6    1 
ATOM   7579  P  P     . DG  I  5  82   ? 220.020 284.959 175.895 1.00 115.18 ? 82   DG  a P     1 
ATOM   7580  O  OP1   . DG  I  5  82   ? 219.038 285.224 174.820 1.00 99.05  ? 82   DG  a OP1   1 
ATOM   7581  O  OP2   . DG  I  5  82   ? 221.418 284.619 175.554 1.00 99.38  ? 82   DG  a OP2   1 
ATOM   7582  O  "O5'" . DG  I  5  82   ? 220.047 286.216 176.880 1.00 100.29 ? 82   DG  a "O5'" 1 
ATOM   7583  C  "C5'" . DG  I  5  82   ? 218.835 286.698 177.443 1.00 108.19 ? 82   DG  a "C5'" 1 
ATOM   7584  C  "C4'" . DG  I  5  82   ? 219.118 287.606 178.625 1.00 113.52 ? 82   DG  a "C4'" 1 
ATOM   7585  O  "O4'" . DG  I  5  82   ? 219.493 286.804 179.772 1.00 115.68 ? 82   DG  a "O4'" 1 
ATOM   7586  C  "C3'" . DG  I  5  82   ? 220.248 288.610 178.408 1.00 115.59 ? 82   DG  a "C3'" 1 
ATOM   7587  O  "O3'" . DG  I  5  82   ? 219.852 289.894 178.861 1.00 120.89 ? 82   DG  a "O3'" 1 
ATOM   7588  C  "C2'" . DG  I  5  82   ? 221.402 288.047 179.236 1.00 112.28 ? 82   DG  a "C2'" 1 
ATOM   7589  C  "C1'" . DG  I  5  82   ? 220.673 287.312 180.348 1.00 117.37 ? 82   DG  a "C1'" 1 
ATOM   7590  N  N9    . DG  I  5  82   ? 221.434 286.191 180.888 1.00 98.52  ? 82   DG  a N9    1 
ATOM   7591  C  C8    . DG  I  5  82   ? 222.129 285.250 180.173 1.00 105.60 ? 82   DG  a C8    1 
ATOM   7592  N  N7    . DG  I  5  82   ? 222.714 284.356 180.919 1.00 106.57 ? 82   DG  a N7    1 
ATOM   7593  C  C5    . DG  I  5  82   ? 222.386 284.731 182.215 1.00 108.68 ? 82   DG  a C5    1 
ATOM   7594  C  C6    . DG  I  5  82   ? 222.744 284.142 183.448 1.00 118.02 ? 82   DG  a C6    1 
ATOM   7595  O  O6    . DG  I  5  82   ? 223.432 283.131 183.643 1.00 123.63 ? 82   DG  a O6    1 
ATOM   7596  N  N1    . DG  I  5  82   ? 222.199 284.833 184.525 1.00 121.95 ? 82   DG  a N1    1 
ATOM   7597  C  C2    . DG  I  5  82   ? 221.404 285.952 184.421 1.00 123.46 ? 82   DG  a C2    1 
ATOM   7598  N  N2    . DG  I  5  82   ? 220.982 286.497 185.570 1.00 124.31 ? 82   DG  a N2    1 
ATOM   7599  N  N3    . DG  I  5  82   ? 221.079 286.523 183.269 1.00 116.45 ? 82   DG  a N3    1 
ATOM   7600  C  C4    . DG  I  5  82   ? 221.599 285.859 182.212 1.00 105.27 ? 82   DG  a C4    1 
ATOM   7601  P  P     . DC  I  5  83   ? 220.757 291.180 178.530 1.00 126.58 ? 83   DC  a P     1 
ATOM   7602  O  OP1   . DC  I  5  83   ? 219.844 292.315 178.275 1.00 129.99 ? 83   DC  a OP1   1 
ATOM   7603  O  OP2   . DC  I  5  83   ? 221.746 290.786 177.502 1.00 121.20 ? 83   DC  a OP2   1 
ATOM   7604  O  "O5'" . DC  I  5  83   ? 221.542 291.451 179.893 1.00 113.52 ? 83   DC  a "O5'" 1 
ATOM   7605  C  "C5'" . DC  I  5  83   ? 220.814 291.746 181.074 1.00 117.24 ? 83   DC  a "C5'" 1 
ATOM   7606  C  "C4'" . DC  I  5  83   ? 221.694 291.621 182.304 1.00 128.74 ? 83   DC  a "C4'" 1 
ATOM   7607  O  "O4'" . DC  I  5  83   ? 222.112 290.253 182.468 1.00 124.50 ? 83   DC  a "O4'" 1 
ATOM   7608  C  "C3'" . DC  I  5  83   ? 222.981 292.451 182.274 1.00 138.40 ? 83   DC  a "C3'" 1 
ATOM   7609  O  "O3'" . DC  I  5  83   ? 222.876 293.528 183.194 1.00 151.02 ? 83   DC  a "O3'" 1 
ATOM   7610  C  "C2'" . DC  I  5  83   ? 224.089 291.460 182.676 1.00 133.39 ? 83   DC  a "C2'" 1 
ATOM   7611  C  "C1'" . DC  I  5  83   ? 223.309 290.255 183.189 1.00 129.38 ? 83   DC  a "C1'" 1 
ATOM   7612  N  N1    . DC  I  5  83   ? 224.000 288.955 182.961 1.00 116.23 ? 83   DC  a N1    1 
ATOM   7613  C  C2    . DC  I  5  83   ? 224.425 288.195 184.057 1.00 122.55 ? 83   DC  a C2    1 
ATOM   7614  O  O2    . DC  I  5  83   ? 224.235 288.629 185.198 1.00 122.39 ? 83   DC  a O2    1 
ATOM   7615  N  N3    . DC  I  5  83   ? 225.063 287.020 183.830 1.00 126.87 ? 83   DC  a N3    1 
ATOM   7616  C  C4    . DC  I  5  83   ? 225.267 286.602 182.579 1.00 128.77 ? 83   DC  a C4    1 
ATOM   7617  N  N4    . DC  I  5  83   ? 225.881 285.429 182.399 1.00 137.64 ? 83   DC  a N4    1 
ATOM   7618  C  C5    . DC  I  5  83   ? 224.821 287.355 181.454 1.00 119.77 ? 83   DC  a C5    1 
ATOM   7619  C  C6    . DC  I  5  83   ? 224.203 288.515 181.690 1.00 115.39 ? 83   DC  a C6    1 
ATOM   7620  P  P     . DG  I  5  84   ? 224.027 294.645 183.278 1.00 139.34 ? 84   DG  a P     1 
ATOM   7621  O  OP1   . DG  I  5  84   ? 223.363 295.950 183.491 1.00 132.68 ? 84   DG  a OP1   1 
ATOM   7622  O  OP2   . DG  I  5  84   ? 224.931 294.465 182.122 1.00 136.74 ? 84   DG  a OP2   1 
ATOM   7623  O  "O5'" . DG  I  5  84   ? 224.828 294.260 184.606 1.00 107.53 ? 84   DG  a "O5'" 1 
ATOM   7624  C  "C5'" . DG  I  5  84   ? 224.142 294.200 185.854 1.00 118.97 ? 84   DG  a "C5'" 1 
ATOM   7625  C  "C4'" . DG  I  5  84   ? 225.029 293.595 186.926 1.00 133.14 ? 84   DG  a "C4'" 1 
ATOM   7626  O  "O4'" . DG  I  5  84   ? 225.257 292.198 186.628 1.00 136.59 ? 84   DG  a "O4'" 1 
ATOM   7627  C  "C3'" . DG  I  5  84   ? 226.404 294.249 187.061 1.00 144.39 ? 84   DG  a "C3'" 1 
ATOM   7628  O  "O3'" . DG  I  5  84   ? 226.606 294.706 188.390 1.00 149.43 ? 84   DG  a "O3'" 1 
ATOM   7629  C  "C2'" . DG  I  5  84   ? 227.399 293.150 186.683 1.00 148.18 ? 84   DG  a "C2'" 1 
ATOM   7630  C  "C1'" . DG  I  5  84   ? 226.601 291.866 186.869 1.00 147.29 ? 84   DG  a "C1'" 1 
ATOM   7631  N  N9    . DG  I  5  84   ? 226.983 290.824 185.922 1.00 138.36 ? 84   DG  a N9    1 
ATOM   7632  C  C8    . DG  I  5  84   ? 226.822 290.858 184.559 1.00 142.41 ? 84   DG  a C8    1 
ATOM   7633  N  N7    . DG  I  5  84   ? 227.259 289.791 183.957 1.00 141.74 ? 84   DG  a N7    1 
ATOM   7634  C  C5    . DG  I  5  84   ? 227.744 288.994 184.984 1.00 140.54 ? 84   DG  a C5    1 
ATOM   7635  C  C6    . DG  I  5  84   ? 228.344 287.716 184.933 1.00 148.69 ? 84   DG  a C6    1 
ATOM   7636  O  O6    . DG  I  5  84   ? 228.560 287.015 183.937 1.00 154.73 ? 84   DG  a O6    1 
ATOM   7637  N  N1    . DG  I  5  84   ? 228.690 287.259 186.200 1.00 145.49 ? 84   DG  a N1    1 
ATOM   7638  C  C2    . DG  I  5  84   ? 228.486 287.952 187.371 1.00 138.76 ? 84   DG  a C2    1 
ATOM   7639  N  N2    . DG  I  5  84   ? 228.894 287.353 188.500 1.00 148.75 ? 84   DG  a N2    1 
ATOM   7640  N  N3    . DG  I  5  84   ? 227.931 289.158 187.431 1.00 127.66 ? 84   DG  a N3    1 
ATOM   7641  C  C4    . DG  I  5  84   ? 227.580 289.615 186.203 1.00 132.06 ? 84   DG  a C4    1 
ATOM   7642  P  P     . DT  I  5  85   ? 227.934 295.530 188.764 1.00 165.35 ? 85   DT  a P     1 
ATOM   7643  O  OP1   . DT  I  5  85   ? 227.612 296.403 189.913 1.00 163.25 ? 85   DT  a OP1   1 
ATOM   7644  O  OP2   . DT  I  5  85   ? 228.464 296.122 187.515 1.00 153.30 ? 85   DT  a OP2   1 
ATOM   7645  O  "O5'" . DT  I  5  85   ? 228.959 294.400 189.246 1.00 153.48 ? 85   DT  a "O5'" 1 
ATOM   7646  C  "C5'" . DT  I  5  85   ? 228.580 293.501 190.279 1.00 157.46 ? 85   DT  a "C5'" 1 
ATOM   7647  C  "C4'" . DT  I  5  85   ? 229.679 292.490 190.552 1.00 164.33 ? 85   DT  a "C4'" 1 
ATOM   7648  O  "O4'" . DT  I  5  85   ? 229.701 291.493 189.502 1.00 170.68 ? 85   DT  a "O4'" 1 
ATOM   7649  C  "C3'" . DT  I  5  85   ? 231.094 293.072 190.626 1.00 161.55 ? 85   DT  a "C3'" 1 
ATOM   7650  O  "O3'" . DT  I  5  85   ? 231.732 292.625 191.814 1.00 154.88 ? 85   DT  a "O3'" 1 
ATOM   7651  C  "C2'" . DT  I  5  85   ? 231.780 292.527 189.369 1.00 167.78 ? 85   DT  a "C2'" 1 
ATOM   7652  C  "C1'" . DT  I  5  85   ? 231.032 291.227 189.135 1.00 168.52 ? 85   DT  a "C1'" 1 
ATOM   7653  N  N1    . DT  I  5  85   ? 231.041 290.767 187.712 1.00 153.53 ? 85   DT  a N1    1 
ATOM   7654  C  C2    . DT  I  5  85   ? 231.535 289.519 187.407 1.00 151.53 ? 85   DT  a C2    1 
ATOM   7655  O  O2    . DT  I  5  85   ? 231.973 288.751 188.245 1.00 157.46 ? 85   DT  a O2    1 
ATOM   7656  N  N3    . DT  I  5  85   ? 231.479 289.191 186.078 1.00 144.87 ? 85   DT  a N3    1 
ATOM   7657  C  C4    . DT  I  5  85   ? 230.996 289.971 185.046 1.00 148.63 ? 85   DT  a C4    1 
ATOM   7658  O  O4    . DT  I  5  85   ? 230.994 289.593 183.878 1.00 142.49 ? 85   DT  a O4    1 
ATOM   7659  C  C5    . DT  I  5  85   ? 230.499 291.269 185.432 1.00 150.99 ? 85   DT  a C5    1 
ATOM   7660  C  C7    . DT  I  5  85   ? 229.956 292.205 184.395 1.00 138.01 ? 85   DT  a C7    1 
ATOM   7661  C  C6    . DT  I  5  85   ? 230.537 291.598 186.732 1.00 152.93 ? 85   DT  a C6    1 
ATOM   7662  P  P     . DT  I  5  86   ? 233.192 293.163 192.211 1.00 184.56 ? 86   DT  a P     1 
ATOM   7663  O  OP1   . DT  I  5  86   ? 233.215 293.338 193.679 1.00 178.55 ? 86   DT  a OP1   1 
ATOM   7664  O  OP2   . DT  I  5  86   ? 233.522 294.310 191.335 1.00 182.96 ? 86   DT  a OP2   1 
ATOM   7665  O  "O5'" . DT  I  5  86   ? 234.155 291.949 191.827 1.00 171.05 ? 86   DT  a "O5'" 1 
ATOM   7666  C  "C5'" . DT  I  5  86   ? 233.859 290.641 192.302 1.00 161.80 ? 86   DT  a "C5'" 1 
ATOM   7667  C  "C4'" . DT  I  5  86   ? 234.817 289.620 191.721 1.00 152.91 ? 86   DT  a "C4'" 1 
ATOM   7668  O  "O4'" . DT  I  5  86   ? 234.475 289.356 190.334 1.00 148.25 ? 86   DT  a "O4'" 1 
ATOM   7669  C  "C3'" . DT  I  5  86   ? 236.290 290.036 191.723 1.00 158.13 ? 86   DT  a "C3'" 1 
ATOM   7670  O  "O3'" . DT  I  5  86   ? 237.094 288.934 192.117 1.00 172.14 ? 86   DT  a "O3'" 1 
ATOM   7671  C  "C2'" . DT  I  5  86   ? 236.539 290.421 190.266 1.00 146.22 ? 86   DT  a "C2'" 1 
ATOM   7672  C  "C1'" . DT  I  5  86   ? 235.639 289.438 189.544 1.00 148.79 ? 86   DT  a "C1'" 1 
ATOM   7673  N  N1    . DT  I  5  86   ? 235.248 289.862 188.167 1.00 148.91 ? 86   DT  a N1    1 
ATOM   7674  C  C2    . DT  I  5  86   ? 235.390 288.971 187.129 1.00 141.51 ? 86   DT  a C2    1 
ATOM   7675  O  O2    . DT  I  5  86   ? 235.805 287.836 187.278 1.00 132.91 ? 86   DT  a O2    1 
ATOM   7676  N  N3    . DT  I  5  86   ? 234.982 289.441 185.909 1.00 139.22 ? 86   DT  a N3    1 
ATOM   7677  C  C4    . DT  I  5  86   ? 234.480 290.695 185.624 1.00 145.12 ? 86   DT  a C4    1 
ATOM   7678  O  O4    . DT  I  5  86   ? 234.159 291.029 184.490 1.00 144.93 ? 86   DT  a O4    1 
ATOM   7679  C  C5    . DT  I  5  86   ? 234.372 291.588 186.751 1.00 149.35 ? 86   DT  a C5    1 
ATOM   7680  C  C7    . DT  I  5  86   ? 233.845 292.977 186.558 1.00 152.10 ? 86   DT  a C7    1 
ATOM   7681  C  C6    . DT  I  5  86   ? 234.746 291.131 187.957 1.00 148.68 ? 86   DT  a C6    1 
ATOM   7682  P  P     . DT  I  5  87   ? 238.653 289.131 192.448 1.00 167.04 ? 87   DT  a P     1 
ATOM   7683  O  OP1   . DT  I  5  87   ? 238.876 288.610 193.814 1.00 158.83 ? 87   DT  a OP1   1 
ATOM   7684  O  OP2   . DT  I  5  87   ? 239.039 290.521 192.125 1.00 161.75 ? 87   DT  a OP2   1 
ATOM   7685  O  "O5'" . DT  I  5  87   ? 239.379 288.156 191.409 1.00 165.04 ? 87   DT  a "O5'" 1 
ATOM   7686  C  "C5'" . DT  I  5  87   ? 238.998 286.788 191.351 1.00 154.85 ? 87   DT  a "C5'" 1 
ATOM   7687  C  "C4'" . DT  I  5  87   ? 239.438 286.147 190.047 1.00 149.10 ? 87   DT  a "C4'" 1 
ATOM   7688  O  "O4'" . DT  I  5  87   ? 238.803 286.816 188.924 1.00 151.67 ? 87   DT  a "O4'" 1 
ATOM   7689  C  "C3'" . DT  I  5  87   ? 240.940 286.196 189.767 1.00 149.01 ? 87   DT  a "C3'" 1 
ATOM   7690  O  "O3'" . DT  I  5  87   ? 241.329 284.980 189.160 1.00 157.97 ? 87   DT  a "O3'" 1 
ATOM   7691  C  "C2'" . DT  I  5  87   ? 241.056 287.361 188.786 1.00 142.77 ? 87   DT  a "C2'" 1 
ATOM   7692  C  "C1'" . DT  I  5  87   ? 239.791 287.155 187.977 1.00 143.89 ? 87   DT  a "C1'" 1 
ATOM   7693  N  N1    . DT  I  5  87   ? 239.325 288.351 187.218 1.00 142.81 ? 87   DT  a N1    1 
ATOM   7694  C  C2    . DT  I  5  87   ? 239.046 288.220 185.880 1.00 142.01 ? 87   DT  a C2    1 
ATOM   7695  O  O2    . DT  I  5  87   ? 239.147 287.164 185.281 1.00 139.72 ? 87   DT  a O2    1 
ATOM   7696  N  N3    . DT  I  5  87   ? 238.589 289.355 185.275 1.00 130.43 ? 87   DT  a N3    1 
ATOM   7697  C  C4    . DT  I  5  87   ? 238.406 290.594 185.852 1.00 139.31 ? 87   DT  a C4    1 
ATOM   7698  O  O4    . DT  I  5  87   ? 238.013 291.563 185.212 1.00 145.24 ? 87   DT  a O4    1 
ATOM   7699  C  C5    . DT  I  5  87   ? 238.736 290.676 187.254 1.00 137.26 ? 87   DT  a C5    1 
ATOM   7700  C  C7    . DT  I  5  87   ? 238.588 291.979 187.983 1.00 128.95 ? 87   DT  a C7    1 
ATOM   7701  C  C6    . DT  I  5  87   ? 239.160 289.558 187.869 1.00 139.42 ? 87   DT  a C6    1 
ATOM   7702  P  P     . DT  I  5  88   ? 242.791 284.371 189.406 1.00 166.87 ? 88   DT  a P     1 
ATOM   7703  O  OP1   . DT  I  5  88   ? 242.678 283.328 190.449 1.00 167.80 ? 88   DT  a OP1   1 
ATOM   7704  O  OP2   . DT  I  5  88   ? 243.723 285.505 189.594 1.00 154.81 ? 88   DT  a OP2   1 
ATOM   7705  O  "O5'" . DT  I  5  88   ? 243.136 283.677 188.010 1.00 149.02 ? 88   DT  a "O5'" 1 
ATOM   7706  C  "C5'" . DT  I  5  88   ? 242.083 283.318 187.119 1.00 144.07 ? 88   DT  a "C5'" 1 
ATOM   7707  C  "C4'" . DT  I  5  88   ? 242.547 283.401 185.676 1.00 145.43 ? 88   DT  a "C4'" 1 
ATOM   7708  O  "O4'" . DT  I  5  88   ? 242.035 284.617 185.060 1.00 151.72 ? 88   DT  a "O4'" 1 
ATOM   7709  C  "C3'" . DT  I  5  88   ? 244.064 283.456 185.495 1.00 142.65 ? 88   DT  a "C3'" 1 
ATOM   7710  O  "O3'" . DT  I  5  88   ? 244.422 282.778 184.308 1.00 151.16 ? 88   DT  a "O3'" 1 
ATOM   7711  C  "C2'" . DT  I  5  88   ? 244.309 284.952 185.355 1.00 132.24 ? 88   DT  a "C2'" 1 
ATOM   7712  C  "C1'" . DT  I  5  88   ? 243.116 285.328 184.500 1.00 148.91 ? 88   DT  a "C1'" 1 
ATOM   7713  N  N1    . DT  I  5  88   ? 242.800 286.783 184.501 1.00 131.27 ? 88   DT  a N1    1 
ATOM   7714  C  C2    . DT  I  5  88   ? 242.296 287.361 183.361 1.00 134.95 ? 88   DT  a C2    1 
ATOM   7715  O  O2    . DT  I  5  88   ? 242.033 286.731 182.353 1.00 158.43 ? 88   DT  a O2    1 
ATOM   7716  N  N3    . DT  I  5  88   ? 242.018 288.697 183.471 1.00 127.19 ? 88   DT  a N3    1 
ATOM   7717  C  C4    . DT  I  5  88   ? 242.236 289.503 184.572 1.00 147.13 ? 88   DT  a C4    1 
ATOM   7718  O  O4    . DT  I  5  88   ? 241.987 290.704 184.566 1.00 152.28 ? 88   DT  a O4    1 
ATOM   7719  C  C5    . DT  I  5  88   ? 242.806 288.843 185.720 1.00 143.53 ? 88   DT  a C5    1 
ATOM   7720  C  C7    . DT  I  5  88   ? 243.099 289.621 186.968 1.00 136.17 ? 88   DT  a C7    1 
ATOM   7721  C  C6    . DT  I  5  88   ? 243.044 287.526 185.636 1.00 136.59 ? 88   DT  a C6    1 
ATOM   7722  P  P     . DA  I  5  89   ? 244.989 281.277 184.362 1.00 152.36 ? 89   DA  a P     1 
ATOM   7723  O  OP1   . DA  I  5  89   ? 243.983 280.440 185.051 1.00 153.08 ? 89   DA  a OP1   1 
ATOM   7724  O  OP2   . DA  I  5  89   ? 246.377 281.336 184.872 1.00 136.54 ? 89   DA  a OP2   1 
ATOM   7725  O  "O5'" . DA  I  5  89   ? 245.049 280.850 182.824 1.00 135.35 ? 89   DA  a "O5'" 1 
ATOM   7726  C  "C5'" . DA  I  5  89   ? 243.883 280.965 182.018 1.00 134.24 ? 89   DA  a "C5'" 1 
ATOM   7727  C  "C4'" . DA  I  5  89   ? 244.106 281.934 180.869 1.00 148.43 ? 89   DA  a "C4'" 1 
ATOM   7728  O  "O4'" . DA  I  5  89   ? 244.136 283.300 181.363 1.00 155.30 ? 89   DA  a "O4'" 1 
ATOM   7729  C  "C3'" . DA  I  5  89   ? 245.411 281.741 180.089 1.00 127.08 ? 89   DA  a "C3'" 1 
ATOM   7730  O  "O3'" . DA  I  5  89   ? 245.148 281.863 178.705 1.00 125.74 ? 89   DA  a "O3'" 1 
ATOM   7731  C  "C2'" . DA  I  5  89   ? 246.276 282.898 180.587 1.00 129.11 ? 89   DA  a "C2'" 1 
ATOM   7732  C  "C1'" . DA  I  5  89   ? 245.220 283.968 180.761 1.00 138.38 ? 89   DA  a "C1'" 1 
ATOM   7733  N  N9    . DA  I  5  89   ? 245.625 285.080 181.614 1.00 135.60 ? 89   DA  a N9    1 
ATOM   7734  C  C8    . DA  I  5  89   ? 246.359 285.017 182.764 1.00 137.16 ? 89   DA  a C8    1 
ATOM   7735  N  N7    . DA  I  5  89   ? 246.569 286.188 183.321 1.00 134.80 ? 89   DA  a N7    1 
ATOM   7736  C  C5    . DA  I  5  89   ? 245.930 287.079 182.476 1.00 131.47 ? 89   DA  a C5    1 
ATOM   7737  C  C6    . DA  I  5  89   ? 245.783 288.481 182.508 1.00 136.18 ? 89   DA  a C6    1 
ATOM   7738  N  N6    . DA  I  5  89   ? 246.297 289.256 183.469 1.00 132.03 ? 89   DA  a N6    1 
ATOM   7739  N  N1    . DA  I  5  89   ? 245.087 289.058 181.506 1.00 141.85 ? 89   DA  a N1    1 
ATOM   7740  C  C2    . DA  I  5  89   ? 244.578 288.281 180.544 1.00 134.23 ? 89   DA  a C2    1 
ATOM   7741  N  N3    . DA  I  5  89   ? 244.646 286.958 180.411 1.00 143.16 ? 89   DA  a N3    1 
ATOM   7742  C  C4    . DA  I  5  89   ? 245.341 286.413 181.419 1.00 139.39 ? 89   DA  a C4    1 
ATOM   7743  P  P     . DA  I  5  90   ? 246.110 281.173 177.623 1.00 126.36 ? 90   DA  a P     1 
ATOM   7744  O  OP1   . DA  I  5  90   ? 245.769 279.735 177.568 1.00 119.04 ? 90   DA  a OP1   1 
ATOM   7745  O  OP2   . DA  I  5  90   ? 247.500 281.589 177.914 1.00 128.44 ? 90   DA  a OP2   1 
ATOM   7746  O  "O5'" . DA  I  5  90   ? 245.673 281.862 176.252 1.00 135.74 ? 90   DA  a "O5'" 1 
ATOM   7747  C  "C5'" . DA  I  5  90   ? 244.296 282.087 175.986 1.00 129.91 ? 90   DA  a "C5'" 1 
ATOM   7748  C  "C4'" . DA  I  5  90   ? 244.084 283.416 175.281 1.00 122.57 ? 90   DA  a "C4'" 1 
ATOM   7749  O  "O4'" . DA  I  5  90   ? 244.282 284.507 176.219 1.00 120.38 ? 90   DA  a "O4'" 1 
ATOM   7750  C  "C3'" . DA  I  5  90   ? 245.025 283.689 174.115 1.00 110.29 ? 90   DA  a "C3'" 1 
ATOM   7751  O  "O3'" . DA  I  5  90   ? 244.327 284.375 173.091 1.00 104.63 ? 90   DA  a "O3'" 1 
ATOM   7752  C  "C2'" . DA  I  5  90   ? 246.108 284.561 174.744 1.00 104.22 ? 90   DA  a "C2'" 1 
ATOM   7753  C  "C1'" . DA  I  5  90   ? 245.312 285.361 175.763 1.00 114.39 ? 90   DA  a "C1'" 1 
ATOM   7754  N  N9    . DA  I  5  90   ? 246.091 285.781 176.926 1.00 134.51 ? 90   DA  a N9    1 
ATOM   7755  C  C8    . DA  I  5  90   ? 246.685 284.969 177.849 1.00 138.67 ? 90   DA  a C8    1 
ATOM   7756  N  N7    . DA  I  5  90   ? 247.309 285.617 178.804 1.00 134.05 ? 90   DA  a N7    1 
ATOM   7757  C  C5    . DA  I  5  90   ? 247.109 286.948 178.488 1.00 136.39 ? 90   DA  a C5    1 
ATOM   7758  C  C6    . DA  I  5  90   ? 247.517 288.142 179.113 1.00 136.32 ? 90   DA  a C6    1 
ATOM   7759  N  N6    . DA  I  5  90   ? 248.251 288.172 180.230 1.00 118.47 ? 90   DA  a N6    1 
ATOM   7760  N  N1    . DA  I  5  90   ? 247.153 289.305 178.538 1.00 130.41 ? 90   DA  a N1    1 
ATOM   7761  C  C2    . DA  I  5  90   ? 246.417 289.270 177.421 1.00 127.57 ? 90   DA  a C2    1 
ATOM   7762  N  N3    . DA  I  5  90   ? 245.975 288.211 176.741 1.00 134.02 ? 90   DA  a N3    1 
ATOM   7763  C  C4    . DA  I  5  90   ? 246.364 287.070 177.330 1.00 136.01 ? 90   DA  a C4    1 
ATOM   7764  P  P     . DC  I  5  91   ? 244.974 284.516 171.630 1.00 126.04 ? 91   DC  a P     1 
ATOM   7765  O  OP1   . DC  I  5  91   ? 243.869 284.522 170.647 1.00 125.72 ? 91   DC  a OP1   1 
ATOM   7766  O  OP2   . DC  I  5  91   ? 246.058 283.516 171.521 1.00 108.55 ? 91   DC  a OP2   1 
ATOM   7767  O  "O5'" . DC  I  5  91   ? 245.644 285.965 171.656 1.00 130.95 ? 91   DC  a "O5'" 1 
ATOM   7768  C  "C5'" . DC  I  5  91   ? 244.885 287.085 172.090 1.00 122.81 ? 91   DC  a "C5'" 1 
ATOM   7769  C  "C4'" . DC  I  5  91   ? 245.728 288.346 172.068 1.00 123.87 ? 91   DC  a "C4'" 1 
ATOM   7770  O  "O4'" . DC  I  5  91   ? 246.364 288.540 173.363 1.00 134.47 ? 91   DC  a "O4'" 1 
ATOM   7771  C  "C3'" . DC  I  5  91   ? 246.860 288.350 171.044 1.00 122.19 ? 91   DC  a "C3'" 1 
ATOM   7772  O  "O3'" . DC  I  5  91   ? 246.984 289.644 170.493 1.00 124.49 ? 91   DC  a "O3'" 1 
ATOM   7773  C  "C2'" . DC  I  5  91   ? 248.075 287.996 171.897 1.00 121.44 ? 91   DC  a "C2'" 1 
ATOM   7774  C  "C1'" . DC  I  5  91   ? 247.741 288.755 173.165 1.00 127.54 ? 91   DC  a "C1'" 1 
ATOM   7775  N  N1    . DC  I  5  91   ? 248.476 288.293 174.379 1.00 129.60 ? 91   DC  a N1    1 
ATOM   7776  C  C2    . DC  I  5  91   ? 249.067 289.239 175.219 1.00 143.33 ? 91   DC  a C2    1 
ATOM   7777  O  O2    . DC  I  5  91   ? 248.980 290.436 174.922 1.00 161.79 ? 91   DC  a O2    1 
ATOM   7778  N  N3    . DC  I  5  91   ? 249.733 288.816 176.322 1.00 142.03 ? 91   DC  a N3    1 
ATOM   7779  C  C4    . DC  I  5  91   ? 249.805 287.511 176.595 1.00 146.20 ? 91   DC  a C4    1 
ATOM   7780  N  N4    . DC  I  5  91   ? 250.466 287.137 177.695 1.00 152.90 ? 91   DC  a N4    1 
ATOM   7781  C  C5    . DC  I  5  91   ? 249.203 286.532 175.752 1.00 129.62 ? 91   DC  a C5    1 
ATOM   7782  C  C6    . DC  I  5  91   ? 248.557 286.965 174.662 1.00 125.08 ? 91   DC  a C6    1 
ATOM   7783  P  P     . DC  I  5  92   ? 247.341 289.843 168.942 1.00 150.49 ? 92   DC  a P     1 
ATOM   7784  O  OP1   . DC  I  5  92   ? 246.098 290.239 168.243 1.00 131.40 ? 92   DC  a OP1   1 
ATOM   7785  O  OP2   . DC  I  5  92   ? 248.095 288.652 168.493 1.00 155.57 ? 92   DC  a OP2   1 
ATOM   7786  O  "O5'" . DC  I  5  92   ? 248.348 291.083 168.953 1.00 144.16 ? 92   DC  a "O5'" 1 
ATOM   7787  C  "C5'" . DC  I  5  92   ? 248.153 292.141 169.883 1.00 138.01 ? 92   DC  a "C5'" 1 
ATOM   7788  C  "C4'" . DC  I  5  92   ? 249.485 292.698 170.347 1.00 146.94 ? 92   DC  a "C4'" 1 
ATOM   7789  O  "O4'" . DC  I  5  92   ? 249.905 292.027 171.567 1.00 145.14 ? 92   DC  a "O4'" 1 
ATOM   7790  C  "C3'" . DC  I  5  92   ? 250.635 292.523 169.349 1.00 155.91 ? 92   DC  a "C3'" 1 
ATOM   7791  O  "O3'" . DC  I  5  92   ? 251.366 293.733 169.239 1.00 170.86 ? 92   DC  a "O3'" 1 
ATOM   7792  C  "C2'" . DC  I  5  92   ? 251.477 291.422 169.985 1.00 149.12 ? 92   DC  a "C2'" 1 
ATOM   7793  C  "C1'" . DC  I  5  92   ? 251.272 291.721 171.456 1.00 153.18 ? 92   DC  a "C1'" 1 
ATOM   7794  N  N1    . DC  I  5  92   ? 251.599 290.574 172.350 1.00 150.83 ? 92   DC  a N1    1 
ATOM   7795  C  C2    . DC  I  5  92   ? 252.322 290.796 173.529 1.00 149.70 ? 92   DC  a C2    1 
ATOM   7796  O  O2    . DC  I  5  92   ? 252.679 291.946 173.802 1.00 143.50 ? 92   DC  a O2    1 
ATOM   7797  N  N3    . DC  I  5  92   ? 252.631 289.736 174.318 1.00 154.53 ? 92   DC  a N3    1 
ATOM   7798  C  C4    . DC  I  5  92   ? 252.239 288.511 173.969 1.00 150.78 ? 92   DC  a C4    1 
ATOM   7799  N  N4    . DC  I  5  92   ? 252.548 287.496 174.782 1.00 152.90 ? 92   DC  a N4    1 
ATOM   7800  C  C5    . DC  I  5  92   ? 251.495 288.270 172.779 1.00 134.72 ? 92   DC  a C5    1 
ATOM   7801  C  C6    . DC  I  5  92   ? 251.212 289.319 172.002 1.00 142.26 ? 92   DC  a C6    1 
ATOM   7802  P  P     . DG  I  5  93   ? 252.348 293.980 167.990 1.00 168.41 ? 93   DG  a P     1 
ATOM   7803  O  OP1   . DG  I  5  93   ? 251.503 294.209 166.799 1.00 167.35 ? 93   DG  a OP1   1 
ATOM   7804  O  OP2   . DG  I  5  93   ? 253.366 292.905 167.971 1.00 151.60 ? 93   DG  a OP2   1 
ATOM   7805  O  "O5'" . DG  I  5  93   ? 253.092 295.342 168.366 1.00 172.01 ? 93   DG  a "O5'" 1 
ATOM   7806  C  "C5'" . DG  I  5  93   ? 253.168 295.754 169.725 1.00 167.04 ? 93   DG  a "C5'" 1 
ATOM   7807  C  "C4'" . DG  I  5  93   ? 254.477 295.315 170.357 1.00 167.88 ? 93   DG  a "C4'" 1 
ATOM   7808  O  "O4'" . DG  I  5  93   ? 254.271 294.128 171.143 1.00 174.67 ? 93   DG  a "O4'" 1 
ATOM   7809  C  "C3'" . DG  I  5  93   ? 255.580 294.940 169.371 1.00 169.15 ? 93   DG  a "C3'" 1 
ATOM   7810  O  "O3'" . DG  I  5  93   ? 256.456 296.044 169.169 1.00 179.35 ? 93   DG  a "O3'" 1 
ATOM   7811  C  "C2'" . DG  I  5  93   ? 256.306 293.761 170.045 1.00 167.67 ? 93   DG  a "C2'" 1 
ATOM   7812  C  "C1'" . DG  I  5  93   ? 255.526 293.537 171.342 1.00 171.55 ? 93   DG  a "C1'" 1 
ATOM   7813  N  N9    . DG  I  5  93   ? 255.350 292.125 171.669 1.00 163.17 ? 93   DG  a N9    1 
ATOM   7814  C  C8    . DG  I  5  93   ? 254.645 291.192 170.953 1.00 159.83 ? 93   DG  a C8    1 
ATOM   7815  N  N7    . DG  I  5  93   ? 254.671 289.999 171.483 1.00 151.65 ? 93   DG  a N7    1 
ATOM   7816  C  C5    . DG  I  5  93   ? 255.454 290.152 172.619 1.00 161.84 ? 93   DG  a C5    1 
ATOM   7817  C  C6    . DG  I  5  93   ? 255.848 289.199 173.585 1.00 164.65 ? 93   DG  a C6    1 
ATOM   7818  O  O6    . DG  I  5  93   ? 255.553 287.997 173.643 1.00 173.52 ? 93   DG  a O6    1 
ATOM   7819  N  N1    . DG  I  5  93   ? 256.639 289.770 174.580 1.00 151.16 ? 93   DG  a N1    1 
ATOM   7820  C  C2    . DG  I  5  93   ? 257.006 291.093 174.627 1.00 147.23 ? 93   DG  a C2    1 
ATOM   7821  N  N2    . DG  I  5  93   ? 257.789 291.463 175.650 1.00 132.43 ? 93   DG  a N2    1 
ATOM   7822  N  N3    . DG  I  5  93   ? 256.661 291.992 173.714 1.00 156.28 ? 93   DG  a N3    1 
ATOM   7823  C  C4    . DG  I  5  93   ? 255.881 291.453 172.746 1.00 160.32 ? 93   DG  a C4    1 
ATOM   7824  P  P     . DC  I  5  94   ? 257.700 295.915 168.157 1.00 175.28 ? 94   DC  a P     1 
ATOM   7825  O  OP1   . DC  I  5  94   ? 258.096 297.284 167.759 1.00 161.90 ? 94   DC  a OP1   1 
ATOM   7826  O  OP2   . DC  I  5  94   ? 257.334 294.927 167.121 1.00 171.34 ? 94   DC  a OP2   1 
ATOM   7827  O  "O5'" . DC  I  5  94   ? 258.864 295.280 169.054 1.00 184.76 ? 94   DC  a "O5'" 1 
ATOM   7828  C  "C5'" . DC  I  5  94   ? 259.235 295.902 170.280 1.00 183.77 ? 94   DC  a "C5'" 1 
ATOM   7829  C  "C4'" . DC  I  5  94   ? 260.040 294.955 171.155 1.00 178.64 ? 94   DC  a "C4'" 1 
ATOM   7830  O  "O4'" . DC  I  5  94   ? 259.250 293.796 171.471 1.00 173.90 ? 94   DC  a "O4'" 1 
ATOM   7831  C  "C3'" . DC  I  5  94   ? 261.306 294.400 170.513 1.00 183.31 ? 94   DC  a "C3'" 1 
ATOM   7832  O  "O3'" . DC  I  5  94   ? 262.433 295.178 170.906 1.00 192.09 ? 94   DC  a "O3'" 1 
ATOM   7833  C  "C2'" . DC  I  5  94   ? 261.406 292.960 171.051 1.00 180.22 ? 94   DC  a "C2'" 1 
ATOM   7834  C  "C1'" . DC  I  5  94   ? 260.125 292.774 171.871 1.00 176.40 ? 94   DC  a "C1'" 1 
ATOM   7835  N  N1    . DC  I  5  94   ? 259.459 291.453 171.650 1.00 172.70 ? 94   DC  a N1    1 
ATOM   7836  C  C2    . DC  I  5  94   ? 259.732 290.386 172.516 1.00 171.19 ? 94   DC  a C2    1 
ATOM   7837  O  O2    . DC  I  5  94   ? 260.545 290.551 173.432 1.00 176.59 ? 94   DC  a O2    1 
ATOM   7838  N  N3    . DC  I  5  94   ? 259.131 289.189 172.290 1.00 163.79 ? 94   DC  a N3    1 
ATOM   7839  C  C4    . DC  I  5  94   ? 258.281 289.050 171.270 1.00 165.55 ? 94   DC  a C4    1 
ATOM   7840  N  N4    . DC  I  5  94   ? 257.692 287.863 171.099 1.00 164.33 ? 94   DC  a N4    1 
ATOM   7841  C  C5    . DC  I  5  94   ? 257.975 290.135 170.396 1.00 171.45 ? 94   DC  a C5    1 
ATOM   7842  C  C6    . DC  I  5  94   ? 258.586 291.300 170.616 1.00 168.65 ? 94   DC  a C6    1 
ATOM   7843  P  P     . DC  I  5  95   ? 263.842 295.007 170.150 1.00 210.06 ? 95   DC  a P     1 
ATOM   7844  O  OP1   . DC  I  5  95   ? 264.676 296.179 170.493 1.00 207.49 ? 95   DC  a OP1   1 
ATOM   7845  O  OP2   . DC  I  5  95   ? 263.560 294.696 168.731 1.00 195.98 ? 95   DC  a OP2   1 
ATOM   7846  O  "O5'" . DC  I  5  95   ? 264.485 293.704 170.818 1.00 200.33 ? 95   DC  a "O5'" 1 
ATOM   7847  C  "C5'" . DC  I  5  95   ? 264.763 293.683 172.215 1.00 195.58 ? 95   DC  a "C5'" 1 
ATOM   7848  C  "C4'" . DC  I  5  95   ? 265.151 292.286 172.667 1.00 183.29 ? 95   DC  a "C4'" 1 
ATOM   7849  O  "O4'" . DC  I  5  95   ? 264.010 291.414 172.574 1.00 184.41 ? 95   DC  a "O4'" 1 
ATOM   7850  C  "C3'" . DC  I  5  95   ? 266.248 291.625 171.834 1.00 180.12 ? 95   DC  a "C3'" 1 
ATOM   7851  O  "O3'" . DC  I  5  95   ? 267.479 291.642 172.547 1.00 185.74 ? 95   DC  a "O3'" 1 
ATOM   7852  C  "C2'" . DC  I  5  95   ? 265.751 290.186 171.600 1.00 175.93 ? 95   DC  a "C2'" 1 
ATOM   7853  C  "C1'" . DC  I  5  95   ? 264.466 290.096 172.424 1.00 183.19 ? 95   DC  a "C1'" 1 
ATOM   7854  N  N1    . DC  I  5  95   ? 263.392 289.299 171.762 1.00 180.77 ? 95   DC  a N1    1 
ATOM   7855  C  C2    . DC  I  5  95   ? 263.148 287.977 172.162 1.00 177.17 ? 95   DC  a C2    1 
ATOM   7856  O  O2    . DC  I  5  95   ? 263.845 287.483 173.055 1.00 176.07 ? 95   DC  a O2    1 
ATOM   7857  N  N3    . DC  I  5  95   ? 262.173 287.271 171.534 1.00 172.76 ? 95   DC  a N3    1 
ATOM   7858  C  C4    . DC  I  5  95   ? 261.460 287.839 170.558 1.00 168.91 ? 95   DC  a C4    1 
ATOM   7859  N  N4    . DC  I  5  95   ? 260.495 287.118 169.979 1.00 169.65 ? 95   DC  a N4    1 
ATOM   7860  C  C5    . DC  I  5  95   ? 261.683 289.186 170.154 1.00 162.08 ? 95   DC  a C5    1 
ATOM   7861  C  C6    . DC  I  5  95   ? 262.650 289.867 170.771 1.00 168.89 ? 95   DC  a C6    1 
ATOM   7862  P  P     . DA  I  5  96   ? 268.847 291.232 171.810 1.00 178.55 ? 96   DA  a P     1 
ATOM   7863  O  OP1   . DA  I  5  96   ? 269.960 291.890 172.531 1.00 176.26 ? 96   DA  a OP1   1 
ATOM   7864  O  OP2   . DA  I  5  96   ? 268.665 291.465 170.360 1.00 177.93 ? 96   DA  a OP2   1 
ATOM   7865  O  "O5'" . DA  I  5  96   ? 268.947 289.651 172.040 1.00 197.86 ? 96   DA  a "O5'" 1 
ATOM   7866  C  "C5'" . DA  I  5  96   ? 268.977 289.128 173.359 1.00 191.77 ? 96   DA  a "C5'" 1 
ATOM   7867  C  "C4'" . DA  I  5  96   ? 268.808 287.620 173.343 1.00 180.64 ? 96   DA  a "C4'" 1 
ATOM   7868  O  "O4'" . DA  I  5  96   ? 267.471 287.286 172.901 1.00 173.92 ? 96   DA  a "O4'" 1 
ATOM   7869  C  "C3'" . DA  I  5  96   ? 269.770 286.870 172.413 1.00 169.12 ? 96   DA  a "C3'" 1 
ATOM   7870  O  "O3'" . DA  I  5  96   ? 270.533 285.925 173.154 1.00 173.97 ? 96   DA  a "O3'" 1 
ATOM   7871  C  "C2'" . DA  I  5  96   ? 268.853 286.181 171.394 1.00 156.92 ? 96   DA  a "C2'" 1 
ATOM   7872  C  "C1'" . DA  I  5  96   ? 267.528 286.114 172.133 1.00 158.58 ? 96   DA  a "C1'" 1 
ATOM   7873  N  N9    . DA  I  5  96   ? 266.380 286.091 171.236 1.00 168.71 ? 96   DA  a N9    1 
ATOM   7874  C  C8    . DA  I  5  96   ? 265.920 287.117 170.462 1.00 171.56 ? 96   DA  a C8    1 
ATOM   7875  N  N7    . DA  I  5  96   ? 264.868 286.811 169.747 1.00 167.26 ? 96   DA  a N7    1 
ATOM   7876  C  C5    . DA  I  5  96   ? 264.623 285.487 170.067 1.00 164.61 ? 96   DA  a C5    1 
ATOM   7877  C  C6    . DA  I  5  96   ? 263.644 284.577 169.638 1.00 168.66 ? 96   DA  a C6    1 
ATOM   7878  N  N6    . DA  I  5  96   ? 262.689 284.892 168.760 1.00 171.50 ? 96   DA  a N6    1 
ATOM   7879  N  N1    . DA  I  5  96   ? 263.679 283.331 170.154 1.00 165.72 ? 96   DA  a N1    1 
ATOM   7880  C  C2    . DA  I  5  96   ? 264.634 283.026 171.042 1.00 149.65 ? 96   DA  a C2    1 
ATOM   7881  N  N3    . DA  I  5  96   ? 265.613 283.796 171.513 1.00 159.37 ? 96   DA  a N3    1 
ATOM   7882  C  C4    . DA  I  5  96   ? 265.549 285.026 170.983 1.00 167.69 ? 96   DA  a C4    1 
ATOM   7883  P  P     . DA  I  5  97   ? 271.852 285.260 172.519 1.00 173.08 ? 97   DA  a P     1 
ATOM   7884  O  OP1   . DA  I  5  97   ? 273.017 285.788 173.260 1.00 178.41 ? 97   DA  a OP1   1 
ATOM   7885  O  OP2   . DA  I  5  97   ? 271.801 285.410 171.047 1.00 158.18 ? 97   DA  a OP2   1 
ATOM   7886  O  "O5'" . DA  I  5  97   ? 271.685 283.706 172.858 1.00 168.04 ? 97   DA  a "O5'" 1 
ATOM   7887  C  "C5'" . DA  I  5  97   ? 270.403 283.104 172.773 1.00 170.51 ? 97   DA  a "C5'" 1 
ATOM   7888  C  "C4'" . DA  I  5  97   ? 270.501 281.591 172.811 1.00 166.77 ? 97   DA  a "C4'" 1 
ATOM   7889  O  "O4'" . DA  I  5  97   ? 269.348 281.031 172.150 1.00 155.46 ? 97   DA  a "O4'" 1 
ATOM   7890  C  "C3'" . DA  I  5  97   ? 271.683 281.007 172.059 1.00 161.64 ? 97   DA  a "C3'" 1 
ATOM   7891  O  "O3'" . DA  I  5  97   ? 271.959 279.692 172.534 1.00 157.11 ? 97   DA  a "O3'" 1 
ATOM   7892  C  "C2'" . DA  I  5  97   ? 271.168 280.988 170.622 1.00 162.29 ? 97   DA  a "C2'" 1 
ATOM   7893  C  "C1'" . DA  I  5  97   ? 269.666 280.749 170.800 1.00 163.58 ? 97   DA  a "C1'" 1 
ATOM   7894  N  N9    . DA  I  5  97   ? 268.850 281.602 169.941 1.00 145.52 ? 97   DA  a N9    1 
ATOM   7895  C  C8    . DA  I  5  97   ? 269.054 282.925 169.665 1.00 147.50 ? 97   DA  a C8    1 
ATOM   7896  N  N7    . DA  I  5  97   ? 268.165 283.440 168.852 1.00 146.95 ? 97   DA  a N7    1 
ATOM   7897  C  C5    . DA  I  5  97   ? 267.318 282.382 168.574 1.00 148.67 ? 97   DA  a C5    1 
ATOM   7898  C  C6    . DA  I  5  97   ? 266.170 282.278 167.768 1.00 160.92 ? 97   DA  a C6    1 
ATOM   7899  N  N6    . DA  I  5  97   ? 265.665 283.300 167.074 1.00 160.79 ? 97   DA  a N6    1 
ATOM   7900  N  N1    . DA  I  5  97   ? 265.555 281.076 167.705 1.00 175.03 ? 97   DA  a N1    1 
ATOM   7901  C  C2    . DA  I  5  97   ? 266.065 280.055 168.403 1.00 171.52 ? 97   DA  a C2    1 
ATOM   7902  N  N3    . DA  I  5  97   ? 267.140 280.034 169.193 1.00 157.64 ? 97   DA  a N3    1 
ATOM   7903  C  C4    . DA  I  5  97   ? 267.725 281.241 169.236 1.00 149.23 ? 97   DA  a C4    1 
ATOM   7904  P  P     . DG  I  5  98   ? 273.040 278.765 171.788 1.00 151.43 ? 98   DG  a P     1 
ATOM   7905  O  OP1   . DG  I  5  98   ? 273.542 277.784 172.774 1.00 160.10 ? 98   DG  a OP1   1 
ATOM   7906  O  OP2   . DG  I  5  98   ? 273.996 279.645 171.082 1.00 151.24 ? 98   DG  a OP2   1 
ATOM   7907  O  "O5'" . DG  I  5  98   ? 272.178 277.987 170.686 1.00 173.14 ? 98   DG  a "O5'" 1 
ATOM   7908  C  "C5'" . DG  I  5  98   ? 270.995 277.294 171.073 1.00 163.69 ? 98   DG  a "C5'" 1 
ATOM   7909  C  "C4'" . DG  I  5  98   ? 270.323 276.650 169.872 1.00 153.79 ? 98   DG  a "C4'" 1 
ATOM   7910  O  "O4'" . DG  I  5  98   ? 269.549 277.644 169.143 1.00 142.01 ? 98   DG  a "O4'" 1 
ATOM   7911  C  "C3'" . DG  I  5  98   ? 271.275 276.030 168.849 1.00 148.93 ? 98   DG  a "C3'" 1 
ATOM   7912  O  "O3'" . DG  I  5  98   ? 270.698 274.839 168.321 1.00 149.48 ? 98   DG  a "O3'" 1 
ATOM   7913  C  "C2'" . DG  I  5  98   ? 271.353 277.120 167.784 1.00 143.21 ? 98   DG  a "C2'" 1 
ATOM   7914  C  "C1'" . DG  I  5  98   ? 269.909 277.585 167.781 1.00 142.74 ? 98   DG  a "C1'" 1 
ATOM   7915  N  N9    . DG  I  5  98   ? 269.693 278.897 167.177 1.00 139.27 ? 98   DG  a N9    1 
ATOM   7916  C  C8    . DG  I  5  98   ? 270.437 280.036 167.368 1.00 145.92 ? 98   DG  a C8    1 
ATOM   7917  N  N7    . DG  I  5  98   ? 269.991 281.063 166.697 1.00 142.81 ? 98   DG  a N7    1 
ATOM   7918  C  C5    . DG  I  5  98   ? 268.880 280.574 166.022 1.00 148.77 ? 98   DG  a C5    1 
ATOM   7919  C  C6    . DG  I  5  98   ? 267.986 281.228 165.140 1.00 164.50 ? 98   DG  a C6    1 
ATOM   7920  O  O6    . DG  I  5  98   ? 268.004 282.408 164.763 1.00 174.43 ? 98   DG  a O6    1 
ATOM   7921  N  N1    . DG  I  5  98   ? 266.996 280.367 164.675 1.00 165.14 ? 98   DG  a N1    1 
ATOM   7922  C  C2    . DG  I  5  98   ? 266.883 279.041 165.023 1.00 159.58 ? 98   DG  a C2    1 
ATOM   7923  N  N2    . DG  I  5  98   ? 265.861 278.362 164.484 1.00 156.88 ? 98   DG  a N2    1 
ATOM   7924  N  N3    . DG  I  5  98   ? 267.711 278.420 165.851 1.00 144.44 ? 98   DG  a N3    1 
ATOM   7925  C  C4    . DG  I  5  98   ? 268.682 279.244 166.308 1.00 139.35 ? 98   DG  a C4    1 
ATOM   7926  P  P     . DG  I  5  99   ? 270.958 273.418 169.027 1.00 153.05 ? 99   DG  a P     1 
ATOM   7927  O  OP1   . DG  I  5  99   ? 270.501 273.511 170.432 1.00 144.64 ? 99   DG  a OP1   1 
ATOM   7928  O  OP2   . DG  I  5  99   ? 272.352 273.023 168.731 1.00 149.71 ? 99   DG  a OP2   1 
ATOM   7929  O  "O5'" . DG  I  5  99   ? 269.988 272.417 168.241 1.00 152.50 ? 99   DG  a "O5'" 1 
ATOM   7930  C  "C5'" . DG  I  5  99   ? 268.575 272.629 168.250 1.00 152.00 ? 99   DG  a "C5'" 1 
ATOM   7931  C  "C4'" . DG  I  5  99   ? 267.970 272.420 166.866 1.00 154.18 ? 99   DG  a "C4'" 1 
ATOM   7932  O  "O4'" . DG  I  5  99   ? 268.020 273.664 166.115 1.00 158.24 ? 99   DG  a "O4'" 1 
ATOM   7933  C  "C3'" . DG  I  5  99   ? 268.675 271.395 165.984 1.00 155.41 ? 99   DG  a "C3'" 1 
ATOM   7934  O  "O3'" . DG  I  5  99   ? 267.744 270.850 165.061 1.00 155.39 ? 99   DG  a "O3'" 1 
ATOM   7935  C  "C2'" . DG  I  5  99   ? 269.683 272.272 165.256 1.00 151.60 ? 99   DG  a "C2'" 1 
ATOM   7936  C  "C1'" . DG  I  5  99   ? 268.802 273.472 164.951 1.00 152.57 ? 99   DG  a "C1'" 1 
ATOM   7937  N  N9    . DG  I  5  99   ? 269.535 274.700 164.682 1.00 139.80 ? 99   DG  a N9    1 
ATOM   7938  C  C8    . DG  I  5  99   ? 270.770 275.050 165.167 1.00 138.95 ? 99   DG  a C8    1 
ATOM   7939  N  N7    . DG  I  5  99   ? 271.170 276.223 164.762 1.00 152.69 ? 99   DG  a N7    1 
ATOM   7940  C  C5    . DG  I  5  99   ? 270.132 276.680 163.962 1.00 152.54 ? 99   DG  a C5    1 
ATOM   7941  C  C6    . DG  I  5  99   ? 269.989 277.903 163.269 1.00 147.74 ? 99   DG  a C6    1 
ATOM   7942  O  O6    . DG  I  5  99   ? 270.802 278.834 163.185 1.00 138.41 ? 99   DG  a O6    1 
ATOM   7943  N  N1    . DG  I  5  99   ? 268.793 277.956 162.562 1.00 155.94 ? 99   DG  a N1    1 
ATOM   7944  C  C2    . DG  I  5  99   ? 267.841 276.964 162.548 1.00 166.69 ? 99   DG  a C2    1 
ATOM   7945  N  N2    . DG  I  5  99   ? 266.730 277.209 161.842 1.00 179.21 ? 99   DG  a N2    1 
ATOM   7946  N  N3    . DG  I  5  99   ? 267.946 275.831 163.229 1.00 155.52 ? 99   DG  a N3    1 
ATOM   7947  C  C4    . DG  I  5  99   ? 269.122 275.750 163.897 1.00 150.18 ? 99   DG  a C4    1 
ATOM   7948  P  P     . DG  I  5  100  ? 266.939 269.500 165.394 1.00 145.45 ? 100  DG  a P     1 
ATOM   7949  O  OP1   . DG  I  5  100  ? 266.179 269.717 166.645 1.00 149.78 ? 100  DG  a OP1   1 
ATOM   7950  O  OP2   . DG  I  5  100  ? 267.887 268.369 165.290 1.00 142.91 ? 100  DG  a OP2   1 
ATOM   7951  O  "O5'" . DG  I  5  100  ? 265.899 269.383 164.183 1.00 141.76 ? 100  DG  a "O5'" 1 
ATOM   7952  C  "C5'" . DG  I  5  100  ? 264.861 270.347 164.048 1.00 124.58 ? 100  DG  a "C5'" 1 
ATOM   7953  C  "C4'" . DG  I  5  100  ? 264.849 270.955 162.654 1.00 120.75 ? 100  DG  a "C4'" 1 
ATOM   7954  O  "O4'" . DG  I  5  100  ? 265.912 271.938 162.529 1.00 126.69 ? 100  DG  a "O4'" 1 
ATOM   7955  C  "C3'" . DG  I  5  100  ? 265.056 269.966 161.502 1.00 124.71 ? 100  DG  a "C3'" 1 
ATOM   7956  O  "O3'" . DG  I  5  100  ? 264.177 270.296 160.438 1.00 126.68 ? 100  DG  a "O3'" 1 
ATOM   7957  C  "C2'" . DG  I  5  100  ? 266.510 270.212 161.108 1.00 120.86 ? 100  DG  a "C2'" 1 
ATOM   7958  C  "C1'" . DG  I  5  100  ? 266.597 271.709 161.321 1.00 129.32 ? 100  DG  a "C1'" 1 
ATOM   7959  N  N9    . DG  I  5  100  ? 267.958 272.219 161.441 1.00 139.50 ? 100  DG  a N9    1 
ATOM   7960  C  C8    . DG  I  5  100  ? 269.009 271.632 162.099 1.00 139.75 ? 100  DG  a C8    1 
ATOM   7961  N  N7    . DG  I  5  100  ? 270.111 272.329 162.042 1.00 140.82 ? 100  DG  a N7    1 
ATOM   7962  C  C5    . DG  I  5  100  ? 269.769 273.447 161.294 1.00 140.57 ? 100  DG  a C5    1 
ATOM   7963  C  C6    . DG  I  5  100  ? 270.551 274.559 160.905 1.00 148.75 ? 100  DG  a C6    1 
ATOM   7964  O  O6    . DG  I  5  100  ? 271.747 274.776 161.141 1.00 164.78 ? 100  DG  a O6    1 
ATOM   7965  N  N1    . DG  I  5  100  ? 269.815 275.466 160.146 1.00 141.89 ? 100  DG  a N1    1 
ATOM   7966  C  C2    . DG  I  5  100  ? 268.487 275.321 159.820 1.00 135.78 ? 100  DG  a C2    1 
ATOM   7967  N  N2    . DG  I  5  100  ? 267.938 276.298 159.084 1.00 129.77 ? 100  DG  a N2    1 
ATOM   7968  N  N3    . DG  I  5  100  ? 267.744 274.286 160.185 1.00 136.87 ? 100  DG  a N3    1 
ATOM   7969  C  C4    . DG  I  5  100  ? 268.449 273.389 160.910 1.00 140.25 ? 100  DG  a C4    1 
ATOM   7970  P  P     . DG  I  5  101  ? 263.782 269.204 159.330 1.00 106.83 ? 101  DG  a P     1 
ATOM   7971  O  OP1   . DG  I  5  101  ? 262.522 268.569 159.770 1.00 100.37 ? 101  DG  a OP1   1 
ATOM   7972  O  OP2   . DG  I  5  101  ? 264.969 268.369 159.047 1.00 112.60 ? 101  DG  a OP2   1 
ATOM   7973  O  "O5'" . DG  I  5  101  ? 263.478 270.082 158.031 1.00 108.59 ? 101  DG  a "O5'" 1 
ATOM   7974  C  "C5'" . DG  I  5  101  ? 262.530 271.139 158.100 1.00 106.00 ? 101  DG  a "C5'" 1 
ATOM   7975  C  "C4'" . DG  I  5  101  ? 262.920 272.283 157.179 1.00 110.04 ? 101  DG  a "C4'" 1 
ATOM   7976  O  "O4'" . DG  I  5  101  ? 264.189 272.842 157.606 1.00 124.41 ? 101  DG  a "O4'" 1 
ATOM   7977  C  "C3'" . DG  I  5  101  ? 263.099 271.902 155.713 1.00 108.56 ? 101  DG  a "C3'" 1 
ATOM   7978  O  "O3'" . DG  I  5  101  ? 262.640 272.959 154.885 1.00 114.72 ? 101  DG  a "O3'" 1 
ATOM   7979  C  "C2'" . DG  I  5  101  ? 264.608 271.715 155.595 1.00 101.99 ? 101  DG  a "C2'" 1 
ATOM   7980  C  "C1'" . DG  I  5  101  ? 265.119 272.789 156.542 1.00 115.85 ? 101  DG  a "C1'" 1 
ATOM   7981  N  N9    . DG  I  5  101  ? 266.437 272.504 157.104 1.00 125.51 ? 101  DG  a N9    1 
ATOM   7982  C  C8    . DG  I  5  101  ? 266.776 271.450 157.916 1.00 131.94 ? 101  DG  a C8    1 
ATOM   7983  N  N7    . DG  I  5  101  ? 268.030 271.455 158.276 1.00 134.70 ? 101  DG  a N7    1 
ATOM   7984  C  C5    . DG  I  5  101  ? 268.554 272.585 157.665 1.00 132.45 ? 101  DG  a C5    1 
ATOM   7985  C  C6    . DG  I  5  101  ? 269.869 273.108 157.696 1.00 136.40 ? 101  DG  a C6    1 
ATOM   7986  O  O6    . DG  I  5  101  ? 270.861 272.655 158.284 1.00 136.79 ? 101  DG  a O6    1 
ATOM   7987  N  N1    . DG  I  5  101  ? 269.979 274.272 156.938 1.00 143.78 ? 101  DG  a N1    1 
ATOM   7988  C  C2    . DG  I  5  101  ? 268.946 274.859 156.246 1.00 148.60 ? 101  DG  a C2    1 
ATOM   7989  N  N2    . DG  I  5  101  ? 269.234 275.979 155.570 1.00 156.40 ? 101  DG  a N2    1 
ATOM   7990  N  N3    . DG  I  5  101  ? 267.708 274.377 156.211 1.00 137.05 ? 101  DG  a N3    1 
ATOM   7991  C  C4    . DG  I  5  101  ? 267.588 273.242 156.939 1.00 128.52 ? 101  DG  a C4    1 
ATOM   7992  P  P     . DA  I  5  102  ? 262.097 272.651 153.405 1.00 141.33 ? 102  DA  a P     1 
ATOM   7993  O  OP1   . DA  I  5  102  ? 260.884 273.472 153.193 1.00 132.18 ? 102  DA  a OP1   1 
ATOM   7994  O  OP2   . DA  I  5  102  ? 262.030 271.182 153.248 1.00 132.27 ? 102  DA  a OP2   1 
ATOM   7995  O  "O5'" . DA  I  5  102  ? 263.262 273.193 152.452 1.00 133.17 ? 102  DA  a "O5'" 1 
ATOM   7996  C  "C5'" . DA  I  5  102  ? 263.596 274.577 152.455 1.00 134.40 ? 102  DA  a "C5'" 1 
ATOM   7997  C  "C4'" . DA  I  5  102  ? 265.000 274.791 151.922 1.00 144.44 ? 102  DA  a "C4'" 1 
ATOM   7998  O  "O4'" . DA  I  5  102  ? 265.956 274.395 152.919 1.00 151.66 ? 102  DA  a "O4'" 1 
ATOM   7999  C  "C3'" . DA  I  5  102  ? 265.342 273.974 150.680 1.00 149.70 ? 102  DA  a "C3'" 1 
ATOM   8000  O  "O3'" . DA  I  5  102  ? 265.297 274.798 149.524 1.00 159.36 ? 102  DA  a "O3'" 1 
ATOM   8001  C  "C2'" . DA  I  5  102  ? 266.762 273.443 150.936 1.00 138.19 ? 102  DA  a "C2'" 1 
ATOM   8002  C  "C1'" . DA  I  5  102  ? 267.155 274.056 152.278 1.00 146.96 ? 102  DA  a "C1'" 1 
ATOM   8003  N  N9    . DA  I  5  102  ? 267.892 273.137 153.139 1.00 141.65 ? 102  DA  a N9    1 
ATOM   8004  C  C8    . DA  I  5  102  ? 267.393 272.045 153.789 1.00 131.29 ? 102  DA  a C8    1 
ATOM   8005  N  N7    . DA  I  5  102  ? 268.286 271.396 154.499 1.00 131.30 ? 102  DA  a N7    1 
ATOM   8006  C  C5    . DA  I  5  102  ? 269.451 272.114 154.300 1.00 142.62 ? 102  DA  a C5    1 
ATOM   8007  C  C6    . DA  I  5  102  ? 270.763 271.941 154.782 1.00 144.22 ? 102  DA  a C6    1 
ATOM   8008  N  N6    . DA  I  5  102  ? 271.119 270.945 155.599 1.00 150.58 ? 102  DA  a N6    1 
ATOM   8009  N  N1    . DA  I  5  102  ? 271.695 272.834 154.394 1.00 147.66 ? 102  DA  a N1    1 
ATOM   8010  C  C2    . DA  I  5  102  ? 271.330 273.834 153.580 1.00 148.66 ? 102  DA  a C2    1 
ATOM   8011  N  N3    . DA  I  5  102  ? 270.131 274.096 153.060 1.00 151.20 ? 102  DA  a N3    1 
ATOM   8012  C  C4    . DA  I  5  102  ? 269.228 273.189 153.462 1.00 149.10 ? 102  DA  a C4    1 
ATOM   8013  P  P     . DT  I  5  103  ? 265.503 274.155 148.067 1.00 152.56 ? 103  DT  a P     1 
ATOM   8014  O  OP1   . DT  I  5  103  ? 264.826 275.030 147.087 1.00 151.64 ? 103  DT  a OP1   1 
ATOM   8015  O  OP2   . DT  I  5  103  ? 265.130 272.726 148.153 1.00 141.39 ? 103  DT  a OP2   1 
ATOM   8016  O  "O5'" . DT  I  5  103  ? 267.082 274.236 147.830 1.00 149.12 ? 103  DT  a "O5'" 1 
ATOM   8017  C  "C5'" . DT  I  5  103  ? 267.751 275.487 147.926 1.00 152.39 ? 103  DT  a "C5'" 1 
ATOM   8018  C  "C4'" . DT  I  5  103  ? 269.254 275.290 147.984 1.00 163.18 ? 103  DT  a "C4'" 1 
ATOM   8019  O  "O4'" . DT  I  5  103  ? 269.590 274.536 149.162 1.00 162.26 ? 103  DT  a "O4'" 1