data_6V96
# 
_entry.id   6V96 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.336 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6V96         
WWPDB D_1000245801 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6V96 
_pdbx_database_status.recvd_initial_deposition_date   2019-12-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zheng, Y.'       1 ? 
'Hussien, R.'     2 ? 
'Alghamdi, M.A.'  3 ? 
'Ballicora, M.A.' 4 ? 
'Liu, D.'         5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
;Site directed mutagenesis of Serine-72 reveals  
the location of the fructose 6-phosphate regulatory site of the Agrobacterium tumefaciens ADP-glucose pyrophosphorylase
;
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Alghamdi, M.A.'  1 ? 
primary 'Hussien, R.'     2 ? 
primary 'Zheng, Y.'       3 ? 
primary 'Patel, H.P.'     4 ? 
primary 'Iglesias, A.A.'  5 ? 
primary 'Liu, D.'         6 ? 
primary 'Ballicora, M.A.' 7 ? 
# 
_cell.angle_alpha                  107.926 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   101.725 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  89.970 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6V96 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     93.607 
_cell.length_a_esd                 ? 
_cell.length_b                     141.187 
_cell.length_b_esd                 ? 
_cell.length_c                     229.427 
_cell.length_c_esd                 ? 
_cell.volume                       2818469.402 
_cell.volume_esd                   ? 
_cell.Z_PDB                        20 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6V96 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            'P 1' 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucose-1-phosphate adenylyltransferase' 49314.543 20   2.7.7.27 S72E ? ? 
2 non-polymer syn 'CITRIC ACID'                             192.124   20   ?        ?    ? ? 
3 non-polymer syn GLYCEROL                                  92.094    22   ?        ?    ? ? 
4 water       nat water                                     18.015    7860 ?        ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ADP-glucose pyrophosphorylase,ADPGlc PPase,ADP-glucose synthase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMSEKRVQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIR
RIGVATQYKAHELIRHLQRGWDFFRPERNESFDILPASQRVSETQWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKM
DYEYMLQQHVDSGADVTIGCLEVPRMEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFLMEAL
RRDAADPTSSRDFGKDIIPYIVEHGKAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPIW
TYAEITPPAKFVHDDEDRRGSAVSSVVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHG
VVIPEGLIVGEDPELDAKRFRRTESGICLITQSMIDKLDL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMSEKRVQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIR
RIGVATQYKAHELIRHLQRGWDFFRPERNESFDILPASQRVSETQWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKM
DYEYMLQQHVDSGADVTIGCLEVPRMEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFLMEAL
RRDAADPTSSRDFGKDIIPYIVEHGKAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPIW
TYAEITPPAKFVHDDEDRRGSAVSSVVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHG
VVIPEGLIVGEDPELDAKRFRRTESGICLITQSMIDKLDL
;
_entity_poly.pdbx_strand_id                 H,A,B,C,D,E,F,G,I,J,K,L,M,N,O,P,Q,R,V,T 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  SER n 
1 23  GLU n 
1 24  LYS n 
1 25  ARG n 
1 26  VAL n 
1 27  GLN n 
1 28  PRO n 
1 29  LEU n 
1 30  ALA n 
1 31  ARG n 
1 32  ASP n 
1 33  ALA n 
1 34  MET n 
1 35  ALA n 
1 36  TYR n 
1 37  VAL n 
1 38  LEU n 
1 39  ALA n 
1 40  GLY n 
1 41  GLY n 
1 42  ARG n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  LEU n 
1 47  LYS n 
1 48  GLU n 
1 49  LEU n 
1 50  THR n 
1 51  ASP n 
1 52  ARG n 
1 53  ARG n 
1 54  ALA n 
1 55  LYS n 
1 56  PRO n 
1 57  ALA n 
1 58  VAL n 
1 59  TYR n 
1 60  PHE n 
1 61  GLY n 
1 62  GLY n 
1 63  LYS n 
1 64  ALA n 
1 65  ARG n 
1 66  ILE n 
1 67  ILE n 
1 68  ASP n 
1 69  PHE n 
1 70  ALA n 
1 71  LEU n 
1 72  SER n 
1 73  ASN n 
1 74  ALA n 
1 75  LEU n 
1 76  ASN n 
1 77  SER n 
1 78  GLY n 
1 79  ILE n 
1 80  ARG n 
1 81  ARG n 
1 82  ILE n 
1 83  GLY n 
1 84  VAL n 
1 85  ALA n 
1 86  THR n 
1 87  GLN n 
1 88  TYR n 
1 89  LYS n 
1 90  ALA n 
1 91  HIS n 
1 92  GLU n 
1 93  LEU n 
1 94  ILE n 
1 95  ARG n 
1 96  HIS n 
1 97  LEU n 
1 98  GLN n 
1 99  ARG n 
1 100 GLY n 
1 101 TRP n 
1 102 ASP n 
1 103 PHE n 
1 104 PHE n 
1 105 ARG n 
1 106 PRO n 
1 107 GLU n 
1 108 ARG n 
1 109 ASN n 
1 110 GLU n 
1 111 SER n 
1 112 PHE n 
1 113 ASP n 
1 114 ILE n 
1 115 LEU n 
1 116 PRO n 
1 117 ALA n 
1 118 SER n 
1 119 GLN n 
1 120 ARG n 
1 121 VAL n 
1 122 SER n 
1 123 GLU n 
1 124 THR n 
1 125 GLN n 
1 126 TRP n 
1 127 TYR n 
1 128 GLU n 
1 129 GLY n 
1 130 THR n 
1 131 ALA n 
1 132 ASP n 
1 133 ALA n 
1 134 VAL n 
1 135 TYR n 
1 136 GLN n 
1 137 ASN n 
1 138 ILE n 
1 139 ASP n 
1 140 ILE n 
1 141 ILE n 
1 142 GLU n 
1 143 PRO n 
1 144 TYR n 
1 145 ALA n 
1 146 PRO n 
1 147 GLU n 
1 148 TYR n 
1 149 MET n 
1 150 VAL n 
1 151 ILE n 
1 152 LEU n 
1 153 ALA n 
1 154 GLY n 
1 155 ASP n 
1 156 HIS n 
1 157 ILE n 
1 158 TYR n 
1 159 LYS n 
1 160 MET n 
1 161 ASP n 
1 162 TYR n 
1 163 GLU n 
1 164 TYR n 
1 165 MET n 
1 166 LEU n 
1 167 GLN n 
1 168 GLN n 
1 169 HIS n 
1 170 VAL n 
1 171 ASP n 
1 172 SER n 
1 173 GLY n 
1 174 ALA n 
1 175 ASP n 
1 176 VAL n 
1 177 THR n 
1 178 ILE n 
1 179 GLY n 
1 180 CYS n 
1 181 LEU n 
1 182 GLU n 
1 183 VAL n 
1 184 PRO n 
1 185 ARG n 
1 186 MET n 
1 187 GLU n 
1 188 ALA n 
1 189 THR n 
1 190 GLY n 
1 191 PHE n 
1 192 GLY n 
1 193 VAL n 
1 194 MET n 
1 195 HIS n 
1 196 VAL n 
1 197 ASN n 
1 198 GLU n 
1 199 LYS n 
1 200 ASP n 
1 201 GLU n 
1 202 ILE n 
1 203 ILE n 
1 204 ASP n 
1 205 PHE n 
1 206 ILE n 
1 207 GLU n 
1 208 LYS n 
1 209 PRO n 
1 210 ALA n 
1 211 ASP n 
1 212 PRO n 
1 213 PRO n 
1 214 GLY n 
1 215 ILE n 
1 216 PRO n 
1 217 GLY n 
1 218 ASN n 
1 219 GLU n 
1 220 GLY n 
1 221 PHE n 
1 222 ALA n 
1 223 LEU n 
1 224 ALA n 
1 225 SER n 
1 226 MET n 
1 227 GLY n 
1 228 ILE n 
1 229 TYR n 
1 230 VAL n 
1 231 PHE n 
1 232 HIS n 
1 233 THR n 
1 234 LYS n 
1 235 PHE n 
1 236 LEU n 
1 237 MET n 
1 238 GLU n 
1 239 ALA n 
1 240 LEU n 
1 241 ARG n 
1 242 ARG n 
1 243 ASP n 
1 244 ALA n 
1 245 ALA n 
1 246 ASP n 
1 247 PRO n 
1 248 THR n 
1 249 SER n 
1 250 SER n 
1 251 ARG n 
1 252 ASP n 
1 253 PHE n 
1 254 GLY n 
1 255 LYS n 
1 256 ASP n 
1 257 ILE n 
1 258 ILE n 
1 259 PRO n 
1 260 TYR n 
1 261 ILE n 
1 262 VAL n 
1 263 GLU n 
1 264 HIS n 
1 265 GLY n 
1 266 LYS n 
1 267 ALA n 
1 268 VAL n 
1 269 ALA n 
1 270 HIS n 
1 271 ARG n 
1 272 PHE n 
1 273 ALA n 
1 274 ASP n 
1 275 SER n 
1 276 CYS n 
1 277 VAL n 
1 278 ARG n 
1 279 SER n 
1 280 ASP n 
1 281 PHE n 
1 282 GLU n 
1 283 HIS n 
1 284 GLU n 
1 285 PRO n 
1 286 TYR n 
1 287 TRP n 
1 288 ARG n 
1 289 ASP n 
1 290 VAL n 
1 291 GLY n 
1 292 THR n 
1 293 ILE n 
1 294 ASP n 
1 295 ALA n 
1 296 TYR n 
1 297 TRP n 
1 298 GLN n 
1 299 ALA n 
1 300 ASN n 
1 301 ILE n 
1 302 ASP n 
1 303 LEU n 
1 304 THR n 
1 305 ASP n 
1 306 VAL n 
1 307 VAL n 
1 308 PRO n 
1 309 ASP n 
1 310 LEU n 
1 311 ASP n 
1 312 ILE n 
1 313 TYR n 
1 314 ASP n 
1 315 LYS n 
1 316 SER n 
1 317 TRP n 
1 318 PRO n 
1 319 ILE n 
1 320 TRP n 
1 321 THR n 
1 322 TYR n 
1 323 ALA n 
1 324 GLU n 
1 325 ILE n 
1 326 THR n 
1 327 PRO n 
1 328 PRO n 
1 329 ALA n 
1 330 LYS n 
1 331 PHE n 
1 332 VAL n 
1 333 HIS n 
1 334 ASP n 
1 335 ASP n 
1 336 GLU n 
1 337 ASP n 
1 338 ARG n 
1 339 ARG n 
1 340 GLY n 
1 341 SER n 
1 342 ALA n 
1 343 VAL n 
1 344 SER n 
1 345 SER n 
1 346 VAL n 
1 347 VAL n 
1 348 SER n 
1 349 GLY n 
1 350 ASP n 
1 351 CYS n 
1 352 ILE n 
1 353 ILE n 
1 354 SER n 
1 355 GLY n 
1 356 ALA n 
1 357 ALA n 
1 358 LEU n 
1 359 ASN n 
1 360 ARG n 
1 361 SER n 
1 362 LEU n 
1 363 LEU n 
1 364 PHE n 
1 365 THR n 
1 366 GLY n 
1 367 VAL n 
1 368 ARG n 
1 369 ALA n 
1 370 ASN n 
1 371 SER n 
1 372 TYR n 
1 373 SER n 
1 374 ARG n 
1 375 LEU n 
1 376 GLU n 
1 377 ASN n 
1 378 ALA n 
1 379 VAL n 
1 380 VAL n 
1 381 LEU n 
1 382 PRO n 
1 383 SER n 
1 384 VAL n 
1 385 LYS n 
1 386 ILE n 
1 387 GLY n 
1 388 ARG n 
1 389 HIS n 
1 390 ALA n 
1 391 GLN n 
1 392 LEU n 
1 393 SER n 
1 394 ASN n 
1 395 VAL n 
1 396 VAL n 
1 397 ILE n 
1 398 ASP n 
1 399 HIS n 
1 400 GLY n 
1 401 VAL n 
1 402 VAL n 
1 403 ILE n 
1 404 PRO n 
1 405 GLU n 
1 406 GLY n 
1 407 LEU n 
1 408 ILE n 
1 409 VAL n 
1 410 GLY n 
1 411 GLU n 
1 412 ASP n 
1 413 PRO n 
1 414 GLU n 
1 415 LEU n 
1 416 ASP n 
1 417 ALA n 
1 418 LYS n 
1 419 ARG n 
1 420 PHE n 
1 421 ARG n 
1 422 ARG n 
1 423 THR n 
1 424 GLU n 
1 425 SER n 
1 426 GLY n 
1 427 ILE n 
1 428 CYS n 
1 429 LEU n 
1 430 ILE n 
1 431 THR n 
1 432 GLN n 
1 433 SER n 
1 434 MET n 
1 435 ILE n 
1 436 ASP n 
1 437 LYS n 
1 438 LEU n 
1 439 ASP n 
1 440 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   440 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'glgC, Atu4076, AGR_L_1560' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'C58 / ATCC 33970' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Agrobacterium fabrum (strain C58 / ATCC 33970)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     176299 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GLGC_AGRFC 
_struct_ref.pdbx_db_accession          Q8U8L5 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSEKRVQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRG
WDFFRPERNESFDILPASQRVSETQWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKMDYEYMLQQHVDSGADVTIGC
LEVPRMEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFLMEALRRDAADPTSSRDFGKDIIPY
IVEHGKAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPIWTYAEITPPAKFVHDDEDRRG
SAVSSVVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHGVVIPEGLIVGEDPELDAKRF
RRTESGICLITQSMIDKLDL
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6V96 H 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
2  1 6V96 A 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
3  1 6V96 B 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
4  1 6V96 C 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
5  1 6V96 D 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
6  1 6V96 E 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
7  1 6V96 F 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
8  1 6V96 G 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
9  1 6V96 I 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
10 1 6V96 J 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
11 1 6V96 K 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
12 1 6V96 L 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
13 1 6V96 M 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
14 1 6V96 N 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
15 1 6V96 O 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
16 1 6V96 P 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
17 1 6V96 Q 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
18 1 6V96 R 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
19 1 6V96 V 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
20 1 6V96 T 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  6V96 MET H 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 1   
1  6V96 GLY H 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 2   
1  6V96 SER H 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 3   
1  6V96 SER H 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 4   
1  6V96 HIS H 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 5   
1  6V96 HIS H 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 6   
1  6V96 HIS H 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 7   
1  6V96 HIS H 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 8   
1  6V96 HIS H 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 9   
1  6V96 HIS H 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 10  
1  6V96 SER H 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  11  
1  6V96 SER H 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  12  
1  6V96 GLY H 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  13  
1  6V96 LEU H 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  14  
1  6V96 VAL H 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  15  
1  6V96 PRO H 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  16  
1  6V96 ARG H 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  17  
1  6V96 GLY H 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  18  
1  6V96 SER H 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  19  
1  6V96 HIS H 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   20  
1  6V96 GLU H 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  21  
2  6V96 MET A 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 22  
2  6V96 GLY A 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 23  
2  6V96 SER A 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 24  
2  6V96 SER A 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 25  
2  6V96 HIS A 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 26  
2  6V96 HIS A 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 27  
2  6V96 HIS A 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 28  
2  6V96 HIS A 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 29  
2  6V96 HIS A 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 30  
2  6V96 HIS A 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 31  
2  6V96 SER A 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  32  
2  6V96 SER A 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  33  
2  6V96 GLY A 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  34  
2  6V96 LEU A 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  35  
2  6V96 VAL A 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  36  
2  6V96 PRO A 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  37  
2  6V96 ARG A 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  38  
2  6V96 GLY A 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  39  
2  6V96 SER A 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  40  
2  6V96 HIS A 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   41  
2  6V96 GLU A 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  42  
3  6V96 MET B 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 43  
3  6V96 GLY B 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 44  
3  6V96 SER B 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 45  
3  6V96 SER B 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 46  
3  6V96 HIS B 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 47  
3  6V96 HIS B 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 48  
3  6V96 HIS B 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 49  
3  6V96 HIS B 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 50  
3  6V96 HIS B 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 51  
3  6V96 HIS B 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 52  
3  6V96 SER B 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  53  
3  6V96 SER B 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  54  
3  6V96 GLY B 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  55  
3  6V96 LEU B 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  56  
3  6V96 VAL B 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  57  
3  6V96 PRO B 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  58  
3  6V96 ARG B 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  59  
3  6V96 GLY B 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  60  
3  6V96 SER B 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  61  
3  6V96 HIS B 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   62  
3  6V96 GLU B 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  63  
4  6V96 MET C 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 64  
4  6V96 GLY C 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 65  
4  6V96 SER C 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 66  
4  6V96 SER C 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 67  
4  6V96 HIS C 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 68  
4  6V96 HIS C 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 69  
4  6V96 HIS C 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 70  
4  6V96 HIS C 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 71  
4  6V96 HIS C 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 72  
4  6V96 HIS C 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 73  
4  6V96 SER C 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  74  
4  6V96 SER C 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  75  
4  6V96 GLY C 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  76  
4  6V96 LEU C 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  77  
4  6V96 VAL C 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  78  
4  6V96 PRO C 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  79  
4  6V96 ARG C 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  80  
4  6V96 GLY C 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  81  
4  6V96 SER C 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  82  
4  6V96 HIS C 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   83  
4  6V96 GLU C 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  84  
5  6V96 MET D 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 85  
5  6V96 GLY D 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 86  
5  6V96 SER D 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 87  
5  6V96 SER D 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 88  
5  6V96 HIS D 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 89  
5  6V96 HIS D 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 90  
5  6V96 HIS D 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 91  
5  6V96 HIS D 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 92  
5  6V96 HIS D 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 93  
5  6V96 HIS D 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 94  
5  6V96 SER D 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  95  
5  6V96 SER D 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  96  
5  6V96 GLY D 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  97  
5  6V96 LEU D 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  98  
5  6V96 VAL D 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  99  
5  6V96 PRO D 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  100 
5  6V96 ARG D 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  101 
5  6V96 GLY D 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  102 
5  6V96 SER D 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  103 
5  6V96 HIS D 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   104 
5  6V96 GLU D 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  105 
6  6V96 MET E 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 106 
6  6V96 GLY E 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 107 
6  6V96 SER E 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 108 
6  6V96 SER E 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 109 
6  6V96 HIS E 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 110 
6  6V96 HIS E 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 111 
6  6V96 HIS E 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 112 
6  6V96 HIS E 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 113 
6  6V96 HIS E 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 114 
6  6V96 HIS E 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 115 
6  6V96 SER E 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  116 
6  6V96 SER E 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  117 
6  6V96 GLY E 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  118 
6  6V96 LEU E 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  119 
6  6V96 VAL E 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  120 
6  6V96 PRO E 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  121 
6  6V96 ARG E 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  122 
6  6V96 GLY E 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  123 
6  6V96 SER E 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  124 
6  6V96 HIS E 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   125 
6  6V96 GLU E 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  126 
7  6V96 MET F 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 127 
7  6V96 GLY F 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 128 
7  6V96 SER F 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 129 
7  6V96 SER F 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 130 
7  6V96 HIS F 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 131 
7  6V96 HIS F 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 132 
7  6V96 HIS F 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 133 
7  6V96 HIS F 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 134 
7  6V96 HIS F 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 135 
7  6V96 HIS F 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 136 
7  6V96 SER F 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  137 
7  6V96 SER F 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  138 
7  6V96 GLY F 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  139 
7  6V96 LEU F 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  140 
7  6V96 VAL F 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  141 
7  6V96 PRO F 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  142 
7  6V96 ARG F 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  143 
7  6V96 GLY F 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  144 
7  6V96 SER F 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  145 
7  6V96 HIS F 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   146 
7  6V96 GLU F 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  147 
8  6V96 MET G 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 148 
8  6V96 GLY G 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 149 
8  6V96 SER G 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 150 
8  6V96 SER G 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 151 
8  6V96 HIS G 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 152 
8  6V96 HIS G 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 153 
8  6V96 HIS G 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 154 
8  6V96 HIS G 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 155 
8  6V96 HIS G 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 156 
8  6V96 HIS G 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 157 
8  6V96 SER G 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  158 
8  6V96 SER G 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  159 
8  6V96 GLY G 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  160 
8  6V96 LEU G 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  161 
8  6V96 VAL G 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  162 
8  6V96 PRO G 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  163 
8  6V96 ARG G 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  164 
8  6V96 GLY G 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  165 
8  6V96 SER G 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  166 
8  6V96 HIS G 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   167 
8  6V96 GLU G 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  168 
9  6V96 MET I 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 169 
9  6V96 GLY I 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 170 
9  6V96 SER I 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 171 
9  6V96 SER I 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 172 
9  6V96 HIS I 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 173 
9  6V96 HIS I 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 174 
9  6V96 HIS I 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 175 
9  6V96 HIS I 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 176 
9  6V96 HIS I 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 177 
9  6V96 HIS I 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 178 
9  6V96 SER I 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  179 
9  6V96 SER I 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  180 
9  6V96 GLY I 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  181 
9  6V96 LEU I 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  182 
9  6V96 VAL I 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  183 
9  6V96 PRO I 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  184 
9  6V96 ARG I 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  185 
9  6V96 GLY I 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  186 
9  6V96 SER I 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  187 
9  6V96 HIS I 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   188 
9  6V96 GLU I 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  189 
10 6V96 MET J 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 190 
10 6V96 GLY J 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 191 
10 6V96 SER J 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 192 
10 6V96 SER J 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 193 
10 6V96 HIS J 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 194 
10 6V96 HIS J 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 195 
10 6V96 HIS J 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 196 
10 6V96 HIS J 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 197 
10 6V96 HIS J 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 198 
10 6V96 HIS J 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 199 
10 6V96 SER J 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  200 
10 6V96 SER J 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  201 
10 6V96 GLY J 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  202 
10 6V96 LEU J 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  203 
10 6V96 VAL J 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  204 
10 6V96 PRO J 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  205 
10 6V96 ARG J 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  206 
10 6V96 GLY J 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  207 
10 6V96 SER J 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  208 
10 6V96 HIS J 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   209 
10 6V96 GLU J 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  210 
11 6V96 MET K 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 211 
11 6V96 GLY K 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 212 
11 6V96 SER K 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 213 
11 6V96 SER K 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 214 
11 6V96 HIS K 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 215 
11 6V96 HIS K 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 216 
11 6V96 HIS K 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 217 
11 6V96 HIS K 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 218 
11 6V96 HIS K 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 219 
11 6V96 HIS K 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 220 
11 6V96 SER K 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  221 
11 6V96 SER K 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  222 
11 6V96 GLY K 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  223 
11 6V96 LEU K 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  224 
11 6V96 VAL K 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  225 
11 6V96 PRO K 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  226 
11 6V96 ARG K 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  227 
11 6V96 GLY K 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  228 
11 6V96 SER K 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  229 
11 6V96 HIS K 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   230 
11 6V96 GLU K 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  231 
12 6V96 MET L 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 232 
12 6V96 GLY L 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 233 
12 6V96 SER L 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 234 
12 6V96 SER L 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 235 
12 6V96 HIS L 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 236 
12 6V96 HIS L 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 237 
12 6V96 HIS L 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 238 
12 6V96 HIS L 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 239 
12 6V96 HIS L 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 240 
12 6V96 HIS L 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 241 
12 6V96 SER L 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  242 
12 6V96 SER L 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  243 
12 6V96 GLY L 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  244 
12 6V96 LEU L 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  245 
12 6V96 VAL L 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  246 
12 6V96 PRO L 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  247 
12 6V96 ARG L 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  248 
12 6V96 GLY L 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  249 
12 6V96 SER L 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  250 
12 6V96 HIS L 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   251 
12 6V96 GLU L 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  252 
13 6V96 MET M 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 253 
13 6V96 GLY M 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 254 
13 6V96 SER M 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 255 
13 6V96 SER M 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 256 
13 6V96 HIS M 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 257 
13 6V96 HIS M 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 258 
13 6V96 HIS M 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 259 
13 6V96 HIS M 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 260 
13 6V96 HIS M 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 261 
13 6V96 HIS M 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 262 
13 6V96 SER M 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  263 
13 6V96 SER M 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  264 
13 6V96 GLY M 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  265 
13 6V96 LEU M 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  266 
13 6V96 VAL M 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  267 
13 6V96 PRO M 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  268 
13 6V96 ARG M 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  269 
13 6V96 GLY M 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  270 
13 6V96 SER M 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  271 
13 6V96 HIS M 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   272 
13 6V96 GLU M 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  273 
14 6V96 MET N 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 274 
14 6V96 GLY N 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 275 
14 6V96 SER N 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 276 
14 6V96 SER N 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 277 
14 6V96 HIS N 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 278 
14 6V96 HIS N 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 279 
14 6V96 HIS N 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 280 
14 6V96 HIS N 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 281 
14 6V96 HIS N 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 282 
14 6V96 HIS N 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 283 
14 6V96 SER N 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  284 
14 6V96 SER N 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  285 
14 6V96 GLY N 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  286 
14 6V96 LEU N 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  287 
14 6V96 VAL N 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  288 
14 6V96 PRO N 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  289 
14 6V96 ARG N 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  290 
14 6V96 GLY N 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  291 
14 6V96 SER N 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  292 
14 6V96 HIS N 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   293 
14 6V96 GLU N 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  294 
15 6V96 MET O 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 295 
15 6V96 GLY O 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 296 
15 6V96 SER O 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 297 
15 6V96 SER O 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 298 
15 6V96 HIS O 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 299 
15 6V96 HIS O 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 300 
15 6V96 HIS O 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 301 
15 6V96 HIS O 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 302 
15 6V96 HIS O 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 303 
15 6V96 HIS O 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 304 
15 6V96 SER O 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  305 
15 6V96 SER O 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  306 
15 6V96 GLY O 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  307 
15 6V96 LEU O 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  308 
15 6V96 VAL O 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  309 
15 6V96 PRO O 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  310 
15 6V96 ARG O 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  311 
15 6V96 GLY O 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  312 
15 6V96 SER O 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  313 
15 6V96 HIS O 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   314 
15 6V96 GLU O 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  315 
16 6V96 MET P 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 316 
16 6V96 GLY P 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 317 
16 6V96 SER P 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 318 
16 6V96 SER P 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 319 
16 6V96 HIS P 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 320 
16 6V96 HIS P 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 321 
16 6V96 HIS P 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 322 
16 6V96 HIS P 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 323 
16 6V96 HIS P 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 324 
16 6V96 HIS P 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 325 
16 6V96 SER P 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  326 
16 6V96 SER P 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  327 
16 6V96 GLY P 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  328 
16 6V96 LEU P 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  329 
16 6V96 VAL P 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  330 
16 6V96 PRO P 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  331 
16 6V96 ARG P 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  332 
16 6V96 GLY P 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  333 
16 6V96 SER P 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  334 
16 6V96 HIS P 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   335 
16 6V96 GLU P 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  336 
17 6V96 MET Q 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 337 
17 6V96 GLY Q 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 338 
17 6V96 SER Q 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 339 
17 6V96 SER Q 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 340 
17 6V96 HIS Q 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 341 
17 6V96 HIS Q 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 342 
17 6V96 HIS Q 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 343 
17 6V96 HIS Q 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 344 
17 6V96 HIS Q 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 345 
17 6V96 HIS Q 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 346 
17 6V96 SER Q 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  347 
17 6V96 SER Q 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  348 
17 6V96 GLY Q 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  349 
17 6V96 LEU Q 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  350 
17 6V96 VAL Q 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  351 
17 6V96 PRO Q 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  352 
17 6V96 ARG Q 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  353 
17 6V96 GLY Q 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  354 
17 6V96 SER Q 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  355 
17 6V96 HIS Q 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   356 
17 6V96 GLU Q 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  357 
18 6V96 MET R 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 358 
18 6V96 GLY R 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 359 
18 6V96 SER R 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 360 
18 6V96 SER R 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 361 
18 6V96 HIS R 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 362 
18 6V96 HIS R 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 363 
18 6V96 HIS R 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 364 
18 6V96 HIS R 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 365 
18 6V96 HIS R 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 366 
18 6V96 HIS R 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 367 
18 6V96 SER R 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  368 
18 6V96 SER R 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  369 
18 6V96 GLY R 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  370 
18 6V96 LEU R 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  371 
18 6V96 VAL R 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  372 
18 6V96 PRO R 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  373 
18 6V96 ARG R 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  374 
18 6V96 GLY R 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  375 
18 6V96 SER R 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  376 
18 6V96 HIS R 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   377 
18 6V96 GLU R 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  378 
19 6V96 MET V 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 379 
19 6V96 GLY V 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 380 
19 6V96 SER V 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 381 
19 6V96 SER V 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 382 
19 6V96 HIS V 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 383 
19 6V96 HIS V 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 384 
19 6V96 HIS V 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 385 
19 6V96 HIS V 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 386 
19 6V96 HIS V 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 387 
19 6V96 HIS V 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 388 
19 6V96 SER V 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  389 
19 6V96 SER V 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  390 
19 6V96 GLY V 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  391 
19 6V96 LEU V 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  392 
19 6V96 VAL V 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  393 
19 6V96 PRO V 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  394 
19 6V96 ARG V 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  395 
19 6V96 GLY V 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  396 
19 6V96 SER V 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  397 
19 6V96 HIS V 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   398 
19 6V96 GLU V 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  399 
20 6V96 MET T 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 400 
20 6V96 GLY T 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 401 
20 6V96 SER T 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 402 
20 6V96 SER T 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 403 
20 6V96 HIS T 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 404 
20 6V96 HIS T 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 405 
20 6V96 HIS T 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 406 
20 6V96 HIS T 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 407 
20 6V96 HIS T 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 408 
20 6V96 HIS T 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 409 
20 6V96 SER T 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  410 
20 6V96 SER T 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  411 
20 6V96 GLY T 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  412 
20 6V96 LEU T 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  413 
20 6V96 VAL T 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  414 
20 6V96 PRO T 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  415 
20 6V96 ARG T 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  416 
20 6V96 GLY T 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  417 
20 6V96 SER T 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  418 
20 6V96 HIS T 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   419 
20 6V96 GLU T 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  420 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CIT non-polymer         . 'CITRIC ACID'   ?                               'C6 H8 O7'       192.124 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6V96 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.98 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         58.67 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            297 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'Sodium citrate, imidazole' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX300HE' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-02-06 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.978 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.978 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            32.4 
_reflns.entry_id                         6V96 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.79 
_reflns.d_resolution_low                 37.4 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       776640 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             82 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  1.5 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            1.0 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.06 
_reflns.pdbx_Rpim_I_all                  0.042 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.79 
_reflns_shell.d_res_low                   1.83 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           41416 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.604 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               32.4 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6V96 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.8 
_refine.ls_d_res_low                             37.39 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     776639 
_refine.ls_number_reflns_R_free                  38499 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    76.7 
_refine.ls_percent_reflns_R_free                 4.96 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.195 
_refine.ls_R_factor_R_free                       0.2276 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1933 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.96 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5W6J 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.26 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1990 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        37.39 
_refine_hist.number_atoms_solvent             7860 
_refine_hist.number_atoms_total               73154 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        64902 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         392 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0109214215798  ? 67745 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.08852349092    ? 92169 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0691317740712  ? 10018 ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.00740218075811 ? 12152 ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 8.16580110076    ? 55227 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.7996 1.82   . . 409  8822  27.4283167434 . . . 0.3366         . 0.3058         . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.82   1.8414 . . 557  11450 35.4691007917 . . . 0.359555289101 . 0.302482518392 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8414 1.8639 . . 746  14403 44.8420803363 . . . 0.33876484012  . 0.294920815268 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8639 1.8875 . . 1005 18675 58.4531305691 . . . 0.344935677827 . 0.286221124807 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8875 1.9123 . . 1204 22126 68.974692526  . . . 0.314105236742 . 0.265892469139 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9123 1.9385 . . 1124 24147 74.9614380636 . . . 0.291692753537 . 0.261610051344 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9385 1.9662 . . 1255 24874 77.5663480378 . . . 0.288039647571 . 0.249870369078 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9662 1.9956 . . 1280 26237 81.1351909185 . . . 0.278735834336 . 0.242762237846 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9956 2.0267 . . 1360 26618 83.0035304239 . . . 0.274528572867 . 0.226838889296 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0267 2.06   . . 1379 26460 82.9405630865 . . . 0.272551625434 . 0.226643834802 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.06   2.0955 . . 1368 26578 82.441441973  . . . 0.257987094432 . 0.22103123653  . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0955 2.1336 . . 1350 26325 82.1143518381 . . . 0.266628125849 . 0.224840853019 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1336 2.1746 . . 1413 26282 81.5926700645 . . . 0.261750144702 . 0.218542217529 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1746 2.219  . . 1336 25950 81.2397653854 . . . 0.255208211508 . 0.204718624284 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.219  2.2672 . . 1286 25907 80.4288671991 . . . 0.252157021787 . 0.199983560946 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2672 2.32   . . 1397 25593 79.6517633171 . . . 0.247804625279 . 0.199679842676 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.32   2.378  . . 1333 25087 78.8045099326 . . . 0.24786784825  . 0.196941767917 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.378  2.4423 . . 1306 25235 78.3035845995 . . . 0.243807997816 . 0.195983177942 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4423 2.5141 . . 1271 24916 77.5313832307 . . . 0.230858774108 . 0.202008472746 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5141 2.5953 . . 1370 24477 76.5406141728 . . . 0.243766035806 . 0.200775587589 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5953 2.688  . . 1259 24376 76.1586452763 . . . 0.235168813944 . 0.199943633303 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.688  2.7956 . . 1360 24454 76.3660030175 . . . 0.226204299281 . 0.196763204782 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7956 2.9228 . . 1235 24718 76.6683406694 . . . 0.222617211719 . 0.193274145312 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9228 3.0768 . . 1413 25341 79.4264339152 . . . 0.22660468088  . 0.187299170933 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0768 3.2695 . . 1460 27150 84.7377306519 . . . 0.205856136274 . 0.187389806759 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2695 3.5217 . . 1488 29314 91.3653486786 . . . 0.20965581855  . 0.175462906915 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5217 3.8758 . . 1831 30693 96.3788300836 . . . 0.193859242464 . 0.155624708929 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8758 4.4358 . . 1608 31531 97.9748107852 . . . 0.168115165549 . 0.145957168571 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4358 5.5857 . . 1634 31357 97.8380782918 . . . 0.186646760869 . 0.161230036881 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.5857 37.3   . . 1462 29045 90.3215300805 . . . 0.236534770139 . 0.208507494887 . . . . . . . . . . . 
# 
_struct.entry_id                     6V96 
_struct.title                        'Agrobacterium tumefaciens ADP-Glucose pyrophosphorylase-S72E' 
_struct.pdbx_descriptor              'Glucose-1-phosphate adenylyltransferase (E.C.2.7.7.27)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6V96 
_struct_keywords.text            'Allosteric regulation, Fructose 6-phosphate, Glycogen synthesis, enzyme structure, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 1 ? 
R  N N 1 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 2 ? 
V  N N 3 ? 
W  N N 2 ? 
X  N N 3 ? 
Y  N N 2 ? 
Z  N N 3 ? 
AA N N 2 ? 
BA N N 3 ? 
CA N N 2 ? 
DA N N 3 ? 
EA N N 2 ? 
FA N N 3 ? 
GA N N 2 ? 
HA N N 3 ? 
IA N N 2 ? 
JA N N 3 ? 
KA N N 2 ? 
LA N N 3 ? 
MA N N 2 ? 
NA N N 3 ? 
OA N N 3 ? 
PA N N 2 ? 
QA N N 3 ? 
RA N N 3 ? 
SA N N 2 ? 
TA N N 3 ? 
UA N N 2 ? 
VA N N 3 ? 
WA N N 2 ? 
XA N N 3 ? 
YA N N 2 ? 
ZA N N 3 ? 
AB N N 2 ? 
BB N N 3 ? 
CB N N 2 ? 
DB N N 3 ? 
EB N N 2 ? 
FB N N 3 ? 
GB N N 2 ? 
HB N N 3 ? 
IB N N 2 ? 
JB N N 3 ? 
KB N N 4 ? 
LB N N 4 ? 
MB N N 4 ? 
NB N N 4 ? 
OB N N 4 ? 
PB N N 4 ? 
QB N N 4 ? 
RB N N 4 ? 
SB N N 4 ? 
TB N N 4 ? 
UB N N 4 ? 
VB N N 4 ? 
WB N N 4 ? 
XB N N 4 ? 
YB N N 4 ? 
ZB N N 4 ? 
AC N N 4 ? 
BC N N 4 ? 
CC N N 4 ? 
DC N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 PRO A 28  ? ARG A 31  ? PRO H 8   ARG H 11  5 ? 4  
HELX_P HELX_P2   AA2 GLY A 43  ? ASP A 51  ? GLY H 23  ASP H 31  5 ? 9  
HELX_P HELX_P3   AA3 ALA A 54  ? ALA A 57  ? ALA H 34  ALA H 37  5 ? 4  
HELX_P HELX_P4   AA4 ILE A 67  ? SER A 77  ? ILE H 47  SER H 57  1 ? 11 
HELX_P HELX_P5   AA5 ALA A 90  ? TRP A 101 ? ALA H 70  TRP H 81  1 ? 12 
HELX_P HELX_P6   AA6 ARG A 105 ? ASN A 109 ? ARG H 85  ASN H 89  5 ? 5  
HELX_P HELX_P7   AA7 GLY A 129 ? GLN A 136 ? GLY H 109 GLN H 116 1 ? 8  
HELX_P HELX_P8   AA8 ASN A 137 ? GLU A 142 ? ASN H 117 GLU H 122 1 ? 6  
HELX_P HELX_P9   AA9 PRO A 143 ? ALA A 145 ? PRO H 123 ALA H 125 5 ? 3  
HELX_P HELX_P10  AB1 ASP A 161 ? GLY A 173 ? ASP H 141 GLY H 153 1 ? 13 
HELX_P HELX_P11  AB2 ARG A 185 ? THR A 189 ? ARG H 165 THR H 169 1 ? 5  
HELX_P HELX_P12  AB3 THR A 233 ? ASP A 246 ? THR H 213 ASP H 226 1 ? 14 
HELX_P HELX_P13  AB4 ASP A 256 ? GLY A 265 ? ASP H 236 GLY H 245 1 ? 10 
HELX_P HELX_P14  AB5 PHE A 272 ? CYS A 276 ? PHE H 252 CYS H 256 1 ? 5  
HELX_P HELX_P15  AB6 THR A 292 ? ASP A 302 ? THR H 272 ASP H 282 1 ? 11 
HELX_P HELX_P16  AB7 LEU A 303 ? ASP A 305 ? LEU H 283 ASP H 285 5 ? 3  
HELX_P HELX_P17  AB8 ASP A 412 ? PHE A 420 ? ASP H 392 PHE H 400 1 ? 9  
HELX_P HELX_P18  AB9 THR A 431 ? LYS A 437 ? THR H 411 LYS H 417 1 ? 7  
HELX_P HELX_P19  AC1 PRO B 28  ? ARG B 31  ? PRO A 8   ARG A 11  5 ? 4  
HELX_P HELX_P20  AC2 GLY B 43  ? ASP B 51  ? GLY A 23  ASP A 31  5 ? 9  
HELX_P HELX_P21  AC3 ALA B 54  ? ALA B 57  ? ALA A 34  ALA A 37  5 ? 4  
HELX_P HELX_P22  AC4 ILE B 67  ? SER B 77  ? ILE A 47  SER A 57  1 ? 11 
HELX_P HELX_P23  AC5 ALA B 90  ? TRP B 101 ? ALA A 70  TRP A 81  1 ? 12 
HELX_P HELX_P24  AC6 ARG B 105 ? ASN B 109 ? ARG A 85  ASN A 89  5 ? 5  
HELX_P HELX_P25  AC7 GLY B 129 ? GLN B 136 ? GLY A 109 GLN A 116 1 ? 8  
HELX_P HELX_P26  AC8 ASN B 137 ? ALA B 145 ? ASN A 117 ALA A 125 1 ? 9  
HELX_P HELX_P27  AC9 ASP B 161 ? GLY B 173 ? ASP A 141 GLY A 153 1 ? 13 
HELX_P HELX_P28  AD1 MET B 186 ? GLY B 190 ? MET A 166 GLY A 170 5 ? 5  
HELX_P HELX_P29  AD2 THR B 233 ? ASP B 246 ? THR A 213 ASP A 226 1 ? 14 
HELX_P HELX_P30  AD3 ASP B 256 ? GLY B 265 ? ASP A 236 GLY A 245 1 ? 10 
HELX_P HELX_P31  AD4 PHE B 272 ? CYS B 276 ? PHE A 252 CYS A 256 1 ? 5  
HELX_P HELX_P32  AD5 THR B 292 ? ASP B 302 ? THR A 272 ASP A 282 1 ? 11 
HELX_P HELX_P33  AD6 LEU B 303 ? ASP B 305 ? LEU A 283 ASP A 285 5 ? 3  
HELX_P HELX_P34  AD7 ASP B 412 ? PHE B 420 ? ASP A 392 PHE A 400 1 ? 9  
HELX_P HELX_P35  AD8 THR B 431 ? LYS B 437 ? THR A 411 LYS A 417 1 ? 7  
HELX_P HELX_P36  AD9 PRO C 28  ? ARG C 31  ? PRO B 8   ARG B 11  5 ? 4  
HELX_P HELX_P37  AE1 GLY C 43  ? ASP C 51  ? GLY B 23  ASP B 31  5 ? 9  
HELX_P HELX_P38  AE2 ALA C 54  ? ALA C 57  ? ALA B 34  ALA B 37  5 ? 4  
HELX_P HELX_P39  AE3 ILE C 67  ? SER C 77  ? ILE B 47  SER B 57  1 ? 11 
HELX_P HELX_P40  AE4 ALA C 90  ? TRP C 101 ? ALA B 70  TRP B 81  1 ? 12 
HELX_P HELX_P41  AE5 ARG C 105 ? ASN C 109 ? ARG B 85  ASN B 89  5 ? 5  
HELX_P HELX_P42  AE6 GLY C 129 ? GLN C 136 ? GLY B 109 GLN B 116 1 ? 8  
HELX_P HELX_P43  AE7 ASN C 137 ? ALA C 145 ? ASN B 117 ALA B 125 1 ? 9  
HELX_P HELX_P44  AE8 ASP C 161 ? GLY C 173 ? ASP B 141 GLY B 153 1 ? 13 
HELX_P HELX_P45  AE9 MET C 186 ? THR C 189 ? MET B 166 THR B 169 5 ? 4  
HELX_P HELX_P46  AF1 THR C 233 ? ASP C 246 ? THR B 213 ASP B 226 1 ? 14 
HELX_P HELX_P47  AF2 ASP C 256 ? GLY C 265 ? ASP B 236 GLY B 245 1 ? 10 
HELX_P HELX_P48  AF3 PHE C 272 ? CYS C 276 ? PHE B 252 CYS B 256 1 ? 5  
HELX_P HELX_P49  AF4 THR C 292 ? ASP C 302 ? THR B 272 ASP B 282 1 ? 11 
HELX_P HELX_P50  AF5 LEU C 303 ? ASP C 305 ? LEU B 283 ASP B 285 5 ? 3  
HELX_P HELX_P51  AF6 ASP C 412 ? PHE C 420 ? ASP B 392 PHE B 400 1 ? 9  
HELX_P HELX_P52  AF7 THR C 431 ? LYS C 437 ? THR B 411 LYS B 417 1 ? 7  
HELX_P HELX_P53  AF8 PRO D 28  ? ARG D 31  ? PRO C 8   ARG C 11  5 ? 4  
HELX_P HELX_P54  AF9 GLY D 43  ? ASP D 51  ? GLY C 23  ASP C 31  5 ? 9  
HELX_P HELX_P55  AG1 ALA D 54  ? ALA D 57  ? ALA C 34  ALA C 37  5 ? 4  
HELX_P HELX_P56  AG2 ILE D 67  ? SER D 77  ? ILE C 47  SER C 57  1 ? 11 
HELX_P HELX_P57  AG3 ALA D 90  ? TRP D 101 ? ALA C 70  TRP C 81  1 ? 12 
HELX_P HELX_P58  AG4 ARG D 105 ? ASN D 109 ? ARG C 85  ASN C 89  5 ? 5  
HELX_P HELX_P59  AG5 GLY D 129 ? GLN D 136 ? GLY C 109 GLN C 116 1 ? 8  
HELX_P HELX_P60  AG6 ASN D 137 ? ALA D 145 ? ASN C 117 ALA C 125 1 ? 9  
HELX_P HELX_P61  AG7 ASP D 161 ? GLY D 173 ? ASP C 141 GLY C 153 1 ? 13 
HELX_P HELX_P62  AG8 ARG D 185 ? THR D 189 ? ARG C 165 THR C 169 1 ? 5  
HELX_P HELX_P63  AG9 THR D 233 ? ASP D 246 ? THR C 213 ASP C 226 1 ? 14 
HELX_P HELX_P64  AH1 ASP D 256 ? GLY D 265 ? ASP C 236 GLY C 245 1 ? 10 
HELX_P HELX_P65  AH2 PHE D 272 ? CYS D 276 ? PHE C 252 CYS C 256 1 ? 5  
HELX_P HELX_P66  AH3 THR D 292 ? ASP D 302 ? THR C 272 ASP C 282 1 ? 11 
HELX_P HELX_P67  AH4 LEU D 303 ? ASP D 305 ? LEU C 283 ASP C 285 5 ? 3  
HELX_P HELX_P68  AH5 ASP D 412 ? PHE D 420 ? ASP C 392 PHE C 400 1 ? 9  
HELX_P HELX_P69  AH6 THR D 431 ? LYS D 437 ? THR C 411 LYS C 417 1 ? 7  
HELX_P HELX_P70  AH7 PRO E 28  ? ARG E 31  ? PRO D 8   ARG D 11  5 ? 4  
HELX_P HELX_P71  AH8 GLY E 43  ? ASP E 51  ? GLY D 23  ASP D 31  5 ? 9  
HELX_P HELX_P72  AH9 ALA E 54  ? ALA E 57  ? ALA D 34  ALA D 37  5 ? 4  
HELX_P HELX_P73  AI1 ILE E 67  ? SER E 77  ? ILE D 47  SER D 57  1 ? 11 
HELX_P HELX_P74  AI2 ALA E 90  ? TRP E 101 ? ALA D 70  TRP D 81  1 ? 12 
HELX_P HELX_P75  AI3 ARG E 105 ? ASN E 109 ? ARG D 85  ASN D 89  5 ? 5  
HELX_P HELX_P76  AI4 GLY E 129 ? GLN E 136 ? GLY D 109 GLN D 116 1 ? 8  
HELX_P HELX_P77  AI5 ASN E 137 ? GLU E 142 ? ASN D 117 GLU D 122 1 ? 6  
HELX_P HELX_P78  AI6 PRO E 143 ? ALA E 145 ? PRO D 123 ALA D 125 5 ? 3  
HELX_P HELX_P79  AI7 ASP E 161 ? GLY E 173 ? ASP D 141 GLY D 153 1 ? 13 
HELX_P HELX_P80  AI8 MET E 186 ? GLY E 190 ? MET D 166 GLY D 170 5 ? 5  
HELX_P HELX_P81  AI9 THR E 233 ? ASP E 246 ? THR D 213 ASP D 226 1 ? 14 
HELX_P HELX_P82  AJ1 ASP E 256 ? GLY E 265 ? ASP D 236 GLY D 245 1 ? 10 
HELX_P HELX_P83  AJ2 ALA E 273 ? SER E 275 ? ALA D 253 SER D 255 5 ? 3  
HELX_P HELX_P84  AJ3 THR E 292 ? ASP E 302 ? THR D 272 ASP D 282 1 ? 11 
HELX_P HELX_P85  AJ4 LEU E 303 ? ASP E 305 ? LEU D 283 ASP D 285 5 ? 3  
HELX_P HELX_P86  AJ5 ASP E 412 ? PHE E 420 ? ASP D 392 PHE D 400 1 ? 9  
HELX_P HELX_P87  AJ6 THR E 431 ? LYS E 437 ? THR D 411 LYS D 417 1 ? 7  
HELX_P HELX_P88  AJ7 PRO F 28  ? ARG F 31  ? PRO E 8   ARG E 11  5 ? 4  
HELX_P HELX_P89  AJ8 GLY F 43  ? ASP F 51  ? GLY E 23  ASP E 31  5 ? 9  
HELX_P HELX_P90  AJ9 ALA F 54  ? ALA F 57  ? ALA E 34  ALA E 37  5 ? 4  
HELX_P HELX_P91  AK1 ILE F 67  ? SER F 77  ? ILE E 47  SER E 57  1 ? 11 
HELX_P HELX_P92  AK2 ALA F 90  ? TRP F 101 ? ALA E 70  TRP E 81  1 ? 12 
HELX_P HELX_P93  AK3 ARG F 105 ? ASN F 109 ? ARG E 85  ASN E 89  5 ? 5  
HELX_P HELX_P94  AK4 GLY F 129 ? GLN F 136 ? GLY E 109 GLN E 116 1 ? 8  
HELX_P HELX_P95  AK5 ASN F 137 ? ALA F 145 ? ASN E 117 ALA E 125 1 ? 9  
HELX_P HELX_P96  AK6 ASP F 161 ? GLY F 173 ? ASP E 141 GLY E 153 1 ? 13 
HELX_P HELX_P97  AK7 MET F 186 ? GLY F 190 ? MET E 166 GLY E 170 5 ? 5  
HELX_P HELX_P98  AK8 THR F 233 ? ASP F 246 ? THR E 213 ASP E 226 1 ? 14 
HELX_P HELX_P99  AK9 ASP F 256 ? GLY F 265 ? ASP E 236 GLY E 245 1 ? 10 
HELX_P HELX_P100 AL1 PHE F 272 ? CYS F 276 ? PHE E 252 CYS E 256 1 ? 5  
HELX_P HELX_P101 AL2 THR F 292 ? ASP F 302 ? THR E 272 ASP E 282 1 ? 11 
HELX_P HELX_P102 AL3 LEU F 303 ? ASP F 305 ? LEU E 283 ASP E 285 5 ? 3  
HELX_P HELX_P103 AL4 ASP F 412 ? PHE F 420 ? ASP E 392 PHE E 400 1 ? 9  
HELX_P HELX_P104 AL5 THR F 431 ? LYS F 437 ? THR E 411 LYS E 417 1 ? 7  
HELX_P HELX_P105 AL6 PRO G 28  ? ARG G 31  ? PRO F 8   ARG F 11  5 ? 4  
HELX_P HELX_P106 AL7 GLY G 43  ? ASP G 51  ? GLY F 23  ASP F 31  5 ? 9  
HELX_P HELX_P107 AL8 ALA G 54  ? ALA G 57  ? ALA F 34  ALA F 37  5 ? 4  
HELX_P HELX_P108 AL9 ILE G 67  ? SER G 77  ? ILE F 47  SER F 57  1 ? 11 
HELX_P HELX_P109 AM1 ALA G 90  ? TRP G 101 ? ALA F 70  TRP F 81  1 ? 12 
HELX_P HELX_P110 AM2 ARG G 105 ? ASN G 109 ? ARG F 85  ASN F 89  5 ? 5  
HELX_P HELX_P111 AM3 GLY G 129 ? GLN G 136 ? GLY F 109 GLN F 116 1 ? 8  
HELX_P HELX_P112 AM4 ASN G 137 ? ALA G 145 ? ASN F 117 ALA F 125 1 ? 9  
HELX_P HELX_P113 AM5 ASP G 161 ? GLY G 173 ? ASP F 141 GLY F 153 1 ? 13 
HELX_P HELX_P114 AM6 MET G 186 ? GLY G 190 ? MET F 166 GLY F 170 5 ? 5  
HELX_P HELX_P115 AM7 THR G 233 ? ASP G 246 ? THR F 213 ASP F 226 1 ? 14 
HELX_P HELX_P116 AM8 ASP G 256 ? GLY G 265 ? ASP F 236 GLY F 245 1 ? 10 
HELX_P HELX_P117 AM9 PHE G 272 ? CYS G 276 ? PHE F 252 CYS F 256 1 ? 5  
HELX_P HELX_P118 AN1 THR G 292 ? ASP G 302 ? THR F 272 ASP F 282 1 ? 11 
HELX_P HELX_P119 AN2 LEU G 303 ? ASP G 305 ? LEU F 283 ASP F 285 5 ? 3  
HELX_P HELX_P120 AN3 ASP G 412 ? PHE G 420 ? ASP F 392 PHE F 400 1 ? 9  
HELX_P HELX_P121 AN4 THR G 431 ? LYS G 437 ? THR F 411 LYS F 417 1 ? 7  
HELX_P HELX_P122 AN5 PRO H 28  ? ARG H 31  ? PRO G 8   ARG G 11  5 ? 4  
HELX_P HELX_P123 AN6 GLY H 43  ? ASP H 51  ? GLY G 23  ASP G 31  5 ? 9  
HELX_P HELX_P124 AN7 ALA H 54  ? ALA H 57  ? ALA G 34  ALA G 37  5 ? 4  
HELX_P HELX_P125 AN8 ILE H 66  ? SER H 77  ? ILE G 46  SER G 57  1 ? 12 
HELX_P HELX_P126 AN9 ALA H 90  ? TRP H 101 ? ALA G 70  TRP G 81  1 ? 12 
HELX_P HELX_P127 AO1 ARG H 105 ? ASN H 109 ? ARG G 85  ASN G 89  5 ? 5  
HELX_P HELX_P128 AO2 GLY H 129 ? GLN H 136 ? GLY G 109 GLN G 116 1 ? 8  
HELX_P HELX_P129 AO3 ASN H 137 ? GLU H 142 ? ASN G 117 GLU G 122 1 ? 6  
HELX_P HELX_P130 AO4 PRO H 143 ? ALA H 145 ? PRO G 123 ALA G 125 5 ? 3  
HELX_P HELX_P131 AO5 ASP H 161 ? GLY H 173 ? ASP G 141 GLY G 153 1 ? 13 
HELX_P HELX_P132 AO6 ARG H 185 ? THR H 189 ? ARG G 165 THR G 169 1 ? 5  
HELX_P HELX_P133 AO7 THR H 233 ? ASP H 246 ? THR G 213 ASP G 226 1 ? 14 
HELX_P HELX_P134 AO8 ASP H 256 ? GLY H 265 ? ASP G 236 GLY G 245 1 ? 10 
HELX_P HELX_P135 AO9 PHE H 272 ? CYS H 276 ? PHE G 252 CYS G 256 1 ? 5  
HELX_P HELX_P136 AP1 THR H 292 ? ASP H 302 ? THR G 272 ASP G 282 1 ? 11 
HELX_P HELX_P137 AP2 LEU H 303 ? ASP H 305 ? LEU G 283 ASP G 285 5 ? 3  
HELX_P HELX_P138 AP3 ASP H 412 ? PHE H 420 ? ASP G 392 PHE G 400 1 ? 9  
HELX_P HELX_P139 AP4 THR H 431 ? LYS H 437 ? THR G 411 LYS G 417 1 ? 7  
HELX_P HELX_P140 AP5 PRO I 28  ? ARG I 31  ? PRO I 8   ARG I 11  5 ? 4  
HELX_P HELX_P141 AP6 GLY I 43  ? ASP I 51  ? GLY I 23  ASP I 31  5 ? 9  
HELX_P HELX_P142 AP7 ALA I 54  ? ALA I 57  ? ALA I 34  ALA I 37  5 ? 4  
HELX_P HELX_P143 AP8 ILE I 67  ? SER I 77  ? ILE I 47  SER I 57  1 ? 11 
HELX_P HELX_P144 AP9 ALA I 90  ? TRP I 101 ? ALA I 70  TRP I 81  1 ? 12 
HELX_P HELX_P145 AQ1 ARG I 105 ? ASN I 109 ? ARG I 85  ASN I 89  5 ? 5  
HELX_P HELX_P146 AQ2 GLY I 129 ? GLN I 136 ? GLY I 109 GLN I 116 1 ? 8  
HELX_P HELX_P147 AQ3 ASN I 137 ? GLU I 142 ? ASN I 117 GLU I 122 1 ? 6  
HELX_P HELX_P148 AQ4 PRO I 143 ? ALA I 145 ? PRO I 123 ALA I 125 5 ? 3  
HELX_P HELX_P149 AQ5 ASP I 161 ? GLY I 173 ? ASP I 141 GLY I 153 1 ? 13 
HELX_P HELX_P150 AQ6 MET I 186 ? GLY I 190 ? MET I 166 GLY I 170 5 ? 5  
HELX_P HELX_P151 AQ7 THR I 233 ? ASP I 246 ? THR I 213 ASP I 226 1 ? 14 
HELX_P HELX_P152 AQ8 ASP I 256 ? GLY I 265 ? ASP I 236 GLY I 245 1 ? 10 
HELX_P HELX_P153 AQ9 PHE I 272 ? CYS I 276 ? PHE I 252 CYS I 256 1 ? 5  
HELX_P HELX_P154 AR1 THR I 292 ? ASP I 302 ? THR I 272 ASP I 282 1 ? 11 
HELX_P HELX_P155 AR2 LEU I 303 ? ASP I 305 ? LEU I 283 ASP I 285 5 ? 3  
HELX_P HELX_P156 AR3 ASP I 412 ? PHE I 420 ? ASP I 392 PHE I 400 1 ? 9  
HELX_P HELX_P157 AR4 THR I 431 ? LYS I 437 ? THR I 411 LYS I 417 1 ? 7  
HELX_P HELX_P158 AR5 PRO J 28  ? ARG J 31  ? PRO J 8   ARG J 11  5 ? 4  
HELX_P HELX_P159 AR6 GLY J 43  ? ASP J 51  ? GLY J 23  ASP J 31  5 ? 9  
HELX_P HELX_P160 AR7 ALA J 54  ? ALA J 57  ? ALA J 34  ALA J 37  5 ? 4  
HELX_P HELX_P161 AR8 ILE J 67  ? SER J 77  ? ILE J 47  SER J 57  1 ? 11 
HELX_P HELX_P162 AR9 ALA J 90  ? TRP J 101 ? ALA J 70  TRP J 81  1 ? 12 
HELX_P HELX_P163 AS1 ARG J 105 ? ASN J 109 ? ARG J 85  ASN J 89  5 ? 5  
HELX_P HELX_P164 AS2 GLY J 129 ? GLN J 136 ? GLY J 109 GLN J 116 1 ? 8  
HELX_P HELX_P165 AS3 ASN J 137 ? ALA J 145 ? ASN J 117 ALA J 125 1 ? 9  
HELX_P HELX_P166 AS4 ASP J 161 ? GLY J 173 ? ASP J 141 GLY J 153 1 ? 13 
HELX_P HELX_P167 AS5 ARG J 185 ? THR J 189 ? ARG J 165 THR J 169 1 ? 5  
HELX_P HELX_P168 AS6 THR J 233 ? ASP J 246 ? THR J 213 ASP J 226 1 ? 14 
HELX_P HELX_P169 AS7 ASP J 256 ? GLY J 265 ? ASP J 236 GLY J 245 1 ? 10 
HELX_P HELX_P170 AS8 PHE J 272 ? CYS J 276 ? PHE J 252 CYS J 256 1 ? 5  
HELX_P HELX_P171 AS9 THR J 292 ? ASP J 302 ? THR J 272 ASP J 282 1 ? 11 
HELX_P HELX_P172 AT1 LEU J 303 ? ASP J 305 ? LEU J 283 ASP J 285 5 ? 3  
HELX_P HELX_P173 AT2 ASP J 412 ? PHE J 420 ? ASP J 392 PHE J 400 1 ? 9  
HELX_P HELX_P174 AT3 THR J 431 ? LYS J 437 ? THR J 411 LYS J 417 1 ? 7  
HELX_P HELX_P175 AT4 PRO K 28  ? ARG K 31  ? PRO K 8   ARG K 11  5 ? 4  
HELX_P HELX_P176 AT5 GLY K 43  ? ASP K 51  ? GLY K 23  ASP K 31  5 ? 9  
HELX_P HELX_P177 AT6 ALA K 54  ? ALA K 57  ? ALA K 34  ALA K 37  5 ? 4  
HELX_P HELX_P178 AT7 ILE K 67  ? SER K 77  ? ILE K 47  SER K 57  1 ? 11 
HELX_P HELX_P179 AT8 ALA K 90  ? TRP K 101 ? ALA K 70  TRP K 81  1 ? 12 
HELX_P HELX_P180 AT9 ARG K 105 ? ASN K 109 ? ARG K 85  ASN K 89  5 ? 5  
HELX_P HELX_P181 AU1 GLY K 129 ? GLN K 136 ? GLY K 109 GLN K 116 1 ? 8  
HELX_P HELX_P182 AU2 ASN K 137 ? ALA K 145 ? ASN K 117 ALA K 125 1 ? 9  
HELX_P HELX_P183 AU3 ASP K 161 ? GLY K 173 ? ASP K 141 GLY K 153 1 ? 13 
HELX_P HELX_P184 AU4 ARG K 185 ? THR K 189 ? ARG K 165 THR K 169 1 ? 5  
HELX_P HELX_P185 AU5 THR K 233 ? ASP K 246 ? THR K 213 ASP K 226 1 ? 14 
HELX_P HELX_P186 AU6 ASP K 256 ? GLY K 265 ? ASP K 236 GLY K 245 1 ? 10 
HELX_P HELX_P187 AU7 PHE K 272 ? CYS K 276 ? PHE K 252 CYS K 256 1 ? 5  
HELX_P HELX_P188 AU8 THR K 292 ? ASP K 302 ? THR K 272 ASP K 282 1 ? 11 
HELX_P HELX_P189 AU9 LEU K 303 ? ASP K 305 ? LEU K 283 ASP K 285 5 ? 3  
HELX_P HELX_P190 AV1 ASP K 412 ? PHE K 420 ? ASP K 392 PHE K 400 1 ? 9  
HELX_P HELX_P191 AV2 THR K 431 ? LYS K 437 ? THR K 411 LYS K 417 1 ? 7  
HELX_P HELX_P192 AV3 PRO L 28  ? ARG L 31  ? PRO L 8   ARG L 11  5 ? 4  
HELX_P HELX_P193 AV4 GLY L 43  ? ASP L 51  ? GLY L 23  ASP L 31  5 ? 9  
HELX_P HELX_P194 AV5 ALA L 54  ? ALA L 57  ? ALA L 34  ALA L 37  5 ? 4  
HELX_P HELX_P195 AV6 ILE L 66  ? SER L 77  ? ILE L 46  SER L 57  1 ? 12 
HELX_P HELX_P196 AV7 ALA L 90  ? TRP L 101 ? ALA L 70  TRP L 81  1 ? 12 
HELX_P HELX_P197 AV8 ARG L 105 ? ASN L 109 ? ARG L 85  ASN L 89  5 ? 5  
HELX_P HELX_P198 AV9 ALA L 131 ? GLN L 136 ? ALA L 111 GLN L 116 1 ? 6  
HELX_P HELX_P199 AW1 ASN L 137 ? GLU L 142 ? ASN L 117 GLU L 122 1 ? 6  
HELX_P HELX_P200 AW2 ASP L 161 ? GLY L 173 ? ASP L 141 GLY L 153 1 ? 13 
HELX_P HELX_P201 AW3 ARG L 185 ? THR L 189 ? ARG L 165 THR L 169 1 ? 5  
HELX_P HELX_P202 AW4 THR L 233 ? ALA L 245 ? THR L 213 ALA L 225 1 ? 13 
HELX_P HELX_P203 AW5 ASP L 256 ? GLY L 265 ? ASP L 236 GLY L 245 1 ? 10 
HELX_P HELX_P204 AW6 PHE L 272 ? CYS L 276 ? PHE L 252 CYS L 256 1 ? 5  
HELX_P HELX_P205 AW7 THR L 292 ? ASP L 302 ? THR L 272 ASP L 282 1 ? 11 
HELX_P HELX_P206 AW8 LEU L 303 ? ASP L 305 ? LEU L 283 ASP L 285 5 ? 3  
HELX_P HELX_P207 AW9 ASP L 412 ? PHE L 420 ? ASP L 392 PHE L 400 1 ? 9  
HELX_P HELX_P208 AX1 THR L 431 ? LYS L 437 ? THR L 411 LYS L 417 1 ? 7  
HELX_P HELX_P209 AX2 PRO M 28  ? ARG M 31  ? PRO M 8   ARG M 11  5 ? 4  
HELX_P HELX_P210 AX3 GLY M 43  ? ASP M 51  ? GLY M 23  ASP M 31  5 ? 9  
HELX_P HELX_P211 AX4 ALA M 54  ? ALA M 57  ? ALA M 34  ALA M 37  5 ? 4  
HELX_P HELX_P212 AX5 ILE M 67  ? SER M 77  ? ILE M 47  SER M 57  1 ? 11 
HELX_P HELX_P213 AX6 ALA M 90  ? TRP M 101 ? ALA M 70  TRP M 81  1 ? 12 
HELX_P HELX_P214 AX7 ARG M 105 ? ASN M 109 ? ARG M 85  ASN M 89  5 ? 5  
HELX_P HELX_P215 AX8 GLY M 129 ? GLN M 136 ? GLY M 109 GLN M 116 1 ? 8  
HELX_P HELX_P216 AX9 ASN M 137 ? GLU M 142 ? ASN M 117 GLU M 122 1 ? 6  
HELX_P HELX_P217 AY1 PRO M 143 ? ALA M 145 ? PRO M 123 ALA M 125 5 ? 3  
HELX_P HELX_P218 AY2 ASP M 161 ? GLY M 173 ? ASP M 141 GLY M 153 1 ? 13 
HELX_P HELX_P219 AY3 MET M 186 ? GLY M 190 ? MET M 166 GLY M 170 5 ? 5  
HELX_P HELX_P220 AY4 THR M 233 ? ASP M 246 ? THR M 213 ASP M 226 1 ? 14 
HELX_P HELX_P221 AY5 ASP M 256 ? GLY M 265 ? ASP M 236 GLY M 245 1 ? 10 
HELX_P HELX_P222 AY6 PHE M 272 ? CYS M 276 ? PHE M 252 CYS M 256 1 ? 5  
HELX_P HELX_P223 AY7 THR M 292 ? ASP M 302 ? THR M 272 ASP M 282 1 ? 11 
HELX_P HELX_P224 AY8 LEU M 303 ? ASP M 305 ? LEU M 283 ASP M 285 5 ? 3  
HELX_P HELX_P225 AY9 ASP M 412 ? PHE M 420 ? ASP M 392 PHE M 400 1 ? 9  
HELX_P HELX_P226 AZ1 THR M 431 ? LYS M 437 ? THR M 411 LYS M 417 1 ? 7  
HELX_P HELX_P227 AZ2 PRO N 28  ? ARG N 31  ? PRO N 8   ARG N 11  5 ? 4  
HELX_P HELX_P228 AZ3 GLY N 43  ? ASP N 51  ? GLY N 23  ASP N 31  5 ? 9  
HELX_P HELX_P229 AZ4 ALA N 54  ? ALA N 57  ? ALA N 34  ALA N 37  5 ? 4  
HELX_P HELX_P230 AZ5 ILE N 67  ? SER N 77  ? ILE N 47  SER N 57  1 ? 11 
HELX_P HELX_P231 AZ6 ALA N 90  ? TRP N 101 ? ALA N 70  TRP N 81  1 ? 12 
HELX_P HELX_P232 AZ7 ARG N 105 ? ASN N 109 ? ARG N 85  ASN N 89  5 ? 5  
HELX_P HELX_P233 AZ8 GLY N 129 ? GLN N 136 ? GLY N 109 GLN N 116 1 ? 8  
HELX_P HELX_P234 AZ9 ASN N 137 ? ALA N 145 ? ASN N 117 ALA N 125 1 ? 9  
HELX_P HELX_P235 BA1 TYR N 162 ? GLY N 173 ? TYR N 142 GLY N 153 1 ? 12 
HELX_P HELX_P236 BA2 MET N 186 ? GLY N 190 ? MET N 166 GLY N 170 5 ? 5  
HELX_P HELX_P237 BA3 THR N 233 ? ALA N 245 ? THR N 213 ALA N 225 1 ? 13 
HELX_P HELX_P238 BA4 ASP N 256 ? GLY N 265 ? ASP N 236 GLY N 245 1 ? 10 
HELX_P HELX_P239 BA5 PHE N 272 ? CYS N 276 ? PHE N 252 CYS N 256 1 ? 5  
HELX_P HELX_P240 BA6 THR N 292 ? ASP N 302 ? THR N 272 ASP N 282 1 ? 11 
HELX_P HELX_P241 BA7 LEU N 303 ? ASP N 305 ? LEU N 283 ASP N 285 5 ? 3  
HELX_P HELX_P242 BA8 ASP N 412 ? PHE N 420 ? ASP N 392 PHE N 400 1 ? 9  
HELX_P HELX_P243 BA9 THR N 431 ? LYS N 437 ? THR N 411 LYS N 417 1 ? 7  
HELX_P HELX_P244 BB1 PRO O 28  ? ARG O 31  ? PRO O 8   ARG O 11  5 ? 4  
HELX_P HELX_P245 BB2 GLY O 43  ? ASP O 51  ? GLY O 23  ASP O 31  5 ? 9  
HELX_P HELX_P246 BB3 ALA O 54  ? ALA O 57  ? ALA O 34  ALA O 37  5 ? 4  
HELX_P HELX_P247 BB4 ILE O 67  ? SER O 77  ? ILE O 47  SER O 57  1 ? 11 
HELX_P HELX_P248 BB5 ALA O 90  ? TRP O 101 ? ALA O 70  TRP O 81  1 ? 12 
HELX_P HELX_P249 BB6 ARG O 105 ? ASN O 109 ? ARG O 85  ASN O 89  5 ? 5  
HELX_P HELX_P250 BB7 GLY O 129 ? GLN O 136 ? GLY O 109 GLN O 116 1 ? 8  
HELX_P HELX_P251 BB8 ASN O 137 ? GLU O 142 ? ASN O 117 GLU O 122 1 ? 6  
HELX_P HELX_P252 BB9 PRO O 143 ? ALA O 145 ? PRO O 123 ALA O 125 5 ? 3  
HELX_P HELX_P253 BC1 ASP O 161 ? GLY O 173 ? ASP O 141 GLY O 153 1 ? 13 
HELX_P HELX_P254 BC2 MET O 186 ? GLY O 190 ? MET O 166 GLY O 170 5 ? 5  
HELX_P HELX_P255 BC3 THR O 233 ? ASP O 246 ? THR O 213 ASP O 226 1 ? 14 
HELX_P HELX_P256 BC4 ASP O 256 ? GLY O 265 ? ASP O 236 GLY O 245 1 ? 10 
HELX_P HELX_P257 BC5 ALA O 273 ? SER O 275 ? ALA O 253 SER O 255 5 ? 3  
HELX_P HELX_P258 BC6 THR O 292 ? ASP O 302 ? THR O 272 ASP O 282 1 ? 11 
HELX_P HELX_P259 BC7 LEU O 303 ? ASP O 305 ? LEU O 283 ASP O 285 5 ? 3  
HELX_P HELX_P260 BC8 ASP O 412 ? PHE O 420 ? ASP O 392 PHE O 400 1 ? 9  
HELX_P HELX_P261 BC9 THR O 431 ? LYS O 437 ? THR O 411 LYS O 417 1 ? 7  
HELX_P HELX_P262 BD1 PRO P 28  ? ARG P 31  ? PRO P 8   ARG P 11  5 ? 4  
HELX_P HELX_P263 BD2 GLY P 43  ? ASP P 51  ? GLY P 23  ASP P 31  5 ? 9  
HELX_P HELX_P264 BD3 ALA P 54  ? ALA P 57  ? ALA P 34  ALA P 37  5 ? 4  
HELX_P HELX_P265 BD4 ILE P 67  ? SER P 77  ? ILE P 47  SER P 57  1 ? 11 
HELX_P HELX_P266 BD5 ALA P 90  ? TRP P 101 ? ALA P 70  TRP P 81  1 ? 12 
HELX_P HELX_P267 BD6 ARG P 105 ? ASN P 109 ? ARG P 85  ASN P 89  5 ? 5  
HELX_P HELX_P268 BD7 GLY P 129 ? GLN P 136 ? GLY P 109 GLN P 116 1 ? 8  
HELX_P HELX_P269 BD8 ASN P 137 ? ALA P 145 ? ASN P 117 ALA P 125 1 ? 9  
HELX_P HELX_P270 BD9 ASP P 161 ? GLY P 173 ? ASP P 141 GLY P 153 1 ? 13 
HELX_P HELX_P271 BE1 ARG P 185 ? THR P 189 ? ARG P 165 THR P 169 1 ? 5  
HELX_P HELX_P272 BE2 THR P 233 ? ALA P 244 ? THR P 213 ALA P 224 1 ? 12 
HELX_P HELX_P273 BE3 ASP P 256 ? GLY P 265 ? ASP P 236 GLY P 245 1 ? 10 
HELX_P HELX_P274 BE4 PHE P 272 ? CYS P 276 ? PHE P 252 CYS P 256 1 ? 5  
HELX_P HELX_P275 BE5 THR P 292 ? ASP P 302 ? THR P 272 ASP P 282 1 ? 11 
HELX_P HELX_P276 BE6 LEU P 303 ? ASP P 305 ? LEU P 283 ASP P 285 5 ? 3  
HELX_P HELX_P277 BE7 ASP P 412 ? PHE P 420 ? ASP P 392 PHE P 400 1 ? 9  
HELX_P HELX_P278 BE8 THR P 431 ? LYS P 437 ? THR P 411 LYS P 417 1 ? 7  
HELX_P HELX_P279 BE9 PRO Q 28  ? ARG Q 31  ? PRO Q 8   ARG Q 11  5 ? 4  
HELX_P HELX_P280 BF1 GLY Q 43  ? ASP Q 51  ? GLY Q 23  ASP Q 31  5 ? 9  
HELX_P HELX_P281 BF2 ALA Q 54  ? ALA Q 57  ? ALA Q 34  ALA Q 37  5 ? 4  
HELX_P HELX_P282 BF3 ILE Q 67  ? SER Q 77  ? ILE Q 47  SER Q 57  1 ? 11 
HELX_P HELX_P283 BF4 ALA Q 90  ? TRP Q 101 ? ALA Q 70  TRP Q 81  1 ? 12 
HELX_P HELX_P284 BF5 ARG Q 105 ? ASN Q 109 ? ARG Q 85  ASN Q 89  5 ? 5  
HELX_P HELX_P285 BF6 GLY Q 129 ? GLN Q 136 ? GLY Q 109 GLN Q 116 1 ? 8  
HELX_P HELX_P286 BF7 ASN Q 137 ? ALA Q 145 ? ASN Q 117 ALA Q 125 1 ? 9  
HELX_P HELX_P287 BF8 ASP Q 161 ? GLY Q 173 ? ASP Q 141 GLY Q 153 1 ? 13 
HELX_P HELX_P288 BF9 MET Q 186 ? GLY Q 190 ? MET Q 166 GLY Q 170 5 ? 5  
HELX_P HELX_P289 BG1 THR Q 233 ? ASP Q 246 ? THR Q 213 ASP Q 226 1 ? 14 
HELX_P HELX_P290 BG2 ASP Q 256 ? GLY Q 265 ? ASP Q 236 GLY Q 245 1 ? 10 
HELX_P HELX_P291 BG3 PHE Q 272 ? CYS Q 276 ? PHE Q 252 CYS Q 256 1 ? 5  
HELX_P HELX_P292 BG4 THR Q 292 ? ASP Q 302 ? THR Q 272 ASP Q 282 1 ? 11 
HELX_P HELX_P293 BG5 LEU Q 303 ? ASP Q 305 ? LEU Q 283 ASP Q 285 5 ? 3  
HELX_P HELX_P294 BG6 ASP Q 412 ? PHE Q 420 ? ASP Q 392 PHE Q 400 1 ? 9  
HELX_P HELX_P295 BG7 THR Q 431 ? LYS Q 437 ? THR Q 411 LYS Q 417 1 ? 7  
HELX_P HELX_P296 BG8 PRO R 28  ? ARG R 31  ? PRO R 8   ARG R 11  5 ? 4  
HELX_P HELX_P297 BG9 GLY R 43  ? ASP R 51  ? GLY R 23  ASP R 31  5 ? 9  
HELX_P HELX_P298 BH1 ALA R 54  ? ALA R 57  ? ALA R 34  ALA R 37  5 ? 4  
HELX_P HELX_P299 BH2 ILE R 66  ? SER R 77  ? ILE R 46  SER R 57  1 ? 12 
HELX_P HELX_P300 BH3 ALA R 90  ? TRP R 101 ? ALA R 70  TRP R 81  1 ? 12 
HELX_P HELX_P301 BH4 ARG R 105 ? ASN R 109 ? ARG R 85  ASN R 89  5 ? 5  
HELX_P HELX_P302 BH5 GLY R 129 ? GLN R 136 ? GLY R 109 GLN R 116 1 ? 8  
HELX_P HELX_P303 BH6 ASN R 137 ? GLU R 142 ? ASN R 117 GLU R 122 1 ? 6  
HELX_P HELX_P304 BH7 PRO R 143 ? ALA R 145 ? PRO R 123 ALA R 125 5 ? 3  
HELX_P HELX_P305 BH8 ASP R 161 ? GLY R 173 ? ASP R 141 GLY R 153 1 ? 13 
HELX_P HELX_P306 BH9 MET R 186 ? GLY R 190 ? MET R 166 GLY R 170 5 ? 5  
HELX_P HELX_P307 BI1 THR R 233 ? ASP R 246 ? THR R 213 ASP R 226 1 ? 14 
HELX_P HELX_P308 BI2 ASP R 256 ? GLY R 265 ? ASP R 236 GLY R 245 1 ? 10 
HELX_P HELX_P309 BI3 PHE R 272 ? CYS R 276 ? PHE R 252 CYS R 256 1 ? 5  
HELX_P HELX_P310 BI4 THR R 292 ? ASP R 302 ? THR R 272 ASP R 282 1 ? 11 
HELX_P HELX_P311 BI5 LEU R 303 ? ASP R 305 ? LEU R 283 ASP R 285 5 ? 3  
HELX_P HELX_P312 BI6 ASP R 412 ? PHE R 420 ? ASP R 392 PHE R 400 1 ? 9  
HELX_P HELX_P313 BI7 THR R 431 ? LYS R 437 ? THR R 411 LYS R 417 1 ? 7  
HELX_P HELX_P314 BI8 PRO S 28  ? ARG S 31  ? PRO V 8   ARG V 11  5 ? 4  
HELX_P HELX_P315 BI9 GLY S 43  ? ASP S 51  ? GLY V 23  ASP V 31  5 ? 9  
HELX_P HELX_P316 BJ1 ALA S 54  ? ALA S 57  ? ALA V 34  ALA V 37  5 ? 4  
HELX_P HELX_P317 BJ2 ILE S 66  ? SER S 77  ? ILE V 46  SER V 57  1 ? 12 
HELX_P HELX_P318 BJ3 ALA S 90  ? TRP S 101 ? ALA V 70  TRP V 81  1 ? 12 
HELX_P HELX_P319 BJ4 ARG S 105 ? ASN S 109 ? ARG V 85  ASN V 89  5 ? 5  
HELX_P HELX_P320 BJ5 GLY S 129 ? GLN S 136 ? GLY V 109 GLN V 116 1 ? 8  
HELX_P HELX_P321 BJ6 ASN S 137 ? GLU S 142 ? ASN V 117 GLU V 122 1 ? 6  
HELX_P HELX_P322 BJ7 PRO S 143 ? ALA S 145 ? PRO V 123 ALA V 125 5 ? 3  
HELX_P HELX_P323 BJ8 ASP S 161 ? GLY S 173 ? ASP V 141 GLY V 153 1 ? 13 
HELX_P HELX_P324 BJ9 MET S 186 ? GLY S 190 ? MET V 166 GLY V 170 5 ? 5  
HELX_P HELX_P325 BK1 THR S 233 ? ASP S 246 ? THR V 213 ASP V 226 1 ? 14 
HELX_P HELX_P326 BK2 ASP S 256 ? GLY S 265 ? ASP V 236 GLY V 245 1 ? 10 
HELX_P HELX_P327 BK3 PHE S 272 ? CYS S 276 ? PHE V 252 CYS V 256 1 ? 5  
HELX_P HELX_P328 BK4 THR S 292 ? ASP S 302 ? THR V 272 ASP V 282 1 ? 11 
HELX_P HELX_P329 BK5 LEU S 303 ? ASP S 305 ? LEU V 283 ASP V 285 5 ? 3  
HELX_P HELX_P330 BK6 ASP S 412 ? PHE S 420 ? ASP V 392 PHE V 400 1 ? 9  
HELX_P HELX_P331 BK7 THR S 431 ? LYS S 437 ? THR V 411 LYS V 417 1 ? 7  
HELX_P HELX_P332 BK8 PRO T 28  ? ARG T 31  ? PRO T 8   ARG T 11  5 ? 4  
HELX_P HELX_P333 BK9 GLY T 43  ? ASP T 51  ? GLY T 23  ASP T 31  5 ? 9  
HELX_P HELX_P334 BL1 ALA T 54  ? ALA T 57  ? ALA T 34  ALA T 37  5 ? 4  
HELX_P HELX_P335 BL2 ILE T 67  ? SER T 77  ? ILE T 47  SER T 57  1 ? 11 
HELX_P HELX_P336 BL3 ALA T 90  ? TRP T 101 ? ALA T 70  TRP T 81  1 ? 12 
HELX_P HELX_P337 BL4 ARG T 105 ? ASN T 109 ? ARG T 85  ASN T 89  5 ? 5  
HELX_P HELX_P338 BL5 GLY T 129 ? GLN T 136 ? GLY T 109 GLN T 116 1 ? 8  
HELX_P HELX_P339 BL6 ASN T 137 ? GLU T 142 ? ASN T 117 GLU T 122 1 ? 6  
HELX_P HELX_P340 BL7 PRO T 143 ? ALA T 145 ? PRO T 123 ALA T 125 5 ? 3  
HELX_P HELX_P341 BL8 ASP T 161 ? GLY T 173 ? ASP T 141 GLY T 153 1 ? 13 
HELX_P HELX_P342 BL9 MET T 186 ? GLY T 190 ? MET T 166 GLY T 170 5 ? 5  
HELX_P HELX_P343 BM1 THR T 233 ? ASP T 246 ? THR T 213 ASP T 226 1 ? 14 
HELX_P HELX_P344 BM2 ASP T 256 ? GLY T 265 ? ASP T 236 GLY T 245 1 ? 10 
HELX_P HELX_P345 BM3 ALA T 273 ? SER T 275 ? ALA T 253 SER T 255 5 ? 3  
HELX_P HELX_P346 BM4 THR T 292 ? ASP T 302 ? THR T 272 ASP T 282 1 ? 11 
HELX_P HELX_P347 BM5 LEU T 303 ? ASP T 305 ? LEU T 283 ASP T 285 5 ? 3  
HELX_P HELX_P348 BM6 ASP T 412 ? PHE T 420 ? ASP T 392 PHE T 400 1 ? 9  
HELX_P HELX_P349 BM7 THR T 431 ? LYS T 437 ? THR T 411 LYS T 417 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7  ? 
AA2 ? 7  ? 
AA3 ? 2  ? 
AA4 ? 2  ? 
AA5 ? 10 ? 
AA6 ? 6  ? 
AA7 ? 6  ? 
AA8 ? 10 ? 
AA9 ? 7  ? 
AB1 ? 7  ? 
AB2 ? 2  ? 
AB3 ? 2  ? 
AB4 ? 10 ? 
AB5 ? 6  ? 
AB6 ? 6  ? 
AB7 ? 10 ? 
AB8 ? 7  ? 
AB9 ? 7  ? 
AC1 ? 2  ? 
AC2 ? 2  ? 
AC3 ? 7  ? 
AC4 ? 7  ? 
AC5 ? 2  ? 
AC6 ? 2  ? 
AC7 ? 10 ? 
AC8 ? 6  ? 
AC9 ? 6  ? 
AD1 ? 10 ? 
AD2 ? 7  ? 
AD3 ? 7  ? 
AD4 ? 2  ? 
AD5 ? 2  ? 
AD6 ? 7  ? 
AD7 ? 7  ? 
AD8 ? 2  ? 
AD9 ? 2  ? 
AE1 ? 10 ? 
AE2 ? 6  ? 
AE3 ? 6  ? 
AE4 ? 10 ? 
AE5 ? 7  ? 
AE6 ? 7  ? 
AE7 ? 2  ? 
AE8 ? 2  ? 
AE9 ? 7  ? 
AF1 ? 7  ? 
AF2 ? 2  ? 
AF3 ? 2  ? 
AF4 ? 7  ? 
AF5 ? 7  ? 
AF6 ? 2  ? 
AF7 ? 2  ? 
AF8 ? 10 ? 
AF9 ? 6  ? 
AG1 ? 6  ? 
AG2 ? 10 ? 
AG3 ? 7  ? 
AG4 ? 7  ? 
AG5 ? 2  ? 
AG6 ? 2  ? 
AG7 ? 7  ? 
AG8 ? 7  ? 
AG9 ? 2  ? 
AH1 ? 2  ? 
AH2 ? 10 ? 
AH3 ? 6  ? 
AH4 ? 6  ? 
AH5 ? 10 ? 
AH6 ? 7  ? 
AH7 ? 7  ? 
AH8 ? 2  ? 
AH9 ? 2  ? 
AI1 ? 7  ? 
AI2 ? 7  ? 
AI3 ? 2  ? 
AI4 ? 2  ? 
AI5 ? 10 ? 
AI6 ? 6  ? 
AI7 ? 6  ? 
AI8 ? 10 ? 
AI9 ? 7  ? 
AJ1 ? 7  ? 
AJ2 ? 2  ? 
AJ3 ? 2  ? 
AJ4 ? 7  ? 
AJ5 ? 7  ? 
AJ6 ? 2  ? 
AJ7 ? 2  ? 
AJ8 ? 10 ? 
AJ9 ? 6  ? 
AK1 ? 6  ? 
AK2 ? 10 ? 
AK3 ? 7  ? 
AK4 ? 7  ? 
AK5 ? 2  ? 
AK6 ? 2  ? 
AK7 ? 7  ? 
AK8 ? 7  ? 
AK9 ? 2  ? 
AL1 ? 2  ? 
AL2 ? 10 ? 
AL3 ? 6  ? 
AL4 ? 6  ? 
AL5 ? 10 ? 
AL6 ? 7  ? 
AL7 ? 7  ? 
AL8 ? 2  ? 
AL9 ? 2  ? 
AM1 ? 7  ? 
AM2 ? 7  ? 
AM3 ? 2  ? 
AM4 ? 2  ? 
AM5 ? 10 ? 
AM6 ? 6  ? 
AM7 ? 6  ? 
AM8 ? 10 ? 
AM9 ? 7  ? 
AN1 ? 7  ? 
AN2 ? 2  ? 
AN3 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? parallel      
AA1 2 3  ? parallel      
AA1 3 4  ? parallel      
AA1 4 5  ? anti-parallel 
AA1 5 6  ? anti-parallel 
AA1 6 7  ? anti-parallel 
AA2 1 2  ? parallel      
AA2 2 3  ? parallel      
AA2 3 4  ? parallel      
AA2 4 5  ? anti-parallel 
AA2 5 6  ? anti-parallel 
AA2 6 7  ? parallel      
AA3 1 2  ? anti-parallel 
AA4 1 2  ? anti-parallel 
AA5 1 2  ? parallel      
AA5 2 3  ? parallel      
AA5 3 4  ? parallel      
AA5 4 5  ? parallel      
AA5 5 6  ? anti-parallel 
AA5 6 7  ? parallel      
AA5 7 8  ? parallel      
AA5 8 9  ? parallel      
AA5 9 10 ? parallel      
AA6 1 2  ? parallel      
AA6 2 3  ? parallel      
AA6 3 4  ? parallel      
AA6 4 5  ? parallel      
AA6 5 6  ? anti-parallel 
AA7 1 2  ? parallel      
AA7 2 3  ? parallel      
AA7 3 4  ? parallel      
AA7 4 5  ? parallel      
AA7 5 6  ? anti-parallel 
AA8 1 2  ? parallel      
AA8 2 3  ? parallel      
AA8 3 4  ? parallel      
AA8 4 5  ? parallel      
AA8 5 6  ? anti-parallel 
AA8 6 7  ? parallel      
AA8 7 8  ? parallel      
AA8 8 9  ? parallel      
AA8 9 10 ? parallel      
AA9 1 2  ? parallel      
AA9 2 3  ? parallel      
AA9 3 4  ? parallel      
AA9 4 5  ? anti-parallel 
AA9 5 6  ? anti-parallel 
AA9 6 7  ? anti-parallel 
AB1 1 2  ? parallel      
AB1 2 3  ? parallel      
AB1 3 4  ? parallel      
AB1 4 5  ? anti-parallel 
AB1 5 6  ? anti-parallel 
AB1 6 7  ? parallel      
AB2 1 2  ? anti-parallel 
AB3 1 2  ? anti-parallel 
AB4 1 2  ? parallel      
AB4 2 3  ? parallel      
AB4 3 4  ? parallel      
AB4 4 5  ? parallel      
AB4 5 6  ? anti-parallel 
AB4 6 7  ? parallel      
AB4 7 8  ? parallel      
AB4 8 9  ? parallel      
AB4 9 10 ? parallel      
AB5 1 2  ? parallel      
AB5 2 3  ? parallel      
AB5 3 4  ? parallel      
AB5 4 5  ? parallel      
AB5 5 6  ? anti-parallel 
AB6 1 2  ? parallel      
AB6 2 3  ? parallel      
AB6 3 4  ? parallel      
AB6 4 5  ? parallel      
AB6 5 6  ? anti-parallel 
AB7 1 2  ? parallel      
AB7 2 3  ? parallel      
AB7 3 4  ? parallel      
AB7 4 5  ? parallel      
AB7 5 6  ? anti-parallel 
AB7 6 7  ? parallel      
AB7 7 8  ? parallel      
AB7 8 9  ? parallel      
AB7 9 10 ? parallel      
AB8 1 2  ? parallel      
AB8 2 3  ? parallel      
AB8 3 4  ? parallel      
AB8 4 5  ? anti-parallel 
AB8 5 6  ? anti-parallel 
AB8 6 7  ? anti-parallel 
AB9 1 2  ? parallel      
AB9 2 3  ? parallel      
AB9 3 4  ? parallel      
AB9 4 5  ? anti-parallel 
AB9 5 6  ? anti-parallel 
AB9 6 7  ? parallel      
AC1 1 2  ? anti-parallel 
AC2 1 2  ? anti-parallel 
AC3 1 2  ? parallel      
AC3 2 3  ? parallel      
AC3 3 4  ? parallel      
AC3 4 5  ? anti-parallel 
AC3 5 6  ? anti-parallel 
AC3 6 7  ? anti-parallel 
AC4 1 2  ? parallel      
AC4 2 3  ? parallel      
AC4 3 4  ? parallel      
AC4 4 5  ? anti-parallel 
AC4 5 6  ? anti-parallel 
AC4 6 7  ? parallel      
AC5 1 2  ? anti-parallel 
AC6 1 2  ? anti-parallel 
AC7 1 2  ? parallel      
AC7 2 3  ? parallel      
AC7 3 4  ? parallel      
AC7 4 5  ? parallel      
AC7 5 6  ? anti-parallel 
AC7 6 7  ? parallel      
AC7 7 8  ? parallel      
AC7 8 9  ? parallel      
AC7 9 10 ? parallel      
AC8 1 2  ? parallel      
AC8 2 3  ? parallel      
AC8 3 4  ? parallel      
AC8 4 5  ? parallel      
AC8 5 6  ? anti-parallel 
AC9 1 2  ? parallel      
AC9 2 3  ? parallel      
AC9 3 4  ? parallel      
AC9 4 5  ? parallel      
AC9 5 6  ? anti-parallel 
AD1 1 2  ? parallel      
AD1 2 3  ? parallel      
AD1 3 4  ? parallel      
AD1 4 5  ? parallel      
AD1 5 6  ? anti-parallel 
AD1 6 7  ? parallel      
AD1 7 8  ? parallel      
AD1 8 9  ? parallel      
AD1 9 10 ? parallel      
AD2 1 2  ? parallel      
AD2 2 3  ? parallel      
AD2 3 4  ? parallel      
AD2 4 5  ? anti-parallel 
AD2 5 6  ? anti-parallel 
AD2 6 7  ? anti-parallel 
AD3 1 2  ? parallel      
AD3 2 3  ? parallel      
AD3 3 4  ? parallel      
AD3 4 5  ? anti-parallel 
AD3 5 6  ? anti-parallel 
AD3 6 7  ? parallel      
AD4 1 2  ? anti-parallel 
AD5 1 2  ? anti-parallel 
AD6 1 2  ? parallel      
AD6 2 3  ? parallel      
AD6 3 4  ? parallel      
AD6 4 5  ? anti-parallel 
AD6 5 6  ? anti-parallel 
AD6 6 7  ? anti-parallel 
AD7 1 2  ? parallel      
AD7 2 3  ? parallel      
AD7 3 4  ? parallel      
AD7 4 5  ? anti-parallel 
AD7 5 6  ? anti-parallel 
AD7 6 7  ? parallel      
AD8 1 2  ? anti-parallel 
AD9 1 2  ? anti-parallel 
AE1 1 2  ? parallel      
AE1 2 3  ? parallel      
AE1 3 4  ? parallel      
AE1 4 5  ? parallel      
AE1 5 6  ? anti-parallel 
AE1 6 7  ? parallel      
AE1 7 8  ? parallel      
AE1 8 9  ? parallel      
AE1 9 10 ? parallel      
AE2 1 2  ? parallel      
AE2 2 3  ? parallel      
AE2 3 4  ? parallel      
AE2 4 5  ? parallel      
AE2 5 6  ? anti-parallel 
AE3 1 2  ? parallel      
AE3 2 3  ? parallel      
AE3 3 4  ? parallel      
AE3 4 5  ? parallel      
AE3 5 6  ? anti-parallel 
AE4 1 2  ? parallel      
AE4 2 3  ? parallel      
AE4 3 4  ? parallel      
AE4 4 5  ? parallel      
AE4 5 6  ? anti-parallel 
AE4 6 7  ? parallel      
AE4 7 8  ? parallel      
AE4 8 9  ? parallel      
AE4 9 10 ? parallel      
AE5 1 2  ? parallel      
AE5 2 3  ? parallel      
AE5 3 4  ? parallel      
AE5 4 5  ? anti-parallel 
AE5 5 6  ? anti-parallel 
AE5 6 7  ? anti-parallel 
AE6 1 2  ? parallel      
AE6 2 3  ? parallel      
AE6 3 4  ? parallel      
AE6 4 5  ? anti-parallel 
AE6 5 6  ? anti-parallel 
AE6 6 7  ? parallel      
AE7 1 2  ? anti-parallel 
AE8 1 2  ? anti-parallel 
AE9 1 2  ? parallel      
AE9 2 3  ? parallel      
AE9 3 4  ? parallel      
AE9 4 5  ? anti-parallel 
AE9 5 6  ? anti-parallel 
AE9 6 7  ? anti-parallel 
AF1 1 2  ? parallel      
AF1 2 3  ? parallel      
AF1 3 4  ? parallel      
AF1 4 5  ? anti-parallel 
AF1 5 6  ? anti-parallel 
AF1 6 7  ? parallel      
AF2 1 2  ? anti-parallel 
AF3 1 2  ? anti-parallel 
AF4 1 2  ? parallel      
AF4 2 3  ? parallel      
AF4 3 4  ? parallel      
AF4 4 5  ? anti-parallel 
AF4 5 6  ? anti-parallel 
AF4 6 7  ? anti-parallel 
AF5 1 2  ? parallel      
AF5 2 3  ? parallel      
AF5 3 4  ? parallel      
AF5 4 5  ? anti-parallel 
AF5 5 6  ? anti-parallel 
AF5 6 7  ? parallel      
AF6 1 2  ? anti-parallel 
AF7 1 2  ? anti-parallel 
AF8 1 2  ? parallel      
AF8 2 3  ? parallel      
AF8 3 4  ? parallel      
AF8 4 5  ? parallel      
AF8 5 6  ? anti-parallel 
AF8 6 7  ? parallel      
AF8 7 8  ? parallel      
AF8 8 9  ? parallel      
AF8 9 10 ? parallel      
AF9 1 2  ? parallel      
AF9 2 3  ? parallel      
AF9 3 4  ? parallel      
AF9 4 5  ? parallel      
AF9 5 6  ? anti-parallel 
AG1 1 2  ? parallel      
AG1 2 3  ? parallel      
AG1 3 4  ? parallel      
AG1 4 5  ? parallel      
AG1 5 6  ? anti-parallel 
AG2 1 2  ? parallel      
AG2 2 3  ? parallel      
AG2 3 4  ? parallel      
AG2 4 5  ? parallel      
AG2 5 6  ? anti-parallel 
AG2 6 7  ? parallel      
AG2 7 8  ? parallel      
AG2 8 9  ? parallel      
AG2 9 10 ? parallel      
AG3 1 2  ? parallel      
AG3 2 3  ? parallel      
AG3 3 4  ? parallel      
AG3 4 5  ? anti-parallel 
AG3 5 6  ? anti-parallel 
AG3 6 7  ? anti-parallel 
AG4 1 2  ? parallel      
AG4 2 3  ? parallel      
AG4 3 4  ? parallel      
AG4 4 5  ? anti-parallel 
AG4 5 6  ? anti-parallel 
AG4 6 7  ? parallel      
AG5 1 2  ? anti-parallel 
AG6 1 2  ? anti-parallel 
AG7 1 2  ? parallel      
AG7 2 3  ? parallel      
AG7 3 4  ? parallel      
AG7 4 5  ? anti-parallel 
AG7 5 6  ? anti-parallel 
AG7 6 7  ? anti-parallel 
AG8 1 2  ? parallel      
AG8 2 3  ? parallel      
AG8 3 4  ? parallel      
AG8 4 5  ? anti-parallel 
AG8 5 6  ? anti-parallel 
AG8 6 7  ? parallel      
AG9 1 2  ? anti-parallel 
AH1 1 2  ? anti-parallel 
AH2 1 2  ? parallel      
AH2 2 3  ? parallel      
AH2 3 4  ? parallel      
AH2 4 5  ? parallel      
AH2 5 6  ? anti-parallel 
AH2 6 7  ? parallel      
AH2 7 8  ? parallel      
AH2 8 9  ? parallel      
AH2 9 10 ? parallel      
AH3 1 2  ? parallel      
AH3 2 3  ? parallel      
AH3 3 4  ? parallel      
AH3 4 5  ? parallel      
AH3 5 6  ? anti-parallel 
AH4 1 2  ? parallel      
AH4 2 3  ? parallel      
AH4 3 4  ? parallel      
AH4 4 5  ? parallel      
AH4 5 6  ? anti-parallel 
AH5 1 2  ? parallel      
AH5 2 3  ? parallel      
AH5 3 4  ? parallel      
AH5 4 5  ? parallel      
AH5 5 6  ? anti-parallel 
AH5 6 7  ? parallel      
AH5 7 8  ? parallel      
AH5 8 9  ? parallel      
AH5 9 10 ? parallel      
AH6 1 2  ? parallel      
AH6 2 3  ? parallel      
AH6 3 4  ? parallel      
AH6 4 5  ? anti-parallel 
AH6 5 6  ? anti-parallel 
AH6 6 7  ? anti-parallel 
AH7 1 2  ? parallel      
AH7 2 3  ? parallel      
AH7 3 4  ? parallel      
AH7 4 5  ? anti-parallel 
AH7 5 6  ? anti-parallel 
AH7 6 7  ? parallel      
AH8 1 2  ? anti-parallel 
AH9 1 2  ? anti-parallel 
AI1 1 2  ? parallel      
AI1 2 3  ? parallel      
AI1 3 4  ? parallel      
AI1 4 5  ? anti-parallel 
AI1 5 6  ? anti-parallel 
AI1 6 7  ? anti-parallel 
AI2 1 2  ? parallel      
AI2 2 3  ? parallel      
AI2 3 4  ? parallel      
AI2 4 5  ? anti-parallel 
AI2 5 6  ? anti-parallel 
AI2 6 7  ? parallel      
AI3 1 2  ? anti-parallel 
AI4 1 2  ? anti-parallel 
AI5 1 2  ? parallel      
AI5 2 3  ? parallel      
AI5 3 4  ? parallel      
AI5 4 5  ? parallel      
AI5 5 6  ? anti-parallel 
AI5 6 7  ? parallel      
AI5 7 8  ? parallel      
AI5 8 9  ? parallel      
AI5 9 10 ? parallel      
AI6 1 2  ? parallel      
AI6 2 3  ? parallel      
AI6 3 4  ? parallel      
AI6 4 5  ? parallel      
AI6 5 6  ? anti-parallel 
AI7 1 2  ? parallel      
AI7 2 3  ? parallel      
AI7 3 4  ? parallel      
AI7 4 5  ? parallel      
AI7 5 6  ? anti-parallel 
AI8 1 2  ? parallel      
AI8 2 3  ? parallel      
AI8 3 4  ? parallel      
AI8 4 5  ? parallel      
AI8 5 6  ? anti-parallel 
AI8 6 7  ? parallel      
AI8 7 8  ? parallel      
AI8 8 9  ? parallel      
AI8 9 10 ? parallel      
AI9 1 2  ? parallel      
AI9 2 3  ? parallel      
AI9 3 4  ? parallel      
AI9 4 5  ? anti-parallel 
AI9 5 6  ? anti-parallel 
AI9 6 7  ? anti-parallel 
AJ1 1 2  ? parallel      
AJ1 2 3  ? parallel      
AJ1 3 4  ? parallel      
AJ1 4 5  ? anti-parallel 
AJ1 5 6  ? anti-parallel 
AJ1 6 7  ? parallel      
AJ2 1 2  ? anti-parallel 
AJ3 1 2  ? anti-parallel 
AJ4 1 2  ? parallel      
AJ4 2 3  ? parallel      
AJ4 3 4  ? parallel      
AJ4 4 5  ? anti-parallel 
AJ4 5 6  ? anti-parallel 
AJ4 6 7  ? anti-parallel 
AJ5 1 2  ? parallel      
AJ5 2 3  ? parallel      
AJ5 3 4  ? parallel      
AJ5 4 5  ? anti-parallel 
AJ5 5 6  ? anti-parallel 
AJ5 6 7  ? parallel      
AJ6 1 2  ? anti-parallel 
AJ7 1 2  ? anti-parallel 
AJ8 1 2  ? parallel      
AJ8 2 3  ? parallel      
AJ8 3 4  ? parallel      
AJ8 4 5  ? parallel      
AJ8 5 6  ? anti-parallel 
AJ8 6 7  ? parallel      
AJ8 7 8  ? parallel      
AJ8 8 9  ? parallel      
AJ8 9 10 ? parallel      
AJ9 1 2  ? parallel      
AJ9 2 3  ? parallel      
AJ9 3 4  ? parallel      
AJ9 4 5  ? parallel      
AJ9 5 6  ? anti-parallel 
AK1 1 2  ? parallel      
AK1 2 3  ? parallel      
AK1 3 4  ? parallel      
AK1 4 5  ? parallel      
AK1 5 6  ? anti-parallel 
AK2 1 2  ? parallel      
AK2 2 3  ? parallel      
AK2 3 4  ? parallel      
AK2 4 5  ? parallel      
AK2 5 6  ? anti-parallel 
AK2 6 7  ? parallel      
AK2 7 8  ? parallel      
AK2 8 9  ? parallel      
AK2 9 10 ? parallel      
AK3 1 2  ? parallel      
AK3 2 3  ? parallel      
AK3 3 4  ? parallel      
AK3 4 5  ? anti-parallel 
AK3 5 6  ? anti-parallel 
AK3 6 7  ? anti-parallel 
AK4 1 2  ? parallel      
AK4 2 3  ? parallel      
AK4 3 4  ? parallel      
AK4 4 5  ? anti-parallel 
AK4 5 6  ? anti-parallel 
AK4 6 7  ? parallel      
AK5 1 2  ? anti-parallel 
AK6 1 2  ? anti-parallel 
AK7 1 2  ? parallel      
AK7 2 3  ? parallel      
AK7 3 4  ? parallel      
AK7 4 5  ? anti-parallel 
AK7 5 6  ? anti-parallel 
AK7 6 7  ? anti-parallel 
AK8 1 2  ? parallel      
AK8 2 3  ? parallel      
AK8 3 4  ? parallel      
AK8 4 5  ? anti-parallel 
AK8 5 6  ? anti-parallel 
AK8 6 7  ? parallel      
AK9 1 2  ? anti-parallel 
AL1 1 2  ? anti-parallel 
AL2 1 2  ? parallel      
AL2 2 3  ? parallel      
AL2 3 4  ? parallel      
AL2 4 5  ? parallel      
AL2 5 6  ? anti-parallel 
AL2 6 7  ? parallel      
AL2 7 8  ? parallel      
AL2 8 9  ? parallel      
AL2 9 10 ? parallel      
AL3 1 2  ? parallel      
AL3 2 3  ? parallel      
AL3 3 4  ? parallel      
AL3 4 5  ? parallel      
AL3 5 6  ? anti-parallel 
AL4 1 2  ? parallel      
AL4 2 3  ? parallel      
AL4 3 4  ? parallel      
AL4 4 5  ? parallel      
AL4 5 6  ? anti-parallel 
AL5 1 2  ? parallel      
AL5 2 3  ? parallel      
AL5 3 4  ? parallel      
AL5 4 5  ? parallel      
AL5 5 6  ? anti-parallel 
AL5 6 7  ? parallel      
AL5 7 8  ? parallel      
AL5 8 9  ? parallel      
AL5 9 10 ? parallel      
AL6 1 2  ? parallel      
AL6 2 3  ? parallel      
AL6 3 4  ? parallel      
AL6 4 5  ? anti-parallel 
AL6 5 6  ? anti-parallel 
AL6 6 7  ? anti-parallel 
AL7 1 2  ? parallel      
AL7 2 3  ? parallel      
AL7 3 4  ? parallel      
AL7 4 5  ? anti-parallel 
AL7 5 6  ? anti-parallel 
AL7 6 7  ? parallel      
AL8 1 2  ? anti-parallel 
AL9 1 2  ? anti-parallel 
AM1 1 2  ? parallel      
AM1 2 3  ? parallel      
AM1 3 4  ? parallel      
AM1 4 5  ? anti-parallel 
AM1 5 6  ? anti-parallel 
AM1 6 7  ? anti-parallel 
AM2 1 2  ? parallel      
AM2 2 3  ? parallel      
AM2 3 4  ? parallel      
AM2 4 5  ? anti-parallel 
AM2 5 6  ? anti-parallel 
AM2 6 7  ? parallel      
AM3 1 2  ? anti-parallel 
AM4 1 2  ? anti-parallel 
AM5 1 2  ? parallel      
AM5 2 3  ? parallel      
AM5 3 4  ? parallel      
AM5 4 5  ? parallel      
AM5 5 6  ? anti-parallel 
AM5 6 7  ? parallel      
AM5 7 8  ? parallel      
AM5 8 9  ? parallel      
AM5 9 10 ? parallel      
AM6 1 2  ? parallel      
AM6 2 3  ? parallel      
AM6 3 4  ? parallel      
AM6 4 5  ? parallel      
AM6 5 6  ? anti-parallel 
AM7 1 2  ? parallel      
AM7 2 3  ? parallel      
AM7 3 4  ? parallel      
AM7 4 5  ? parallel      
AM7 5 6  ? anti-parallel 
AM8 1 2  ? parallel      
AM8 2 3  ? parallel      
AM8 3 4  ? parallel      
AM8 4 5  ? parallel      
AM8 5 6  ? anti-parallel 
AM8 6 7  ? parallel      
AM8 7 8  ? parallel      
AM8 8 9  ? parallel      
AM8 9 10 ? parallel      
AM9 1 2  ? parallel      
AM9 2 3  ? parallel      
AM9 3 4  ? parallel      
AM9 4 5  ? anti-parallel 
AM9 5 6  ? anti-parallel 
AM9 6 7  ? anti-parallel 
AN1 1 2  ? parallel      
AN1 2 3  ? parallel      
AN1 3 4  ? parallel      
AN1 4 5  ? anti-parallel 
AN1 5 6  ? anti-parallel 
AN1 6 7  ? parallel      
AN2 1 2  ? anti-parallel 
AN3 1 2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  SER A 111 ? PRO A 116 ? SER H 91  PRO H 96  
AA1 2  ARG A 81  ? THR A 86  ? ARG H 61  THR H 66  
AA1 3  ALA A 33  ? ALA A 39  ? ALA H 13  ALA H 19  
AA1 4  TYR A 148 ? ALA A 153 ? TYR H 128 ALA H 133 
AA1 5  PHE A 221 ? HIS A 232 ? PHE H 201 HIS H 212 
AA1 6  GLY A 192 ? VAL A 196 ? GLY H 172 VAL H 176 
AA1 7  ILE A 202 ? GLU A 207 ? ILE H 182 GLU H 187 
AA2 1  SER A 111 ? PRO A 116 ? SER H 91  PRO H 96  
AA2 2  ARG A 81  ? THR A 86  ? ARG H 61  THR H 66  
AA2 3  ALA A 33  ? ALA A 39  ? ALA H 13  ALA H 19  
AA2 4  TYR A 148 ? ALA A 153 ? TYR H 128 ALA H 133 
AA2 5  PHE A 221 ? HIS A 232 ? PHE H 201 HIS H 212 
AA2 6  VAL A 176 ? PRO A 184 ? VAL H 156 PRO H 164 
AA2 7  ALA A 267 ? ARG A 271 ? ALA H 247 ARG H 251 
AA3 1  TYR A 59  ? PHE A 60  ? TYR H 39  PHE H 40  
AA3 2  ALA A 64  ? ARG A 65  ? ALA H 44  ARG H 45  
AA4 1  ILE A 157 ? TYR A 158 ? ILE H 137 TYR H 138 
AA4 2  TRP A 287 ? ARG A 288 ? TRP H 267 ARG H 268 
AA5 1  VAL A 402 ? ILE A 403 ? VAL H 382 ILE H 383 
AA5 2  LYS A 385 ? ILE A 386 ? LYS H 365 ILE H 366 
AA5 3  ARG A 368 ? ALA A 369 ? ARG H 348 ALA H 349 
AA5 4  ILE A 352 ? SER A 354 ? ILE H 332 SER H 334 
AA5 5  ALA A 329 ? VAL A 332 ? ALA H 309 VAL H 312 
AA5 6  SER H 345 ? VAL H 347 ? SER G 325 VAL G 327 
AA5 7  ALA H 357 ? LEU H 363 ? ALA G 337 LEU G 343 
AA5 8  ARG H 374 ? VAL H 380 ? ARG G 354 VAL G 360 
AA5 9  GLN H 391 ? ILE H 397 ? GLN G 371 ILE G 377 
AA5 10 ILE H 408 ? VAL H 409 ? ILE G 388 VAL G 389 
AA6 1  SER H 341 ? VAL H 343 ? SER G 321 VAL G 323 
AA6 2  ALA H 357 ? LEU H 363 ? ALA G 337 LEU G 343 
AA6 3  ARG H 374 ? VAL H 380 ? ARG G 354 VAL G 360 
AA6 4  GLN H 391 ? ILE H 397 ? GLN G 371 ILE G 377 
AA6 5  CYS H 428 ? ILE H 430 ? CYS G 408 ILE G 410 
AA6 6  ARG H 421 ? ARG H 422 ? ARG G 401 ARG G 402 
AA7 1  SER A 341 ? VAL A 343 ? SER H 321 VAL H 323 
AA7 2  ALA A 357 ? ASN A 359 ? ALA H 337 ASN H 339 
AA7 3  ARG A 374 ? VAL A 380 ? ARG H 354 VAL H 360 
AA7 4  GLN A 391 ? ILE A 397 ? GLN H 371 ILE H 377 
AA7 5  CYS A 428 ? ILE A 430 ? CYS H 408 ILE H 410 
AA7 6  ARG A 421 ? ARG A 422 ? ARG H 401 ARG H 402 
AA8 1  ILE A 408 ? VAL A 409 ? ILE H 388 VAL H 389 
AA8 2  GLN A 391 ? ILE A 397 ? GLN H 371 ILE H 377 
AA8 3  ARG A 374 ? VAL A 380 ? ARG H 354 VAL H 360 
AA8 4  LEU A 362 ? LEU A 363 ? LEU H 342 LEU H 343 
AA8 5  SER A 345 ? VAL A 347 ? SER H 325 VAL H 327 
AA8 6  ALA H 329 ? VAL H 332 ? ALA G 309 VAL G 312 
AA8 7  ILE H 352 ? SER H 354 ? ILE G 332 SER G 334 
AA8 8  ARG H 368 ? ALA H 369 ? ARG G 348 ALA G 349 
AA8 9  LYS H 385 ? ILE H 386 ? LYS G 365 ILE G 366 
AA8 10 VAL H 402 ? ILE H 403 ? VAL G 382 ILE G 383 
AA9 1  SER B 111 ? PRO B 116 ? SER A 91  PRO A 96  
AA9 2  ARG B 81  ? THR B 86  ? ARG A 61  THR A 66  
AA9 3  ALA B 33  ? LEU B 38  ? ALA A 13  LEU A 18  
AA9 4  TYR B 148 ? ALA B 153 ? TYR A 128 ALA A 133 
AA9 5  PHE B 221 ? HIS B 232 ? PHE A 201 HIS A 212 
AA9 6  GLY B 192 ? VAL B 196 ? GLY A 172 VAL A 176 
AA9 7  ILE B 202 ? GLU B 207 ? ILE A 182 GLU A 187 
AB1 1  SER B 111 ? PRO B 116 ? SER A 91  PRO A 96  
AB1 2  ARG B 81  ? THR B 86  ? ARG A 61  THR A 66  
AB1 3  ALA B 33  ? LEU B 38  ? ALA A 13  LEU A 18  
AB1 4  TYR B 148 ? ALA B 153 ? TYR A 128 ALA A 133 
AB1 5  PHE B 221 ? HIS B 232 ? PHE A 201 HIS A 212 
AB1 6  VAL B 176 ? PRO B 184 ? VAL A 156 PRO A 164 
AB1 7  ALA B 267 ? ARG B 271 ? ALA A 247 ARG A 251 
AB2 1  TYR B 59  ? PHE B 60  ? TYR A 39  PHE A 40  
AB2 2  ALA B 64  ? ARG B 65  ? ALA A 44  ARG A 45  
AB3 1  ILE B 157 ? TYR B 158 ? ILE A 137 TYR A 138 
AB3 2  TRP B 287 ? ARG B 288 ? TRP A 267 ARG A 268 
AB4 1  VAL B 402 ? ILE B 403 ? VAL A 382 ILE A 383 
AB4 2  LYS B 385 ? ILE B 386 ? LYS A 365 ILE A 366 
AB4 3  ARG B 368 ? ALA B 369 ? ARG A 348 ALA A 349 
AB4 4  ILE B 352 ? SER B 354 ? ILE A 332 SER A 334 
AB4 5  ALA B 329 ? VAL B 332 ? ALA A 309 VAL A 312 
AB4 6  SER C 345 ? VAL C 347 ? SER B 325 VAL B 327 
AB4 7  LEU C 362 ? LEU C 363 ? LEU B 342 LEU B 343 
AB4 8  ARG C 374 ? VAL C 380 ? ARG B 354 VAL B 360 
AB4 9  GLN C 391 ? ILE C 397 ? GLN B 371 ILE B 377 
AB4 10 ILE C 408 ? VAL C 409 ? ILE B 388 VAL B 389 
AB5 1  SER C 341 ? VAL C 343 ? SER B 321 VAL B 323 
AB5 2  ALA C 357 ? ASN C 359 ? ALA B 337 ASN B 339 
AB5 3  ARG C 374 ? VAL C 380 ? ARG B 354 VAL B 360 
AB5 4  GLN C 391 ? ILE C 397 ? GLN B 371 ILE B 377 
AB5 5  CYS C 428 ? ILE C 430 ? CYS B 408 ILE B 410 
AB5 6  ARG C 421 ? ARG C 422 ? ARG B 401 ARG B 402 
AB6 1  SER B 341 ? VAL B 343 ? SER A 321 VAL A 323 
AB6 2  ALA B 357 ? ASN B 359 ? ALA A 337 ASN A 339 
AB6 3  ARG B 374 ? VAL B 380 ? ARG A 354 VAL A 360 
AB6 4  GLN B 391 ? ILE B 397 ? GLN A 371 ILE A 377 
AB6 5  CYS B 428 ? ILE B 430 ? CYS A 408 ILE A 410 
AB6 6  ARG B 421 ? ARG B 422 ? ARG A 401 ARG A 402 
AB7 1  ILE B 408 ? VAL B 409 ? ILE A 388 VAL A 389 
AB7 2  GLN B 391 ? ILE B 397 ? GLN A 371 ILE A 377 
AB7 3  ARG B 374 ? VAL B 380 ? ARG A 354 VAL A 360 
AB7 4  LEU B 362 ? LEU B 363 ? LEU A 342 LEU A 343 
AB7 5  SER B 345 ? VAL B 347 ? SER A 325 VAL A 327 
AB7 6  ALA C 329 ? VAL C 332 ? ALA B 309 VAL B 312 
AB7 7  ILE C 352 ? SER C 354 ? ILE B 332 SER B 334 
AB7 8  ARG C 368 ? ALA C 369 ? ARG B 348 ALA B 349 
AB7 9  LYS C 385 ? ILE C 386 ? LYS B 365 ILE B 366 
AB7 10 VAL C 402 ? ILE C 403 ? VAL B 382 ILE B 383 
AB8 1  SER C 111 ? PRO C 116 ? SER B 91  PRO B 96  
AB8 2  ARG C 81  ? THR C 86  ? ARG B 61  THR B 66  
AB8 3  ALA C 33  ? ALA C 39  ? ALA B 13  ALA B 19  
AB8 4  TYR C 148 ? ALA C 153 ? TYR B 128 ALA B 133 
AB8 5  PHE C 221 ? HIS C 232 ? PHE B 201 HIS B 212 
AB8 6  GLY C 192 ? VAL C 196 ? GLY B 172 VAL B 176 
AB8 7  ILE C 202 ? GLU C 207 ? ILE B 182 GLU B 187 
AB9 1  SER C 111 ? PRO C 116 ? SER B 91  PRO B 96  
AB9 2  ARG C 81  ? THR C 86  ? ARG B 61  THR B 66  
AB9 3  ALA C 33  ? ALA C 39  ? ALA B 13  ALA B 19  
AB9 4  TYR C 148 ? ALA C 153 ? TYR B 128 ALA B 133 
AB9 5  PHE C 221 ? HIS C 232 ? PHE B 201 HIS B 212 
AB9 6  VAL C 176 ? PRO C 184 ? VAL B 156 PRO B 164 
AB9 7  ALA C 267 ? ARG C 271 ? ALA B 247 ARG B 251 
AC1 1  TYR C 59  ? PHE C 60  ? TYR B 39  PHE B 40  
AC1 2  ALA C 64  ? ARG C 65  ? ALA B 44  ARG B 45  
AC2 1  ILE C 157 ? TYR C 158 ? ILE B 137 TYR B 138 
AC2 2  TRP C 287 ? ARG C 288 ? TRP B 267 ARG B 268 
AC3 1  SER D 111 ? PRO D 116 ? SER C 91  PRO C 96  
AC3 2  ARG D 81  ? THR D 86  ? ARG C 61  THR C 66  
AC3 3  ALA D 33  ? LEU D 38  ? ALA C 13  LEU C 18  
AC3 4  TYR D 148 ? ALA D 153 ? TYR C 128 ALA C 133 
AC3 5  PHE D 221 ? HIS D 232 ? PHE C 201 HIS C 212 
AC3 6  GLY D 192 ? VAL D 196 ? GLY C 172 VAL C 176 
AC3 7  ILE D 202 ? GLU D 207 ? ILE C 182 GLU C 187 
AC4 1  SER D 111 ? PRO D 116 ? SER C 91  PRO C 96  
AC4 2  ARG D 81  ? THR D 86  ? ARG C 61  THR C 66  
AC4 3  ALA D 33  ? LEU D 38  ? ALA C 13  LEU C 18  
AC4 4  TYR D 148 ? ALA D 153 ? TYR C 128 ALA C 133 
AC4 5  PHE D 221 ? HIS D 232 ? PHE C 201 HIS C 212 
AC4 6  VAL D 176 ? PRO D 184 ? VAL C 156 PRO C 164 
AC4 7  ALA D 267 ? ARG D 271 ? ALA C 247 ARG C 251 
AC5 1  TYR D 59  ? PHE D 60  ? TYR C 39  PHE C 40  
AC5 2  ALA D 64  ? ARG D 65  ? ALA C 44  ARG C 45  
AC6 1  ILE D 157 ? TYR D 158 ? ILE C 137 TYR C 138 
AC6 2  TRP D 287 ? ARG D 288 ? TRP C 267 ARG C 268 
AC7 1  VAL D 402 ? ILE D 403 ? VAL C 382 ILE C 383 
AC7 2  LYS D 385 ? ILE D 386 ? LYS C 365 ILE C 366 
AC7 3  ARG D 368 ? ALA D 369 ? ARG C 348 ALA C 349 
AC7 4  ILE D 352 ? SER D 354 ? ILE C 332 SER C 334 
AC7 5  ALA D 329 ? VAL D 332 ? ALA C 309 VAL C 312 
AC7 6  SER E 345 ? VAL E 347 ? SER D 325 VAL D 327 
AC7 7  LEU E 362 ? LEU E 363 ? LEU D 342 LEU D 343 
AC7 8  ARG E 374 ? VAL E 380 ? ARG D 354 VAL D 360 
AC7 9  GLN E 391 ? ILE E 397 ? GLN D 371 ILE D 377 
AC7 10 ILE E 408 ? VAL E 409 ? ILE D 388 VAL D 389 
AC8 1  SER E 341 ? VAL E 343 ? SER D 321 VAL D 323 
AC8 2  ALA E 357 ? ASN E 359 ? ALA D 337 ASN D 339 
AC8 3  ARG E 374 ? VAL E 380 ? ARG D 354 VAL D 360 
AC8 4  GLN E 391 ? ILE E 397 ? GLN D 371 ILE D 377 
AC8 5  CYS E 428 ? ILE E 430 ? CYS D 408 ILE D 410 
AC8 6  ARG E 421 ? ARG E 422 ? ARG D 401 ARG D 402 
AC9 1  SER D 341 ? VAL D 343 ? SER C 321 VAL C 323 
AC9 2  ALA D 357 ? ASN D 359 ? ALA C 337 ASN C 339 
AC9 3  ARG D 374 ? VAL D 380 ? ARG C 354 VAL C 360 
AC9 4  GLN D 391 ? ILE D 397 ? GLN C 371 ILE C 377 
AC9 5  CYS D 428 ? ILE D 430 ? CYS C 408 ILE C 410 
AC9 6  ARG D 421 ? ARG D 422 ? ARG C 401 ARG C 402 
AD1 1  ILE D 408 ? VAL D 409 ? ILE C 388 VAL C 389 
AD1 2  GLN D 391 ? ILE D 397 ? GLN C 371 ILE C 377 
AD1 3  ARG D 374 ? VAL D 380 ? ARG C 354 VAL C 360 
AD1 4  LEU D 362 ? LEU D 363 ? LEU C 342 LEU C 343 
AD1 5  SER D 345 ? VAL D 347 ? SER C 325 VAL C 327 
AD1 6  ALA E 329 ? VAL E 332 ? ALA D 309 VAL D 312 
AD1 7  ILE E 352 ? SER E 354 ? ILE D 332 SER D 334 
AD1 8  ARG E 368 ? ALA E 369 ? ARG D 348 ALA D 349 
AD1 9  LYS E 385 ? ILE E 386 ? LYS D 365 ILE D 366 
AD1 10 VAL E 402 ? ILE E 403 ? VAL D 382 ILE D 383 
AD2 1  SER E 111 ? PRO E 116 ? SER D 91  PRO D 96  
AD2 2  ARG E 81  ? THR E 86  ? ARG D 61  THR D 66  
AD2 3  ALA E 33  ? LEU E 38  ? ALA D 13  LEU D 18  
AD2 4  TYR E 148 ? ALA E 153 ? TYR D 128 ALA D 133 
AD2 5  PHE E 221 ? HIS E 232 ? PHE D 201 HIS D 212 
AD2 6  GLY E 192 ? VAL E 196 ? GLY D 172 VAL D 176 
AD2 7  ILE E 202 ? GLU E 207 ? ILE D 182 GLU D 187 
AD3 1  SER E 111 ? PRO E 116 ? SER D 91  PRO D 96  
AD3 2  ARG E 81  ? THR E 86  ? ARG D 61  THR D 66  
AD3 3  ALA E 33  ? LEU E 38  ? ALA D 13  LEU D 18  
AD3 4  TYR E 148 ? ALA E 153 ? TYR D 128 ALA D 133 
AD3 5  PHE E 221 ? HIS E 232 ? PHE D 201 HIS D 212 
AD3 6  VAL E 176 ? PRO E 184 ? VAL D 156 PRO D 164 
AD3 7  ALA E 267 ? ARG E 271 ? ALA D 247 ARG D 251 
AD4 1  TYR E 59  ? PHE E 60  ? TYR D 39  PHE D 40  
AD4 2  ALA E 64  ? ARG E 65  ? ALA D 44  ARG D 45  
AD5 1  ILE E 157 ? TYR E 158 ? ILE D 137 TYR D 138 
AD5 2  TRP E 287 ? ARG E 288 ? TRP D 267 ARG D 268 
AD6 1  SER F 111 ? PRO F 116 ? SER E 91  PRO E 96  
AD6 2  ARG F 81  ? THR F 86  ? ARG E 61  THR E 66  
AD6 3  ALA F 33  ? LEU F 38  ? ALA E 13  LEU E 18  
AD6 4  TYR F 148 ? ALA F 153 ? TYR E 128 ALA E 133 
AD6 5  PHE F 221 ? HIS F 232 ? PHE E 201 HIS E 212 
AD6 6  GLY F 192 ? VAL F 196 ? GLY E 172 VAL E 176 
AD6 7  ILE F 202 ? GLU F 207 ? ILE E 182 GLU E 187 
AD7 1  SER F 111 ? PRO F 116 ? SER E 91  PRO E 96  
AD7 2  ARG F 81  ? THR F 86  ? ARG E 61  THR E 66  
AD7 3  ALA F 33  ? LEU F 38  ? ALA E 13  LEU E 18  
AD7 4  TYR F 148 ? ALA F 153 ? TYR E 128 ALA E 133 
AD7 5  PHE F 221 ? HIS F 232 ? PHE E 201 HIS E 212 
AD7 6  VAL F 176 ? PRO F 184 ? VAL E 156 PRO E 164 
AD7 7  ALA F 267 ? ARG F 271 ? ALA E 247 ARG E 251 
AD8 1  TYR F 59  ? PHE F 60  ? TYR E 39  PHE E 40  
AD8 2  ALA F 64  ? ARG F 65  ? ALA E 44  ARG E 45  
AD9 1  ILE F 157 ? TYR F 158 ? ILE E 137 TYR E 138 
AD9 2  TRP F 287 ? ARG F 288 ? TRP E 267 ARG E 268 
AE1 1  VAL F 402 ? ILE F 403 ? VAL E 382 ILE E 383 
AE1 2  LYS F 385 ? ILE F 386 ? LYS E 365 ILE E 366 
AE1 3  ARG F 368 ? ALA F 369 ? ARG E 348 ALA E 349 
AE1 4  ILE F 352 ? SER F 354 ? ILE E 332 SER E 334 
AE1 5  ALA F 329 ? VAL F 332 ? ALA E 309 VAL E 312 
AE1 6  SER G 345 ? VAL G 347 ? SER F 325 VAL F 327 
AE1 7  LEU G 362 ? LEU G 363 ? LEU F 342 LEU F 343 
AE1 8  ARG G 374 ? VAL G 380 ? ARG F 354 VAL F 360 
AE1 9  GLN G 391 ? ILE G 397 ? GLN F 371 ILE F 377 
AE1 10 ILE G 408 ? VAL G 409 ? ILE F 388 VAL F 389 
AE2 1  SER G 341 ? VAL G 343 ? SER F 321 VAL F 323 
AE2 2  ALA G 357 ? ASN G 359 ? ALA F 337 ASN F 339 
AE2 3  ARG G 374 ? VAL G 380 ? ARG F 354 VAL F 360 
AE2 4  GLN G 391 ? ILE G 397 ? GLN F 371 ILE F 377 
AE2 5  CYS G 428 ? ILE G 430 ? CYS F 408 ILE F 410 
AE2 6  ARG G 421 ? ARG G 422 ? ARG F 401 ARG F 402 
AE3 1  SER F 341 ? VAL F 343 ? SER E 321 VAL E 323 
AE3 2  ALA F 357 ? ASN F 359 ? ALA E 337 ASN E 339 
AE3 3  ARG F 374 ? VAL F 380 ? ARG E 354 VAL E 360 
AE3 4  GLN F 391 ? ILE F 397 ? GLN E 371 ILE E 377 
AE3 5  CYS F 428 ? ILE F 430 ? CYS E 408 ILE E 410 
AE3 6  ARG F 421 ? ARG F 422 ? ARG E 401 ARG E 402 
AE4 1  ILE F 408 ? VAL F 409 ? ILE E 388 VAL E 389 
AE4 2  GLN F 391 ? ILE F 397 ? GLN E 371 ILE E 377 
AE4 3  ARG F 374 ? VAL F 380 ? ARG E 354 VAL E 360 
AE4 4  LEU F 362 ? LEU F 363 ? LEU E 342 LEU E 343 
AE4 5  SER F 345 ? VAL F 347 ? SER E 325 VAL E 327 
AE4 6  ALA G 329 ? VAL G 332 ? ALA F 309 VAL F 312 
AE4 7  ILE G 352 ? SER G 354 ? ILE F 332 SER F 334 
AE4 8  ARG G 368 ? ALA G 369 ? ARG F 348 ALA F 349 
AE4 9  LYS G 385 ? ILE G 386 ? LYS F 365 ILE F 366 
AE4 10 VAL G 402 ? ILE G 403 ? VAL F 382 ILE F 383 
AE5 1  SER G 111 ? PRO G 116 ? SER F 91  PRO F 96  
AE5 2  ARG G 81  ? THR G 86  ? ARG F 61  THR F 66  
AE5 3  ALA G 33  ? ALA G 39  ? ALA F 13  ALA F 19  
AE5 4  TYR G 148 ? ALA G 153 ? TYR F 128 ALA F 133 
AE5 5  PHE G 221 ? HIS G 232 ? PHE F 201 HIS F 212 
AE5 6  GLY G 192 ? VAL G 196 ? GLY F 172 VAL F 176 
AE5 7  ILE G 202 ? GLU G 207 ? ILE F 182 GLU F 187 
AE6 1  SER G 111 ? PRO G 116 ? SER F 91  PRO F 96  
AE6 2  ARG G 81  ? THR G 86  ? ARG F 61  THR F 66  
AE6 3  ALA G 33  ? ALA G 39  ? ALA F 13  ALA F 19  
AE6 4  TYR G 148 ? ALA G 153 ? TYR F 128 ALA F 133 
AE6 5  PHE G 221 ? HIS G 232 ? PHE F 201 HIS F 212 
AE6 6  VAL G 176 ? PRO G 184 ? VAL F 156 PRO F 164 
AE6 7  ALA G 267 ? ARG G 271 ? ALA F 247 ARG F 251 
AE7 1  TYR G 59  ? PHE G 60  ? TYR F 39  PHE F 40  
AE7 2  ALA G 64  ? ARG G 65  ? ALA F 44  ARG F 45  
AE8 1  ILE G 157 ? TYR G 158 ? ILE F 137 TYR F 138 
AE8 2  TRP G 287 ? ARG G 288 ? TRP F 267 ARG F 268 
AE9 1  SER H 111 ? PRO H 116 ? SER G 91  PRO G 96  
AE9 2  ARG H 81  ? THR H 86  ? ARG G 61  THR G 66  
AE9 3  ALA H 33  ? LEU H 38  ? ALA G 13  LEU G 18  
AE9 4  TYR H 148 ? ALA H 153 ? TYR G 128 ALA G 133 
AE9 5  PHE H 221 ? HIS H 232 ? PHE G 201 HIS G 212 
AE9 6  GLY H 192 ? VAL H 196 ? GLY G 172 VAL G 176 
AE9 7  ILE H 202 ? GLU H 207 ? ILE G 182 GLU G 187 
AF1 1  SER H 111 ? PRO H 116 ? SER G 91  PRO G 96  
AF1 2  ARG H 81  ? THR H 86  ? ARG G 61  THR G 66  
AF1 3  ALA H 33  ? LEU H 38  ? ALA G 13  LEU G 18  
AF1 4  TYR H 148 ? ALA H 153 ? TYR G 128 ALA G 133 
AF1 5  PHE H 221 ? HIS H 232 ? PHE G 201 HIS G 212 
AF1 6  VAL H 176 ? PRO H 184 ? VAL G 156 PRO G 164 
AF1 7  ALA H 267 ? ARG H 271 ? ALA G 247 ARG G 251 
AF2 1  TYR H 59  ? PHE H 60  ? TYR G 39  PHE G 40  
AF2 2  ALA H 64  ? ARG H 65  ? ALA G 44  ARG G 45  
AF3 1  ILE H 157 ? TYR H 158 ? ILE G 137 TYR G 138 
AF3 2  TRP H 287 ? ARG H 288 ? TRP G 267 ARG G 268 
AF4 1  SER I 111 ? PRO I 116 ? SER I 91  PRO I 96  
AF4 2  ARG I 81  ? THR I 86  ? ARG I 61  THR I 66  
AF4 3  ALA I 33  ? LEU I 38  ? ALA I 13  LEU I 18  
AF4 4  TYR I 148 ? ALA I 153 ? TYR I 128 ALA I 133 
AF4 5  PHE I 221 ? HIS I 232 ? PHE I 201 HIS I 212 
AF4 6  GLY I 192 ? VAL I 196 ? GLY I 172 VAL I 176 
AF4 7  ILE I 202 ? GLU I 207 ? ILE I 182 GLU I 187 
AF5 1  SER I 111 ? PRO I 116 ? SER I 91  PRO I 96  
AF5 2  ARG I 81  ? THR I 86  ? ARG I 61  THR I 66  
AF5 3  ALA I 33  ? LEU I 38  ? ALA I 13  LEU I 18  
AF5 4  TYR I 148 ? ALA I 153 ? TYR I 128 ALA I 133 
AF5 5  PHE I 221 ? HIS I 232 ? PHE I 201 HIS I 212 
AF5 6  VAL I 176 ? PRO I 184 ? VAL I 156 PRO I 164 
AF5 7  ALA I 267 ? ARG I 271 ? ALA I 247 ARG I 251 
AF6 1  TYR I 59  ? PHE I 60  ? TYR I 39  PHE I 40  
AF6 2  ALA I 64  ? ARG I 65  ? ALA I 44  ARG I 45  
AF7 1  ILE I 157 ? TYR I 158 ? ILE I 137 TYR I 138 
AF7 2  TRP I 287 ? ARG I 288 ? TRP I 267 ARG I 268 
AF8 1  VAL I 402 ? ILE I 403 ? VAL I 382 ILE I 383 
AF8 2  LYS I 385 ? ILE I 386 ? LYS I 365 ILE I 366 
AF8 3  ARG I 368 ? ALA I 369 ? ARG I 348 ALA I 349 
AF8 4  ILE I 352 ? SER I 354 ? ILE I 332 SER I 334 
AF8 5  ALA I 329 ? VAL I 332 ? ALA I 309 VAL I 312 
AF8 6  SER J 345 ? VAL J 347 ? SER J 325 VAL J 327 
AF8 7  LEU J 362 ? LEU J 363 ? LEU J 342 LEU J 343 
AF8 8  ARG J 374 ? VAL J 380 ? ARG J 354 VAL J 360 
AF8 9  GLN J 391 ? ILE J 397 ? GLN J 371 ILE J 377 
AF8 10 ILE J 408 ? VAL J 409 ? ILE J 388 VAL J 389 
AF9 1  SER J 341 ? VAL J 343 ? SER J 321 VAL J 323 
AF9 2  ALA J 357 ? ASN J 359 ? ALA J 337 ASN J 339 
AF9 3  ARG J 374 ? VAL J 380 ? ARG J 354 VAL J 360 
AF9 4  GLN J 391 ? ILE J 397 ? GLN J 371 ILE J 377 
AF9 5  CYS J 428 ? ILE J 430 ? CYS J 408 ILE J 410 
AF9 6  ARG J 421 ? ARG J 422 ? ARG J 401 ARG J 402 
AG1 1  SER I 341 ? VAL I 343 ? SER I 321 VAL I 323 
AG1 2  ALA I 357 ? ASN I 359 ? ALA I 337 ASN I 339 
AG1 3  ARG I 374 ? VAL I 380 ? ARG I 354 VAL I 360 
AG1 4  GLN I 391 ? ILE I 397 ? GLN I 371 ILE I 377 
AG1 5  CYS I 428 ? ILE I 430 ? CYS I 408 ILE I 410 
AG1 6  ARG I 421 ? ARG I 422 ? ARG I 401 ARG I 402 
AG2 1  ILE I 408 ? VAL I 409 ? ILE I 388 VAL I 389 
AG2 2  GLN I 391 ? ILE I 397 ? GLN I 371 ILE I 377 
AG2 3  ARG I 374 ? VAL I 380 ? ARG I 354 VAL I 360 
AG2 4  LEU I 362 ? LEU I 363 ? LEU I 342 LEU I 343 
AG2 5  SER I 345 ? VAL I 347 ? SER I 325 VAL I 327 
AG2 6  ALA J 329 ? VAL J 332 ? ALA J 309 VAL J 312 
AG2 7  ILE J 352 ? SER J 354 ? ILE J 332 SER J 334 
AG2 8  ARG J 368 ? ALA J 369 ? ARG J 348 ALA J 349 
AG2 9  LYS J 385 ? ILE J 386 ? LYS J 365 ILE J 366 
AG2 10 VAL J 402 ? ILE J 403 ? VAL J 382 ILE J 383 
AG3 1  SER J 111 ? PRO J 116 ? SER J 91  PRO J 96  
AG3 2  ARG J 81  ? THR J 86  ? ARG J 61  THR J 66  
AG3 3  ALA J 33  ? LEU J 38  ? ALA J 13  LEU J 18  
AG3 4  TYR J 148 ? ALA J 153 ? TYR J 128 ALA J 133 
AG3 5  PHE J 221 ? HIS J 232 ? PHE J 201 HIS J 212 
AG3 6  GLY J 192 ? VAL J 196 ? GLY J 172 VAL J 176 
AG3 7  ILE J 202 ? GLU J 207 ? ILE J 182 GLU J 187 
AG4 1  SER J 111 ? PRO J 116 ? SER J 91  PRO J 96  
AG4 2  ARG J 81  ? THR J 86  ? ARG J 61  THR J 66  
AG4 3  ALA J 33  ? LEU J 38  ? ALA J 13  LEU J 18  
AG4 4  TYR J 148 ? ALA J 153 ? TYR J 128 ALA J 133 
AG4 5  PHE J 221 ? HIS J 232 ? PHE J 201 HIS J 212 
AG4 6  VAL J 176 ? PRO J 184 ? VAL J 156 PRO J 164 
AG4 7  ALA J 267 ? ARG J 271 ? ALA J 247 ARG J 251 
AG5 1  TYR J 59  ? PHE J 60  ? TYR J 39  PHE J 40  
AG5 2  ALA J 64  ? ARG J 65  ? ALA J 44  ARG J 45  
AG6 1  ILE J 157 ? TYR J 158 ? ILE J 137 TYR J 138 
AG6 2  TRP J 287 ? ARG J 288 ? TRP J 267 ARG J 268 
AG7 1  SER K 111 ? PRO K 116 ? SER K 91  PRO K 96  
AG7 2  ARG K 81  ? THR K 86  ? ARG K 61  THR K 66  
AG7 3  ALA K 33  ? LEU K 38  ? ALA K 13  LEU K 18  
AG7 4  TYR K 148 ? ALA K 153 ? TYR K 128 ALA K 133 
AG7 5  PHE K 221 ? HIS K 232 ? PHE K 201 HIS K 212 
AG7 6  GLY K 192 ? VAL K 196 ? GLY K 172 VAL K 176 
AG7 7  ILE K 202 ? GLU K 207 ? ILE K 182 GLU K 187 
AG8 1  SER K 111 ? PRO K 116 ? SER K 91  PRO K 96  
AG8 2  ARG K 81  ? THR K 86  ? ARG K 61  THR K 66  
AG8 3  ALA K 33  ? LEU K 38  ? ALA K 13  LEU K 18  
AG8 4  TYR K 148 ? ALA K 153 ? TYR K 128 ALA K 133 
AG8 5  PHE K 221 ? HIS K 232 ? PHE K 201 HIS K 212 
AG8 6  VAL K 176 ? PRO K 184 ? VAL K 156 PRO K 164 
AG8 7  ALA K 267 ? ARG K 271 ? ALA K 247 ARG K 251 
AG9 1  TYR K 59  ? PHE K 60  ? TYR K 39  PHE K 40  
AG9 2  ALA K 64  ? ARG K 65  ? ALA K 44  ARG K 45  
AH1 1  ILE K 157 ? TYR K 158 ? ILE K 137 TYR K 138 
AH1 2  TRP K 287 ? ARG K 288 ? TRP K 267 ARG K 268 
AH2 1  VAL K 402 ? ILE K 403 ? VAL K 382 ILE K 383 
AH2 2  LYS K 385 ? ILE K 386 ? LYS K 365 ILE K 366 
AH2 3  ARG K 368 ? ALA K 369 ? ARG K 348 ALA K 349 
AH2 4  ILE K 352 ? SER K 354 ? ILE K 332 SER K 334 
AH2 5  ALA K 329 ? VAL K 332 ? ALA K 309 VAL K 312 
AH2 6  SER L 345 ? VAL L 347 ? SER L 325 VAL L 327 
AH2 7  ALA L 357 ? LEU L 363 ? ALA L 337 LEU L 343 
AH2 8  ARG L 374 ? VAL L 380 ? ARG L 354 VAL L 360 
AH2 9  GLN L 391 ? ILE L 397 ? GLN L 371 ILE L 377 
AH2 10 ILE L 408 ? VAL L 409 ? ILE L 388 VAL L 389 
AH3 1  SER L 341 ? VAL L 343 ? SER L 321 VAL L 323 
AH3 2  ALA L 357 ? LEU L 363 ? ALA L 337 LEU L 343 
AH3 3  ARG L 374 ? VAL L 380 ? ARG L 354 VAL L 360 
AH3 4  GLN L 391 ? ILE L 397 ? GLN L 371 ILE L 377 
AH3 5  CYS L 428 ? ILE L 430 ? CYS L 408 ILE L 410 
AH3 6  ARG L 421 ? ARG L 422 ? ARG L 401 ARG L 402 
AH4 1  SER K 341 ? VAL K 343 ? SER K 321 VAL K 323 
AH4 2  ALA K 357 ? ASN K 359 ? ALA K 337 ASN K 339 
AH4 3  ARG K 374 ? VAL K 380 ? ARG K 354 VAL K 360 
AH4 4  GLN K 391 ? ILE K 397 ? GLN K 371 ILE K 377 
AH4 5  CYS K 428 ? ILE K 430 ? CYS K 408 ILE K 410 
AH4 6  ARG K 421 ? ARG K 422 ? ARG K 401 ARG K 402 
AH5 1  ILE K 408 ? VAL K 409 ? ILE K 388 VAL K 389 
AH5 2  GLN K 391 ? ILE K 397 ? GLN K 371 ILE K 377 
AH5 3  ARG K 374 ? VAL K 380 ? ARG K 354 VAL K 360 
AH5 4  LEU K 362 ? LEU K 363 ? LEU K 342 LEU K 343 
AH5 5  SER K 345 ? VAL K 347 ? SER K 325 VAL K 327 
AH5 6  ALA L 329 ? VAL L 332 ? ALA L 309 VAL L 312 
AH5 7  ILE L 352 ? SER L 354 ? ILE L 332 SER L 334 
AH5 8  ARG L 368 ? ALA L 369 ? ARG L 348 ALA L 349 
AH5 9  LYS L 385 ? ILE L 386 ? LYS L 365 ILE L 366 
AH5 10 VAL L 402 ? ILE L 403 ? VAL L 382 ILE L 383 
AH6 1  SER L 111 ? PRO L 116 ? SER L 91  PRO L 96  
AH6 2  ARG L 81  ? THR L 86  ? ARG L 61  THR L 66  
AH6 3  ALA L 33  ? LEU L 38  ? ALA L 13  LEU L 18  
AH6 4  TYR L 148 ? ALA L 153 ? TYR L 128 ALA L 133 
AH6 5  PHE L 221 ? HIS L 232 ? PHE L 201 HIS L 212 
AH6 6  GLY L 192 ? VAL L 196 ? GLY L 172 VAL L 176 
AH6 7  ILE L 202 ? GLU L 207 ? ILE L 182 GLU L 187 
AH7 1  SER L 111 ? PRO L 116 ? SER L 91  PRO L 96  
AH7 2  ARG L 81  ? THR L 86  ? ARG L 61  THR L 66  
AH7 3  ALA L 33  ? LEU L 38  ? ALA L 13  LEU L 18  
AH7 4  TYR L 148 ? ALA L 153 ? TYR L 128 ALA L 133 
AH7 5  PHE L 221 ? HIS L 232 ? PHE L 201 HIS L 212 
AH7 6  VAL L 176 ? PRO L 184 ? VAL L 156 PRO L 164 
AH7 7  ALA L 267 ? ARG L 271 ? ALA L 247 ARG L 251 
AH8 1  TYR L 59  ? PHE L 60  ? TYR L 39  PHE L 40  
AH8 2  ALA L 64  ? ARG L 65  ? ALA L 44  ARG L 45  
AH9 1  ILE L 157 ? TYR L 158 ? ILE L 137 TYR L 138 
AH9 2  TRP L 287 ? ARG L 288 ? TRP L 267 ARG L 268 
AI1 1  SER M 111 ? PRO M 116 ? SER M 91  PRO M 96  
AI1 2  ARG M 81  ? THR M 86  ? ARG M 61  THR M 66  
AI1 3  ALA M 33  ? LEU M 38  ? ALA M 13  LEU M 18  
AI1 4  TYR M 148 ? ALA M 153 ? TYR M 128 ALA M 133 
AI1 5  PHE M 221 ? HIS M 232 ? PHE M 201 HIS M 212 
AI1 6  GLY M 192 ? VAL M 196 ? GLY M 172 VAL M 176 
AI1 7  ILE M 202 ? GLU M 207 ? ILE M 182 GLU M 187 
AI2 1  SER M 111 ? PRO M 116 ? SER M 91  PRO M 96  
AI2 2  ARG M 81  ? THR M 86  ? ARG M 61  THR M 66  
AI2 3  ALA M 33  ? LEU M 38  ? ALA M 13  LEU M 18  
AI2 4  TYR M 148 ? ALA M 153 ? TYR M 128 ALA M 133 
AI2 5  PHE M 221 ? HIS M 232 ? PHE M 201 HIS M 212 
AI2 6  VAL M 176 ? PRO M 184 ? VAL M 156 PRO M 164 
AI2 7  ALA M 267 ? ARG M 271 ? ALA M 247 ARG M 251 
AI3 1  TYR M 59  ? PHE M 60  ? TYR M 39  PHE M 40  
AI3 2  ALA M 64  ? ARG M 65  ? ALA M 44  ARG M 45  
AI4 1  ILE M 157 ? TYR M 158 ? ILE M 137 TYR M 138 
AI4 2  TRP M 287 ? ARG M 288 ? TRP M 267 ARG M 268 
AI5 1  VAL M 402 ? ILE M 403 ? VAL M 382 ILE M 383 
AI5 2  LYS M 385 ? ILE M 386 ? LYS M 365 ILE M 366 
AI5 3  ARG M 368 ? ALA M 369 ? ARG M 348 ALA M 349 
AI5 4  ILE M 352 ? SER M 354 ? ILE M 332 SER M 334 
AI5 5  ALA M 329 ? VAL M 332 ? ALA M 309 VAL M 312 
AI5 6  SER N 345 ? VAL N 347 ? SER N 325 VAL N 327 
AI5 7  LEU N 362 ? LEU N 363 ? LEU N 342 LEU N 343 
AI5 8  ARG N 374 ? VAL N 380 ? ARG N 354 VAL N 360 
AI5 9  GLN N 391 ? ILE N 397 ? GLN N 371 ILE N 377 
AI5 10 ILE N 408 ? VAL N 409 ? ILE N 388 VAL N 389 
AI6 1  SER N 341 ? VAL N 343 ? SER N 321 VAL N 323 
AI6 2  ALA N 357 ? ASN N 359 ? ALA N 337 ASN N 339 
AI6 3  ARG N 374 ? VAL N 380 ? ARG N 354 VAL N 360 
AI6 4  GLN N 391 ? ILE N 397 ? GLN N 371 ILE N 377 
AI6 5  CYS N 428 ? ILE N 430 ? CYS N 408 ILE N 410 
AI6 6  ARG N 421 ? ARG N 422 ? ARG N 401 ARG N 402 
AI7 1  SER M 341 ? VAL M 343 ? SER M 321 VAL M 323 
AI7 2  ALA M 357 ? ASN M 359 ? ALA M 337 ASN M 339 
AI7 3  ARG M 374 ? VAL M 380 ? ARG M 354 VAL M 360 
AI7 4  GLN M 391 ? ILE M 397 ? GLN M 371 ILE M 377 
AI7 5  CYS M 428 ? ILE M 430 ? CYS M 408 ILE M 410 
AI7 6  ARG M 421 ? ARG M 422 ? ARG M 401 ARG M 402 
AI8 1  ILE M 408 ? VAL M 409 ? ILE M 388 VAL M 389 
AI8 2  GLN M 391 ? ILE M 397 ? GLN M 371 ILE M 377 
AI8 3  ARG M 374 ? VAL M 380 ? ARG M 354 VAL M 360 
AI8 4  LEU M 362 ? LEU M 363 ? LEU M 342 LEU M 343 
AI8 5  SER M 345 ? VAL M 347 ? SER M 325 VAL M 327 
AI8 6  ALA N 329 ? VAL N 332 ? ALA N 309 VAL N 312 
AI8 7  ILE N 352 ? SER N 354 ? ILE N 332 SER N 334 
AI8 8  ARG N 368 ? ALA N 369 ? ARG N 348 ALA N 349 
AI8 9  LYS N 385 ? ILE N 386 ? LYS N 365 ILE N 366 
AI8 10 VAL N 402 ? ILE N 403 ? VAL N 382 ILE N 383 
AI9 1  SER N 111 ? PRO N 116 ? SER N 91  PRO N 96  
AI9 2  ARG N 81  ? THR N 86  ? ARG N 61  THR N 66  
AI9 3  ALA N 33  ? LEU N 38  ? ALA N 13  LEU N 18  
AI9 4  TYR N 148 ? ALA N 153 ? TYR N 128 ALA N 133 
AI9 5  PHE N 221 ? HIS N 232 ? PHE N 201 HIS N 212 
AI9 6  GLY N 192 ? VAL N 196 ? GLY N 172 VAL N 176 
AI9 7  ILE N 202 ? GLU N 207 ? ILE N 182 GLU N 187 
AJ1 1  SER N 111 ? PRO N 116 ? SER N 91  PRO N 96  
AJ1 2  ARG N 81  ? THR N 86  ? ARG N 61  THR N 66  
AJ1 3  ALA N 33  ? LEU N 38  ? ALA N 13  LEU N 18  
AJ1 4  TYR N 148 ? ALA N 153 ? TYR N 128 ALA N 133 
AJ1 5  PHE N 221 ? HIS N 232 ? PHE N 201 HIS N 212 
AJ1 6  VAL N 176 ? PRO N 184 ? VAL N 156 PRO N 164 
AJ1 7  ALA N 267 ? ARG N 271 ? ALA N 247 ARG N 251 
AJ2 1  TYR N 59  ? PHE N 60  ? TYR N 39  PHE N 40  
AJ2 2  ALA N 64  ? ARG N 65  ? ALA N 44  ARG N 45  
AJ3 1  ILE N 157 ? TYR N 158 ? ILE N 137 TYR N 138 
AJ3 2  TRP N 287 ? ARG N 288 ? TRP N 267 ARG N 268 
AJ4 1  SER O 111 ? PRO O 116 ? SER O 91  PRO O 96  
AJ4 2  ARG O 81  ? THR O 86  ? ARG O 61  THR O 66  
AJ4 3  ALA O 33  ? LEU O 38  ? ALA O 13  LEU O 18  
AJ4 4  TYR O 148 ? ALA O 153 ? TYR O 128 ALA O 133 
AJ4 5  PHE O 221 ? HIS O 232 ? PHE O 201 HIS O 212 
AJ4 6  GLY O 192 ? VAL O 196 ? GLY O 172 VAL O 176 
AJ4 7  ILE O 202 ? GLU O 207 ? ILE O 182 GLU O 187 
AJ5 1  SER O 111 ? PRO O 116 ? SER O 91  PRO O 96  
AJ5 2  ARG O 81  ? THR O 86  ? ARG O 61  THR O 66  
AJ5 3  ALA O 33  ? LEU O 38  ? ALA O 13  LEU O 18  
AJ5 4  TYR O 148 ? ALA O 153 ? TYR O 128 ALA O 133 
AJ5 5  PHE O 221 ? HIS O 232 ? PHE O 201 HIS O 212 
AJ5 6  VAL O 176 ? PRO O 184 ? VAL O 156 PRO O 164 
AJ5 7  ALA O 267 ? ARG O 271 ? ALA O 247 ARG O 251 
AJ6 1  TYR O 59  ? PHE O 60  ? TYR O 39  PHE O 40  
AJ6 2  ALA O 64  ? ARG O 65  ? ALA O 44  ARG O 45  
AJ7 1  ILE O 157 ? TYR O 158 ? ILE O 137 TYR O 138 
AJ7 2  TRP O 287 ? ARG O 288 ? TRP O 267 ARG O 268 
AJ8 1  VAL O 402 ? ILE O 403 ? VAL O 382 ILE O 383 
AJ8 2  LYS O 385 ? ILE O 386 ? LYS O 365 ILE O 366 
AJ8 3  ARG O 368 ? ALA O 369 ? ARG O 348 ALA O 349 
AJ8 4  ILE O 352 ? SER O 354 ? ILE O 332 SER O 334 
AJ8 5  ALA O 329 ? VAL O 332 ? ALA O 309 VAL O 312 
AJ8 6  SER P 345 ? VAL P 347 ? SER P 325 VAL P 327 
AJ8 7  LEU P 362 ? LEU P 363 ? LEU P 342 LEU P 343 
AJ8 8  ARG P 374 ? VAL P 380 ? ARG P 354 VAL P 360 
AJ8 9  GLN P 391 ? ILE P 397 ? GLN P 371 ILE P 377 
AJ8 10 ILE P 408 ? VAL P 409 ? ILE P 388 VAL P 389 
AJ9 1  SER P 341 ? VAL P 343 ? SER P 321 VAL P 323 
AJ9 2  ALA P 357 ? ASN P 359 ? ALA P 337 ASN P 339 
AJ9 3  ARG P 374 ? VAL P 380 ? ARG P 354 VAL P 360 
AJ9 4  GLN P 391 ? ILE P 397 ? GLN P 371 ILE P 377 
AJ9 5  CYS P 428 ? ILE P 430 ? CYS P 408 ILE P 410 
AJ9 6  ARG P 421 ? ARG P 422 ? ARG P 401 ARG P 402 
AK1 1  SER O 341 ? VAL O 343 ? SER O 321 VAL O 323 
AK1 2  ALA O 357 ? ASN O 359 ? ALA O 337 ASN O 339 
AK1 3  ARG O 374 ? VAL O 380 ? ARG O 354 VAL O 360 
AK1 4  GLN O 391 ? ILE O 397 ? GLN O 371 ILE O 377 
AK1 5  CYS O 428 ? ILE O 430 ? CYS O 408 ILE O 410 
AK1 6  ARG O 421 ? ARG O 422 ? ARG O 401 ARG O 402 
AK2 1  ILE O 408 ? VAL O 409 ? ILE O 388 VAL O 389 
AK2 2  GLN O 391 ? ILE O 397 ? GLN O 371 ILE O 377 
AK2 3  ARG O 374 ? VAL O 380 ? ARG O 354 VAL O 360 
AK2 4  LEU O 362 ? LEU O 363 ? LEU O 342 LEU O 343 
AK2 5  SER O 345 ? VAL O 347 ? SER O 325 VAL O 327 
AK2 6  ALA P 329 ? VAL P 332 ? ALA P 309 VAL P 312 
AK2 7  ILE P 352 ? SER P 354 ? ILE P 332 SER P 334 
AK2 8  ARG P 368 ? ALA P 369 ? ARG P 348 ALA P 349 
AK2 9  LYS P 385 ? ILE P 386 ? LYS P 365 ILE P 366 
AK2 10 VAL P 402 ? ILE P 403 ? VAL P 382 ILE P 383 
AK3 1  SER P 111 ? PRO P 116 ? SER P 91  PRO P 96  
AK3 2  ARG P 81  ? THR P 86  ? ARG P 61  THR P 66  
AK3 3  ALA P 33  ? LEU P 38  ? ALA P 13  LEU P 18  
AK3 4  TYR P 148 ? ALA P 153 ? TYR P 128 ALA P 133 
AK3 5  PHE P 221 ? HIS P 232 ? PHE P 201 HIS P 212 
AK3 6  GLY P 192 ? VAL P 196 ? GLY P 172 VAL P 176 
AK3 7  ILE P 202 ? GLU P 207 ? ILE P 182 GLU P 187 
AK4 1  SER P 111 ? PRO P 116 ? SER P 91  PRO P 96  
AK4 2  ARG P 81  ? THR P 86  ? ARG P 61  THR P 66  
AK4 3  ALA P 33  ? LEU P 38  ? ALA P 13  LEU P 18  
AK4 4  TYR P 148 ? ALA P 153 ? TYR P 128 ALA P 133 
AK4 5  PHE P 221 ? HIS P 232 ? PHE P 201 HIS P 212 
AK4 6  VAL P 176 ? PRO P 184 ? VAL P 156 PRO P 164 
AK4 7  ALA P 267 ? ARG P 271 ? ALA P 247 ARG P 251 
AK5 1  TYR P 59  ? PHE P 60  ? TYR P 39  PHE P 40  
AK5 2  ALA P 64  ? ARG P 65  ? ALA P 44  ARG P 45  
AK6 1  ILE P 157 ? TYR P 158 ? ILE P 137 TYR P 138 
AK6 2  TRP P 287 ? ARG P 288 ? TRP P 267 ARG P 268 
AK7 1  SER Q 111 ? PRO Q 116 ? SER Q 91  PRO Q 96  
AK7 2  ARG Q 81  ? THR Q 86  ? ARG Q 61  THR Q 66  
AK7 3  ALA Q 33  ? LEU Q 38  ? ALA Q 13  LEU Q 18  
AK7 4  TYR Q 148 ? ALA Q 153 ? TYR Q 128 ALA Q 133 
AK7 5  PHE Q 221 ? HIS Q 232 ? PHE Q 201 HIS Q 212 
AK7 6  GLY Q 192 ? VAL Q 196 ? GLY Q 172 VAL Q 176 
AK7 7  ILE Q 202 ? GLU Q 207 ? ILE Q 182 GLU Q 187 
AK8 1  SER Q 111 ? PRO Q 116 ? SER Q 91  PRO Q 96  
AK8 2  ARG Q 81  ? THR Q 86  ? ARG Q 61  THR Q 66  
AK8 3  ALA Q 33  ? LEU Q 38  ? ALA Q 13  LEU Q 18  
AK8 4  TYR Q 148 ? ALA Q 153 ? TYR Q 128 ALA Q 133 
AK8 5  PHE Q 221 ? HIS Q 232 ? PHE Q 201 HIS Q 212 
AK8 6  VAL Q 176 ? PRO Q 184 ? VAL Q 156 PRO Q 164 
AK8 7  ALA Q 267 ? ARG Q 271 ? ALA Q 247 ARG Q 251 
AK9 1  TYR Q 59  ? PHE Q 60  ? TYR Q 39  PHE Q 40  
AK9 2  ALA Q 64  ? ARG Q 65  ? ALA Q 44  ARG Q 45  
AL1 1  ILE Q 157 ? TYR Q 158 ? ILE Q 137 TYR Q 138 
AL1 2  TRP Q 287 ? ARG Q 288 ? TRP Q 267 ARG Q 268 
AL2 1  VAL Q 402 ? ILE Q 403 ? VAL Q 382 ILE Q 383 
AL2 2  LYS Q 385 ? ILE Q 386 ? LYS Q 365 ILE Q 366 
AL2 3  ARG Q 368 ? ALA Q 369 ? ARG Q 348 ALA Q 349 
AL2 4  ILE Q 352 ? SER Q 354 ? ILE Q 332 SER Q 334 
AL2 5  ALA Q 329 ? VAL Q 332 ? ALA Q 309 VAL Q 312 
AL2 6  SER R 345 ? VAL R 347 ? SER R 325 VAL R 327 
AL2 7  LEU R 362 ? LEU R 363 ? LEU R 342 LEU R 343 
AL2 8  ARG R 374 ? VAL R 380 ? ARG R 354 VAL R 360 
AL2 9  GLN R 391 ? ILE R 397 ? GLN R 371 ILE R 377 
AL2 10 ILE R 408 ? VAL R 409 ? ILE R 388 VAL R 389 
AL3 1  SER R 341 ? VAL R 343 ? SER R 321 VAL R 323 
AL3 2  ALA R 357 ? ASN R 359 ? ALA R 337 ASN R 339 
AL3 3  ARG R 374 ? VAL R 380 ? ARG R 354 VAL R 360 
AL3 4  GLN R 391 ? ILE R 397 ? GLN R 371 ILE R 377 
AL3 5  CYS R 428 ? ILE R 430 ? CYS R 408 ILE R 410 
AL3 6  ARG R 421 ? ARG R 422 ? ARG R 401 ARG R 402 
AL4 1  SER Q 341 ? VAL Q 343 ? SER Q 321 VAL Q 323 
AL4 2  ALA Q 357 ? ASN Q 359 ? ALA Q 337 ASN Q 339 
AL4 3  ARG Q 374 ? VAL Q 380 ? ARG Q 354 VAL Q 360 
AL4 4  GLN Q 391 ? ILE Q 397 ? GLN Q 371 ILE Q 377 
AL4 5  CYS Q 428 ? ILE Q 430 ? CYS Q 408 ILE Q 410 
AL4 6  ARG Q 421 ? ARG Q 422 ? ARG Q 401 ARG Q 402 
AL5 1  ILE Q 408 ? VAL Q 409 ? ILE Q 388 VAL Q 389 
AL5 2  GLN Q 391 ? ILE Q 397 ? GLN Q 371 ILE Q 377 
AL5 3  ARG Q 374 ? VAL Q 380 ? ARG Q 354 VAL Q 360 
AL5 4  LEU Q 362 ? LEU Q 363 ? LEU Q 342 LEU Q 343 
AL5 5  SER Q 345 ? VAL Q 347 ? SER Q 325 VAL Q 327 
AL5 6  ALA R 329 ? VAL R 332 ? ALA R 309 VAL R 312 
AL5 7  ILE R 352 ? SER R 354 ? ILE R 332 SER R 334 
AL5 8  ARG R 368 ? ALA R 369 ? ARG R 348 ALA R 349 
AL5 9  LYS R 385 ? ILE R 386 ? LYS R 365 ILE R 366 
AL5 10 VAL R 402 ? ILE R 403 ? VAL R 382 ILE R 383 
AL6 1  SER R 111 ? PRO R 116 ? SER R 91  PRO R 96  
AL6 2  ARG R 81  ? THR R 86  ? ARG R 61  THR R 66  
AL6 3  ALA R 33  ? LEU R 38  ? ALA R 13  LEU R 18  
AL6 4  TYR R 148 ? ALA R 153 ? TYR R 128 ALA R 133 
AL6 5  PHE R 221 ? HIS R 232 ? PHE R 201 HIS R 212 
AL6 6  GLY R 192 ? VAL R 196 ? GLY R 172 VAL R 176 
AL6 7  ILE R 202 ? GLU R 207 ? ILE R 182 GLU R 187 
AL7 1  SER R 111 ? PRO R 116 ? SER R 91  PRO R 96  
AL7 2  ARG R 81  ? THR R 86  ? ARG R 61  THR R 66  
AL7 3  ALA R 33  ? LEU R 38  ? ALA R 13  LEU R 18  
AL7 4  TYR R 148 ? ALA R 153 ? TYR R 128 ALA R 133 
AL7 5  PHE R 221 ? HIS R 232 ? PHE R 201 HIS R 212 
AL7 6  VAL R 176 ? PRO R 184 ? VAL R 156 PRO R 164 
AL7 7  ALA R 267 ? ARG R 271 ? ALA R 247 ARG R 251 
AL8 1  TYR R 59  ? PHE R 60  ? TYR R 39  PHE R 40  
AL8 2  ALA R 64  ? ARG R 65  ? ALA R 44  ARG R 45  
AL9 1  ILE R 157 ? TYR R 158 ? ILE R 137 TYR R 138 
AL9 2  TRP R 287 ? ARG R 288 ? TRP R 267 ARG R 268 
AM1 1  SER S 111 ? PRO S 116 ? SER V 91  PRO V 96  
AM1 2  ARG S 81  ? THR S 86  ? ARG V 61  THR V 66  
AM1 3  ALA S 33  ? LEU S 38  ? ALA V 13  LEU V 18  
AM1 4  TYR S 148 ? ALA S 153 ? TYR V 128 ALA V 133 
AM1 5  PHE S 221 ? HIS S 232 ? PHE V 201 HIS V 212 
AM1 6  GLY S 192 ? VAL S 196 ? GLY V 172 VAL V 176 
AM1 7  ILE S 202 ? GLU S 207 ? ILE V 182 GLU V 187 
AM2 1  SER S 111 ? PRO S 116 ? SER V 91  PRO V 96  
AM2 2  ARG S 81  ? THR S 86  ? ARG V 61  THR V 66  
AM2 3  ALA S 33  ? LEU S 38  ? ALA V 13  LEU V 18  
AM2 4  TYR S 148 ? ALA S 153 ? TYR V 128 ALA V 133 
AM2 5  PHE S 221 ? HIS S 232 ? PHE V 201 HIS V 212 
AM2 6  VAL S 176 ? PRO S 184 ? VAL V 156 PRO V 164 
AM2 7  ALA S 267 ? ARG S 271 ? ALA V 247 ARG V 251 
AM3 1  TYR S 59  ? PHE S 60  ? TYR V 39  PHE V 40  
AM3 2  ALA S 64  ? ARG S 65  ? ALA V 44  ARG V 45  
AM4 1  ILE S 157 ? TYR S 158 ? ILE V 137 TYR V 138 
AM4 2  TRP S 287 ? ARG S 288 ? TRP V 267 ARG V 268 
AM5 1  VAL S 402 ? ILE S 403 ? VAL V 382 ILE V 383 
AM5 2  LYS S 385 ? ILE S 386 ? LYS V 365 ILE V 366 
AM5 3  ARG S 368 ? ALA S 369 ? ARG V 348 ALA V 349 
AM5 4  ILE S 352 ? SER S 354 ? ILE V 332 SER V 334 
AM5 5  ALA S 329 ? VAL S 332 ? ALA V 309 VAL V 312 
AM5 6  SER T 345 ? VAL T 347 ? SER T 325 VAL T 327 
AM5 7  LEU T 362 ? LEU T 363 ? LEU T 342 LEU T 343 
AM5 8  ARG T 374 ? VAL T 380 ? ARG T 354 VAL T 360 
AM5 9  GLN T 391 ? ILE T 397 ? GLN T 371 ILE T 377 
AM5 10 ILE T 408 ? VAL T 409 ? ILE T 388 VAL T 389 
AM6 1  SER T 341 ? VAL T 343 ? SER T 321 VAL T 323 
AM6 2  ALA T 357 ? ASN T 359 ? ALA T 337 ASN T 339 
AM6 3  ARG T 374 ? VAL T 380 ? ARG T 354 VAL T 360 
AM6 4  GLN T 391 ? ILE T 397 ? GLN T 371 ILE T 377 
AM6 5  CYS T 428 ? ILE T 430 ? CYS T 408 ILE T 410 
AM6 6  ARG T 421 ? ARG T 422 ? ARG T 401 ARG T 402 
AM7 1  SER S 341 ? VAL S 343 ? SER V 321 VAL V 323 
AM7 2  ALA S 357 ? ASN S 359 ? ALA V 337 ASN V 339 
AM7 3  ARG S 374 ? VAL S 380 ? ARG V 354 VAL V 360 
AM7 4  GLN S 391 ? ILE S 397 ? GLN V 371 ILE V 377 
AM7 5  CYS S 428 ? ILE S 430 ? CYS V 408 ILE V 410 
AM7 6  ARG S 421 ? ARG S 422 ? ARG V 401 ARG V 402 
AM8 1  ILE S 408 ? VAL S 409 ? ILE V 388 VAL V 389 
AM8 2  GLN S 391 ? ILE S 397 ? GLN V 371 ILE V 377 
AM8 3  ARG S 374 ? VAL S 380 ? ARG V 354 VAL V 360 
AM8 4  LEU S 362 ? LEU S 363 ? LEU V 342 LEU V 343 
AM8 5  SER S 345 ? VAL S 347 ? SER V 325 VAL V 327 
AM8 6  ALA T 329 ? VAL T 332 ? ALA T 309 VAL T 312 
AM8 7  ILE T 352 ? SER T 354 ? ILE T 332 SER T 334 
AM8 8  ARG T 368 ? ALA T 369 ? ARG T 348 ALA T 349 
AM8 9  LYS T 385 ? ILE T 386 ? LYS T 365 ILE T 366 
AM8 10 VAL T 402 ? ILE T 403 ? VAL T 382 ILE T 383 
AM9 1  SER T 111 ? PRO T 116 ? SER T 91  PRO T 96  
AM9 2  ARG T 81  ? THR T 86  ? ARG T 61  THR T 66  
AM9 3  ALA T 33  ? LEU T 38  ? ALA T 13  LEU T 18  
AM9 4  TYR T 148 ? ALA T 153 ? TYR T 128 ALA T 133 
AM9 5  PHE T 221 ? HIS T 232 ? PHE T 201 HIS T 212 
AM9 6  GLY T 192 ? VAL T 196 ? GLY T 172 VAL T 176 
AM9 7  ILE T 202 ? GLU T 207 ? ILE T 182 GLU T 187 
AN1 1  SER T 111 ? PRO T 116 ? SER T 91  PRO T 96  
AN1 2  ARG T 81  ? THR T 86  ? ARG T 61  THR T 66  
AN1 3  ALA T 33  ? LEU T 38  ? ALA T 13  LEU T 18  
AN1 4  TYR T 148 ? ALA T 153 ? TYR T 128 ALA T 133 
AN1 5  PHE T 221 ? HIS T 232 ? PHE T 201 HIS T 212 
AN1 6  VAL T 176 ? PRO T 184 ? VAL T 156 PRO T 164 
AN1 7  ALA T 267 ? ARG T 271 ? ALA T 247 ARG T 251 
AN2 1  TYR T 59  ? PHE T 60  ? TYR T 39  PHE T 40  
AN2 2  ALA T 64  ? ARG T 65  ? ALA T 44  ARG T 45  
AN3 1  ILE T 157 ? TYR T 158 ? ILE T 137 TYR T 138 
AN3 2  TRP T 287 ? ARG T 288 ? TRP T 267 ARG T 268 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  O LEU A 115 ? O LEU H 95  N VAL A 84  ? N VAL H 64  
AA1 2 3  O GLY A 83  ? O GLY H 63  N VAL A 37  ? N VAL H 17  
AA1 3 4  N LEU A 38  ? N LEU H 18  O LEU A 152 ? O LEU H 132 
AA1 4 5  N ILE A 151 ? N ILE H 131 O TYR A 229 ? O TYR H 209 
AA1 5 6  O SER A 225 ? O SER H 205 N GLY A 192 ? N GLY H 172 
AA1 6 7  N VAL A 193 ? N VAL H 173 O ILE A 206 ? O ILE H 186 
AA2 1 2  O LEU A 115 ? O LEU H 95  N VAL A 84  ? N VAL H 64  
AA2 2 3  O GLY A 83  ? O GLY H 63  N VAL A 37  ? N VAL H 17  
AA2 3 4  N LEU A 38  ? N LEU H 18  O LEU A 152 ? O LEU H 132 
AA2 4 5  N ILE A 151 ? N ILE H 131 O TYR A 229 ? O TYR H 209 
AA2 5 6  O ALA A 224 ? O ALA H 204 N LEU A 181 ? N LEU H 161 
AA2 6 7  N ILE A 178 ? N ILE H 158 O HIS A 270 ? O HIS H 250 
AA3 1 2  N PHE A 60  ? N PHE H 40  O ALA A 64  ? O ALA H 44  
AA4 1 2  N ILE A 157 ? N ILE H 137 O ARG A 288 ? O ARG H 268 
AA5 1 2  O ILE A 403 ? O ILE H 383 N LYS A 385 ? N LYS H 365 
AA5 2 3  O ILE A 386 ? O ILE H 366 N ARG A 368 ? N ARG H 348 
AA5 3 4  O ALA A 369 ? O ALA H 349 N SER A 354 ? N SER H 334 
AA5 4 5  O ILE A 353 ? O ILE H 333 N LYS A 330 ? N LYS H 310 
AA5 5 6  N PHE A 331 ? N PHE H 311 O SER H 345 ? O SER G 325 
AA5 6 7  N VAL H 346 ? N VAL G 326 O LEU H 363 ? O LEU G 343 
AA5 7 8  N LEU H 362 ? N LEU G 342 O VAL H 380 ? O VAL G 360 
AA5 8 9  N VAL H 379 ? N VAL G 359 O ILE H 397 ? O ILE G 377 
AA5 9 10 N GLN H 391 ? N GLN G 371 O VAL H 409 ? O VAL G 389 
AA6 1 2  N SER H 341 ? N SER G 321 O LEU H 358 ? O LEU G 338 
AA6 2 3  N LEU H 362 ? N LEU G 342 O VAL H 380 ? O VAL G 360 
AA6 3 4  N VAL H 379 ? N VAL G 359 O ILE H 397 ? O ILE G 377 
AA6 4 5  N VAL H 396 ? N VAL G 376 O ILE H 430 ? O ILE G 410 
AA6 5 6  O LEU H 429 ? O LEU G 409 N ARG H 421 ? N ARG G 401 
AA7 1 2  N SER A 341 ? N SER H 321 O LEU A 358 ? O LEU H 338 
AA7 2 3  N ALA A 357 ? N ALA H 337 O LEU A 375 ? O LEU H 355 
AA7 3 4  N VAL A 379 ? N VAL H 359 O ILE A 397 ? O ILE H 377 
AA7 4 5  N VAL A 396 ? N VAL H 376 O ILE A 430 ? O ILE H 410 
AA7 5 6  O LEU A 429 ? O LEU H 409 N ARG A 421 ? N ARG H 401 
AA8 1 2  O VAL A 409 ? O VAL H 389 N GLN A 391 ? N GLN H 371 
AA8 2 3  O ILE A 397 ? O ILE H 377 N VAL A 379 ? N VAL H 359 
AA8 3 4  O VAL A 380 ? O VAL H 360 N LEU A 362 ? N LEU H 342 
AA8 4 5  O LEU A 363 ? O LEU H 343 N VAL A 346 ? N VAL H 326 
AA8 5 6  N SER A 345 ? N SER H 325 O PHE H 331 ? O PHE G 311 
AA8 6 7  N LYS H 330 ? N LYS G 310 O ILE H 353 ? O ILE G 333 
AA8 7 8  N SER H 354 ? N SER G 334 O ALA H 369 ? O ALA G 349 
AA8 8 9  N ARG H 368 ? N ARG G 348 O ILE H 386 ? O ILE G 366 
AA8 9 10 N LYS H 385 ? N LYS G 365 O ILE H 403 ? O ILE G 383 
AA9 1 2  O LEU B 115 ? O LEU A 95  N VAL B 84  ? N VAL A 64  
AA9 2 3  O GLY B 83  ? O GLY A 63  N VAL B 37  ? N VAL A 17  
AA9 3 4  N TYR B 36  ? N TYR A 16  O VAL B 150 ? O VAL A 130 
AA9 4 5  N ILE B 151 ? N ILE A 131 O TYR B 229 ? O TYR A 209 
AA9 5 6  O SER B 225 ? O SER A 205 N GLY B 192 ? N GLY A 172 
AA9 6 7  N HIS B 195 ? N HIS A 175 O ASP B 204 ? O ASP A 184 
AB1 1 2  O LEU B 115 ? O LEU A 95  N VAL B 84  ? N VAL A 64  
AB1 2 3  O GLY B 83  ? O GLY A 63  N VAL B 37  ? N VAL A 17  
AB1 3 4  N TYR B 36  ? N TYR A 16  O VAL B 150 ? O VAL A 130 
AB1 4 5  N ILE B 151 ? N ILE A 131 O TYR B 229 ? O TYR A 209 
AB1 5 6  O MET B 226 ? O MET A 206 N GLY B 179 ? N GLY A 159 
AB1 6 7  N ILE B 178 ? N ILE A 158 O HIS B 270 ? O HIS A 250 
AB2 1 2  N PHE B 60  ? N PHE A 40  O ALA B 64  ? O ALA A 44  
AB3 1 2  N ILE B 157 ? N ILE A 137 O ARG B 288 ? O ARG A 268 
AB4 1 2  O ILE B 403 ? O ILE A 383 N LYS B 385 ? N LYS A 365 
AB4 2 3  O ILE B 386 ? O ILE A 366 N ARG B 368 ? N ARG A 348 
AB4 3 4  O ALA B 369 ? O ALA A 349 N SER B 354 ? N SER A 334 
AB4 4 5  O ILE B 353 ? O ILE A 333 N LYS B 330 ? N LYS A 310 
AB4 5 6  N PHE B 331 ? N PHE A 311 O SER C 345 ? O SER B 325 
AB4 6 7  N VAL C 346 ? N VAL B 326 O LEU C 363 ? O LEU B 343 
AB4 7 8  N LEU C 362 ? N LEU B 342 O VAL C 380 ? O VAL B 360 
AB4 8 9  N VAL C 379 ? N VAL B 359 O ILE C 397 ? O ILE B 377 
AB4 9 10 N GLN C 391 ? N GLN B 371 O VAL C 409 ? O VAL B 389 
AB5 1 2  N VAL C 343 ? N VAL B 323 O LEU C 358 ? O LEU B 338 
AB5 2 3  N ALA C 357 ? N ALA B 337 O LEU C 375 ? O LEU B 355 
AB5 3 4  N VAL C 379 ? N VAL B 359 O ILE C 397 ? O ILE B 377 
AB5 4 5  N VAL C 396 ? N VAL B 376 O ILE C 430 ? O ILE B 410 
AB5 5 6  O LEU C 429 ? O LEU B 409 N ARG C 421 ? N ARG B 401 
AB6 1 2  N SER B 341 ? N SER A 321 O LEU B 358 ? O LEU A 338 
AB6 2 3  N ALA B 357 ? N ALA A 337 O LEU B 375 ? O LEU A 355 
AB6 3 4  N VAL B 379 ? N VAL A 359 O ILE B 397 ? O ILE A 377 
AB6 4 5  N VAL B 396 ? N VAL A 376 O ILE B 430 ? O ILE A 410 
AB6 5 6  O LEU B 429 ? O LEU A 409 N ARG B 421 ? N ARG A 401 
AB7 1 2  O VAL B 409 ? O VAL A 389 N GLN B 391 ? N GLN A 371 
AB7 2 3  O ILE B 397 ? O ILE A 377 N VAL B 379 ? N VAL A 359 
AB7 3 4  O VAL B 380 ? O VAL A 360 N LEU B 362 ? N LEU A 342 
AB7 4 5  O LEU B 363 ? O LEU A 343 N VAL B 346 ? N VAL A 326 
AB7 5 6  N SER B 345 ? N SER A 325 O PHE C 331 ? O PHE B 311 
AB7 6 7  N LYS C 330 ? N LYS B 310 O ILE C 353 ? O ILE B 333 
AB7 7 8  N SER C 354 ? N SER B 334 O ALA C 369 ? O ALA B 349 
AB7 8 9  N ARG C 368 ? N ARG B 348 O ILE C 386 ? O ILE B 366 
AB7 9 10 N LYS C 385 ? N LYS B 365 O ILE C 403 ? O ILE B 383 
AB8 1 2  O LEU C 115 ? O LEU B 95  N VAL C 84  ? N VAL B 64  
AB8 2 3  O GLY C 83  ? O GLY B 63  N VAL C 37  ? N VAL B 17  
AB8 3 4  N TYR C 36  ? N TYR B 16  O VAL C 150 ? O VAL B 130 
AB8 4 5  N ILE C 151 ? N ILE B 131 O TYR C 229 ? O TYR B 209 
AB8 5 6  O SER C 225 ? O SER B 205 N GLY C 192 ? N GLY B 172 
AB8 6 7  N HIS C 195 ? N HIS B 175 O ASP C 204 ? O ASP B 184 
AB9 1 2  O LEU C 115 ? O LEU B 95  N VAL C 84  ? N VAL B 64  
AB9 2 3  O GLY C 83  ? O GLY B 63  N VAL C 37  ? N VAL B 17  
AB9 3 4  N TYR C 36  ? N TYR B 16  O VAL C 150 ? O VAL B 130 
AB9 4 5  N ILE C 151 ? N ILE B 131 O TYR C 229 ? O TYR B 209 
AB9 5 6  O ALA C 224 ? O ALA B 204 N LEU C 181 ? N LEU B 161 
AB9 6 7  N CYS C 180 ? N CYS B 160 O HIS C 270 ? O HIS B 250 
AC1 1 2  N PHE C 60  ? N PHE B 40  O ALA C 64  ? O ALA B 44  
AC2 1 2  N ILE C 157 ? N ILE B 137 O ARG C 288 ? O ARG B 268 
AC3 1 2  O LEU D 115 ? O LEU C 95  N VAL D 84  ? N VAL C 64  
AC3 2 3  O GLY D 83  ? O GLY C 63  N VAL D 37  ? N VAL C 17  
AC3 3 4  N LEU D 38  ? N LEU C 18  O LEU D 152 ? O LEU C 132 
AC3 4 5  N ILE D 151 ? N ILE C 131 O TYR D 229 ? O TYR C 209 
AC3 5 6  O SER D 225 ? O SER C 205 N GLY D 192 ? N GLY C 172 
AC3 6 7  N HIS D 195 ? N HIS C 175 O ILE D 203 ? O ILE C 183 
AC4 1 2  O LEU D 115 ? O LEU C 95  N VAL D 84  ? N VAL C 64  
AC4 2 3  O GLY D 83  ? O GLY C 63  N VAL D 37  ? N VAL C 17  
AC4 3 4  N LEU D 38  ? N LEU C 18  O LEU D 152 ? O LEU C 132 
AC4 4 5  N ILE D 151 ? N ILE C 131 O TYR D 229 ? O TYR C 209 
AC4 5 6  O ALA D 224 ? O ALA C 204 N LEU D 181 ? N LEU C 161 
AC4 6 7  N CYS D 180 ? N CYS C 160 O HIS D 270 ? O HIS C 250 
AC5 1 2  N PHE D 60  ? N PHE C 40  O ALA D 64  ? O ALA C 44  
AC6 1 2  N ILE D 157 ? N ILE C 137 O ARG D 288 ? O ARG C 268 
AC7 1 2  O ILE D 403 ? O ILE C 383 N LYS D 385 ? N LYS C 365 
AC7 2 3  O ILE D 386 ? O ILE C 366 N ARG D 368 ? N ARG C 348 
AC7 3 4  O ALA D 369 ? O ALA C 349 N SER D 354 ? N SER C 334 
AC7 4 5  O ILE D 353 ? O ILE C 333 N LYS D 330 ? N LYS C 310 
AC7 5 6  N PHE D 331 ? N PHE C 311 O SER E 345 ? O SER D 325 
AC7 6 7  N VAL E 346 ? N VAL D 326 O LEU E 363 ? O LEU D 343 
AC7 7 8  N LEU E 362 ? N LEU D 342 O VAL E 380 ? O VAL D 360 
AC7 8 9  N VAL E 379 ? N VAL D 359 O ILE E 397 ? O ILE D 377 
AC7 9 10 N GLN E 391 ? N GLN D 371 O VAL E 409 ? O VAL D 389 
AC8 1 2  N SER E 341 ? N SER D 321 O LEU E 358 ? O LEU D 338 
AC8 2 3  N ALA E 357 ? N ALA D 337 O LEU E 375 ? O LEU D 355 
AC8 3 4  N VAL E 379 ? N VAL D 359 O ILE E 397 ? O ILE D 377 
AC8 4 5  N VAL E 396 ? N VAL D 376 O ILE E 430 ? O ILE D 410 
AC8 5 6  O LEU E 429 ? O LEU D 409 N ARG E 421 ? N ARG D 401 
AC9 1 2  N SER D 341 ? N SER C 321 O LEU D 358 ? O LEU C 338 
AC9 2 3  N ALA D 357 ? N ALA C 337 O LEU D 375 ? O LEU C 355 
AC9 3 4  N VAL D 379 ? N VAL C 359 O ILE D 397 ? O ILE C 377 
AC9 4 5  N VAL D 396 ? N VAL C 376 O ILE D 430 ? O ILE C 410 
AC9 5 6  O LEU D 429 ? O LEU C 409 N ARG D 421 ? N ARG C 401 
AD1 1 2  O VAL D 409 ? O VAL C 389 N GLN D 391 ? N GLN C 371 
AD1 2 3  O ILE D 397 ? O ILE C 377 N VAL D 379 ? N VAL C 359 
AD1 3 4  O VAL D 380 ? O VAL C 360 N LEU D 362 ? N LEU C 342 
AD1 4 5  O LEU D 363 ? O LEU C 343 N VAL D 346 ? N VAL C 326 
AD1 5 6  N SER D 345 ? N SER C 325 O PHE E 331 ? O PHE D 311 
AD1 6 7  N LYS E 330 ? N LYS D 310 O ILE E 353 ? O ILE D 333 
AD1 7 8  N SER E 354 ? N SER D 334 O ALA E 369 ? O ALA D 349 
AD1 8 9  N ARG E 368 ? N ARG D 348 O ILE E 386 ? O ILE D 366 
AD1 9 10 N LYS E 385 ? N LYS D 365 O ILE E 403 ? O ILE D 383 
AD2 1 2  O LEU E 115 ? O LEU D 95  N VAL E 84  ? N VAL D 64  
AD2 2 3  O GLY E 83  ? O GLY D 63  N VAL E 37  ? N VAL D 17  
AD2 3 4  N LEU E 38  ? N LEU D 18  O LEU E 152 ? O LEU D 132 
AD2 4 5  N ILE E 151 ? N ILE D 131 O TYR E 229 ? O TYR D 209 
AD2 5 6  O SER E 225 ? O SER D 205 N GLY E 192 ? N GLY D 172 
AD2 6 7  N HIS E 195 ? N HIS D 175 O ILE E 203 ? O ILE D 183 
AD3 1 2  O LEU E 115 ? O LEU D 95  N VAL E 84  ? N VAL D 64  
AD3 2 3  O GLY E 83  ? O GLY D 63  N VAL E 37  ? N VAL D 17  
AD3 3 4  N LEU E 38  ? N LEU D 18  O LEU E 152 ? O LEU D 132 
AD3 4 5  N ILE E 151 ? N ILE D 131 O TYR E 229 ? O TYR D 209 
AD3 5 6  O ALA E 224 ? O ALA D 204 N LEU E 181 ? N LEU D 161 
AD3 6 7  N CYS E 180 ? N CYS D 160 O HIS E 270 ? O HIS D 250 
AD4 1 2  N PHE E 60  ? N PHE D 40  O ALA E 64  ? O ALA D 44  
AD5 1 2  N ILE E 157 ? N ILE D 137 O ARG E 288 ? O ARG D 268 
AD6 1 2  O LEU F 115 ? O LEU E 95  N VAL F 84  ? N VAL E 64  
AD6 2 3  O GLY F 83  ? O GLY E 63  N VAL F 37  ? N VAL E 17  
AD6 3 4  N TYR F 36  ? N TYR E 16  O VAL F 150 ? O VAL E 130 
AD6 4 5  N ILE F 151 ? N ILE E 131 O TYR F 229 ? O TYR E 209 
AD6 5 6  O SER F 225 ? O SER E 205 N GLY F 192 ? N GLY E 172 
AD6 6 7  N VAL F 193 ? N VAL E 173 O ILE F 206 ? O ILE E 186 
AD7 1 2  O LEU F 115 ? O LEU E 95  N VAL F 84  ? N VAL E 64  
AD7 2 3  O GLY F 83  ? O GLY E 63  N VAL F 37  ? N VAL E 17  
AD7 3 4  N TYR F 36  ? N TYR E 16  O VAL F 150 ? O VAL E 130 
AD7 4 5  N ILE F 151 ? N ILE E 131 O TYR F 229 ? O TYR E 209 
AD7 5 6  O ALA F 224 ? O ALA E 204 N LEU F 181 ? N LEU E 161 
AD7 6 7  N ILE F 178 ? N ILE E 158 O HIS F 270 ? O HIS E 250 
AD8 1 2  N PHE F 60  ? N PHE E 40  O ALA F 64  ? O ALA E 44  
AD9 1 2  N ILE F 157 ? N ILE E 137 O ARG F 288 ? O ARG E 268 
AE1 1 2  O ILE F 403 ? O ILE E 383 N LYS F 385 ? N LYS E 365 
AE1 2 3  O ILE F 386 ? O ILE E 366 N ARG F 368 ? N ARG E 348 
AE1 3 4  O ALA F 369 ? O ALA E 349 N SER F 354 ? N SER E 334 
AE1 4 5  O ILE F 353 ? O ILE E 333 N LYS F 330 ? N LYS E 310 
AE1 5 6  N ALA F 329 ? N ALA E 309 O VAL G 347 ? O VAL F 327 
AE1 6 7  N VAL G 346 ? N VAL F 326 O LEU G 363 ? O LEU F 343 
AE1 7 8  N LEU G 362 ? N LEU F 342 O VAL G 380 ? O VAL F 360 
AE1 8 9  N VAL G 379 ? N VAL F 359 O ILE G 397 ? O ILE F 377 
AE1 9 10 N GLN G 391 ? N GLN F 371 O VAL G 409 ? O VAL F 389 
AE2 1 2  N SER G 341 ? N SER F 321 O LEU G 358 ? O LEU F 338 
AE2 2 3  N ALA G 357 ? N ALA F 337 O LEU G 375 ? O LEU F 355 
AE2 3 4  N VAL G 379 ? N VAL F 359 O ILE G 397 ? O ILE F 377 
AE2 4 5  N VAL G 396 ? N VAL F 376 O ILE G 430 ? O ILE F 410 
AE2 5 6  O LEU G 429 ? O LEU F 409 N ARG G 421 ? N ARG F 401 
AE3 1 2  N VAL F 343 ? N VAL E 323 O LEU F 358 ? O LEU E 338 
AE3 2 3  N ALA F 357 ? N ALA E 337 O LEU F 375 ? O LEU E 355 
AE3 3 4  N VAL F 379 ? N VAL E 359 O ILE F 397 ? O ILE E 377 
AE3 4 5  N VAL F 396 ? N VAL E 376 O ILE F 430 ? O ILE E 410 
AE3 5 6  O LEU F 429 ? O LEU E 409 N ARG F 421 ? N ARG E 401 
AE4 1 2  O VAL F 409 ? O VAL E 389 N GLN F 391 ? N GLN E 371 
AE4 2 3  O ILE F 397 ? O ILE E 377 N VAL F 379 ? N VAL E 359 
AE4 3 4  O VAL F 380 ? O VAL E 360 N LEU F 362 ? N LEU E 342 
AE4 4 5  O LEU F 363 ? O LEU E 343 N VAL F 346 ? N VAL E 326 
AE4 5 6  N SER F 345 ? N SER E 325 O PHE G 331 ? O PHE F 311 
AE4 6 7  N LYS G 330 ? N LYS F 310 O ILE G 353 ? O ILE F 333 
AE4 7 8  N SER G 354 ? N SER F 334 O ALA G 369 ? O ALA F 349 
AE4 8 9  N ARG G 368 ? N ARG F 348 O ILE G 386 ? O ILE F 366 
AE4 9 10 N LYS G 385 ? N LYS F 365 O ILE G 403 ? O ILE F 383 
AE5 1 2  O LEU G 115 ? O LEU F 95  N VAL G 84  ? N VAL F 64  
AE5 2 3  O GLY G 83  ? O GLY F 63  N VAL G 37  ? N VAL F 17  
AE5 3 4  N LEU G 38  ? N LEU F 18  O LEU G 152 ? O LEU F 132 
AE5 4 5  N ILE G 151 ? N ILE F 131 O TYR G 229 ? O TYR F 209 
AE5 5 6  O SER G 225 ? O SER F 205 N GLY G 192 ? N GLY F 172 
AE5 6 7  N VAL G 193 ? N VAL F 173 O ILE G 206 ? O ILE F 186 
AE6 1 2  O LEU G 115 ? O LEU F 95  N VAL G 84  ? N VAL F 64  
AE6 2 3  O GLY G 83  ? O GLY F 63  N VAL G 37  ? N VAL F 17  
AE6 3 4  N LEU G 38  ? N LEU F 18  O LEU G 152 ? O LEU F 132 
AE6 4 5  N ILE G 151 ? N ILE F 131 O TYR G 229 ? O TYR F 209 
AE6 5 6  O MET G 226 ? O MET F 206 N GLY G 179 ? N GLY F 159 
AE6 6 7  N ILE G 178 ? N ILE F 158 O HIS G 270 ? O HIS F 250 
AE7 1 2  N PHE G 60  ? N PHE F 40  O ALA G 64  ? O ALA F 44  
AE8 1 2  N ILE G 157 ? N ILE F 137 O ARG G 288 ? O ARG F 268 
AE9 1 2  O LEU H 115 ? O LEU G 95  N VAL H 84  ? N VAL G 64  
AE9 2 3  O GLY H 83  ? O GLY G 63  N VAL H 37  ? N VAL G 17  
AE9 3 4  N LEU H 38  ? N LEU G 18  O LEU H 152 ? O LEU G 132 
AE9 4 5  N ILE H 151 ? N ILE G 131 O TYR H 229 ? O TYR G 209 
AE9 5 6  O SER H 225 ? O SER G 205 N GLY H 192 ? N GLY G 172 
AE9 6 7  N VAL H 193 ? N VAL G 173 O ILE H 206 ? O ILE G 186 
AF1 1 2  O LEU H 115 ? O LEU G 95  N VAL H 84  ? N VAL G 64  
AF1 2 3  O GLY H 83  ? O GLY G 63  N VAL H 37  ? N VAL G 17  
AF1 3 4  N LEU H 38  ? N LEU G 18  O LEU H 152 ? O LEU G 132 
AF1 4 5  N ILE H 151 ? N ILE G 131 O TYR H 229 ? O TYR G 209 
AF1 5 6  O MET H 226 ? O MET G 206 N GLY H 179 ? N GLY G 159 
AF1 6 7  N CYS H 180 ? N CYS G 160 O HIS H 270 ? O HIS G 250 
AF2 1 2  N PHE H 60  ? N PHE G 40  O ALA H 64  ? O ALA G 44  
AF3 1 2  N ILE H 157 ? N ILE G 137 O ARG H 288 ? O ARG G 268 
AF4 1 2  O LEU I 115 ? O LEU I 95  N VAL I 84  ? N VAL I 64  
AF4 2 3  O GLY I 83  ? O GLY I 63  N VAL I 37  ? N VAL I 17  
AF4 3 4  N LEU I 38  ? N LEU I 18  O LEU I 152 ? O LEU I 132 
AF4 4 5  N ILE I 151 ? N ILE I 131 O TYR I 229 ? O TYR I 209 
AF4 5 6  O SER I 225 ? O SER I 205 N GLY I 192 ? N GLY I 172 
AF4 6 7  N VAL I 193 ? N VAL I 173 O ILE I 206 ? O ILE I 186 
AF5 1 2  O LEU I 115 ? O LEU I 95  N VAL I 84  ? N VAL I 64  
AF5 2 3  O GLY I 83  ? O GLY I 63  N VAL I 37  ? N VAL I 17  
AF5 3 4  N LEU I 38  ? N LEU I 18  O LEU I 152 ? O LEU I 132 
AF5 4 5  N ILE I 151 ? N ILE I 131 O TYR I 229 ? O TYR I 209 
AF5 5 6  O ALA I 224 ? O ALA I 204 N LEU I 181 ? N LEU I 161 
AF5 6 7  N CYS I 180 ? N CYS I 160 O HIS I 270 ? O HIS I 250 
AF6 1 2  N PHE I 60  ? N PHE I 40  O ALA I 64  ? O ALA I 44  
AF7 1 2  N ILE I 157 ? N ILE I 137 O ARG I 288 ? O ARG I 268 
AF8 1 2  O ILE I 403 ? O ILE I 383 N LYS I 385 ? N LYS I 365 
AF8 2 3  O ILE I 386 ? O ILE I 366 N ARG I 368 ? N ARG I 348 
AF8 3 4  O ALA I 369 ? O ALA I 349 N SER I 354 ? N SER I 334 
AF8 4 5  O ILE I 353 ? O ILE I 333 N LYS I 330 ? N LYS I 310 
AF8 5 6  N PHE I 331 ? N PHE I 311 O SER J 345 ? O SER J 325 
AF8 6 7  N VAL J 346 ? N VAL J 326 O LEU J 363 ? O LEU J 343 
AF8 7 8  N LEU J 362 ? N LEU J 342 O VAL J 380 ? O VAL J 360 
AF8 8 9  N VAL J 379 ? N VAL J 359 O ILE J 397 ? O ILE J 377 
AF8 9 10 N GLN J 391 ? N GLN J 371 O VAL J 409 ? O VAL J 389 
AF9 1 2  N SER J 341 ? N SER J 321 O LEU J 358 ? O LEU J 338 
AF9 2 3  N ALA J 357 ? N ALA J 337 O LEU J 375 ? O LEU J 355 
AF9 3 4  N VAL J 379 ? N VAL J 359 O ILE J 397 ? O ILE J 377 
AF9 4 5  N VAL J 396 ? N VAL J 376 O ILE J 430 ? O ILE J 410 
AF9 5 6  O LEU J 429 ? O LEU J 409 N ARG J 421 ? N ARG J 401 
AG1 1 2  N SER I 341 ? N SER I 321 O LEU I 358 ? O LEU I 338 
AG1 2 3  N ALA I 357 ? N ALA I 337 O LEU I 375 ? O LEU I 355 
AG1 3 4  N VAL I 379 ? N VAL I 359 O ILE I 397 ? O ILE I 377 
AG1 4 5  N VAL I 396 ? N VAL I 376 O ILE I 430 ? O ILE I 410 
AG1 5 6  O LEU I 429 ? O LEU I 409 N ARG I 421 ? N ARG I 401 
AG2 1 2  O VAL I 409 ? O VAL I 389 N GLN I 391 ? N GLN I 371 
AG2 2 3  O ILE I 397 ? O ILE I 377 N VAL I 379 ? N VAL I 359 
AG2 3 4  O VAL I 380 ? O VAL I 360 N LEU I 362 ? N LEU I 342 
AG2 4 5  O LEU I 363 ? O LEU I 343 N VAL I 346 ? N VAL I 326 
AG2 5 6  N SER I 345 ? N SER I 325 O PHE J 331 ? O PHE J 311 
AG2 6 7  N LYS J 330 ? N LYS J 310 O ILE J 353 ? O ILE J 333 
AG2 7 8  N SER J 354 ? N SER J 334 O ALA J 369 ? O ALA J 349 
AG2 8 9  N ARG J 368 ? N ARG J 348 O ILE J 386 ? O ILE J 366 
AG2 9 10 N LYS J 385 ? N LYS J 365 O ILE J 403 ? O ILE J 383 
AG3 1 2  O LEU J 115 ? O LEU J 95  N VAL J 84  ? N VAL J 64  
AG3 2 3  O GLY J 83  ? O GLY J 63  N VAL J 37  ? N VAL J 17  
AG3 3 4  N LEU J 38  ? N LEU J 18  O LEU J 152 ? O LEU J 132 
AG3 4 5  N ILE J 151 ? N ILE J 131 O TYR J 229 ? O TYR J 209 
AG3 5 6  O SER J 225 ? O SER J 205 N GLY J 192 ? N GLY J 172 
AG3 6 7  N HIS J 195 ? N HIS J 175 O ILE J 203 ? O ILE J 183 
AG4 1 2  O LEU J 115 ? O LEU J 95  N VAL J 84  ? N VAL J 64  
AG4 2 3  O GLY J 83  ? O GLY J 63  N VAL J 37  ? N VAL J 17  
AG4 3 4  N LEU J 38  ? N LEU J 18  O LEU J 152 ? O LEU J 132 
AG4 4 5  N ILE J 151 ? N ILE J 131 O TYR J 229 ? O TYR J 209 
AG4 5 6  O ALA J 224 ? O ALA J 204 N LEU J 181 ? N LEU J 161 
AG4 6 7  N CYS J 180 ? N CYS J 160 O HIS J 270 ? O HIS J 250 
AG5 1 2  N PHE J 60  ? N PHE J 40  O ALA J 64  ? O ALA J 44  
AG6 1 2  N ILE J 157 ? N ILE J 137 O ARG J 288 ? O ARG J 268 
AG7 1 2  O LEU K 115 ? O LEU K 95  N VAL K 84  ? N VAL K 64  
AG7 2 3  O GLY K 83  ? O GLY K 63  N VAL K 37  ? N VAL K 17  
AG7 3 4  N LEU K 38  ? N LEU K 18  O LEU K 152 ? O LEU K 132 
AG7 4 5  N ILE K 151 ? N ILE K 131 O TYR K 229 ? O TYR K 209 
AG7 5 6  O SER K 225 ? O SER K 205 N GLY K 192 ? N GLY K 172 
AG7 6 7  N VAL K 193 ? N VAL K 173 O ILE K 206 ? O ILE K 186 
AG8 1 2  O LEU K 115 ? O LEU K 95  N VAL K 84  ? N VAL K 64  
AG8 2 3  O GLY K 83  ? O GLY K 63  N VAL K 37  ? N VAL K 17  
AG8 3 4  N LEU K 38  ? N LEU K 18  O LEU K 152 ? O LEU K 132 
AG8 4 5  N ILE K 151 ? N ILE K 131 O TYR K 229 ? O TYR K 209 
AG8 5 6  O ALA K 222 ? O ALA K 202 N VAL K 183 ? N VAL K 163 
AG8 6 7  N CYS K 180 ? N CYS K 160 O HIS K 270 ? O HIS K 250 
AG9 1 2  N PHE K 60  ? N PHE K 40  O ALA K 64  ? O ALA K 44  
AH1 1 2  N ILE K 157 ? N ILE K 137 O ARG K 288 ? O ARG K 268 
AH2 1 2  O ILE K 403 ? O ILE K 383 N LYS K 385 ? N LYS K 365 
AH2 2 3  O ILE K 386 ? O ILE K 366 N ARG K 368 ? N ARG K 348 
AH2 3 4  O ALA K 369 ? O ALA K 349 N SER K 354 ? N SER K 334 
AH2 4 5  O ILE K 353 ? O ILE K 333 N LYS K 330 ? N LYS K 310 
AH2 5 6  N PHE K 331 ? N PHE K 311 O SER L 345 ? O SER L 325 
AH2 6 7  N VAL L 346 ? N VAL L 326 O SER L 361 ? O SER L 341 
AH2 7 8  N LEU L 362 ? N LEU L 342 O VAL L 380 ? O VAL L 360 
AH2 8 9  N VAL L 379 ? N VAL L 359 O ILE L 397 ? O ILE L 377 
AH2 9 10 N GLN L 391 ? N GLN L 371 O VAL L 409 ? O VAL L 389 
AH3 1 2  N SER L 341 ? N SER L 321 O LEU L 358 ? O LEU L 338 
AH3 2 3  N LEU L 362 ? N LEU L 342 O VAL L 380 ? O VAL L 360 
AH3 3 4  N VAL L 379 ? N VAL L 359 O ILE L 397 ? O ILE L 377 
AH3 4 5  N VAL L 396 ? N VAL L 376 O ILE L 430 ? O ILE L 410 
AH3 5 6  O LEU L 429 ? O LEU L 409 N ARG L 421 ? N ARG L 401 
AH4 1 2  N SER K 341 ? N SER K 321 O LEU K 358 ? O LEU K 338 
AH4 2 3  N ALA K 357 ? N ALA K 337 O LEU K 375 ? O LEU K 355 
AH4 3 4  N VAL K 379 ? N VAL K 359 O ILE K 397 ? O ILE K 377 
AH4 4 5  N VAL K 396 ? N VAL K 376 O ILE K 430 ? O ILE K 410 
AH4 5 6  O LEU K 429 ? O LEU K 409 N ARG K 421 ? N ARG K 401 
AH5 1 2  O VAL K 409 ? O VAL K 389 N GLN K 391 ? N GLN K 371 
AH5 2 3  O ILE K 397 ? O ILE K 377 N VAL K 379 ? N VAL K 359 
AH5 3 4  O VAL K 380 ? O VAL K 360 N LEU K 362 ? N LEU K 342 
AH5 4 5  O LEU K 363 ? O LEU K 343 N VAL K 346 ? N VAL K 326 
AH5 5 6  N SER K 345 ? N SER K 325 O PHE L 331 ? O PHE L 311 
AH5 6 7  N LYS L 330 ? N LYS L 310 O ILE L 353 ? O ILE L 333 
AH5 7 8  N SER L 354 ? N SER L 334 O ALA L 369 ? O ALA L 349 
AH5 8 9  N ARG L 368 ? N ARG L 348 O ILE L 386 ? O ILE L 366 
AH5 9 10 N LYS L 385 ? N LYS L 365 O ILE L 403 ? O ILE L 383 
AH6 1 2  O LEU L 115 ? O LEU L 95  N VAL L 84  ? N VAL L 64  
AH6 2 3  O GLY L 83  ? O GLY L 63  N VAL L 37  ? N VAL L 17  
AH6 3 4  N LEU L 38  ? N LEU L 18  O LEU L 152 ? O LEU L 132 
AH6 4 5  N ILE L 151 ? N ILE L 131 O TYR L 229 ? O TYR L 209 
AH6 5 6  O SER L 225 ? O SER L 205 N GLY L 192 ? N GLY L 172 
AH6 6 7  N VAL L 193 ? N VAL L 173 O ILE L 206 ? O ILE L 186 
AH7 1 2  O LEU L 115 ? O LEU L 95  N VAL L 84  ? N VAL L 64  
AH7 2 3  O GLY L 83  ? O GLY L 63  N VAL L 37  ? N VAL L 17  
AH7 3 4  N LEU L 38  ? N LEU L 18  O LEU L 152 ? O LEU L 132 
AH7 4 5  N ILE L 151 ? N ILE L 131 O TYR L 229 ? O TYR L 209 
AH7 5 6  O ALA L 224 ? O ALA L 204 N LEU L 181 ? N LEU L 161 
AH7 6 7  N ILE L 178 ? N ILE L 158 O HIS L 270 ? O HIS L 250 
AH8 1 2  N PHE L 60  ? N PHE L 40  O ALA L 64  ? O ALA L 44  
AH9 1 2  N ILE L 157 ? N ILE L 137 O ARG L 288 ? O ARG L 268 
AI1 1 2  O LEU M 115 ? O LEU M 95  N VAL M 84  ? N VAL M 64  
AI1 2 3  O GLY M 83  ? O GLY M 63  N VAL M 37  ? N VAL M 17  
AI1 3 4  N TYR M 36  ? N TYR M 16  O VAL M 150 ? O VAL M 130 
AI1 4 5  N ILE M 151 ? N ILE M 131 O TYR M 229 ? O TYR M 209 
AI1 5 6  O SER M 225 ? O SER M 205 N GLY M 192 ? N GLY M 172 
AI1 6 7  N VAL M 193 ? N VAL M 173 O ILE M 206 ? O ILE M 186 
AI2 1 2  O LEU M 115 ? O LEU M 95  N VAL M 84  ? N VAL M 64  
AI2 2 3  O GLY M 83  ? O GLY M 63  N VAL M 37  ? N VAL M 17  
AI2 3 4  N TYR M 36  ? N TYR M 16  O VAL M 150 ? O VAL M 130 
AI2 4 5  N ILE M 151 ? N ILE M 131 O TYR M 229 ? O TYR M 209 
AI2 5 6  O ALA M 222 ? O ALA M 202 N VAL M 183 ? N VAL M 163 
AI2 6 7  N ILE M 178 ? N ILE M 158 O HIS M 270 ? O HIS M 250 
AI3 1 2  N PHE M 60  ? N PHE M 40  O ALA M 64  ? O ALA M 44  
AI4 1 2  N ILE M 157 ? N ILE M 137 O ARG M 288 ? O ARG M 268 
AI5 1 2  O ILE M 403 ? O ILE M 383 N LYS M 385 ? N LYS M 365 
AI5 2 3  O ILE M 386 ? O ILE M 366 N ARG M 368 ? N ARG M 348 
AI5 3 4  O ALA M 369 ? O ALA M 349 N SER M 354 ? N SER M 334 
AI5 4 5  O ILE M 353 ? O ILE M 333 N LYS M 330 ? N LYS M 310 
AI5 5 6  N PHE M 331 ? N PHE M 311 O SER N 345 ? O SER N 325 
AI5 6 7  N VAL N 346 ? N VAL N 326 O LEU N 363 ? O LEU N 343 
AI5 7 8  N LEU N 362 ? N LEU N 342 O VAL N 380 ? O VAL N 360 
AI5 8 9  N VAL N 379 ? N VAL N 359 O ILE N 397 ? O ILE N 377 
AI5 9 10 N GLN N 391 ? N GLN N 371 O VAL N 409 ? O VAL N 389 
AI6 1 2  N SER N 341 ? N SER N 321 O LEU N 358 ? O LEU N 338 
AI6 2 3  N ALA N 357 ? N ALA N 337 O LEU N 375 ? O LEU N 355 
AI6 3 4  N VAL N 379 ? N VAL N 359 O ILE N 397 ? O ILE N 377 
AI6 4 5  N VAL N 396 ? N VAL N 376 O ILE N 430 ? O ILE N 410 
AI6 5 6  O LEU N 429 ? O LEU N 409 N ARG N 421 ? N ARG N 401 
AI7 1 2  N SER M 341 ? N SER M 321 O LEU M 358 ? O LEU M 338 
AI7 2 3  N ALA M 357 ? N ALA M 337 O LEU M 375 ? O LEU M 355 
AI7 3 4  N VAL M 379 ? N VAL M 359 O ILE M 397 ? O ILE M 377 
AI7 4 5  N VAL M 396 ? N VAL M 376 O ILE M 430 ? O ILE M 410 
AI7 5 6  O LEU M 429 ? O LEU M 409 N ARG M 421 ? N ARG M 401 
AI8 1 2  O VAL M 409 ? O VAL M 389 N GLN M 391 ? N GLN M 371 
AI8 2 3  O ILE M 397 ? O ILE M 377 N VAL M 379 ? N VAL M 359 
AI8 3 4  O VAL M 380 ? O VAL M 360 N LEU M 362 ? N LEU M 342 
AI8 4 5  O LEU M 363 ? O LEU M 343 N VAL M 346 ? N VAL M 326 
AI8 5 6  N SER M 345 ? N SER M 325 O PHE N 331 ? O PHE N 311 
AI8 6 7  N LYS N 330 ? N LYS N 310 O ILE N 353 ? O ILE N 333 
AI8 7 8  N SER N 354 ? N SER N 334 O ALA N 369 ? O ALA N 349 
AI8 8 9  N ARG N 368 ? N ARG N 348 O ILE N 386 ? O ILE N 366 
AI8 9 10 N LYS N 385 ? N LYS N 365 O ILE N 403 ? O ILE N 383 
AI9 1 2  O LEU N 115 ? O LEU N 95  N VAL N 84  ? N VAL N 64  
AI9 2 3  O GLY N 83  ? O GLY N 63  N VAL N 37  ? N VAL N 17  
AI9 3 4  N LEU N 38  ? N LEU N 18  O LEU N 152 ? O LEU N 132 
AI9 4 5  N ILE N 151 ? N ILE N 131 O TYR N 229 ? O TYR N 209 
AI9 5 6  O SER N 225 ? O SER N 205 N GLY N 192 ? N GLY N 172 
AI9 6 7  N HIS N 195 ? N HIS N 175 O ILE N 203 ? O ILE N 183 
AJ1 1 2  O LEU N 115 ? O LEU N 95  N VAL N 84  ? N VAL N 64  
AJ1 2 3  O GLY N 83  ? O GLY N 63  N VAL N 37  ? N VAL N 17  
AJ1 3 4  N LEU N 38  ? N LEU N 18  O LEU N 152 ? O LEU N 132 
AJ1 4 5  N ILE N 151 ? N ILE N 131 O TYR N 229 ? O TYR N 209 
AJ1 5 6  O ALA N 224 ? O ALA N 204 N LEU N 181 ? N LEU N 161 
AJ1 6 7  N ILE N 178 ? N ILE N 158 O HIS N 270 ? O HIS N 250 
AJ2 1 2  N PHE N 60  ? N PHE N 40  O ALA N 64  ? O ALA N 44  
AJ3 1 2  N ILE N 157 ? N ILE N 137 O ARG N 288 ? O ARG N 268 
AJ4 1 2  O LEU O 115 ? O LEU O 95  N VAL O 84  ? N VAL O 64  
AJ4 2 3  O GLY O 83  ? O GLY O 63  N VAL O 37  ? N VAL O 17  
AJ4 3 4  N LEU O 38  ? N LEU O 18  O LEU O 152 ? O LEU O 132 
AJ4 4 5  N ILE O 151 ? N ILE O 131 O TYR O 229 ? O TYR O 209 
AJ4 5 6  O SER O 225 ? O SER O 205 N GLY O 192 ? N GLY O 172 
AJ4 6 7  N VAL O 193 ? N VAL O 173 O ILE O 206 ? O ILE O 186 
AJ5 1 2  O LEU O 115 ? O LEU O 95  N VAL O 84  ? N VAL O 64  
AJ5 2 3  O GLY O 83  ? O GLY O 63  N VAL O 37  ? N VAL O 17  
AJ5 3 4  N LEU O 38  ? N LEU O 18  O LEU O 152 ? O LEU O 132 
AJ5 4 5  N ILE O 151 ? N ILE O 131 O TYR O 229 ? O TYR O 209 
AJ5 5 6  O MET O 226 ? O MET O 206 N GLY O 179 ? N GLY O 159 
AJ5 6 7  N ILE O 178 ? N ILE O 158 O HIS O 270 ? O HIS O 250 
AJ6 1 2  N PHE O 60  ? N PHE O 40  O ALA O 64  ? O ALA O 44  
AJ7 1 2  N ILE O 157 ? N ILE O 137 O ARG O 288 ? O ARG O 268 
AJ8 1 2  O ILE O 403 ? O ILE O 383 N LYS O 385 ? N LYS O 365 
AJ8 2 3  O ILE O 386 ? O ILE O 366 N ARG O 368 ? N ARG O 348 
AJ8 3 4  O ALA O 369 ? O ALA O 349 N SER O 354 ? N SER O 334 
AJ8 4 5  O ILE O 353 ? O ILE O 333 N LYS O 330 ? N LYS O 310 
AJ8 5 6  N PHE O 331 ? N PHE O 311 O SER P 345 ? O SER P 325 
AJ8 6 7  N VAL P 346 ? N VAL P 326 O LEU P 363 ? O LEU P 343 
AJ8 7 8  N LEU P 362 ? N LEU P 342 O VAL P 380 ? O VAL P 360 
AJ8 8 9  N VAL P 379 ? N VAL P 359 O ILE P 397 ? O ILE P 377 
AJ8 9 10 N GLN P 391 ? N GLN P 371 O VAL P 409 ? O VAL P 389 
AJ9 1 2  N SER P 341 ? N SER P 321 O LEU P 358 ? O LEU P 338 
AJ9 2 3  N ALA P 357 ? N ALA P 337 O LEU P 375 ? O LEU P 355 
AJ9 3 4  N VAL P 379 ? N VAL P 359 O ILE P 397 ? O ILE P 377 
AJ9 4 5  N VAL P 396 ? N VAL P 376 O ILE P 430 ? O ILE P 410 
AJ9 5 6  O LEU P 429 ? O LEU P 409 N ARG P 421 ? N ARG P 401 
AK1 1 2  N SER O 341 ? N SER O 321 O LEU O 358 ? O LEU O 338 
AK1 2 3  N ALA O 357 ? N ALA O 337 O LEU O 375 ? O LEU O 355 
AK1 3 4  N VAL O 379 ? N VAL O 359 O VAL O 395 ? O VAL O 375 
AK1 4 5  N VAL O 396 ? N VAL O 376 O ILE O 430 ? O ILE O 410 
AK1 5 6  O LEU O 429 ? O LEU O 409 N ARG O 421 ? N ARG O 401 
AK2 1 2  O VAL O 409 ? O VAL O 389 N GLN O 391 ? N GLN O 371 
AK2 2 3  O VAL O 395 ? O VAL O 375 N VAL O 379 ? N VAL O 359 
AK2 3 4  O VAL O 380 ? O VAL O 360 N LEU O 362 ? N LEU O 342 
AK2 4 5  O LEU O 363 ? O LEU O 343 N VAL O 346 ? N VAL O 326 
AK2 5 6  N SER O 345 ? N SER O 325 O PHE P 331 ? O PHE P 311 
AK2 6 7  N LYS P 330 ? N LYS P 310 O ILE P 353 ? O ILE P 333 
AK2 7 8  N SER P 354 ? N SER P 334 O ALA P 369 ? O ALA P 349 
AK2 8 9  N ARG P 368 ? N ARG P 348 O ILE P 386 ? O ILE P 366 
AK2 9 10 N LYS P 385 ? N LYS P 365 O ILE P 403 ? O ILE P 383 
AK3 1 2  O LEU P 115 ? O LEU P 95  N VAL P 84  ? N VAL P 64  
AK3 2 3  O GLY P 83  ? O GLY P 63  N VAL P 37  ? N VAL P 17  
AK3 3 4  N LEU P 38  ? N LEU P 18  O LEU P 152 ? O LEU P 132 
AK3 4 5  N ILE P 151 ? N ILE P 131 O TYR P 229 ? O TYR P 209 
AK3 5 6  O SER P 225 ? O SER P 205 N GLY P 192 ? N GLY P 172 
AK3 6 7  N HIS P 195 ? N HIS P 175 O ILE P 203 ? O ILE P 183 
AK4 1 2  O LEU P 115 ? O LEU P 95  N VAL P 84  ? N VAL P 64  
AK4 2 3  O GLY P 83  ? O GLY P 63  N VAL P 37  ? N VAL P 17  
AK4 3 4  N LEU P 38  ? N LEU P 18  O LEU P 152 ? O LEU P 132 
AK4 4 5  N ILE P 151 ? N ILE P 131 O TYR P 229 ? O TYR P 209 
AK4 5 6  O ALA P 224 ? O ALA P 204 N LEU P 181 ? N LEU P 161 
AK4 6 7  N ILE P 178 ? N ILE P 158 O HIS P 270 ? O HIS P 250 
AK5 1 2  N PHE P 60  ? N PHE P 40  O ALA P 64  ? O ALA P 44  
AK6 1 2  N ILE P 157 ? N ILE P 137 O ARG P 288 ? O ARG P 268 
AK7 1 2  O LEU Q 115 ? O LEU Q 95  N VAL Q 84  ? N VAL Q 64  
AK7 2 3  O GLY Q 83  ? O GLY Q 63  N VAL Q 37  ? N VAL Q 17  
AK7 3 4  N LEU Q 38  ? N LEU Q 18  O LEU Q 152 ? O LEU Q 132 
AK7 4 5  N ILE Q 151 ? N ILE Q 131 O TYR Q 229 ? O TYR Q 209 
AK7 5 6  O SER Q 225 ? O SER Q 205 N GLY Q 192 ? N GLY Q 172 
AK7 6 7  N HIS Q 195 ? N HIS Q 175 O ILE Q 203 ? O ILE Q 183 
AK8 1 2  O LEU Q 115 ? O LEU Q 95  N VAL Q 84  ? N VAL Q 64  
AK8 2 3  O GLY Q 83  ? O GLY Q 63  N VAL Q 37  ? N VAL Q 17  
AK8 3 4  N LEU Q 38  ? N LEU Q 18  O LEU Q 152 ? O LEU Q 132 
AK8 4 5  N ILE Q 151 ? N ILE Q 131 O TYR Q 229 ? O TYR Q 209 
AK8 5 6  O ALA Q 224 ? O ALA Q 204 N LEU Q 181 ? N LEU Q 161 
AK8 6 7  N CYS Q 180 ? N CYS Q 160 O HIS Q 270 ? O HIS Q 250 
AK9 1 2  N PHE Q 60  ? N PHE Q 40  O ALA Q 64  ? O ALA Q 44  
AL1 1 2  N ILE Q 157 ? N ILE Q 137 O ARG Q 288 ? O ARG Q 268 
AL2 1 2  O ILE Q 403 ? O ILE Q 383 N LYS Q 385 ? N LYS Q 365 
AL2 2 3  O ILE Q 386 ? O ILE Q 366 N ARG Q 368 ? N ARG Q 348 
AL2 3 4  O ALA Q 369 ? O ALA Q 349 N SER Q 354 ? N SER Q 334 
AL2 4 5  O ILE Q 353 ? O ILE Q 333 N LYS Q 330 ? N LYS Q 310 
AL2 5 6  N PHE Q 331 ? N PHE Q 311 O SER R 345 ? O SER R 325 
AL2 6 7  N VAL R 346 ? N VAL R 326 O LEU R 363 ? O LEU R 343 
AL2 7 8  N LEU R 362 ? N LEU R 342 O VAL R 380 ? O VAL R 360 
AL2 8 9  N VAL R 379 ? N VAL R 359 O ILE R 397 ? O ILE R 377 
AL2 9 10 N GLN R 391 ? N GLN R 371 O VAL R 409 ? O VAL R 389 
AL3 1 2  N SER R 341 ? N SER R 321 O LEU R 358 ? O LEU R 338 
AL3 2 3  N ALA R 357 ? N ALA R 337 O LEU R 375 ? O LEU R 355 
AL3 3 4  N VAL R 379 ? N VAL R 359 O ILE R 397 ? O ILE R 377 
AL3 4 5  N VAL R 396 ? N VAL R 376 O ILE R 430 ? O ILE R 410 
AL3 5 6  O LEU R 429 ? O LEU R 409 N ARG R 421 ? N ARG R 401 
AL4 1 2  N SER Q 341 ? N SER Q 321 O LEU Q 358 ? O LEU Q 338 
AL4 2 3  N ALA Q 357 ? N ALA Q 337 O LEU Q 375 ? O LEU Q 355 
AL4 3 4  N VAL Q 379 ? N VAL Q 359 O ILE Q 397 ? O ILE Q 377 
AL4 4 5  N VAL Q 396 ? N VAL Q 376 O ILE Q 430 ? O ILE Q 410 
AL4 5 6  O LEU Q 429 ? O LEU Q 409 N ARG Q 421 ? N ARG Q 401 
AL5 1 2  O VAL Q 409 ? O VAL Q 389 N GLN Q 391 ? N GLN Q 371 
AL5 2 3  O ILE Q 397 ? O ILE Q 377 N VAL Q 379 ? N VAL Q 359 
AL5 3 4  O VAL Q 380 ? O VAL Q 360 N LEU Q 362 ? N LEU Q 342 
AL5 4 5  O LEU Q 363 ? O LEU Q 343 N VAL Q 346 ? N VAL Q 326 
AL5 5 6  N SER Q 345 ? N SER Q 325 O PHE R 331 ? O PHE R 311 
AL5 6 7  N LYS R 330 ? N LYS R 310 O ILE R 353 ? O ILE R 333 
AL5 7 8  N SER R 354 ? N SER R 334 O ALA R 369 ? O ALA R 349 
AL5 8 9  N ARG R 368 ? N ARG R 348 O ILE R 386 ? O ILE R 366 
AL5 9 10 N LYS R 385 ? N LYS R 365 O ILE R 403 ? O ILE R 383 
AL6 1 2  O LEU R 115 ? O LEU R 95  N VAL R 84  ? N VAL R 64  
AL6 2 3  O GLY R 83  ? O GLY R 63  N VAL R 37  ? N VAL R 17  
AL6 3 4  N LEU R 38  ? N LEU R 18  O LEU R 152 ? O LEU R 132 
AL6 4 5  N ILE R 151 ? N ILE R 131 O TYR R 229 ? O TYR R 209 
AL6 5 6  O SER R 225 ? O SER R 205 N GLY R 192 ? N GLY R 172 
AL6 6 7  N HIS R 195 ? N HIS R 175 O ILE R 203 ? O ILE R 183 
AL7 1 2  O LEU R 115 ? O LEU R 95  N VAL R 84  ? N VAL R 64  
AL7 2 3  O GLY R 83  ? O GLY R 63  N VAL R 37  ? N VAL R 17  
AL7 3 4  N LEU R 38  ? N LEU R 18  O LEU R 152 ? O LEU R 132 
AL7 4 5  N ILE R 151 ? N ILE R 131 O TYR R 229 ? O TYR R 209 
AL7 5 6  O ALA R 224 ? O ALA R 204 N LEU R 181 ? N LEU R 161 
AL7 6 7  N CYS R 180 ? N CYS R 160 O HIS R 270 ? O HIS R 250 
AL8 1 2  N PHE R 60  ? N PHE R 40  O ALA R 64  ? O ALA R 44  
AL9 1 2  N ILE R 157 ? N ILE R 137 O ARG R 288 ? O ARG R 268 
AM1 1 2  O LEU S 115 ? O LEU V 95  N VAL S 84  ? N VAL V 64  
AM1 2 3  O GLY S 83  ? O GLY V 63  N VAL S 37  ? N VAL V 17  
AM1 3 4  N LEU S 38  ? N LEU V 18  O LEU S 152 ? O LEU V 132 
AM1 4 5  N ILE S 151 ? N ILE V 131 O TYR S 229 ? O TYR V 209 
AM1 5 6  O SER S 225 ? O SER V 205 N GLY S 192 ? N GLY V 172 
AM1 6 7  N HIS S 195 ? N HIS V 175 O ILE S 203 ? O ILE V 183 
AM2 1 2  O LEU S 115 ? O LEU V 95  N VAL S 84  ? N VAL V 64  
AM2 2 3  O GLY S 83  ? O GLY V 63  N VAL S 37  ? N VAL V 17  
AM2 3 4  N LEU S 38  ? N LEU V 18  O LEU S 152 ? O LEU V 132 
AM2 4 5  N ILE S 151 ? N ILE V 131 O TYR S 229 ? O TYR V 209 
AM2 5 6  O ALA S 224 ? O ALA V 204 N LEU S 181 ? N LEU V 161 
AM2 6 7  N ILE S 178 ? N ILE V 158 O HIS S 270 ? O HIS V 250 
AM3 1 2  N PHE S 60  ? N PHE V 40  O ALA S 64  ? O ALA V 44  
AM4 1 2  N ILE S 157 ? N ILE V 137 O ARG S 288 ? O ARG V 268 
AM5 1 2  O ILE S 403 ? O ILE V 383 N LYS S 385 ? N LYS V 365 
AM5 2 3  O ILE S 386 ? O ILE V 366 N ARG S 368 ? N ARG V 348 
AM5 3 4  O ALA S 369 ? O ALA V 349 N SER S 354 ? N SER V 334 
AM5 4 5  O ILE S 353 ? O ILE V 333 N LYS S 330 ? N LYS V 310 
AM5 5 6  N PHE S 331 ? N PHE V 311 O SER T 345 ? O SER T 325 
AM5 6 7  N VAL T 346 ? N VAL T 326 O LEU T 363 ? O LEU T 343 
AM5 7 8  N LEU T 362 ? N LEU T 342 O VAL T 380 ? O VAL T 360 
AM5 8 9  N VAL T 379 ? N VAL T 359 O ILE T 397 ? O ILE T 377 
AM5 9 10 N GLN T 391 ? N GLN T 371 O VAL T 409 ? O VAL T 389 
AM6 1 2  N SER T 341 ? N SER T 321 O LEU T 358 ? O LEU T 338 
AM6 2 3  N ALA T 357 ? N ALA T 337 O LEU T 375 ? O LEU T 355 
AM6 3 4  N VAL T 379 ? N VAL T 359 O ILE T 397 ? O ILE T 377 
AM6 4 5  N VAL T 396 ? N VAL T 376 O ILE T 430 ? O ILE T 410 
AM6 5 6  O LEU T 429 ? O LEU T 409 N ARG T 421 ? N ARG T 401 
AM7 1 2  N SER S 341 ? N SER V 321 O LEU S 358 ? O LEU V 338 
AM7 2 3  N ALA S 357 ? N ALA V 337 O LEU S 375 ? O LEU V 355 
AM7 3 4  N VAL S 379 ? N VAL V 359 O ILE S 397 ? O ILE V 377 
AM7 4 5  N VAL S 396 ? N VAL V 376 O ILE S 430 ? O ILE V 410 
AM7 5 6  O LEU S 429 ? O LEU V 409 N ARG S 421 ? N ARG V 401 
AM8 1 2  O VAL S 409 ? O VAL V 389 N GLN S 391 ? N GLN V 371 
AM8 2 3  O ILE S 397 ? O ILE V 377 N VAL S 379 ? N VAL V 359 
AM8 3 4  O VAL S 380 ? O VAL V 360 N LEU S 362 ? N LEU V 342 
AM8 4 5  O LEU S 363 ? O LEU V 343 N VAL S 346 ? N VAL V 326 
AM8 5 6  N SER S 345 ? N SER V 325 O PHE T 331 ? O PHE T 311 
AM8 6 7  N LYS T 330 ? N LYS T 310 O ILE T 353 ? O ILE T 333 
AM8 7 8  N SER T 354 ? N SER T 334 O ALA T 369 ? O ALA T 349 
AM8 8 9  N ARG T 368 ? N ARG T 348 O ILE T 386 ? O ILE T 366 
AM8 9 10 N LYS T 385 ? N LYS T 365 O ILE T 403 ? O ILE T 383 
AM9 1 2  O LEU T 115 ? O LEU T 95  N VAL T 84  ? N VAL T 64  
AM9 2 3  O GLY T 83  ? O GLY T 63  N VAL T 37  ? N VAL T 17  
AM9 3 4  N LEU T 38  ? N LEU T 18  O LEU T 152 ? O LEU T 132 
AM9 4 5  N ILE T 151 ? N ILE T 131 O TYR T 229 ? O TYR T 209 
AM9 5 6  O SER T 225 ? O SER T 205 N GLY T 192 ? N GLY T 172 
AM9 6 7  N HIS T 195 ? N HIS T 175 O ILE T 203 ? O ILE T 183 
AN1 1 2  O LEU T 115 ? O LEU T 95  N VAL T 84  ? N VAL T 64  
AN1 2 3  O GLY T 83  ? O GLY T 63  N VAL T 37  ? N VAL T 17  
AN1 3 4  N LEU T 38  ? N LEU T 18  O LEU T 152 ? O LEU T 132 
AN1 4 5  N ILE T 151 ? N ILE T 131 O TYR T 229 ? O TYR T 209 
AN1 5 6  O ALA T 224 ? O ALA T 204 N LEU T 181 ? N LEU T 161 
AN1 6 7  N ILE T 178 ? N ILE T 158 O HIS T 270 ? O HIS T 250 
AN2 1 2  N PHE T 60  ? N PHE T 40  O ALA T 64  ? O ALA T 44  
AN3 1 2  N ILE T 157 ? N ILE T 137 O ARG T 288 ? O ARG T 268 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software H CIT 501 ? 6  'binding site for residue CIT H 501' 
AC2 Software H GOL 502 ? 8  'binding site for residue GOL H 502' 
AC3 Software A CIT 501 ? 7  'binding site for residue CIT A 501' 
AC4 Software A GOL 502 ? 7  'binding site for residue GOL A 502' 
AC5 Software B CIT 501 ? 6  'binding site for residue CIT B 501' 
AC6 Software B GOL 502 ? 9  'binding site for residue GOL B 502' 
AC7 Software C CIT 501 ? 11 'binding site for residue CIT C 501' 
AC8 Software C GOL 502 ? 8  'binding site for residue GOL C 502' 
AC9 Software D CIT 501 ? 8  'binding site for residue CIT D 501' 
AD1 Software D GOL 502 ? 7  'binding site for residue GOL D 502' 
AD2 Software E CIT 501 ? 6  'binding site for residue CIT E 501' 
AD3 Software E GOL 502 ? 7  'binding site for residue GOL E 502' 
AD4 Software F CIT 501 ? 6  'binding site for residue CIT F 501' 
AD5 Software F GOL 502 ? 4  'binding site for residue GOL F 502' 
AD6 Software G CIT 501 ? 7  'binding site for residue CIT G 501' 
AD7 Software G GOL 502 ? 10 'binding site for residue GOL G 502' 
AD8 Software I CIT 501 ? 9  'binding site for residue CIT I 501' 
AD9 Software I GOL 502 ? 7  'binding site for residue GOL I 502' 
AE1 Software J CIT 501 ? 7  'binding site for residue CIT J 501' 
AE2 Software J GOL 502 ? 5  'binding site for residue GOL J 502' 
AE3 Software J GOL 503 ? 9  'binding site for residue GOL J 503' 
AE4 Software K CIT 501 ? 6  'binding site for residue CIT K 501' 
AE5 Software K GOL 502 ? 6  'binding site for residue GOL K 502' 
AE6 Software K GOL 503 ? 10 'binding site for residue GOL K 503' 
AE7 Software L CIT 501 ? 8  'binding site for residue CIT L 501' 
AE8 Software L GOL 502 ? 5  'binding site for residue GOL L 502' 
AE9 Software M CIT 501 ? 7  'binding site for residue CIT M 501' 
AF1 Software M GOL 502 ? 5  'binding site for residue GOL M 502' 
AF2 Software N CIT 501 ? 7  'binding site for residue CIT N 501' 
AF3 Software N GOL 502 ? 8  'binding site for residue GOL N 502' 
AF4 Software O CIT 501 ? 8  'binding site for residue CIT O 501' 
AF5 Software O GOL 502 ? 7  'binding site for residue GOL O 502' 
AF6 Software P CIT 501 ? 8  'binding site for residue CIT P 501' 
AF7 Software P GOL 502 ? 6  'binding site for residue GOL P 502' 
AF8 Software Q CIT 501 ? 6  'binding site for residue CIT Q 501' 
AF9 Software Q GOL 502 ? 5  'binding site for residue GOL Q 502' 
AG1 Software R CIT 501 ? 8  'binding site for residue CIT R 501' 
AG2 Software R GOL 502 ? 7  'binding site for residue GOL R 502' 
AG3 Software V CIT 501 ? 8  'binding site for residue CIT V 501' 
AG4 Software V GOL 502 ? 7  'binding site for residue GOL V 502' 
AG5 Software T CIT 501 ? 8  'binding site for residue CIT T 501' 
AG6 Software T GOL 502 ? 8  'binding site for residue GOL T 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  HIS A  333 ? HIS H 313 . ? 1_555 ? 
2   AC1 6  SER A  354 ? SER H 334 . ? 1_555 ? 
3   AC1 6  ASN A  370 ? ASN H 350 . ? 1_555 ? 
4   AC1 6  SER A  371 ? SER H 351 . ? 1_555 ? 
5   AC1 6  ARG A  388 ? ARG H 368 . ? 1_555 ? 
6   AC1 6  HOH KB .   ? HOH H 659 . ? 1_555 ? 
7   AC2 8  PRO A  308 ? PRO H 288 . ? 1_555 ? 
8   AC2 8  ASP A  311 ? ASP H 291 . ? 1_555 ? 
9   AC2 8  TYR A  313 ? TYR H 293 . ? 1_555 ? 
10  AC2 8  HOH KB .   ? HOH H 649 . ? 1_555 ? 
11  AC2 8  HOH KB .   ? HOH H 650 . ? 1_555 ? 
12  AC2 8  HOH KB .   ? HOH H 684 . ? 1_555 ? 
13  AC2 8  HOH KB .   ? HOH H 703 . ? 1_555 ? 
14  AC2 8  HOH KB .   ? HOH H 756 . ? 1_555 ? 
15  AC3 7  HIS B  333 ? HIS A 313 . ? 1_555 ? 
16  AC3 7  SER B  354 ? SER A 334 . ? 1_555 ? 
17  AC3 7  ASN B  370 ? ASN A 350 . ? 1_555 ? 
18  AC3 7  SER B  371 ? SER A 351 . ? 1_555 ? 
19  AC3 7  ARG B  388 ? ARG A 368 . ? 1_555 ? 
20  AC3 7  HOH LB .   ? HOH A 610 . ? 1_555 ? 
21  AC3 7  HOH LB .   ? HOH A 752 . ? 1_555 ? 
22  AC4 7  ASP B  311 ? ASP A 291 . ? 1_555 ? 
23  AC4 7  TYR B  313 ? TYR A 293 . ? 1_555 ? 
24  AC4 7  HOH LB .   ? HOH A 648 . ? 1_555 ? 
25  AC4 7  HOH LB .   ? HOH A 659 . ? 1_555 ? 
26  AC4 7  HOH LB .   ? HOH A 700 . ? 1_555 ? 
27  AC4 7  HOH LB .   ? HOH A 746 . ? 1_555 ? 
28  AC4 7  HOH LB .   ? HOH A 791 . ? 1_555 ? 
29  AC5 6  HIS C  333 ? HIS B 313 . ? 1_555 ? 
30  AC5 6  SER C  354 ? SER B 334 . ? 1_555 ? 
31  AC5 6  ASN C  370 ? ASN B 350 . ? 1_555 ? 
32  AC5 6  SER C  371 ? SER B 351 . ? 1_555 ? 
33  AC5 6  ARG C  388 ? ARG B 368 . ? 1_555 ? 
34  AC5 6  HOH MB .   ? HOH B 745 . ? 1_555 ? 
35  AC6 9  LYS B  330 ? LYS A 310 . ? 1_555 ? 
36  AC6 9  ILE B  352 ? ILE A 332 . ? 1_555 ? 
37  AC6 9  ASP C  311 ? ASP B 291 . ? 1_555 ? 
38  AC6 9  TYR C  313 ? TYR B 293 . ? 1_555 ? 
39  AC6 9  HOH MB .   ? HOH B 639 . ? 1_555 ? 
40  AC6 9  HOH MB .   ? HOH B 669 . ? 1_555 ? 
41  AC6 9  HOH MB .   ? HOH B 671 . ? 1_555 ? 
42  AC6 9  HOH MB .   ? HOH B 686 . ? 1_555 ? 
43  AC6 9  HOH MB .   ? HOH B 785 . ? 1_555 ? 
44  AC7 11 HIS D  333 ? HIS C 313 . ? 1_555 ? 
45  AC7 11 SER D  354 ? SER C 334 . ? 1_555 ? 
46  AC7 11 ASN D  370 ? ASN C 350 . ? 1_555 ? 
47  AC7 11 SER D  371 ? SER C 351 . ? 1_555 ? 
48  AC7 11 ARG D  388 ? ARG C 368 . ? 1_555 ? 
49  AC7 11 HOH NB .   ? HOH C 625 . ? 1_555 ? 
50  AC7 11 HOH NB .   ? HOH C 630 . ? 1_555 ? 
51  AC7 11 HOH NB .   ? HOH C 717 . ? 1_555 ? 
52  AC7 11 HOH NB .   ? HOH C 720 . ? 1_555 ? 
53  AC7 11 HOH NB .   ? HOH C 804 . ? 1_555 ? 
54  AC7 11 HOH NB .   ? HOH C 857 . ? 1_555 ? 
55  AC8 8  PRO D  308 ? PRO C 288 . ? 1_555 ? 
56  AC8 8  ASP D  311 ? ASP C 291 . ? 1_555 ? 
57  AC8 8  TYR D  313 ? TYR C 293 . ? 1_555 ? 
58  AC8 8  HOH NB .   ? HOH C 662 . ? 1_555 ? 
59  AC8 8  HOH NB .   ? HOH C 689 . ? 1_555 ? 
60  AC8 8  HOH NB .   ? HOH C 691 . ? 1_555 ? 
61  AC8 8  HOH NB .   ? HOH C 712 . ? 1_555 ? 
62  AC8 8  HOH NB .   ? HOH C 782 . ? 1_555 ? 
63  AC9 8  HIS E  333 ? HIS D 313 . ? 1_555 ? 
64  AC9 8  SER E  354 ? SER D 334 . ? 1_555 ? 
65  AC9 8  ASN E  370 ? ASN D 350 . ? 1_555 ? 
66  AC9 8  SER E  371 ? SER D 351 . ? 1_555 ? 
67  AC9 8  ARG E  388 ? ARG D 368 . ? 1_555 ? 
68  AC9 8  HOH OB .   ? HOH D 613 . ? 1_555 ? 
69  AC9 8  HOH OB .   ? HOH D 738 . ? 1_555 ? 
70  AC9 8  HOH OB .   ? HOH D 811 . ? 1_555 ? 
71  AD1 7  PRO E  308 ? PRO D 288 . ? 1_555 ? 
72  AD1 7  ASP E  311 ? ASP D 291 . ? 1_555 ? 
73  AD1 7  TYR E  313 ? TYR D 293 . ? 1_555 ? 
74  AD1 7  HOH OB .   ? HOH D 620 . ? 1_555 ? 
75  AD1 7  HOH OB .   ? HOH D 656 . ? 1_555 ? 
76  AD1 7  HOH OB .   ? HOH D 714 . ? 1_555 ? 
77  AD1 7  HOH OB .   ? HOH D 817 . ? 1_555 ? 
78  AD2 6  HIS F  333 ? HIS E 313 . ? 1_555 ? 
79  AD2 6  SER F  354 ? SER E 334 . ? 1_555 ? 
80  AD2 6  ASN F  370 ? ASN E 350 . ? 1_555 ? 
81  AD2 6  SER F  371 ? SER E 351 . ? 1_555 ? 
82  AD2 6  ARG F  388 ? ARG E 368 . ? 1_555 ? 
83  AD2 6  HOH PB .   ? HOH E 612 . ? 1_555 ? 
84  AD3 7  ASP F  311 ? ASP E 291 . ? 1_555 ? 
85  AD3 7  TYR F  313 ? TYR E 293 . ? 1_555 ? 
86  AD3 7  HOH PB .   ? HOH E 642 . ? 1_555 ? 
87  AD3 7  HOH PB .   ? HOH E 668 . ? 1_555 ? 
88  AD3 7  HOH PB .   ? HOH E 671 . ? 1_555 ? 
89  AD3 7  HOH PB .   ? HOH E 743 . ? 1_555 ? 
90  AD3 7  ILE G  352 ? ILE F 332 . ? 1_555 ? 
91  AD4 6  HIS G  333 ? HIS F 313 . ? 1_555 ? 
92  AD4 6  SER G  354 ? SER F 334 . ? 1_555 ? 
93  AD4 6  ASN G  370 ? ASN F 350 . ? 1_555 ? 
94  AD4 6  SER G  371 ? SER F 351 . ? 1_555 ? 
95  AD4 6  ARG G  388 ? ARG F 368 . ? 1_555 ? 
96  AD4 6  HOH QB .   ? HOH F 825 . ? 1_555 ? 
97  AD5 4  ASP G  311 ? ASP F 291 . ? 1_555 ? 
98  AD5 4  HOH QB .   ? HOH F 635 . ? 1_555 ? 
99  AD5 4  HOH QB .   ? HOH F 655 . ? 1_555 ? 
100 AD5 4  HOH QB .   ? HOH F 669 . ? 1_555 ? 
101 AD6 7  HIS H  333 ? HIS G 313 . ? 1_555 ? 
102 AD6 7  SER H  354 ? SER G 334 . ? 1_555 ? 
103 AD6 7  ASN H  370 ? ASN G 350 . ? 1_555 ? 
104 AD6 7  SER H  371 ? SER G 351 . ? 1_555 ? 
105 AD6 7  ARG H  388 ? ARG G 368 . ? 1_555 ? 
106 AD6 7  HOH RB .   ? HOH G 731 . ? 1_555 ? 
107 AD6 7  HOH RB .   ? HOH G 747 . ? 1_555 ? 
108 AD7 10 PHE H  281 ? PHE G 261 . ? 1_555 ? 
109 AD7 10 PRO H  308 ? PRO G 288 . ? 1_555 ? 
110 AD7 10 ASP H  311 ? ASP G 291 . ? 1_555 ? 
111 AD7 10 TYR H  313 ? TYR G 293 . ? 1_555 ? 
112 AD7 10 HOH RB .   ? HOH G 609 . ? 1_555 ? 
113 AD7 10 HOH RB .   ? HOH G 650 . ? 1_555 ? 
114 AD7 10 HOH RB .   ? HOH G 727 . ? 1_555 ? 
115 AD7 10 HOH RB .   ? HOH G 840 . ? 1_555 ? 
116 AD7 10 LYS A  330 ? LYS H 310 . ? 1_555 ? 
117 AD7 10 ILE A  352 ? ILE H 332 . ? 1_555 ? 
118 AD8 9  HIS I  333 ? HIS I 313 . ? 1_555 ? 
119 AD8 9  SER I  354 ? SER I 334 . ? 1_555 ? 
120 AD8 9  ASN I  370 ? ASN I 350 . ? 1_555 ? 
121 AD8 9  SER I  371 ? SER I 351 . ? 1_555 ? 
122 AD8 9  ARG I  388 ? ARG I 368 . ? 1_555 ? 
123 AD8 9  HOH SB .   ? HOH I 678 . ? 1_555 ? 
124 AD8 9  HOH SB .   ? HOH I 771 . ? 1_555 ? 
125 AD8 9  HOH SB .   ? HOH I 775 . ? 1_555 ? 
126 AD8 9  HOH SB .   ? HOH I 798 . ? 1_555 ? 
127 AD9 7  ASP I  311 ? ASP I 291 . ? 1_555 ? 
128 AD9 7  TYR I  313 ? TYR I 293 . ? 1_555 ? 
129 AD9 7  HOH SB .   ? HOH I 644 . ? 1_555 ? 
130 AD9 7  HOH SB .   ? HOH I 686 . ? 1_555 ? 
131 AD9 7  HOH SB .   ? HOH I 694 . ? 1_555 ? 
132 AD9 7  HOH SB .   ? HOH I 804 . ? 1_555 ? 
133 AD9 7  LYS J  330 ? LYS J 310 . ? 1_555 ? 
134 AE1 7  HIS J  333 ? HIS J 313 . ? 1_555 ? 
135 AE1 7  SER J  354 ? SER J 334 . ? 1_555 ? 
136 AE1 7  ASN J  370 ? ASN J 350 . ? 1_555 ? 
137 AE1 7  SER J  371 ? SER J 351 . ? 1_555 ? 
138 AE1 7  ARG J  388 ? ARG J 368 . ? 1_555 ? 
139 AE1 7  HOH TB .   ? HOH J 604 . ? 1_555 ? 
140 AE1 7  HOH TB .   ? HOH J 651 . ? 1_555 ? 
141 AE2 5  ASP J  311 ? ASP J 291 . ? 1_555 ? 
142 AE2 5  HOH TB .   ? HOH J 643 . ? 1_555 ? 
143 AE2 5  HOH TB .   ? HOH J 669 . ? 1_555 ? 
144 AE2 5  HOH TB .   ? HOH J 688 . ? 1_555 ? 
145 AE2 5  HOH TB .   ? HOH J 750 . ? 1_555 ? 
146 AE3 9  ALA J  417 ? ALA J 397 . ? 1_555 ? 
147 AE3 9  LYS J  418 ? LYS J 398 . ? 1_555 ? 
148 AE3 9  PHE J  420 ? PHE J 400 . ? 1_555 ? 
149 AE3 9  ARG J  421 ? ARG J 401 . ? 1_555 ? 
150 AE3 9  ARG J  422 ? ARG J 402 . ? 1_555 ? 
151 AE3 9  HOH TB .   ? HOH J 610 . ? 1_555 ? 
152 AE3 9  HOH TB .   ? HOH J 634 . ? 1_555 ? 
153 AE3 9  HOH TB .   ? HOH J 826 . ? 1_555 ? 
154 AE3 9  HOH TB .   ? HOH J 838 . ? 1_555 ? 
155 AE4 6  HIS K  333 ? HIS K 313 . ? 1_555 ? 
156 AE4 6  SER K  354 ? SER K 334 . ? 1_555 ? 
157 AE4 6  ASN K  370 ? ASN K 350 . ? 1_555 ? 
158 AE4 6  SER K  371 ? SER K 351 . ? 1_555 ? 
159 AE4 6  ARG K  388 ? ARG K 368 . ? 1_555 ? 
160 AE4 6  HOH UB .   ? HOH K 784 . ? 1_555 ? 
161 AE5 6  PHE K  281 ? PHE K 261 . ? 1_555 ? 
162 AE5 6  ASP K  311 ? ASP K 291 . ? 1_555 ? 
163 AE5 6  TYR K  313 ? TYR K 293 . ? 1_555 ? 
164 AE5 6  HOH UB .   ? HOH K 707 . ? 1_555 ? 
165 AE5 6  HOH UB .   ? HOH K 711 . ? 1_555 ? 
166 AE5 6  HOH UB .   ? HOH K 714 . ? 1_555 ? 
167 AE6 10 VAL K  193 ? VAL K 173 . ? 1_555 ? 
168 AE6 10 MET K  194 ? MET K 174 . ? 1_555 ? 
169 AE6 10 HIS K  195 ? HIS K 175 . ? 1_555 ? 
170 AE6 10 VAL K  196 ? VAL K 176 . ? 1_555 ? 
171 AE6 10 PRO K  213 ? PRO K 193 . ? 1_555 ? 
172 AE6 10 GLY K  214 ? GLY K 194 . ? 1_555 ? 
173 AE6 10 ILE K  215 ? ILE K 195 . ? 1_555 ? 
174 AE6 10 PRO K  216 ? PRO K 196 . ? 1_555 ? 
175 AE6 10 ALA K  222 ? ALA K 202 . ? 1_555 ? 
176 AE6 10 LEU K  223 ? LEU K 203 . ? 1_555 ? 
177 AE7 8  HIS L  333 ? HIS L 313 . ? 1_555 ? 
178 AE7 8  SER L  354 ? SER L 334 . ? 1_555 ? 
179 AE7 8  ASN L  370 ? ASN L 350 . ? 1_555 ? 
180 AE7 8  SER L  371 ? SER L 351 . ? 1_555 ? 
181 AE7 8  ARG L  388 ? ARG L 368 . ? 1_555 ? 
182 AE7 8  HOH VB .   ? HOH L 612 . ? 1_555 ? 
183 AE7 8  HOH VB .   ? HOH L 621 . ? 1_555 ? 
184 AE7 8  HOH VB .   ? HOH L 713 . ? 1_555 ? 
185 AE8 5  ILE K  352 ? ILE K 332 . ? 1_555 ? 
186 AE8 5  ASP L  311 ? ASP L 291 . ? 1_555 ? 
187 AE8 5  HOH VB .   ? HOH L 659 . ? 1_555 ? 
188 AE8 5  HOH VB .   ? HOH L 671 . ? 1_555 ? 
189 AE8 5  HOH VB .   ? HOH L 689 . ? 1_555 ? 
190 AE9 7  HIS M  333 ? HIS M 313 . ? 1_555 ? 
191 AE9 7  SER M  354 ? SER M 334 . ? 1_555 ? 
192 AE9 7  ASN M  370 ? ASN M 350 . ? 1_555 ? 
193 AE9 7  SER M  371 ? SER M 351 . ? 1_555 ? 
194 AE9 7  ARG M  388 ? ARG M 368 . ? 1_555 ? 
195 AE9 7  HOH WB .   ? HOH M 657 . ? 1_555 ? 
196 AE9 7  HOH WB .   ? HOH M 844 . ? 1_555 ? 
197 AF1 5  ASP M  311 ? ASP M 291 . ? 1_555 ? 
198 AF1 5  HOH WB .   ? HOH M 641 . ? 1_555 ? 
199 AF1 5  HOH WB .   ? HOH M 672 . ? 1_555 ? 
200 AF1 5  HOH WB .   ? HOH M 708 . ? 1_555 ? 
201 AF1 5  HOH WB .   ? HOH M 770 . ? 1_555 ? 
202 AF2 7  HIS N  333 ? HIS N 313 . ? 1_555 ? 
203 AF2 7  SER N  354 ? SER N 334 . ? 1_555 ? 
204 AF2 7  ASN N  370 ? ASN N 350 . ? 1_555 ? 
205 AF2 7  SER N  371 ? SER N 351 . ? 1_555 ? 
206 AF2 7  ARG N  388 ? ARG N 368 . ? 1_555 ? 
207 AF2 7  HOH XB .   ? HOH N 619 . ? 1_555 ? 
208 AF2 7  HOH XB .   ? HOH N 779 . ? 1_555 ? 
209 AF3 8  PRO N  308 ? PRO N 288 . ? 1_555 ? 
210 AF3 8  ASP N  311 ? ASP N 291 . ? 1_555 ? 
211 AF3 8  TYR N  313 ? TYR N 293 . ? 1_555 ? 
212 AF3 8  HOH XB .   ? HOH N 616 . ? 1_555 ? 
213 AF3 8  HOH XB .   ? HOH N 630 . ? 1_555 ? 
214 AF3 8  HOH XB .   ? HOH N 638 . ? 1_555 ? 
215 AF3 8  HOH XB .   ? HOH N 694 . ? 1_555 ? 
216 AF3 8  HOH XB .   ? HOH N 780 . ? 1_555 ? 
217 AF4 8  HIS O  333 ? HIS O 313 . ? 1_555 ? 
218 AF4 8  SER O  354 ? SER O 334 . ? 1_555 ? 
219 AF4 8  ASN O  370 ? ASN O 350 . ? 1_555 ? 
220 AF4 8  SER O  371 ? SER O 351 . ? 1_555 ? 
221 AF4 8  ARG O  388 ? ARG O 368 . ? 1_555 ? 
222 AF4 8  HOH YB .   ? HOH O 615 . ? 1_555 ? 
223 AF4 8  HOH YB .   ? HOH O 768 . ? 1_555 ? 
224 AF4 8  HOH YB .   ? HOH O 823 . ? 1_555 ? 
225 AF5 7  ASP O  311 ? ASP O 291 . ? 1_555 ? 
226 AF5 7  TYR O  313 ? TYR O 293 . ? 1_555 ? 
227 AF5 7  HOH YB .   ? HOH O 623 . ? 1_555 ? 
228 AF5 7  HOH YB .   ? HOH O 670 . ? 1_555 ? 
229 AF5 7  HOH YB .   ? HOH O 688 . ? 1_555 ? 
230 AF5 7  HOH YB .   ? HOH O 735 . ? 1_555 ? 
231 AF5 7  HOH YB .   ? HOH O 838 . ? 1_555 ? 
232 AF6 8  HIS P  333 ? HIS P 313 . ? 1_555 ? 
233 AF6 8  SER P  354 ? SER P 334 . ? 1_555 ? 
234 AF6 8  ASN P  370 ? ASN P 350 . ? 1_555 ? 
235 AF6 8  SER P  371 ? SER P 351 . ? 1_555 ? 
236 AF6 8  ARG P  388 ? ARG P 368 . ? 1_555 ? 
237 AF6 8  HOH ZB .   ? HOH P 617 . ? 1_555 ? 
238 AF6 8  HOH ZB .   ? HOH P 772 . ? 1_555 ? 
239 AF6 8  HOH ZB .   ? HOH P 803 . ? 1_555 ? 
240 AF7 6  ASP P  311 ? ASP P 291 . ? 1_555 ? 
241 AF7 6  TYR P  313 ? TYR P 293 . ? 1_555 ? 
242 AF7 6  HOH ZB .   ? HOH P 632 . ? 1_555 ? 
243 AF7 6  HOH ZB .   ? HOH P 633 . ? 1_555 ? 
244 AF7 6  HOH ZB .   ? HOH P 640 . ? 1_555 ? 
245 AF7 6  HOH ZB .   ? HOH P 657 . ? 1_555 ? 
246 AF8 6  HIS Q  333 ? HIS Q 313 . ? 1_555 ? 
247 AF8 6  SER Q  354 ? SER Q 334 . ? 1_555 ? 
248 AF8 6  ASN Q  370 ? ASN Q 350 . ? 1_555 ? 
249 AF8 6  SER Q  371 ? SER Q 351 . ? 1_555 ? 
250 AF8 6  ARG Q  388 ? ARG Q 368 . ? 1_555 ? 
251 AF8 6  HOH AC .   ? HOH Q 812 . ? 1_555 ? 
252 AF9 5  ASP Q  311 ? ASP Q 291 . ? 1_555 ? 
253 AF9 5  HOH AC .   ? HOH Q 649 . ? 1_555 ? 
254 AF9 5  HOH AC .   ? HOH Q 666 . ? 1_555 ? 
255 AF9 5  HOH AC .   ? HOH Q 726 . ? 1_555 ? 
256 AF9 5  HOH AC .   ? HOH Q 845 . ? 1_555 ? 
257 AG1 8  HIS R  333 ? HIS R 313 . ? 1_555 ? 
258 AG1 8  SER R  354 ? SER R 334 . ? 1_555 ? 
259 AG1 8  ASN R  370 ? ASN R 350 . ? 1_555 ? 
260 AG1 8  SER R  371 ? SER R 351 . ? 1_555 ? 
261 AG1 8  ARG R  388 ? ARG R 368 . ? 1_555 ? 
262 AG1 8  HOH BC .   ? HOH R 606 . ? 1_555 ? 
263 AG1 8  HOH BC .   ? HOH R 769 . ? 1_555 ? 
264 AG1 8  HOH BC .   ? HOH R 800 . ? 1_555 ? 
265 AG2 7  PRO R  308 ? PRO R 288 . ? 1_555 ? 
266 AG2 7  ASP R  311 ? ASP R 291 . ? 1_555 ? 
267 AG2 7  TYR R  313 ? TYR R 293 . ? 1_555 ? 
268 AG2 7  HOH BC .   ? HOH R 654 . ? 1_555 ? 
269 AG2 7  HOH BC .   ? HOH R 677 . ? 1_555 ? 
270 AG2 7  HOH BC .   ? HOH R 706 . ? 1_555 ? 
271 AG2 7  HOH BC .   ? HOH R 707 . ? 1_555 ? 
272 AG3 8  HIS S  333 ? HIS V 313 . ? 1_555 ? 
273 AG3 8  SER S  354 ? SER V 334 . ? 1_555 ? 
274 AG3 8  ASN S  370 ? ASN V 350 . ? 1_555 ? 
275 AG3 8  SER S  371 ? SER V 351 . ? 1_555 ? 
276 AG3 8  ARG S  388 ? ARG V 368 . ? 1_555 ? 
277 AG3 8  HOH CC .   ? HOH V 706 . ? 1_555 ? 
278 AG3 8  HOH CC .   ? HOH V 738 . ? 1_555 ? 
279 AG3 8  HOH CC .   ? HOH V 739 . ? 1_555 ? 
280 AG4 7  PRO S  308 ? PRO V 288 . ? 1_555 ? 
281 AG4 7  ASP S  311 ? ASP V 291 . ? 1_555 ? 
282 AG4 7  TYR S  313 ? TYR V 293 . ? 1_555 ? 
283 AG4 7  HOH CC .   ? HOH V 638 . ? 1_555 ? 
284 AG4 7  HOH CC .   ? HOH V 680 . ? 1_555 ? 
285 AG4 7  HOH CC .   ? HOH V 712 . ? 1_555 ? 
286 AG4 7  HOH CC .   ? HOH V 759 . ? 1_555 ? 
287 AG5 8  HIS T  333 ? HIS T 313 . ? 1_555 ? 
288 AG5 8  SER T  354 ? SER T 334 . ? 1_555 ? 
289 AG5 8  ASN T  370 ? ASN T 350 . ? 1_555 ? 
290 AG5 8  SER T  371 ? SER T 351 . ? 1_555 ? 
291 AG5 8  ARG T  388 ? ARG T 368 . ? 1_555 ? 
292 AG5 8  HOH DC .   ? HOH T 604 . ? 1_555 ? 
293 AG5 8  HOH DC .   ? HOH T 669 . ? 1_555 ? 
294 AG5 8  HOH DC .   ? HOH T 767 . ? 1_555 ? 
295 AG6 8  PHE T  281 ? PHE T 261 . ? 1_555 ? 
296 AG6 8  ASP T  311 ? ASP T 291 . ? 1_555 ? 
297 AG6 8  TYR T  313 ? TYR T 293 . ? 1_555 ? 
298 AG6 8  HOH DC .   ? HOH T 623 . ? 1_555 ? 
299 AG6 8  HOH DC .   ? HOH T 684 . ? 1_555 ? 
300 AG6 8  HOH DC .   ? HOH T 714 . ? 1_555 ? 
301 AG6 8  HOH DC .   ? HOH T 735 . ? 1_555 ? 
302 AG6 8  ILE S  352 ? ILE V 332 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6V96 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.010683 
_atom_sites.fract_transf_matrix[1][2]   -0.000006 
_atom_sites.fract_transf_matrix[1][3]   0.002334 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007083 
_atom_sites.fract_transf_matrix[2][3]   0.002344 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004689 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C ? ? 3.54356 2.42580 25.62398 1.50364  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N ? ? 4.01032 2.96436 19.97189 1.75589  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O ? ? 4.49882 3.47563 15.80542 1.70748  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S ? ? 9.55732 6.39887 1.23737  29.19336 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . VAL A  1 26  ? 47.40137  36.76116   31.19351  1.000 51.70369  ? 6    VAL H N   1 
ATOM   2     C CA  . VAL A  1 26  ? 46.44715  36.79147   32.30397  1.000 51.81636  ? 6    VAL H CA  1 
ATOM   3     C C   . VAL A  1 26  ? 45.02761  36.45268   31.87247  1.000 47.01676  ? 6    VAL H C   1 
ATOM   4     O O   . VAL A  1 26  ? 44.46193  35.46942   32.34088  1.000 44.00020  ? 6    VAL H O   1 
ATOM   5     C CB  . VAL A  1 26  ? 46.41280  38.15721   33.01248  1.000 56.20073  ? 6    VAL H CB  1 
ATOM   6     C CG1 . VAL A  1 26  ? 45.34270  38.13917   34.11320  1.000 56.91231  ? 6    VAL H CG1 1 
ATOM   7     C CG2 . VAL A  1 26  ? 47.79121  38.52697   33.56870  1.000 58.11628  ? 6    VAL H CG2 1 
ATOM   8     N N   . GLN A  1 27  ? 44.43223  37.30931   31.00149  1.000 45.00252  ? 7    GLN H N   1 
ATOM   9     C CA  . GLN A  1 27  ? 43.03178  37.10377   30.61395  1.000 43.55926  ? 7    GLN H CA  1 
ATOM   10    C C   . GLN A  1 27  ? 42.92463  35.97402   29.59863  1.000 37.94518  ? 7    GLN H C   1 
ATOM   11    O O   . GLN A  1 27  ? 43.76968  35.85602   28.70522  1.000 43.44696  ? 7    GLN H O   1 
ATOM   12    C CB  . GLN A  1 27  ? 42.42716  38.37089   30.01514  1.000 46.66380  ? 7    GLN H CB  1 
ATOM   13    C CG  . GLN A  1 27  ? 42.21656  39.48531   31.02331  1.000 51.52816  ? 7    GLN H CG  1 
ATOM   14    C CD  . GLN A  1 27  ? 41.72791  40.73866   30.35449  1.000 55.86040  ? 7    GLN H CD  1 
ATOM   15    O OE1 . GLN A  1 27  ? 40.96193  40.67655   29.38315  1.000 55.00987  ? 7    GLN H OE1 1 
ATOM   16    N NE2 . GLN A  1 27  ? 42.17346  41.89358   30.85476  1.000 59.51384  ? 7    GLN H NE2 1 
ATOM   17    N N   . PRO A  1 28  ? 41.90128  35.14286   29.70535  1.000 28.67299  ? 8    PRO H N   1 
ATOM   18    C CA  . PRO A  1 28  ? 41.71424  34.10102   28.70208  1.000 28.47996  ? 8    PRO H CA  1 
ATOM   19    C C   . PRO A  1 28  ? 41.32470  34.71105   27.35822  1.000 25.33883  ? 8    PRO H C   1 
ATOM   20    O O   . PRO A  1 28  ? 40.60952  35.71650   27.27503  1.000 22.22768  ? 8    PRO H O   1 
ATOM   21    C CB  . PRO A  1 28  ? 40.59751  33.22792   29.30114  1.000 28.11074  ? 8    PRO H CB  1 
ATOM   22    C CG  . PRO A  1 28  ? 39.87817  34.10624   30.22108  1.000 28.92872  ? 8    PRO H CG  1 
ATOM   23    C CD  . PRO A  1 28  ? 40.84621  35.13574   30.73171  1.000 27.65752  ? 8    PRO H CD  1 
ATOM   24    N N   . LEU A  1 29  ? 41.81901  34.10092   26.29521  1.000 18.82218  ? 9    LEU H N   1 
ATOM   25    C CA  . LEU A  1 29  ? 41.54965  34.62741   24.95584  1.000 18.54457  ? 9    LEU H CA  1 
ATOM   26    C C   . LEU A  1 29  ? 40.13916  34.33292   24.49946  1.000 18.77076  ? 9    LEU H C   1 
ATOM   27    O O   . LEU A  1 29  ? 39.63719  35.02254   23.61555  1.000 21.23680  ? 9    LEU H O   1 
ATOM   28    C CB  . LEU A  1 29  ? 42.55726  34.06857   23.95743  1.000 18.91394  ? 9    LEU H CB  1 
ATOM   29    C CG  . LEU A  1 29  ? 44.03669  34.15367   24.37967  1.000 22.35898  ? 9    LEU H CG  1 
ATOM   30    C CD1 . LEU A  1 29  ? 44.87313  33.45131   23.35893  1.000 24.37185  ? 9    LEU H CD1 1 
ATOM   31    C CD2 . LEU A  1 29  ? 44.55472  35.56993   24.57380  1.000 23.73992  ? 9    LEU H CD2 1 
ATOM   32    N N   . ALA A  1 30  ? 39.47122  33.35587   25.10710  1.000 19.27443  ? 10   ALA H N   1 
ATOM   33    C CA  . ALA A  1 30  ? 38.08745  33.08122   24.71782  1.000 18.29883  ? 10   ALA H CA  1 
ATOM   34    C C   . ALA A  1 30  ? 37.17170  34.28281   24.95592  1.000 15.60905  ? 10   ALA H C   1 
ATOM   35    O O   . ALA A  1 30  ? 36.19258  34.44555   24.22540  1.000 17.17843  ? 10   ALA H O   1 
ATOM   36    C CB  . ALA A  1 30  ? 37.55898  31.84944   25.46272  1.000 17.06040  ? 10   ALA H CB  1 
ATOM   37    N N   . ARG A  1 31  ? 37.46898  35.13311   25.96304  1.000 16.42756  ? 11   ARG H N   1 
ATOM   38    C CA  . ARG A  1 31  ? 36.69445  36.35426   26.16561  1.000 18.02363  ? 11   ARG H CA  1 
ATOM   39    C C   . ARG A  1 31  ? 36.62501  37.20024   24.91159  1.000 23.46544  ? 11   ARG H C   1 
ATOM   40    O O   . ARG A  1 31  ? 35.66508  37.95878   24.72197  1.000 21.93146  ? 11   ARG H O   1 
ATOM   41    C CB  . ARG A  1 31  ? 37.29578  37.24339   27.28018  1.000 19.03515  ? 11   ARG H CB  1 
ATOM   42    C CG  . ARG A  1 31  ? 37.32611  36.64934   28.67747  1.000 18.74919  ? 11   ARG H CG  1 
ATOM   43    C CD  . ARG A  1 31  ? 37.57868  37.73931   29.66732  1.000 19.42948  ? 11   ARG H CD  1 
ATOM   44    N NE  . ARG A  1 31  ? 37.79099  37.22676   31.01496  1.000 19.94994  ? 11   ARG H NE  1 
ATOM   45    C CZ  . ARG A  1 31  ? 38.29903  37.95382   32.00156  1.000 21.29587  ? 11   ARG H CZ  1 
ATOM   46    N NH1 . ARG A  1 31  ? 38.64437  39.21375   31.77193  1.000 25.70900  ? 11   ARG H NH1 1 
ATOM   47    N NH2 . ARG A  1 31  ? 38.49699  37.42504   33.19532  1.000 25.53065  ? 11   ARG H NH2 1 
ATOM   48    N N   . ASP A  1 32  ? 37.63794  37.11344   24.05870  1.000 22.38184  ? 12   ASP H N   1 
ATOM   49    C CA  . ASP A  1 32  ? 37.71488  37.96995   22.88661  1.000 27.43427  ? 12   ASP H CA  1 
ATOM   50    C C   . ASP A  1 32  ? 37.50845  37.20213   21.59276  1.000 26.07217  ? 12   ASP H C   1 
ATOM   51    O O   . ASP A  1 32  ? 37.92636  37.68135   20.52932  1.000 23.54606  ? 12   ASP H O   1 
ATOM   52    C CB  . ASP A  1 32  ? 39.05958  38.69274   22.84754  1.000 32.18752  ? 12   ASP H CB  1 
ATOM   53    C CG  . ASP A  1 32  ? 39.18356  39.71476   23.92781  1.000 42.07353  ? 12   ASP H CG  1 
ATOM   54    O OD1 . ASP A  1 32  ? 38.21110  40.47817   24.13672  1.000 42.14072  ? 12   ASP H OD1 1 
ATOM   55    O OD2 . ASP A  1 32  ? 40.24454  39.73129   24.58026  1.000 46.02848  ? 12   ASP H OD2 1 
ATOM   56    N N   . ALA A  1 33  ? 36.88489  36.02130   21.65914  1.000 21.35205  ? 13   ALA H N   1 
ATOM   57    C CA  . ALA A  1 33  ? 36.70711  35.16471   20.49856  1.000 21.72738  ? 13   ALA H CA  1 
ATOM   58    C C   . ALA A  1 33  ? 35.23686  35.05485   20.11757  1.000 22.71051  ? 13   ALA H C   1 
ATOM   59    O O   . ALA A  1 33  ? 34.33955  35.28595   20.92617  1.000 20.07122  ? 13   ALA H O   1 
ATOM   60    C CB  . ALA A  1 33  ? 37.25927  33.76067   20.75757  1.000 19.65778  ? 13   ALA H CB  1 
ATOM   61    N N   . MET A  1 34  ? 34.99669  34.68593   18.87324  1.000 19.92322  ? 14   MET H N   1 
ATOM   62    C CA  . MET A  1 34  ? 33.65895  34.35573   18.41712  1.000 19.05967  ? 14   MET H CA  1 
ATOM   63    C C   . MET A  1 34  ? 33.75975  33.07153   17.61253  1.000 20.20765  ? 14   MET H C   1 
ATOM   64    O O   . MET A  1 34  ? 34.67093  32.90645   16.79607  1.000 18.27577  ? 14   MET H O   1 
ATOM   65    C CB  . MET A  1 34  ? 33.02172  35.46899   17.60135  1.000 20.16343  ? 14   MET H CB  1 
ATOM   66    C CG  . MET A  1 34  ? 31.82503  35.05271   16.73147  1.000 18.01519  ? 14   MET H CG  1 
ATOM   67    S SD  . MET A  1 34  ? 31.26485  36.42279   15.63995  1.000 23.57127  ? 14   MET H SD  1 
ATOM   68    C CE  . MET A  1 34  ? 29.53355  36.01213   15.30970  1.000 17.48270  ? 14   MET H CE  1 
ATOM   69    N N   . ALA A  1 35  ? 32.87273  32.14233   17.91253  1.000 15.13953  ? 15   ALA H N   1 
ATOM   70    C CA  . ALA A  1 35  ? 32.83043  30.86686   17.24508  1.000 13.35742  ? 15   ALA H CA  1 
ATOM   71    C C   . ALA A  1 35  ? 31.86509  30.99520   16.08905  1.000 17.37039  ? 15   ALA H C   1 
ATOM   72    O O   . ALA A  1 35  ? 30.84198  31.67970   16.18946  1.000 21.36362  ? 15   ALA H O   1 
ATOM   73    C CB  . ALA A  1 35  ? 32.39798  29.76125   18.22119  1.000 15.31705  ? 15   ALA H CB  1 
ATOM   74    N N   . TYR A  1 36  ? 32.22947  30.43065   14.94885  1.000 17.71449  ? 16   TYR H N   1 
ATOM   75    C CA  . TYR A  1 36  ? 31.38223  30.53140   13.76316  1.000 17.19570  ? 16   TYR H CA  1 
ATOM   76    C C   . TYR A  1 36  ? 31.22288  29.11912   13.22091  1.000 16.41228  ? 16   TYR H C   1 
ATOM   77    O O   . TYR A  1 36  ? 32.18604  28.54126   12.71635  1.000 18.71032  ? 16   TYR H O   1 
ATOM   78    C CB  . TYR A  1 36  ? 31.99830  31.46402   12.71786  1.000 16.78859  ? 16   TYR H CB  1 
ATOM   79    C CG  . TYR A  1 36  ? 30.99234  32.02572   11.73561  1.000 19.46261  ? 16   TYR H CG  1 
ATOM   80    C CD1 . TYR A  1 36  ? 30.54667  31.25654   10.66639  1.000 22.31855  ? 16   TYR H CD1 1 
ATOM   81    C CD2 . TYR A  1 36  ? 30.44883  33.30453   11.90366  1.000 20.14961  ? 16   TYR H CD2 1 
ATOM   82    C CE1 . TYR A  1 36  ? 29.61723  31.74932   9.75398   1.000 22.50055  ? 16   TYR H CE1 1 
ATOM   83    C CE2 . TYR A  1 36  ? 29.49848  33.80999   10.99325  1.000 26.16495  ? 16   TYR H CE2 1 
ATOM   84    C CZ  . TYR A  1 36  ? 29.09250  33.01997   9.91184   1.000 26.62448  ? 16   TYR H CZ  1 
ATOM   85    O OH  . TYR A  1 36  ? 28.15662  33.48920   9.00124   1.000 30.84431  ? 16   TYR H OH  1 
ATOM   86    N N   . VAL A  1 37  ? 30.03328  28.54463   13.35907  1.000 18.00338  ? 17   VAL H N   1 
ATOM   87    C CA  . VAL A  1 37  ? 29.83956  27.12554   13.09086  1.000 17.42440  ? 17   VAL H CA  1 
ATOM   88    C C   . VAL A  1 37  ? 29.26421  26.96267   11.69382  1.000 20.46975  ? 17   VAL H C   1 
ATOM   89    O O   . VAL A  1 37  ? 28.21028  27.53210   11.36749  1.000 20.91312  ? 17   VAL H O   1 
ATOM   90    C CB  . VAL A  1 37  ? 28.93191  26.47202   14.14507  1.000 16.01687  ? 17   VAL H CB  1 
ATOM   91    C CG1 . VAL A  1 37  ? 28.76652  24.99121   13.83658  1.000 14.85224  ? 17   VAL H CG1 1 
ATOM   92    C CG2 . VAL A  1 37  ? 29.49156  26.69854   15.55834  1.000 11.57045  ? 17   VAL H CG2 1 
ATOM   93    N N   . LEU A  1 38  ? 29.94200  26.16779   10.86299  1.000 23.44438  ? 18   LEU H N   1 
ATOM   94    C CA  . LEU A  1 38  ? 29.44645  25.87415   9.51860   1.000 23.83246  ? 18   LEU H CA  1 
ATOM   95    C C   . LEU A  1 38  ? 28.46164  24.71047   9.60237   1.000 21.84814  ? 18   LEU H C   1 
ATOM   96    O O   . LEU A  1 38  ? 28.85045  23.56972   9.87741   1.000 19.34582  ? 18   LEU H O   1 
ATOM   97    C CB  . LEU A  1 38  ? 30.60583  25.56437   8.57157   1.000 24.54461  ? 18   LEU H CB  1 
ATOM   98    C CG  . LEU A  1 38  ? 31.59240  26.73359   8.52748   1.000 26.34924  ? 18   LEU H CG  1 
ATOM   99    C CD1 . LEU A  1 38  ? 32.89102  26.37095   7.80980   1.000 30.68980  ? 18   LEU H CD1 1 
ATOM   100   C CD2 . LEU A  1 38  ? 30.96341  28.02759   7.97285   1.000 22.60057  ? 18   LEU H CD2 1 
ATOM   101   N N   . ALA A  1 39  ? 27.18180  24.99445   9.38493   1.000 19.13444  ? 19   ALA H N   1 
ATOM   102   C CA  . ALA A  1 39  ? 26.14169  24.00008   9.60150   1.000 18.86833  ? 19   ALA H CA  1 
ATOM   103   C C   . ALA A  1 39  ? 25.28654  23.84140   8.35798   1.000 22.70863  ? 19   ALA H C   1 
ATOM   104   O O   . ALA A  1 39  ? 24.09978  23.52219   8.44096   1.000 26.60153  ? 19   ALA H O   1 
ATOM   105   C CB  . ALA A  1 39  ? 25.29234  24.35922   10.82170  1.000 21.33678  ? 19   ALA H CB  1 
ATOM   106   N N   . GLY A  1 40  ? 25.87397  24.09863   7.19426   1.000 22.48748  ? 20   GLY H N   1 
ATOM   107   C CA  . GLY A  1 40  ? 25.16996  23.90684   5.94893   1.000 26.41917  ? 20   GLY H CA  1 
ATOM   108   C C   . GLY A  1 40  ? 25.31591  22.53890   5.33447   1.000 31.76354  ? 20   GLY H C   1 
ATOM   109   O O   . GLY A  1 40  ? 24.77339  22.30263   4.25029   1.000 37.57523  ? 20   GLY H O   1 
ATOM   110   N N   . GLY A  1 41  ? 25.98963  21.61445   6.01488   1.000 32.93840  ? 21   GLY H N   1 
ATOM   111   C CA  . GLY A  1 41  ? 26.35711  20.34856   5.39290   1.000 34.50469  ? 21   GLY H CA  1 
ATOM   112   C C   . GLY A  1 41  ? 25.15336  19.45437   5.18682   1.000 33.60908  ? 21   GLY H C   1 
ATOM   113   O O   . GLY A  1 41  ? 24.36112  19.22375   6.10964   1.000 28.01757  ? 21   GLY H O   1 
ATOM   114   N N   . ARG A  1 42  ? 25.01333  18.93453   3.96244   1.000 35.50503  ? 22   ARG H N   1 
ATOM   115   C CA  . ARG A  1 42  ? 23.87336  18.10214   3.61340   1.000 38.12670  ? 22   ARG H CA  1 
ATOM   116   C C   . ARG A  1 42  ? 23.97702  16.69097   4.18289   1.000 42.21391  ? 22   ARG H C   1 
ATOM   117   O O   . ARG A  1 42  ? 22.94414  16.07160   4.45143   1.000 46.81542  ? 22   ARG H O   1 
ATOM   118   C CB  . ARG A  1 42  ? 23.72679  18.02997   2.07966   1.000 40.46061  ? 22   ARG H CB  1 
ATOM   119   N N   . GLY A  1 43  ? 25.19231  16.16273   4.34808   1.000 38.59022  ? 23   GLY H N   1 
ATOM   120   C CA  . GLY A  1 43  ? 25.38343  14.76258   4.70475   1.000 35.76559  ? 23   GLY H CA  1 
ATOM   121   C C   . GLY A  1 43  ? 24.75017  13.81101   3.71129   1.000 34.77760  ? 23   GLY H C   1 
ATOM   122   O O   . GLY A  1 43  ? 23.89507  12.99489   4.08518   1.000 35.61192  ? 23   GLY H O   1 
ATOM   123   N N   . SER A  1 44  ? 25.17929  13.90310   2.43811   1.000 30.72053  ? 24   SER H N   1 
ATOM   124   C CA  . SER A  1 44  ? 24.51525  13.18227   1.35830   1.000 29.93985  ? 24   SER H CA  1 
ATOM   125   C C   . SER A  1 44  ? 24.54213  11.67859   1.56447   1.000 32.40964  ? 24   SER H C   1 
ATOM   126   O O   . SER A  1 44  ? 23.60965  10.98075   1.14394   1.000 33.66483  ? 24   SER H O   1 
ATOM   127   C CB  . SER A  1 44  ? 25.17825  13.48831   0.00967   1.000 29.84717  ? 24   SER H CB  1 
ATOM   128   O OG  . SER A  1 44  ? 25.50871  14.84903   -0.12133  1.000 39.48215  ? 24   SER H OG  1 
ATOM   129   N N   . ARG A  1 45  ? 25.61904  11.15743   2.15250   1.000 33.59634  ? 25   ARG H N   1 
ATOM   130   C CA  . ARG A  1 45  ? 25.77750  9.71729    2.29868   1.000 35.13504  ? 25   ARG H CA  1 
ATOM   131   C C   . ARG A  1 45  ? 24.93398  9.12066    3.41518   1.000 34.79036  ? 25   ARG H C   1 
ATOM   132   O O   . ARG A  1 45  ? 24.84677  7.89028    3.49315   1.000 34.81290  ? 25   ARG H O   1 
ATOM   133   C CB  . ARG A  1 45  ? 27.24633  9.38644    2.52683   1.000 38.83055  ? 25   ARG H CB  1 
ATOM   134   C CG  . ARG A  1 45  ? 28.09921  9.85482    1.38773   1.000 48.62648  ? 25   ARG H CG  1 
ATOM   135   C CD  . ARG A  1 45  ? 29.35466  9.05000    1.30392   1.000 55.47709  ? 25   ARG H CD  1 
ATOM   136   N NE  . ARG A  1 45  ? 30.22329  9.37506    2.42445   1.000 58.98661  ? 25   ARG H NE  1 
ATOM   137   C CZ  . ARG A  1 45  ? 31.31176  8.68332    2.73248   1.000 62.11681  ? 25   ARG H CZ  1 
ATOM   138   N NH1 . ARG A  1 45  ? 31.64931  7.62678    1.99057   1.000 63.97137  ? 25   ARG H NH1 1 
ATOM   139   N NH2 . ARG A  1 45  ? 32.05220  9.04311    3.78232   1.000 61.43852  ? 25   ARG H NH2 1 
ATOM   140   N N   . LEU A  1 46  ? 24.32616  9.94897    4.27518   1.000 31.77374  ? 26   LEU H N   1 
ATOM   141   C CA  . LEU A  1 46  ? 23.31090  9.47047    5.21323   1.000 27.81191  ? 26   LEU H CA  1 
ATOM   142   C C   . LEU A  1 46  ? 21.96788  9.24295    4.53195   1.000 25.96398  ? 26   LEU H C   1 
ATOM   143   O O   . LEU A  1 46  ? 21.01672  8.81691    5.19044   1.000 24.84477  ? 26   LEU H O   1 
ATOM   144   C CB  . LEU A  1 46  ? 23.17995  10.44624   6.39159   1.000 21.94339  ? 26   LEU H CB  1 
ATOM   145   C CG  . LEU A  1 46  ? 24.46542  10.63493   7.21483   1.000 21.13552  ? 26   LEU H CG  1 
ATOM   146   C CD1 . LEU A  1 46  ? 24.39021  11.80602   8.24267   1.000 22.39186  ? 26   LEU H CD1 1 
ATOM   147   C CD2 . LEU A  1 46  ? 24.79106  9.34838    7.96042   1.000 25.07786  ? 26   LEU H CD2 1 
ATOM   148   N N   . LYS A  1 47  ? 21.89470  9.47986    3.21543   1.000 25.51738  ? 27   LYS H N   1 
ATOM   149   C CA  . LYS A  1 47  ? 20.77910  9.10976    2.34854   1.000 26.77139  ? 27   LYS H CA  1 
ATOM   150   C C   . LYS A  1 47  ? 19.50498  9.64981    2.98128   1.000 26.37948  ? 27   LYS H C   1 
ATOM   151   O O   . LYS A  1 47  ? 19.44595  10.84286   3.31435   1.000 27.82566  ? 27   LYS H O   1 
ATOM   152   C CB  . LYS A  1 47  ? 20.78513  7.61320    2.07957   1.000 31.44544  ? 27   LYS H CB  1 
ATOM   153   C CG  . LYS A  1 47  ? 22.08588  7.14540    1.46175   1.000 36.49197  ? 27   LYS H CG  1 
ATOM   154   C CD  . LYS A  1 47  ? 22.01112  7.04800    -0.06947  1.000 45.58772  ? 27   LYS H CD  1 
ATOM   155   C CE  . LYS A  1 47  ? 23.39936  6.80565    -0.68353  1.000 50.46842  ? 27   LYS H CE  1 
ATOM   156   N NZ  . LYS A  1 47  ? 24.44191  6.45618    0.34031   1.000 49.68103  ? 27   LYS H NZ  1 
ATOM   157   N N   . GLU A  1 48  ? 18.49348  8.82125    3.21122   1.000 29.82967  ? 28   GLU H N   1 
ATOM   158   C CA  . GLU A  1 48  ? 17.21797  9.38498    3.61329   1.000 29.85212  ? 28   GLU H CA  1 
ATOM   159   C C   . GLU A  1 48  ? 17.22927  9.91788    5.04503   1.000 27.46904  ? 28   GLU H C   1 
ATOM   160   O O   . GLU A  1 48  ? 16.26587  10.56779   5.47080   1.000 26.23145  ? 28   GLU H O   1 
ATOM   161   C CB  . GLU A  1 48  ? 16.12301  8.33953    3.44781   1.000 30.24890  ? 28   GLU H CB  1 
ATOM   162   C CG  . GLU A  1 48  ? 15.85952  7.91258    2.03161   1.000 32.54192  ? 28   GLU H CG  1 
ATOM   163   C CD  . GLU A  1 48  ? 16.84491  6.87130    1.49401   1.000 34.16112  ? 28   GLU H CD  1 
ATOM   164   O OE1 . GLU A  1 48  ? 17.75035  6.39304    2.19506   1.000 32.91987  ? 28   GLU H OE1 1 
ATOM   165   O OE2 . GLU A  1 48  ? 16.54463  6.37136    0.40861   1.000 38.42288  ? 28   GLU H OE2 1 
ATOM   166   N N   . LEU A  1 49  ? 18.27904  9.65453    5.81101   1.000 27.76687  ? 29   LEU H N   1 
ATOM   167   C CA  . LEU A  1 49  ? 18.34380  10.25066   7.13757   1.000 27.08965  ? 29   LEU H CA  1 
ATOM   168   C C   . LEU A  1 49  ? 18.49494  11.76430   7.05472   1.000 29.94587  ? 29   LEU H C   1 
ATOM   169   O O   . LEU A  1 49  ? 18.16588  12.46619   8.02258   1.000 33.47848  ? 29   LEU H O   1 
ATOM   170   C CB  . LEU A  1 49  ? 19.49020  9.61281    7.92052   1.000 26.40815  ? 29   LEU H CB  1 
ATOM   171   C CG  . LEU A  1 49  ? 19.53711  9.83625    9.43645   1.000 27.27257  ? 29   LEU H CG  1 
ATOM   172   C CD1 . LEU A  1 49  ? 18.34687  9.17489    10.12062  1.000 24.89650  ? 29   LEU H CD1 1 
ATOM   173   C CD2 . LEU A  1 49  ? 20.84179  9.29815    9.98756   1.000 23.93003  ? 29   LEU H CD2 1 
ATOM   174   N N   . THR A  1 50  ? 18.99265  12.28382   5.92191   1.000 23.22124  ? 30   THR H N   1 
ATOM   175   C CA  . THR A  1 50  ? 19.16136  13.72643   5.74813   1.000 24.72938  ? 30   THR H CA  1 
ATOM   176   C C   . THR A  1 50  ? 18.31976  14.27313   4.60097   1.000 30.96654  ? 30   THR H C   1 
ATOM   177   O O   . THR A  1 50  ? 18.58074  15.38252   4.12465   1.000 32.44574  ? 30   THR H O   1 
ATOM   178   C CB  . THR A  1 50  ? 20.63106  14.10590   5.54986   1.000 23.80012  ? 30   THR H CB  1 
ATOM   179   O OG1 . THR A  1 50  ? 21.21679  13.29859   4.52935   1.000 24.29320  ? 30   THR H OG1 1 
ATOM   180   C CG2 . THR A  1 50  ? 21.42005  13.91817   6.84713   1.000 23.42890  ? 30   THR H CG2 1 
ATOM   181   N N   . ASP A  1 51  ? 17.29690  13.53521   4.17296   1.000 32.36160  ? 31   ASP H N   1 
ATOM   182   C CA  . ASP A  1 51  ? 16.41398  14.03573   3.12253   1.000 37.26622  ? 31   ASP H CA  1 
ATOM   183   C C   . ASP A  1 51  ? 15.66143  15.28244   3.56578   1.000 40.89041  ? 31   ASP H C   1 
ATOM   184   O O   . ASP A  1 51  ? 15.46441  16.20315   2.76293   1.000 41.07445  ? 31   ASP H O   1 
ATOM   185   C CB  . ASP A  1 51  ? 15.43245  12.95495   2.69567   1.000 37.10560  ? 31   ASP H CB  1 
ATOM   186   C CG  . ASP A  1 51  ? 15.97189  12.09820   1.56484   1.000 39.47954  ? 31   ASP H CG  1 
ATOM   187   O OD1 . ASP A  1 51  ? 17.08496  12.39249   1.05862   1.000 42.26066  ? 31   ASP H OD1 1 
ATOM   188   O OD2 . ASP A  1 51  ? 15.28811  11.12413   1.19824   1.000 40.26463  ? 31   ASP H OD2 1 
ATOM   189   N N   . ARG A  1 52  ? 15.24358  15.34847   4.84397   1.000 34.03619  ? 32   ARG H N   1 
ATOM   190   C CA  . ARG A  1 52  ? 14.44711  16.47912   5.31148   1.000 36.95867  ? 32   ARG H CA  1 
ATOM   191   C C   . ARG A  1 52  ? 15.12084  17.24614   6.44609   1.000 32.87775  ? 32   ARG H C   1 
ATOM   192   O O   . ARG A  1 52  ? 14.45987  18.02349   7.13695   1.000 32.43702  ? 32   ARG H O   1 
ATOM   193   C CB  . ARG A  1 52  ? 13.05485  16.01227   5.74005   1.000 43.42944  ? 32   ARG H CB  1 
ATOM   194   C CG  . ARG A  1 52  ? 12.13157  15.77616   4.56226   1.000 52.91756  ? 32   ARG H CG  1 
ATOM   195   C CD  . ARG A  1 52  ? 11.11747  14.68455   4.86553   1.000 63.72566  ? 32   ARG H CD  1 
ATOM   196   N NE  . ARG A  1 52  ? 10.97460  13.74027   3.74880   1.000 74.79903  ? 32   ARG H NE  1 
ATOM   197   C CZ  . ARG A  1 52  ? 11.18811  12.42461   3.83590   1.000 80.10207  ? 32   ARG H CZ  1 
ATOM   198   N NH1 . ARG A  1 52  ? 11.54897  11.87833   4.99822   1.000 81.11488  ? 32   ARG H NH1 1 
ATOM   199   N NH2 . ARG A  1 52  ? 11.03849  11.65090   2.76192   1.000 81.35406  ? 32   ARG H NH2 1 
ATOM   200   N N   . ARG A  1 53  ? 16.41771  17.04518   6.65140   1.000 30.10998  ? 33   ARG H N   1 
ATOM   201   C CA  . ARG A  1 53  ? 17.14590  17.79688   7.66477   1.000 28.90501  ? 33   ARG H CA  1 
ATOM   202   C C   . ARG A  1 53  ? 18.61444  17.77254   7.28776   1.000 28.71204  ? 33   ARG H C   1 
ATOM   203   O O   . ARG A  1 53  ? 19.11395  16.78870   6.73647   1.000 27.18836  ? 33   ARG H O   1 
ATOM   204   C CB  . ARG A  1 53  ? 16.94037  17.21564   9.07519   1.000 24.41672  ? 33   ARG H CB  1 
ATOM   205   C CG  . ARG A  1 53  ? 17.49309  15.82448   9.24658   1.000 22.74284  ? 33   ARG H CG  1 
ATOM   206   C CD  . ARG A  1 53  ? 17.22282  15.25327   10.64969  1.000 27.74676  ? 33   ARG H CD  1 
ATOM   207   N NE  . ARG A  1 53  ? 15.83602  14.83851   10.86369  1.000 31.28360  ? 33   ARG H NE  1 
ATOM   208   C CZ  . ARG A  1 53  ? 15.38465  13.58465   10.71056  1.000 36.33724  ? 33   ARG H CZ  1 
ATOM   209   N NH1 . ARG A  1 53  ? 16.20178  12.61597   10.31644  1.000 35.37865  ? 33   ARG H NH1 1 
ATOM   210   N NH2 . ARG A  1 53  ? 14.10617  13.29702   10.94402  1.000 37.74159  ? 33   ARG H NH2 1 
ATOM   211   N N   . ALA A  1 54  ? 19.30126  18.85601   7.61263   1.000 29.30124  ? 34   ALA H N   1 
ATOM   212   C CA  . ALA A  1 54  ? 20.74053  18.90535   7.42915   1.000 28.87698  ? 34   ALA H CA  1 
ATOM   213   C C   . ALA A  1 54  ? 21.43288  18.00150   8.44052   1.000 25.29848  ? 34   ALA H C   1 
ATOM   214   O O   . ALA A  1 54  ? 20.92041  17.74814   9.54423   1.000 24.91324  ? 34   ALA H O   1 
ATOM   215   C CB  . ALA A  1 54  ? 21.24878  20.34279   7.57381   1.000 29.29337  ? 34   ALA H CB  1 
ATOM   216   N N   . LYS A  1 55  ? 22.61681  17.51749   8.05780   1.000 20.64870  ? 35   LYS H N   1 
ATOM   217   C CA  . LYS A  1 55  ? 23.38942  16.64126   8.93398   1.000 21.44420  ? 35   LYS H CA  1 
ATOM   218   C C   . LYS A  1 55  ? 23.59863  17.18093   10.34861  1.000 23.20536  ? 35   LYS H C   1 
ATOM   219   O O   . LYS A  1 55  ? 23.45399  16.38957   11.30907  1.000 17.17092  ? 35   LYS H O   1 
ATOM   220   C CB  . LYS A  1 55  ? 24.74393  16.32919   8.28591   1.000 26.38935  ? 35   LYS H CB  1 
ATOM   221   C CG  . LYS A  1 55  ? 25.51388  15.23786   9.07025   1.000 23.13372  ? 35   LYS H CG  1 
ATOM   222   C CD  . LYS A  1 55  ? 26.86170  14.92013   8.44574   1.000 25.69026  ? 35   LYS H CD  1 
ATOM   223   C CE  . LYS A  1 55  ? 27.74004  14.13331   9.39926   1.000 25.05159  ? 35   LYS H CE  1 
ATOM   224   N NZ  . LYS A  1 55  ? 29.15390  14.20883   8.90365   1.000 23.49787  ? 35   LYS H NZ  1 
ATOM   225   N N   . PRO A  1 56  ? 23.94648  18.45883   10.56662  1.000 18.61327  ? 36   PRO H N   1 
ATOM   226   C CA  . PRO A  1 56  ? 24.08677  18.93536   11.94627  1.000 17.01393  ? 36   PRO H CA  1 
ATOM   227   C C   . PRO A  1 56  ? 22.82050  18.81341   12.77425  1.000 17.07699  ? 36   PRO H C   1 
ATOM   228   O O   . PRO A  1 56  ? 22.90343  18.81537   14.00982  1.000 16.63930  ? 36   PRO H O   1 
ATOM   229   C CB  . PRO A  1 56  ? 24.50531  20.40195   11.76518  1.000 13.23782  ? 36   PRO H CB  1 
ATOM   230   C CG  . PRO A  1 56  ? 25.21264  20.41302   10.42935  1.000 18.48652  ? 36   PRO H CG  1 
ATOM   231   C CD  . PRO A  1 56  ? 24.39571  19.47391   9.59210   1.000 17.66299  ? 36   PRO H CD  1 
ATOM   232   N N   . ALA A  1 57  ? 21.64743  18.71255   12.14581  1.000 17.86624  ? 37   ALA H N   1 
ATOM   233   C CA  . ALA A  1 57  ? 20.38767  18.55867   12.87351  1.000 20.34471  ? 37   ALA H CA  1 
ATOM   234   C C   . ALA A  1 57  ? 20.06940  17.10848   13.25021  1.000 21.44014  ? 37   ALA H C   1 
ATOM   235   O O   . ALA A  1 57  ? 19.09695  16.87371   13.99066  1.000 20.96422  ? 37   ALA H O   1 
ATOM   236   C CB  . ALA A  1 57  ? 19.23461  19.13309   12.04314  1.000 19.74549  ? 37   ALA H CB  1 
ATOM   237   N N   . VAL A  1 58  ? 20.84563  16.13611   12.76220  1.000 20.20924  ? 38   VAL H N   1 
ATOM   238   C CA  . VAL A  1 58  ? 20.57717  14.72941   13.06714  1.000 17.07479  ? 38   VAL H CA  1 
ATOM   239   C C   . VAL A  1 58  ? 20.76080  14.43049   14.55118  1.000 15.01587  ? 38   VAL H C   1 
ATOM   240   O O   . VAL A  1 58  ? 21.76745  14.81275   15.17075  1.000 13.80010  ? 38   VAL H O   1 
ATOM   241   C CB  . VAL A  1 58  ? 21.47671  13.81156   12.22058  1.000 15.22385  ? 38   VAL H CB  1 
ATOM   242   C CG1 . VAL A  1 58  ? 21.19835  12.35350   12.57791  1.000 15.75725  ? 38   VAL H CG1 1 
ATOM   243   C CG2 . VAL A  1 58  ? 21.17982  14.00953   10.70292  1.000 16.16448  ? 38   VAL H CG2 1 
ATOM   244   N N   . TYR A  1 59  ? 19.83826  13.65509   15.11258  1.000 14.42671  ? 39   TYR H N   1 
ATOM   245   C CA  . TYR A  1 59  ? 19.93121  13.26898   16.51912  1.000 17.89689  ? 39   TYR H CA  1 
ATOM   246   C C   . TYR A  1 59  ? 21.09669  12.32357   16.75334  1.000 16.91024  ? 39   TYR H C   1 
ATOM   247   O O   . TYR A  1 59  ? 21.42666  11.48279   15.89941  1.000 15.04127  ? 39   TYR H O   1 
ATOM   248   C CB  . TYR A  1 59  ? 18.64235  12.59727   16.96842  1.000 19.32247  ? 39   TYR H CB  1 
ATOM   249   C CG  . TYR A  1 59  ? 17.39086  13.40359   16.73603  1.000 25.18534  ? 39   TYR H CG  1 
ATOM   250   C CD1 . TYR A  1 59  ? 16.66339  13.22221   15.56410  1.000 34.90276  ? 39   TYR H CD1 1 
ATOM   251   C CD2 . TYR A  1 59  ? 16.91920  14.33267   17.67952  1.000 26.99084  ? 39   TYR H CD2 1 
ATOM   252   C CE1 . TYR A  1 59  ? 15.51612  13.92639   15.31037  1.000 38.16356  ? 39   TYR H CE1 1 
ATOM   253   C CE2 . TYR A  1 59  ? 15.71597  15.05166   17.43779  1.000 28.06727  ? 39   TYR H CE2 1 
ATOM   254   C CZ  . TYR A  1 59  ? 15.03892  14.83630   16.22939  1.000 37.99737  ? 39   TYR H CZ  1 
ATOM   255   O OH  . TYR A  1 59  ? 13.86747  15.48773   15.86027  1.000 44.01904  ? 39   TYR H OH  1 
ATOM   256   N N   . PHE A  1 60  ? 21.69254  12.42454   17.94171  1.000 14.61620  ? 40   PHE H N   1 
ATOM   257   C CA  . PHE A  1 60  ? 22.79308  11.52974   18.27990  1.000 16.96248  ? 40   PHE H CA  1 
ATOM   258   C C   . PHE A  1 60  ? 22.80792  11.17929   19.75745  1.000 20.61101  ? 40   PHE H C   1 
ATOM   259   O O   . PHE A  1 60  ? 22.71243  12.05431   20.62384  1.000 21.76793  ? 40   PHE H O   1 
ATOM   260   C CB  . PHE A  1 60  ? 24.15721  12.10478   17.89450  1.000 18.68438  ? 40   PHE H CB  1 
ATOM   261   C CG  . PHE A  1 60  ? 25.26927  11.20100   18.27728  1.000 20.77957  ? 40   PHE H CG  1 
ATOM   262   C CD1 . PHE A  1 60  ? 25.56013  10.06871   17.50077  1.000 22.79244  ? 40   PHE H CD1 1 
ATOM   263   C CD2 . PHE A  1 60  ? 25.95966  11.39936   19.46132  1.000 17.93353  ? 40   PHE H CD2 1 
ATOM   264   C CE1 . PHE A  1 60  ? 26.58392  9.20369    17.87816  1.000 23.65758  ? 40   PHE H CE1 1 
ATOM   265   C CE2 . PHE A  1 60  ? 26.95666  10.53541   19.85042  1.000 17.10544  ? 40   PHE H CE2 1 
ATOM   266   C CZ  . PHE A  1 60  ? 27.26819  9.43310    19.05493  1.000 20.88880  ? 40   PHE H CZ  1 
ATOM   267   N N   . GLY A  1 61  ? 22.93736  9.88623    20.04039  1.000 19.78576  ? 41   GLY H N   1 
ATOM   268   C CA  . GLY A  1 61  ? 23.29677  9.42679    21.37488  1.000 21.94747  ? 41   GLY H CA  1 
ATOM   269   C C   . GLY A  1 61  ? 22.24093  9.48157    22.44625  1.000 22.00993  ? 41   GLY H C   1 
ATOM   270   O O   . GLY A  1 61  ? 22.57877  9.31592    23.61861  1.000 25.74645  ? 41   GLY H O   1 
ATOM   271   N N   A GLY A  1 62  ? 20.96702  9.63830    22.09144  0.505 17.01517  ? 42   GLY H N   1 
ATOM   272   N N   B GLY A  1 62  ? 20.98025  9.70094    22.10075  0.495 16.95098  ? 42   GLY H N   1 
ATOM   273   C CA  A GLY A  1 62  ? 19.94851  9.87845    23.09474  0.505 17.04030  ? 42   GLY H CA  1 
ATOM   274   C CA  B GLY A  1 62  ? 19.96391  9.66410    23.12204  0.495 17.19203  ? 42   GLY H CA  1 
ATOM   275   C C   A GLY A  1 62  ? 20.28172  11.05933   23.97399  0.505 17.87775  ? 42   GLY H C   1 
ATOM   276   C C   B GLY A  1 62  ? 19.09235  10.89916   23.17334  0.495 17.44390  ? 42   GLY H C   1 
ATOM   277   O O   A GLY A  1 62  ? 19.89175  11.08986   25.14518  0.505 18.70513  ? 42   GLY H O   1 
ATOM   278   O O   B GLY A  1 62  ? 17.88506  10.77941   23.38573  0.495 22.71500  ? 42   GLY H O   1 
ATOM   279   N N   A LYS A  1 63  ? 20.99136  12.02376   23.44177  0.505 14.43504  ? 43   LYS H N   1 
ATOM   280   N N   B LYS A  1 63  ? 19.67100  12.08485   22.93888  0.495 15.69729  ? 43   LYS H N   1 
ATOM   281   C CA  A LYS A  1 63  ? 21.75443  13.03286   24.16437  0.505 17.85548  ? 43   LYS H CA  1 
ATOM   282   C CA  B LYS A  1 63  ? 18.89065  13.30541   23.10579  0.495 16.38625  ? 43   LYS H CA  1 
ATOM   283   C C   A LYS A  1 63  ? 21.52233  14.42783   23.63165  0.505 16.36643  ? 43   LYS H C   1 
ATOM   284   C C   B LYS A  1 63  ? 19.35703  14.44858   22.21572  0.495 13.29863  ? 43   LYS H C   1 
ATOM   285   O O   A LYS A  1 63  ? 21.32979  15.35548   24.42440  0.505 16.73080  ? 43   LYS H O   1 
ATOM   286   O O   B LYS A  1 63  ? 18.55687  15.04583   21.48852  0.495 13.34491  ? 43   LYS H O   1 
ATOM   287   C CB  A LYS A  1 63  ? 23.26907  12.71306   24.08185  0.505 15.78973  ? 43   LYS H CB  1 
ATOM   288   C CB  B LYS A  1 63  ? 18.93530  13.75278   24.57247  0.495 17.03104  ? 43   LYS H CB  1 
ATOM   289   C CG  A LYS A  1 63  ? 24.15858  13.67582   24.90087  0.505 12.93238  ? 43   LYS H CG  1 
ATOM   290   C CG  B LYS A  1 63  ? 18.11378  14.99988   24.84894  0.495 22.52440  ? 43   LYS H CG  1 
ATOM   291   C CD  A LYS A  1 63  ? 23.99810  13.45985   26.42542  0.505 13.55927  ? 43   LYS H CD  1 
ATOM   292   C CD  B LYS A  1 63  ? 17.15822  14.80880   26.02123  0.495 28.33677  ? 43   LYS H CD  1 
ATOM   293   C CE  A LYS A  1 63  ? 25.14256  14.11525   27.18853  0.505 13.44158  ? 43   LYS H CE  1 
ATOM   294   C CE  B LYS A  1 63  ? 17.92494  14.70736   27.32733  0.495 26.98107  ? 43   LYS H CE  1 
ATOM   295   N NZ  A LYS A  1 63  ? 24.91210  14.23414   28.65370  0.505 14.10128  ? 43   LYS H NZ  1 
ATOM   296   N NZ  B LYS A  1 63  ? 18.20964  13.28823   27.67360  0.495 29.71883  ? 43   LYS H NZ  1 
ATOM   297   N N   A ALA A  1 64  ? 21.50198  14.58369   22.30897  0.505 12.91122  ? 44   ALA H N   1 
ATOM   298   N N   B ALA A  1 64  ? 20.64411  14.77274   22.28129  0.495 12.71818  ? 44   ALA H N   1 
ATOM   299   C CA  A ALA A  1 64  ? 21.55509  15.87283   21.63066  0.505 13.69291  ? 44   ALA H CA  1 
ATOM   300   C CA  B ALA A  1 64  ? 21.16468  15.94226   21.59479  0.495 14.21060  ? 44   ALA H CA  1 
ATOM   301   C C   A ALA A  1 64  ? 21.49196  15.68448   20.12117  0.505 15.65851  ? 44   ALA H C   1 
ATOM   302   C C   B ALA A  1 64  ? 21.12612  15.74486   20.08348  0.495 15.88474  ? 44   ALA H C   1 
ATOM   303   O O   A ALA A  1 64  ? 21.37837  14.54663   19.63013  0.505 15.67157  ? 44   ALA H O   1 
ATOM   304   O O   B ALA A  1 64  ? 20.74432  14.68658   19.55998  0.495 15.61812  ? 44   ALA H O   1 
ATOM   305   C CB  A ALA A  1 64  ? 22.83590  16.61438   22.00756  0.505 14.17226  ? 44   ALA H CB  1 
ATOM   306   C CB  B ALA A  1 64  ? 22.59017  16.23985   22.05354  0.495 12.67859  ? 44   ALA H CB  1 
ATOM   307   N N   . ARG A  1 65  ? 21.54245  16.78725   19.37760  1.000 14.53458  ? 45   ARG H N   1 
ATOM   308   C CA  . ARG A  1 65  ? 21.77109  16.74681   17.94263  1.000 12.86282  ? 45   ARG H CA  1 
ATOM   309   C C   . ARG A  1 65  ? 23.26440  16.96059   17.69083  1.000 14.70756  ? 45   ARG H C   1 
ATOM   310   O O   . ARG A  1 65  ? 23.98415  17.44984   18.56122  1.000 11.80107  ? 45   ARG H O   1 
ATOM   311   C CB  . ARG A  1 65  ? 20.93802  17.81749   17.21897  1.000 17.73917  ? 45   ARG H CB  1 
ATOM   312   C CG  . ARG A  1 65  ? 19.42749  17.64606   17.42996  1.000 19.99051  ? 45   ARG H CG  1 
ATOM   313   C CD  . ARG A  1 65  ? 18.68488  18.72023   16.64071  1.000 17.44688  ? 45   ARG H CD  1 
ATOM   314   N NE  . ARG A  1 65  ? 17.24333  18.74946   16.86108  1.000 16.58649  ? 45   ARG H NE  1 
ATOM   315   C CZ  . ARG A  1 65  ? 16.33046  18.25720   16.03717  1.000 18.14478  ? 45   ARG H CZ  1 
ATOM   316   N NH1 . ARG A  1 65  ? 16.68998  17.64112   14.90382  1.000 19.53698  ? 45   ARG H NH1 1 
ATOM   317   N NH2 . ARG A  1 65  ? 15.03686  18.37439   16.33975  1.000 22.09173  ? 45   ARG H NH2 1 
ATOM   318   N N   . ILE A  1 66  ? 23.73094  16.58509   16.48474  1.000 14.81225  ? 46   ILE H N   1 
ATOM   319   C CA  . ILE A  1 66  ? 25.16955  16.62705   16.21249  1.000 16.47348  ? 46   ILE H CA  1 
ATOM   320   C C   . ILE A  1 66  ? 25.72214  18.03389   16.44554  1.000 14.22697  ? 46   ILE H C   1 
ATOM   321   O O   . ILE A  1 66  ? 26.77742  18.20512   17.06913  1.000 15.59862  ? 46   ILE H O   1 
ATOM   322   C CB  . ILE A  1 66  ? 25.46793  16.14445   14.78108  1.000 14.20699  ? 46   ILE H CB  1 
ATOM   323   C CG1 . ILE A  1 66  ? 25.14256  14.65756   14.66508  1.000 14.81228  ? 46   ILE H CG1 1 
ATOM   324   C CG2 . ILE A  1 66  ? 26.96535  16.43055   14.43910  1.000 17.35160  ? 46   ILE H CG2 1 
ATOM   325   C CD1 . ILE A  1 66  ? 25.07767  14.14615   13.22161  1.000 15.26955  ? 46   ILE H CD1 1 
ATOM   326   N N   . ILE A  1 67  ? 25.00894  19.05847   15.98244  1.000 16.80084  ? 47   ILE H N   1 
ATOM   327   C CA  . ILE A  1 67  ? 25.52810  20.43387   16.11572  1.000 16.16819  ? 47   ILE H CA  1 
ATOM   328   C C   . ILE A  1 67  ? 25.77561  20.81637   17.57067  1.000 13.27923  ? 47   ILE H C   1 
ATOM   329   O O   . ILE A  1 67  ? 26.59565  21.70204   17.85706  1.000 13.14714  ? 47   ILE H O   1 
ATOM   330   C CB  . ILE A  1 67  ? 24.56268  21.44192   15.46579  1.000 13.94336  ? 47   ILE H CB  1 
ATOM   331   C CG1 . ILE A  1 67  ? 25.29288  22.77754   15.18636  1.000 18.75515  ? 47   ILE H CG1 1 
ATOM   332   C CG2 . ILE A  1 67  ? 23.30707  21.62571   16.37291  1.000 11.16582  ? 47   ILE H CG2 1 
ATOM   333   C CD1 . ILE A  1 67  ? 24.45790  23.80516   14.55317  1.000 25.62086  ? 47   ILE H CD1 1 
ATOM   334   N N   . ASP A  1 68  ? 25.08312  20.17809   18.51686  1.000 10.63066  ? 48   ASP H N   1 
ATOM   335   C CA  . ASP A  1 68  ? 25.22548  20.60030   19.89740  1.000 10.25716  ? 48   ASP H CA  1 
ATOM   336   C C   . ASP A  1 68  ? 26.62105  20.31894   20.44254  1.000 14.68093  ? 48   ASP H C   1 
ATOM   337   O O   . ASP A  1 68  ? 26.98751  20.87516   21.48653  1.000 14.18719  ? 48   ASP H O   1 
ATOM   338   C CB  . ASP A  1 68  ? 24.21259  19.89453   20.81340  1.000 10.54421  ? 48   ASP H CB  1 
ATOM   339   C CG  . ASP A  1 68  ? 22.76635  20.29592   20.53877  1.000 15.79835  ? 48   ASP H CG  1 
ATOM   340   O OD1 . ASP A  1 68  ? 22.47737  21.49003   20.19433  1.000 13.28965  ? 48   ASP H OD1 1 
ATOM   341   O OD2 . ASP A  1 68  ? 21.90621  19.37212   20.65528  1.000 13.27533  ? 48   ASP H OD2 1 
ATOM   342   N N   . PHE A  1 69  ? 27.40259  19.44509   19.79130  1.000 12.67329  ? 49   PHE H N   1 
ATOM   343   C CA  . PHE A  1 69  ? 28.74215  19.19420   20.33091  1.000 13.36637  ? 49   PHE H CA  1 
ATOM   344   C C   . PHE A  1 69  ? 29.65287  20.41439   20.11265  1.000 12.95253  ? 49   PHE H C   1 
ATOM   345   O O   . PHE A  1 69  ? 30.21912  20.94629   21.07380  1.000 11.95417  ? 49   PHE H O   1 
ATOM   346   C CB  . PHE A  1 69  ? 29.30834  17.89613   19.74043  1.000 14.20887  ? 49   PHE H CB  1 
ATOM   347   C CG  . PHE A  1 69  ? 28.69818  16.68762   20.40557  1.000 15.97153  ? 49   PHE H CG  1 
ATOM   348   C CD1 . PHE A  1 69  ? 27.43782  16.21483   19.99691  1.000 15.52207  ? 49   PHE H CD1 1 
ATOM   349   C CD2 . PHE A  1 69  ? 29.30610  16.10619   21.50673  1.000 11.52547  ? 49   PHE H CD2 1 
ATOM   350   C CE1 . PHE A  1 69  ? 26.82801  15.11798   20.66733  1.000 11.61677  ? 49   PHE H CE1 1 
ATOM   351   C CE2 . PHE A  1 69  ? 28.68959  15.00889   22.17521  1.000 16.56652  ? 49   PHE H CE2 1 
ATOM   352   C CZ  . PHE A  1 69  ? 27.44258  14.54302   21.74330  1.000 12.45654  ? 49   PHE H CZ  1 
ATOM   353   N N   . ALA A  1 70  ? 29.73809  20.91392   18.89091  1.000 10.51013  ? 50   ALA H N   1 
ATOM   354   C CA  . ALA A  1 70  ? 30.57376  22.09562   18.65368  1.000 10.59194  ? 50   ALA H CA  1 
ATOM   355   C C   . ALA A  1 70  ? 30.06011  23.30268   19.42237  1.000 13.03623  ? 50   ALA H C   1 
ATOM   356   O O   . ALA A  1 70  ? 30.86312  24.07716   19.95573  1.000 13.74770  ? 50   ALA H O   1 
ATOM   357   C CB  . ALA A  1 70  ? 30.64707  22.44550   17.17359  1.000 12.37124  ? 50   ALA H CB  1 
ATOM   358   N N   . LEU A  1 71  ? 28.72965  23.50774   19.45410  1.000 11.83991  ? 51   LEU H N   1 
ATOM   359   C CA  . LEU A  1 71  ? 28.17706  24.60686   20.24739  1.000 10.07749  ? 51   LEU H CA  1 
ATOM   360   C C   . LEU A  1 71  ? 28.55220  24.49065   21.72017  1.000 13.54264  ? 51   LEU H C   1 
ATOM   361   O O   . LEU A  1 71  ? 28.86661  25.49695   22.37426  1.000 12.38184  ? 51   LEU H O   1 
ATOM   362   C CB  . LEU A  1 71  ? 26.64051  24.65064   20.11743  1.000 10.07295  ? 51   LEU H CB  1 
ATOM   363   C CG  . LEU A  1 71  ? 26.13298  24.87938   18.68699  1.000 16.61232  ? 51   LEU H CG  1 
ATOM   364   C CD1 . LEU A  1 71  ? 24.57427  24.78564   18.60140  1.000 15.27138  ? 51   LEU H CD1 1 
ATOM   365   C CD2 . LEU A  1 71  ? 26.58803  26.24224   18.17562  1.000 14.98718  ? 51   LEU H CD2 1 
ATOM   366   N N   . SER A  1 72  ? 28.41941  23.28511   22.29669  1.000 10.43472  ? 52   SER H N   1 
ATOM   367   C CA  . SER A  1 72  ? 28.76546  23.10959   23.69424  1.000 10.23212  ? 52   SER H CA  1 
ATOM   368   C C   . SER A  1 72  ? 30.26892  23.26234   23.89643  1.000 11.98900  ? 52   SER H C   1 
ATOM   369   O O   . SER A  1 72  ? 30.70245  23.75122   24.94607  1.000 12.75099  ? 52   SER H O   1 
ATOM   370   C CB  . SER A  1 72  ? 28.28428  21.73944   24.21613  1.000 11.35515  ? 52   SER H CB  1 
ATOM   371   O OG  . SER A  1 72  ? 26.84375  21.70996   24.25211  1.000 12.48688  ? 52   SER H OG  1 
ATOM   372   N N   . ASN A  1 73  ? 31.07839  22.83076   22.93157  1.000 11.92920  ? 53   ASN H N   1 
ATOM   373   C CA  . ASN A  1 73  ? 32.51730  23.07174   23.05492  1.000 13.45591  ? 53   ASN H CA  1 
ATOM   374   C C   . ASN A  1 73  ? 32.80712  24.57002   23.11917  1.000 13.76951  ? 53   ASN H C   1 
ATOM   375   O O   . ASN A  1 73  ? 33.57158  25.03191   23.97734  1.000 14.88917  ? 53   ASN H O   1 
ATOM   376   C CB  . ASN A  1 73  ? 33.25760  22.45865   21.87577  1.000 12.69570  ? 53   ASN H CB  1 
ATOM   377   C CG  . ASN A  1 73  ? 33.33770  20.95274   21.95454  1.000 11.29825  ? 53   ASN H CG  1 
ATOM   378   O OD1 . ASN A  1 73  ? 33.22746  20.35724   23.03315  1.000 12.36440  ? 53   ASN H OD1 1 
ATOM   379   N ND2 . ASN A  1 73  ? 33.56520  20.33669   20.81468  1.000 12.24691  ? 53   ASN H ND2 1 
ATOM   380   N N   . ALA A  1 74  ? 32.16780  25.34327   22.23866  1.000 12.94892  ? 54   ALA H N   1 
ATOM   381   C CA  . ALA A  1 74  ? 32.28739  26.80346   22.29258  1.000 12.66699  ? 54   ALA H CA  1 
ATOM   382   C C   . ALA A  1 74  ? 31.93035  27.34223   23.67051  1.000 14.72318  ? 54   ALA H C   1 
ATOM   383   O O   . ALA A  1 74  ? 32.68110  28.12342   24.25045  1.000 14.30610  ? 54   ALA H O   1 
ATOM   384   C CB  . ALA A  1 74  ? 31.38715  27.45680   21.26975  1.000 10.84039  ? 54   ALA H CB  1 
ATOM   385   N N   . LEU A  1 75  ? 30.74917  26.95564   24.17371  1.000 13.33374  ? 55   LEU H N   1 
ATOM   386   C CA  . LEU A  1 75  ? 30.25412  27.40129   25.46586  1.000 15.74135  ? 55   LEU H CA  1 
ATOM   387   C C   . LEU A  1 75  ? 31.22710  27.05834   26.58727  1.000 11.57825  ? 55   LEU H C   1 
ATOM   388   O O   . LEU A  1 75  ? 31.61745  27.92895   27.38081  1.000 13.55738  ? 55   LEU H O   1 
ATOM   389   C CB  . LEU A  1 75  ? 28.87548  26.75806   25.70826  1.000 15.56214  ? 55   LEU H CB  1 
ATOM   390   C CG  . LEU A  1 75  ? 28.19039  27.04834   27.03510  1.000 22.52153  ? 55   LEU H CG  1 
ATOM   391   C CD1 . LEU A  1 75  ? 27.81229  28.53416   27.06674  1.000 19.95633  ? 55   LEU H CD1 1 
ATOM   392   C CD2 . LEU A  1 75  ? 26.94486  26.12672   27.20628  1.000 19.36873  ? 55   LEU H CD2 1 
ATOM   393   N N   . ASN A  1 76  ? 31.58967  25.77534   26.69601  1.000 11.54444  ? 56   ASN H N   1 
ATOM   394   C CA  . ASN A  1 76  ? 32.42681  25.31381   27.78499  1.000 16.57495  ? 56   ASN H CA  1 
ATOM   395   C C   . ASN A  1 76  ? 33.82116  25.90248   27.68616  1.000 12.60146  ? 56   ASN H C   1 
ATOM   396   O O   . ASN A  1 76  ? 34.50510  25.99650   28.69944  1.000 17.33831  ? 56   ASN H O   1 
ATOM   397   C CB  . ASN A  1 76  ? 32.55443  23.77193   27.83699  1.000 17.14680  ? 56   ASN H CB  1 
ATOM   398   C CG  . ASN A  1 76  ? 31.19285  23.04547   27.99661  1.000 25.06394  ? 56   ASN H CG  1 
ATOM   399   O OD1 . ASN A  1 76  ? 31.07618  21.83165   27.75047  1.000 18.54607  ? 56   ASN H OD1 1 
ATOM   400   N ND2 . ASN A  1 76  ? 30.16236  23.80618   28.34167  1.000 11.85631  ? 56   ASN H ND2 1 
ATOM   401   N N   . SER A  1 77  ? 34.23561  26.31360   26.49630  1.000 12.63443  ? 57   SER H N   1 
ATOM   402   C CA  . SER A  1 77  ? 35.52885  26.97244   26.31831  1.000 14.27632  ? 57   SER H CA  1 
ATOM   403   C C   . SER A  1 77  ? 35.47770  28.44944   26.67386  1.000 15.65076  ? 57   SER H C   1 
ATOM   404   O O   . SER A  1 77  ? 36.50782  29.11157   26.59550  1.000 17.52891  ? 57   SER H O   1 
ATOM   405   C CB  . SER A  1 77  ? 36.01211  26.81515   24.86701  1.000 12.72848  ? 57   SER H CB  1 
ATOM   406   O OG  . SER A  1 77  ? 36.26776  25.44324   24.52889  1.000 14.99800  ? 57   SER H OG  1 
ATOM   407   N N   . GLY A  1 78  ? 34.32143  28.98169   27.06416  1.000 16.58997  ? 58   GLY H N   1 
ATOM   408   C CA  . GLY A  1 78  ? 34.22020  30.37699   27.43306  1.000 15.86723  ? 58   GLY H CA  1 
ATOM   409   C C   . GLY A  1 78  ? 33.96866  31.33408   26.28524  1.000 17.65565  ? 58   GLY H C   1 
ATOM   410   O O   . GLY A  1 78  ? 34.08185  32.55752   26.47585  1.000 14.25008  ? 58   GLY H O   1 
ATOM   411   N N   . ILE A  1 79  ? 33.63338  30.84248   25.10166  1.000 12.74591  ? 59   ILE H N   1 
ATOM   412   C CA  . ILE A  1 79  ? 33.30805  31.71680   23.98377  1.000 12.74386  ? 59   ILE H CA  1 
ATOM   413   C C   . ILE A  1 79  ? 31.82284  32.04808   24.08796  1.000 25.52170  ? 59   ILE H C   1 
ATOM   414   O O   . ILE A  1 79  ? 30.97991  31.14619   24.12086  1.000 26.45993  ? 59   ILE H O   1 
ATOM   415   C CB  . ILE A  1 79  ? 33.63314  31.03883   22.64842  1.000 14.64178  ? 59   ILE H CB  1 
ATOM   416   C CG1 . ILE A  1 79  ? 35.13146  30.74381   22.56616  1.000 15.43989  ? 59   ILE H CG1 1 
ATOM   417   C CG2 . ILE A  1 79  ? 33.18317  31.90093   21.48813  1.000 14.58327  ? 59   ILE H CG2 1 
ATOM   418   C CD1 . ILE A  1 79  ? 35.51954  29.96314   21.28587  1.000 15.09021  ? 59   ILE H CD1 1 
ATOM   419   N N   . ARG A  1 80  ? 31.50067  33.33704   24.16381  1.000 18.82693  ? 60   ARG H N   1 
ATOM   420   C CA  . ARG A  1 80  ? 30.14669  33.77716   24.43889  1.000 26.29486  ? 60   ARG H CA  1 
ATOM   421   C C   . ARG A  1 80  ? 29.47111  34.39688   23.22829  1.000 23.20565  ? 60   ARG H C   1 
ATOM   422   O O   . ARG A  1 80  ? 28.33463  34.86827   23.34396  1.000 17.08839  ? 60   ARG H O   1 
ATOM   423   C CB  . ARG A  1 80  ? 30.15345  34.78698   25.59059  1.000 38.16884  ? 60   ARG H CB  1 
ATOM   424   C CG  . ARG A  1 80  ? 31.02386  34.39097   26.78585  1.000 46.53663  ? 60   ARG H CG  1 
ATOM   425   C CD  . ARG A  1 80  ? 30.21326  34.42998   28.06814  1.000 51.20253  ? 60   ARG H CD  1 
ATOM   426   N NE  . ARG A  1 80  ? 29.09816  33.48412   28.03027  1.000 52.65409  ? 60   ARG H NE  1 
ATOM   427   C CZ  . ARG A  1 80  ? 29.09790  32.29528   28.62037  1.000 53.35963  ? 60   ARG H CZ  1 
ATOM   428   N NH1 . ARG A  1 80  ? 30.15391  31.87848   29.31113  1.000 53.56861  ? 60   ARG H NH1 1 
ATOM   429   N NH2 . ARG A  1 80  ? 28.03284  31.52469   28.52224  1.000 55.38373  ? 60   ARG H NH2 1 
ATOM   430   N N   . ARG A  1 81  ? 30.15016  34.43522   22.08349  1.000 17.98277  ? 61   ARG H N   1 
ATOM   431   C CA  . ARG A  1 81  ? 29.58471  34.91487   20.83864  1.000 13.47112  ? 61   ARG H CA  1 
ATOM   432   C C   . ARG A  1 81  ? 29.65795  33.74918   19.87402  1.000 12.93387  ? 61   ARG H C   1 
ATOM   433   O O   . ARG A  1 81  ? 30.75395  33.23372   19.58292  1.000 17.60762  ? 61   ARG H O   1 
ATOM   434   C CB  . ARG A  1 81  ? 30.35780  36.12589   20.29889  1.000 14.33725  ? 61   ARG H CB  1 
ATOM   435   C CG  . ARG A  1 81  ? 30.41033  37.30417   21.30861  1.000 15.04552  ? 61   ARG H CG  1 
ATOM   436   C CD  . ARG A  1 81  ? 30.27209  38.60500   20.53814  1.000 16.04452  ? 61   ARG H CD  1 
ATOM   437   N NE  . ARG A  1 81  ? 30.36380  39.76867   21.38270  1.000 16.90702  ? 61   ARG H NE  1 
ATOM   438   C CZ  . ARG A  1 81  ? 29.28618  40.41935   21.76953  1.000 20.06912  ? 61   ARG H CZ  1 
ATOM   439   N NH1 . ARG A  1 81  ? 28.10323  39.90476   21.43521  1.000 16.94840  ? 61   ARG H NH1 1 
ATOM   440   N NH2 . ARG A  1 81  ? 29.36349  41.49028   22.52931  1.000 18.31222  ? 61   ARG H NH2 1 
ATOM   441   N N   . ILE A  1 82  ? 28.50961  33.32947   19.40098  1.000 13.05493  ? 62   ILE H N   1 
ATOM   442   C CA  . ILE A  1 82  ? 28.42951  32.20024   18.47156  1.000 15.79451  ? 62   ILE H CA  1 
ATOM   443   C C   . ILE A  1 82  ? 27.58411  32.62645   17.29004  1.000 15.88226  ? 62   ILE H C   1 
ATOM   444   O O   . ILE A  1 82  ? 26.53603  33.26601   17.46850  1.000 18.68253  ? 62   ILE H O   1 
ATOM   445   C CB  . ILE A  1 82  ? 27.81793  30.94534   19.14400  1.000 15.93930  ? 62   ILE H CB  1 
ATOM   446   C CG1 . ILE A  1 82  ? 28.70581  30.49366   20.30519  1.000 11.37023  ? 62   ILE H CG1 1 
ATOM   447   C CG2 . ILE A  1 82  ? 27.60707  29.85649   18.10121  1.000 17.32457  ? 62   ILE H CG2 1 
ATOM   448   C CD1 . ILE A  1 82  ? 28.04277  29.40525   21.20040  1.000 16.56562  ? 62   ILE H CD1 1 
ATOM   449   N N   . GLY A  1 83  ? 28.04358  32.29459   16.07547  1.000 13.11302  ? 63   GLY H N   1 
ATOM   450   C CA  . GLY A  1 83  ? 27.21928  32.39607   14.88905  1.000 15.91998  ? 63   GLY H CA  1 
ATOM   451   C C   . GLY A  1 83  ? 27.08644  31.02281   14.26609  1.000 16.36968  ? 63   GLY H C   1 
ATOM   452   O O   . GLY A  1 83  ? 27.97321  30.17861   14.40550  1.000 16.91780  ? 63   GLY H O   1 
ATOM   453   N N   . VAL A  1 84  ? 25.96361  30.79013   13.59105  1.000 17.02508  ? 64   VAL H N   1 
ATOM   454   C CA  . VAL A  1 84  ? 25.71627  29.48923   12.96949  1.000 17.07159  ? 64   VAL H CA  1 
ATOM   455   C C   . VAL A  1 84  ? 25.21161  29.71622   11.56077  1.000 20.32333  ? 64   VAL H C   1 
ATOM   456   O O   . VAL A  1 84  ? 24.09310  30.21443   11.36927  1.000 18.13589  ? 64   VAL H O   1 
ATOM   457   C CB  . VAL A  1 84  ? 24.71247  28.63522   13.74967  1.000 17.79743  ? 64   VAL H CB  1 
ATOM   458   C CG1 . VAL A  1 84  ? 24.50134  27.30055   12.96733  1.000 16.85483  ? 64   VAL H CG1 1 
ATOM   459   C CG2 . VAL A  1 84  ? 25.20568  28.40284   15.19645  1.000 15.25695  ? 64   VAL H CG2 1 
ATOM   460   N N   . ALA A  1 85  ? 26.00436  29.32977   10.57746  1.000 20.92432  ? 65   ALA H N   1 
ATOM   461   C CA  . ALA A  1 85  ? 25.59450  29.48235   9.18854   1.000 24.88226  ? 65   ALA H CA  1 
ATOM   462   C C   . ALA A  1 85  ? 24.84456  28.23527   8.74385   1.000 24.63134  ? 65   ALA H C   1 
ATOM   463   O O   . ALA A  1 85  ? 25.33882  27.12170   8.91446   1.000 27.39037  ? 65   ALA H O   1 
ATOM   464   C CB  . ALA A  1 85  ? 26.80605  29.72430   8.29235   1.000 24.28919  ? 65   ALA H CB  1 
ATOM   465   N N   . THR A  1 86  ? 23.65075  28.41822   8.20150   1.000 23.80303  ? 66   THR H N   1 
ATOM   466   C CA  . THR A  1 86  ? 22.84886  27.28022   7.75904   1.000 24.12163  ? 66   THR H CA  1 
ATOM   467   C C   . THR A  1 86  ? 22.48505  27.46164   6.29557   1.000 23.90217  ? 66   THR H C   1 
ATOM   468   O O   . THR A  1 86  ? 22.66761  28.53747   5.71181   1.000 27.97882  ? 66   THR H O   1 
ATOM   469   C CB  . THR A  1 86  ? 21.57186  27.11337   8.58867   1.000 24.20291  ? 66   THR H CB  1 
ATOM   470   O OG1 . THR A  1 86  ? 20.64353  28.15547   8.24622   1.000 25.94604  ? 66   THR H OG1 1 
ATOM   471   C CG2 . THR A  1 86  ? 21.87091  27.17462   10.11092  1.000 22.03333  ? 66   THR H CG2 1 
ATOM   472   N N   . GLN A  1 87  ? 21.99927  26.37787   5.68758   1.000 25.91549  ? 67   GLN H N   1 
ATOM   473   C CA  . GLN A  1 87  ? 21.75261  26.39572   4.24871   1.000 35.96699  ? 67   GLN H CA  1 
ATOM   474   C C   . GLN A  1 87  ? 20.80234  25.28913   3.83248   1.000 45.66551  ? 67   GLN H C   1 
ATOM   475   O O   . GLN A  1 87  ? 19.58135  25.47291   3.87898   1.000 51.39039  ? 67   GLN H O   1 
ATOM   476   C CB  . GLN A  1 87  ? 23.06400  26.27486   3.47804   1.000 45.11163  ? 67   GLN H CB  1 
ATOM   477   C CG  . GLN A  1 87  ? 23.09413  27.14021   2.20163   1.000 57.94178  ? 67   GLN H CG  1 
ATOM   478   C CD  . GLN A  1 87  ? 24.24996  26.80754   1.30082   1.000 65.07443  ? 67   GLN H CD  1 
ATOM   479   O OE1 . GLN A  1 87  ? 24.17422  26.99428   0.08875   1.000 61.73498  ? 67   GLN H OE1 1 
ATOM   480   N NE2 . GLN A  1 87  ? 25.32961  26.28738   1.88955   1.000 75.88511  ? 67   GLN H NE2 1 
ATOM   481   N N   . TYR A  1 88  ? 21.35797  24.15620   3.39709   1.000 50.65976  ? 68   TYR H N   1 
ATOM   482   C CA  . TYR A  1 88  ? 20.55923  22.97912   3.06057   1.000 54.45679  ? 68   TYR H CA  1 
ATOM   483   C C   . TYR A  1 88  ? 19.53440  22.68055   4.15073   1.000 52.23510  ? 68   TYR H C   1 
ATOM   484   O O   . TYR A  1 88  ? 19.88802  22.58346   5.33735   1.000 48.02400  ? 68   TYR H O   1 
ATOM   485   C CB  . TYR A  1 88  ? 21.47830  21.76520   2.86927   1.000 59.20534  ? 68   TYR H CB  1 
ATOM   486   C CG  . TYR A  1 88  ? 20.76494  20.42458   2.68000   1.000 61.65704  ? 68   TYR H CG  1 
ATOM   487   C CD1 . TYR A  1 88  ? 20.58905  19.53373   3.74643   1.000 59.11637  ? 68   TYR H CD1 1 
ATOM   488   C CD2 . TYR A  1 88  ? 20.29686  20.04336   1.42618   1.000 64.48200  ? 68   TYR H CD2 1 
ATOM   489   C CE1 . TYR A  1 88  ? 19.95141  18.30545   3.55814   1.000 61.93201  ? 68   TYR H CE1 1 
ATOM   490   C CE2 . TYR A  1 88  ? 19.66535  18.83542   1.23004   1.000 66.37259  ? 68   TYR H CE2 1 
ATOM   491   C CZ  . TYR A  1 88  ? 19.49152  17.96809   2.28560   1.000 65.71769  ? 68   TYR H CZ  1 
ATOM   492   O OH  . TYR A  1 88  ? 18.85356  16.77006   2.02875   1.000 65.64086  ? 68   TYR H OH  1 
ATOM   493   N N   . LYS A  1 89  ? 18.25952  22.56888   3.72791   1.000 48.87748  ? 69   LYS H N   1 
ATOM   494   C CA  . LYS A  1 89  ? 17.11682  22.11612   4.52365   1.000 48.63158  ? 69   LYS H CA  1 
ATOM   495   C C   . LYS A  1 89  ? 17.25547  22.40908   6.02027   1.000 45.98910  ? 69   LYS H C   1 
ATOM   496   O O   . LYS A  1 89  ? 17.55499  21.50318   6.81377   1.000 45.97429  ? 69   LYS H O   1 
ATOM   497   C CB  . LYS A  1 89  ? 16.90520  20.61625   4.29823   1.000 55.03759  ? 69   LYS H CB  1 
ATOM   498   C CG  . LYS A  1 89  ? 15.54123  20.11692   4.72004   1.000 58.86902  ? 69   LYS H CG  1 
ATOM   499   C CD  . LYS A  1 89  ? 14.42914  20.95141   4.10581   1.000 60.65096  ? 69   LYS H CD  1 
ATOM   500   C CE  . LYS A  1 89  ? 13.30109  21.14602   5.11164   1.000 61.15414  ? 69   LYS H CE  1 
ATOM   501   N NZ  . LYS A  1 89  ? 13.57621  22.25050   6.09465   1.000 57.46883  ? 69   LYS H NZ  1 
ATOM   502   N N   . ALA A  1 90  ? 17.02430  23.65818   6.42995   1.000 39.39035  ? 70   ALA H N   1 
ATOM   503   C CA  . ALA A  1 90  ? 17.42867  24.08067   7.76393   1.000 31.37646  ? 70   ALA H CA  1 
ATOM   504   C C   . ALA A  1 90  ? 16.26910  24.38879   8.70252   1.000 32.13278  ? 70   ALA H C   1 
ATOM   505   O O   . ALA A  1 90  ? 16.51924  24.82920   9.82572   1.000 29.58195  ? 70   ALA H O   1 
ATOM   506   C CB  . ALA A  1 90  ? 18.35161  25.29151   7.66973   1.000 28.28118  ? 70   ALA H CB  1 
ATOM   507   N N   . HIS A  1 91  ? 15.01954  24.13514   8.30643   1.000 30.83799  ? 71   HIS H N   1 
ATOM   508   C CA  . HIS A  1 91  ? 13.90318  24.45759   9.19427   1.000 34.40170  ? 71   HIS H CA  1 
ATOM   509   C C   . HIS A  1 91  ? 14.04437  23.77255   10.54930  1.000 29.65908  ? 71   HIS H C   1 
ATOM   510   O O   . HIS A  1 91  ? 13.92102  24.41171   11.60336  1.000 28.29424  ? 71   HIS H O   1 
ATOM   511   C CB  . HIS A  1 91  ? 12.57096  24.06408   8.55743   1.000 46.66468  ? 71   HIS H CB  1 
ATOM   512   C CG  . HIS A  1 91  ? 11.40242  24.32897   9.45377   1.000 58.49036  ? 71   HIS H CG  1 
ATOM   513   N ND1 . HIS A  1 91  ? 10.69201  23.32277   10.07202  1.000 63.25637  ? 71   HIS H ND1 1 
ATOM   514   C CD2 . HIS A  1 91  ? 10.86103  25.49330   9.88816   1.000 61.66698  ? 71   HIS H CD2 1 
ATOM   515   C CE1 . HIS A  1 91  ? 9.74663   23.85439   10.82819  1.000 64.37632  ? 71   HIS H CE1 1 
ATOM   516   N NE2 . HIS A  1 91  ? 9.82756   25.17076   10.73430  1.000 62.79074  ? 71   HIS H NE2 1 
ATOM   517   N N   . GLU A  1 92  ? 14.28480  22.45972   10.53732  1.000 31.34681  ? 72   GLU H N   1 
ATOM   518   C CA  . GLU A  1 92  ? 14.38573  21.70937   11.78580  1.000 30.43521  ? 72   GLU H CA  1 
ATOM   519   C C   . GLU A  1 92  ? 15.58682  22.16906   12.59685  1.000 23.53068  ? 72   GLU H C   1 
ATOM   520   O O   . GLU A  1 92  ? 15.52459  22.26120   13.83500  1.000 22.15976  ? 72   GLU H O   1 
ATOM   521   C CB  . GLU A  1 92  ? 14.48080  20.21793   11.45894  1.000 33.93412  ? 72   GLU H CB  1 
ATOM   522   C CG  . GLU A  1 92  ? 14.62059  19.31164   12.62522  1.000 36.27115  ? 72   GLU H CG  1 
ATOM   523   C CD  . GLU A  1 92  ? 14.47326  17.85985   12.19848  1.000 40.17730  ? 72   GLU H CD  1 
ATOM   524   O OE1 . GLU A  1 92  ? 13.59029  17.58618   11.36595  1.000 43.74450  ? 72   GLU H OE1 1 
ATOM   525   O OE2 . GLU A  1 92  ? 15.24262  16.99582   12.66705  1.000 41.18219  ? 72   GLU H OE2 1 
ATOM   526   N N   . LEU A  1 93  ? 16.68402  22.47756   11.91404  1.000 21.32037  ? 73   LEU H N   1 
ATOM   527   C CA  . LEU A  1 93  ? 17.89515  22.92447   12.59387  1.000 19.69185  ? 73   LEU H CA  1 
ATOM   528   C C   . LEU A  1 93  ? 17.70726  24.30375   13.21729  1.000 21.58991  ? 73   LEU H C   1 
ATOM   529   O O   . LEU A  1 93  ? 18.08759  24.53021   14.37401  1.000 16.84819  ? 73   LEU H O   1 
ATOM   530   C CB  . LEU A  1 93  ? 19.04342  22.91986   11.58647  1.000 20.24862  ? 73   LEU H CB  1 
ATOM   531   C CG  . LEU A  1 93  ? 20.34497  23.52239   12.06460  1.000 18.98913  ? 73   LEU H CG  1 
ATOM   532   C CD1 . LEU A  1 93  ? 20.80522  22.76179   13.31002  1.000 18.52861  ? 73   LEU H CD1 1 
ATOM   533   C CD2 . LEU A  1 93  ? 21.39689  23.49864   10.94211  1.000 21.98473  ? 73   LEU H CD2 1 
ATOM   534   N N   . ILE A  1 94  ? 17.09788  25.22844   12.47621  1.000 22.25372  ? 74   ILE H N   1 
ATOM   535   C CA  . ILE A  1 94  ? 16.89197  26.58056   12.98559  1.000 18.24016  ? 74   ILE H CA  1 
ATOM   536   C C   . ILE A  1 94  ? 15.96738  26.55722   14.19605  1.000 17.24832  ? 74   ILE H C   1 
ATOM   537   O O   . ILE A  1 94  ? 16.20729  27.24853   15.18705  1.000 20.36263  ? 74   ILE H O   1 
ATOM   538   C CB  . ILE A  1 94  ? 16.36677  27.49831   11.85471  1.000 19.24794  ? 74   ILE H CB  1 
ATOM   539   C CG1 . ILE A  1 94  ? 17.52481  27.82098   10.89085  1.000 18.81074  ? 74   ILE H CG1 1 
ATOM   540   C CG2 . ILE A  1 94  ? 15.78211  28.81050   12.44158  1.000 20.55739  ? 74   ILE H CG2 1 
ATOM   541   C CD1 . ILE A  1 94  ? 17.09182  28.29274   9.47994   1.000 20.72449  ? 74   ILE H CD1 1 
ATOM   542   N N   . ARG A  1 95  ? 14.92167  25.73489   14.14804  1.000 18.21062  ? 75   ARG H N   1 
ATOM   543   C CA  . ARG A  1 95  ? 13.98232  25.68864   15.25816  1.000 23.85324  ? 75   ARG H CA  1 
ATOM   544   C C   . ARG A  1 95  ? 14.63610  25.09693   16.50415  1.000 20.83469  ? 75   ARG H C   1 
ATOM   545   O O   . ARG A  1 95  ? 14.37991  25.56640   17.62712  1.000 19.76731  ? 75   ARG H O   1 
ATOM   546   C CB  . ARG A  1 95  ? 12.73604  24.89921   14.86525  1.000 30.25322  ? 75   ARG H CB  1 
ATOM   547   C CG  . ARG A  1 95  ? 11.76351  24.75948   16.02277  1.000 38.93593  ? 75   ARG H CG  1 
ATOM   548   C CD  . ARG A  1 95  ? 10.35878  24.38925   15.56200  1.000 52.41209  ? 75   ARG H CD  1 
ATOM   549   N NE  . ARG A  1 95  ? 9.97774   23.02705   15.95768  1.000 60.49456  ? 75   ARG H NE  1 
ATOM   550   C CZ  . ARG A  1 95  ? 8.72338   22.61782   16.19929  1.000 64.52974  ? 75   ARG H CZ  1 
ATOM   551   N NH1 . ARG A  1 95  ? 8.48876   21.35069   16.54681  1.000 65.65073  ? 75   ARG H NH1 1 
ATOM   552   N NH2 . ARG A  1 95  ? 7.69468   23.46329   16.08467  1.000 63.66135  ? 75   ARG H NH2 1 
ATOM   553   N N   . HIS A  1 96  ? 15.53364  24.12762   16.31888  1.000 20.86063  ? 76   HIS H N   1 
ATOM   554   C CA  . HIS A  1 96  ? 16.29869  23.58143   17.44438  1.000 18.04912  ? 76   HIS H CA  1 
ATOM   555   C C   . HIS A  1 96  ? 17.17693  24.63748   18.07899  1.000 17.53491  ? 76   HIS H C   1 
ATOM   556   O O   . HIS A  1 96  ? 17.29684  24.69662   19.30876  1.000 15.07595  ? 76   HIS H O   1 
ATOM   557   C CB  . HIS A  1 96  ? 17.15611  22.41658   16.95407  1.000 17.72069  ? 76   HIS H CB  1 
ATOM   558   C CG  . HIS A  1 96  ? 18.19436  21.97041   17.93695  1.000 17.39840  ? 76   HIS H CG  1 
ATOM   559   N ND1 . HIS A  1 96  ? 17.92227  21.06134   18.93557  1.000 19.69466  ? 76   HIS H ND1 1 
ATOM   560   C CD2 . HIS A  1 96  ? 19.51363  22.27018   18.04925  1.000 18.71622  ? 76   HIS H CD2 1 
ATOM   561   C CE1 . HIS A  1 96  ? 19.02786  20.81400   19.61643  1.000 19.82868  ? 76   HIS H CE1 1 
ATOM   562   N NE2 . HIS A  1 96  ? 20.00461  21.54000   19.10431  1.000 17.14334  ? 76   HIS H NE2 1 
ATOM   563   N N   . LEU A  1 97  ? 17.86041  25.43007   17.25494  1.000 18.70244  ? 77   LEU H N   1 
ATOM   564   C CA  . LEU A  1 97  ? 18.73511  26.48060   17.76554  1.000 17.46926  ? 77   LEU H CA  1 
ATOM   565   C C   . LEU A  1 97  ? 17.93209  27.56107   18.49017  1.000 15.05165  ? 77   LEU H C   1 
ATOM   566   O O   . LEU A  1 97  ? 18.30031  27.99890   19.59874  1.000 15.52846  ? 77   LEU H O   1 
ATOM   567   C CB  . LEU A  1 97  ? 19.53568  27.07982   16.60631  1.000 15.36874  ? 77   LEU H CB  1 
ATOM   568   C CG  . LEU A  1 97  ? 20.48002  26.12056   15.84641  1.000 15.11099  ? 77   LEU H CG  1 
ATOM   569   C CD1 . LEU A  1 97  ? 20.98478  26.83311   14.61626  1.000 19.21940  ? 77   LEU H CD1 1 
ATOM   570   C CD2 . LEU A  1 97  ? 21.64346  25.66382   16.79471  1.000 13.77702  ? 77   LEU H CD2 1 
ATOM   571   N N   . GLN A  1 98  ? 16.83154  27.98871   17.88278  1.000 14.42340  ? 78   GLN H N   1 
ATOM   572   C CA  . GLN A  1 98  ? 15.96340  28.99587   18.48737  1.000 15.29085  ? 78   GLN H CA  1 
ATOM   573   C C   . GLN A  1 98  ? 15.47527  28.55801   19.85540  1.000 16.35821  ? 78   GLN H C   1 
ATOM   574   O O   . GLN A  1 98  ? 15.39402  29.37210   20.78772  1.000 19.98814  ? 78   GLN H O   1 
ATOM   575   C CB  . GLN A  1 98  ? 14.75482  29.25962   17.57556  1.000 18.23936  ? 78   GLN H CB  1 
ATOM   576   C CG  . GLN A  1 98  ? 15.07614  30.08866   16.32913  1.000 25.80500  ? 78   GLN H CG  1 
ATOM   577   C CD  . GLN A  1 98  ? 13.90972  30.13717   15.31575  1.000 30.50369  ? 78   GLN H CD  1 
ATOM   578   O OE1 . GLN A  1 98  ? 13.03074  29.27522   15.31575  1.000 34.53755  ? 78   GLN H OE1 1 
ATOM   579   N NE2 . GLN A  1 98  ? 13.91603  31.13999   14.45251  1.000 26.47264  ? 78   GLN H NE2 1 
ATOM   580   N N   . ARG A  1 99  ? 15.07945  27.29251   19.98027  1.000 15.63035  ? 79   ARG H N   1 
ATOM   581   C CA  . ARG A  1 99  ? 14.44414  26.82520   21.21584  1.000 19.31385  ? 79   ARG H CA  1 
ATOM   582   C C   . ARG A  1 99  ? 15.46050  26.31868   22.23049  1.000 19.42164  ? 79   ARG H C   1 
ATOM   583   O O   . ARG A  1 99  ? 15.20496  26.39585   23.43680  1.000 18.42920  ? 79   ARG H O   1 
ATOM   584   C CB  . ARG A  1 99  ? 13.42604  25.71737   20.90696  1.000 23.81055  ? 79   ARG H CB  1 
ATOM   585   C CG  . ARG A  1 99  ? 12.26173  26.20023   20.02374  1.000 32.15648  ? 79   ARG H CG  1 
ATOM   586   C CD  . ARG A  1 99  ? 11.04543  25.30439   20.06686  1.000 39.49746  ? 79   ARG H CD  1 
ATOM   587   N NE  . ARG A  1 99  ? 11.35162  23.93689   19.67646  1.000 45.15232  ? 79   ARG H NE  1 
ATOM   588   C CZ  . ARG A  1 99  ? 10.45036  22.95399   19.65101  1.000 51.86416  ? 79   ARG H CZ  1 
ATOM   589   N NH1 . ARG A  1 99  ? 9.18541   23.21379   19.99603  1.000 55.42662  ? 79   ARG H NH1 1 
ATOM   590   N NH2 . ARG A  1 99  ? 10.80670  21.71568   19.27828  1.000 47.29201  ? 79   ARG H NH2 1 
ATOM   591   N N   . GLY A  1 100 ? 16.60898  25.81423   21.77072  1.000 14.18972  ? 80   GLY H N   1 
ATOM   592   C CA  . GLY A  1 100 ? 17.59181  25.23561   22.66826  1.000 16.36669  ? 80   GLY H CA  1 
ATOM   593   C C   . GLY A  1 100 ? 18.67417  26.20849   23.10425  1.000 13.98618  ? 80   GLY H C   1 
ATOM   594   O O   . GLY A  1 100 ? 19.10908  26.19429   24.26533  1.000 19.13463  ? 80   GLY H O   1 
ATOM   595   N N   . TRP A  1 101 ? 19.12530  27.05757   22.17820  1.000 13.95842  ? 81   TRP H N   1 
ATOM   596   C CA  . TRP A  1 101 ? 20.28627  27.90044   22.41777  1.000 14.63895  ? 81   TRP H CA  1 
ATOM   597   C C   . TRP A  1 101 ? 19.84003  29.35135   22.62692  1.000 17.20007  ? 81   TRP H C   1 
ATOM   598   O O   . TRP A  1 101 ? 20.25842  30.25521   21.89198  1.000 16.43424  ? 81   TRP H O   1 
ATOM   599   C CB  . TRP A  1 101 ? 21.28416  27.72985   21.25323  1.000 12.09605  ? 81   TRP H CB  1 
ATOM   600   C CG  . TRP A  1 101 ? 21.94306  26.35930   21.37678  1.000 12.08981  ? 81   TRP H CG  1 
ATOM   601   C CD1 . TRP A  1 101 ? 21.48724  25.16271   20.88220  1.000 13.03464  ? 81   TRP H CD1 1 
ATOM   602   C CD2 . TRP A  1 101 ? 23.10432  26.05815   22.13934  1.000 14.50350  ? 81   TRP H CD2 1 
ATOM   603   N NE1 . TRP A  1 101 ? 22.34626  24.13108   21.25123  1.000 14.96059  ? 81   TRP H NE1 1 
ATOM   604   C CE2 . TRP A  1 101 ? 23.34184  24.66518   22.03110  1.000 14.76632  ? 81   TRP H CE2 1 
ATOM   605   C CE3 . TRP A  1 101 ? 23.98898  26.83729   22.89350  1.000 15.02155  ? 81   TRP H CE3 1 
ATOM   606   C CZ2 . TRP A  1 101 ? 24.41331  24.04874   22.64311  1.000 14.60103  ? 81   TRP H CZ2 1 
ATOM   607   C CZ3 . TRP A  1 101 ? 25.06747  26.21504   23.47650  1.000 12.97349  ? 81   TRP H CZ3 1 
ATOM   608   C CH2 . TRP A  1 101 ? 25.26368  24.84158   23.35889  1.000 14.24580  ? 81   TRP H CH2 1 
ATOM   609   N N   . ASP A  1 102 ? 19.02980  29.57573   23.68218  1.000 17.50562  ? 82   ASP H N   1 
ATOM   610   C CA  . ASP A  1 102 ? 18.22451  30.78939   23.79307  1.000 14.73127  ? 82   ASP H CA  1 
ATOM   611   C C   . ASP A  1 102 ? 18.58590  31.61231   25.01787  1.000 14.95215  ? 82   ASP H C   1 
ATOM   612   O O   . ASP A  1 102 ? 17.84192  32.52163   25.40180  1.000 20.51942  ? 82   ASP H O   1 
ATOM   613   C CB  . ASP A  1 102 ? 16.73633  30.44053   23.82064  1.000 15.33303  ? 82   ASP H CB  1 
ATOM   614   C CG  . ASP A  1 102 ? 16.33211  29.65369   25.07668  1.000 21.52291  ? 82   ASP H CG  1 
ATOM   615   O OD1 . ASP A  1 102 ? 17.22818  29.09325   25.79009  1.000 23.10738  ? 82   ASP H OD1 1 
ATOM   616   O OD2 . ASP A  1 102 ? 15.09936  29.59764   25.33984  1.000 24.89247  ? 82   ASP H OD2 1 
ATOM   617   N N   . PHE A  1 103 ? 19.70286  31.32414   25.64738  1.000 11.11403  ? 83   PHE H N   1 
ATOM   618   C CA  . PHE A  1 103 ? 20.00275  31.91246   26.94256  1.000 15.37227  ? 83   PHE H CA  1 
ATOM   619   C C   . PHE A  1 103 ? 21.17274  32.90902   26.88695  1.000 15.17628  ? 83   PHE H C   1 
ATOM   620   O O   . PHE A  1 103 ? 21.74350  33.21768   27.92922  1.000 19.42061  ? 83   PHE H O   1 
ATOM   621   C CB  . PHE A  1 103 ? 20.30781  30.78657   27.92629  1.000 14.86270  ? 83   PHE H CB  1 
ATOM   622   C CG  . PHE A  1 103 ? 21.42113  29.87471   27.45056  1.000 17.08431  ? 83   PHE H CG  1 
ATOM   623   C CD1 . PHE A  1 103 ? 22.74449  30.12749   27.80191  1.000 18.47471  ? 83   PHE H CD1 1 
ATOM   624   C CD2 . PHE A  1 103 ? 21.14114  28.75311   26.64422  1.000 16.89156  ? 83   PHE H CD2 1 
ATOM   625   C CE1 . PHE A  1 103 ? 23.78377  29.28763   27.36436  1.000 15.93803  ? 83   PHE H CE1 1 
ATOM   626   C CE2 . PHE A  1 103 ? 22.16946  27.90934   26.22258  1.000 16.92506  ? 83   PHE H CE2 1 
ATOM   627   C CZ  . PHE A  1 103 ? 23.48923  28.18032   26.55989  1.000 16.22971  ? 83   PHE H CZ  1 
ATOM   628   N N   . PHE A  1 104 ? 21.54002  33.38905   25.71143  1.000 13.56032  ? 84   PHE H N   1 
ATOM   629   C CA  . PHE A  1 104 ? 22.59511  34.40790   25.56294  1.000 17.45655  ? 84   PHE H CA  1 
ATOM   630   C C   . PHE A  1 104 ? 21.94855  35.79651   25.61361  1.000 19.58724  ? 84   PHE H C   1 
ATOM   631   O O   . PHE A  1 104 ? 20.92595  36.01591   24.95835  1.000 20.57280  ? 84   PHE H O   1 
ATOM   632   C CB  . PHE A  1 104 ? 23.34730  34.22334   24.22897  1.000 17.31477  ? 84   PHE H CB  1 
ATOM   633   C CG  . PHE A  1 104 ? 24.15279  32.95401   24.12807  1.000 19.72115  ? 84   PHE H CG  1 
ATOM   634   C CD1 . PHE A  1 104 ? 23.53989  31.70639   24.19678  1.000 27.06039  ? 84   PHE H CD1 1 
ATOM   635   C CD2 . PHE A  1 104 ? 25.52350  32.99981   23.91306  1.000 21.02201  ? 84   PHE H CD2 1 
ATOM   636   C CE1 . PHE A  1 104 ? 24.29052  30.53519   24.12508  1.000 30.19526  ? 84   PHE H CE1 1 
ATOM   637   C CE2 . PHE A  1 104 ? 26.28514  31.82385   23.85240  1.000 24.24702  ? 84   PHE H CE2 1 
ATOM   638   C CZ  . PHE A  1 104 ? 25.66065  30.59857   23.94653  1.000 30.50930  ? 84   PHE H CZ  1 
ATOM   639   N N   . ARG A  1 105 ? 22.50571  36.72648   26.40847  1.000 16.23739  ? 85   ARG H N   1 
ATOM   640   C CA  . ARG A  1 105 ? 21.98584  38.10265   26.42219  1.000 17.13852  ? 85   ARG H CA  1 
ATOM   641   C C   . ARG A  1 105 ? 23.04414  39.12159   25.99587  1.000 13.27889  ? 85   ARG H C   1 
ATOM   642   O O   . ARG A  1 105 ? 24.15083  39.12732   26.54316  1.000 13.44798  ? 85   ARG H O   1 
ATOM   643   C CB  . ARG A  1 105 ? 21.41390  38.50393   27.81053  1.000 17.49791  ? 85   ARG H CB  1 
ATOM   644   C CG  . ARG A  1 105 ? 20.11545  37.71007   28.11710  1.000 16.02731  ? 85   ARG H CG  1 
ATOM   645   C CD  . ARG A  1 105 ? 18.85378  38.29588   27.38115  1.000 14.25698  ? 85   ARG H CD  1 
ATOM   646   N NE  . ARG A  1 105 ? 18.63439  39.74231   27.44988  1.000 17.86248  ? 85   ARG H NE  1 
ATOM   647   C CZ  . ARG A  1 105 ? 17.45453  40.34815   27.20974  1.000 26.54610  ? 85   ARG H CZ  1 
ATOM   648   N NH1 . ARG A  1 105 ? 16.37683  39.63579   26.84601  1.000 23.24062  ? 85   ARG H NH1 1 
ATOM   649   N NH2 . ARG A  1 105 ? 17.32742  41.66978   27.35733  1.000 27.60893  ? 85   ARG H NH2 1 
ATOM   650   N N   . PRO A  1 106 ? 22.74094  39.97287   25.01433  1.000 13.90614  ? 86   PRO H N   1 
ATOM   651   C CA  . PRO A  1 106 ? 23.74063  40.94444   24.54281  1.000 15.42370  ? 86   PRO H CA  1 
ATOM   652   C C   . PRO A  1 106 ? 24.21984  41.86513   25.63389  1.000 19.32058  ? 86   PRO H C   1 
ATOM   653   O O   . PRO A  1 106 ? 25.37749  42.32003   25.59536  1.000 17.27662  ? 86   PRO H O   1 
ATOM   654   C CB  . PRO A  1 106 ? 22.99535  41.71354   23.43854  1.000 21.80543  ? 86   PRO H CB  1 
ATOM   655   C CG  . PRO A  1 106 ? 21.93960  40.76158   22.93528  1.000 28.22702  ? 86   PRO H CG  1 
ATOM   656   C CD  . PRO A  1 106 ? 21.48566  40.03973   24.23621  1.000 14.12952  ? 86   PRO H CD  1 
ATOM   657   N N   . GLU A  1 107 ? 23.38402  42.15366   26.63038  1.000 16.45151  ? 87   GLU H N   1 
ATOM   658   C CA  . GLU A  1 107 ? 23.88917  43.11126   27.60211  1.000 17.88173  ? 87   GLU H CA  1 
ATOM   659   C C   . GLU A  1 107 ? 24.93888  42.48056   28.49424  1.000 17.50252  ? 87   GLU H C   1 
ATOM   660   O O   . GLU A  1 107 ? 25.61651  43.20324   29.22524  1.000 20.22013  ? 87   GLU H O   1 
ATOM   661   C CB  . GLU A  1 107 ? 22.73363  43.76674   28.39021  1.000 24.83695  ? 87   GLU H CB  1 
ATOM   662   C CG  . GLU A  1 107 ? 21.80397  42.88556   29.08069  1.000 25.47202  ? 87   GLU H CG  1 
ATOM   663   C CD  . GLU A  1 107 ? 20.54830  42.53190   28.25037  1.000 20.49666  ? 87   GLU H CD  1 
ATOM   664   O OE1 . GLU A  1 107 ? 20.73439  41.77503   27.32309  1.000 16.69804  ? 87   GLU H OE1 1 
ATOM   665   O OE2 . GLU A  1 107 ? 19.41707  42.98644   28.56402  1.000 19.22534  ? 87   GLU H OE2 1 
ATOM   666   N N   . ARG A  1 108 ? 25.14280  41.17119   28.39112  1.000 16.06537  ? 88   ARG H N   1 
ATOM   667   C CA  . ARG A  1 108 ? 26.25294  40.46669   29.01565  1.000 15.96965  ? 88   ARG H CA  1 
ATOM   668   C C   . ARG A  1 108 ? 27.37928  40.19623   28.03293  1.000 17.09033  ? 88   ARG H C   1 
ATOM   669   O O   . ARG A  1 108 ? 28.27370  39.41508   28.35219  1.000 16.03301  ? 88   ARG H O   1 
ATOM   670   C CB  . ARG A  1 108 ? 25.76085  39.13373   29.63369  1.000 17.09162  ? 88   ARG H CB  1 
ATOM   671   C CG  . ARG A  1 108 ? 24.78378  39.35090   30.79141  1.000 15.78840  ? 88   ARG H CG  1 
ATOM   672   C CD  . ARG A  1 108 ? 24.45649  38.07838   31.60419  1.000 17.01509  ? 88   ARG H CD  1 
ATOM   673   N NE  . ARG A  1 108 ? 23.87267  36.99366   30.81995  1.000 22.47010  ? 88   ARG H NE  1 
ATOM   674   C CZ  . ARG A  1 108 ? 22.58015  36.63313   30.84778  1.000 18.86581  ? 88   ARG H CZ  1 
ATOM   675   N NH1 . ARG A  1 108 ? 21.69807  37.27205   31.61462  1.000 17.32173  ? 88   ARG H NH1 1 
ATOM   676   N NH2 . ARG A  1 108 ? 22.15563  35.63772   30.08036  1.000 20.67049  ? 88   ARG H NH2 1 
ATOM   677   N N   . ASN A  1 109 ? 27.35232  40.82591   26.84634  1.000 15.92756  ? 89   ASN H N   1 
ATOM   678   C CA  . ASN A  1 109 ? 28.35502  40.60730   25.79688  1.000 17.29767  ? 89   ASN H CA  1 
ATOM   679   C C   . ASN A  1 109 ? 28.31191  39.17191   25.27935  1.000 17.09738  ? 89   ASN H C   1 
ATOM   680   O O   . ASN A  1 109 ? 29.33457  38.56528   24.99525  1.000 18.62531  ? 89   ASN H O   1 
ATOM   681   C CB  . ASN A  1 109 ? 29.75610  40.97062   26.27972  1.000 17.41759  ? 89   ASN H CB  1 
ATOM   682   C CG  . ASN A  1 109 ? 29.91446  42.44437   26.46756  1.000 27.28774  ? 89   ASN H CG  1 
ATOM   683   O OD1 . ASN A  1 109 ? 30.52032  42.91324   27.44180  1.000 26.76613  ? 89   ASN H OD1 1 
ATOM   684   N ND2 . ASN A  1 109 ? 29.36374  43.19625   25.52904  1.000 19.54393  ? 89   ASN H ND2 1 
ATOM   685   N N   . GLU A  1 110 ? 27.12041  38.62306   25.18973  1.000 15.91700  ? 90   GLU H N   1 
ATOM   686   C CA  . GLU A  1 110 ? 26.89085  37.27819   24.70167  1.000 16.35298  ? 90   GLU H CA  1 
ATOM   687   C C   . GLU A  1 110 ? 26.02112  37.43019   23.48271  1.000 15.11761  ? 90   GLU H C   1 
ATOM   688   O O   . GLU A  1 110 ? 25.10914  38.26704   23.47531  1.000 18.20213  ? 90   GLU H O   1 
ATOM   689   C CB  . GLU A  1 110 ? 26.13862  36.40378   25.73624  1.000 15.38434  ? 90   GLU H CB  1 
ATOM   690   C CG  . GLU A  1 110 ? 26.78399  36.30237   27.10963  1.000 20.76101  ? 90   GLU H CG  1 
ATOM   691   C CD  . GLU A  1 110 ? 25.84902  35.73979   28.18065  1.000 21.44579  ? 90   GLU H CD  1 
ATOM   692   O OE1 . GLU A  1 110 ? 24.61328  35.64749   27.97395  1.000 15.91274  ? 90   GLU H OE1 1 
ATOM   693   O OE2 . GLU A  1 110 ? 26.36735  35.41431   29.26081  1.000 26.50475  ? 90   GLU H OE2 1 
ATOM   694   N N   . SER A  1 111 ? 26.20748  36.57282   22.48546  1.000 15.56954  ? 91   SER H N   1 
ATOM   695   C CA  . SER A  1 111 ? 25.31626  36.64714   21.34184  1.000 14.13226  ? 91   SER H CA  1 
ATOM   696   C C   . SER A  1 111 ? 25.25807  35.26384   20.70083  1.000 13.14591  ? 91   SER H C   1 
ATOM   697   O O   . SER A  1 111 ? 26.23036  34.50355   20.76008  1.000 17.85572  ? 91   SER H O   1 
ATOM   698   C CB  . SER A  1 111 ? 25.77907  37.70256   20.31366  1.000 16.82564  ? 91   SER H CB  1 
ATOM   699   O OG  . SER A  1 111 ? 27.14396  37.52105   19.95401  1.000 15.59761  ? 91   SER H OG  1 
ATOM   700   N N   . PHE A  1 112 ? 24.10625  34.95811   20.11503  1.000 11.72356  ? 92   PHE H N   1 
ATOM   701   C CA  . PHE A  1 112 ? 23.89525  33.71659   19.36073  1.000 14.10140  ? 92   PHE H CA  1 
ATOM   702   C C   . PHE A  1 112 ? 23.13573  34.06561   18.08110  1.000 17.90557  ? 92   PHE H C   1 
ATOM   703   O O   . PHE A  1 112 ? 21.94430  34.41944   18.12502  1.000 19.79235  ? 92   PHE H O   1 
ATOM   704   C CB  . PHE A  1 112 ? 23.14951  32.67542   20.23130  1.000 16.37590  ? 92   PHE H CB  1 
ATOM   705   C CG  . PHE A  1 112 ? 23.27975  31.25746   19.69487  1.000 17.44335  ? 92   PHE H CG  1 
ATOM   706   C CD1 . PHE A  1 112 ? 22.55042  30.86454   18.55987  1.000 21.62073  ? 92   PHE H CD1 1 
ATOM   707   C CD2 . PHE A  1 112 ? 24.15890  30.35453   20.27076  1.000 10.69997  ? 92   PHE H CD2 1 
ATOM   708   C CE1 . PHE A  1 112 ? 22.69301  29.60281   18.02815  1.000 17.35536  ? 92   PHE H CE1 1 
ATOM   709   C CE2 . PHE A  1 112 ? 24.32183  29.07705   19.73672  1.000 17.55648  ? 92   PHE H CE2 1 
ATOM   710   C CZ  . PHE A  1 112 ? 23.58223  28.69700   18.61682  1.000 14.85876  ? 92   PHE H CZ  1 
ATOM   711   N N   . ASP A  1 113 ? 23.82773  34.02076   16.93727  1.000 14.17984  ? 93   ASP H N   1 
ATOM   712   C CA  . ASP A  1 113 ? 23.30007  34.51098   15.67306  1.000 19.26521  ? 93   ASP H CA  1 
ATOM   713   C C   . ASP A  1 113 ? 23.08993  33.32752   14.74039  1.000 21.79549  ? 93   ASP H C   1 
ATOM   714   O O   . ASP A  1 113 ? 24.04487  32.59896   14.43613  1.000 24.77032  ? 93   ASP H O   1 
ATOM   715   C CB  . ASP A  1 113 ? 24.24094  35.53391   15.01692  1.000 19.99880  ? 93   ASP H CB  1 
ATOM   716   C CG  . ASP A  1 113 ? 24.22822  36.89552   15.75866  1.000 25.18409  ? 93   ASP H CG  1 
ATOM   717   O OD1 . ASP A  1 113 ? 25.27373  37.30929   16.28470  1.000 22.67562  ? 93   ASP H OD1 1 
ATOM   718   O OD2 . ASP A  1 113 ? 23.16292  37.54181   15.80757  1.000 24.88463  ? 93   ASP H OD2 1 
ATOM   719   N N   . ILE A  1 114 ? 21.85144  33.17006   14.26130  1.000 19.96585  ? 94   ILE H N   1 
ATOM   720   C CA  . ILE A  1 114 ? 21.50024  32.14577   13.28482  1.000 22.61281  ? 94   ILE H CA  1 
ATOM   721   C C   . ILE A  1 114 ? 21.42051  32.84572   11.93984  1.000 24.73287  ? 94   ILE H C   1 
ATOM   722   O O   . ILE A  1 114 ? 20.66288  33.81242   11.78534  1.000 25.68974  ? 94   ILE H O   1 
ATOM   723   C CB  . ILE A  1 114 ? 20.17036  31.46472   13.63590  1.000 23.39435  ? 94   ILE H CB  1 
ATOM   724   C CG1 . ILE A  1 114 ? 20.16187  30.96446   15.09321  1.000 22.58437  ? 94   ILE H CG1 1 
ATOM   725   C CG2 . ILE A  1 114 ? 19.89275  30.34233   12.65401  1.000 25.74597  ? 94   ILE H CG2 1 
ATOM   726   C CD1 . ILE A  1 114 ? 18.79603  30.56508   15.58363  1.000 21.74877  ? 94   ILE H CD1 1 
ATOM   727   N N   . LEU A  1 115 ? 22.20515  32.37737   10.97067  1.000 22.74125  ? 95   LEU H N   1 
ATOM   728   C CA  . LEU A  1 115 ? 22.45383  33.09520   9.72229   1.000 21.01139  ? 95   LEU H CA  1 
ATOM   729   C C   . LEU A  1 115 ? 22.16977  32.21260   8.51251   1.000 26.80987  ? 95   LEU H C   1 
ATOM   730   O O   . LEU A  1 115 ? 23.09308  31.67080   7.88968   1.000 30.63621  ? 95   LEU H O   1 
ATOM   731   C CB  . LEU A  1 115 ? 23.89682  33.59470   9.69676   1.000 23.21893  ? 95   LEU H CB  1 
ATOM   732   C CG  . LEU A  1 115 ? 24.30983  34.29340   10.99522  1.000 25.81350  ? 95   LEU H CG  1 
ATOM   733   C CD1 . LEU A  1 115 ? 25.80838  34.20256   11.20679  1.000 26.71558  ? 95   LEU H CD1 1 
ATOM   734   C CD2 . LEU A  1 115 ? 23.86148  35.73217   10.92954  1.000 27.80444  ? 95   LEU H CD2 1 
ATOM   735   N N   . PRO A  1 116 ? 20.90210  32.07914   8.12789   1.000 29.17694  ? 96   PRO H N   1 
ATOM   736   C CA  . PRO A  1 116 ? 20.56882  31.31443   6.92905   1.000 30.59011  ? 96   PRO H CA  1 
ATOM   737   C C   . PRO A  1 116 ? 20.79872  32.16253   5.69863   1.000 34.32307  ? 96   PRO H C   1 
ATOM   738   O O   . PRO A  1 116 ? 20.70996  33.38894   5.74167   1.000 38.42423  ? 96   PRO H O   1 
ATOM   739   C CB  . PRO A  1 116 ? 19.07378  31.00016   7.09860   1.000 31.99138  ? 96   PRO H CB  1 
ATOM   740   C CG  . PRO A  1 116 ? 18.69341  31.49297   8.50899   1.000 33.28266  ? 96   PRO H CG  1 
ATOM   741   C CD  . PRO A  1 116 ? 19.70049  32.55027   8.83720   1.000 31.94634  ? 96   PRO H CD  1 
ATOM   742   N N   . ALA A  1 117 ? 21.11229  31.50057   4.59624   1.000 40.52865  ? 97   ALA H N   1 
ATOM   743   C CA  . ALA A  1 117 ? 21.17198  32.21047   3.32776   1.000 42.34424  ? 97   ALA H CA  1 
ATOM   744   C C   . ALA A  1 117 ? 19.76456  32.67751   2.96471   1.000 51.77967  ? 97   ALA H C   1 
ATOM   745   O O   . ALA A  1 117 ? 18.85163  31.86190   2.80654   1.000 51.54189  ? 97   ALA H O   1 
ATOM   746   C CB  . ALA A  1 117 ? 21.76951  31.30525   2.26310   1.000 41.04883  ? 97   ALA H CB  1 
ATOM   747   N N   . SER A  1 118 ? 19.56122  33.98880   2.91389   1.000 65.42476  ? 98   SER H N   1 
ATOM   748   C CA  . SER A  1 118 ? 18.22792  34.52704   2.66277   1.000 83.51854  ? 98   SER H CA  1 
ATOM   749   C C   . SER A  1 118 ? 18.37722  35.97023   2.20099   1.000 104.32525 ? 98   SER H C   1 
ATOM   750   O O   . SER A  1 118 ? 19.40001  36.61538   2.45218   1.000 105.80527 ? 98   SER H O   1 
ATOM   751   C CB  . SER A  1 118 ? 17.31209  34.42564   3.90402   1.000 78.91100  ? 98   SER H CB  1 
ATOM   752   O OG  . SER A  1 118 ? 17.59349  35.41102   4.89884   1.000 74.37757  ? 98   SER H OG  1 
ATOM   753   N N   . GLN A  1 119 ? 17.34518  36.46370   1.50679   1.000 120.42669 ? 99   GLN H N   1 
ATOM   754   C CA  . GLN A  1 119 ? 17.34075  37.82147   0.96735   1.000 132.85405 ? 99   GLN H CA  1 
ATOM   755   C C   . GLN A  1 119 ? 17.40610  38.87458   2.07107   1.000 139.87989 ? 99   GLN H C   1 
ATOM   756   O O   . GLN A  1 119 ? 16.37874  39.45279   2.44579   1.000 144.13986 ? 99   GLN H O   1 
ATOM   757   C CB  . GLN A  1 119 ? 16.09793  38.04473   0.10059   1.000 137.43109 ? 99   GLN H CB  1 
ATOM   758   N N   . ARG A  1 120 ? 18.61268  39.13006   2.59108   1.000 140.79697 ? 100  ARG H N   1 
ATOM   759   C CA  . ARG A  1 120 ? 18.83362  40.14257   3.62161   1.000 141.79566 ? 100  ARG H CA  1 
ATOM   760   C C   . ARG A  1 120 ? 19.96239  41.09039   3.21488   1.000 148.61696 ? 100  ARG H C   1 
ATOM   761   O O   . ARG A  1 120 ? 19.95770  42.26861   3.59225   1.000 149.49189 ? 100  ARG H O   1 
ATOM   762   C CB  . ARG A  1 120 ? 19.12562  39.47727   4.97877   1.000 131.42713 ? 100  ARG H CB  1 
ATOM   763   C CG  . ARG A  1 120 ? 20.60265  39.33582   5.33192   1.000 121.43995 ? 100  ARG H CG  1 
ATOM   764   C CD  . ARG A  1 120 ? 20.82258  39.24162   6.83629   1.000 112.53703 ? 100  ARG H CD  1 
ATOM   765   N NE  . ARG A  1 120 ? 22.20134  38.87859   7.14672   1.000 102.59798 ? 100  ARG H NE  1 
ATOM   766   C CZ  . ARG A  1 120 ? 23.19215  39.75396   7.27132   1.000 96.05907  ? 100  ARG H CZ  1 
ATOM   767   N NH1 . ARG A  1 120 ? 24.41548  39.33340   7.53861   1.000 90.87551  ? 100  ARG H NH1 1 
ATOM   768   N NH2 . ARG A  1 120 ? 22.96177  41.04958   7.12435   1.000 97.66914  ? 100  ARG H NH2 1 
ATOM   769   N N   . VAL A  1 121 ? 20.92286  40.59053   2.43162   1.000 153.71531 ? 101  VAL H N   1 
ATOM   770   C CA  . VAL A  1 121 ? 22.03830  41.39772   1.94326   1.000 158.67017 ? 101  VAL H CA  1 
ATOM   771   C C   . VAL A  1 121 ? 22.22180  41.15695   0.44767   1.000 165.55331 ? 101  VAL H C   1 
ATOM   772   O O   . VAL A  1 121 ? 22.91866  41.91938   -0.23285  1.000 167.48874 ? 101  VAL H O   1 
ATOM   773   C CB  . VAL A  1 121 ? 23.33498  41.09881   2.72461   1.000 153.70848 ? 101  VAL H CB  1 
ATOM   774   C CG1 . VAL A  1 121 ? 24.02109  39.84849   2.18919   1.000 151.08417 ? 101  VAL H CG1 1 
ATOM   775   C CG2 . VAL A  1 121 ? 24.27373  42.29733   2.67790   1.000 153.75379 ? 101  VAL H CG2 1 
ATOM   776   N N   . SER A  1 122 ? 21.59025  40.10349   -0.07346  1.000 169.34495 ? 102  SER H N   1 
ATOM   777   C CA  . SER A  1 122 ? 21.63947  39.78607   -1.49723  1.000 173.37233 ? 102  SER H CA  1 
ATOM   778   C C   . SER A  1 122 ? 20.50441  38.82544   -1.83379  1.000 170.86898 ? 102  SER H C   1 
ATOM   779   O O   . SER A  1 122 ? 19.91910  38.19435   -0.94916  1.000 170.94161 ? 102  SER H O   1 
ATOM   780   C CB  . SER A  1 122 ? 22.99488  39.18492   -1.89753  1.000 175.06767 ? 102  SER H CB  1 
ATOM   781   O OG  . SER A  1 122 ? 23.36793  38.11698   -1.03963  1.000 173.56224 ? 102  SER H OG  1 
ATOM   782   N N   . GLU A  1 123 ? 20.19719  38.72730   -3.13088  1.000 166.94218 ? 103  GLU H N   1 
ATOM   783   C CA  . GLU A  1 123 ? 19.17242  37.80404   -3.60779  1.000 161.71587 ? 103  GLU H CA  1 
ATOM   784   C C   . GLU A  1 123 ? 19.57210  36.37199   -3.27638  1.000 153.87149 ? 103  GLU H C   1 
ATOM   785   O O   . GLU A  1 123 ? 18.93134  35.72280   -2.44244  1.000 152.46114 ? 103  GLU H O   1 
ATOM   786   C CB  . GLU A  1 123 ? 18.95234  37.96880   -5.11364  1.000 164.39391 ? 103  GLU H CB  1 
ATOM   787   N N   . THR A  1 124 ? 20.63293  35.88957   -3.93350  1.000 148.48446 ? 104  THR H N   1 
ATOM   788   C CA  . THR A  1 124 ? 21.32303  34.62697   -3.65680  1.000 140.85099 ? 104  THR H CA  1 
ATOM   789   C C   . THR A  1 124 ? 20.41373  33.48850   -3.19777  1.000 133.36963 ? 104  THR H C   1 
ATOM   790   O O   . THR A  1 124 ? 20.01948  32.64603   -4.01324  1.000 134.69852 ? 104  THR H O   1 
ATOM   791   C CB  . THR A  1 124 ? 22.43804  34.84234   -2.61881  1.000 138.81373 ? 104  THR H CB  1 
ATOM   792   O OG1 . THR A  1 124 ? 21.94585  35.59368   -1.49956  1.000 138.60740 ? 104  THR H OG1 1 
ATOM   793   C CG2 . THR A  1 124 ? 23.61605  35.58055   -3.24542  1.000 139.58886 ? 104  THR H CG2 1 
ATOM   794   N N   . GLN A  1 125 ? 20.10990  33.43868   -1.89411  1.000 123.87706 ? 105  GLN H N   1 
ATOM   795   C CA  . GLN A  1 125 ? 19.29720  32.40782   -1.23724  1.000 115.13736 ? 105  GLN H CA  1 
ATOM   796   C C   . GLN A  1 125 ? 20.10885  31.11557   -1.11561  1.000 110.55524 ? 105  GLN H C   1 
ATOM   797   O O   . GLN A  1 125 ? 19.58032  30.07907   -0.67329  1.000 110.54251 ? 105  GLN H O   1 
ATOM   798   C CB  . GLN A  1 125 ? 17.96844  32.22592   -1.98820  1.000 114.23366 ? 105  GLN H CB  1 
ATOM   799   C CG  . GLN A  1 125 ? 16.92434  31.29063   -1.42283  1.000 110.88145 ? 105  GLN H CG  1 
ATOM   800   C CD  . GLN A  1 125 ? 15.62125  31.39416   -2.20073  1.000 112.92259 ? 105  GLN H CD  1 
ATOM   801   O OE1 . GLN A  1 125 ? 15.25173  32.47187   -2.67388  1.000 114.54825 ? 105  GLN H OE1 1 
ATOM   802   N NE2 . GLN A  1 125 ? 14.93592  30.26950   -2.36450  1.000 113.26630 ? 105  GLN H NE2 1 
ATOM   803   N N   . TRP A  1 126 ? 21.40372  31.16422   -1.45434  1.000 106.12674 ? 106  TRP H N   1 
ATOM   804   C CA  . TRP A  1 126 ? 22.35664  30.05891   -1.40075  1.000 99.91170  ? 106  TRP H CA  1 
ATOM   805   C C   . TRP A  1 126 ? 23.70749  30.63910   -0.99572  1.000 83.85479  ? 106  TRP H C   1 
ATOM   806   O O   . TRP A  1 126 ? 24.04810  31.74276   -1.42823  1.000 85.45435  ? 106  TRP H O   1 
ATOM   807   C CB  . TRP A  1 126 ? 22.46156  29.36778   -2.78126  1.000 112.23365 ? 106  TRP H CB  1 
ATOM   808   C CG  . TRP A  1 126 ? 22.78160  27.88885   -2.77550  1.000 119.96965 ? 106  TRP H CG  1 
ATOM   809   C CD1 . TRP A  1 126 ? 21.92585  26.87315   -2.48300  1.000 122.63334 ? 106  TRP H CD1 1 
ATOM   810   C CD2 . TRP A  1 126 ? 24.03320  27.26730   -3.12654  1.000 124.14945 ? 106  TRP H CD2 1 
ATOM   811   N NE1 . TRP A  1 126 ? 22.56298  25.65919   -2.59750  1.000 124.21181 ? 106  TRP H NE1 1 
ATOM   812   C CE2 . TRP A  1 126 ? 23.85785  25.87230   -2.99456  1.000 125.00663 ? 106  TRP H CE2 1 
ATOM   813   C CE3 . TRP A  1 126 ? 25.28377  27.75438   -3.53247  1.000 125.67977 ? 106  TRP H CE3 1 
ATOM   814   C CZ2 . TRP A  1 126 ? 24.88887  24.95867   -3.24718  1.000 125.19447 ? 106  TRP H CZ2 1 
ATOM   815   C CZ3 . TRP A  1 126 ? 26.31281  26.84158   -3.77834  1.000 125.25130 ? 106  TRP H CZ3 1 
ATOM   816   C CH2 . TRP A  1 126 ? 26.10453  25.46265   -3.63662  1.000 124.94901 ? 106  TRP H CH2 1 
ATOM   817   N N   . TYR A  1 127 ? 24.47235  29.93265   -0.15554  1.000 68.53440  ? 107  TYR H N   1 
ATOM   818   C CA  . TYR A  1 127 ? 25.86556  30.31843   0.09084   1.000 57.90199  ? 107  TYR H CA  1 
ATOM   819   C C   . TYR A  1 127 ? 26.76058  29.58045   -0.89592  1.000 55.36002  ? 107  TYR H C   1 
ATOM   820   O O   . TYR A  1 127 ? 26.63828  28.36264   -1.05487  1.000 54.89619  ? 107  TYR H O   1 
ATOM   821   C CB  . TYR A  1 127 ? 26.35291  30.00279   1.50544   1.000 51.75752  ? 107  TYR H CB  1 
ATOM   822   C CG  . TYR A  1 127 ? 25.81779  30.86093   2.65475   1.000 46.30705  ? 107  TYR H CG  1 
ATOM   823   C CD1 . TYR A  1 127 ? 25.81493  32.25378   2.60159   1.000 44.93309  ? 107  TYR H CD1 1 
ATOM   824   C CD2 . TYR A  1 127 ? 25.34647  30.25632   3.81049   1.000 41.92429  ? 107  TYR H CD2 1 
ATOM   825   C CE1 . TYR A  1 127 ? 25.32342  33.01046   3.67159   1.000 38.75073  ? 107  TYR H CE1 1 
ATOM   826   C CE2 . TYR A  1 127 ? 24.85357  30.99705   4.88310   1.000 34.27497  ? 107  TYR H CE2 1 
ATOM   827   C CZ  . TYR A  1 127 ? 24.84009  32.35962   4.81257   1.000 33.81239  ? 107  TYR H CZ  1 
ATOM   828   O OH  . TYR A  1 127 ? 24.33173  33.03996   5.89368   1.000 28.49995  ? 107  TYR H OH  1 
ATOM   829   N N   . GLU A  1 128 ? 27.68841  30.30978   -1.51962  1.000 50.94110  ? 108  GLU H N   1 
ATOM   830   C CA  . GLU A  1 128 ? 28.54686  29.73441   -2.55122  1.000 48.78972  ? 108  GLU H CA  1 
ATOM   831   C C   . GLU A  1 128 ? 29.54819  28.72858   -2.00018  1.000 44.91134  ? 108  GLU H C   1 
ATOM   832   O O   . GLU A  1 128 ? 30.18565  28.01919   -2.78869  1.000 46.60351  ? 108  GLU H O   1 
ATOM   833   C CB  . GLU A  1 128 ? 29.28115  30.85143   -3.29912  1.000 49.59195  ? 108  GLU H CB  1 
ATOM   834   C CG  . GLU A  1 128 ? 29.34585  30.61362   -4.78470  1.000 60.60968  ? 108  GLU H CG  1 
ATOM   835   C CD  . GLU A  1 128 ? 28.01034  30.84163   -5.47179  1.000 67.18463  ? 108  GLU H CD  1 
ATOM   836   O OE1 . GLU A  1 128 ? 27.59053  32.01850   -5.57089  1.000 71.54625  ? 108  GLU H OE1 1 
ATOM   837   O OE2 . GLU A  1 128 ? 27.38053  29.84477   -5.90694  1.000 66.65473  ? 108  GLU H OE2 1 
ATOM   838   N N   . GLY A  1 129 ? 29.66828  28.62300   -0.68716  1.000 36.39799  ? 109  GLY H N   1 
ATOM   839   C CA  . GLY A  1 129 ? 30.67700  27.78342   -0.08088  1.000 32.44272  ? 109  GLY H CA  1 
ATOM   840   C C   . GLY A  1 129 ? 30.90659  28.22490   1.34765   1.000 34.94282  ? 109  GLY H C   1 
ATOM   841   O O   . GLY A  1 129 ? 30.37607  29.23961   1.79857   1.000 37.46205  ? 109  GLY H O   1 
ATOM   842   N N   . THR A  1 130 ? 31.75473  27.45384   2.04446   1.000 35.07647  ? 110  THR H N   1 
ATOM   843   C CA  . THR A  1 130 ? 31.95870  27.67013   3.48347   1.000 32.99822  ? 110  THR H CA  1 
ATOM   844   C C   . THR A  1 130 ? 32.67329  28.98422   3.77672   1.000 34.00140  ? 110  THR H C   1 
ATOM   845   O O   . THR A  1 130 ? 32.44427  29.59192   4.83254   1.000 35.35363  ? 110  THR H O   1 
ATOM   846   C CB  . THR A  1 130 ? 32.75880  26.51446   4.08453   1.000 33.41193  ? 110  THR H CB  1 
ATOM   847   O OG1 . THR A  1 130 ? 33.98608  26.35507   3.34976   1.000 35.75061  ? 110  THR H OG1 1 
ATOM   848   C CG2 . THR A  1 130 ? 31.94000  25.21869   4.05540   1.000 31.07368  ? 110  THR H CG2 1 
ATOM   849   N N   . ALA A  1 131 ? 33.57922  29.41759   2.89502   1.000 32.59664  ? 111  ALA H N   1 
ATOM   850   C CA  . ALA A  1 131 ? 34.15594  30.74585   3.06184   1.000 31.01093  ? 111  ALA H CA  1 
ATOM   851   C C   . ALA A  1 131 ? 33.09549  31.82535   2.83938   1.000 35.48117  ? 111  ALA H C   1 
ATOM   852   O O   . ALA A  1 131 ? 32.99270  32.77306   3.62618   1.000 35.88654  ? 111  ALA H O   1 
ATOM   853   C CB  . ALA A  1 131 ? 35.34738  30.93181   2.12020   1.000 35.38578  ? 111  ALA H CB  1 
ATOM   854   N N   . ASP A  1 132 ? 32.27571  31.67508   1.78665   1.000 38.50988  ? 112  ASP H N   1 
ATOM   855   C CA  . ASP A  1 132 ? 31.18090  32.60961   1.51612   1.000 39.12157  ? 112  ASP H CA  1 
ATOM   856   C C   . ASP A  1 132 ? 30.19147  32.68587   2.67074   1.000 36.11015  ? 112  ASP H C   1 
ATOM   857   O O   . ASP A  1 132 ? 29.61667  33.75514   2.92593   1.000 33.70100  ? 112  ASP H O   1 
ATOM   858   C CB  . ASP A  1 132 ? 30.44491  32.20477   0.23518   1.000 31.15403  ? 112  ASP H CB  1 
ATOM   859   C CG  . ASP A  1 132 ? 29.52261  33.29301   -0.28584  1.000 39.33195  ? 112  ASP H CG  1 
ATOM   860   O OD1 . ASP A  1 132 ? 29.96963  34.46230   -0.41310  1.000 38.97742  ? 112  ASP H OD1 1 
ATOM   861   O OD2 . ASP A  1 132 ? 28.35411  32.97915   -0.62668  1.000 38.77299  ? 112  ASP H OD2 1 
ATOM   862   N N   . ALA A  1 133 ? 29.96936  31.56653   3.37329   1.000 34.27144  ? 113  ALA H N   1 
ATOM   863   C CA  . ALA A  1 133 ? 29.02813  31.56554   4.49341   1.000 32.47004  ? 113  ALA H CA  1 
ATOM   864   C C   . ALA A  1 133 ? 29.46387  32.50708   5.61478   1.000 32.38841  ? 113  ALA H C   1 
ATOM   865   O O   . ALA A  1 133 ? 28.61301  33.07534   6.30934   1.000 37.33200  ? 113  ALA H O   1 
ATOM   866   C CB  . ALA A  1 133 ? 28.85545  30.14858   5.02946   1.000 26.20957  ? 113  ALA H CB  1 
ATOM   867   N N   . VAL A  1 134 ? 30.76881  32.68135   5.81953   1.000 28.32174  ? 114  VAL H N   1 
ATOM   868   C CA  . VAL A  1 134 ? 31.23398  33.73125   6.72407   1.000 29.76522  ? 114  VAL H CA  1 
ATOM   869   C C   . VAL A  1 134 ? 31.24762  35.08758   6.01590   1.000 30.68749  ? 114  VAL H C   1 
ATOM   870   O O   . VAL A  1 134 ? 30.85997  36.11853   6.59440   1.000 26.79697  ? 114  VAL H O   1 
ATOM   871   C CB  . VAL A  1 134 ? 32.61938  33.36820   7.28868   1.000 29.12751  ? 114  VAL H CB  1 
ATOM   872   C CG1 . VAL A  1 134 ? 33.02751  34.32722   8.40644   1.000 24.16482  ? 114  VAL H CG1 1 
ATOM   873   C CG2 . VAL A  1 134 ? 32.62098  31.93623   7.80985   1.000 27.69466  ? 114  VAL H CG2 1 
ATOM   874   N N   . TYR A  1 135 ? 31.62704  35.09914   4.73065   1.000 31.65343  ? 115  TYR H N   1 
ATOM   875   C CA  . TYR A  1 135 ? 31.87586  36.36032   4.04165   1.000 29.58618  ? 115  TYR H CA  1 
ATOM   876   C C   . TYR A  1 135 ? 30.60735  37.19911   3.95446   1.000 32.28514  ? 115  TYR H C   1 
ATOM   877   O O   . TYR A  1 135 ? 30.62349  38.39953   4.24528   1.000 33.70059  ? 115  TYR H O   1 
ATOM   878   C CB  . TYR A  1 135 ? 32.44659  36.09286   2.64849   1.000 32.30135  ? 115  TYR H CB  1 
ATOM   879   C CG  . TYR A  1 135 ? 32.47542  37.33206   1.79195   1.000 36.42021  ? 115  TYR H CG  1 
ATOM   880   C CD1 . TYR A  1 135 ? 33.43982  38.30094   1.99044   1.000 36.86135  ? 115  TYR H CD1 1 
ATOM   881   C CD2 . TYR A  1 135 ? 31.52524  37.54413   0.79828   1.000 39.90747  ? 115  TYR H CD2 1 
ATOM   882   C CE1 . TYR A  1 135 ? 33.47263  39.43634   1.23041   1.000 37.75177  ? 115  TYR H CE1 1 
ATOM   883   C CE2 . TYR A  1 135 ? 31.54990  38.69385   0.02316   1.000 41.68666  ? 115  TYR H CE2 1 
ATOM   884   C CZ  . TYR A  1 135 ? 32.53022  39.63272   0.25030   1.000 42.09426  ? 115  TYR H CZ  1 
ATOM   885   O OH  . TYR A  1 135 ? 32.59247  40.77636   -0.50815  1.000 46.57878  ? 115  TYR H OH  1 
ATOM   886   N N   A GLN A  1 136 ? 29.48836  36.57853   3.56570   0.781 32.11987  ? 116  GLN H N   1 
ATOM   887   N N   B GLN A  1 136 ? 29.48830  36.57310   3.58278   0.219 32.48276  ? 116  GLN H N   1 
ATOM   888   C CA  A GLN A  1 136 ? 28.23156  37.30773   3.47439   0.781 34.08028  ? 116  GLN H CA  1 
ATOM   889   C CA  B GLN A  1 136 ? 28.22172  37.28612   3.48177   0.219 34.27883  ? 116  GLN H CA  1 
ATOM   890   C C   A GLN A  1 136 ? 27.78201  37.87892   4.81105   0.781 33.12157  ? 116  GLN H C   1 
ATOM   891   C C   B GLN A  1 136 ? 27.73384  37.82197   4.81989   0.219 33.60680  ? 116  GLN H C   1 
ATOM   892   O O   A GLN A  1 136 ? 26.90156  38.74769   4.81307   0.781 36.46183  ? 116  GLN H O   1 
ATOM   893   O O   B GLN A  1 136 ? 26.77503  38.60276   4.83799   0.219 35.86962  ? 116  GLN H O   1 
ATOM   894   C CB  A GLN A  1 136 ? 27.13034  36.40623   2.91023   0.781 35.32323  ? 116  GLN H CB  1 
ATOM   895   C CB  B GLN A  1 136 ? 27.15363  36.37245   2.88299   0.219 35.41227  ? 116  GLN H CB  1 
ATOM   896   C CG  A GLN A  1 136 ? 27.41307  35.89643   1.48883   0.781 37.24521  ? 116  GLN H CG  1 
ATOM   897   C CG  B GLN A  1 136 ? 26.31506  37.03134   1.80782   0.219 39.53510  ? 116  GLN H CG  1 
ATOM   898   C CD  A GLN A  1 136 ? 27.51008  37.02296   0.49979   0.781 42.17754  ? 116  GLN H CD  1 
ATOM   899   C CD  B GLN A  1 136 ? 25.08816  36.21853   1.44708   0.219 40.17034  ? 116  GLN H CD  1 
ATOM   900   O OE1 A GLN A  1 136 ? 26.68473  37.93917   0.50887   0.781 42.98280  ? 116  GLN H OE1 1 
ATOM   901   O OE1 B GLN A  1 136 ? 23.95461  36.64843   1.67105   0.219 41.18981  ? 116  GLN H OE1 1 
ATOM   902   N NE2 A GLN A  1 136 ? 28.52189  36.97511   -0.36379  0.781 44.65130  ? 116  GLN H NE2 1 
ATOM   903   N NE2 B GLN A  1 136 ? 25.30868  35.03468   0.88194   0.219 38.47696  ? 116  GLN H NE2 1 
ATOM   904   N N   . ASN A  1 137 ? 28.36072  37.42673   5.93003   1.000 28.73794  ? 117  ASN H N   1 
ATOM   905   C CA  . ASN A  1 137 ? 27.93934  37.84635   7.26266   1.000 30.21515  ? 117  ASN H CA  1 
ATOM   906   C C   . ASN A  1 137 ? 28.98848  38.69103   7.98431   1.000 30.15622  ? 117  ASN H C   1 
ATOM   907   O O   . ASN A  1 137 ? 28.94509  38.82133   9.21987   1.000 25.97900  ? 117  ASN H O   1 
ATOM   908   C CB  . ASN A  1 137 ? 27.54484  36.61476   8.08300   1.000 27.02137  ? 117  ASN H CB  1 
ATOM   909   C CG  . ASN A  1 137 ? 26.30230  35.93564   7.51520   1.000 30.27428  ? 117  ASN H CG  1 
ATOM   910   O OD1 . ASN A  1 137 ? 25.20589  36.49685   7.55849   1.000 35.27289  ? 117  ASN H OD1 1 
ATOM   911   N ND2 . ASN A  1 137 ? 26.47371  34.75011   6.94408   1.000 28.54694  ? 117  ASN H ND2 1 
ATOM   912   N N   . ILE A  1 138 ? 29.89457  39.33048   7.23722   1.000 31.47114  ? 118  ILE H N   1 
ATOM   913   C CA  . ILE A  1 138 ? 30.85566  40.23905   7.86432   1.000 34.17016  ? 118  ILE H CA  1 
ATOM   914   C C   . ILE A  1 138 ? 30.13758  41.36677   8.61546   1.000 33.56449  ? 118  ILE H C   1 
ATOM   915   O O   . ILE A  1 138 ? 30.58460  41.79939   9.68880   1.000 34.11612  ? 118  ILE H O   1 
ATOM   916   C CB  . ILE A  1 138 ? 31.84304  40.77165   6.80389   1.000 37.14526  ? 118  ILE H CB  1 
ATOM   917   C CG1 . ILE A  1 138 ? 32.74005  39.62934   6.30426   1.000 38.01249  ? 118  ILE H CG1 1 
ATOM   918   C CG2 . ILE A  1 138 ? 32.69862  41.88715   7.37761   1.000 41.24422  ? 118  ILE H CG2 1 
ATOM   919   C CD1 . ILE A  1 138 ? 33.68824  40.04345   5.16687   1.000 40.85658  ? 118  ILE H CD1 1 
ATOM   920   N N   . ASP A  1 139 ? 28.98301  41.80431   8.11848   1.000 35.06958  ? 119  ASP H N   1 
ATOM   921   C CA  . ASP A  1 139 ? 28.29775  42.90302   8.77925   1.000 35.21628  ? 119  ASP H CA  1 
ATOM   922   C C   . ASP A  1 139 ? 27.67448  42.49870   10.10550  1.000 36.09407  ? 119  ASP H C   1 
ATOM   923   O O   . ASP A  1 139 ? 27.27504  43.39066   10.85933  1.000 39.07418  ? 119  ASP H O   1 
ATOM   924   C CB  . ASP A  1 139 ? 27.22856  43.49308   7.86054   1.000 43.80557  ? 119  ASP H CB  1 
ATOM   925   C CG  . ASP A  1 139 ? 26.16470  42.48098   7.45556   1.000 50.85377  ? 119  ASP H CG  1 
ATOM   926   O OD1 . ASP A  1 139 ? 26.36166  41.26693   7.67120   1.000 51.34403  ? 119  ASP H OD1 1 
ATOM   927   O OD2 . ASP A  1 139 ? 25.12721  42.90474   6.90928   1.000 55.51814  ? 119  ASP H OD2 1 
ATOM   928   N N   . ILE A  1 140 ? 27.54738  41.19179   10.38304  1.000 28.96582  ? 120  ILE H N   1 
ATOM   929   C CA  . ILE A  1 140 ? 27.18946  40.71649   11.71864  1.000 27.37426  ? 120  ILE H CA  1 
ATOM   930   C C   . ILE A  1 140 ? 28.42206  40.68427   12.60802  1.000 35.18198  ? 120  ILE H C   1 
ATOM   931   O O   . ILE A  1 140 ? 28.34430  40.99009   13.80625  1.000 37.23142  ? 120  ILE H O   1 
ATOM   932   C CB  . ILE A  1 140 ? 26.52747  39.32267   11.66555  1.000 28.27288  ? 120  ILE H CB  1 
ATOM   933   C CG1 . ILE A  1 140 ? 25.43057  39.24282   10.60671  1.000 33.37708  ? 120  ILE H CG1 1 
ATOM   934   C CG2 . ILE A  1 140 ? 25.95840  38.92116   13.04214  1.000 31.20074  ? 120  ILE H CG2 1 
ATOM   935   C CD1 . ILE A  1 140 ? 24.08750  39.80278   11.03858  1.000 37.45649  ? 120  ILE H CD1 1 
ATOM   936   N N   . ILE A  1 141 ? 29.57095  40.30141   12.04804  1.000 24.70137  ? 121  ILE H N   1 
ATOM   937   C CA  . ILE A  1 141 ? 30.76227  40.06012   12.85928  1.000 31.89704  ? 121  ILE H CA  1 
ATOM   938   C C   . ILE A  1 141 ? 31.40279  41.37518   13.28219  1.000 34.12603  ? 121  ILE H C   1 
ATOM   939   O O   . ILE A  1 141 ? 31.74116  41.56433   14.45947  1.000 35.70119  ? 121  ILE H O   1 
ATOM   940   C CB  . ILE A  1 141 ? 31.76293  39.17515   12.08927  1.000 31.40019  ? 121  ILE H CB  1 
ATOM   941   C CG1 . ILE A  1 141 ? 31.24864  37.73360   11.96345  1.000 27.65038  ? 121  ILE H CG1 1 
ATOM   942   C CG2 . ILE A  1 141 ? 33.13089  39.24181   12.76032  1.000 30.85320  ? 121  ILE H CG2 1 
ATOM   943   C CD1 . ILE A  1 141 ? 31.95077  36.89942   10.85752  1.000 28.67740  ? 121  ILE H CD1 1 
ATOM   944   N N   . GLU A  1 142 ? 31.59095  42.29508   12.32807  1.000 31.55200  ? 122  GLU H N   1 
ATOM   945   C CA  . GLU A  1 142 ? 32.33879  43.51945   12.61556  1.000 34.49485  ? 122  GLU H CA  1 
ATOM   946   C C   . GLU A  1 142 ? 31.75700  44.33592   13.76010  1.000 35.12693  ? 122  GLU H C   1 
ATOM   947   O O   . GLU A  1 142 ? 32.54721  44.80049   14.59441  1.000 37.57423  ? 122  GLU H O   1 
ATOM   948   C CB  . GLU A  1 142 ? 32.47756  44.37184   11.34500  1.000 42.63502  ? 122  GLU H CB  1 
ATOM   949   C CG  . GLU A  1 142 ? 33.52668  43.81984   10.37670  1.000 48.79263  ? 122  GLU H CG  1 
ATOM   950   C CD  . GLU A  1 142 ? 33.64954  44.61219   9.06741   1.000 55.93285  ? 122  GLU H CD  1 
ATOM   951   O OE1 . GLU A  1 142 ? 34.63974  44.37314   8.33304   1.000 57.34279  ? 122  GLU H OE1 1 
ATOM   952   O OE2 . GLU A  1 142 ? 32.76266  45.45333   8.76459   1.000 58.53135  ? 122  GLU H OE2 1 
ATOM   953   N N   . PRO A  1 143 ? 30.43914  44.53092   13.89167  1.000 38.39887  ? 123  PRO H N   1 
ATOM   954   C CA  . PRO A  1 143 ? 29.92907  45.24379   15.07714  1.000 37.72480  ? 123  PRO H CA  1 
ATOM   955   C C   . PRO A  1 143 ? 30.33280  44.63938   16.40622  1.000 36.12843  ? 123  PRO H C   1 
ATOM   956   O O   . PRO A  1 143 ? 30.35930  45.36049   17.41397  1.000 37.25850  ? 123  PRO H O   1 
ATOM   957   C CB  . PRO A  1 143 ? 28.40800  45.18430   14.89141  1.000 41.98414  ? 123  PRO H CB  1 
ATOM   958   C CG  . PRO A  1 143 ? 28.22866  45.18439   13.43358  1.000 47.30355  ? 123  PRO H CG  1 
ATOM   959   C CD  . PRO A  1 143 ? 29.37945  44.35437   12.88170  1.000 46.86278  ? 123  PRO H CD  1 
ATOM   960   N N   . TYR A  1 144 ? 30.61181  43.33543   16.46026  1.000 32.17197  ? 124  TYR H N   1 
ATOM   961   C CA  . TYR A  1 144 ? 31.05153  42.73181   17.71829  1.000 30.17477  ? 124  TYR H CA  1 
ATOM   962   C C   . TYR A  1 144 ? 32.53837  42.94540   17.93653  1.000 30.40641  ? 124  TYR H C   1 
ATOM   963   O O   . TYR A  1 144 ? 33.00713  42.90927   19.08425  1.000 29.15705  ? 124  TYR H O   1 
ATOM   964   C CB  . TYR A  1 144 ? 30.76488  41.22517   17.74307  1.000 22.84574  ? 124  TYR H CB  1 
ATOM   965   C CG  . TYR A  1 144 ? 29.29970  40.81811   17.69026  1.000 23.54427  ? 124  TYR H CG  1 
ATOM   966   C CD1 . TYR A  1 144 ? 28.34077  41.49262   18.42188  1.000 27.43309  ? 124  TYR H CD1 1 
ATOM   967   C CD2 . TYR A  1 144 ? 28.88478  39.74710   16.88303  1.000 23.68345  ? 124  TYR H CD2 1 
ATOM   968   C CE1 . TYR A  1 144 ? 26.99075  41.12615   18.36850  1.000 29.31808  ? 124  TYR H CE1 1 
ATOM   969   C CE2 . TYR A  1 144 ? 27.55352  39.36895   16.83859  1.000 24.64180  ? 124  TYR H CE2 1 
ATOM   970   C CZ  . TYR A  1 144 ? 26.61043  40.05868   17.57544  1.000 27.48787  ? 124  TYR H CZ  1 
ATOM   971   O OH  . TYR A  1 144 ? 25.28583  39.68877   17.52058  1.000 32.03529  ? 124  TYR H OH  1 
ATOM   972   N N   . ALA A  1 145 ? 33.27360  43.13608   16.84487  1.000 28.79122  ? 125  ALA H N   1 
ATOM   973   C CA  . ALA A  1 145 ? 34.71509  43.34226   16.86418  1.000 27.34247  ? 125  ALA H CA  1 
ATOM   974   C C   . ALA A  1 145 ? 35.43015  42.31821   17.75030  1.000 26.90944  ? 125  ALA H C   1 
ATOM   975   O O   . ALA A  1 145 ? 36.17534  42.69509   18.65693  1.000 30.02668  ? 125  ALA H O   1 
ATOM   976   C CB  . ALA A  1 145 ? 35.03549  44.75654   17.33413  1.000 30.51520  ? 125  ALA H CB  1 
ATOM   977   N N   . PRO A  1 146 ? 35.20081  41.02371   17.54167  1.000 26.86872  ? 126  PRO H N   1 
ATOM   978   C CA  . PRO A  1 146 ? 35.96630  40.03934   18.30755  1.000 27.14165  ? 126  PRO H CA  1 
ATOM   979   C C   . PRO A  1 146 ? 37.40009  40.03628   17.81579  1.000 25.96484  ? 126  PRO H C   1 
ATOM   980   O O   . PRO A  1 146 ? 37.66824  40.28170   16.63913  1.000 25.39660  ? 126  PRO H O   1 
ATOM   981   C CB  . PRO A  1 146 ? 35.26766  38.71720   18.00067  1.000 28.34405  ? 126  PRO H CB  1 
ATOM   982   C CG  . PRO A  1 146 ? 34.71942  38.90300   16.61356  1.000 32.53397  ? 126  PRO H CG  1 
ATOM   983   C CD  . PRO A  1 146 ? 34.36240  40.38830   16.50625  1.000 32.08928  ? 126  PRO H CD  1 
ATOM   984   N N   . GLU A  1 147 ? 38.33450  39.77728   18.73188  1.000 24.00147  ? 127  GLU H N   1 
ATOM   985   C CA  . GLU A  1 147 ? 39.73531  39.75925   18.31118  1.000 25.32947  ? 127  GLU H CA  1 
ATOM   986   C C   . GLU A  1 147 ? 40.05085  38.51414   17.48619  1.000 27.29569  ? 127  GLU H C   1 
ATOM   987   O O   . GLU A  1 147 ? 40.90005  38.56709   16.58086  1.000 28.27830  ? 127  GLU H O   1 
ATOM   988   C CB  . GLU A  1 147 ? 40.65939  39.83728   19.51693  1.000 27.42266  ? 127  GLU H CB  1 
ATOM   989   C CG  . GLU A  1 147 ? 42.12537  39.97433   19.14298  1.000 36.82673  ? 127  GLU H CG  1 
ATOM   990   C CD  . GLU A  1 147 ? 42.50268  41.38151   18.69304  1.000 46.15958  ? 127  GLU H CD  1 
ATOM   991   O OE1 . GLU A  1 147 ? 41.61938  42.27358   18.68829  1.000 47.48414  ? 127  GLU H OE1 1 
ATOM   992   O OE2 . GLU A  1 147 ? 43.69547  41.59291   18.35499  1.000 51.52870  ? 127  GLU H OE2 1 
ATOM   993   N N   . TYR A  1 148 ? 39.36398  37.40160   17.77059  1.000 24.16508  ? 128  TYR H N   1 
ATOM   994   C CA  . TYR A  1 148 ? 39.62911  36.10090   17.14814  1.000 23.71441  ? 128  TYR H CA  1 
ATOM   995   C C   . TYR A  1 148 ? 38.34977  35.46982   16.62483  1.000 20.83728  ? 128  TYR H C   1 
ATOM   996   O O   . TYR A  1 148 ? 37.26448  35.64486   17.19545  1.000 21.64079  ? 128  TYR H O   1 
ATOM   997   C CB  . TYR A  1 148 ? 40.27651  35.10744   18.12566  1.000 23.65729  ? 128  TYR H CB  1 
ATOM   998   C CG  . TYR A  1 148 ? 41.35008  35.73889   18.95785  1.000 30.62720  ? 128  TYR H CG  1 
ATOM   999   C CD1 . TYR A  1 148 ? 42.55203  36.07387   18.38714  1.000 31.70755  ? 128  TYR H CD1 1 
ATOM   1000  C CD2 . TYR A  1 148 ? 41.14723  36.03710   20.30204  1.000 32.01564  ? 128  TYR H CD2 1 
ATOM   1001  C CE1 . TYR A  1 148 ? 43.54858  36.66538   19.11255  1.000 32.28117  ? 128  TYR H CE1 1 
ATOM   1002  C CE2 . TYR A  1 148 ? 42.14536  36.64462   21.05050  1.000 33.63948  ? 128  TYR H CE2 1 
ATOM   1003  C CZ  . TYR A  1 148 ? 43.35142  36.95546   20.43078  1.000 35.21501  ? 128  TYR H CZ  1 
ATOM   1004  O OH  . TYR A  1 148 ? 44.37865  37.55615   21.10865  1.000 37.73214  ? 128  TYR H OH  1 
ATOM   1005  N N   . MET A  1 149 ? 38.50424  34.68643   15.55297  1.000 22.21933  ? 129  MET H N   1 
ATOM   1006  C CA  . MET A  1 149 ? 37.43751  33.86498   14.98932  1.000 24.22832  ? 129  MET H CA  1 
ATOM   1007  C C   . MET A  1 149 ? 37.81564  32.39935   15.14552  1.000 21.68248  ? 129  MET H C   1 
ATOM   1008  O O   . MET A  1 149 ? 38.95298  32.01283   14.84022  1.000 19.14040  ? 129  MET H O   1 
ATOM   1009  C CB  . MET A  1 149 ? 37.21848  34.16133   13.50795  1.000 22.05491  ? 129  MET H CB  1 
ATOM   1010  C CG  . MET A  1 149 ? 36.72266  35.57934   13.21644  1.000 27.60029  ? 129  MET H CG  1 
ATOM   1011  S SD  . MET A  1 149 ? 35.13375  35.94732   13.98527  1.000 27.67446  ? 129  MET H SD  1 
ATOM   1012  C CE  . MET A  1 149 ? 34.04012  34.71493   13.26117  1.000 28.33393  ? 129  MET H CE  1 
ATOM   1013  N N   . VAL A  1 150 ? 36.87698  31.59867   15.63122  1.000 18.82511  ? 130  VAL H N   1 
ATOM   1014  C CA  . VAL A  1 150 ? 37.02488  30.14665   15.72739  1.000 19.47227  ? 130  VAL H CA  1 
ATOM   1015  C C   . VAL A  1 150 ? 36.00275  29.57994   14.75430  1.000 21.62640  ? 130  VAL H C   1 
ATOM   1016  O O   . VAL A  1 150 ? 34.78898  29.62682   15.02239  1.000 18.60412  ? 130  VAL H O   1 
ATOM   1017  C CB  . VAL A  1 150 ? 36.78915  29.62411   17.15198  1.000 18.07756  ? 130  VAL H CB  1 
ATOM   1018  C CG1 . VAL A  1 150 ? 37.01155  28.12329   17.18944  1.000 19.36644  ? 130  VAL H CG1 1 
ATOM   1019  C CG2 . VAL A  1 150 ? 37.70272  30.33518   18.18498  1.000 17.38803  ? 130  VAL H CG2 1 
ATOM   1020  N N   . ILE A  1 151 ? 36.46666  29.08547   13.60407  1.000 21.46880  ? 131  ILE H N   1 
ATOM   1021  C CA  . ILE A  1 151 ? 35.58754  28.56246   12.57216  1.000 17.36150  ? 131  ILE H CA  1 
ATOM   1022  C C   . ILE A  1 151 ? 35.44257  27.06176   12.79846  1.000 14.47595  ? 131  ILE H C   1 
ATOM   1023  O O   . ILE A  1 151 ? 36.45111  26.35225   12.85968  1.000 17.65090  ? 131  ILE H O   1 
ATOM   1024  C CB  . ILE A  1 151 ? 36.15494  28.83757   11.16785  1.000 19.77258  ? 131  ILE H CB  1 
ATOM   1025  C CG1 . ILE A  1 151 ? 36.46173  30.34185   10.93924  1.000 21.66687  ? 131  ILE H CG1 1 
ATOM   1026  C CG2 . ILE A  1 151 ? 35.25745  28.18784   10.10972  1.000 20.66552  ? 131  ILE H CG2 1 
ATOM   1027  C CD1 . ILE A  1 151 ? 35.29256  31.29469   11.08200  1.000 22.17195  ? 131  ILE H CD1 1 
ATOM   1028  N N   . LEU A  1 152 ? 34.20889  26.56714   12.89696  1.000 16.68335  ? 132  LEU H N   1 
ATOM   1029  C CA  . LEU A  1 152 ? 34.00478  25.18810   13.34264  1.000 14.47430  ? 132  LEU H CA  1 
ATOM   1030  C C   . LEU A  1 152 ? 33.12152  24.44725   12.36680  1.000 13.62424  ? 132  LEU H C   1 
ATOM   1031  O O   . LEU A  1 152 ? 32.09827  24.98451   11.91167  1.000 20.57373  ? 132  LEU H O   1 
ATOM   1032  C CB  . LEU A  1 152 ? 33.37265  25.14896   14.77739  1.000 12.90625  ? 132  LEU H CB  1 
ATOM   1033  C CG  . LEU A  1 152 ? 34.13464  25.85035   15.89167  1.000 15.53320  ? 132  LEU H CG  1 
ATOM   1034  C CD1 . LEU A  1 152 ? 33.28905  25.94650   17.18378  1.000 11.36977  ? 132  LEU H CD1 1 
ATOM   1035  C CD2 . LEU A  1 152 ? 35.45714  25.11803   16.15706  1.000 13.23110  ? 132  LEU H CD2 1 
ATOM   1036  N N   . ALA A  1 153 ? 33.46429  23.17895   12.07927  1.000 20.88110  ? 133  ALA H N   1 
ATOM   1037  C CA  . ALA A  1 153 ? 32.51013  22.31014   11.39680  1.000 19.10459  ? 133  ALA H CA  1 
ATOM   1038  C C   . ALA A  1 153 ? 31.43094  21.89533   12.38491  1.000 17.87666  ? 133  ALA H C   1 
ATOM   1039  O O   . ALA A  1 153 ? 31.73787  21.50682   13.51549  1.000 18.63774  ? 133  ALA H O   1 
ATOM   1040  C CB  . ALA A  1 153 ? 33.19086  21.06863   10.79907  1.000 21.10328  ? 133  ALA H CB  1 
ATOM   1041  N N   . GLY A  1 154 ? 30.16306  21.97004   11.95986  1.000 21.58073  ? 134  GLY H N   1 
ATOM   1042  C CA  . GLY A  1 154 ? 29.06096  21.64740   12.86375  1.000 24.86323  ? 134  GLY H CA  1 
ATOM   1043  C C   . GLY A  1 154 ? 28.48844  20.24950   12.71867  1.000 20.29168  ? 134  GLY H C   1 
ATOM   1044  O O   . GLY A  1 154 ? 27.39282  19.97224   13.23281  1.000 16.98768  ? 134  GLY H O   1 
ATOM   1045  N N   . ASP A  1 155 ? 29.21786  19.35371   12.04333  1.000 17.80196  ? 135  ASP H N   1 
ATOM   1046  C CA  . ASP A  1 155 ? 28.69913  18.02109   11.72577  1.000 16.85498  ? 135  ASP H CA  1 
ATOM   1047  C C   . ASP A  1 155 ? 29.54290  16.89058   12.33460  1.000 15.58019  ? 135  ASP H C   1 
ATOM   1048  O O   . ASP A  1 155 ? 29.45758  15.75305   11.87274  1.000 18.24172  ? 135  ASP H O   1 
ATOM   1049  C CB  . ASP A  1 155 ? 28.56349  17.83361   10.19637  1.000 21.47956  ? 135  ASP H CB  1 
ATOM   1050  C CG  . ASP A  1 155 ? 29.87979  17.80037   9.47359   1.000 22.04589  ? 135  ASP H CG  1 
ATOM   1051  O OD1 . ASP A  1 155 ? 30.08328  16.85623   8.66953   1.000 25.11062  ? 135  ASP H OD1 1 
ATOM   1052  O OD2 . ASP A  1 155 ? 30.72052  18.70350   9.67268   1.000 23.30624  ? 135  ASP H OD2 1 
ATOM   1053  N N   . HIS A  1 156 ? 30.31394  17.16258   13.39088  1.000 16.52768  ? 136  HIS H N   1 
ATOM   1054  C CA  . HIS A  1 156 ? 31.15510  16.14894   14.01829  1.000 15.80561  ? 136  HIS H CA  1 
ATOM   1055  C C   . HIS A  1 156 ? 30.84037  16.05380   15.51066  1.000 20.91174  ? 136  HIS H C   1 
ATOM   1056  O O   . HIS A  1 156 ? 30.49074  17.05283   16.14937  1.000 18.29286  ? 136  HIS H O   1 
ATOM   1057  C CB  . HIS A  1 156 ? 32.63344  16.46090   13.87342  1.000 16.35404  ? 136  HIS H CB  1 
ATOM   1058  C CG  . HIS A  1 156 ? 33.09904  16.58242   12.44216  1.000 17.54215  ? 136  HIS H CG  1 
ATOM   1059  N ND1 . HIS A  1 156 ? 34.20676  17.32298   12.09447  1.000 24.61349  ? 136  HIS H ND1 1 
ATOM   1060  C CD2 . HIS A  1 156 ? 32.60942  16.06510   11.28405  1.000 22.45276  ? 136  HIS H CD2 1 
ATOM   1061  C CE1 . HIS A  1 156 ? 34.37842  17.27556   10.78243  1.000 24.19591  ? 136  HIS H CE1 1 
ATOM   1062  N NE2 . HIS A  1 156 ? 33.42356  16.51750   10.26438  1.000 23.45753  ? 136  HIS H NE2 1 
ATOM   1063  N N   . ILE A  1 157 ? 31.04497  14.86075   16.07350  1.000 16.15144  ? 137  ILE H N   1 
ATOM   1064  C CA  . ILE A  1 157 ? 30.86682  14.61088   17.50734  1.000 15.74905  ? 137  ILE H CA  1 
ATOM   1065  C C   . ILE A  1 157 ? 32.22651  14.49694   18.17743  1.000 15.38061  ? 137  ILE H C   1 
ATOM   1066  O O   . ILE A  1 157 ? 32.98585  13.56019   17.87439  1.000 18.87080  ? 137  ILE H O   1 
ATOM   1067  C CB  . ILE A  1 157 ? 30.06079  13.33124   17.73773  1.000 14.96096  ? 137  ILE H CB  1 
ATOM   1068  C CG1 . ILE A  1 157 ? 28.68362  13.46499   17.10209  1.000 18.08688  ? 137  ILE H CG1 1 
ATOM   1069  C CG2 . ILE A  1 157 ? 29.82972  13.08324   19.23396  1.000 13.48503  ? 137  ILE H CG2 1 
ATOM   1070  C CD1 . ILE A  1 157 ? 28.30657  12.27669   16.31059  1.000 20.75989  ? 137  ILE H CD1 1 
ATOM   1071  N N   . TYR A  1 158 ? 32.50780  15.39976   19.12911  1.000 11.83050  ? 138  TYR H N   1 
ATOM   1072  C CA  . TYR A  1 158 ? 33.80941  15.52205   19.78806  1.000 13.28143  ? 138  TYR H CA  1 
ATOM   1073  C C   . TYR A  1 158 ? 33.72470  16.60028   20.86076  1.000 12.89289  ? 138  TYR H C   1 
ATOM   1074  O O   . TYR A  1 158 ? 32.83603  17.46221   20.84387  1.000 15.29275  ? 138  TYR H O   1 
ATOM   1075  C CB  . TYR A  1 158 ? 34.94569  15.86807   18.77984  1.000 12.68026  ? 138  TYR H CB  1 
ATOM   1076  C CG  . TYR A  1 158 ? 34.88543  17.28912   18.30149  1.000 14.56436  ? 138  TYR H CG  1 
ATOM   1077  C CD1 . TYR A  1 158 ? 33.96283  17.67032   17.34343  1.000 18.56935  ? 138  TYR H CD1 1 
ATOM   1078  C CD2 . TYR A  1 158 ? 35.72782  18.26200   18.83287  1.000 17.84614  ? 138  TYR H CD2 1 
ATOM   1079  C CE1 . TYR A  1 158 ? 33.90426  18.99561   16.87967  1.000 22.87958  ? 138  TYR H CE1 1 
ATOM   1080  C CE2 . TYR A  1 158 ? 35.67608  19.59309   18.38456  1.000 17.94126  ? 138  TYR H CE2 1 
ATOM   1081  C CZ  . TYR A  1 158 ? 34.76339  19.94673   17.43330  1.000 19.91829  ? 138  TYR H CZ  1 
ATOM   1082  O OH  . TYR A  1 158 ? 34.71185  21.25646   17.02011  1.000 21.39735  ? 138  TYR H OH  1 
ATOM   1083  N N   . LYS A  1 159 ? 34.66919  16.55378   21.78463  1.000 13.65050  ? 139  LYS H N   1 
ATOM   1084  C CA  . LYS A  1 159 ? 34.78651  17.53951   22.84708  1.000 11.48175  ? 139  LYS H CA  1 
ATOM   1085  C C   . LYS A  1 159 ? 36.19509  18.10503   22.85186  1.000 13.41564  ? 139  LYS H C   1 
ATOM   1086  O O   . LYS A  1 159 ? 37.16828  17.34445   22.77043  1.000 17.16815  ? 139  LYS H O   1 
ATOM   1087  C CB  . LYS A  1 159 ? 34.42474  16.91191   24.18302  1.000 16.51688  ? 139  LYS H CB  1 
ATOM   1088  C CG  . LYS A  1 159 ? 32.94495  16.55987   24.25102  1.000 17.38779  ? 139  LYS H CG  1 
ATOM   1089  C CD  . LYS A  1 159 ? 32.58645  15.75328   25.45980  1.000 23.23030  ? 139  LYS H CD  1 
ATOM   1090  C CE  . LYS A  1 159 ? 33.40751  14.53036   25.56115  1.000 25.33539  ? 139  LYS H CE  1 
ATOM   1091  N NZ  . LYS A  1 159 ? 32.70975  13.69460   26.56227  1.000 32.92969  ? 139  LYS H NZ  1 
ATOM   1092  N N   . MET A  1 160 ? 36.30816  19.43147   22.95052  1.000 13.78852  ? 140  MET H N   1 
ATOM   1093  C CA  . MET A  1 160 ? 37.59033  20.08521   22.74129  1.000 12.18921  ? 140  MET H CA  1 
ATOM   1094  C C   . MET A  1 160 ? 37.52997  21.45755   23.40188  1.000 17.00908  ? 140  MET H C   1 
ATOM   1095  O O   . MET A  1 160 ? 36.50573  22.14337   23.32353  1.000 16.71338  ? 140  MET H O   1 
ATOM   1096  C CB  . MET A  1 160 ? 37.88165  20.21480   21.25721  1.000 15.10872  ? 140  MET H CB  1 
ATOM   1097  C CG  . MET A  1 160 ? 39.22594  20.88876   20.86231  1.000 15.20141  ? 140  MET H CG  1 
ATOM   1098  S SD  . MET A  1 160 ? 39.41154  20.75873   19.08330  1.000 23.27670  ? 140  MET H SD  1 
ATOM   1099  C CE  . MET A  1 160 ? 41.10466  21.31390   18.87748  1.000 22.13101  ? 140  MET H CE  1 
ATOM   1100  N N   . ASP A  1 161 ? 38.61538  21.82870   24.07237  1.000 17.61583  ? 141  ASP H N   1 
ATOM   1101  C CA  . ASP A  1 161 ? 38.74364  23.11405   24.75425  1.000 16.04402  ? 141  ASP H CA  1 
ATOM   1102  C C   . ASP A  1 161 ? 39.47672  24.08253   23.82309  1.000 17.55045  ? 141  ASP H C   1 
ATOM   1103  O O   . ASP A  1 161 ? 40.70600  24.03827   23.69931  1.000 15.83406  ? 141  ASP H O   1 
ATOM   1104  C CB  . ASP A  1 161 ? 39.45808  22.89030   26.07958  1.000 16.13073  ? 141  ASP H CB  1 
ATOM   1105  C CG  . ASP A  1 161 ? 39.56144  24.13917   26.91339  1.000 15.59270  ? 141  ASP H CG  1 
ATOM   1106  O OD1 . ASP A  1 161 ? 39.25093  25.24746   26.41831  1.000 18.86101  ? 141  ASP H OD1 1 
ATOM   1107  O OD2 . ASP A  1 161 ? 39.96477  24.00369   28.07911  1.000 19.57608  ? 141  ASP H OD2 1 
ATOM   1108  N N   . TYR A  1 162 ? 38.73112  24.99555   23.19728  1.000 16.40979  ? 142  TYR H N   1 
ATOM   1109  C CA  . TYR A  1 162 ? 39.35273  25.84730   22.18731  1.000 18.36479  ? 142  TYR H CA  1 
ATOM   1110  C C   . TYR A  1 162 ? 40.29829  26.89636   22.76321  1.000 22.18299  ? 142  TYR H C   1 
ATOM   1111  O O   . TYR A  1 162 ? 41.03577  27.50923   21.97810  1.000 22.13870  ? 142  TYR H O   1 
ATOM   1112  C CB  . TYR A  1 162 ? 38.28583  26.53520   21.33987  1.000 17.01782  ? 142  TYR H CB  1 
ATOM   1113  C CG  . TYR A  1 162 ? 37.29580  25.57532   20.70304  1.000 16.73730  ? 142  TYR H CG  1 
ATOM   1114  C CD1 . TYR A  1 162 ? 37.71819  24.49712   19.93492  1.000 17.29694  ? 142  TYR H CD1 1 
ATOM   1115  C CD2 . TYR A  1 162 ? 35.93461  25.76859   20.87235  1.000 15.92648  ? 142  TYR H CD2 1 
ATOM   1116  C CE1 . TYR A  1 162 ? 36.81611  23.64229   19.34270  1.000 17.19447  ? 142  TYR H CE1 1 
ATOM   1117  C CE2 . TYR A  1 162 ? 35.01977  24.92304   20.30980  1.000 17.09639  ? 142  TYR H CE2 1 
ATOM   1118  C CZ  . TYR A  1 162 ? 35.45693  23.86136   19.53292  1.000 16.88138  ? 142  TYR H CZ  1 
ATOM   1119  O OH  . TYR A  1 162 ? 34.50287  23.04404   19.00009  1.000 15.97733  ? 142  TYR H OH  1 
ATOM   1120  N N   . GLU A  1 163 ? 40.30752  27.13107   24.08915  1.000 19.00045  ? 143  GLU H N   1 
ATOM   1121  C CA  . GLU A  1 163 ? 41.31849  28.02900   24.66131  1.000 23.23157  ? 143  GLU H CA  1 
ATOM   1122  C C   . GLU A  1 163 ? 42.72608  27.58986   24.28561  1.000 23.19438  ? 143  GLU H C   1 
ATOM   1123  O O   . GLU A  1 163 ? 43.60381  28.43725   24.12296  1.000 23.45950  ? 143  GLU H O   1 
ATOM   1124  C CB  . GLU A  1 163 ? 41.18079  28.09044   26.19783  1.000 21.06052  ? 143  GLU H CB  1 
ATOM   1125  C CG  . GLU A  1 163 ? 41.95280  29.18688   26.99991  1.000 26.29662  ? 143  GLU H CG  1 
ATOM   1126  C CD  . GLU A  1 163 ? 41.78078  30.63289   26.55915  1.000 24.37020  ? 143  GLU H CD  1 
ATOM   1127  O OE1 . GLU A  1 163 ? 40.60895  31.05706   26.34865  1.000 21.65001  ? 143  GLU H OE1 1 
ATOM   1128  O OE2 . GLU A  1 163 ? 42.79124  31.36422   26.49961  1.000 17.68421  ? 143  GLU H OE2 1 
ATOM   1129  N N   . TYR A  1 164 ? 42.96027  26.27601   24.13431  1.000 22.37129  ? 144  TYR H N   1 
ATOM   1130  C CA  . TYR A  1 164 ? 44.30625  25.79178   23.81091  1.000 24.22795  ? 144  TYR H CA  1 
ATOM   1131  C C   . TYR A  1 164 ? 44.73565  26.22993   22.42136  1.000 22.85339  ? 144  TYR H C   1 
ATOM   1132  O O   . TYR A  1 164 ? 45.84988  26.73822   22.23096  1.000 23.91015  ? 144  TYR H O   1 
ATOM   1133  C CB  . TYR A  1 164 ? 44.36416  24.27254   23.89502  1.000 29.22421  ? 144  TYR H CB  1 
ATOM   1134  C CG  . TYR A  1 164 ? 44.40816  23.74308   25.29166  1.000 34.50079  ? 144  TYR H CG  1 
ATOM   1135  C CD1 . TYR A  1 164 ? 43.23071  23.52963   26.00524  1.000 35.06318  ? 144  TYR H CD1 1 
ATOM   1136  C CD2 . TYR A  1 164 ? 45.61670  23.45857   25.91099  1.000 36.93156  ? 144  TYR H CD2 1 
ATOM   1137  C CE1 . TYR A  1 164 ? 43.25589  23.05491   27.29933  1.000 38.67720  ? 144  TYR H CE1 1 
ATOM   1138  C CE2 . TYR A  1 164 ? 45.65342  22.97205   27.21784  1.000 40.48145  ? 144  TYR H CE2 1 
ATOM   1139  C CZ  . TYR A  1 164 ? 44.46644  22.77566   27.90389  1.000 41.65153  ? 144  TYR H CZ  1 
ATOM   1140  O OH  . TYR A  1 164 ? 44.47193  22.30091   29.19853  1.000 43.43124  ? 144  TYR H OH  1 
ATOM   1141  N N   . MET A  1 165 ? 43.86435  26.01389   21.43362  1.000 23.15563  ? 145  MET H N   1 
ATOM   1142  C CA  . MET A  1 165 ? 44.11658  26.48491   20.07086  1.000 28.33880  ? 145  MET H CA  1 
ATOM   1143  C C   . MET A  1 165 ? 44.29951  27.99375   20.03331  1.000 25.33653  ? 145  MET H C   1 
ATOM   1144  O O   . MET A  1 165 ? 45.13881  28.51571   19.27703  1.000 25.26669  ? 145  MET H O   1 
ATOM   1145  C CB  . MET A  1 165 ? 42.94605  26.09196   19.16404  1.000 30.35289  ? 145  MET H CB  1 
ATOM   1146  C CG  . MET A  1 165 ? 43.10424  24.79087   18.48919  1.000 37.07291  ? 145  MET H CG  1 
ATOM   1147  S SD  . MET A  1 165 ? 41.84971  24.64078   17.23049  1.000 37.51152  ? 145  MET H SD  1 
ATOM   1148  C CE  . MET A  1 165 ? 42.67681  25.39258   15.82496  1.000 37.02720  ? 145  MET H CE  1 
ATOM   1149  N N   . LEU A  1 166 ? 43.50074  28.71649   20.81866  1.000 22.34934  ? 146  LEU H N   1 
ATOM   1150  C CA  . LEU A  1 166 ? 43.62860  30.16555   20.84083  1.000 26.63638  ? 146  LEU H CA  1 
ATOM   1151  C C   . LEU A  1 166 ? 44.98867  30.58251   21.39835  1.000 24.40189  ? 146  LEU H C   1 
ATOM   1152  O O   . LEU A  1 166 ? 45.64682  31.46606   20.83810  1.000 24.92388  ? 146  LEU H O   1 
ATOM   1153  C CB  . LEU A  1 166 ? 42.47616  30.77842   21.65772  1.000 25.40083  ? 146  LEU H CB  1 
ATOM   1154  C CG  . LEU A  1 166 ? 41.08727  30.81545   21.00772  1.000 19.09546  ? 146  LEU H CG  1 
ATOM   1155  C CD1 . LEU A  1 166 ? 40.05933  31.19017   22.07915  1.000 22.12010  ? 146  LEU H CD1 1 
ATOM   1156  C CD2 . LEU A  1 166 ? 41.00554  31.79504   19.83263  1.000 19.75421  ? 146  LEU H CD2 1 
ATOM   1157  N N   . GLN A  1 167 ? 45.43879  29.94252   22.48344  1.000 24.13280  ? 147  GLN H N   1 
ATOM   1158  C CA  . GLN A  1 167 ? 46.78315  30.21114   22.98879  1.000 28.21513  ? 147  GLN H CA  1 
ATOM   1159  C C   . GLN A  1 167 ? 47.83384  29.88754   21.93619  1.000 26.12788  ? 147  GLN H C   1 
ATOM   1160  O O   . GLN A  1 167 ? 48.70389  30.71517   21.63948  1.000 26.21857  ? 147  GLN H O   1 
ATOM   1161  C CB  . GLN A  1 167 ? 47.07641  29.40608   24.25507  1.000 33.93812  ? 147  GLN H CB  1 
ATOM   1162  C CG  . GLN A  1 167 ? 46.09170  29.54992   25.38756  1.000 39.14488  ? 147  GLN H CG  1 
ATOM   1163  C CD  . GLN A  1 167 ? 46.34209  30.74435   26.25211  1.000 44.00180  ? 147  GLN H CD  1 
ATOM   1164  O OE1 . GLN A  1 167 ? 47.27878  31.51382   26.02368  1.000 49.23593  ? 147  GLN H OE1 1 
ATOM   1165  N NE2 . GLN A  1 167 ? 45.49056  30.92114   27.26531  1.000 42.26293  ? 147  GLN H NE2 1 
ATOM   1166  N N   . GLN A  1 168 ? 47.78152  28.67170   21.37029  1.000 29.02816  ? 148  GLN H N   1 
ATOM   1167  C CA  . GLN A  1 168 ? 48.78178  28.29844   20.37564  1.000 29.07631  ? 148  GLN H CA  1 
ATOM   1168  C C   . GLN A  1 168 ? 48.79958  29.28811   19.22039  1.000 30.51547  ? 148  GLN H C   1 
ATOM   1169  O O   . GLN A  1 168 ? 49.86736  29.65533   18.72761  1.000 31.99237  ? 148  GLN H O   1 
ATOM   1170  C CB  . GLN A  1 168 ? 48.54189  26.87871   19.85112  1.000 26.94859  ? 148  GLN H CB  1 
ATOM   1171  C CG  . GLN A  1 168 ? 49.56255  26.46653   18.76998  1.000 31.89106  ? 148  GLN H CG  1 
ATOM   1172  C CD  . GLN A  1 168 ? 49.20267  25.15962   18.11109  1.000 34.65730  ? 148  GLN H CD  1 
ATOM   1173  O OE1 . GLN A  1 168 ? 48.54795  24.31839   18.71762  1.000 36.83731  ? 148  GLN H OE1 1 
ATOM   1174  N NE2 . GLN A  1 168 ? 49.63461  24.97471   16.87126  1.000 35.27055  ? 148  GLN H NE2 1 
ATOM   1175  N N   . HIS A  1 169 ? 47.62530  29.74110   18.77837  1.000 29.83383  ? 149  HIS H N   1 
ATOM   1176  C CA  . HIS A  1 169 ? 47.57086  30.61313   17.61094  1.000 28.85511  ? 149  HIS H CA  1 
ATOM   1177  C C   . HIS A  1 169 ? 48.29173  31.92811   17.87799  1.000 34.31033  ? 149  HIS H C   1 
ATOM   1178  O O   . HIS A  1 169 ? 49.16794  32.33736   17.10509  1.000 35.10406  ? 149  HIS H O   1 
ATOM   1179  C CB  . HIS A  1 169 ? 46.11784  30.85388   17.21162  1.000 29.89998  ? 149  HIS H CB  1 
ATOM   1180  C CG  . HIS A  1 169 ? 45.95375  31.80786   16.07671  1.000 30.82327  ? 149  HIS H CG  1 
ATOM   1181  N ND1 . HIS A  1 169 ? 46.14283  31.44215   14.75613  1.000 31.69352  ? 149  HIS H ND1 1 
ATOM   1182  C CD2 . HIS A  1 169 ? 45.63599  33.12372   16.06349  1.000 30.33483  ? 149  HIS H CD2 1 
ATOM   1183  C CE1 . HIS A  1 169 ? 45.93475  32.49295   13.98201  1.000 31.50323  ? 149  HIS H CE1 1 
ATOM   1184  N NE2 . HIS A  1 169 ? 45.62347  33.52332   14.75057  1.000 29.63216  ? 149  HIS H NE2 1 
ATOM   1185  N N   . VAL A  1 170 ? 47.94630  32.59125   18.98447  1.000 36.48394  ? 150  VAL H N   1 
ATOM   1186  C CA  . VAL A  1 170 ? 48.57312  33.86398   19.31761  1.000 36.72342  ? 150  VAL H CA  1 
ATOM   1187  C C   . VAL A  1 170 ? 50.07330  33.68548   19.48926  1.000 39.26585  ? 150  VAL H C   1 
ATOM   1188  O O   . VAL A  1 170 ? 50.87368  34.43320   18.91118  1.000 39.79634  ? 150  VAL H O   1 
ATOM   1189  C CB  . VAL A  1 170 ? 47.93600  34.46052   20.58157  1.000 36.26701  ? 150  VAL H CB  1 
ATOM   1190  C CG1 . VAL A  1 170 ? 48.73012  35.66103   21.03254  1.000 35.84500  ? 150  VAL H CG1 1 
ATOM   1191  C CG2 . VAL A  1 170 ? 46.50257  34.84043   20.30820  1.000 35.60538  ? 150  VAL H CG2 1 
ATOM   1192  N N   . ASP A  1 171 ? 50.48527  32.68978   20.27565  1.000 38.43397  ? 151  ASP H N   1 
ATOM   1193  C CA  . ASP A  1 171 ? 51.91244  32.55518   20.56624  1.000 39.78088  ? 151  ASP H CA  1 
ATOM   1194  C C   . ASP A  1 171 ? 52.70935  32.16642   19.33064  1.000 41.35893  ? 151  ASP H C   1 
ATOM   1195  O O   . ASP A  1 171 ? 53.84972  32.61148   19.14971  1.000 41.87190  ? 151  ASP H O   1 
ATOM   1196  C CB  . ASP A  1 171 ? 52.13744  31.52520   21.65755  1.000 38.90782  ? 151  ASP H CB  1 
ATOM   1197  C CG  . ASP A  1 171 ? 51.57479  31.94979   22.97408  1.000 40.82955  ? 151  ASP H CG  1 
ATOM   1198  O OD1 . ASP A  1 171 ? 51.32116  33.15886   23.19118  1.000 43.68364  ? 151  ASP H OD1 1 
ATOM   1199  O OD2 . ASP A  1 171 ? 51.38623  31.04722   23.80323  1.000 45.33352  ? 151  ASP H OD2 1 
ATOM   1200  N N   . SER A  1 172 ? 52.14217  31.32108   18.48025  1.000 38.76254  ? 152  SER H N   1 
ATOM   1201  C CA  . SER A  1 172 ? 52.86377  30.90534   17.28723  1.000 37.46875  ? 152  SER H CA  1 
ATOM   1202  C C   . SER A  1 172 ? 52.99093  32.03232   16.27541  1.000 37.94632  ? 152  SER H C   1 
ATOM   1203  O O   . SER A  1 172 ? 53.80028  31.93545   15.34425  1.000 37.58236  ? 152  SER H O   1 
ATOM   1204  C CB  . SER A  1 172 ? 52.15355  29.71867   16.64499  1.000 34.21849  ? 152  SER H CB  1 
ATOM   1205  O OG  . SER A  1 172 ? 50.96657  30.14858   15.99308  1.000 35.68819  ? 152  SER H OG  1 
ATOM   1206  N N   . GLY A  1 173 ? 52.20543  33.09243   16.42758  1.000 37.85475  ? 153  GLY H N   1 
ATOM   1207  C CA  . GLY A  1 173 ? 52.16521  34.10636   15.39992  1.000 34.04062  ? 153  GLY H CA  1 
ATOM   1208  C C   . GLY A  1 173 ? 51.58076  33.65669   14.08528  1.000 31.78564  ? 153  GLY H C   1 
ATOM   1209  O O   . GLY A  1 173 ? 51.79207  34.31981   13.07906  1.000 32.75496  ? 153  GLY H O   1 
ATOM   1210  N N   . ALA A  1 174 ? 50.82290  32.56388   14.06017  1.000 29.28752  ? 154  ALA H N   1 
ATOM   1211  C CA  . ALA A  1 174 ? 50.29428  32.03649   12.80809  1.000 31.58342  ? 154  ALA H CA  1 
ATOM   1212  C C   . ALA A  1 174 ? 49.27250  32.98480   12.18669  1.000 31.76653  ? 154  ALA H C   1 
ATOM   1213  O O   . ALA A  1 174 ? 48.67926  33.83134   12.85993  1.000 36.71655  ? 154  ALA H O   1 
ATOM   1214  C CB  . ALA A  1 174 ? 49.62727  30.67573   13.04277  1.000 30.91510  ? 154  ALA H CB  1 
ATOM   1215  N N   . ASP A  1 175 ? 49.09592  32.83683   10.86947  1.000 31.41265  ? 155  ASP H N   1 
ATOM   1216  C CA  . ASP A  1 175 ? 47.96679  33.40726   10.14226  1.000 31.76678  ? 155  ASP H CA  1 
ATOM   1217  C C   . ASP A  1 175 ? 46.72197  32.53663   10.27650  1.000 31.12820  ? 155  ASP H C   1 
ATOM   1218  O O   . ASP A  1 175 ? 45.59767  33.05592   10.33930  1.000 28.76721  ? 155  ASP H O   1 
ATOM   1219  C CB  . ASP A  1 175 ? 48.32124  33.55556   8.66344   1.000 32.57349  ? 155  ASP H CB  1 
ATOM   1220  C CG  . ASP A  1 175 ? 49.45286  34.55326   8.43975   1.000 40.57234  ? 155  ASP H CG  1 
ATOM   1221  O OD1 . ASP A  1 175 ? 49.36412  35.66946   9.00833   1.000 37.07755  ? 155  ASP H OD1 1 
ATOM   1222  O OD2 . ASP A  1 175 ? 50.41804  34.21401   7.71150   1.000 38.87729  ? 155  ASP H OD2 1 
ATOM   1223  N N   . VAL A  1 176 ? 46.89955  31.22207   10.31928  1.000 28.81052  ? 156  VAL H N   1 
ATOM   1224  C CA  . VAL A  1 176 ? 45.80633  30.31791   10.67046  1.000 29.85118  ? 156  VAL H CA  1 
ATOM   1225  C C   . VAL A  1 176 ? 46.37185  29.12393   11.42823  1.000 32.56052  ? 156  VAL H C   1 
ATOM   1226  O O   . VAL A  1 176 ? 47.45958  28.62418   11.11545  1.000 28.03553  ? 156  VAL H O   1 
ATOM   1227  C CB  . VAL A  1 176 ? 45.02269  29.86834   9.42173   1.000 30.78015  ? 156  VAL H CB  1 
ATOM   1228  C CG1 . VAL A  1 176 ? 45.93191  29.09405   8.49069   1.000 33.93026  ? 156  VAL H CG1 1 
ATOM   1229  C CG2 . VAL A  1 176 ? 43.76736  29.03762   9.82579   1.000 27.92690  ? 156  VAL H CG2 1 
ATOM   1230  N N   . THR A  1 177 ? 45.60760  28.66501   12.42365  1.000 26.16299  ? 157  THR H N   1 
ATOM   1231  C CA  . THR A  1 177 ? 45.87981  27.46033   13.19563  1.000 35.88803  ? 157  THR H CA  1 
ATOM   1232  C C   . THR A  1 177 ? 44.75377  26.46130   12.94272  1.000 33.26761  ? 157  THR H C   1 
ATOM   1233  O O   . THR A  1 177 ? 43.57066  26.82549   12.98642  1.000 24.41537  ? 157  THR H O   1 
ATOM   1234  C CB  . THR A  1 177 ? 45.99788  27.79314   14.68892  1.000 32.54103  ? 157  THR H CB  1 
ATOM   1235  O OG1 . THR A  1 177 ? 47.07117  28.71829   14.86075  1.000 32.63654  ? 157  THR H OG1 1 
ATOM   1236  C CG2 . THR A  1 177 ? 46.26681  26.54644   15.50900  1.000 30.94011  ? 157  THR H CG2 1 
ATOM   1237  N N   . ILE A  1 178 ? 45.11657  25.21334   12.64638  1.000 31.37596  ? 158  ILE H N   1 
ATOM   1238  C CA  . ILE A  1 178 ? 44.17701  24.22128   12.13087  1.000 24.98636  ? 158  ILE H CA  1 
ATOM   1239  C C   . ILE A  1 178 ? 44.15038  23.02167   13.07260  1.000 25.97653  ? 158  ILE H C   1 
ATOM   1240  O O   . ILE A  1 178 ? 45.18716  22.39818   13.32040  1.000 26.75791  ? 158  ILE H O   1 
ATOM   1241  C CB  . ILE A  1 178 ? 44.56113  23.78874   10.70616  1.000 27.12653  ? 158  ILE H CB  1 
ATOM   1242  C CG1 . ILE A  1 178 ? 44.82617  25.03116   9.85982   1.000 31.47670  ? 158  ILE H CG1 1 
ATOM   1243  C CG2 . ILE A  1 178 ? 43.50015  22.84533   10.10521  1.000 25.51346  ? 158  ILE H CG2 1 
ATOM   1244  C CD1 . ILE A  1 178 ? 44.93551  24.77362   8.39163   1.000 27.88376  ? 158  ILE H CD1 1 
ATOM   1245  N N   . GLY A  1 179 ? 42.97212  22.69355   13.59357  1.000 26.01666  ? 159  GLY H N   1 
ATOM   1246  C CA  . GLY A  1 179 ? 42.84112  21.48848   14.40107  1.000 22.82329  ? 159  GLY H CA  1 
ATOM   1247  C C   . GLY A  1 179 ? 42.96949  20.25639   13.50584  1.000 23.27467  ? 159  GLY H C   1 
ATOM   1248  O O   . GLY A  1 179 ? 42.31842  20.16918   12.46080  1.000 24.91509  ? 159  GLY H O   1 
ATOM   1249  N N   . CYS A  1 180 ? 43.79709  19.28945   13.93176  1.000 33.78600  ? 160  CYS H N   1 
ATOM   1250  C CA  . CYS A  1 180 ? 44.09683  18.07681   13.17121  1.000 24.00359  ? 160  CYS H CA  1 
ATOM   1251  C C   . CYS A  1 180 ? 44.02162  16.81946   14.02950  1.000 25.53869  ? 160  CYS H C   1 
ATOM   1252  O O   . CYS A  1 180 ? 44.45732  16.80570   15.19159  1.000 23.20334  ? 160  CYS H O   1 
ATOM   1253  C CB  . CYS A  1 180 ? 45.48241  18.18349   12.57212  1.000 29.05359  ? 160  CYS H CB  1 
ATOM   1254  S SG  . CYS A  1 180 ? 45.61967  19.40717   11.25649  1.000 29.85536  ? 160  CYS H SG  1 
ATOM   1255  N N   . LEU A  1 181 ? 43.44965  15.75909   13.45382  1.000 26.75555  ? 161  LEU H N   1 
ATOM   1256  C CA  . LEU A  1 181 ? 43.53105  14.43362   14.04843  1.000 25.48592  ? 161  LEU H CA  1 
ATOM   1257  C C   . LEU A  1 181 ? 44.83354  13.75314   13.66315  1.000 31.55623  ? 161  LEU H C   1 
ATOM   1258  O O   . LEU A  1 181 ? 45.24754  13.78628   12.49963  1.000 33.65106  ? 161  LEU H O   1 
ATOM   1259  C CB  . LEU A  1 181 ? 42.34958  13.55591   13.62511  1.000 24.66306  ? 161  LEU H CB  1 
ATOM   1260  C CG  . LEU A  1 181 ? 40.94849  14.16569   13.64782  1.000 24.32885  ? 161  LEU H CG  1 
ATOM   1261  C CD1 . LEU A  1 181 ? 39.95640  13.31716   12.88527  1.000 25.53932  ? 161  LEU H CD1 1 
ATOM   1262  C CD2 . LEU A  1 181 ? 40.51626  14.33527   15.08595  1.000 21.33249  ? 161  LEU H CD2 1 
ATOM   1263  N N   . GLU A  1 182 ? 45.48836  13.13583   14.64390  1.000 34.44036  ? 162  GLU H N   1 
ATOM   1264  C CA  . GLU A  1 182 ? 46.62391  12.26106   14.37808  1.000 37.07515  ? 162  GLU H CA  1 
ATOM   1265  C C   . GLU A  1 182 ? 46.07659  10.85156   14.15612  1.000 35.48810  ? 162  GLU H C   1 
ATOM   1266  O O   . GLU A  1 182 ? 45.55092  10.23208   15.08997  1.000 33.77073  ? 162  GLU H O   1 
ATOM   1267  C CB  . GLU A  1 182 ? 47.61538  12.31320   15.53431  1.000 39.04014  ? 162  GLU H CB  1 
ATOM   1268  C CG  . GLU A  1 182 ? 48.98951  11.72062   15.19257  1.000 45.49499  ? 162  GLU H CG  1 
ATOM   1269  C CD  . GLU A  1 182 ? 50.01059  11.94089   16.29910  1.000 51.04063  ? 162  GLU H CD  1 
ATOM   1270  O OE1 . GLU A  1 182 ? 50.95846  11.12887   16.41347  1.000 56.51040  ? 162  GLU H OE1 1 
ATOM   1271  O OE2 . GLU A  1 182 ? 49.86064  12.92394   17.06005  1.000 47.73121  ? 162  GLU H OE2 1 
ATOM   1272  N N   . VAL A  1 183 ? 46.14748  10.36413   12.91841  1.000 31.21325  ? 163  VAL H N   1 
ATOM   1273  C CA  . VAL A  1 183 ? 45.53476  9.08345    12.55322  1.000 33.33830  ? 163  VAL H CA  1 
ATOM   1274  C C   . VAL A  1 183 ? 46.48526  8.30727    11.65721  1.000 36.02034  ? 163  VAL H C   1 
ATOM   1275  O O   . VAL A  1 183 ? 47.34019  8.89049    10.97517  1.000 39.31588  ? 163  VAL H O   1 
ATOM   1276  C CB  . VAL A  1 183 ? 44.16640  9.25304    11.84051  1.000 31.41119  ? 163  VAL H CB  1 
ATOM   1277  C CG1 . VAL A  1 183 ? 43.16747  10.01783   12.70067  1.000 30.14568  ? 163  VAL H CG1 1 
ATOM   1278  C CG2 . VAL A  1 183 ? 44.31021  9.89333    10.45011  1.000 34.26348  ? 163  VAL H CG2 1 
ATOM   1279  N N   . PRO A  1 184 ? 46.35947  6.97437    11.63737  1.000 33.47170  ? 164  PRO H N   1 
ATOM   1280  C CA  . PRO A  1 184 ? 47.24014  6.17957    10.76936  1.000 32.78345  ? 164  PRO H CA  1 
ATOM   1281  C C   . PRO A  1 184 ? 47.05832  6.58095    9.31358   1.000 30.40666  ? 164  PRO H C   1 
ATOM   1282  O O   . PRO A  1 184 ? 45.95329  6.89998    8.87482   1.000 32.17461  ? 164  PRO H O   1 
ATOM   1283  C CB  . PRO A  1 184 ? 46.78526  4.73588    11.02212  1.000 32.76203  ? 164  PRO H CB  1 
ATOM   1284  C CG  . PRO A  1 184 ? 46.11639  4.77521    12.35912  1.000 32.12347  ? 164  PRO H CG  1 
ATOM   1285  C CD  . PRO A  1 184 ? 45.47076  6.12562    12.45365  1.000 33.28775  ? 164  PRO H CD  1 
ATOM   1286  N N   . ARG A  1 185 ? 48.16249  6.58257    8.55708   1.000 31.66136  ? 165  ARG H N   1 
ATOM   1287  C CA  . ARG A  1 185 ? 48.10235  7.14193    7.21675   1.000 29.30935  ? 165  ARG H CA  1 
ATOM   1288  C C   . ARG A  1 185 ? 47.09259  6.43002    6.34512   1.000 32.42437  ? 165  ARG H C   1 
ATOM   1289  O O   . ARG A  1 185 ? 46.45907  7.05310    5.48766   1.000 30.51390  ? 165  ARG H O   1 
ATOM   1290  C CB  . ARG A  1 185 ? 49.46742  7.06512    6.54549   1.000 38.45760  ? 165  ARG H CB  1 
ATOM   1291  C CG  . ARG A  1 185 ? 50.26637  8.29472    6.74298   1.000 45.38054  ? 165  ARG H CG  1 
ATOM   1292  C CD  . ARG A  1 185 ? 51.72330  7.97128    6.87837   1.000 51.17291  ? 165  ARG H CD  1 
ATOM   1293  N NE  . ARG A  1 185 ? 52.12229  6.75211    6.17941   1.000 53.41747  ? 165  ARG H NE  1 
ATOM   1294  C CZ  . ARG A  1 185 ? 52.28338  6.65675    4.86475   1.000 52.99097  ? 165  ARG H CZ  1 
ATOM   1295  N NH1 . ARG A  1 185 ? 52.08829  7.71436    4.09288   1.000 51.01503  ? 165  ARG H NH1 1 
ATOM   1296  N NH2 . ARG A  1 185 ? 52.64611  5.49593    4.32795   1.000 57.31197  ? 165  ARG H NH2 1 
ATOM   1297  N N   . MET A  1 186 ? 46.95893  5.11672    6.51175   1.000 36.40657  ? 166  MET H N   1 
ATOM   1298  C CA  . MET A  1 186 ? 45.97405  4.37725    5.73302   1.000 44.19759  ? 166  MET H CA  1 
ATOM   1299  C C   . MET A  1 186 ? 44.57252  4.95799    5.91459   1.000 43.07905  ? 166  MET H C   1 
ATOM   1300  O O   . MET A  1 186 ? 43.77501  4.98972    4.96976   1.000 43.17591  ? 166  MET H O   1 
ATOM   1301  C CB  . MET A  1 186 ? 46.01278  2.91828    6.16377   1.000 53.83435  ? 166  MET H CB  1 
ATOM   1302  C CG  . MET A  1 186 ? 47.27675  2.59629    6.95972   1.000 63.12990  ? 166  MET H CG  1 
ATOM   1303  S SD  . MET A  1 186 ? 47.28528  0.92783    7.65593   1.000 72.08577  ? 166  MET H SD  1 
ATOM   1304  C CE  . MET A  1 186 ? 46.12999  1.05566    9.00891   1.000 70.54320  ? 166  MET H CE  1 
ATOM   1305  N N   . GLU A  1 187 ? 44.26962  5.44964    7.11292   1.000 39.18888  ? 167  GLU H N   1 
ATOM   1306  C CA  . GLU A  1 187 ? 42.95926  6.01317    7.39793   1.000 37.31861  ? 167  GLU H CA  1 
ATOM   1307  C C   . GLU A  1 187 ? 42.82844  7.44704    6.91836   1.000 41.69601  ? 167  GLU H C   1 
ATOM   1308  O O   . GLU A  1 187 ? 41.70271  7.93736    6.76247   1.000 46.63844  ? 167  GLU H O   1 
ATOM   1309  C CB  . GLU A  1 187 ? 42.69842  5.94133    8.89768   1.000 39.33244  ? 167  GLU H CB  1 
ATOM   1310  C CG  . GLU A  1 187 ? 43.10897  4.60025    9.52016   1.000 44.29484  ? 167  GLU H CG  1 
ATOM   1311  C CD  . GLU A  1 187 ? 42.58878  4.43890    10.94188  1.000 50.61913  ? 167  GLU H CD  1 
ATOM   1312  O OE1 . GLU A  1 187 ? 42.98694  3.47264    11.62993  1.000 52.82457  ? 167  GLU H OE1 1 
ATOM   1313  O OE2 . GLU A  1 187 ? 41.78491  5.29148    11.37162  1.000 53.07204  ? 167  GLU H OE2 1 
ATOM   1314  N N   . ALA A  1 188 ? 43.95192  8.12188    6.67493   1.000 37.08289  ? 168  ALA H N   1 
ATOM   1315  C CA  . ALA A  1 188 ? 43.95157  9.53237    6.30260   1.000 33.49705  ? 168  ALA H CA  1 
ATOM   1316  C C   . ALA A  1 188 ? 43.56452  9.76516    4.84608   1.000 37.07494  ? 168  ALA H C   1 
ATOM   1317  O O   . ALA A  1 188 ? 43.25485  10.90972   4.48134   1.000 34.29200  ? 168  ALA H O   1 
ATOM   1318  C CB  . ALA A  1 188 ? 45.32722  10.13352   6.59121   1.000 28.72878  ? 168  ALA H CB  1 
ATOM   1319  N N   . THR A  1 189 ? 43.52921  8.70433    4.02829   1.000 37.73797  ? 169  THR H N   1 
ATOM   1320  C CA  . THR A  1 189 ? 43.20796  8.83342    2.61250   1.000 35.64532  ? 169  THR H CA  1 
ATOM   1321  C C   . THR A  1 189 ? 41.86522  9.50861    2.37456   1.000 36.09909  ? 169  THR H C   1 
ATOM   1322  O O   . THR A  1 189 ? 41.63201  10.01860   1.27430   1.000 35.39061  ? 169  THR H O   1 
ATOM   1323  C CB  . THR A  1 189 ? 43.20435  7.46469    1.91637   1.000 33.17863  ? 169  THR H CB  1 
ATOM   1324  O OG1 . THR A  1 189 ? 42.08889  6.67708    2.34132   1.000 28.89232  ? 169  THR H OG1 1 
ATOM   1325  C CG2 . THR A  1 189 ? 44.49378  6.71039    2.17557   1.000 36.68640  ? 169  THR H CG2 1 
ATOM   1326  N N   . GLY A  1 190 ? 40.98600  9.53452    3.36570   1.000 34.56602  ? 170  GLY H N   1 
ATOM   1327  C CA  . GLY A  1 190 ? 39.69616  10.16970   3.22452   1.000 35.66882  ? 170  GLY H CA  1 
ATOM   1328  C C   . GLY A  1 190 ? 39.58088  11.59682   3.71316   1.000 33.88569  ? 170  GLY H C   1 
ATOM   1329  O O   . GLY A  1 190 ? 38.50378  12.18457   3.58629   1.000 38.12713  ? 170  GLY H O   1 
ATOM   1330  N N   . PHE A  1 191 ? 40.64339  12.17703   4.26050   1.000 29.84792  ? 171  PHE H N   1 
ATOM   1331  C CA  . PHE A  1 191 ? 40.62227  13.52041   4.81915   1.000 31.32486  ? 171  PHE H CA  1 
ATOM   1332  C C   . PHE A  1 191 ? 41.38130  14.50603   3.93918   1.000 35.26073  ? 171  PHE H C   1 
ATOM   1333  O O   . PHE A  1 191 ? 42.20967  14.13210   3.09447   1.000 34.85728  ? 171  PHE H O   1 
ATOM   1334  C CB  . PHE A  1 191 ? 41.24906  13.54051   6.21162   1.000 32.12374  ? 171  PHE H CB  1 
ATOM   1335  C CG  . PHE A  1 191 ? 40.44549  12.79921   7.23992   1.000 33.06374  ? 171  PHE H CG  1 
ATOM   1336  C CD1 . PHE A  1 191 ? 40.49464  11.41388   7.30746   1.000 32.07449  ? 171  PHE H CD1 1 
ATOM   1337  C CD2 . PHE A  1 191 ? 39.64891  13.48638   8.13675   1.000 33.69641  ? 171  PHE H CD2 1 
ATOM   1338  C CE1 . PHE A  1 191 ? 39.75739  10.71544   8.26220   1.000 33.64887  ? 171  PHE H CE1 1 
ATOM   1339  C CE2 . PHE A  1 191 ? 38.90333  12.79347   9.07738   1.000 31.58854  ? 171  PHE H CE2 1 
ATOM   1340  C CZ  . PHE A  1 191 ? 38.96321  11.40423   9.13607   1.000 33.62128  ? 171  PHE H CZ  1 
ATOM   1341  N N   . GLY A  1 192 ? 41.10853  15.78548   4.17619   1.000 32.06437  ? 172  GLY H N   1 
ATOM   1342  C CA  . GLY A  1 192 ? 42.10009  16.80045   3.87888   1.000 31.65078  ? 172  GLY H CA  1 
ATOM   1343  C C   . GLY A  1 192 ? 43.29448  16.61645   4.79748   1.000 33.15652  ? 172  GLY H C   1 
ATOM   1344  O O   . GLY A  1 192 ? 43.14937  16.56867   6.02481   1.000 34.61303  ? 172  GLY H O   1 
ATOM   1345  N N   . VAL A  1 193 ? 44.48501  16.50308   4.21529   1.000 32.15330  ? 173  VAL H N   1 
ATOM   1346  C CA  . VAL A  1 193 ? 45.67020  16.11625   4.96731   1.000 31.22292  ? 173  VAL H CA  1 
ATOM   1347  C C   . VAL A  1 193 ? 46.67641  17.24867   4.93373   1.000 34.78128  ? 173  VAL H C   1 
ATOM   1348  O O   . VAL A  1 193 ? 47.01142  17.76726   3.85708   1.000 36.43632  ? 173  VAL H O   1 
ATOM   1349  C CB  . VAL A  1 193 ? 46.29108  14.81214   4.43350   1.000 32.86789  ? 173  VAL H CB  1 
ATOM   1350  C CG1 . VAL A  1 193 ? 47.63707  14.55693   5.09332   1.000 29.98268  ? 173  VAL H CG1 1 
ATOM   1351  C CG2 . VAL A  1 193 ? 45.34395  13.63536   4.68455   1.000 28.71423  ? 173  VAL H CG2 1 
ATOM   1352  N N   . MET A  1 194 ? 47.16827  17.61189   6.11962   1.000 32.08835  ? 174  MET H N   1 
ATOM   1353  C CA  . MET A  1 194 ? 48.19319  18.63309   6.29216   1.000 30.91188  ? 174  MET H CA  1 
ATOM   1354  C C   . MET A  1 194 ? 49.56699  17.95793   6.31660   1.000 36.03354  ? 174  MET H C   1 
ATOM   1355  O O   . MET A  1 194 ? 49.81718  17.06816   7.14560   1.000 34.16850  ? 174  MET H O   1 
ATOM   1356  C CB  . MET A  1 194 ? 47.92072  19.41041   7.58665   1.000 32.86796  ? 174  MET H CB  1 
ATOM   1357  C CG  . MET A  1 194 ? 46.62634  20.24308   7.58531   1.000 33.42574  ? 174  MET H CG  1 
ATOM   1358  S SD  . MET A  1 194 ? 46.30473  21.37080   6.19901   1.000 38.32695  ? 174  MET H SD  1 
ATOM   1359  C CE  . MET A  1 194 ? 44.50408  21.60146   6.16899   1.000 31.14189  ? 174  MET H CE  1 
ATOM   1360  N N   . HIS A  1 195 ? 50.44118  18.35308   5.38579   1.000 34.47262  ? 175  HIS H N   1 
ATOM   1361  C CA  . HIS A  1 195 ? 51.85325  17.98758   5.41087   1.000 40.08959  ? 175  HIS H CA  1 
ATOM   1362  C C   . HIS A  1 195 ? 52.61551  19.02902   6.22584   1.000 41.13899  ? 175  HIS H C   1 
ATOM   1363  O O   . HIS A  1 195 ? 52.61312  20.21004   5.86388   1.000 44.03329  ? 175  HIS H O   1 
ATOM   1364  C CB  . HIS A  1 195 ? 52.39167  17.91934   3.97306   1.000 42.78323  ? 175  HIS H CB  1 
ATOM   1365  C CG  . HIS A  1 195 ? 53.80058  17.40885   3.85381   1.000 47.18944  ? 175  HIS H CG  1 
ATOM   1366  N ND1 . HIS A  1 195 ? 54.61962  17.19270   4.94390   1.000 46.92442  ? 175  HIS H ND1 1 
ATOM   1367  C CD2 . HIS A  1 195 ? 54.52293  17.04274   2.76509   1.000 48.93189  ? 175  HIS H CD2 1 
ATOM   1368  C CE1 . HIS A  1 195 ? 55.79153  16.73800   4.52985   1.000 49.49777  ? 175  HIS H CE1 1 
ATOM   1369  N NE2 . HIS A  1 195 ? 55.75577  16.62932   3.21491   1.000 49.67344  ? 175  HIS H NE2 1 
ATOM   1370  N N   . VAL A  1 196 ? 53.28483  18.60264   7.30309   1.000 34.05453  ? 176  VAL H N   1 
ATOM   1371  C CA  . VAL A  1 196 ? 53.96259  19.54020   8.18761   1.000 32.98125  ? 176  VAL H CA  1 
ATOM   1372  C C   . VAL A  1 196 ? 55.45481  19.26469   8.24340   1.000 38.51632  ? 176  VAL H C   1 
ATOM   1373  O O   . VAL A  1 196 ? 55.93084  18.17916   7.90570   1.000 37.03028  ? 176  VAL H O   1 
ATOM   1374  C CB  . VAL A  1 196 ? 53.38888  19.51237   9.61109   1.000 37.97962  ? 176  VAL H CB  1 
ATOM   1375  C CG1 . VAL A  1 196 ? 51.91316  19.80255   9.56702   1.000 37.62278  ? 176  VAL H CG1 1 
ATOM   1376  C CG2 . VAL A  1 196 ? 53.67201  18.15510   10.25198  1.000 38.92364  ? 176  VAL H CG2 1 
ATOM   1377  N N   . ASN A  1 197 ? 56.19978  20.27543   8.69704   1.000 39.26971  ? 177  ASN H N   1 
ATOM   1378  C CA  . ASN A  1 197 ? 57.61458  20.10056   8.98848   1.000 40.50942  ? 177  ASN H CA  1 
ATOM   1379  C C   . ASN A  1 197 ? 57.75768  19.74358   10.47045  1.000 39.60462  ? 177  ASN H C   1 
ATOM   1380  O O   . ASN A  1 197 ? 56.77281  19.46481   11.15471  1.000 38.03664  ? 177  ASN H O   1 
ATOM   1381  C CB  . ASN A  1 197 ? 58.40947  21.35313   8.59195   1.000 40.14042  ? 177  ASN H CB  1 
ATOM   1382  C CG  . ASN A  1 197 ? 57.89295  22.60589   9.26069   1.000 43.36885  ? 177  ASN H CG  1 
ATOM   1383  O OD1 . ASN A  1 197 ? 57.27675  22.55195   10.34018  1.000 41.75501  ? 177  ASN H OD1 1 
ATOM   1384  N ND2 . ASN A  1 197 ? 58.12814  23.75062   8.62666   1.000 42.73250  ? 177  ASN H ND2 1 
ATOM   1385  N N   . GLU A  1 198 ? 58.99456  19.73452   10.97245  1.000 40.85627  ? 178  GLU H N   1 
ATOM   1386  C CA  . GLU A  1 198 ? 59.27307  19.39378   12.36331  1.000 44.06136  ? 178  GLU H CA  1 
ATOM   1387  C C   . GLU A  1 198 ? 58.60698  20.34125   13.34575  1.000 41.93867  ? 178  GLU H C   1 
ATOM   1388  O O   . GLU A  1 198 ? 58.43688  19.98923   14.51892  1.000 41.98190  ? 178  GLU H O   1 
ATOM   1389  C CB  . GLU A  1 198 ? 60.78267  19.42295   12.58757  1.000 56.76850  ? 178  GLU H CB  1 
ATOM   1390  C CG  . GLU A  1 198 ? 61.33674  20.85792   12.50433  1.000 66.11078  ? 178  GLU H CG  1 
ATOM   1391  C CD  . GLU A  1 198 ? 62.61837  21.06192   13.30034  1.000 72.79787  ? 178  GLU H CD  1 
ATOM   1392  O OE1 . GLU A  1 198 ? 63.00869  20.12463   14.03594  1.000 75.82892  ? 178  GLU H OE1 1 
ATOM   1393  O OE2 . GLU A  1 198 ? 63.22270  22.16097   13.19361  1.000 74.78425  ? 178  GLU H OE2 1 
ATOM   1394  N N   . LYS A  1 199 ? 58.25968  21.54263   12.90748  1.000 40.01385  ? 179  LYS H N   1 
ATOM   1395  C CA  . LYS A  1 199 ? 57.70042  22.54915   13.78666  1.000 41.04114  ? 179  LYS H CA  1 
ATOM   1396  C C   . LYS A  1 199 ? 56.17815  22.48621   13.85975  1.000 41.54618  ? 179  LYS H C   1 
ATOM   1397  O O   . LYS A  1 199 ? 55.56956  23.32482   14.52738  1.000 40.91787  ? 179  LYS H O   1 
ATOM   1398  C CB  . LYS A  1 199 ? 58.14298  23.94842   13.33340  1.000 44.37364  ? 179  LYS H CB  1 
ATOM   1399  C CG  . LYS A  1 199 ? 59.57403  24.02384   12.75622  1.000 50.79939  ? 179  LYS H CG  1 
ATOM   1400  C CD  . LYS A  1 199 ? 59.98417  25.48387   12.39830  1.000 53.86087  ? 179  LYS H CD  1 
ATOM   1401  C CE  . LYS A  1 199 ? 61.14875  25.55071   11.36766  1.000 53.60952  ? 179  LYS H CE  1 
ATOM   1402  N NZ  . LYS A  1 199 ? 61.01274  26.67271   10.37742  1.000 52.86133  ? 179  LYS H NZ  1 
ATOM   1403  N N   . ASP A  1 200 ? 55.55573  21.50439   13.21474  1.000 39.09690  ? 180  ASP H N   1 
ATOM   1404  C CA  . ASP A  1 200 ? 54.10549  21.45323   13.02941  1.000 38.16033  ? 180  ASP H CA  1 
ATOM   1405  C C   . ASP A  1 200 ? 53.59987  22.66327   12.24702  1.000 39.51821  ? 180  ASP H C   1 
ATOM   1406  O O   . ASP A  1 200 ? 52.43080  23.02436   12.34530  1.000 37.36220  ? 180  ASP H O   1 
ATOM   1407  C CB  . ASP A  1 200 ? 53.35682  21.30833   14.36785  1.000 36.96858  ? 180  ASP H CB  1 
ATOM   1408  C CG  . ASP A  1 200 ? 52.85483  19.87843   14.60192  1.000 37.69799  ? 180  ASP H CG  1 
ATOM   1409  O OD1 . ASP A  1 200 ? 53.38145  18.96991   13.93312  1.000 37.38352  ? 180  ASP H OD1 1 
ATOM   1410  O OD2 . ASP A  1 200 ? 51.96019  19.64160   15.44736  1.000 35.94646  ? 180  ASP H OD2 1 
ATOM   1411  N N   . GLU A  1 201 ? 54.47291  23.31888   11.48245  1.000 31.99253  ? 181  GLU H N   1 
ATOM   1412  C CA  . GLU A  1 201 ? 54.02267  24.27432   10.47902  1.000 32.28557  ? 181  GLU H CA  1 
ATOM   1413  C C   . GLU A  1 201 ? 53.62816  23.53746   9.20741   1.000 35.02632  ? 181  GLU H C   1 
ATOM   1414  O O   . GLU A  1 201 ? 54.28301  22.57091   8.80533   1.000 35.47135  ? 181  GLU H O   1 
ATOM   1415  C CB  . GLU A  1 201 ? 55.12939  25.30962   10.18484  1.000 40.14962  ? 181  GLU H CB  1 
ATOM   1416  C CG  . GLU A  1 201 ? 55.84822  25.81119   11.45253  1.000 42.99373  ? 181  GLU H CG  1 
ATOM   1417  C CD  . GLU A  1 201 ? 57.03055  26.77241   11.16762  1.000 49.04259  ? 181  GLU H CD  1 
ATOM   1418  O OE1 . GLU A  1 201 ? 57.45597  26.89383   9.99008   1.000 47.75608  ? 181  GLU H OE1 1 
ATOM   1419  O OE2 . GLU A  1 201 ? 57.52785  27.40711   12.13639  1.000 48.51588  ? 181  GLU H OE2 1 
ATOM   1420  N N   . ILE A  1 202 ? 52.55351  23.98443   8.56786   1.000 32.23736  ? 182  ILE H N   1 
ATOM   1421  C CA  . ILE A  1 202 ? 52.01698  23.27079   7.41657   1.000 37.41900  ? 182  ILE H CA  1 
ATOM   1422  C C   . ILE A  1 202 ? 52.73963  23.71437   6.13972   1.000 41.44589  ? 182  ILE H C   1 
ATOM   1423  O O   . ILE A  1 202 ? 52.70091  24.89294   5.74964   1.000 40.26259  ? 182  ILE H O   1 
ATOM   1424  C CB  . ILE A  1 202 ? 50.50160  23.46634   7.30482   1.000 34.77439  ? 182  ILE H CB  1 
ATOM   1425  C CG1 . ILE A  1 202 ? 49.83281  23.10010   8.63939   1.000 34.82439  ? 182  ILE H CG1 1 
ATOM   1426  C CG2 . ILE A  1 202 ? 49.94334  22.59364   6.21501   1.000 36.70671  ? 182  ILE H CG2 1 
ATOM   1427  C CD1 . ILE A  1 202 ? 48.52200  23.82081   8.88793   1.000 32.54146  ? 182  ILE H CD1 1 
ATOM   1428  N N   . ILE A  1 203 ? 53.41192  22.77042   5.48362   1.000 44.64237  ? 183  ILE H N   1 
ATOM   1429  C CA  . ILE A  1 203 ? 54.14430  23.10003   4.26379   1.000 41.96424  ? 183  ILE H CA  1 
ATOM   1430  C C   . ILE A  1 203 ? 53.36902  22.72563   3.00372   1.000 40.99742  ? 183  ILE H C   1 
ATOM   1431  O O   . ILE A  1 203 ? 53.63521  23.29278   1.93331   1.000 44.00198  ? 183  ILE H O   1 
ATOM   1432  C CB  . ILE A  1 203 ? 55.54468  22.45573   4.26677   1.000 39.94065  ? 183  ILE H CB  1 
ATOM   1433  C CG1 . ILE A  1 203 ? 55.44196  20.94674   4.10079   1.000 43.96955  ? 183  ILE H CG1 1 
ATOM   1434  C CG2 . ILE A  1 203 ? 56.31385  22.82836   5.54477   1.000 36.34164  ? 183  ILE H CG2 1 
ATOM   1435  C CD1 . ILE A  1 203 ? 56.79919  20.27519   4.04093   1.000 48.57700  ? 183  ILE H CD1 1 
ATOM   1436  N N   . ASP A  1 204 ? 52.39957  21.82735   3.10085   1.000 38.71214  ? 184  ASP H N   1 
ATOM   1437  C CA  . ASP A  1 204 ? 51.52920  21.52060   1.97692   1.000 41.12137  ? 184  ASP H CA  1 
ATOM   1438  C C   . ASP A  1 204 ? 50.18440  21.06346   2.53132   1.000 41.18329  ? 184  ASP H C   1 
ATOM   1439  O O   . ASP A  1 204 ? 50.07792  20.69503   3.70925   1.000 37.53494  ? 184  ASP H O   1 
ATOM   1440  C CB  . ASP A  1 204 ? 52.17970  20.45379   1.07777   1.000 41.35917  ? 184  ASP H CB  1 
ATOM   1441  C CG  . ASP A  1 204 ? 51.47265  20.28891   -0.26281  1.000 47.43174  ? 184  ASP H CG  1 
ATOM   1442  O OD1 . ASP A  1 204 ? 50.69456  21.18027   -0.66207  1.000 47.11020  ? 184  ASP H OD1 1 
ATOM   1443  O OD2 . ASP A  1 204 ? 51.70070  19.24289   -0.92688  1.000 49.42701  ? 184  ASP H OD2 1 
ATOM   1444  N N   . PHE A  1 205 ? 49.14727  21.12017   1.68258   1.000 39.23995  ? 185  PHE H N   1 
ATOM   1445  C CA  . PHE A  1 205 ? 47.84800  20.52479   1.98582   1.000 39.66095  ? 185  PHE H CA  1 
ATOM   1446  C C   . PHE A  1 205 ? 47.37043  19.70956   0.78975   1.000 42.88078  ? 185  PHE H C   1 
ATOM   1447  O O   . PHE A  1 205 ? 47.53548  20.12996   -0.36025  1.000 45.03485  ? 185  PHE H O   1 
ATOM   1448  C CB  . PHE A  1 205 ? 46.80027  21.58725   2.33993   1.000 39.88253  ? 185  PHE H CB  1 
ATOM   1449  C CG  . PHE A  1 205 ? 45.36670  21.12859   2.14714   1.000 40.44501  ? 185  PHE H CG  1 
ATOM   1450  C CD1 . PHE A  1 205 ? 44.75492  20.29024   3.06369   1.000 39.79137  ? 185  PHE H CD1 1 
ATOM   1451  C CD2 . PHE A  1 205 ? 44.63291  21.54879   1.04597   1.000 43.56708  ? 185  PHE H CD2 1 
ATOM   1452  C CE1 . PHE A  1 205 ? 43.43132  19.86600   2.88024   1.000 41.95804  ? 185  PHE H CE1 1 
ATOM   1453  C CE2 . PHE A  1 205 ? 43.31417  21.14206   0.84681   1.000 42.54718  ? 185  PHE H CE2 1 
ATOM   1454  C CZ  . PHE A  1 205 ? 42.70554  20.29713   1.76780   1.000 44.43114  ? 185  PHE H CZ  1 
ATOM   1455  N N   . ILE A  1 206 ? 46.77227  18.54614   1.05606   1.000 40.28819  ? 186  ILE H N   1 
ATOM   1456  C CA  . ILE A  1 206 ? 46.31790  17.65470   -0.00632  1.000 37.90274  ? 186  ILE H CA  1 
ATOM   1457  C C   . ILE A  1 206 ? 44.93329  17.15371   0.33161   1.000 38.48185  ? 186  ILE H C   1 
ATOM   1458  O O   . ILE A  1 206 ? 44.70571  16.63802   1.43072   1.000 40.12413  ? 186  ILE H O   1 
ATOM   1459  C CB  . ILE A  1 206 ? 47.27596  16.46678   -0.21757  1.000 37.73393  ? 186  ILE H CB  1 
ATOM   1460  C CG1 . ILE A  1 206 ? 48.69112  16.98216   -0.45239  1.000 41.78543  ? 186  ILE H CG1 1 
ATOM   1461  C CG2 . ILE A  1 206 ? 46.82228  15.60374   -1.42286  1.000 38.95148  ? 186  ILE H CG2 1 
ATOM   1462  C CD1 . ILE A  1 206 ? 49.57995  16.89669   0.76731   1.000 43.61391  ? 186  ILE H CD1 1 
ATOM   1463  N N   . GLU A  1 207 ? 44.01311  17.28359   -0.61679  1.000 38.99633  ? 187  GLU H N   1 
ATOM   1464  C CA  . GLU A  1 207 ? 42.64402  16.80834   -0.45680  1.000 39.87930  ? 187  GLU H CA  1 
ATOM   1465  C C   . GLU A  1 207 ? 42.58774  15.32455   -0.82565  1.000 40.68067  ? 187  GLU H C   1 
ATOM   1466  O O   . GLU A  1 207 ? 42.73649  14.96499   -1.99851  1.000 39.72110  ? 187  GLU H O   1 
ATOM   1467  C CB  . GLU A  1 207 ? 41.70151  17.64035   -1.32360  1.000 42.64628  ? 187  GLU H CB  1 
ATOM   1468  C CG  . GLU A  1 207 ? 40.29084  17.11542   -1.38492  1.000 49.64381  ? 187  GLU H CG  1 
ATOM   1469  C CD  . GLU A  1 207 ? 39.56044  17.30936   -0.07886  1.000 58.54599  ? 187  GLU H CD  1 
ATOM   1470  O OE1 . GLU A  1 207 ? 39.90741  18.26576   0.65114   1.000 63.04884  ? 187  GLU H OE1 1 
ATOM   1471  O OE2 . GLU A  1 207 ? 38.65100  16.50257   0.22701   1.000 60.31892  ? 187  GLU H OE2 1 
ATOM   1472  N N   . LYS A  1 208 ? 42.38150  14.45570   0.18123   1.000 36.17819  ? 188  LYS H N   1 
ATOM   1473  C CA  . LYS A  1 208 ? 42.30189  13.00324   0.01301   1.000 31.14855  ? 188  LYS H CA  1 
ATOM   1474  C C   . LYS A  1 208 ? 43.52150  12.38914   -0.67875  1.000 36.37524  ? 188  LYS H C   1 
ATOM   1475  O O   . LYS A  1 208 ? 43.38265  11.76304   -1.74187  1.000 34.96598  ? 188  LYS H O   1 
ATOM   1476  C CB  . LYS A  1 208 ? 41.03681  12.64233   -0.76163  1.000 32.44068  ? 188  LYS H CB  1 
ATOM   1477  C CG  . LYS A  1 208 ? 39.78314  13.33300   -0.22782  1.000 37.55424  ? 188  LYS H CG  1 
ATOM   1478  C CD  . LYS A  1 208 ? 38.56179  12.44783   -0.36878  1.000 42.00047  ? 188  LYS H CD  1 
ATOM   1479  C CE  . LYS A  1 208 ? 37.38657  13.25113   -0.90573  1.000 45.62833  ? 188  LYS H CE  1 
ATOM   1480  N NZ  . LYS A  1 208 ? 36.73121  14.01753   0.18097   1.000 43.93485  ? 188  LYS H NZ  1 
ATOM   1481  N N   . PRO A  1 209 ? 44.71558  12.50582   -0.10101  1.000 34.94084  ? 189  PRO H N   1 
ATOM   1482  C CA  . PRO A  1 209 ? 45.89954  11.89633   -0.72727  1.000 34.57572  ? 189  PRO H CA  1 
ATOM   1483  C C   . PRO A  1 209 ? 45.77267  10.38181   -0.82708  1.000 35.14494  ? 189  PRO H C   1 
ATOM   1484  O O   . PRO A  1 209 ? 45.37409  9.71252    0.12678   1.000 32.24058  ? 189  PRO H O   1 
ATOM   1485  C CB  . PRO A  1 209 ? 47.04194  12.29759   0.21314   1.000 38.12672  ? 189  PRO H CB  1 
ATOM   1486  C CG  . PRO A  1 209 ? 46.35701  12.64240   1.52996   1.000 37.10835  ? 189  PRO H CG  1 
ATOM   1487  C CD  . PRO A  1 209 ? 45.04014  13.21974   1.14557   1.000 32.71569  ? 189  PRO H CD  1 
ATOM   1488  N N   . ALA A  1 210 ? 46.10688  9.84149    -2.00768  1.000 32.69167  ? 190  ALA H N   1 
ATOM   1489  C CA  . ALA A  1 210 ? 46.21141  8.39018    -2.14243  1.000 36.59585  ? 190  ALA H CA  1 
ATOM   1490  C C   . ALA A  1 210 ? 47.26704  7.84420    -1.19735  1.000 38.67431  ? 190  ALA H C   1 
ATOM   1491  O O   . ALA A  1 210 ? 47.10253  6.76759    -0.61722  1.000 40.65783  ? 190  ALA H O   1 
ATOM   1492  C CB  . ALA A  1 210 ? 46.53112  8.00373    -3.58671  1.000 40.42140  ? 190  ALA H CB  1 
ATOM   1493  N N   . ASP A  1 211 ? 48.35200  8.58365    -1.01161  1.000 37.74172  ? 191  ASP H N   1 
ATOM   1494  C CA  . ASP A  1 211 ? 49.38012  8.21603    -0.04725  1.000 37.58964  ? 191  ASP H CA  1 
ATOM   1495  C C   . ASP A  1 211 ? 49.61262  9.41730    0.85376   1.000 36.55217  ? 191  ASP H C   1 
ATOM   1496  O O   . ASP A  1 211 ? 50.40668  10.30913   0.52027   1.000 39.39634  ? 191  ASP H O   1 
ATOM   1497  C CB  . ASP A  1 211 ? 50.65967  7.78880    -0.74903  1.000 37.43759  ? 191  ASP H CB  1 
ATOM   1498  C CG  . ASP A  1 211 ? 51.59209  7.06304    0.17112   1.000 42.30449  ? 191  ASP H CG  1 
ATOM   1499  O OD1 . ASP A  1 211 ? 52.77761  6.93879    -0.18770  1.000 42.29142  ? 191  ASP H OD1 1 
ATOM   1500  O OD2 . ASP A  1 211 ? 51.12919  6.62527    1.25969   1.000 47.24313  ? 191  ASP H OD2 1 
ATOM   1501  N N   . PRO A  1 212 ? 48.93034  9.48234    1.99251   1.000 36.01193  ? 192  PRO H N   1 
ATOM   1502  C CA  . PRO A  1 212 ? 48.99645  10.67914   2.83324   1.000 33.10269  ? 192  PRO H CA  1 
ATOM   1503  C C   . PRO A  1 212 ? 50.40706  10.93706   3.32515   1.000 36.07472  ? 192  PRO H C   1 
ATOM   1504  O O   . PRO A  1 212 ? 51.10162  10.01796   3.78142   1.000 37.06932  ? 192  PRO H O   1 
ATOM   1505  C CB  . PRO A  1 212 ? 48.05011  10.34826   4.00198   1.000 37.67447  ? 192  PRO H CB  1 
ATOM   1506  C CG  . PRO A  1 212 ? 47.12884  9.31995    3.47035   1.000 35.78330  ? 192  PRO H CG  1 
ATOM   1507  C CD  . PRO A  1 212 ? 47.94567  8.50628    2.49197   1.000 35.51954  ? 192  PRO H CD  1 
ATOM   1508  N N   . PRO A  1 213 ? 50.86404  12.18344   3.24868   1.000 40.35199  ? 193  PRO H N   1 
ATOM   1509  C CA  . PRO A  1 213 ? 52.17232  12.53571   3.81162   1.000 41.96263  ? 193  PRO H CA  1 
ATOM   1510  C C   . PRO A  1 213 ? 52.24880  12.19282   5.28637   1.000 41.76714  ? 193  PRO H C   1 
ATOM   1511  O O   . PRO A  1 213 ? 51.35389  12.52605   6.07074   1.000 37.76710  ? 193  PRO H O   1 
ATOM   1512  C CB  . PRO A  1 213 ? 52.25872  14.04992   3.59513   1.000 46.76131  ? 193  PRO H CB  1 
ATOM   1513  C CG  . PRO A  1 213 ? 51.23394  14.36236   2.56886   1.000 48.04909  ? 193  PRO H CG  1 
ATOM   1514  C CD  . PRO A  1 213 ? 50.14555  13.34851   2.71645   1.000 42.29156  ? 193  PRO H CD  1 
ATOM   1515  N N   . GLY A  1 214 ? 53.32568  11.53098   5.66382   1.000 33.27307  ? 194  GLY H N   1 
ATOM   1516  C CA  . GLY A  1 214 ? 53.51571  11.19306   7.04905   1.000 35.71016  ? 194  GLY H CA  1 
ATOM   1517  C C   . GLY A  1 214 ? 54.03049  12.36874   7.85225   1.000 36.63996  ? 194  GLY H C   1 
ATOM   1518  O O   . GLY A  1 214 ? 54.64597  13.30132   7.32437   1.000 34.74215  ? 194  GLY H O   1 
ATOM   1519  N N   . ILE A  1 215 ? 53.78281  12.30494   9.15057   1.000 32.40775  ? 195  ILE H N   1 
ATOM   1520  C CA  . ILE A  1 215 ? 54.35947  13.28724   10.08278  1.000 38.13444  ? 195  ILE H CA  1 
ATOM   1521  C C   . ILE A  1 215 ? 55.85691  13.02807   10.20660  1.000 43.17050  ? 195  ILE H C   1 
ATOM   1522  O O   . ILE A  1 215 ? 56.25754  11.86240   10.38328  1.000 43.54634  ? 195  ILE H O   1 
ATOM   1523  C CB  . ILE A  1 215 ? 53.68227  13.18163   11.44815  1.000 37.70778  ? 195  ILE H CB  1 
ATOM   1524  C CG1 . ILE A  1 215 ? 52.18164  13.48930   11.34234  1.000 37.36749  ? 195  ILE H CG1 1 
ATOM   1525  C CG2 . ILE A  1 215 ? 54.41007  14.03548   12.46343  1.000 38.96400  ? 195  ILE H CG2 1 
ATOM   1526  C CD1 . ILE A  1 215 ? 51.37308  13.16295   12.63867  1.000 34.37375  ? 195  ILE H CD1 1 
ATOM   1527  N N   . PRO A  1 216 ? 56.71552  14.05294   10.13474  1.000 47.96856  ? 196  PRO H N   1 
ATOM   1528  C CA  . PRO A  1 216 ? 58.16254  13.80580   10.24311  1.000 50.76680  ? 196  PRO H CA  1 
ATOM   1529  C C   . PRO A  1 216 ? 58.52313  13.15332   11.56796  1.000 46.71362  ? 196  PRO H C   1 
ATOM   1530  O O   . PRO A  1 216 ? 58.04378  13.54772   12.63100  1.000 43.69957  ? 196  PRO H O   1 
ATOM   1531  C CB  . PRO A  1 216 ? 58.77831  15.20545   10.12089  1.000 49.94564  ? 196  PRO H CB  1 
ATOM   1532  C CG  . PRO A  1 216 ? 57.80797  15.96257   9.32155   1.000 51.46968  ? 196  PRO H CG  1 
ATOM   1533  C CD  . PRO A  1 216 ? 56.43592  15.44545   9.74167   1.000 48.15355  ? 196  PRO H CD  1 
ATOM   1534  N N   . GLY A  1 217 ? 59.37975  12.13918   11.48619  1.000 43.02048  ? 197  GLY H N   1 
ATOM   1535  C CA  . GLY A  1 217 ? 59.75591  11.37939   12.64871  1.000 43.88368  ? 197  GLY H CA  1 
ATOM   1536  C C   . GLY A  1 217 ? 58.71708  10.38766   13.11051  1.000 42.77183  ? 197  GLY H C   1 
ATOM   1537  O O   . GLY A  1 217 ? 59.03149  9.52158    13.93507  1.000 44.94434  ? 197  GLY H O   1 
ATOM   1538  N N   . ASN A  1 218 ? 57.49304  10.47160   12.60714  1.000 39.67549  ? 198  ASN H N   1 
ATOM   1539  C CA  . ASN A  1 218 ? 56.43265  9.57380    13.01086  1.000 42.50070  ? 198  ASN H CA  1 
ATOM   1540  C C   . ASN A  1 218 ? 55.65150  9.22232    11.74780  1.000 42.57678  ? 198  ASN H C   1 
ATOM   1541  O O   . ASN A  1 218 ? 54.48750  9.59683    11.56570  1.000 38.73164  ? 198  ASN H O   1 
ATOM   1542  C CB  . ASN A  1 218 ? 55.53919  10.19914   14.07430  1.000 41.12663  ? 198  ASN H CB  1 
ATOM   1543  C CG  . ASN A  1 218 ? 54.42497  9.28513    14.48267  1.000 38.46700  ? 198  ASN H CG  1 
ATOM   1544  O OD1 . ASN A  1 218 ? 54.53717  8.07675    14.34748  1.000 34.22121  ? 198  ASN H OD1 1 
ATOM   1545  N ND2 . ASN A  1 218 ? 53.33393  9.85489    14.97873  1.000 39.67862  ? 198  ASN H ND2 1 
ATOM   1546  N N   . GLU A  1 219 ? 56.31793  8.48742    10.85551  1.000 42.36257  ? 199  GLU H N   1 
ATOM   1547  C CA  . GLU A  1 219 ? 55.78393  8.31439    9.52040   1.000 42.64122  ? 199  GLU H CA  1 
ATOM   1548  C C   . GLU A  1 219 ? 54.55830  7.42848    9.49000   1.000 37.98034  ? 199  GLU H C   1 
ATOM   1549  O O   . GLU A  1 219 ? 53.88297  7.40135    8.46908   1.000 39.75559  ? 199  GLU H O   1 
ATOM   1550  C CB  . GLU A  1 219 ? 56.86056  7.75474    8.58174   1.000 48.55867  ? 199  GLU H CB  1 
ATOM   1551  C CG  . GLU A  1 219 ? 56.65082  8.11788    7.10365   1.000 52.71173  ? 199  GLU H CG  1 
ATOM   1552  C CD  . GLU A  1 219 ? 56.92575  9.58454    6.80443   1.000 50.66599  ? 199  GLU H CD  1 
ATOM   1553  O OE1 . GLU A  1 219 ? 56.39700  10.09139   5.78855   1.000 50.54736  ? 199  GLU H OE1 1 
ATOM   1554  O OE2 . GLU A  1 219 ? 57.65989  10.22841   7.58114   1.000 49.31500  ? 199  GLU H OE2 1 
ATOM   1555  N N   . GLY A  1 220 ? 54.24678  6.71080    10.55606  1.000 39.37114  ? 200  GLY H N   1 
ATOM   1556  C CA  . GLY A  1 220 ? 53.05215  5.89544    10.47889  1.000 41.41384  ? 200  GLY H CA  1 
ATOM   1557  C C   . GLY A  1 220 ? 51.74419  6.63569    10.61189  1.000 39.82700  ? 200  GLY H C   1 
ATOM   1558  O O   . GLY A  1 220 ? 50.67842  6.01750    10.55944  1.000 39.78451  ? 200  GLY H O   1 
ATOM   1559  N N   . PHE A  1 221 ? 51.78687  7.95186    10.79032  1.000 37.08315  ? 201  PHE H N   1 
ATOM   1560  C CA  . PHE A  1 221 ? 50.59168  8.73798    11.04797  1.000 34.77970  ? 201  PHE H CA  1 
ATOM   1561  C C   . PHE A  1 221 ? 50.60848  9.98721    10.18152  1.000 35.56925  ? 201  PHE H C   1 
ATOM   1562  O O   . PHE A  1 221 ? 51.66587  10.44858   9.74099   1.000 33.93384  ? 201  PHE H O   1 
ATOM   1563  C CB  . PHE A  1 221 ? 50.50783  9.13856    12.52092  1.000 37.28260  ? 201  PHE H CB  1 
ATOM   1564  C CG  . PHE A  1 221 ? 50.24622  7.97687    13.44615  1.000 41.73545  ? 201  PHE H CG  1 
ATOM   1565  C CD1 . PHE A  1 221 ? 51.28126  7.13126    13.84072  1.000 44.65371  ? 201  PHE H CD1 1 
ATOM   1566  C CD2 . PHE A  1 221 ? 48.96517  7.72851    13.91002  1.000 37.88649  ? 201  PHE H CD2 1 
ATOM   1567  C CE1 . PHE A  1 221 ? 51.03431  6.05678    14.69590  1.000 45.46932  ? 201  PHE H CE1 1 
ATOM   1568  C CE2 . PHE A  1 221 ? 48.71021  6.66629    14.75776  1.000 39.84403  ? 201  PHE H CE2 1 
ATOM   1569  C CZ  . PHE A  1 221 ? 49.74973  5.82580    15.15658  1.000 43.08591  ? 201  PHE H CZ  1 
ATOM   1570  N N   . ALA A  1 222 ? 49.41737  10.53703   9.95679   1.000 28.62534  ? 202  ALA H N   1 
ATOM   1571  C CA  . ALA A  1 222 ? 49.23656  11.77695   9.22318   1.000 28.87662  ? 202  ALA H CA  1 
ATOM   1572  C C   . ALA A  1 222 ? 48.27020  12.67815   9.97816   1.000 32.29061  ? 202  ALA H C   1 
ATOM   1573  O O   . ALA A  1 222 ? 47.41616  12.20461   10.73965  1.000 29.93003  ? 202  ALA H O   1 
ATOM   1574  C CB  . ALA A  1 222 ? 48.71287  11.53372   7.80127   1.000 29.20347  ? 202  ALA H CB  1 
ATOM   1575  N N   . LEU A  1 223 ? 48.41312  13.98787   9.76021   1.000 30.36755  ? 203  LEU H N   1 
ATOM   1576  C CA  . LEU A  1 223 ? 47.55161  14.98150   10.40334  1.000 31.11577  ? 203  LEU H CA  1 
ATOM   1577  C C   . LEU A  1 223 ? 46.38134  15.26585   9.46648   1.000 30.44886  ? 203  LEU H C   1 
ATOM   1578  O O   . LEU A  1 223 ? 46.56311  15.79235   8.36064   1.000 30.55641  ? 203  LEU H O   1 
ATOM   1579  C CB  . LEU A  1 223 ? 48.34171  16.24420   10.72687  1.000 37.52380  ? 203  LEU H CB  1 
ATOM   1580  C CG  . LEU A  1 223 ? 49.47764  16.07348   11.73258  1.000 27.99163  ? 203  LEU H CG  1 
ATOM   1581  C CD1 . LEU A  1 223 ? 50.24933  17.37876   11.80272  1.000 35.51485  ? 203  LEU H CD1 1 
ATOM   1582  C CD2 . LEU A  1 223 ? 48.91447  15.72162   13.07812  1.000 26.97022  ? 203  LEU H CD2 1 
ATOM   1583  N N   . ALA A  1 224 ? 45.20128  14.84183   9.88311   1.000 28.87217  ? 204  ALA H N   1 
ATOM   1584  C CA  . ALA A  1 224 ? 43.97564  14.93806   9.11251   1.000 25.77242  ? 204  ALA H CA  1 
ATOM   1585  C C   . ALA A  1 224 ? 43.16761  16.11253   9.63501   1.000 29.39979  ? 204  ALA H C   1 
ATOM   1586  O O   . ALA A  1 224 ? 42.90025  16.19661   10.84458  1.000 29.70767  ? 204  ALA H O   1 
ATOM   1587  C CB  . ALA A  1 224 ? 43.17650  13.65021   9.24858   1.000 25.18100  ? 204  ALA H CB  1 
ATOM   1588  N N   . SER A  1 225 ? 42.78765  17.00861   8.73127   1.000 26.85562  ? 205  SER H N   1 
ATOM   1589  C CA  . SER A  1 225 ? 42.09374  18.22648   9.11808   1.000 29.12818  ? 205  SER H CA  1 
ATOM   1590  C C   . SER A  1 225 ? 40.71001  17.96482   9.69412   1.000 23.73836  ? 205  SER H C   1 
ATOM   1591  O O   . SER A  1 225 ? 39.91180  17.19925   9.15736   1.000 23.51451  ? 205  SER H O   1 
ATOM   1592  C CB  . SER A  1 225 ? 41.95064  19.16475   7.93548   1.000 29.82945  ? 205  SER H CB  1 
ATOM   1593  O OG  . SER A  1 225 ? 41.33368  20.40012   8.32466   1.000 24.96431  ? 205  SER H OG  1 
ATOM   1594  N N   . MET A  1 226 ? 40.39836  18.71518   10.73748  1.000 23.08076  ? 206  MET H N   1 
ATOM   1595  C CA  . MET A  1 226 ? 39.13021  18.67853   11.41323  1.000 26.55045  ? 206  MET H CA  1 
ATOM   1596  C C   . MET A  1 226 ? 38.14969  19.70384   10.84320  1.000 27.61285  ? 206  MET H C   1 
ATOM   1597  O O   . MET A  1 226 ? 36.97575  19.71938   11.24174  1.000 24.74769  ? 206  MET H O   1 
ATOM   1598  C CB  . MET A  1 226 ? 39.37533  18.96042   12.89829  1.000 21.61134  ? 206  MET H CB  1 
ATOM   1599  C CG  . MET A  1 226 ? 40.17945  17.88504   13.56731  1.000 24.79087  ? 206  MET H CG  1 
ATOM   1600  S SD  . MET A  1 226 ? 40.28549  18.21716   15.30744  1.000 26.63376  ? 206  MET H SD  1 
ATOM   1601  C CE  . MET A  1 226 ? 41.92366  18.58747   15.81989  1.000 39.70265  ? 206  MET H CE  1 
ATOM   1602  N N   . GLY A  1 227 ? 38.61395  20.59457   9.96462   1.000 22.60290  ? 207  GLY H N   1 
ATOM   1603  C CA  . GLY A  1 227 ? 37.80014  21.72997   9.57543   1.000 22.44867  ? 207  GLY H CA  1 
ATOM   1604  C C   . GLY A  1 227 ? 37.57015  22.70313   10.71005  1.000 21.80923  ? 207  GLY H C   1 
ATOM   1605  O O   . GLY A  1 227 ? 36.49684  23.31598   10.77120  1.000 25.16625  ? 207  GLY H O   1 
ATOM   1606  N N   . ILE A  1 228 ? 38.53348  22.80949   11.63741  1.000 21.85941  ? 208  ILE H N   1 
ATOM   1607  C CA  . ILE A  1 228 ? 38.55637  23.77377   12.73898  1.000 21.37499  ? 208  ILE H CA  1 
ATOM   1608  C C   . ILE A  1 228 ? 39.71512  24.72648   12.48647  1.000 22.23528  ? 208  ILE H C   1 
ATOM   1609  O O   . ILE A  1 228 ? 40.86589  24.27756   12.37598  1.000 22.90755  ? 208  ILE H O   1 
ATOM   1610  C CB  . ILE A  1 228 ? 38.74254  23.09802   14.10305  1.000 21.11522  ? 208  ILE H CB  1 
ATOM   1611  C CG1 . ILE A  1 228 ? 37.64675  22.04440   14.36928  1.000 21.16528  ? 208  ILE H CG1 1 
ATOM   1612  C CG2 . ILE A  1 228 ? 38.81004  24.16889   15.20914  1.000 21.37725  ? 208  ILE H CG2 1 
ATOM   1613  C CD1 . ILE A  1 228 ? 37.85745  21.22298   15.64544  1.000 19.34606  ? 208  ILE H CD1 1 
ATOM   1614  N N   . TYR A  1 229 ? 39.43092  26.03081   12.45839  1.000 22.20703  ? 209  TYR H N   1 
ATOM   1615  C CA  . TYR A  1 229 ? 40.39704  27.04620   12.04285  1.000 23.52289  ? 209  TYR H CA  1 
ATOM   1616  C C   . TYR A  1 229 ? 40.29195  28.22958   12.98384  1.000 26.24242  ? 209  TYR H C   1 
ATOM   1617  O O   . TYR A  1 229 ? 39.18979  28.73488   13.21280  1.000 28.46524  ? 209  TYR H O   1 
ATOM   1618  C CB  . TYR A  1 229 ? 40.11763  27.55642   10.63132  1.000 23.73787  ? 209  TYR H CB  1 
ATOM   1619  C CG  . TYR A  1 229 ? 39.83257  26.49961   9.59957   1.000 25.95037  ? 209  TYR H CG  1 
ATOM   1620  C CD1 . TYR A  1 229 ? 40.82374  25.61976   9.19118   1.000 24.70710  ? 209  TYR H CD1 1 
ATOM   1621  C CD2 . TYR A  1 229 ? 38.56220  26.38597   9.01097   1.000 26.32643  ? 209  TYR H CD2 1 
ATOM   1622  C CE1 . TYR A  1 229 ? 40.57036  24.65269   8.24569   1.000 29.39874  ? 209  TYR H CE1 1 
ATOM   1623  C CE2 . TYR A  1 229 ? 38.30121  25.39711   8.06679   1.000 27.15744  ? 209  TYR H CE2 1 
ATOM   1624  C CZ  . TYR A  1 229 ? 39.31293  24.55368   7.69391   1.000 28.37344  ? 209  TYR H CZ  1 
ATOM   1625  O OH  . TYR A  1 229 ? 39.06331  23.60006   6.74935   1.000 30.28912  ? 209  TYR H OH  1 
ATOM   1626  N N   . VAL A  1 230 ? 41.42150  28.69270   13.49384  1.000 25.70438  ? 210  VAL H N   1 
ATOM   1627  C CA  . VAL A  1 230 ? 41.47089  29.89884   14.31042  1.000 25.51553  ? 210  VAL H CA  1 
ATOM   1628  C C   . VAL A  1 230 ? 42.18511  30.99825   13.51783  1.000 28.50023  ? 210  VAL H C   1 
ATOM   1629  O O   . VAL A  1 230 ? 43.25146  30.75291   12.95219  1.000 24.78737  ? 210  VAL H O   1 
ATOM   1630  C CB  . VAL A  1 230 ? 42.17313  29.61932   15.64857  1.000 22.44844  ? 210  VAL H CB  1 
ATOM   1631  C CG1 . VAL A  1 230 ? 42.38447  30.90495   16.38650  1.000 25.40990  ? 210  VAL H CG1 1 
ATOM   1632  C CG2 . VAL A  1 230 ? 41.32605  28.67488   16.47815  1.000 25.41950  ? 210  VAL H CG2 1 
ATOM   1633  N N   . PHE A  1 231 ? 41.59864  32.20710   13.47575  1.000 25.78766  ? 211  PHE H N   1 
ATOM   1634  C CA  . PHE A  1 231 ? 42.22750  33.37030   12.84967  1.000 24.47434  ? 211  PHE H CA  1 
ATOM   1635  C C   . PHE A  1 231 ? 42.11358  34.57724   13.77141  1.000 25.62407  ? 211  PHE H C   1 
ATOM   1636  O O   . PHE A  1 231 ? 41.18905  34.68394   14.57872  1.000 25.45586  ? 211  PHE H O   1 
ATOM   1637  C CB  . PHE A  1 231 ? 41.56786  33.79227   11.52386  1.000 25.96149  ? 211  PHE H CB  1 
ATOM   1638  C CG  . PHE A  1 231 ? 41.42355  32.69743   10.48222  1.000 30.14603  ? 211  PHE H CG  1 
ATOM   1639  C CD1 . PHE A  1 231 ? 40.35340  31.81008   10.51993  1.000 24.47542  ? 211  PHE H CD1 1 
ATOM   1640  C CD2 . PHE A  1 231 ? 42.28940  32.63819   9.41121   1.000 29.92062  ? 211  PHE H CD2 1 
ATOM   1641  C CE1 . PHE A  1 231 ? 40.21570  30.82861   9.53183   1.000 33.43770  ? 211  PHE H CE1 1 
ATOM   1642  C CE2 . PHE A  1 231 ? 42.14899  31.65155   8.40984   1.000 29.18471  ? 211  PHE H CE2 1 
ATOM   1643  C CZ  . PHE A  1 231 ? 41.10842  30.76436   8.47698   1.000 31.94760  ? 211  PHE H CZ  1 
ATOM   1644  N N   . HIS A  1 232 ? 43.02231  35.53351   13.58446  1.000 25.16602  ? 212  HIS H N   1 
ATOM   1645  C CA  . HIS A  1 232 ? 42.73015  36.90857   13.96274  1.000 27.47509  ? 212  HIS H CA  1 
ATOM   1646  C C   . HIS A  1 232 ? 41.61472  37.43039   13.06602  1.000 26.12005  ? 212  HIS H C   1 
ATOM   1647  O O   . HIS A  1 232 ? 41.63514  37.22500   11.85537  1.000 31.06452  ? 212  HIS H O   1 
ATOM   1648  C CB  . HIS A  1 232 ? 43.98162  37.77604   13.84987  1.000 31.90542  ? 212  HIS H CB  1 
ATOM   1649  C CG  . HIS A  1 232 ? 44.95652  37.57839   14.97388  1.000 32.51693  ? 212  HIS H CG  1 
ATOM   1650  N ND1 . HIS A  1 232 ? 45.97646  36.65011   14.92133  1.000 33.86043  ? 212  HIS H ND1 1 
ATOM   1651  C CD2 . HIS A  1 232 ? 45.07110  38.19336   16.17451  1.000 31.29539  ? 212  HIS H CD2 1 
ATOM   1652  C CE1 . HIS A  1 232 ? 46.67752  36.70042   16.04324  1.000 32.78836  ? 212  HIS H CE1 1 
ATOM   1653  N NE2 . HIS A  1 232 ? 46.14758  37.62909   16.82245  1.000 33.46503  ? 212  HIS H NE2 1 
ATOM   1654  N N   . THR A  1 233 ? 40.61716  38.07310   13.66535  1.000 24.43564  ? 213  THR H N   1 
ATOM   1655  C CA  . THR A  1 233 ? 39.43507  38.47168   12.90424  1.000 28.10222  ? 213  THR H CA  1 
ATOM   1656  C C   . THR A  1 233 ? 39.81278  39.39462   11.75149  1.000 30.07528  ? 213  THR H C   1 
ATOM   1657  O O   . THR A  1 233 ? 39.34950  39.22612   10.61254  1.000 29.19041  ? 213  THR H O   1 
ATOM   1658  C CB  . THR A  1 233 ? 38.44379  39.16635   13.83774  1.000 29.00579  ? 213  THR H CB  1 
ATOM   1659  O OG1 . THR A  1 233 ? 38.12033  38.30425   14.92728  1.000 29.25360  ? 213  THR H OG1 1 
ATOM   1660  C CG2 . THR A  1 233 ? 37.15938  39.55979   13.11533  1.000 30.34579  ? 213  THR H CG2 1 
ATOM   1661  N N   . LYS A  1 234 ? 40.66325  40.37573   12.02376  1.000 28.88351  ? 214  LYS H N   1 
ATOM   1662  C CA  . LYS A  1 234 ? 41.00443  41.31908   10.97437  1.000 34.33785  ? 214  LYS H CA  1 
ATOM   1663  C C   . LYS A  1 234 ? 41.67624  40.60167   9.80719   1.000 32.61805  ? 214  LYS H C   1 
ATOM   1664  O O   . LYS A  1 234 ? 41.39907  40.90802   8.64928   1.000 29.48709  ? 214  LYS H O   1 
ATOM   1665  C CB  . LYS A  1 234 ? 41.87354  42.45506   11.52619  1.000 39.65833  ? 214  LYS H CB  1 
ATOM   1666  C CG  . LYS A  1 234 ? 43.40504  42.34011   11.36657  1.000 49.69034  ? 214  LYS H CG  1 
ATOM   1667  C CD  . LYS A  1 234 ? 44.04878  41.15227   12.10244  1.000 52.87781  ? 214  LYS H CD  1 
ATOM   1668  C CE  . LYS A  1 234 ? 45.55506  41.11740   11.86929  1.000 58.99079  ? 214  LYS H CE  1 
ATOM   1669  N NZ  . LYS A  1 234 ? 46.19291  39.83397   12.28540  1.000 60.91110  ? 214  LYS H NZ  1 
ATOM   1670  N N   . PHE A  1 235 ? 42.50938  39.59649   10.09427  1.000 31.31316  ? 215  PHE H N   1 
ATOM   1671  C CA  . PHE A  1 235 ? 43.17990  38.88712   9.00628   1.000 30.86276  ? 215  PHE H CA  1 
ATOM   1672  C C   . PHE A  1 235 ? 42.18687  38.07891   8.19513   1.000 28.23818  ? 215  PHE H C   1 
ATOM   1673  O O   . PHE A  1 235 ? 42.31088  37.98933   6.95935   1.000 29.06423  ? 215  PHE H O   1 
ATOM   1674  C CB  . PHE A  1 235 ? 44.28670  37.97964   9.54903   1.000 30.34853  ? 215  PHE H CB  1 
ATOM   1675  C CG  . PHE A  1 235 ? 44.93504  37.12563   8.49946   1.000 35.75437  ? 215  PHE H CG  1 
ATOM   1676  C CD1 . PHE A  1 235 ? 44.45146  35.84670   8.21561   1.000 37.98705  ? 215  PHE H CD1 1 
ATOM   1677  C CD2 . PHE A  1 235 ? 46.02973  37.58712   7.78594   1.000 39.50009  ? 215  PHE H CD2 1 
ATOM   1678  C CE1 . PHE A  1 235 ? 45.06426  35.05728   7.22775   1.000 42.21779  ? 215  PHE H CE1 1 
ATOM   1679  C CE2 . PHE A  1 235 ? 46.63341  36.80940   6.81654   1.000 42.90113  ? 215  PHE H CE2 1 
ATOM   1680  C CZ  . PHE A  1 235 ? 46.15548  35.54351   6.54156   1.000 44.38666  ? 215  PHE H CZ  1 
ATOM   1681  N N   . LEU A  1 236 ? 41.24397  37.41424   8.87977   1.000 26.85274  ? 216  LEU H N   1 
ATOM   1682  C CA  . LEU A  1 236 ? 40.28335  36.57085   8.18115   1.000 29.82003  ? 216  LEU H CA  1 
ATOM   1683  C C   . LEU A  1 236 ? 39.38295  37.41270   7.29690   1.000 32.28644  ? 216  LEU H C   1 
ATOM   1684  O O   . LEU A  1 236 ? 39.07236  37.02289   6.16120   1.000 27.49633  ? 216  LEU H O   1 
ATOM   1685  C CB  . LEU A  1 236 ? 39.43241  35.78036   9.19525   1.000 25.33557  ? 216  LEU H CB  1 
ATOM   1686  C CG  . LEU A  1 236 ? 38.33399  34.90157   8.60143   1.000 24.92205  ? 216  LEU H CG  1 
ATOM   1687  C CD1 . LEU A  1 236 ? 38.87325  33.88861   7.59470   1.000 25.81626  ? 216  LEU H CD1 1 
ATOM   1688  C CD2 . LEU A  1 236 ? 37.55963  34.18344   9.71911   1.000 23.72555  ? 216  LEU H CD2 1 
ATOM   1689  N N   . MET A  1 237 ? 38.93684  38.56612   7.81747   1.000 30.61557  ? 217  MET H N   1 
ATOM   1690  C CA  . MET A  1 237 ? 38.06687  39.44869   7.04738   1.000 37.35539  ? 217  MET H CA  1 
ATOM   1691  C C   . MET A  1 237 ? 38.72100  39.86970   5.73799   1.000 36.75185  ? 217  MET H C   1 
ATOM   1692  O O   . MET A  1 237 ? 38.04194  39.98527   4.70982   1.000 33.44649  ? 217  MET H O   1 
ATOM   1693  C CB  . MET A  1 237 ? 37.70139  40.68189   7.87199   1.000 39.49457  ? 217  MET H CB  1 
ATOM   1694  C CG  . MET A  1 237 ? 36.92972  40.36266   9.13468   1.000 40.12025  ? 217  MET H CG  1 
ATOM   1695  S SD  . MET A  1 237 ? 35.42425  39.42481   8.83624   1.000 43.90775  ? 217  MET H SD  1 
ATOM   1696  C CE  . MET A  1 237 ? 35.83926  37.82532   9.54305   1.000 44.21098  ? 217  MET H CE  1 
ATOM   1697  N N   . GLU A  1 238 ? 40.04039  40.09193   5.76354   1.000 38.93051  ? 218  GLU H N   1 
ATOM   1698  C CA  . GLU A  1 238 ? 40.77903  40.43540   4.55428   1.000 43.39831  ? 218  GLU H CA  1 
ATOM   1699  C C   . GLU A  1 238 ? 40.95266  39.21745   3.65607   1.000 41.53204  ? 218  GLU H C   1 
ATOM   1700  O O   . GLU A  1 238 ? 40.88506  39.32725   2.42275   1.000 40.74265  ? 218  GLU H O   1 
ATOM   1701  C CB  . GLU A  1 238 ? 42.13819  41.02101   4.93390   1.000 48.70815  ? 218  GLU H CB  1 
ATOM   1702  N N   . ALA A  1 239 ? 41.18186  38.04685   4.25286   1.000 37.71822  ? 219  ALA H N   1 
ATOM   1703  C CA  . ALA A  1 239 ? 41.30866  36.85017   3.43072   1.000 38.61610  ? 219  ALA H CA  1 
ATOM   1704  C C   . ALA A  1 239 ? 39.97468  36.49466   2.78720   1.000 39.96193  ? 219  ALA H C   1 
ATOM   1705  O O   . ALA A  1 239 ? 39.95559  35.98402   1.66025   1.000 40.73047  ? 219  ALA H O   1 
ATOM   1706  C CB  . ALA A  1 239 ? 41.86285  35.68786   4.26196   1.000 34.97608  ? 219  ALA H CB  1 
ATOM   1707  N N   . LEU A  1 240 ? 38.85245  36.78999   3.46178   1.000 35.94040  ? 220  LEU H N   1 
ATOM   1708  C CA  . LEU A  1 240 ? 37.54228  36.52486   2.86489   1.000 34.23015  ? 220  LEU H CA  1 
ATOM   1709  C C   . LEU A  1 240 ? 37.25741  37.49216   1.72358   1.000 36.85278  ? 220  LEU H C   1 
ATOM   1710  O O   . LEU A  1 240 ? 36.73963  37.08935   0.67257   1.000 34.74332  ? 220  LEU H O   1 
ATOM   1711  C CB  . LEU A  1 240 ? 36.43653  36.58821   3.91463   1.000 32.79415  ? 220  LEU H CB  1 
ATOM   1712  C CG  . LEU A  1 240 ? 36.44083  35.50970   5.01050   1.000 29.37067  ? 220  LEU H CG  1 
ATOM   1713  C CD1 . LEU A  1 240 ? 35.41265  35.81204   6.11350   1.000 26.02808  ? 220  LEU H CD1 1 
ATOM   1714  C CD2 . LEU A  1 240 ? 36.24483  34.10964   4.40032   1.000 28.56330  ? 220  LEU H CD2 1 
ATOM   1715  N N   . ARG A  1 241 ? 37.61483  38.76526   1.89877   1.000 39.82074  ? 221  ARG H N   1 
ATOM   1716  C CA  . ARG A  1 241 ? 37.43743  39.72967   0.81970   1.000 40.05452  ? 221  ARG H CA  1 
ATOM   1717  C C   . ARG A  1 241 ? 38.28005  39.36721   -0.39654  1.000 40.67757  ? 221  ARG H C   1 
ATOM   1718  O O   . ARG A  1 241 ? 37.77907  39.41621   -1.52383  1.000 42.25913  ? 221  ARG H O   1 
ATOM   1719  C CB  . ARG A  1 241 ? 37.75439  41.13536   1.32573   1.000 39.36314  ? 221  ARG H CB  1 
ATOM   1720  C CG  . ARG A  1 241 ? 36.74103  41.58902   2.36339   1.000 38.84186  ? 221  ARG H CG  1 
ATOM   1721  C CD  . ARG A  1 241 ? 36.80972  43.05908   2.67991   1.000 43.31655  ? 221  ARG H CD  1 
ATOM   1722  N NE  . ARG A  1 241 ? 35.63697  43.49983   3.44150   1.000 46.85490  ? 221  ARG H NE  1 
ATOM   1723  C CZ  . ARG A  1 241 ? 35.63207  43.72242   4.75580   1.000 49.86807  ? 221  ARG H CZ  1 
ATOM   1724  N NH1 . ARG A  1 241 ? 36.74900  43.56447   5.46199   1.000 53.37355  ? 221  ARG H NH1 1 
ATOM   1725  N NH2 . ARG A  1 241 ? 34.52040  44.13232   5.36423   1.000 44.72885  ? 221  ARG H NH2 1 
ATOM   1726  N N   . ARG A  1 242 ? 39.55160  38.98374   -0.20010  1.000 43.01509  ? 222  ARG H N   1 
ATOM   1727  C CA  . ARG A  1 242 ? 40.34997  38.48777   -1.32827  1.000 43.91568  ? 222  ARG H CA  1 
ATOM   1728  C C   . ARG A  1 242 ? 39.61178  37.36511   -2.03206  1.000 41.66685  ? 222  ARG H C   1 
ATOM   1729  O O   . ARG A  1 242 ? 39.50888  37.33223   -3.26287  1.000 36.67822  ? 222  ARG H O   1 
ATOM   1730  C CB  . ARG A  1 242 ? 41.71916  37.94636   -0.88689  1.000 51.10064  ? 222  ARG H CB  1 
ATOM   1731  C CG  . ARG A  1 242 ? 42.63194  38.83459   -0.06073  1.000 58.87881  ? 222  ARG H CG  1 
ATOM   1732  C CD  . ARG A  1 242 ? 43.52252  37.95341   0.85351   1.000 64.97975  ? 222  ARG H CD  1 
ATOM   1733  N NE  . ARG A  1 242 ? 44.22194  38.70936   1.90244   1.000 69.44245  ? 222  ARG H NE  1 
ATOM   1734  C CZ  . ARG A  1 242 ? 45.02515  38.17052   2.82107   1.000 69.61458  ? 222  ARG H CZ  1 
ATOM   1735  N NH1 . ARG A  1 242 ? 45.61675  38.94816   3.72258   1.000 68.70776  ? 222  ARG H NH1 1 
ATOM   1736  N NH2 . ARG A  1 242 ? 45.23736  36.85686   2.84327   1.000 70.75086  ? 222  ARG H NH2 1 
ATOM   1737  N N   . ASP A  1 243 ? 39.09268  36.42578   -1.24201  1.000 35.14454  ? 223  ASP H N   1 
ATOM   1738  C CA  . ASP A  1 243 ? 38.49951  35.21965   -1.78762  1.000 37.69749  ? 223  ASP H CA  1 
ATOM   1739  C C   . ASP A  1 243 ? 37.22778  35.52734   -2.57041  1.000 37.15116  ? 223  ASP H C   1 
ATOM   1740  O O   . ASP A  1 243 ? 36.97110  34.90458   -3.60604  1.000 41.22712  ? 223  ASP H O   1 
ATOM   1741  C CB  . ASP A  1 243 ? 38.22523  34.24918   -0.63010  1.000 37.22034  ? 223  ASP H CB  1 
ATOM   1742  C CG  . ASP A  1 243 ? 37.56249  32.98649   -1.07526  1.000 38.39082  ? 223  ASP H CG  1 
ATOM   1743  O OD1 . ASP A  1 243 ? 36.33021  32.87448   -0.85992  1.000 38.43063  ? 223  ASP H OD1 1 
ATOM   1744  O OD2 . ASP A  1 243 ? 38.28147  32.12050   -1.62576  1.000 36.87190  ? 223  ASP H OD2 1 
ATOM   1745  N N   . ALA A  1 244 ? 36.41128  36.46741   -2.08248  1.000 34.71183  ? 224  ALA H N   1 
ATOM   1746  C CA  . ALA A  1 244 ? 35.17996  36.83008   -2.77077  1.000 36.36951  ? 224  ALA H CA  1 
ATOM   1747  C C   . ALA A  1 244 ? 35.45144  37.47424   -4.12255  1.000 45.89034  ? 224  ALA H C   1 
ATOM   1748  O O   . ALA A  1 244 ? 34.54251  37.55626   -4.95959  1.000 48.75105  ? 224  ALA H O   1 
ATOM   1749  C CB  . ALA A  1 244 ? 34.36771  37.78696   -1.90831  1.000 37.04264  ? 224  ALA H CB  1 
ATOM   1750  N N   . ALA A  1 245 ? 36.68211  37.92703   -4.34726  1.000 45.10236  ? 225  ALA H N   1 
ATOM   1751  C CA  . ALA A  1 245 ? 37.10327  38.50350   -5.61511  1.000 49.35459  ? 225  ALA H CA  1 
ATOM   1752  C C   . ALA A  1 245 ? 37.69196  37.45962   -6.57198  1.000 56.93147  ? 225  ALA H C   1 
ATOM   1753  O O   . ALA A  1 245 ? 37.43013  37.51549   -7.77712  1.000 62.78494  ? 225  ALA H O   1 
ATOM   1754  C CB  . ALA A  1 245 ? 38.10990  39.62622   -5.34355  1.000 44.45730  ? 225  ALA H CB  1 
ATOM   1755  N N   . ASP A  1 246 ? 38.46619  36.49018   -6.05885  1.000 54.43892  ? 226  ASP H N   1 
ATOM   1756  C CA  . ASP A  1 246 ? 39.14457  35.46699   -6.84437  1.000 51.81336  ? 226  ASP H CA  1 
ATOM   1757  C C   . ASP A  1 246 ? 38.15665  34.60404   -7.61918  1.000 51.79587  ? 226  ASP H C   1 
ATOM   1758  O O   . ASP A  1 246 ? 37.39744  33.83201   -7.02349  1.000 52.17400  ? 226  ASP H O   1 
ATOM   1759  C CB  . ASP A  1 246 ? 40.00585  34.59294   -5.93131  1.000 53.14250  ? 226  ASP H CB  1 
ATOM   1760  C CG  . ASP A  1 246 ? 40.96311  33.69127   -6.69640  1.000 58.01108  ? 226  ASP H CG  1 
ATOM   1761  O OD1 . ASP A  1 246 ? 40.77797  33.48257   -7.91434  1.000 60.49979  ? 226  ASP H OD1 1 
ATOM   1762  O OD2 . ASP A  1 246 ? 41.91768  33.18091   -6.07478  1.000 60.44409  ? 226  ASP H OD2 1 
ATOM   1763  N N   . PRO A  1 247 ? 38.15770  34.67795   -8.95235  1.000 51.19436  ? 227  PRO H N   1 
ATOM   1764  C CA  . PRO A  1 247 ? 37.25295  33.81600   -9.72762  1.000 48.09302  ? 227  PRO H CA  1 
ATOM   1765  C C   . PRO A  1 247 ? 37.69910  32.36746   -9.77492  1.000 46.85971  ? 227  PRO H C   1 
ATOM   1766  O O   . PRO A  1 247 ? 36.86441  31.49541   -10.04105 1.000 48.40306  ? 227  PRO H O   1 
ATOM   1767  C CB  . PRO A  1 247 ? 37.26663  34.44945   -11.12865 1.000 53.70903  ? 227  PRO H CB  1 
ATOM   1768  C CG  . PRO A  1 247 ? 38.11094  35.72692   -11.00719 1.000 55.90829  ? 227  PRO H CG  1 
ATOM   1769  C CD  . PRO A  1 247 ? 39.00001  35.50960   -9.82466  1.000 54.71095  ? 227  PRO H CD  1 
ATOM   1770  N N   . THR A  1 248 ? 38.98737  32.07591   -9.54696  1.000 44.71444  ? 228  THR H N   1 
ATOM   1771  C CA  . THR A  1 248 ? 39.44679  30.68595   -9.47053  1.000 43.91516  ? 228  THR H CA  1 
ATOM   1772  C C   . THR A  1 248 ? 39.03328  29.98799   -8.16620  1.000 45.82544  ? 228  THR H C   1 
ATOM   1773  O O   . THR A  1 248 ? 39.34174  28.79388   -8.00222  1.000 42.50019  ? 228  THR H O   1 
ATOM   1774  C CB  . THR A  1 248 ? 40.97769  30.60354   -9.61528  1.000 46.88721  ? 228  THR H CB  1 
ATOM   1775  O OG1 . THR A  1 248 ? 41.61134  31.18754   -8.46340  1.000 52.36350  ? 228  THR H OG1 1 
ATOM   1776  C CG2 . THR A  1 248 ? 41.48009  31.32064   -10.88720 1.000 45.41093  ? 228  THR H CG2 1 
ATOM   1777  N N   . SER A  1 249 ? 38.35094  30.68391   -7.24681  1.000 47.68431  ? 229  SER H N   1 
ATOM   1778  C CA  . SER A  1 249 ? 38.05642  30.13734   -5.92319  1.000 44.57832  ? 229  SER H CA  1 
ATOM   1779  C C   . SER A  1 249 ? 36.70316  29.43507   -5.89188  1.000 41.99474  ? 229  SER H C   1 
ATOM   1780  O O   . SER A  1 249 ? 35.69063  29.99074   -6.33638  1.000 42.64257  ? 229  SER H O   1 
ATOM   1781  C CB  . SER A  1 249 ? 38.07366  31.23131   -4.85072  1.000 45.96235  ? 229  SER H CB  1 
ATOM   1782  O OG  . SER A  1 249 ? 37.43400  30.76456   -3.65749  1.000 43.08506  ? 229  SER H OG  1 
ATOM   1783  N N   . SER A  1 250 ? 36.68001  28.23056   -5.32616  1.000 38.66170  ? 230  SER H N   1 
ATOM   1784  C CA  . SER A  1 250 ? 35.41294  27.56814   -5.04941  1.000 38.00081  ? 230  SER H CA  1 
ATOM   1785  C C   . SER A  1 250 ? 34.76855  28.04419   -3.73942  1.000 39.36129  ? 230  SER H C   1 
ATOM   1786  O O   . SER A  1 250 ? 33.79153  27.42649   -3.29279  1.000 36.12190  ? 230  SER H O   1 
ATOM   1787  C CB  . SER A  1 250 ? 35.62271  26.05609   -5.00866  1.000 44.90476  ? 230  SER H CB  1 
ATOM   1788  O OG  . SER A  1 250 ? 36.59540  25.71346   -4.03292  1.000 48.77693  ? 230  SER H OG  1 
ATOM   1789  N N   . ARG A  1 251 ? 35.30088  29.11136   -3.12535  1.000 39.81478  ? 231  ARG H N   1 
ATOM   1790  C CA  . ARG A  1 251 ? 34.70035  29.75779   -1.94500  1.000 41.21885  ? 231  ARG H CA  1 
ATOM   1791  C C   . ARG A  1 251 ? 34.60035  28.80433   -0.74958  1.000 38.81737  ? 231  ARG H C   1 
ATOM   1792  O O   . ARG A  1 251 ? 33.60284  28.78393   -0.02513  1.000 35.25922  ? 231  ARG H O   1 
ATOM   1793  C CB  . ARG A  1 251 ? 33.32872  30.35135   -2.28537  1.000 42.65203  ? 231  ARG H CB  1 
ATOM   1794  C CG  . ARG A  1 251 ? 33.32222  31.11348   -3.61713  1.000 42.45405  ? 231  ARG H CG  1 
ATOM   1795  C CD  . ARG A  1 251 ? 34.20343  32.37384   -3.54703  1.000 41.35334  ? 231  ARG H CD  1 
ATOM   1796  N NE  . ARG A  1 251 ? 33.90606  33.23715   -2.39277  1.000 38.01124  ? 231  ARG H NE  1 
ATOM   1797  C CZ  . ARG A  1 251 ? 32.81251  33.98391   -2.23097  1.000 38.64512  ? 231  ARG H CZ  1 
ATOM   1798  N NH1 . ARG A  1 251 ? 31.84186  33.98353   -3.14024  1.000 38.47182  ? 231  ARG H NH1 1 
ATOM   1799  N NH2 . ARG A  1 251 ? 32.67164  34.70750   -1.12043  1.000 37.64733  ? 231  ARG H NH2 1 
ATOM   1800  N N   . ASP A  1 252 ? 35.67088  28.05602   -0.50940  1.000 37.25733  ? 232  ASP H N   1 
ATOM   1801  C CA  . ASP A  1 252 ? 35.69805  27.00419   0.48871   1.000 40.14137  ? 232  ASP H CA  1 
ATOM   1802  C C   . ASP A  1 252 ? 36.89499  27.22119   1.39908   1.000 37.94399  ? 232  ASP H C   1 
ATOM   1803  O O   . ASP A  1 252 ? 38.00285  27.47253   0.91725   1.000 30.87485  ? 232  ASP H O   1 
ATOM   1804  C CB  . ASP A  1 252 ? 35.78412  25.62504   -0.18753  1.000 45.24296  ? 232  ASP H CB  1 
ATOM   1805  C CG  . ASP A  1 252 ? 35.27851  24.52044   0.70235   1.000 47.47203  ? 232  ASP H CG  1 
ATOM   1806  O OD1 . ASP A  1 252 ? 34.05871  24.53380   1.01164   1.000 45.68659  ? 232  ASP H OD1 1 
ATOM   1807  O OD2 . ASP A  1 252 ? 36.11066  23.66834   1.10454   1.000 46.14839  ? 232  ASP H OD2 1 
ATOM   1808  N N   . PHE A  1 253 ? 36.68392  27.10764   2.71234   1.000 38.39503  ? 233  PHE H N   1 
ATOM   1809  C CA  . PHE A  1 253 ? 37.81660  27.19571   3.63075   1.000 35.44424  ? 233  PHE H CA  1 
ATOM   1810  C C   . PHE A  1 253 ? 38.86165  26.13850   3.30082   1.000 32.78943  ? 233  PHE H C   1 
ATOM   1811  O O   . PHE A  1 253 ? 40.05258  26.43816   3.17535   1.000 33.42959  ? 233  PHE H O   1 
ATOM   1812  C CB  . PHE A  1 253 ? 37.33222  27.03721   5.07423   1.000 35.40003  ? 233  PHE H CB  1 
ATOM   1813  C CG  . PHE A  1 253 ? 36.99177  28.32895   5.74182   1.000 33.77774  ? 233  PHE H CG  1 
ATOM   1814  C CD1 . PHE A  1 253 ? 37.98875  29.12433   6.29027   1.000 34.19025  ? 233  PHE H CD1 1 
ATOM   1815  C CD2 . PHE A  1 253 ? 35.67354  28.76632   5.79806   1.000 31.33763  ? 233  PHE H CD2 1 
ATOM   1816  C CE1 . PHE A  1 253 ? 37.67183  30.32561   6.90259   1.000 29.88504  ? 233  PHE H CE1 1 
ATOM   1817  C CE2 . PHE A  1 253 ? 35.34890  29.97418   6.40781   1.000 26.49298  ? 233  PHE H CE2 1 
ATOM   1818  C CZ  . PHE A  1 253 ? 36.34769  30.74407   6.96596   1.000 24.83441  ? 233  PHE H CZ  1 
ATOM   1819  N N   . GLY A  1 254 ? 38.42305  24.89070   3.12548   1.000 34.89070  ? 234  GLY H N   1 
ATOM   1820  C CA  . GLY A  1 254 ? 39.37159  23.80713   2.93030   1.000 38.35214  ? 234  GLY H CA  1 
ATOM   1821  C C   . GLY A  1 254 ? 40.14876  23.91851   1.63332   1.000 41.31760  ? 234  GLY H C   1 
ATOM   1822  O O   . GLY A  1 254 ? 41.36664  23.71786   1.60759   1.000 43.68715  ? 234  GLY H O   1 
ATOM   1823  N N   . LYS A  1 255 ? 39.46507  24.24813   0.54426   1.000 41.12335  ? 235  LYS H N   1 
ATOM   1824  C CA  . LYS A  1 255 ? 40.08349  24.16314   -0.77116  1.000 46.09652  ? 235  LYS H CA  1 
ATOM   1825  C C   . LYS A  1 255 ? 40.66806  25.48735   -1.26188  1.000 45.53205  ? 235  LYS H C   1 
ATOM   1826  O O   . LYS A  1 255 ? 41.49614  25.47434   -2.17643  1.000 50.77263  ? 235  LYS H O   1 
ATOM   1827  C CB  . LYS A  1 255 ? 39.06388  23.60913   -1.78261  1.000 50.60458  ? 235  LYS H CB  1 
ATOM   1828  C CG  . LYS A  1 255 ? 38.73014  22.10819   -1.57489  1.000 54.49784  ? 235  LYS H CG  1 
ATOM   1829  C CD  . LYS A  1 255 ? 39.33450  21.20650   -2.68687  1.000 61.18563  ? 235  LYS H CD  1 
ATOM   1830  C CE  . LYS A  1 255 ? 40.84769  21.47023   -2.89490  1.000 64.33268  ? 235  LYS H CE  1 
ATOM   1831  N NZ  . LYS A  1 255 ? 41.49836  20.70409   -3.99731  1.000 64.38072  ? 235  LYS H NZ  1 
ATOM   1832  N N   . ASP A  1 256 ? 40.30496  26.62029   -0.65486  1.000 40.60909  ? 236  ASP H N   1 
ATOM   1833  C CA  . ASP A  1 256 ? 40.75462  27.92832   -1.12704  1.000 42.23155  ? 236  ASP H CA  1 
ATOM   1834  C C   . ASP A  1 256 ? 41.48443  28.71250   -0.04598  1.000 42.62704  ? 236  ASP H C   1 
ATOM   1835  O O   . ASP A  1 256 ? 42.64491  29.07878   -0.24090  1.000 40.65627  ? 236  ASP H O   1 
ATOM   1836  C CB  . ASP A  1 256 ? 39.55936  28.73714   -1.65116  1.000 44.95659  ? 236  ASP H CB  1 
ATOM   1837  C CG  . ASP A  1 256 ? 38.76554  27.99186   -2.71679  1.000 50.25406  ? 236  ASP H CG  1 
ATOM   1838  O OD1 . ASP A  1 256 ? 37.67724  27.47492   -2.37685  1.000 47.52598  ? 236  ASP H OD1 1 
ATOM   1839  O OD2 . ASP A  1 256 ? 39.22193  27.93021   -3.88775  1.000 54.18663  ? 236  ASP H OD2 1 
ATOM   1840  N N   . ILE A  1 257 ? 40.84288  28.96604   1.09936   1.000 42.06332  ? 237  ILE H N   1 
ATOM   1841  C CA  . ILE A  1 257 ? 41.39056  29.91186   2.06977   1.000 37.19954  ? 237  ILE H CA  1 
ATOM   1842  C C   . ILE A  1 257 ? 42.69516  29.39188   2.64425   1.000 34.80896  ? 237  ILE H C   1 
ATOM   1843  O O   . ILE A  1 257 ? 43.70873  30.10443   2.68650   1.000 33.72167  ? 237  ILE H O   1 
ATOM   1844  C CB  . ILE A  1 257 ? 40.37952  30.18243   3.19683   1.000 32.84644  ? 237  ILE H CB  1 
ATOM   1845  C CG1 . ILE A  1 257 ? 39.00822  30.56952   2.63606   1.000 34.49768  ? 237  ILE H CG1 1 
ATOM   1846  C CG2 . ILE A  1 257 ? 40.93327  31.26082   4.11586   1.000 30.83916  ? 237  ILE H CG2 1 
ATOM   1847  C CD1 . ILE A  1 257 ? 39.00822  31.91276   1.92070   1.000 41.00430  ? 237  ILE H CD1 1 
ATOM   1848  N N   . ILE A  1 258 ? 42.66500  28.16430   3.15858   1.000 32.37686  ? 238  ILE H N   1 
ATOM   1849  C CA  . ILE A  1 258 ? 43.78471  27.56829   3.87961   1.000 34.44643  ? 238  ILE H CA  1 
ATOM   1850  C C   . ILE A  1 258 ? 44.93006  27.30039   2.90822   1.000 40.69256  ? 238  ILE H C   1 
ATOM   1851  O O   . ILE A  1 258 ? 46.08421  27.65461   3.21594   1.000 42.78937  ? 238  ILE H O   1 
ATOM   1852  C CB  . ILE A  1 258 ? 43.35449  26.29860   4.63292   1.000 32.74063  ? 238  ILE H CB  1 
ATOM   1853  C CG1 . ILE A  1 258 ? 42.99323  26.66501   6.07486   1.000 35.39790  ? 238  ILE H CG1 1 
ATOM   1854  C CG2 . ILE A  1 258 ? 44.49177  25.30179   4.67661   1.000 33.17499  ? 238  ILE H CG2 1 
ATOM   1855  C CD1 . ILE A  1 258 ? 41.76271  27.58123   6.22393   1.000 35.51125  ? 238  ILE H CD1 1 
ATOM   1856  N N   . PRO A  1 259 ? 44.68347  26.70500   1.72903   1.000 40.62718  ? 239  PRO H N   1 
ATOM   1857  C CA  . PRO A  1 259 ? 45.79982  26.52536   0.79151   1.000 38.78300  ? 239  PRO H CA  1 
ATOM   1858  C C   . PRO A  1 259 ? 46.49983  27.82606   0.43274   1.000 40.51011  ? 239  PRO H C   1 
ATOM   1859  O O   . PRO A  1 259 ? 47.73954  27.85978   0.36551   1.000 40.53188  ? 239  PRO H O   1 
ATOM   1860  C CB  . PRO A  1 259 ? 45.12437  25.87223   -0.42542  1.000 40.28895  ? 239  PRO H CB  1 
ATOM   1861  C CG  . PRO A  1 259 ? 43.94378  25.16936   0.12806   1.000 41.66739  ? 239  PRO H CG  1 
ATOM   1862  C CD  . PRO A  1 259 ? 43.44313  26.10291   1.19527   1.000 40.16212  ? 239  PRO H CD  1 
ATOM   1863  N N   . TYR A  1 260 ? 45.74714  28.90884   0.21039   1.000 36.41394  ? 240  TYR H N   1 
ATOM   1864  C CA  . TYR A  1 260 ? 46.39109  30.17894   -0.11107  1.000 37.67113  ? 240  TYR H CA  1 
ATOM   1865  C C   . TYR A  1 260 ? 47.31567  30.62318   1.01947   1.000 39.55577  ? 240  TYR H C   1 
ATOM   1866  O O   . TYR A  1 260 ? 48.41726  31.12360   0.76599   1.000 39.72465  ? 240  TYR H O   1 
ATOM   1867  C CB  . TYR A  1 260 ? 45.32801  31.23833   -0.42254  1.000 43.68628  ? 240  TYR H CB  1 
ATOM   1868  C CG  . TYR A  1 260 ? 45.86639  32.59816   -0.85073  1.000 52.32998  ? 240  TYR H CG  1 
ATOM   1869  C CD1 . TYR A  1 260 ? 46.08432  33.60896   0.08243   1.000 56.31851  ? 240  TYR H CD1 1 
ATOM   1870  C CD2 . TYR A  1 260 ? 46.15384  32.87424   -2.19400  1.000 57.99227  ? 240  TYR H CD2 1 
ATOM   1871  C CE1 . TYR A  1 260 ? 46.57081  34.85067   -0.29727  1.000 58.98438  ? 240  TYR H CE1 1 
ATOM   1872  C CE2 . TYR A  1 260 ? 46.64946  34.11720   -2.58825  1.000 58.60644  ? 240  TYR H CE2 1 
ATOM   1873  C CZ  . TYR A  1 260 ? 46.85027  35.10112   -1.63036  1.000 60.84800  ? 240  TYR H CZ  1 
ATOM   1874  O OH  . TYR A  1 260 ? 47.32936  36.34200   -1.98804  1.000 62.93986  ? 240  TYR H OH  1 
ATOM   1875  N N   . ILE A  1 261 ? 46.89753  30.41454   2.27856   1.000 38.22870  ? 241  ILE H N   1 
ATOM   1876  C CA  . ILE A  1 261 ? 47.71468  30.81348   3.42827   1.000 37.59820  ? 241  ILE H CA  1 
ATOM   1877  C C   . ILE A  1 261 ? 48.93277  29.90262   3.58140   1.000 37.56230  ? 241  ILE H C   1 
ATOM   1878  O O   . ILE A  1 261 ? 50.03111  30.37444   3.91302   1.000 40.15274  ? 241  ILE H O   1 
ATOM   1879  C CB  . ILE A  1 261 ? 46.86396  30.83117   4.72287   1.000 37.26384  ? 241  ILE H CB  1 
ATOM   1880  C CG1 . ILE A  1 261 ? 45.67989  31.80027   4.59747   1.000 34.24299  ? 241  ILE H CG1 1 
ATOM   1881  C CG2 . ILE A  1 261 ? 47.71482  31.22059   5.94635   1.000 31.45495  ? 241  ILE H CG2 1 
ATOM   1882  C CD1 . ILE A  1 261 ? 44.63142  31.59577   5.70314   1.000 29.90653  ? 241  ILE H CD1 1 
ATOM   1883  N N   . VAL A  1 262 ? 48.75304  28.58197   3.42529   1.000 42.03715  ? 242  VAL H N   1 
ATOM   1884  C CA  . VAL A  1 262 ? 49.89777  27.68841   3.58709   1.000 48.79461  ? 242  VAL H CA  1 
ATOM   1885  C C   . VAL A  1 262 ? 50.91597  28.00209   2.50870   1.000 59.64347  ? 242  VAL H C   1 
ATOM   1886  O O   . VAL A  1 262 ? 52.12191  27.80030   2.69939   1.000 72.77128  ? 242  VAL H O   1 
ATOM   1887  C CB  . VAL A  1 262 ? 49.49948  26.18963   3.56384   1.000 45.41002  ? 242  VAL H CB  1 
ATOM   1888  C CG1 . VAL A  1 262 ? 48.39113  25.86716   4.53927   1.000 42.98753  ? 242  VAL H CG1 1 
ATOM   1889  C CG2 . VAL A  1 262 ? 49.06540  25.77243   2.20412   1.000 44.35472  ? 242  VAL H CG2 1 
ATOM   1890  N N   . GLU A  1 263 ? 50.44893  28.54881   1.38243   1.000 60.50227  ? 243  GLU H N   1 
ATOM   1891  C CA  . GLU A  1 263 ? 51.34160  28.96721   0.31097   1.000 63.60383  ? 243  GLU H CA  1 
ATOM   1892  C C   . GLU A  1 263 ? 52.09567  30.23792   0.69838   1.000 62.45057  ? 243  GLU H C   1 
ATOM   1893  O O   . GLU A  1 263 ? 53.32608  30.23298   0.81266   1.000 65.10256  ? 243  GLU H O   1 
ATOM   1894  C CB  . GLU A  1 263 ? 50.54205  29.16734   -0.98031  1.000 67.88788  ? 243  GLU H CB  1 
ATOM   1895  C CG  . GLU A  1 263 ? 51.33802  28.88541   -2.25424  1.000 76.46246  ? 243  GLU H CG  1 
ATOM   1896  C CD  . GLU A  1 263 ? 50.93664  29.78168   -3.41213  1.000 81.08709  ? 243  GLU H CD  1 
ATOM   1897  O OE1 . GLU A  1 263 ? 49.74694  30.15966   -3.50078  1.000 81.42312  ? 243  GLU H OE1 1 
ATOM   1898  O OE2 . GLU A  1 263 ? 51.81529  30.11413   -4.23167  1.000 85.29583  ? 243  GLU H OE2 1 
ATOM   1899  N N   . HIS A  1 264 ? 51.36352  31.32910   0.94294   1.000 57.93550  ? 244  HIS H N   1 
ATOM   1900  C CA  . HIS A  1 264 ? 51.94939  32.66090   1.07057   1.000 53.79325  ? 244  HIS H CA  1 
ATOM   1901  C C   . HIS A  1 264 ? 52.11405  33.14588   2.50593   1.000 50.63907  ? 244  HIS H C   1 
ATOM   1902  O O   . HIS A  1 264 ? 52.83516  34.12787   2.72491   1.000 46.80014  ? 244  HIS H O   1 
ATOM   1903  C CB  . HIS A  1 264 ? 51.10472  33.68344   0.30200   1.000 57.09460  ? 244  HIS H CB  1 
ATOM   1904  C CG  . HIS A  1 264 ? 50.95380  33.36812   -1.15430  1.000 63.17134  ? 244  HIS H CG  1 
ATOM   1905  N ND1 . HIS A  1 264 ? 49.72399  33.23937   -1.76596  1.000 64.11205  ? 244  HIS H ND1 1 
ATOM   1906  C CD2 . HIS A  1 264 ? 51.87833  33.15065   -2.11819  1.000 64.05926  ? 244  HIS H CD2 1 
ATOM   1907  C CE1 . HIS A  1 264 ? 49.89933  32.96860   -3.04674  1.000 64.49730  ? 244  HIS H CE1 1 
ATOM   1908  N NE2 . HIS A  1 264 ? 51.19652  32.90352   -3.28426  1.000 64.93945  ? 244  HIS H NE2 1 
ATOM   1909  N N   . GLY A  1 265 ? 51.44597  32.52509   3.47921   1.000 47.82206  ? 245  GLY H N   1 
ATOM   1910  C CA  . GLY A  1 265 ? 51.61419  32.94389   4.85760   1.000 50.54152  ? 245  GLY H CA  1 
ATOM   1911  C C   . GLY A  1 265 ? 52.10505  31.84674   5.78493   1.000 50.90779  ? 245  GLY H C   1 
ATOM   1912  O O   . GLY A  1 265 ? 52.89385  30.98382   5.37675   1.000 49.62163  ? 245  GLY H O   1 
ATOM   1913  N N   . LYS A  1 266 ? 51.63617  31.86149   7.03708   1.000 46.01937  ? 246  LYS H N   1 
ATOM   1914  C CA  . LYS A  1 266 ? 52.08158  30.90991   8.04859   1.000 42.90452  ? 246  LYS H CA  1 
ATOM   1915  C C   . LYS A  1 266 ? 50.88056  30.14974   8.60012   1.000 41.48746  ? 246  LYS H C   1 
ATOM   1916  O O   . LYS A  1 266 ? 50.09923  30.70489   9.37814   1.000 30.99138  ? 246  LYS H O   1 
ATOM   1917  C CB  . LYS A  1 266 ? 52.83090  31.59964   9.18606   1.000 41.74740  ? 246  LYS H CB  1 
ATOM   1918  C CG  . LYS A  1 266 ? 53.39871  30.56112   10.13497  1.000 47.01625  ? 246  LYS H CG  1 
ATOM   1919  C CD  . LYS A  1 266 ? 54.15782  31.12992   11.30262  1.000 51.94064  ? 246  LYS H CD  1 
ATOM   1920  C CE  . LYS A  1 266 ? 54.86666  29.99711   12.04560  1.000 54.97996  ? 246  LYS H CE  1 
ATOM   1921  N NZ  . LYS A  1 266 ? 55.58143  30.50368   13.24633  1.000 55.94620  ? 246  LYS H NZ  1 
ATOM   1922  N N   . ALA A  1 267 ? 50.75672  28.87916   8.21961   1.000 39.88016  ? 247  ALA H N   1 
ATOM   1923  C CA  . ALA A  1 267 ? 49.73294  27.98059   8.74197   1.000 35.84023  ? 247  ALA H CA  1 
ATOM   1924  C C   . ALA A  1 267 ? 50.35650  26.96946   9.70153   1.000 37.08170  ? 247  ALA H C   1 
ATOM   1925  O O   . ALA A  1 267 ? 51.40202  26.38212   9.41150   1.000 33.83765  ? 247  ALA H O   1 
ATOM   1926  C CB  . ALA A  1 267 ? 49.01455  27.25719   7.59897   1.000 32.69640  ? 247  ALA H CB  1 
ATOM   1927  N N   . VAL A  1 268 ? 49.69758  26.73501   10.83896  1.000 36.04011  ? 248  VAL H N   1 
ATOM   1928  C CA  . VAL A  1 268 ? 50.24840  25.89783   11.89751  1.000 30.05777  ? 248  VAL H CA  1 
ATOM   1929  C C   . VAL A  1 268 ? 49.18107  24.90178   12.34167  1.000 32.59280  ? 248  VAL H C   1 
ATOM   1930  O O   . VAL A  1 268 ? 48.00688  25.26285   12.48615  1.000 30.71918  ? 248  VAL H O   1 
ATOM   1931  C CB  . VAL A  1 268 ? 50.75156  26.75549   13.08084  1.000 29.15283  ? 248  VAL H CB  1 
ATOM   1932  C CG1 . VAL A  1 268 ? 51.32770  25.88375   14.16296  1.000 33.83712  ? 248  VAL H CG1 1 
ATOM   1933  C CG2 . VAL A  1 268 ? 51.83840  27.76225   12.60409  1.000 33.22102  ? 248  VAL H CG2 1 
ATOM   1934  N N   . ALA A  1 269 ? 49.59117  23.64522   12.53281  1.000 34.37391  ? 249  ALA H N   1 
ATOM   1935  C CA  . ALA A  1 269 ? 48.68571  22.56907   12.91354  1.000 35.34569  ? 249  ALA H CA  1 
ATOM   1936  C C   . ALA A  1 269 ? 48.63139  22.42007   14.42599  1.000 31.76330  ? 249  ALA H C   1 
ATOM   1937  O O   . ALA A  1 269 ? 49.66250  22.46519   15.11075  1.000 29.22427  ? 249  ALA H O   1 
ATOM   1938  C CB  . ALA A  1 269 ? 49.11337  21.24901   12.26977  1.000 34.25836  ? 249  ALA H CB  1 
ATOM   1939  N N   . HIS A  1 270 ? 47.40462  22.29001   14.94076  1.000 30.74236  ? 250  HIS H N   1 
ATOM   1940  C CA  . HIS A  1 270 ? 47.12470  21.97028   16.33165  1.000 29.03565  ? 250  HIS H CA  1 
ATOM   1941  C C   . HIS A  1 270 ? 46.53372  20.56342   16.40868  1.000 27.55155  ? 250  HIS H C   1 
ATOM   1942  O O   . HIS A  1 270 ? 45.56692  20.24738   15.70297  1.000 29.73992  ? 250  HIS H O   1 
ATOM   1943  C CB  . HIS A  1 270 ? 46.13017  22.96289   16.94408  1.000 29.90229  ? 250  HIS H CB  1 
ATOM   1944  C CG  . HIS A  1 270 ? 45.69106  22.58847   18.33004  1.000 27.85560  ? 250  HIS H CG  1 
ATOM   1945  N ND1 . HIS A  1 270 ? 46.40313  22.94727   19.45074  1.000 26.61309  ? 250  HIS H ND1 1 
ATOM   1946  C CD2 . HIS A  1 270 ? 44.62291  21.87815   18.77704  1.000 27.15214  ? 250  HIS H CD2 1 
ATOM   1947  C CE1 . HIS A  1 270 ? 45.80139  22.47481   20.52630  1.000 28.60739  ? 250  HIS H CE1 1 
ATOM   1948  N NE2 . HIS A  1 270 ? 44.70932  21.83768   20.14514  1.000 26.91856  ? 250  HIS H NE2 1 
ATOM   1949  N N   . ARG A  1 271 ? 47.09998  19.73017   17.26489  1.000 24.95203  ? 251  ARG H N   1 
ATOM   1950  C CA  . ARG A  1 271 ? 46.68869  18.34343   17.34059  1.000 23.61289  ? 251  ARG H CA  1 
ATOM   1951  C C   . ARG A  1 271 ? 45.52718  18.18418   18.32499  1.000 22.41897  ? 251  ARG H C   1 
ATOM   1952  O O   . ARG A  1 271 ? 45.56141  18.71150   19.44546  1.000 25.45108  ? 251  ARG H O   1 
ATOM   1953  C CB  . ARG A  1 271 ? 47.86075  17.44760   17.73962  1.000 24.37098  ? 251  ARG H CB  1 
ATOM   1954  C CG  . ARG A  1 271 ? 49.17809  17.76131   17.02774  1.000 26.75505  ? 251  ARG H CG  1 
ATOM   1955  C CD  . ARG A  1 271 ? 49.98991  16.53241   16.77025  1.000 29.33689  ? 251  ARG H CD  1 
ATOM   1956  N NE  . ARG A  1 271 ? 51.18733  16.86544   16.00573  1.000 33.71858  ? 251  ARG H NE  1 
ATOM   1957  C CZ  . ARG A  1 271 ? 52.22650  16.05351   15.86295  1.000 36.31598  ? 251  ARG H CZ  1 
ATOM   1958  N NH1 . ARG A  1 271 ? 52.20496  14.83802   16.42176  1.000 35.79189  ? 251  ARG H NH1 1 
ATOM   1959  N NH2 . ARG A  1 271 ? 53.27561  16.44822   15.14997  1.000 33.00531  ? 251  ARG H NH2 1 
ATOM   1960  N N   . PHE A  1 272 ? 44.51075  17.45015   17.89129  1.000 25.21516  ? 252  PHE H N   1 
ATOM   1961  C CA  . PHE A  1 272 ? 43.34059  17.15361   18.72703  1.000 24.06232  ? 252  PHE H CA  1 
ATOM   1962  C C   . PHE A  1 272 ? 43.72304  16.64408   20.11119  1.000 22.86208  ? 252  PHE H C   1 
ATOM   1963  O O   . PHE A  1 272 ? 43.18606  17.11098   21.12197  1.000 23.00002  ? 252  PHE H O   1 
ATOM   1964  C CB  . PHE A  1 272 ? 42.46577  16.12431   18.01171  1.000 25.90513  ? 252  PHE H CB  1 
ATOM   1965  C CG  . PHE A  1 272 ? 41.13599  15.86704   18.68348  1.000 23.94818  ? 252  PHE H CG  1 
ATOM   1966  C CD1 . PHE A  1 272 ? 40.41849  16.90266   19.27455  1.000 20.63652  ? 252  PHE H CD1 1 
ATOM   1967  C CD2 . PHE A  1 272 ? 40.59892  14.58122   18.71066  1.000 24.49939  ? 252  PHE H CD2 1 
ATOM   1968  C CE1 . PHE A  1 272 ? 39.17814  16.64804   19.87266  1.000 18.29887  ? 252  PHE H CE1 1 
ATOM   1969  C CE2 . PHE A  1 272 ? 39.36347  14.32524   19.31717  1.000 21.10788  ? 252  PHE H CE2 1 
ATOM   1970  C CZ  . PHE A  1 272 ? 38.66001  15.36994   19.89840  1.000 18.29685  ? 252  PHE H CZ  1 
ATOM   1971  N N   . ALA A  1 273 ? 44.63959  15.66995   20.18157  1.000 25.48891  ? 253  ALA H N   1 
ATOM   1972  C CA  . ALA A  1 273 ? 44.98677  15.07589   21.47476  1.000 28.90675  ? 253  ALA H CA  1 
ATOM   1973  C C   . ALA A  1 273 ? 45.48438  16.10728   22.48161  1.000 33.21935  ? 253  ALA H C   1 
ATOM   1974  O O   . ALA A  1 273 ? 45.41945  15.86011   23.69737  1.000 30.61572  ? 253  ALA H O   1 
ATOM   1975  C CB  . ALA A  1 273 ? 46.05484  13.99676   21.30498  1.000 30.65635  ? 253  ALA H CB  1 
ATOM   1976  N N   . ASP A  1 274 ? 45.98068  17.25470   22.00068  1.000 31.15412  ? 254  ASP H N   1 
ATOM   1977  C CA  . ASP A  1 274 ? 46.49985  18.28428   22.89517  1.000 28.46663  ? 254  ASP H CA  1 
ATOM   1978  C C   . ASP A  1 274 ? 45.38972  18.99402   23.65913  1.000 27.88864  ? 254  ASP H C   1 
ATOM   1979  O O   . ASP A  1 274 ? 45.62663  19.49502   24.77176  1.000 30.11937  ? 254  ASP H O   1 
ATOM   1980  C CB  . ASP A  1 274 ? 47.32356  19.29346   22.09016  1.000 32.21355  ? 254  ASP H CB  1 
ATOM   1981  C CG  . ASP A  1 274 ? 48.69808  18.75134   21.73311  1.000 38.41675  ? 254  ASP H CG  1 
ATOM   1982  O OD1 . ASP A  1 274 ? 49.14079  17.84445   22.46604  1.000 43.66394  ? 254  ASP H OD1 1 
ATOM   1983  O OD2 . ASP A  1 274 ? 49.33096  19.20408   20.74358  1.000 38.71872  ? 254  ASP H OD2 1 
ATOM   1984  N N   . SER A  1 275 ? 44.18312  19.06978   23.08362  1.000 23.21955  ? 255  SER H N   1 
ATOM   1985  C CA  . SER A  1 275 ? 43.09447  19.82873   23.70550  1.000 23.82466  ? 255  SER H CA  1 
ATOM   1986  C C   . SER A  1 275 ? 41.76801  19.08063   23.74530  1.000 22.11858  ? 255  SER H C   1 
ATOM   1987  O O   . SER A  1 275 ? 40.76193  19.65200   24.19752  1.000 22.70587  ? 255  SER H O   1 
ATOM   1988  C CB  . SER A  1 275 ? 42.90227  21.17453   22.98042  1.000 23.46097  ? 255  SER H CB  1 
ATOM   1989  O OG  . SER A  1 275 ? 42.56196  20.94841   21.61695  1.000 23.21354  ? 255  SER H OG  1 
ATOM   1990  N N   . CYS A  1 276 ? 41.73822  17.81693   23.33874  1.000 25.28276  ? 256  CYS H N   1 
ATOM   1991  C CA  . CYS A  1 276 ? 40.53474  17.02174   23.53952  1.000 25.19462  ? 256  CYS H CA  1 
ATOM   1992  C C   . CYS A  1 276 ? 40.20558  16.96267   25.02893  1.000 26.51294  ? 256  CYS H C   1 
ATOM   1993  O O   . CYS A  1 276 ? 41.09415  16.90869   25.88473  1.000 25.12295  ? 256  CYS H O   1 
ATOM   1994  C CB  . CYS A  1 276 ? 40.72112  15.61622   22.95539  1.000 27.28658  ? 256  CYS H CB  1 
ATOM   1995  S SG  . CYS A  1 276 ? 39.31651  14.46413   23.36429  1.000 30.45617  ? 256  CYS H SG  1 
ATOM   1996  N N   . VAL A  1 277 ? 38.92285  17.07036   25.35560  1.000 21.79520  ? 257  VAL H N   1 
ATOM   1997  C CA  . VAL A  1 277 ? 38.48090  16.95285   26.73379  1.000 22.84940  ? 257  VAL H CA  1 
ATOM   1998  C C   . VAL A  1 277 ? 38.00663  15.51808   26.91008  1.000 27.00365  ? 257  VAL H C   1 
ATOM   1999  O O   . VAL A  1 277 ? 36.97683  15.13918   26.35235  1.000 28.90284  ? 257  VAL H O   1 
ATOM   2000  C CB  . VAL A  1 277 ? 37.37636  17.96011   27.06626  1.000 25.18749  ? 257  VAL H CB  1 
ATOM   2001  C CG1 . VAL A  1 277 ? 36.98625  17.83633   28.52495  1.000 26.35894  ? 257  VAL H CG1 1 
ATOM   2002  C CG2 . VAL A  1 277 ? 37.89540  19.36551   26.82961  1.000 24.41776  ? 257  VAL H CG2 1 
ATOM   2003  N N   . ARG A  1 278 ? 38.76718  14.70764   27.65037  1.000 29.21842  ? 258  ARG H N   1 
ATOM   2004  C CA  . ARG A  1 278 ? 38.44427  13.29643   27.87704  1.000 31.54869  ? 258  ARG H CA  1 
ATOM   2005  C C   . ARG A  1 278 ? 37.88578  13.12534   29.27889  1.000 33.61918  ? 258  ARG H C   1 
ATOM   2006  O O   . ARG A  1 278 ? 38.49589  13.60191   30.24219  1.000 33.04890  ? 258  ARG H O   1 
ATOM   2007  C CB  . ARG A  1 278 ? 39.68449  12.41130   27.74900  1.000 34.30698  ? 258  ARG H CB  1 
ATOM   2008  C CG  . ARG A  1 278 ? 40.16521  12.13709   26.36199  1.000 40.65993  ? 258  ARG H CG  1 
ATOM   2009  C CD  . ARG A  1 278 ? 41.26549  11.06552   26.38291  1.000 44.98224  ? 258  ARG H CD  1 
ATOM   2010  N NE  . ARG A  1 278 ? 41.06386  10.13669   27.48459  1.000 50.75996  ? 258  ARG H NE  1 
ATOM   2011  C CZ  . ARG A  1 278 ? 42.03883  9.65904    28.25246  1.000 56.35595  ? 258  ARG H CZ  1 
ATOM   2012  N NH1 . ARG A  1 278 ? 43.29515  10.01338   28.02765  1.000 60.25076  ? 258  ARG H NH1 1 
ATOM   2013  N NH2 . ARG A  1 278 ? 41.75142  8.82819    29.24731  1.000 58.73887  ? 258  ARG H NH2 1 
ATOM   2014  N N   . SER A  1 279 ? 36.75807  12.41965   29.41192  1.000 29.58105  ? 259  SER H N   1 
ATOM   2015  C CA  . SER A  1 279 ? 36.37704  12.15854   30.79066  1.000 27.74931  ? 259  SER H CA  1 
ATOM   2016  C C   . SER A  1 279 ? 37.20479  10.98730   31.30484  1.000 23.75831  ? 259  SER H C   1 
ATOM   2017  O O   . SER A  1 279 ? 37.87255  10.28087   30.54000  1.000 22.77323  ? 259  SER H O   1 
ATOM   2018  C CB  . SER A  1 279 ? 34.88005  11.85135   30.95250  1.000 30.74208  ? 259  SER H CB  1 
ATOM   2019  O OG  . SER A  1 279 ? 34.56488  10.46310   30.88632  1.000 27.04699  ? 259  SER H OG  1 
ATOM   2020  N N   . ASP A  1 280 ? 37.14287  10.77994   32.61910  1.000 28.35282  ? 260  ASP H N   1 
ATOM   2021  C CA  . ASP A  1 280 ? 37.89868  9.70549    33.25751  1.000 31.73802  ? 260  ASP H CA  1 
ATOM   2022  C C   . ASP A  1 280 ? 37.48989  8.33001    32.75300  1.000 31.82262  ? 260  ASP H C   1 
ATOM   2023  O O   . ASP A  1 280 ? 38.25514  7.36566    32.91117  1.000 30.72429  ? 260  ASP H O   1 
ATOM   2024  C CB  . ASP A  1 280 ? 37.70491  9.75863    34.76404  1.000 33.73233  ? 260  ASP H CB  1 
ATOM   2025  C CG  . ASP A  1 280 ? 38.45729  10.90202   35.40582  1.000 39.14586  ? 260  ASP H CG  1 
ATOM   2026  O OD1 . ASP A  1 280 ? 39.38802  11.45163   34.77759  1.000 40.55806  ? 260  ASP H OD1 1 
ATOM   2027  O OD2 . ASP A  1 280 ? 38.11891  11.23057   36.55547  1.000 41.56427  ? 260  ASP H OD2 1 
ATOM   2028  N N   . PHE A  1 281 ? 36.30617  8.22049    32.14737  1.000 27.42653  ? 261  PHE H N   1 
ATOM   2029  C CA  . PHE A  1 281 ? 35.79956  6.95499    31.64079  1.000 25.45365  ? 261  PHE H CA  1 
ATOM   2030  C C   . PHE A  1 281 ? 35.91650  6.84130    30.13041  1.000 27.03861  ? 261  PHE H C   1 
ATOM   2031  O O   . PHE A  1 281 ? 35.27048  5.97642    29.53025  1.000 27.73220  ? 261  PHE H O   1 
ATOM   2032  C CB  . PHE A  1 281 ? 34.34859  6.76438    32.10370  1.000 27.55923  ? 261  PHE H CB  1 
ATOM   2033  C CG  . PHE A  1 281 ? 34.18439  6.93016    33.59122  1.000 32.59225  ? 261  PHE H CG  1 
ATOM   2034  C CD1 . PHE A  1 281 ? 34.55564  5.91766    34.45511  1.000 37.38827  ? 261  PHE H CD1 1 
ATOM   2035  C CD2 . PHE A  1 281 ? 33.69827  8.11107    34.12521  1.000 34.97466  ? 261  PHE H CD2 1 
ATOM   2036  C CE1 . PHE A  1 281 ? 34.43033  6.06984    35.84056  1.000 38.06659  ? 261  PHE H CE1 1 
ATOM   2037  C CE2 . PHE A  1 281 ? 33.56639  8.27329    35.49795  1.000 37.18104  ? 261  PHE H CE2 1 
ATOM   2038  C CZ  . PHE A  1 281 ? 33.93928  7.25254    36.35684  1.000 37.46900  ? 261  PHE H CZ  1 
ATOM   2039  N N   . GLU A  1 282 ? 36.76191  7.65973    29.49967  1.000 24.40694  ? 262  GLU H N   1 
ATOM   2040  C CA  . GLU A  1 282 ? 37.00227  7.57804    28.06113  1.000 22.83194  ? 262  GLU H CA  1 
ATOM   2041  C C   . GLU A  1 282 ? 38.46035  7.19958    27.85734  1.000 27.67124  ? 262  GLU H C   1 
ATOM   2042  O O   . GLU A  1 282 ? 39.35282  7.90475    28.33347  1.000 28.12039  ? 262  GLU H O   1 
ATOM   2043  C CB  . GLU A  1 282 ? 36.66224  8.91365    27.37470  1.000 24.63947  ? 262  GLU H CB  1 
ATOM   2044  C CG  . GLU A  1 282 ? 35.17782  9.29088    27.57280  1.000 24.84727  ? 262  GLU H CG  1 
ATOM   2045  C CD  . GLU A  1 282 ? 34.79566  10.63959   26.99717  1.000 25.80393  ? 262  GLU H CD  1 
ATOM   2046  O OE1 . GLU A  1 282 ? 35.69521  11.49611   26.85476  1.000 28.82667  ? 262  GLU H OE1 1 
ATOM   2047  O OE2 . GLU A  1 282 ? 33.59649  10.82541   26.65145  1.000 21.17970  ? 262  GLU H OE2 1 
ATOM   2048  N N   . HIS A  1 283 ? 38.70631  6.07660    27.17576  1.000 30.50871  ? 263  HIS H N   1 
ATOM   2049  C CA  . HIS A  1 283 ? 40.07029  5.55488    27.11956  1.000 34.31613  ? 263  HIS H CA  1 
ATOM   2050  C C   . HIS A  1 283 ? 40.95083  6.26256    26.09391  1.000 30.33922  ? 263  HIS H C   1 
ATOM   2051  O O   . HIS A  1 283 ? 42.14948  5.96833    26.03367  1.000 34.97882  ? 263  HIS H O   1 
ATOM   2052  C CB  . HIS A  1 283 ? 40.04443  4.04223    26.82983  1.000 33.77902  ? 263  HIS H CB  1 
ATOM   2053  C CG  . HIS A  1 283 ? 39.77995  3.70128    25.39725  1.000 37.68113  ? 263  HIS H CG  1 
ATOM   2054  N ND1 . HIS A  1 283 ? 38.52365  3.78248    24.83351  1.000 39.41607  ? 263  HIS H ND1 1 
ATOM   2055  C CD2 . HIS A  1 283 ? 40.60572  3.25950    24.41552  1.000 40.64672  ? 263  HIS H CD2 1 
ATOM   2056  C CE1 . HIS A  1 283 ? 38.58790  3.41925    23.56113  1.000 39.77401  ? 263  HIS H CE1 1 
ATOM   2057  N NE2 . HIS A  1 283 ? 39.84083  3.09105    23.28567  1.000 41.19485  ? 263  HIS H NE2 1 
ATOM   2058  N N   . GLU A  1 284 ? 40.40127  7.16212    25.29012  1.000 24.87799  ? 264  GLU H N   1 
ATOM   2059  C CA  . GLU A  1 284 ? 41.12720  7.79051    24.19093  1.000 24.87404  ? 264  GLU H CA  1 
ATOM   2060  C C   . GLU A  1 284 ? 40.32765  9.00888    23.72007  1.000 25.30664  ? 264  GLU H C   1 
ATOM   2061  O O   . GLU A  1 284 ? 39.10826  9.07677    23.93771  1.000 20.71912  ? 264  GLU H O   1 
ATOM   2062  C CB  . GLU A  1 284 ? 41.34668  6.79890    23.02132  1.000 24.90862  ? 264  GLU H CB  1 
ATOM   2063  C CG  . GLU A  1 284 ? 40.09713  6.57308    22.12826  1.000 27.65319  ? 264  GLU H CG  1 
ATOM   2064  C CD  . GLU A  1 284 ? 40.36111  5.62596    20.94897  1.000 36.70628  ? 264  GLU H CD  1 
ATOM   2065  O OE1 . GLU A  1 284 ? 41.49868  5.11861    20.81561  1.000 40.06067  ? 264  GLU H OE1 1 
ATOM   2066  O OE2 . GLU A  1 284 ? 39.42588  5.39457    20.14716  1.000 38.34862  ? 264  GLU H OE2 1 
ATOM   2067  N N   . PRO A  1 285 ? 40.98695  9.98870    23.09860  1.000 27.98344  ? 265  PRO H N   1 
ATOM   2068  C CA  . PRO A  1 285 ? 40.24229  11.11782   22.51956  1.000 24.43875  ? 265  PRO H CA  1 
ATOM   2069  C C   . PRO A  1 285 ? 39.19500  10.62984   21.53248  1.000 22.02402  ? 265  PRO H C   1 
ATOM   2070  O O   . PRO A  1 285 ? 39.48686  9.81949    20.65367  1.000 22.10264  ? 265  PRO H O   1 
ATOM   2071  C CB  . PRO A  1 285 ? 41.33849  11.93402   21.81460  1.000 30.41298  ? 265  PRO H CB  1 
ATOM   2072  C CG  . PRO A  1 285 ? 42.56828  11.64079   22.60483  1.000 33.44705  ? 265  PRO H CG  1 
ATOM   2073  C CD  . PRO A  1 285 ? 42.44542  10.19124   23.02225  1.000 33.15151  ? 265  PRO H CD  1 
ATOM   2074  N N   . TYR A  1 286 ? 37.97455  11.15085   21.66062  1.000 22.20834  ? 266  TYR H N   1 
ATOM   2075  C CA  . TYR A  1 286 ? 36.82373  10.68263   20.89729  1.000 18.31015  ? 266  TYR H CA  1 
ATOM   2076  C C   . TYR A  1 286 ? 36.47685  11.69386   19.81112  1.000 19.81860  ? 266  TYR H C   1 
ATOM   2077  O O   . TYR A  1 286 ? 36.15543  12.85011   20.10871  1.000 18.65819  ? 266  TYR H O   1 
ATOM   2078  C CB  . TYR A  1 286 ? 35.62959  10.47399   21.83337  1.000 17.07177  ? 266  TYR H CB  1 
ATOM   2079  C CG  . TYR A  1 286 ? 34.36572  9.94260    21.18278  1.000 16.40589  ? 266  TYR H CG  1 
ATOM   2080  C CD1 . TYR A  1 286 ? 33.47310  10.79557   20.56938  1.000 16.07820  ? 266  TYR H CD1 1 
ATOM   2081  C CD2 . TYR A  1 286 ? 34.07865  8.57640    21.18820  1.000 19.30538  ? 266  TYR H CD2 1 
ATOM   2082  C CE1 . TYR A  1 286 ? 32.29893  10.33907   19.99104  1.000 17.51129  ? 266  TYR H CE1 1 
ATOM   2083  C CE2 . TYR A  1 286 ? 32.88817  8.09270    20.59083  1.000 16.24084  ? 266  TYR H CE2 1 
ATOM   2084  C CZ  . TYR A  1 286 ? 32.01492  8.98904    20.01660  1.000 15.39689  ? 266  TYR H CZ  1 
ATOM   2085  O OH  . TYR A  1 286 ? 30.85766  8.54989    19.43486  1.000 16.70111  ? 266  TYR H OH  1 
ATOM   2086  N N   . TRP A  1 287 ? 36.46682  11.23965   18.56650  1.000 18.92593  ? 267  TRP H N   1 
ATOM   2087  C CA  . TRP A  1 287 ? 35.98186  12.06197   17.46895  1.000 18.85912  ? 267  TRP H CA  1 
ATOM   2088  C C   . TRP A  1 287 ? 35.26363  11.16307   16.48412  1.000 21.85902  ? 267  TRP H C   1 
ATOM   2089  O O   . TRP A  1 287 ? 35.77536  10.10311   16.13134  1.000 24.02485  ? 267  TRP H O   1 
ATOM   2090  C CB  . TRP A  1 287 ? 37.13994  12.80222   16.79047  1.000 20.05171  ? 267  TRP H CB  1 
ATOM   2091  C CG  . TRP A  1 287 ? 36.76661  13.70864   15.66028  1.000 20.46976  ? 267  TRP H CG  1 
ATOM   2092  C CD1 . TRP A  1 287 ? 36.56517  15.07119   15.71973  1.000 20.77442  ? 267  TRP H CD1 1 
ATOM   2093  C CD2 . TRP A  1 287 ? 36.62870  13.34235   14.29112  1.000 25.24455  ? 267  TRP H CD2 1 
ATOM   2094  N NE1 . TRP A  1 287 ? 36.26595  15.56082   14.46753  1.000 22.73558  ? 267  TRP H NE1 1 
ATOM   2095  C CE2 . TRP A  1 287 ? 36.30304  14.52375   13.56939  1.000 24.40104  ? 267  TRP H CE2 1 
ATOM   2096  C CE3 . TRP A  1 287 ? 36.74729  12.12762   13.59180  1.000 24.16962  ? 267  TRP H CE3 1 
ATOM   2097  C CZ2 . TRP A  1 287 ? 36.08388  14.51710   12.18561  1.000 24.91409  ? 267  TRP H CZ2 1 
ATOM   2098  C CZ3 . TRP A  1 287 ? 36.52724  12.12163   12.22631  1.000 23.11646  ? 267  TRP H CZ3 1 
ATOM   2099  C CH2 . TRP A  1 287 ? 36.21467  13.31914   11.52838  1.000 22.49520  ? 267  TRP H CH2 1 
ATOM   2100  N N   . ARG A  1 288 ? 34.09563  11.57861   16.03109  1.000 18.27464  ? 268  ARG H N   1 
ATOM   2101  C CA  . ARG A  1 288 ? 33.35808  10.79749   15.05182  1.000 21.61383  ? 268  ARG H CA  1 
ATOM   2102  C C   . ARG A  1 288 ? 32.72155  11.75040   14.05591  1.000 19.45156  ? 268  ARG H C   1 
ATOM   2103  O O   . ARG A  1 288 ? 32.11000  12.74642   14.46170  1.000 20.15202  ? 268  ARG H O   1 
ATOM   2104  C CB  . ARG A  1 288 ? 32.22927  9.98548    15.71631  1.000 17.27607  ? 268  ARG H CB  1 
ATOM   2105  C CG  . ARG A  1 288 ? 32.60049  8.89816    16.69218  1.000 16.97874  ? 268  ARG H CG  1 
ATOM   2106  C CD  . ARG A  1 288 ? 33.40704  7.76825    16.04892  1.000 20.44192  ? 268  ARG H CD  1 
ATOM   2107  N NE  . ARG A  1 288 ? 33.62673  6.71466    17.03304  1.000 22.72756  ? 268  ARG H NE  1 
ATOM   2108  C CZ  . ARG A  1 288 ? 34.66096  6.71906    17.86078  1.000 23.44239  ? 268  ARG H CZ  1 
ATOM   2109  N NH1 . ARG A  1 288 ? 35.53230  7.72754    17.82561  1.000 23.49819  ? 268  ARG H NH1 1 
ATOM   2110  N NH2 . ARG A  1 288 ? 34.81899  5.75312    18.73249  1.000 17.65891  ? 268  ARG H NH2 1 
ATOM   2111  N N   . ASP A  1 289 ? 32.78480  11.41436   12.76444  1.000 19.35004  ? 269  ASP H N   1 
ATOM   2112  C CA  . ASP A  1 289 ? 32.04387  12.21748   11.80670  1.000 22.71020  ? 269  ASP H CA  1 
ATOM   2113  C C   . ASP A  1 289 ? 30.72520  11.59761   11.36995  1.000 19.28866  ? 269  ASP H C   1 
ATOM   2114  O O   . ASP A  1 289 ? 29.96435  12.27314   10.68483  1.000 22.68941  ? 269  ASP H O   1 
ATOM   2115  C CB  . ASP A  1 289 ? 32.91905  12.56642   10.58430  1.000 27.56802  ? 269  ASP H CB  1 
ATOM   2116  C CG  . ASP A  1 289 ? 33.10291  11.41781   9.64168   1.000 34.39466  ? 269  ASP H CG  1 
ATOM   2117  O OD1 . ASP A  1 289 ? 32.99390  10.23987   10.06987  1.000 38.13861  ? 269  ASP H OD1 1 
ATOM   2118  O OD2 . ASP A  1 289 ? 33.36631  11.70946   8.45779   1.000 39.15398  ? 269  ASP H OD2 1 
ATOM   2119  N N   . VAL A  1 290 ? 30.40577  10.36580   11.79456  1.000 18.73094  ? 270  VAL H N   1 
ATOM   2120  C CA  . VAL A  1 290 ? 29.14466  9.67271    11.48190  1.000 19.04640  ? 270  VAL H CA  1 
ATOM   2121  C C   . VAL A  1 290 ? 28.65081  9.98398    10.06446  1.000 22.71282  ? 270  VAL H C   1 
ATOM   2122  O O   . VAL A  1 290 ? 27.48376  10.33106   9.83244   1.000 23.56734  ? 270  VAL H O   1 
ATOM   2123  C CB  . VAL A  1 290 ? 28.04857  9.93347    12.55556  1.000 17.28505  ? 270  VAL H CB  1 
ATOM   2124  C CG1 . VAL A  1 290 ? 28.43199  9.26780    13.89078  1.000 16.56583  ? 270  VAL H CG1 1 
ATOM   2125  C CG2 . VAL A  1 290 ? 27.75891  11.41913   12.82183  1.000 17.88686  ? 270  VAL H CG2 1 
ATOM   2126  N N   . GLY A  1 291 ? 29.54496  9.84714    9.10557   1.000 25.03608  ? 271  GLY H N   1 
ATOM   2127  C CA  . GLY A  1 291 ? 29.29221  10.25950   7.73777   1.000 27.08423  ? 271  GLY H CA  1 
ATOM   2128  C C   . GLY A  1 291 ? 28.54022  9.27676    6.87039   1.000 25.17986  ? 271  GLY H C   1 
ATOM   2129  O O   . GLY A  1 291 ? 28.12333  9.65705    5.77134   1.000 27.90556  ? 271  GLY H O   1 
ATOM   2130  N N   . THR A  1 292 ? 28.37864  8.02410    7.30472   1.000 21.26819  ? 272  THR H N   1 
ATOM   2131  C CA  . THR A  1 292 ? 27.63226  7.01260    6.56591   1.000 26.51720  ? 272  THR H CA  1 
ATOM   2132  C C   . THR A  1 292 ? 26.59776  6.37697    7.48267   1.000 24.48130  ? 272  THR H C   1 
ATOM   2133  O O   . THR A  1 292 ? 26.65175  6.52252    8.70743   1.000 19.56982  ? 272  THR H O   1 
ATOM   2134  C CB  . THR A  1 292 ? 28.55853  5.91342    6.01273   1.000 29.25506  ? 272  THR H CB  1 
ATOM   2135  O OG1 . THR A  1 292 ? 29.07887  5.14984    7.09583   1.000 28.12569  ? 272  THR H OG1 1 
ATOM   2136  C CG2 . THR A  1 292 ? 29.72106  6.52340    5.24077   1.000 36.24551  ? 272  THR H CG2 1 
ATOM   2137  N N   . ILE A  1 293 ? 25.65131  5.63426    6.90224   1.000 21.79123  ? 273  ILE H N   1 
ATOM   2138  C CA  . ILE A  1 293 ? 24.64683  5.00502    7.75911   1.000 22.72615  ? 273  ILE H CA  1 
ATOM   2139  C C   . ILE A  1 293 ? 25.30568  4.01924    8.71160   1.000 22.10637  ? 273  ILE H C   1 
ATOM   2140  O O   . ILE A  1 293 ? 24.98214  3.97892    9.90273   1.000 22.82183  ? 273  ILE H O   1 
ATOM   2141  C CB  . ILE A  1 293 ? 23.53403  4.33919    6.92660   1.000 26.36372  ? 273  ILE H CB  1 
ATOM   2142  C CG1 . ILE A  1 293 ? 22.63799  5.41490    6.32241   1.000 26.27570  ? 273  ILE H CG1 1 
ATOM   2143  C CG2 . ILE A  1 293 ? 22.69055  3.44462    7.82057   1.000 24.50047  ? 273  ILE H CG2 1 
ATOM   2144  C CD1 . ILE A  1 293 ? 21.83966  4.95562    5.11988   1.000 28.39226  ? 273  ILE H CD1 1 
ATOM   2145  N N   . ASP A  1 294 ? 26.24964  3.21049    8.21316   1.000 24.68697  ? 274  ASP H N   1 
ATOM   2146  C CA  . ASP A  1 294 ? 26.95235  2.28151    9.10262   1.000 23.82699  ? 274  ASP H CA  1 
ATOM   2147  C C   . ASP A  1 294 ? 27.65514  3.02165    10.22502  1.000 20.52625  ? 274  ASP H C   1 
ATOM   2148  O O   . ASP A  1 294 ? 27.60616  2.60101    11.38697  1.000 18.35850  ? 274  ASP H O   1 
ATOM   2149  C CB  . ASP A  1 294 ? 27.97931  1.47429    8.33340   1.000 26.34276  ? 274  ASP H CB  1 
ATOM   2150  C CG  . ASP A  1 294 ? 27.37105  0.29102    7.65568   1.000 40.43119  ? 274  ASP H CG  1 
ATOM   2151  O OD1 . ASP A  1 294 ? 28.08688  -0.36194   6.86222   1.000 45.33711  ? 274  ASP H OD1 1 
ATOM   2152  O OD2 . ASP A  1 294 ? 26.17809  0.00758    7.92469   1.000 41.26369  ? 274  ASP H OD2 1 
ATOM   2153  N N   . ALA A  1 295 ? 28.32138  4.12530    9.89935   1.000 23.45328  ? 275  ALA H N   1 
ATOM   2154  C CA  . ALA A  1 295 ? 29.06480  4.84661    10.92509  1.000 18.86458  ? 275  ALA H CA  1 
ATOM   2155  C C   . ALA A  1 295 ? 28.12391  5.50390    11.91503  1.000 17.77528  ? 275  ALA H C   1 
ATOM   2156  O O   . ALA A  1 295 ? 28.45268  5.61091    13.09461  1.000 17.16232  ? 275  ALA H O   1 
ATOM   2157  C CB  . ALA A  1 295 ? 29.97719  5.90177    10.29639  1.000 19.58586  ? 275  ALA H CB  1 
ATOM   2158  N N   . TYR A  1 296 ? 26.97854  6.00463    11.44224  1.000 19.21426  ? 276  TYR H N   1 
ATOM   2159  C CA  . TYR A  1 296 ? 25.98866  6.59404    12.33991  1.000 21.15251  ? 276  TYR H CA  1 
ATOM   2160  C C   . TYR A  1 296 ? 25.40378  5.53210    13.27143  1.000 19.43033  ? 276  TYR H C   1 
ATOM   2161  O O   . TYR A  1 296 ? 25.35449  5.70803    14.50224  1.000 15.37461  ? 276  TYR H O   1 
ATOM   2162  C CB  . TYR A  1 296 ? 24.89195  7.26558    11.51568  1.000 22.47032  ? 276  TYR H CB  1 
ATOM   2163  C CG  . TYR A  1 296 ? 23.75897  7.81254    12.35460  1.000 18.21824  ? 276  TYR H CG  1 
ATOM   2164  C CD1 . TYR A  1 296 ? 23.89653  9.03450    13.00907  1.000 16.58251  ? 276  TYR H CD1 1 
ATOM   2165  C CD2 . TYR A  1 296 ? 22.55937  7.11286    12.50174  1.000 16.50834  ? 276  TYR H CD2 1 
ATOM   2166  C CE1 . TYR A  1 296 ? 22.85059  9.56322    13.78904  1.000 15.96400  ? 276  TYR H CE1 1 
ATOM   2167  C CE2 . TYR A  1 296 ? 21.52717  7.62630    13.28228  1.000 17.77002  ? 276  TYR H CE2 1 
ATOM   2168  C CZ  . TYR A  1 296 ? 21.69030  8.85377    13.91885  1.000 16.82168  ? 276  TYR H CZ  1 
ATOM   2169  O OH  . TYR A  1 296 ? 20.66351  9.35922    14.67805  1.000 20.40479  ? 276  TYR H OH  1 
ATOM   2170  N N   . TRP A  1 297 ? 25.00191  4.39802    12.69946  1.000 16.48215  ? 277  TRP H N   1 
ATOM   2171  C CA  . TRP A  1 297 ? 24.50345  3.28098    13.50262  1.000 16.05014  ? 277  TRP H CA  1 
ATOM   2172  C C   . TRP A  1 297 ? 25.53938  2.82639    14.51811  1.000 16.20061  ? 277  TRP H C   1 
ATOM   2173  O O   . TRP A  1 297 ? 25.23557  2.66074    15.71872  1.000 16.46532  ? 277  TRP H O   1 
ATOM   2174  C CB  . TRP A  1 297 ? 24.12799  2.12088    12.58331  1.000 16.74202  ? 277  TRP H CB  1 
ATOM   2175  C CG  . TRP A  1 297 ? 23.71991  0.86845    13.32515  1.000 18.00868  ? 277  TRP H CG  1 
ATOM   2176  C CD1 . TRP A  1 297 ? 22.44665  0.53277    13.73358  1.000 16.14766  ? 277  TRP H CD1 1 
ATOM   2177  C CD2 . TRP A  1 297 ? 24.57465  -0.22869   13.71486  1.000 19.92336  ? 277  TRP H CD2 1 
ATOM   2178  N NE1 . TRP A  1 297 ? 22.46587  -0.69964   14.36089  1.000 16.26921  ? 277  TRP H NE1 1 
ATOM   2179  C CE2 . TRP A  1 297 ? 23.75980  -1.17788   14.37102  1.000 16.51879  ? 277  TRP H CE2 1 
ATOM   2180  C CE3 . TRP A  1 297 ? 25.95525  -0.49389   13.57815  1.000 19.46909  ? 277  TRP H CE3 1 
ATOM   2181  C CZ2 . TRP A  1 297 ? 24.26802  -2.38464   14.86574  1.000 16.79391  ? 277  TRP H CZ2 1 
ATOM   2182  C CZ3 . TRP A  1 297 ? 26.45811  -1.68539   14.07552  1.000 20.47763  ? 277  TRP H CZ3 1 
ATOM   2183  C CH2 . TRP A  1 297 ? 25.61788  -2.61146   14.74067  1.000 20.35057  ? 277  TRP H CH2 1 
ATOM   2184  N N   . GLN A  1 298 ? 26.77975  2.64369    14.07186  1.000 16.43687  ? 278  GLN H N   1 
ATOM   2185  C CA  . GLN A  1 298 ? 27.80490  2.11076    14.96558  1.000 16.82770  ? 278  GLN H CA  1 
ATOM   2186  C C   . GLN A  1 298 ? 28.04981  3.03040    16.15577  1.000 17.45461  ? 278  GLN H C   1 
ATOM   2187  O O   . GLN A  1 298 ? 28.12786  2.57449    17.31083  1.000 15.34390  ? 278  GLN H O   1 
ATOM   2188  C CB  . GLN A  1 298 ? 29.10430  1.88829    14.20203  1.000 19.37260  ? 278  GLN H CB  1 
ATOM   2189  C CG  . GLN A  1 298 ? 30.11489  1.11439    15.04628  1.000 24.29783  ? 278  GLN H CG  1 
ATOM   2190  C CD  . GLN A  1 298 ? 29.77114  -0.34289   15.07798  1.000 25.90674  ? 278  GLN H CD  1 
ATOM   2191  O OE1 . GLN A  1 298 ? 29.72165  -0.98116   14.03889  1.000 24.08518  ? 278  GLN H OE1 1 
ATOM   2192  N NE2 . GLN A  1 298 ? 29.52350  -0.88211   16.26898  1.000 22.40472  ? 278  GLN H NE2 1 
ATOM   2193  N N   . ALA A  1 299 ? 28.23028  4.32237    15.88844  1.000 17.29147  ? 279  ALA H N   1 
ATOM   2194  C CA  . ALA A  1 299 ? 28.54010  5.25073    16.97068  1.000 17.49978  ? 279  ALA H CA  1 
ATOM   2195  C C   . ALA A  1 299 ? 27.43151  5.27399    18.02331  1.000 15.27880  ? 279  ALA H C   1 
ATOM   2196  O O   . ALA A  1 299 ? 27.70962  5.43177    19.21112  1.000 16.71933  ? 279  ALA H O   1 
ATOM   2197  C CB  . ALA A  1 299 ? 28.75779  6.65246    16.41535  1.000 15.40138  ? 279  ALA H CB  1 
ATOM   2198  N N   . ASN A  1 300 ? 26.16497  5.19184    17.59511  1.000 16.26295  ? 280  ASN H N   1 
ATOM   2199  C CA  . ASN A  1 300 ? 25.05321  5.17068    18.55255  1.000 16.04210  ? 280  ASN H CA  1 
ATOM   2200  C C   . ASN A  1 300 ? 25.00426  3.83971    19.29924  1.000 14.12202  ? 280  ASN H C   1 
ATOM   2201  O O   . ASN A  1 300 ? 24.91394  3.79039    20.53535  1.000 15.15398  ? 280  ASN H O   1 
ATOM   2202  C CB  . ASN A  1 300 ? 23.72671  5.42056    17.81467  1.000 16.61952  ? 280  ASN H CB  1 
ATOM   2203  C CG  . ASN A  1 300 ? 23.45350  6.90591    17.53771  1.000 19.02639  ? 280  ASN H CG  1 
ATOM   2204  O OD1 . ASN A  1 300 ? 23.04008  7.64564    18.44522  1.000 16.58828  ? 280  ASN H OD1 1 
ATOM   2205  N ND2 . ASN A  1 300 ? 23.62411  7.33759    16.25798  1.000 14.90474  ? 280  ASN H ND2 1 
ATOM   2206  N N   . ILE A  1 301 ? 25.07178  2.73069    18.56314  1.000 14.83267  ? 281  ILE H N   1 
ATOM   2207  C CA  . ILE A  1 301 ? 24.96230  1.43374    19.20895  1.000 16.74481  ? 281  ILE H CA  1 
ATOM   2208  C C   . ILE A  1 301 ? 26.14262  1.16966    20.15281  1.000 15.20511  ? 281  ILE H C   1 
ATOM   2209  O O   . ILE A  1 301 ? 25.99091  0.48901    21.19469  1.000 13.89865  ? 281  ILE H O   1 
ATOM   2210  C CB  . ILE A  1 301 ? 24.80837  0.37452    18.09125  1.000 16.20692  ? 281  ILE H CB  1 
ATOM   2211  C CG1 . ILE A  1 301 ? 23.85418  -0.70718   18.52824  1.000 22.02110  ? 281  ILE H CG1 1 
ATOM   2212  C CG2 . ILE A  1 301 ? 26.17581  -0.15897   17.65998  1.000 23.29519  ? 281  ILE H CG2 1 
ATOM   2213  C CD1 . ILE A  1 301 ? 22.41762  -0.23128   18.40525  1.000 19.42387  ? 281  ILE H CD1 1 
ATOM   2214  N N   . ASP A  1 302 ? 27.31908  1.74419    19.86316  1.000 14.33774  ? 282  ASP H N   1 
ATOM   2215  C CA  . ASP A  1 302 ? 28.42677  1.60240    20.79265  1.000 14.52123  ? 282  ASP H CA  1 
ATOM   2216  C C   . ASP A  1 302 ? 28.10740  2.22739    22.15014  1.000 13.94064  ? 282  ASP H C   1 
ATOM   2217  O O   . ASP A  1 302 ? 28.76595  1.90083    23.14204  1.000 14.08905  ? 282  ASP H O   1 
ATOM   2218  C CB  . ASP A  1 302 ? 29.72915  2.25311    20.24823  1.000 15.10713  ? 282  ASP H CB  1 
ATOM   2219  C CG  . ASP A  1 302 ? 30.34150  1.49822    19.05567  1.000 25.10484  ? 282  ASP H CG  1 
ATOM   2220  O OD1 . ASP A  1 302 ? 29.94116  0.35686    18.76816  1.000 22.86712  ? 282  ASP H OD1 1 
ATOM   2221  O OD2 . ASP A  1 302 ? 31.23872  2.07354    18.38963  1.000 23.95794  ? 282  ASP H OD2 1 
ATOM   2222  N N   . LEU A  1 303 ? 27.13633  3.15275    22.21949  1.000 13.79054  ? 283  LEU H N   1 
ATOM   2223  C CA  . LEU A  1 303 ? 26.78783  3.71629    23.53333  1.000 12.90031  ? 283  LEU H CA  1 
ATOM   2224  C C   . LEU A  1 303 ? 26.13950  2.69334    24.45548  1.000 13.66782  ? 283  LEU H C   1 
ATOM   2225  O O   . LEU A  1 303 ? 26.00624  2.96239    25.64346  1.000 13.94676  ? 283  LEU H O   1 
ATOM   2226  C CB  . LEU A  1 303 ? 25.86425  4.91838    23.36345  1.000 12.45195  ? 283  LEU H CB  1 
ATOM   2227  C CG  . LEU A  1 303 ? 26.62066  6.06420    22.67473  1.000 14.05752  ? 283  LEU H CG  1 
ATOM   2228  C CD1 . LEU A  1 303 ? 25.65250  7.19314    22.38135  1.000 15.75510  ? 283  LEU H CD1 1 
ATOM   2229  C CD2 . LEU A  1 303 ? 27.75214  6.55617    23.58046  1.000 20.44351  ? 283  LEU H CD2 1 
ATOM   2230  N N   . THR A  1 304 ? 25.78450  1.51454    23.95318  1.000 15.52408  ? 284  THR H N   1 
ATOM   2231  C CA  . THR A  1 304 ? 25.21026  0.46670    24.80055  1.000 13.92478  ? 284  THR H CA  1 
ATOM   2232  C C   . THR A  1 304 ? 26.26934  -0.43493   25.40059  1.000 19.17502  ? 284  THR H C   1 
ATOM   2233  O O   . THR A  1 304 ? 25.92666  -1.34277   26.16861  1.000 13.85008  ? 284  THR H O   1 
ATOM   2234  C CB  . THR A  1 304 ? 24.19545  -0.37880   24.01361  1.000 15.12157  ? 284  THR H CB  1 
ATOM   2235  O OG1 . THR A  1 304 ? 24.87143  -1.12463   22.97423  1.000 13.99659  ? 284  THR H OG1 1 
ATOM   2236  C CG2 . THR A  1 304 ? 23.02730  0.45061    23.41627  1.000 18.05113  ? 284  THR H CG2 1 
ATOM   2237  N N   . ASP A  1 305 ? 27.54529  -0.22299   25.07018  1.000 14.03669  ? 285  ASP H N   1 
ATOM   2238  C CA  . ASP A  1 305 ? 28.61768  -1.03642   25.63493  1.000 18.11598  ? 285  ASP H CA  1 
ATOM   2239  C C   . ASP A  1 305 ? 28.69382  -0.87236   27.15522  1.000 18.56159  ? 285  ASP H C   1 
ATOM   2240  O O   . ASP A  1 305 ? 28.25452  0.14458    27.72249  1.000 15.78860  ? 285  ASP H O   1 
ATOM   2241  C CB  . ASP A  1 305 ? 29.99573  -0.63241   25.07304  1.000 19.72024  ? 285  ASP H CB  1 
ATOM   2242  C CG  . ASP A  1 305 ? 30.17743  -1.01412   23.60306  1.000 21.83270  ? 285  ASP H CG  1 
ATOM   2243  O OD1 . ASP A  1 305 ? 29.26011  -1.61658   22.99915  1.000 21.63667  ? 285  ASP H OD1 1 
ATOM   2244  O OD2 . ASP A  1 305 ? 31.24760  -0.64857   23.05097  1.000 20.16616  ? 285  ASP H OD2 1 
ATOM   2245  N N   . VAL A  1 306 ? 29.32166  -1.85815   27.80113  1.000 16.48698  ? 286  VAL H N   1 
ATOM   2246  C CA  . VAL A  1 306 ? 29.59107  -1.75467   29.24387  1.000 19.40588  ? 286  VAL H CA  1 
ATOM   2247  C C   . VAL A  1 306 ? 30.55520  -0.60873   29.52997  1.000 18.59538  ? 286  VAL H C   1 
ATOM   2248  O O   . VAL A  1 306 ? 30.33877  0.17220    30.45930  1.000 20.05271  ? 286  VAL H O   1 
ATOM   2249  C CB  . VAL A  1 306 ? 30.13032  -3.08068   29.81338  1.000 24.12184  ? 286  VAL H CB  1 
ATOM   2250  C CG1 . VAL A  1 306 ? 30.43749  -2.91498   31.29427  1.000 28.81276  ? 286  VAL H CG1 1 
ATOM   2251  C CG2 . VAL A  1 306 ? 29.11784  -4.19450   29.66437  1.000 25.20008  ? 286  VAL H CG2 1 
ATOM   2252  N N   . VAL A  1 307 ? 31.61246  -0.47108   28.72535  1.000 20.70302  ? 287  VAL H N   1 
ATOM   2253  C CA  . VAL A  1 307 ? 32.55698  0.65256    28.82049  1.000 20.96330  ? 287  VAL H CA  1 
ATOM   2254  C C   . VAL A  1 307 ? 32.55424  1.41309    27.49161  1.000 19.98548  ? 287  VAL H C   1 
ATOM   2255  O O   . VAL A  1 307 ? 33.33374  1.10533    26.57331  1.000 19.06927  ? 287  VAL H O   1 
ATOM   2256  C CB  . VAL A  1 307 ? 33.96943  0.16628    29.19467  1.000 25.84165  ? 287  VAL H CB  1 
ATOM   2257  C CG1 . VAL A  1 307 ? 34.90170  1.35337    29.46251  1.000 25.72402  ? 287  VAL H CG1 1 
ATOM   2258  C CG2 . VAL A  1 307 ? 33.91002  -0.70050   30.41318  1.000 29.68398  ? 287  VAL H CG2 1 
ATOM   2259  N N   . PRO A  1 308 ? 31.64699  2.35148    27.30840  1.000 19.18909  ? 288  PRO H N   1 
ATOM   2260  C CA  . PRO A  1 308 ? 31.55874  3.04169    26.01229  1.000 20.21923  ? 288  PRO H CA  1 
ATOM   2261  C C   . PRO A  1 308 ? 32.72004  4.00631    25.80139  1.000 18.25744  ? 288  PRO H C   1 
ATOM   2262  O O   . PRO A  1 308 ? 33.27231  4.57671    26.75385  1.000 17.68167  ? 288  PRO H O   1 
ATOM   2263  C CB  . PRO A  1 308 ? 30.22309  3.79580    26.08629  1.000 19.95177  ? 288  PRO H CB  1 
ATOM   2264  C CG  . PRO A  1 308 ? 29.79272  3.71651    27.50735  1.000 24.63027  ? 288  PRO H CG  1 
ATOM   2265  C CD  . PRO A  1 308 ? 30.51190  2.61103    28.19728  1.000 20.89772  ? 288  PRO H CD  1 
ATOM   2266  N N   . ASP A  1 309 ? 33.07794  4.16214    24.52139  1.000 15.53356  ? 289  ASP H N   1 
ATOM   2267  C CA  . ASP A  1 309 ? 34.09876  5.12729    24.10651  1.000 18.54429  ? 289  ASP H CA  1 
ATOM   2268  C C   . ASP A  1 309 ? 33.71941  6.55087    24.46974  1.000 18.55231  ? 289  ASP H C   1 
ATOM   2269  O O   . ASP A  1 309 ? 34.57894  7.33815    24.88474  1.000 17.55303  ? 289  ASP H O   1 
ATOM   2270  C CB  . ASP A  1 309 ? 34.34269  5.05368    22.59851  1.000 18.02517  ? 289  ASP H CB  1 
ATOM   2271  C CG  . ASP A  1 309 ? 34.72313  3.67645    22.14197  1.000 24.14432  ? 289  ASP H CG  1 
ATOM   2272  O OD1 . ASP A  1 309 ? 35.59353  3.06827    22.78483  1.000 25.26423  ? 289  ASP H OD1 1 
ATOM   2273  O OD2 . ASP A  1 309 ? 34.23484  3.25781    21.08030  1.000 28.50947  ? 289  ASP H OD2 1 
ATOM   2274  N N   . LEU A  1 310 ? 32.44067  6.89400    24.34234  1.000 17.76834  ? 290  LEU H N   1 
ATOM   2275  C CA  . LEU A  1 310 ? 31.94325  8.21720    24.69595  1.000 18.45759  ? 290  LEU H CA  1 
ATOM   2276  C C   . LEU A  1 310 ? 31.20174  8.12915    26.02029  1.000 17.96693  ? 290  LEU H C   1 
ATOM   2277  O O   . LEU A  1 310 ? 30.34471  7.25202    26.18985  1.000 15.90059  ? 290  LEU H O   1 
ATOM   2278  C CB  . LEU A  1 310 ? 31.00748  8.74243    23.60155  1.000 19.46671  ? 290  LEU H CB  1 
ATOM   2279  C CG  . LEU A  1 310 ? 30.44669  10.11884   23.95001  1.000 18.46164  ? 290  LEU H CG  1 
ATOM   2280  C CD1 . LEU A  1 310 ? 31.61910  11.13233   24.00053  1.000 17.59833  ? 290  LEU H CD1 1 
ATOM   2281  C CD2 . LEU A  1 310 ? 29.39030  10.53286   22.94402  1.000 14.00274  ? 290  LEU H CD2 1 
ATOM   2282  N N   . ASP A  1 311 ? 31.51780  9.03601    26.95708  1.000 15.43996  ? 291  ASP H N   1 
ATOM   2283  C CA  . ASP A  1 311 ? 30.86673  9.03781    28.26698  1.000 14.85631  ? 291  ASP H CA  1 
ATOM   2284  C C   . ASP A  1 311 ? 29.72647  10.05821   28.25318  1.000 16.87666  ? 291  ASP H C   1 
ATOM   2285  O O   . ASP A  1 311 ? 29.94849  11.25986   28.42187  1.000 17.45441  ? 291  ASP H O   1 
ATOM   2286  C CB  . ASP A  1 311 ? 31.89705  9.32071    29.36215  1.000 15.94720  ? 291  ASP H CB  1 
ATOM   2287  C CG  . ASP A  1 311 ? 31.27024  9.41100    30.73946  1.000 19.94250  ? 291  ASP H CG  1 
ATOM   2288  O OD1 . ASP A  1 311 ? 31.97506  9.86485    31.66558  1.000 22.56732  ? 291  ASP H OD1 1 
ATOM   2289  O OD2 . ASP A  1 311 ? 30.07280  9.06616    30.90391  1.000 21.22865  ? 291  ASP H OD2 1 
ATOM   2290  N N   . ILE A  1 312 ? 28.49125  9.59334    28.04711  1.000 12.68398  ? 292  ILE H N   1 
ATOM   2291  C CA  . ILE A  1 312 ? 27.39089  10.55283   27.97676  1.000 13.11381  ? 292  ILE H CA  1 
ATOM   2292  C C   . ILE A  1 312 ? 26.87599  10.91728   29.35643  1.000 14.19131  ? 292  ILE H C   1 
ATOM   2293  O O   . ILE A  1 312 ? 25.93928  11.73116   29.45732  1.000 15.80533  ? 292  ILE H O   1 
ATOM   2294  C CB  . ILE A  1 312 ? 26.22425  10.04357   27.09665  1.000 15.96500  ? 292  ILE H CB  1 
ATOM   2295  C CG1 . ILE A  1 312 ? 25.59726  8.79397    27.70227  1.000 17.76673  ? 292  ILE H CG1 1 
ATOM   2296  C CG2 . ILE A  1 312 ? 26.70690  9.82044    25.60040  1.000 15.71897  ? 292  ILE H CG2 1 
ATOM   2297  C CD1 . ILE A  1 312 ? 24.35653  8.29384    26.87813  1.000 22.52904  ? 292  ILE H CD1 1 
ATOM   2298  N N   . TYR A  1 313 ? 27.44791  10.33158   30.42320  1.000 13.16102  ? 293  TYR H N   1 
ATOM   2299  C CA  . TYR A  1 313 ? 27.10837  10.64958   31.80843  1.000 13.75384  ? 293  TYR H CA  1 
ATOM   2300  C C   . TYR A  1 313 ? 28.06178  11.66902   32.40782  1.000 18.64202  ? 293  TYR H C   1 
ATOM   2301  O O   . TYR A  1 313 ? 27.88686  12.07568   33.56719  1.000 24.24259  ? 293  TYR H O   1 
ATOM   2302  C CB  . TYR A  1 313 ? 27.07438  9.34579    32.64657  1.000 14.36841  ? 293  TYR H CB  1 
ATOM   2303  C CG  . TYR A  1 313 ? 25.95577  8.50329    32.11324  1.000 12.66662  ? 293  TYR H CG  1 
ATOM   2304  C CD1 . TYR A  1 313 ? 24.64394  8.69657    32.56427  1.000 15.82636  ? 293  TYR H CD1 1 
ATOM   2305  C CD2 . TYR A  1 313 ? 26.17513  7.56305    31.12067  1.000 12.27283  ? 293  TYR H CD2 1 
ATOM   2306  C CE1 . TYR A  1 313 ? 23.56915  7.95029    32.03192  1.000 18.16264  ? 293  TYR H CE1 1 
ATOM   2307  C CE2 . TYR A  1 313 ? 25.10489  6.82089    30.56601  1.000 24.08846  ? 293  TYR H CE2 1 
ATOM   2308  C CZ  . TYR A  1 313 ? 23.81301  7.01890    31.05057  1.000 21.53590  ? 293  TYR H CZ  1 
ATOM   2309  O OH  . TYR A  1 313 ? 22.75193  6.32499    30.52356  1.000 25.13265  ? 293  TYR H OH  1 
ATOM   2310  N N   . ASP A  1 314 ? 29.02232  12.14557   31.62306  1.000 18.34884  ? 294  ASP H N   1 
ATOM   2311  C CA  . ASP A  1 314 ? 29.98934  13.10670   32.11885  1.000 20.62670  ? 294  ASP H CA  1 
ATOM   2312  C C   . ASP A  1 314 ? 29.35464  14.46094   32.39795  1.000 22.13110  ? 294  ASP H C   1 
ATOM   2313  O O   . ASP A  1 314 ? 28.59484  14.99415   31.59275  1.000 23.32158  ? 294  ASP H O   1 
ATOM   2314  C CB  . ASP A  1 314 ? 31.11721  13.31043   31.11807  1.000 23.47707  ? 294  ASP H CB  1 
ATOM   2315  C CG  . ASP A  1 314 ? 31.96709  14.51175   31.49486  1.000 25.66483  ? 294  ASP H CG  1 
ATOM   2316  O OD1 . ASP A  1 314 ? 32.56107  14.48745   32.59096  1.000 24.74823  ? 294  ASP H OD1 1 
ATOM   2317  O OD2 . ASP A  1 314 ? 31.97318  15.51198   30.75258  1.000 26.89858  ? 294  ASP H OD2 1 
ATOM   2318  N N   . LYS A  1 315 ? 29.69736  15.04256   33.53910  1.000 20.87891  ? 295  LYS H N   1 
ATOM   2319  C CA  . LYS A  1 315 ? 29.19900  16.36387   33.87712  1.000 20.36222  ? 295  LYS H CA  1 
ATOM   2320  C C   . LYS A  1 315 ? 30.29146  17.41081   33.85311  1.000 21.67953  ? 295  LYS H C   1 
ATOM   2321  O O   . LYS A  1 315 ? 29.99410  18.59952   34.02894  1.000 19.25513  ? 295  LYS H O   1 
ATOM   2322  C CB  . LYS A  1 315 ? 28.54704  16.33950   35.26347  1.000 25.26817  ? 295  LYS H CB  1 
ATOM   2323  C CG  . LYS A  1 315 ? 27.29676  15.47440   35.34853  1.000 30.69669  ? 295  LYS H CG  1 
ATOM   2324  C CD  . LYS A  1 315 ? 26.36146  15.94394   36.46378  1.000 40.61191  ? 295  LYS H CD  1 
ATOM   2325  C CE  . LYS A  1 315 ? 24.89261  15.68573   36.12476  1.000 48.43945  ? 295  LYS H CE  1 
ATOM   2326  N NZ  . LYS A  1 315 ? 24.29197  14.61822   36.97835  1.000 52.96430  ? 295  LYS H NZ  1 
ATOM   2327  N N   . SER A  1 316 ? 31.55062  17.01487   33.66140  1.000 16.83737  ? 296  SER H N   1 
ATOM   2328  C CA  . SER A  1 316 ? 32.58603  18.02969   33.73027  1.000 19.05055  ? 296  SER H CA  1 
ATOM   2329  C C   . SER A  1 316 ? 32.65942  18.85746   32.44483  1.000 18.41173  ? 296  SER H C   1 
ATOM   2330  O O   . SER A  1 316 ? 33.11313  20.01535   32.48216  1.000 21.76001  ? 296  SER H O   1 
ATOM   2331  C CB  . SER A  1 316 ? 33.93103  17.37053   34.04705  1.000 27.94556  ? 296  SER H CB  1 
ATOM   2332  O OG  . SER A  1 316 ? 34.35369  16.54812   32.96051  1.000 30.45572  ? 296  SER H OG  1 
ATOM   2333  N N   . TRP A  1 317 ? 32.24515  18.29713   31.30939  1.000 16.34801  ? 297  TRP H N   1 
ATOM   2334  C CA  . TRP A  1 317 ? 32.23934  19.00817   30.02568  1.000 16.05667  ? 297  TRP H CA  1 
ATOM   2335  C C   . TRP A  1 317 ? 30.90070  18.73698   29.37571  1.000 15.27425  ? 297  TRP H C   1 
ATOM   2336  O O   . TRP A  1 317 ? 30.80190  17.94471   28.42571  1.000 16.80679  ? 297  TRP H O   1 
ATOM   2337  C CB  . TRP A  1 317 ? 33.39504  18.57285   29.12177  1.000 16.46810  ? 297  TRP H CB  1 
ATOM   2338  C CG  . TRP A  1 317 ? 33.65458  19.47714   27.92887  1.000 16.88434  ? 297  TRP H CG  1 
ATOM   2339  C CD1 . TRP A  1 317 ? 33.17247  19.31407   26.65198  1.000 16.59646  ? 297  TRP H CD1 1 
ATOM   2340  C CD2 . TRP A  1 317 ? 34.45188  20.67657   27.90223  1.000 17.79316  ? 297  TRP H CD2 1 
ATOM   2341  N NE1 . TRP A  1 317 ? 33.62944  20.34640   25.84019  1.000 17.69240  ? 297  TRP H NE1 1 
ATOM   2342  C CE2 . TRP A  1 317 ? 34.39531  21.19605   26.58672  1.000 18.01498  ? 297  TRP H CE2 1 
ATOM   2343  C CE3 . TRP A  1 317 ? 35.19043  21.36950   28.86712  1.000 18.53738  ? 297  TRP H CE3 1 
ATOM   2344  C CZ2 . TRP A  1 317 ? 35.07550  22.36904   26.20036  1.000 18.96526  ? 297  TRP H CZ2 1 
ATOM   2345  C CZ3 . TRP A  1 317 ? 35.85559  22.53826   28.48712  1.000 23.86247  ? 297  TRP H CZ3 1 
ATOM   2346  C CH2 . TRP A  1 317 ? 35.78904  23.02241   27.16488  1.000 19.65826  ? 297  TRP H CH2 1 
ATOM   2347  N N   . PRO A  1 318 ? 29.83954  19.37001   29.86240  1.000 15.47236  ? 298  PRO H N   1 
ATOM   2348  C CA  . PRO A  1 318 ? 28.50102  18.89211   29.52871  1.000 14.50983  ? 298  PRO H CA  1 
ATOM   2349  C C   . PRO A  1 318 ? 28.07530  19.31696   28.13836  1.000 15.83613  ? 298  PRO H C   1 
ATOM   2350  O O   . PRO A  1 318 ? 28.54291  20.31607   27.60414  1.000 14.97051  ? 298  PRO H O   1 
ATOM   2351  C CB  . PRO A  1 318 ? 27.59999  19.52182   30.59392  1.000 14.38251  ? 298  PRO H CB  1 
ATOM   2352  C CG  . PRO A  1 318 ? 28.34824  20.77844   31.00021  1.000 15.80634  ? 298  PRO H CG  1 
ATOM   2353  C CD  . PRO A  1 318 ? 29.84715  20.47308   30.84726  1.000 17.12047  ? 298  PRO H CD  1 
ATOM   2354  N N   . ILE A  1 319 ? 27.17127  18.53247   27.55488  1.000 13.77741  ? 299  ILE H N   1 
ATOM   2355  C CA  . ILE A  1 319 ? 26.60772  18.86141   26.25184  1.000 13.80032  ? 299  ILE H CA  1 
ATOM   2356  C C   . ILE A  1 319 ? 25.23092  19.48955   26.48142  1.000 15.52463  ? 299  ILE H C   1 
ATOM   2357  O O   . ILE A  1 319 ? 24.26481  18.79676   26.83949  1.000 13.22249  ? 299  ILE H O   1 
ATOM   2358  C CB  . ILE A  1 319 ? 26.50062  17.62157   25.37198  1.000 13.44164  ? 299  ILE H CB  1 
ATOM   2359  C CG1 . ILE A  1 319 ? 27.87523  16.96734   25.22389  1.000 16.14616  ? 299  ILE H CG1 1 
ATOM   2360  C CG2 . ILE A  1 319 ? 25.92389  18.05170   23.97182  1.000 13.64038  ? 299  ILE H CG2 1 
ATOM   2361  C CD1 . ILE A  1 319 ? 28.98739  17.96472   24.81187  1.000 14.41132  ? 299  ILE H CD1 1 
ATOM   2362  N N   . TRP A  1 320 ? 25.13113  20.79637   26.24746  1.000 14.21809  ? 300  TRP H N   1 
ATOM   2363  C CA  . TRP A  1 320 ? 23.83513  21.45074   26.30696  1.000 15.87570  ? 300  TRP H CA  1 
ATOM   2364  C C   . TRP A  1 320 ? 23.02619  21.09979   25.05353  1.000 17.23752  ? 300  TRP H C   1 
ATOM   2365  O O   . TRP A  1 320 ? 23.58371  20.89762   23.97972  1.000 14.32123  ? 300  TRP H O   1 
ATOM   2366  C CB  . TRP A  1 320 ? 24.00725  22.97176   26.40277  1.000 15.03945  ? 300  TRP H CB  1 
ATOM   2367  C CG  . TRP A  1 320 ? 22.70224  23.66572   26.52590  1.000 15.24211  ? 300  TRP H CG  1 
ATOM   2368  C CD1 . TRP A  1 320 ? 21.96446  24.22754   25.50413  1.000 15.61675  ? 300  TRP H CD1 1 
ATOM   2369  C CD2 . TRP A  1 320 ? 21.91920  23.82395   27.72410  1.000 15.19445  ? 300  TRP H CD2 1 
ATOM   2370  N NE1 . TRP A  1 320 ? 20.80713  24.76062   26.00747  1.000 15.82746  ? 300  TRP H NE1 1 
ATOM   2371  C CE2 . TRP A  1 320 ? 20.74407  24.52459   27.36118  1.000 15.71306  ? 300  TRP H CE2 1 
ATOM   2372  C CE3 . TRP A  1 320 ? 22.10837  23.45925   29.07030  1.000 14.99751  ? 300  TRP H CE3 1 
ATOM   2373  C CZ2 . TRP A  1 320 ? 19.75282  24.86912   28.29698  1.000 18.95785  ? 300  TRP H CZ2 1 
ATOM   2374  C CZ3 . TRP A  1 320 ? 21.11784  23.82639   30.02241  1.000 20.00009  ? 300  TRP H CZ3 1 
ATOM   2375  C CH2 . TRP A  1 320 ? 19.96177  24.51691   29.62156  1.000 19.80033  ? 300  TRP H CH2 1 
ATOM   2376  N N   . THR A  1 321 ? 21.69950  21.00265   25.20321  1.000 13.99314  ? 301  THR H N   1 
ATOM   2377  C CA  . THR A  1 321 ? 20.82856  20.74500   24.05007  1.000 14.03535  ? 301  THR H CA  1 
ATOM   2378  C C   . THR A  1 321 ? 19.42785  21.26440   24.36130  1.000 14.23706  ? 301  THR H C   1 
ATOM   2379  O O   . THR A  1 321 ? 19.17165  21.76666   25.44480  1.000 14.32138  ? 301  THR H O   1 
ATOM   2380  C CB  . THR A  1 321 ? 20.79689  19.25273   23.70923  1.000 13.46826  ? 301  THR H CB  1 
ATOM   2381  O OG1 . THR A  1 321 ? 20.18265  19.07713   22.42022  1.000 13.68773  ? 301  THR H OG1 1 
ATOM   2382  C CG2 . THR A  1 321 ? 19.98291  18.46176   24.74932  1.000 12.97940  ? 301  THR H CG2 1 
ATOM   2383  N N   . TYR A  1 322 ? 18.50850  21.15290   23.38368  1.000 14.43883  ? 302  TYR H N   1 
ATOM   2384  C CA  . TYR A  1 322 ? 17.11223  21.44660   23.65382  1.000 14.67927  ? 302  TYR H CA  1 
ATOM   2385  C C   . TYR A  1 322 ? 16.49451  20.24078   24.35782  1.000 14.07226  ? 302  TYR H C   1 
ATOM   2386  O O   . TYR A  1 322 ? 16.54720  19.12020   23.83246  1.000 13.68689  ? 302  TYR H O   1 
ATOM   2387  C CB  . TYR A  1 322 ? 16.33672  21.73736   22.37344  1.000 15.44225  ? 302  TYR H CB  1 
ATOM   2388  C CG  . TYR A  1 322 ? 14.87304  21.97254   22.69529  1.000 16.32031  ? 302  TYR H CG  1 
ATOM   2389  C CD1 . TYR A  1 322 ? 14.49423  23.03237   23.50394  1.000 16.06618  ? 302  TYR H CD1 1 
ATOM   2390  C CD2 . TYR A  1 322 ? 13.88388  21.09303   22.23391  1.000 21.29926  ? 302  TYR H CD2 1 
ATOM   2391  C CE1 . TYR A  1 322 ? 13.14727  23.25042   23.83170  1.000 16.74746  ? 302  TYR H CE1 1 
ATOM   2392  C CE2 . TYR A  1 322 ? 12.53016  21.30716   22.55292  1.000 21.73602  ? 302  TYR H CE2 1 
ATOM   2393  C CZ  . TYR A  1 322 ? 12.18659  22.39364   23.35127  1.000 19.96867  ? 302  TYR H CZ  1 
ATOM   2394  O OH  . TYR A  1 322 ? 10.87663  22.64222   23.68722  1.000 22.52794  ? 302  TYR H OH  1 
ATOM   2395  N N   . ALA A  1 323 ? 15.90580  20.46864   25.53209  1.000 14.09556  ? 303  ALA H N   1 
ATOM   2396  C CA  . ALA A  1 323 ? 15.26147  19.39801   26.28944  1.000 16.05004  ? 303  ALA H CA  1 
ATOM   2397  C C   . ALA A  1 323 ? 13.97103  19.90969   26.90565  1.000 16.55753  ? 303  ALA H C   1 
ATOM   2398  O O   . ALA A  1 323 ? 13.89589  21.06957   27.31000  1.000 14.70786  ? 303  ALA H O   1 
ATOM   2399  C CB  . ALA A  1 323 ? 16.14378  18.85328   27.42931  1.000 17.42842  ? 303  ALA H CB  1 
ATOM   2400  N N   . GLU A  1 324 ? 12.96142  19.04044   26.95816  1.000 15.12146  ? 304  GLU H N   1 
ATOM   2401  C CA  . GLU A  1 324 ? 11.71149  19.31569   27.63786  1.000 14.60135  ? 304  GLU H CA  1 
ATOM   2402  C C   . GLU A  1 324 ? 11.59530  18.42194   28.86142  1.000 14.84848  ? 304  GLU H C   1 
ATOM   2403  O O   . GLU A  1 324 ? 12.21916  17.35920   28.94615  1.000 14.76962  ? 304  GLU H O   1 
ATOM   2404  C CB  . GLU A  1 324 ? 10.51033  19.09809   26.70415  1.000 14.98694  ? 304  GLU H CB  1 
ATOM   2405  C CG  . GLU A  1 324 ? 10.51215  20.07441   25.50047  1.000 17.51343  ? 304  GLU H CG  1 
ATOM   2406  C CD  . GLU A  1 324 ? 9.38410   19.78826   24.48033  1.000 28.05429  ? 304  GLU H CD  1 
ATOM   2407  O OE1 . GLU A  1 324 ? 8.61890   18.82117   24.67811  1.000 28.94219  ? 304  GLU H OE1 1 
ATOM   2408  O OE2 . GLU A  1 324 ? 9.25718   20.54976   23.49753  1.000 26.61052  ? 304  GLU H OE2 1 
ATOM   2409  N N   . ILE A  1 325 ? 10.82443  18.90010   29.82906  1.000 14.73573  ? 305  ILE H N   1 
ATOM   2410  C CA  . ILE A  1 325 ? 10.38417  18.04168   30.91985  1.000 14.67067  ? 305  ILE H CA  1 
ATOM   2411  C C   . ILE A  1 325 ? 9.70616   16.81972   30.32240  1.000 14.53862  ? 305  ILE H C   1 
ATOM   2412  O O   . ILE A  1 325 ? 8.69335   16.93050   29.61873  1.000 16.67087  ? 305  ILE H O   1 
ATOM   2413  C CB  . ILE A  1 325 ? 9.44279   18.80116   31.85565  1.000 15.47079  ? 305  ILE H CB  1 
ATOM   2414  C CG1 . ILE A  1 325 ? 10.12365  20.07081   32.35302  1.000 20.30048  ? 305  ILE H CG1 1 
ATOM   2415  C CG2 . ILE A  1 325 ? 9.00245   17.91193   33.01122  1.000 19.49698  ? 305  ILE H CG2 1 
ATOM   2416  C CD1 . ILE A  1 325 ? 9.19849   20.88204   33.25441  1.000 20.33982  ? 305  ILE H CD1 1 
ATOM   2417  N N   . THR A  1 326 ? 10.26820  15.65140   30.58373  1.000 16.85402  ? 306  THR H N   1 
ATOM   2418  C CA  . THR A  1 326 ? 9.77237   14.42111   30.02660  1.000 18.09435  ? 306  THR H CA  1 
ATOM   2419  C C   . THR A  1 326 ? 9.46217   13.42663   31.13416  1.000 17.28468  ? 306  THR H C   1 
ATOM   2420  O O   . THR A  1 326 ? 10.19052  13.35971   32.13060  1.000 18.75781  ? 306  THR H O   1 
ATOM   2421  C CB  . THR A  1 326 ? 10.78934  13.81017   29.07024  1.000 30.58245  ? 306  THR H CB  1 
ATOM   2422  O OG1 . THR A  1 326 ? 11.91130  13.35089   29.82160  1.000 41.08959  ? 306  THR H OG1 1 
ATOM   2423  C CG2 . THR A  1 326 ? 11.29606  14.85282   28.12491  1.000 23.96924  ? 306  THR H CG2 1 
ATOM   2424  N N   . PRO A  1 327 ? 8.39307   12.65519   31.01367  1.000 19.74003  ? 307  PRO H N   1 
ATOM   2425  C CA  . PRO A  1 327 ? 8.11443   11.64634   32.04326  1.000 20.57154  ? 307  PRO H CA  1 
ATOM   2426  C C   . PRO A  1 327 ? 9.13447   10.52209   31.97647  1.000 18.78541  ? 307  PRO H C   1 
ATOM   2427  O O   . PRO A  1 327 ? 9.92548   10.43853   31.01802  1.000 17.54450  ? 307  PRO H O   1 
ATOM   2428  C CB  . PRO A  1 327 ? 6.68493   11.17173   31.71099  1.000 22.03635  ? 307  PRO H CB  1 
ATOM   2429  C CG  . PRO A  1 327 ? 6.37085   11.66321   30.36262  1.000 20.91264  ? 307  PRO H CG  1 
ATOM   2430  C CD  . PRO A  1 327 ? 7.26103   12.87734   30.11027  1.000 19.62252  ? 307  PRO H CD  1 
ATOM   2431  N N   . PRO A  1 328 ? 9.20394   9.65613    32.99789  1.000 20.53728  ? 308  PRO H N   1 
ATOM   2432  C CA  . PRO A  1 328 ? 10.22219  8.59267    32.95910  1.000 15.57405  ? 308  PRO H CA  1 
ATOM   2433  C C   . PRO A  1 328 ? 9.87293   7.50581    31.95117  1.000 16.62119  ? 308  PRO H C   1 
ATOM   2434  O O   . PRO A  1 328 ? 8.84415   7.57128    31.28152  1.000 15.51018  ? 308  PRO H O   1 
ATOM   2435  C CB  . PRO A  1 328 ? 10.25194  8.05078    34.39476  1.000 13.65323  ? 308  PRO H CB  1 
ATOM   2436  C CG  . PRO A  1 328 ? 8.85171   8.42353    34.96370  1.000 23.64936  ? 308  PRO H CG  1 
ATOM   2437  C CD  . PRO A  1 328 ? 8.40101   9.65593    34.24421  1.000 21.09618  ? 308  PRO H CD  1 
ATOM   2438  N N   . ALA A  1 329 ? 10.78648  6.55286    31.79404  1.000 17.73218  ? 309  ALA H N   1 
ATOM   2439  C CA  . ALA A  1 329 ? 10.54639  5.35857    30.99546  1.000 15.71204  ? 309  ALA H CA  1 
ATOM   2440  C C   . ALA A  1 329 ? 9.75072   4.35507    31.81486  1.000 13.52174  ? 309  ALA H C   1 
ATOM   2441  O O   . ALA A  1 329 ? 9.85278   4.32775    33.03015  1.000 13.74254  ? 309  ALA H O   1 
ATOM   2442  C CB  . ALA A  1 329 ? 11.86958  4.72655    30.58094  1.000 12.54592  ? 309  ALA H CB  1 
ATOM   2443  N N   . LYS A  1 330 ? 8.98094   3.50395    31.13170  1.000 13.84534  ? 310  LYS H N   1 
ATOM   2444  C CA  . LYS A  1 330 ? 8.09018   2.55459    31.80258  1.000 14.52206  ? 310  LYS H CA  1 
ATOM   2445  C C   . LYS A  1 330 ? 8.20117   1.20836    31.09826  1.000 14.65025  ? 310  LYS H C   1 
ATOM   2446  O O   . LYS A  1 330 ? 8.19896   1.14184    29.85432  1.000 14.49996  ? 310  LYS H O   1 
ATOM   2447  C CB  . LYS A  1 330 ? 6.62784   3.07346    31.75234  1.000 15.12257  ? 310  LYS H CB  1 
ATOM   2448  C CG  . LYS A  1 330 ? 5.55393   2.14602    32.38966  1.000 16.97875  ? 310  LYS H CG  1 
ATOM   2449  C CD  . LYS A  1 330 ? 4.16638   2.84578    32.41754  1.000 20.87930  ? 310  LYS H CD  1 
ATOM   2450  C CE  . LYS A  1 330 ? 3.05037   2.04258    33.17034  1.000 20.12905  ? 310  LYS H CE  1 
ATOM   2451  N NZ  . LYS A  1 330 ? 3.45384   1.76438    34.56354  1.000 22.01655  ? 310  LYS H NZ  1 
ATOM   2452  N N   . PHE A  1 331 ? 8.28418   0.13390    31.88873  1.000 15.04452  ? 311  PHE H N   1 
ATOM   2453  C CA  . PHE A  1 331 ? 8.33970   -1.22787   31.37745  1.000 15.61500  ? 311  PHE H CA  1 
ATOM   2454  C C   . PHE A  1 331 ? 7.14268   -1.95704   31.96783  1.000 16.26356  ? 311  PHE H C   1 
ATOM   2455  O O   . PHE A  1 331 ? 6.96972   -1.94775   33.18947  1.000 16.62933  ? 311  PHE H O   1 
ATOM   2456  C CB  . PHE A  1 331 ? 9.64754   -1.92197   31.78651  1.000 15.32477  ? 311  PHE H CB  1 
ATOM   2457  C CG  . PHE A  1 331 ? 10.86190  -1.16484   31.34530  1.000 16.55211  ? 311  PHE H CG  1 
ATOM   2458  C CD1 . PHE A  1 331 ? 11.45577  -1.46093   30.14322  1.000 17.25505  ? 311  PHE H CD1 1 
ATOM   2459  C CD2 . PHE A  1 331 ? 11.40924  -0.15922   32.14405  1.000 20.29551  ? 311  PHE H CD2 1 
ATOM   2460  C CE1 . PHE A  1 331 ? 12.56418  -0.75364   29.71062  1.000 16.22881  ? 311  PHE H CE1 1 
ATOM   2461  C CE2 . PHE A  1 331 ? 12.53084  0.55911    31.71471  1.000 19.44040  ? 311  PHE H CE2 1 
ATOM   2462  C CZ  . PHE A  1 331 ? 13.09887  0.24463    30.47167  1.000 19.42353  ? 311  PHE H CZ  1 
ATOM   2463  N N   . VAL A  1 332 ? 6.31911   -2.57126   31.12040  1.000 16.73766  ? 312  VAL H N   1 
ATOM   2464  C CA  . VAL A  1 332 ? 5.20560   -3.35311   31.65120  1.000 20.17170  ? 312  VAL H CA  1 
ATOM   2465  C C   . VAL A  1 332 ? 5.04276   -4.68925   30.94455  1.000 18.27178  ? 312  VAL H C   1 
ATOM   2466  O O   . VAL A  1 332 ? 5.53931   -4.91277   29.83932  1.000 17.93935  ? 312  VAL H O   1 
ATOM   2467  C CB  . VAL A  1 332 ? 3.85671   -2.61453   31.62073  1.000 24.40703  ? 312  VAL H CB  1 
ATOM   2468  C CG1 . VAL A  1 332 ? 3.80345   -1.60453   32.78343  1.000 28.94007  ? 312  VAL H CG1 1 
ATOM   2469  C CG2 . VAL A  1 332 ? 3.65503   -1.94183   30.29784  1.000 21.64792  ? 312  VAL H CG2 1 
ATOM   2470  N N   . HIS A  1 333 ? 4.29742   -5.55394   31.63129  1.000 19.23079  ? 313  HIS H N   1 
ATOM   2471  C CA  . HIS A  1 333 ? 3.96256   -6.92809   31.29845  1.000 23.31136  ? 313  HIS H CA  1 
ATOM   2472  C C   . HIS A  1 333 ? 5.11297   -7.86848   31.62976  1.000 22.92059  ? 313  HIS H C   1 
ATOM   2473  O O   . HIS A  1 333 ? 6.29023   -7.55318   31.42371  1.000 19.15656  ? 313  HIS H O   1 
ATOM   2474  C CB  . HIS A  1 333 ? 3.50517   -7.05449   29.84138  1.000 24.19464  ? 313  HIS H CB  1 
ATOM   2475  C CG  . HIS A  1 333 ? 2.17855   -6.40530   29.58799  1.000 23.94279  ? 313  HIS H CG  1 
ATOM   2476  N ND1 . HIS A  1 333 ? 1.99157   -5.40820   28.65099  1.000 24.55088  ? 313  HIS H ND1 1 
ATOM   2477  C CD2 . HIS A  1 333 ? 0.99852   -6.54897   30.22767  1.000 22.18720  ? 313  HIS H CD2 1 
ATOM   2478  C CE1 . HIS A  1 333 ? 0.72985   -5.01318   28.68327  1.000 22.88853  ? 313  HIS H CE1 1 
ATOM   2479  N NE2 . HIS A  1 333 ? 0.10450   -5.69575   29.63032  1.000 28.88396  ? 313  HIS H NE2 1 
ATOM   2480  N N   . ASP A  1 334 ? 4.76402   -9.04502   32.14072  1.000 20.99400  ? 314  ASP H N   1 
ATOM   2481  C CA  . ASP A  1 334 ? 5.77549   -9.98227   32.61407  1.000 24.71118  ? 314  ASP H CA  1 
ATOM   2482  C C   . ASP A  1 334 ? 5.10258   -11.32066  32.87796  1.000 31.00477  ? 314  ASP H C   1 
ATOM   2483  O O   . ASP A  1 334 ? 4.76331   -11.63761  34.02205  1.000 31.27062  ? 314  ASP H O   1 
ATOM   2484  C CB  . ASP A  1 334 ? 6.46867   -9.45004   33.86851  1.000 24.67327  ? 314  ASP H CB  1 
ATOM   2485  C CG  . ASP A  1 334 ? 7.59287   -10.37197  34.36463  1.000 32.91229  ? 314  ASP H CG  1 
ATOM   2486  O OD1 . ASP A  1 334 ? 8.19908   -11.09485  33.53871  1.000 32.68481  ? 314  ASP H OD1 1 
ATOM   2487  O OD2 . ASP A  1 334 ? 7.86143   -10.38039  35.58674  1.000 34.95184  ? 314  ASP H OD2 1 
ATOM   2488  N N   . ASP A  1 335 ? 4.85467   -12.08242  31.81640  1.000 31.06217  ? 315  ASP H N   1 
ATOM   2489  C CA  . ASP A  1 335 ? 4.12921   -13.33678  31.94952  1.000 32.71924  ? 315  ASP H CA  1 
ATOM   2490  C C   . ASP A  1 335 ? 4.75165   -14.35288  31.00675  1.000 34.18138  ? 315  ASP H C   1 
ATOM   2491  O O   . ASP A  1 335 ? 5.82036   -14.12192  30.43390  1.000 34.09434  ? 315  ASP H O   1 
ATOM   2492  C CB  . ASP A  1 335 ? 2.62906   -13.15234  31.67881  1.000 35.16416  ? 315  ASP H CB  1 
ATOM   2493  C CG  . ASP A  1 335 ? 2.33042   -12.59309  30.30709  1.000 36.43023  ? 315  ASP H CG  1 
ATOM   2494  O OD1 . ASP A  1 335 ? 3.01928   -12.93737  29.31505  1.000 36.90891  ? 315  ASP H OD1 1 
ATOM   2495  O OD2 . ASP A  1 335 ? 1.36990   -11.79365  30.21503  1.000 41.17735  ? 315  ASP H OD2 1 
ATOM   2496  N N   . GLU A  1 336 ? 4.05741   -15.48708  30.84826  1.000 38.10145  ? 316  GLU H N   1 
ATOM   2497  C CA  . GLU A  1 336 ? 4.58880   -16.59142  30.05178  1.000 43.77791  ? 316  GLU H CA  1 
ATOM   2498  C C   . GLU A  1 336 ? 4.92306   -16.16215  28.63012  1.000 38.22422  ? 316  GLU H C   1 
ATOM   2499  O O   . GLU A  1 336 ? 5.87076   -16.69084  28.03824  1.000 38.36150  ? 316  GLU H O   1 
ATOM   2500  C CB  . GLU A  1 336 ? 3.58464   -17.76903  30.04877  1.000 53.03766  ? 316  GLU H CB  1 
ATOM   2501  C CG  . GLU A  1 336 ? 2.39206   -17.52949  29.07590  1.000 66.50560  ? 316  GLU H CG  1 
ATOM   2502  C CD  . GLU A  1 336 ? 1.77229   -18.76611  28.33401  1.000 76.84506  ? 316  GLU H CD  1 
ATOM   2503  O OE1 . GLU A  1 336 ? 0.65988   -19.23026  28.70785  1.000 78.38559  ? 316  GLU H OE1 1 
ATOM   2504  O OE2 . GLU A  1 336 ? 2.38572   -19.25251  27.35230  1.000 79.68946  ? 316  GLU H OE2 1 
ATOM   2505  N N   . ASP A  1 337 ? 4.19301   -15.18497  28.07692  1.000 35.30066  ? 317  ASP H N   1 
ATOM   2506  C CA  . ASP A  1 337 ? 4.26550   -14.86848  26.65481  1.000 33.93589  ? 317  ASP H CA  1 
ATOM   2507  C C   . ASP A  1 337 ? 4.89851   -13.52610  26.32115  1.000 28.60481  ? 317  ASP H C   1 
ATOM   2508  O O   . ASP A  1 337 ? 5.32655   -13.33612  25.17604  1.000 32.07497  ? 317  ASP H O   1 
ATOM   2509  C CB  . ASP A  1 337 ? 2.86641   -14.86379  26.02682  1.000 37.69545  ? 317  ASP H CB  1 
ATOM   2510  C CG  . ASP A  1 337 ? 2.14774   -16.19746  26.16474  1.000 44.90203  ? 317  ASP H CG  1 
ATOM   2511  O OD1 . ASP A  1 337 ? 2.74065   -17.21436  25.73610  1.000 44.32291  ? 317  ASP H OD1 1 
ATOM   2512  O OD2 . ASP A  1 337 ? 1.01062   -16.22400  26.70081  1.000 42.92806  ? 317  ASP H OD2 1 
ATOM   2513  N N   . ARG A  1 338 ? 4.92002   -12.57443  27.25186  1.000 24.76798  ? 318  ARG H N   1 
ATOM   2514  C CA  . ARG A  1 338 ? 5.43980   -11.25645  26.94768  1.000 21.91577  ? 318  ARG H CA  1 
ATOM   2515  C C   . ARG A  1 338 ? 6.06439   -10.66268  28.20015  1.000 23.19660  ? 318  ARG H C   1 
ATOM   2516  O O   . ARG A  1 338 ? 5.59511   -10.88607  29.32294  1.000 24.00522  ? 318  ARG H O   1 
ATOM   2517  C CB  . ARG A  1 338 ? 4.36369   -10.30316  26.42466  1.000 23.77945  ? 318  ARG H CB  1 
ATOM   2518  C CG  . ARG A  1 338 ? 3.14825   -10.23895  27.29566  1.000 25.35172  ? 318  ARG H CG  1 
ATOM   2519  C CD  . ARG A  1 338 ? 2.16591   -9.22595   26.75400  1.000 25.91689  ? 318  ARG H CD  1 
ATOM   2520  N NE  . ARG A  1 338 ? 0.93269   -9.29335   27.51076  1.000 28.05651  ? 318  ARG H NE  1 
ATOM   2521  C CZ  . ARG A  1 338 ? -0.10155  -8.48498   27.33305  1.000 28.37324  ? 318  ARG H CZ  1 
ATOM   2522  N NH1 . ARG A  1 338 ? -0.04668  -7.51454   26.42567  1.000 26.39664  ? 318  ARG H NH1 1 
ATOM   2523  N NH2 . ARG A  1 338 ? -1.18541  -8.64781   28.07657  1.000 28.36709  ? 318  ARG H NH2 1 
ATOM   2524  N N   . ARG A  1 339 ? 7.12765   -9.91203   27.98130  1.000 23.03455  ? 319  ARG H N   1 
ATOM   2525  C CA  . ARG A  1 339 ? 7.71566   -9.12162   29.05620  1.000 19.05486  ? 319  ARG H CA  1 
ATOM   2526  C C   . ARG A  1 339 ? 8.31319   -7.87467   28.43978  1.000 22.25304  ? 319  ARG H C   1 
ATOM   2527  O O   . ARG A  1 339 ? 9.03125   -7.95199   27.43266  1.000 23.73008  ? 319  ARG H O   1 
ATOM   2528  C CB  . ARG A  1 339 ? 8.74655   -9.93419   29.81825  1.000 20.95189  ? 319  ARG H CB  1 
ATOM   2529  C CG  . ARG A  1 339 ? 9.55111   -9.07314   30.78593  1.000 25.28125  ? 319  ARG H CG  1 
ATOM   2530  C CD  . ARG A  1 339 ? 10.86598  -9.67291   30.97827  1.000 32.95478  ? 319  ARG H CD  1 
ATOM   2531  N NE  . ARG A  1 339 ? 10.70613  -10.94693  31.63978  1.000 41.04203  ? 319  ARG H NE  1 
ATOM   2532  C CZ  . ARG A  1 339 ? 11.69440  -11.82000  31.75140  1.000 48.32146  ? 319  ARG H CZ  1 
ATOM   2533  N NH1 . ARG A  1 339 ? 12.88211  -11.54033  31.21874  1.000 50.27200  ? 319  ARG H NH1 1 
ATOM   2534  N NH2 . ARG A  1 339 ? 11.49856  -12.96625  32.37903  1.000 48.34209  ? 319  ARG H NH2 1 
ATOM   2535  N N   . GLY A  1 340 ? 7.94158   -6.72397   28.98188  1.000 18.66649  ? 320  GLY H N   1 
ATOM   2536  C CA  . GLY A  1 340 ? 8.57137   -5.48909   28.57492  1.000 16.64730  ? 320  GLY H CA  1 
ATOM   2537  C C   . GLY A  1 340 ? 9.84901   -5.29306   29.37313  1.000 17.79596  ? 320  GLY H C   1 
ATOM   2538  O O   . GLY A  1 340 ? 9.79299   -5.16492   30.59881  1.000 19.47740  ? 320  GLY H O   1 
ATOM   2539  N N   . SER A  1 341 ? 11.01404  -5.28743   28.71727  1.000 15.68199  ? 321  SER H N   1 
ATOM   2540  C CA  . SER A  1 341 ? 12.26189  -5.08909   29.45599  1.000 16.06029  ? 321  SER H CA  1 
ATOM   2541  C C   . SER A  1 341 ? 13.37168  -4.74763   28.47884  1.000 17.65585  ? 321  SER H C   1 
ATOM   2542  O O   . SER A  1 341 ? 13.29964  -5.09417   27.29544  1.000 19.04374  ? 321  SER H O   1 
ATOM   2543  C CB  . SER A  1 341 ? 12.65552  -6.32519   30.27964  1.000 18.50255  ? 321  SER H CB  1 
ATOM   2544  O OG  . SER A  1 341 ? 13.21072  -7.31528   29.42091  1.000 28.35766  ? 321  SER H OG  1 
ATOM   2545  N N   . ALA A  1 342 ? 14.42418  -4.10452   29.00302  1.000 14.77782  ? 322  ALA H N   1 
ATOM   2546  C CA  . ALA A  1 342 ? 15.59827  -3.73228   28.21201  1.000 16.29975  ? 322  ALA H CA  1 
ATOM   2547  C C   . ALA A  1 342 ? 16.85877  -4.33382   28.83194  1.000 19.93754  ? 322  ALA H C   1 
ATOM   2548  O O   . ALA A  1 342 ? 17.04241  -4.28537   30.05918  1.000 18.53872  ? 322  ALA H O   1 
ATOM   2549  C CB  . ALA A  1 342 ? 15.69759  -2.19508   28.08170  1.000 15.20398  ? 322  ALA H CB  1 
ATOM   2550  N N   . VAL A  1 343 ? 17.70136  -4.95024   27.99345  1.000 14.33552  ? 323  VAL H N   1 
ATOM   2551  C CA  . VAL A  1 343 ? 19.00944  -5.46456   28.40257  1.000 14.62253  ? 323  VAL H CA  1 
ATOM   2552  C C   . VAL A  1 343 ? 20.05470  -4.86512   27.46929  1.000 14.37089  ? 323  VAL H C   1 
ATOM   2553  O O   . VAL A  1 343 ? 19.80204  -4.70123   26.26097  1.000 14.20212  ? 323  VAL H O   1 
ATOM   2554  C CB  . VAL A  1 343 ? 19.11643  -7.01360   28.35304  1.000 18.90660  ? 323  VAL H CB  1 
ATOM   2555  C CG1 . VAL A  1 343 ? 18.20383  -7.65321   29.41042  1.000 23.89216  ? 323  VAL H CG1 1 
ATOM   2556  C CG2 . VAL A  1 343 ? 18.75352  -7.52040   26.98566  1.000 21.97182  ? 323  VAL H CG2 1 
ATOM   2557  N N   . SER A  1 344 ? 21.21733  -4.54727   28.03620  1.000 14.29491  ? 324  SER H N   1 
ATOM   2558  C CA  . SER A  1 344 ? 22.32101  -3.95605   27.29893  1.000 16.63956  ? 324  SER H CA  1 
ATOM   2559  C C   . SER A  1 344 ? 21.84536  -2.82264   26.39627  1.000 17.61036  ? 324  SER H C   1 
ATOM   2560  O O   . SER A  1 344 ? 22.14670  -2.76907   25.19699  1.000 13.90438  ? 324  SER H O   1 
ATOM   2561  C CB  . SER A  1 344 ? 23.07024  -5.04421   26.52170  1.000 16.29912  ? 324  SER H CB  1 
ATOM   2562  O OG  . SER A  1 344 ? 23.30705  -6.17282   27.34087  1.000 15.44545  ? 324  SER H OG  1 
ATOM   2563  N N   . SER A  1 345 ? 21.06061  -1.90476   26.96555  1.000 13.07939  ? 325  SER H N   1 
ATOM   2564  C CA  . SER A  1 345 ? 20.40540  -0.88779   26.16747  1.000 12.65789  ? 325  SER H CA  1 
ATOM   2565  C C   . SER A  1 345 ? 20.35939  0.45252    26.89222  1.000 12.21069  ? 325  SER H C   1 
ATOM   2566  O O   . SER A  1 345 ? 20.46660  0.53828    28.11662  1.000 12.78112  ? 325  SER H O   1 
ATOM   2567  C CB  . SER A  1 345 ? 18.96351  -1.27186   25.82196  1.000 13.06144  ? 325  SER H CB  1 
ATOM   2568  O OG  . SER A  1 345 ? 18.84808  -2.39244   24.92782  1.000 13.76749  ? 325  SER H OG  1 
ATOM   2569  N N   . VAL A  1 346 ? 20.13911  1.49238    26.10683  1.000 11.92445  ? 326  VAL H N   1 
ATOM   2570  C CA  . VAL A  1 346 ? 20.04535  2.86672    26.57625  1.000 11.58398  ? 326  VAL H CA  1 
ATOM   2571  C C   . VAL A  1 346 ? 18.63377  3.31261    26.26203  1.000 16.60534  ? 326  VAL H C   1 
ATOM   2572  O O   . VAL A  1 346 ? 18.19764  3.20982    25.10598  1.000 13.30845  ? 326  VAL H O   1 
ATOM   2573  C CB  . VAL A  1 346 ? 21.10484  3.74101    25.88423  1.000 15.88904  ? 326  VAL H CB  1 
ATOM   2574  C CG1 . VAL A  1 346 ? 20.90648  5.19833    26.21212  1.000 11.25577  ? 326  VAL H CG1 1 
ATOM   2575  C CG2 . VAL A  1 346 ? 22.47642  3.26627    26.31997  1.000 11.73567  ? 326  VAL H CG2 1 
ATOM   2576  N N   . VAL A  1 347 ? 17.89119  3.75805    27.27915  1.000 12.92416  ? 327  VAL H N   1 
ATOM   2577  C CA  . VAL A  1 347 ? 16.48208  4.09404    27.07225  1.000 11.47213  ? 327  VAL H CA  1 
ATOM   2578  C C   . VAL A  1 347 ? 16.18527  5.49333    27.61552  1.000 15.62106  ? 327  VAL H C   1 
ATOM   2579  O O   . VAL A  1 347 ? 16.33908  5.74501    28.82050  1.000 13.51541  ? 327  VAL H O   1 
ATOM   2580  C CB  . VAL A  1 347 ? 15.53147  3.06554    27.72097  1.000 11.77458  ? 327  VAL H CB  1 
ATOM   2581  C CG1 . VAL A  1 347 ? 14.10569  3.44482    27.40120  1.000 14.28075  ? 327  VAL H CG1 1 
ATOM   2582  C CG2 . VAL A  1 347 ? 15.81312  1.67685    27.21818  1.000 13.18413  ? 327  VAL H CG2 1 
ATOM   2583  N N   . SER A  1 348 ? 15.73280  6.39679    26.73771  1.000 13.73770  ? 328  SER H N   1 
ATOM   2584  C CA  . SER A  1 348 ? 15.40745  7.77392    27.12625  1.000 13.86514  ? 328  SER H CA  1 
ATOM   2585  C C   . SER A  1 348 ? 14.06238  7.84241    27.84670  1.000 18.45466  ? 328  SER H C   1 
ATOM   2586  O O   . SER A  1 348 ? 13.31424  6.87120    27.91519  1.000 15.28419  ? 328  SER H O   1 
ATOM   2587  C CB  . SER A  1 348 ? 15.35788  8.68825    25.89695  1.000 14.13321  ? 328  SER H CB  1 
ATOM   2588  O OG  . SER A  1 348 ? 16.57174  8.61556    25.18526  1.000 16.06938  ? 328  SER H OG  1 
ATOM   2589  N N   . GLY A  1 349 ? 13.74959  9.02334    28.38664  1.000 20.04375  ? 329  GLY H N   1 
ATOM   2590  C CA  . GLY A  1 349 ? 12.47118  9.21678    29.04382  1.000 18.75211  ? 329  GLY H CA  1 
ATOM   2591  C C   . GLY A  1 349 ? 11.32041  9.14991    28.04551  1.000 22.23766  ? 329  GLY H C   1 
ATOM   2592  O O   . GLY A  1 349 ? 11.50112  9.08338    26.82883  1.000 19.58188  ? 329  GLY H O   1 
ATOM   2593  N N   . ASP A  1 350 ? 10.09778  9.13513    28.58583  1.000 18.06095  ? 330  ASP H N   1 
ATOM   2594  C CA  . ASP A  1 350 ? 8.89593   9.09752    27.78432  1.000 16.80519  ? 330  ASP H CA  1 
ATOM   2595  C C   . ASP A  1 350 ? 8.90888   7.92355    26.82174  1.000 15.97957  ? 330  ASP H C   1 
ATOM   2596  O O   . ASP A  1 350 ? 8.37404   8.01371    25.72347  1.000 19.49458  ? 330  ASP H O   1 
ATOM   2597  C CB  . ASP A  1 350 ? 8.65673   10.40864   26.99952  1.000 18.18540  ? 330  ASP H CB  1 
ATOM   2598  C CG  . ASP A  1 350 ? 7.23310   10.50200   26.49872  1.000 24.39598  ? 330  ASP H CG  1 
ATOM   2599  O OD1 . ASP A  1 350 ? 6.38080   9.81535    27.10245  1.000 25.15549  ? 330  ASP H OD1 1 
ATOM   2600  O OD2 . ASP A  1 350 ? 6.94106   11.23169   25.53224  1.000 27.79006  ? 330  ASP H OD2 1 
ATOM   2601  N N   . CYS A  1 351 ? 9.55798   6.83262    27.20719  1.000 13.60320  ? 331  CYS H N   1 
ATOM   2602  C CA  . CYS A  1 351 ? 9.49912   5.57815    26.47117  1.000 13.13269  ? 331  CYS H CA  1 
ATOM   2603  C C   . CYS A  1 351 ? 8.63765   4.60120    27.26655  1.000 13.90167  ? 331  CYS H C   1 
ATOM   2604  O O   . CYS A  1 351 ? 8.87962   4.40403    28.46069  1.000 16.82229  ? 331  CYS H O   1 
ATOM   2605  C CB  . CYS A  1 351 ? 10.90992  5.01457    26.28265  1.000 14.02492  ? 331  CYS H CB  1 
ATOM   2606  S SG  . CYS A  1 351 ? 11.89233  5.87025    25.01963  1.000 15.30499  ? 331  CYS H SG  1 
ATOM   2607  N N   . ILE A  1 352 ? 7.61881   4.01864    26.64125  1.000 14.55708  ? 332  ILE H N   1 
ATOM   2608  C CA  . ILE A  1 352 ? 6.84491   2.95693    27.29695  1.000 16.75722  ? 332  ILE H CA  1 
ATOM   2609  C C   . ILE A  1 352 ? 7.11332   1.66971    26.52982  1.000 17.87119  ? 332  ILE H C   1 
ATOM   2610  O O   . ILE A  1 352 ? 6.75390   1.54040    25.34450  1.000 15.06109  ? 332  ILE H O   1 
ATOM   2611  C CB  . ILE A  1 352 ? 5.33833   3.26133    27.37869  1.000 17.40665  ? 332  ILE H CB  1 
ATOM   2612  C CG1 . ILE A  1 352 ? 5.10231   4.63533    28.04605  1.000 16.51686  ? 332  ILE H CG1 1 
ATOM   2613  C CG2 . ILE A  1 352 ? 4.63945   2.15929    28.21133  1.000 17.67780  ? 332  ILE H CG2 1 
ATOM   2614  C CD1 . ILE A  1 352 ? 3.64424   4.95069    28.34161  1.000 20.60565  ? 332  ILE H CD1 1 
ATOM   2615  N N   . ILE A  1 353 ? 7.74731   0.72284    27.21567  1.000 16.30693  ? 333  ILE H N   1 
ATOM   2616  C CA  . ILE A  1 353 ? 8.17481   -0.54589   26.63471  1.000 14.83619  ? 333  ILE H CA  1 
ATOM   2617  C C   . ILE A  1 353 ? 7.16051   -1.55182   27.16991  1.000 17.73782  ? 333  ILE H C   1 
ATOM   2618  O O   . ILE A  1 353 ? 7.28378   -2.06038   28.27437  1.000 16.52198  ? 333  ILE H O   1 
ATOM   2619  C CB  . ILE A  1 353 ? 9.60881   -0.88432   27.03106  1.000 14.33907  ? 333  ILE H CB  1 
ATOM   2620  C CG1 . ILE A  1 353 ? 10.53850  0.30722    26.74172  1.000 13.65178  ? 333  ILE H CG1 1 
ATOM   2621  C CG2 . ILE A  1 353 ? 10.08552  -2.17472   26.32148  1.000 15.07016  ? 333  ILE H CG2 1 
ATOM   2622  C CD1 . ILE A  1 353 ? 10.48791  0.83075    25.27940  1.000 14.14038  ? 333  ILE H CD1 1 
ATOM   2623  N N   . SER A  1 354 ? 6.11548   -1.79106   26.39081  1.000 19.05042  ? 334  SER H N   1 
ATOM   2624  C CA  . SER A  1 354 ? 4.96049   -2.55650   26.83560  1.000 20.56762  ? 334  SER H CA  1 
ATOM   2625  C C   . SER A  1 354 ? 5.02793   -3.95058   26.20759  1.000 23.79907  ? 334  SER H C   1 
ATOM   2626  O O   . SER A  1 354 ? 4.62439   -4.13977   25.05877  1.000 18.02993  ? 334  SER H O   1 
ATOM   2627  C CB  . SER A  1 354 ? 3.67508   -1.82720   26.46582  1.000 20.11181  ? 334  SER H CB  1 
ATOM   2628  O OG  . SER A  1 354 ? 2.52054   -2.54145   26.92107  1.000 18.72608  ? 334  SER H OG  1 
ATOM   2629  N N   . GLY A  1 355 ? 5.51776   -4.93217   26.97530  1.000 21.53798  ? 335  GLY H N   1 
ATOM   2630  C CA  . GLY A  1 355 ? 5.59144   -6.28991   26.46504  1.000 22.48001  ? 335  GLY H CA  1 
ATOM   2631  C C   . GLY A  1 355 ? 6.60912   -6.47984   25.36148  1.000 25.06856  ? 335  GLY H C   1 
ATOM   2632  O O   . GLY A  1 355 ? 6.53643   -7.48156   24.63185  1.000 25.50212  ? 335  GLY H O   1 
ATOM   2633  N N   . ALA A  1 356 ? 7.55780   -5.54544   25.21325  1.000 18.93763  ? 336  ALA H N   1 
ATOM   2634  C CA  . ALA A  1 356 ? 8.53849   -5.56044   24.14245  1.000 16.82554  ? 336  ALA H CA  1 
ATOM   2635  C C   . ALA A  1 356 ? 9.89843   -5.90760   24.72259  1.000 18.74207  ? 336  ALA H C   1 
ATOM   2636  O O   . ALA A  1 356 ? 10.24395  -5.45015   25.82121  1.000 18.18380  ? 336  ALA H O   1 
ATOM   2637  C CB  . ALA A  1 356 ? 8.60550   -4.19946   23.42923  1.000 16.24783  ? 336  ALA H CB  1 
ATOM   2638  N N   . ALA A  1 357 ? 10.66279  -6.73142   24.00530  1.000 16.60005  ? 337  ALA H N   1 
ATOM   2639  C CA  . ALA A  1 357 ? 12.02234  -7.07776   24.43156  1.000 21.07103  ? 337  ALA H CA  1 
ATOM   2640  C C   . ALA A  1 357 ? 13.02233  -6.21302   23.67622  1.000 19.91019  ? 337  ALA H C   1 
ATOM   2641  O O   . ALA A  1 357 ? 13.08179  -6.26829   22.44272  1.000 18.13646  ? 337  ALA H O   1 
ATOM   2642  C CB  . ALA A  1 357 ? 12.31392  -8.55718   24.17290  1.000 17.12826  ? 337  ALA H CB  1 
ATOM   2643  N N   . LEU A  1 358 ? 13.81104  -5.42085   24.39713  1.000 15.07665  ? 338  LEU H N   1 
ATOM   2644  C CA  . LEU A  1 358 ? 14.88355  -4.63310   23.77652  1.000 16.75237  ? 338  LEU H CA  1 
ATOM   2645  C C   . LEU A  1 358 ? 16.22773  -5.24185   24.17004  1.000 19.00088  ? 338  LEU H C   1 
ATOM   2646  O O   . LEU A  1 358 ? 16.44967  -5.57856   25.34549  1.000 14.71264  ? 338  LEU H O   1 
ATOM   2647  C CB  . LEU A  1 358 ? 14.85263  -3.16370   24.20811  1.000 16.70204  ? 338  LEU H CB  1 
ATOM   2648  C CG  . LEU A  1 358 ? 13.48510  -2.49084   24.26916  1.000 22.37711  ? 338  LEU H CG  1 
ATOM   2649  C CD1 . LEU A  1 358 ? 13.60083  -1.02818   24.71916  1.000 17.21317  ? 338  LEU H CD1 1 
ATOM   2650  C CD2 . LEU A  1 358 ? 12.69207  -2.63859   22.99473  1.000 24.17253  ? 338  LEU H CD2 1 
ATOM   2651  N N   . ASN A  1 359 ? 17.11527  -5.41339   23.18293  1.000 16.94082  ? 339  ASN H N   1 
ATOM   2652  C CA  . ASN A  1 359 ? 18.47188  -5.86953   23.47533  1.000 14.95077  ? 339  ASN H CA  1 
ATOM   2653  C C   . ASN A  1 359 ? 19.44994  -5.08238   22.62062  1.000 15.04811  ? 339  ASN H C   1 
ATOM   2654  O O   . ASN A  1 359 ? 19.23754  -4.92400   21.39964  1.000 15.37732  ? 339  ASN H O   1 
ATOM   2655  C CB  . ASN A  1 359 ? 18.61420  -7.37027   23.22090  1.000 18.72165  ? 339  ASN H CB  1 
ATOM   2656  C CG  . ASN A  1 359 ? 20.02935  -7.86295   23.44622  1.000 22.41813  ? 339  ASN H CG  1 
ATOM   2657  O OD1 . ASN A  1 359 ? 20.74360  -7.39208   24.32837  1.000 22.36047  ? 339  ASN H OD1 1 
ATOM   2658  N ND2 . ASN A  1 359 ? 20.44965  -8.81512   22.62998  1.000 25.03784  ? 339  ASN H ND2 1 
ATOM   2659  N N   . ARG A  1 360 ? 20.52069  -4.59404   23.24173  1.000 14.43742  ? 340  ARG H N   1 
ATOM   2660  C CA  . ARG A  1 360 ? 21.52980  -3.83998   22.50324  1.000 18.46077  ? 340  ARG H CA  1 
ATOM   2661  C C   . ARG A  1 360 ? 20.88765  -2.78121   21.60556  1.000 18.53273  ? 340  ARG H C   1 
ATOM   2662  O O   . ARG A  1 360 ? 21.14053  -2.70567   20.39533  1.000 14.26292  ? 340  ARG H O   1 
ATOM   2663  C CB  . ARG A  1 360 ? 22.44189  -4.78123   21.70279  1.000 24.55792  ? 340  ARG H CB  1 
ATOM   2664  C CG  . ARG A  1 360 ? 23.78554  -4.11093   21.42443  1.000 35.71437  ? 340  ARG H CG  1 
ATOM   2665  C CD  . ARG A  1 360 ? 24.89906  -5.07110   21.14361  1.000 40.44484  ? 340  ARG H CD  1 
ATOM   2666  N NE  . ARG A  1 360 ? 26.05781  -4.39086   20.54664  1.000 39.94947  ? 340  ARG H NE  1 
ATOM   2667  C CZ  . ARG A  1 360 ? 26.31872  -4.36812   19.24439  1.000 36.77338  ? 340  ARG H CZ  1 
ATOM   2668  N NH1 . ARG A  1 360 ? 25.48965  -4.97715   18.40328  1.000 36.18370  ? 340  ARG H NH1 1 
ATOM   2669  N NH2 . ARG A  1 360 ? 27.40739  -3.74611   18.78325  1.000 33.60546  ? 340  ARG H NH2 1 
ATOM   2670  N N   . SER A  1 361 ? 20.04568  -1.93024   22.20891  1.000 13.45768  ? 341  SER H N   1 
ATOM   2671  C CA  . SER A  1 361 ? 19.34085  -0.91408   21.45716  1.000 13.23932  ? 341  SER H CA  1 
ATOM   2672  C C   . SER A  1 361 ? 19.46754  0.43325    22.15997  1.000 12.98304  ? 341  SER H C   1 
ATOM   2673  O O   . SER A  1 361 ? 19.64563  0.51456    23.38118  1.000 12.86687  ? 341  SER H O   1 
ATOM   2674  C CB  . SER A  1 361 ? 17.86200  -1.28771   21.26590  1.000 13.81024  ? 341  SER H CB  1 
ATOM   2675  O OG  . SER A  1 361 ? 17.73804  -2.36829   20.33956  1.000 17.67375  ? 341  SER H OG  1 
ATOM   2676  N N   . LEU A  1 362 ? 19.41097  1.49161    21.36786  1.000 13.92297  ? 342  LEU H N   1 
ATOM   2677  C CA  . LEU A  1 362 ? 19.42758  2.85768    21.88947  1.000 12.60228  ? 342  LEU H CA  1 
ATOM   2678  C C   . LEU A  1 362 ? 18.12969  3.54500    21.47039  1.000 12.15848  ? 342  LEU H C   1 
ATOM   2679  O O   . LEU A  1 362 ? 17.86056  3.68241    20.27074  1.000 14.47608  ? 342  LEU H O   1 
ATOM   2680  C CB  . LEU A  1 362 ? 20.66509  3.60368    21.37600  1.000 12.43599  ? 342  LEU H CB  1 
ATOM   2681  C CG  . LEU A  1 362 ? 20.83459  4.99232    21.98104  1.000 17.44761  ? 342  LEU H CG  1 
ATOM   2682  C CD1 . LEU A  1 362 ? 22.30741  5.25497    22.38309  1.000 21.69154  ? 342  LEU H CD1 1 
ATOM   2683  C CD2 . LEU A  1 362 ? 20.32594  6.01120    20.98751  1.000 18.91857  ? 342  LEU H CD2 1 
ATOM   2684  N N   . LEU A  1 363 ? 17.32499  3.98315    22.44782  1.000 11.91785  ? 343  LEU H N   1 
ATOM   2685  C CA  . LEU A  1 363 ? 16.02304  4.61509    22.19226  1.000 16.47090  ? 343  LEU H CA  1 
ATOM   2686  C C   . LEU A  1 363 ? 16.08926  6.07761    22.63004  1.000 17.48917  ? 343  LEU H C   1 
ATOM   2687  O O   . LEU A  1 363 ? 16.40568  6.35679    23.79202  1.000 12.40454  ? 343  LEU H O   1 
ATOM   2688  C CB  . LEU A  1 363 ? 14.88938  3.91019    22.96702  1.000 13.55861  ? 343  LEU H CB  1 
ATOM   2689  C CG  . LEU A  1 363 ? 14.17111  2.74507    22.26654  1.000 14.49385  ? 343  LEU H CG  1 
ATOM   2690  C CD1 . LEU A  1 363 ? 15.20005  1.63103    21.96957  1.000 12.95138  ? 343  LEU H CD1 1 
ATOM   2691  C CD2 . LEU A  1 363 ? 13.00058  2.23133    23.12750  1.000 14.20874  ? 343  LEU H CD2 1 
ATOM   2692  N N   . PHE A  1 364 ? 15.74700  6.99499    21.71531  1.000 12.10856  ? 344  PHE H N   1 
ATOM   2693  C CA  . PHE A  1 364 ? 15.51270  8.39956    22.02643  1.000 11.96622  ? 344  PHE H CA  1 
ATOM   2694  C C   . PHE A  1 364 ? 14.13375  8.55223    22.67234  1.000 12.09637  ? 344  PHE H C   1 
ATOM   2695  O O   . PHE A  1 364 ? 13.38436  7.57707    22.82164  1.000 12.87446  ? 344  PHE H O   1 
ATOM   2696  C CB  . PHE A  1 364 ? 15.60047  9.23994    20.74244  1.000 12.33485  ? 344  PHE H CB  1 
ATOM   2697  C CG  . PHE A  1 364 ? 16.99035  9.31651    20.13340  1.000 16.68631  ? 344  PHE H CG  1 
ATOM   2698  C CD1 . PHE A  1 364 ? 17.57122  8.21026    19.49894  1.000 15.64030  ? 344  PHE H CD1 1 
ATOM   2699  C CD2 . PHE A  1 364 ? 17.70905  10.51440   20.18108  1.000 15.75313  ? 344  PHE H CD2 1 
ATOM   2700  C CE1 . PHE A  1 364 ? 18.85253  8.30338    18.90395  1.000 18.94127  ? 344  PHE H CE1 1 
ATOM   2701  C CE2 . PHE A  1 364 ? 18.99434  10.61607   19.58868  1.000 17.92054  ? 344  PHE H CE2 1 
ATOM   2702  C CZ  . PHE A  1 364 ? 19.55175  9.50138    18.94487  1.000 18.06471  ? 344  PHE H CZ  1 
ATOM   2703  N N   A THR A  1 365 ? 13.77881  9.78891    23.02293  0.387 13.17273  ? 345  THR H N   1 
ATOM   2704  N N   B THR A  1 365 ? 13.79312  9.77350    23.10065  0.613 12.36155  ? 345  THR H N   1 
ATOM   2705  C CA  A THR A  1 365 ? 12.54428  10.06780   23.75421  0.387 13.99784  ? 345  THR H CA  1 
ATOM   2706  C CA  B THR A  1 365 ? 12.54636  9.96404    23.84254  0.613 13.72051  ? 345  THR H CA  1 
ATOM   2707  C C   A THR A  1 365 ? 11.29077  9.69846    22.96189  0.387 15.25326  ? 345  THR H C   1 
ATOM   2708  C C   B THR A  1 365 ? 11.31026  9.67850    22.99598  0.613 15.25118  ? 345  THR H C   1 
ATOM   2709  O O   A THR A  1 365 ? 11.24358  9.80345    21.73161  0.387 15.66683  ? 345  THR H O   1 
ATOM   2710  O O   B THR A  1 365 ? 11.29896  9.82854    21.76746  0.613 15.60910  ? 345  THR H O   1 
ATOM   2711  C CB  A THR A  1 365 ? 12.47773  11.55529   24.10940  0.387 16.03929  ? 345  THR H CB  1 
ATOM   2712  C CB  B THR A  1 365 ? 12.40808  11.39200   24.40188  0.613 15.85579  ? 345  THR H CB  1 
ATOM   2713  O OG1 A THR A  1 365 ? 13.80433  12.06691   24.26039  0.387 15.51869  ? 345  THR H OG1 1 
ATOM   2714  O OG1 B THR A  1 365 ? 12.33188  12.33638   23.31468  0.613 15.01610  ? 345  THR H OG1 1 
ATOM   2715  C CG2 A THR A  1 365 ? 11.70166  11.78451   25.38404  0.387 14.47591  ? 345  THR H CG2 1 
ATOM   2716  C CG2 B THR A  1 365 ? 13.54331  11.74173   25.35053  0.613 15.33749  ? 345  THR H CG2 1 
ATOM   2717  N N   . GLY A  1 366 ? 10.24318  9.31021    23.69078  1.000 14.39794  ? 346  GLY H N   1 
ATOM   2718  C CA  . GLY A  1 366 ? 8.93931   9.18093    23.08567  1.000 15.72364  ? 346  GLY H CA  1 
ATOM   2719  C C   . GLY A  1 366 ? 8.63835   7.84745    22.43712  1.000 18.99507  ? 346  GLY H C   1 
ATOM   2720  O O   . GLY A  1 366 ? 7.59503   7.72577    21.78712  1.000 20.36708  ? 346  GLY H O   1 
ATOM   2721  N N   . VAL A  1 367 ? 9.49260   6.83453    22.59681  1.000 15.97071  ? 347  VAL H N   1 
ATOM   2722  C CA  . VAL A  1 367 ? 9.21619   5.57658    21.90813  1.000 15.37292  ? 347  VAL H CA  1 
ATOM   2723  C C   . VAL A  1 367 ? 8.05772   4.83929    22.58271  1.000 16.05247  ? 347  VAL H C   1 
ATOM   2724  O O   . VAL A  1 367 ? 7.85117   4.91432    23.80454  1.000 16.93012  ? 347  VAL H O   1 
ATOM   2725  C CB  . VAL A  1 367 ? 10.48832  4.71302    21.81146  1.000 15.48319  ? 347  VAL H CB  1 
ATOM   2726  C CG1 . VAL A  1 367 ? 10.17852  3.39304    21.09363  1.000 13.97871  ? 347  VAL H CG1 1 
ATOM   2727  C CG2 . VAL A  1 367 ? 11.58346  5.45077    21.02225  1.000 20.44180  ? 347  VAL H CG2 1 
ATOM   2728  N N   . ARG A  1 368 ? 7.24668   4.15418    21.77652  1.000 15.75771  ? 348  ARG H N   1 
ATOM   2729  C CA  . ARG A  1 368 ? 6.20893   3.25989    22.29579  1.000 15.54633  ? 348  ARG H CA  1 
ATOM   2730  C C   . ARG A  1 368 ? 6.44352   1.92406    21.61087  1.000 20.24834  ? 348  ARG H C   1 
ATOM   2731  O O   . ARG A  1 368 ? 6.27236   1.82321    20.39541  1.000 20.96003  ? 348  ARG H O   1 
ATOM   2732  C CB  . ARG A  1 368 ? 4.80335   3.79207    21.98103  1.000 18.85463  ? 348  ARG H CB  1 
ATOM   2733  C CG  . ARG A  1 368 ? 4.47345   5.15268    22.64752  1.000 19.10049  ? 348  ARG H CG  1 
ATOM   2734  C CD  . ARG A  1 368 ? 4.21433   4.97430    24.15202  1.000 18.92108  ? 348  ARG H CD  1 
ATOM   2735  N NE  . ARG A  1 368 ? 3.79023   6.21689    24.79804  1.000 20.67536  ? 348  ARG H NE  1 
ATOM   2736  C CZ  . ARG A  1 368 ? 4.65428   7.12855    25.21919  1.000 21.10769  ? 348  ARG H CZ  1 
ATOM   2737  N NH1 . ARG A  1 368 ? 4.23317   8.24496    25.80900  1.000 24.52152  ? 348  ARG H NH1 1 
ATOM   2738  N NH2 . ARG A  1 368 ? 5.94449   6.90900    25.05147  1.000 19.10108  ? 348  ARG H NH2 1 
ATOM   2739  N N   . ALA A  1 369 ? 6.85469   0.91042    22.35551  1.000 16.12795  ? 349  ALA H N   1 
ATOM   2740  C CA  . ALA A  1 369 ? 7.06494   -0.39941   21.76664  1.000 19.49731  ? 349  ALA H CA  1 
ATOM   2741  C C   . ALA A  1 369 ? 6.04230   -1.33639   22.38014  1.000 20.71269  ? 349  ALA H C   1 
ATOM   2742  O O   . ALA A  1 369 ? 5.86103   -1.34180   23.60382  1.000 19.68949  ? 349  ALA H O   1 
ATOM   2743  C CB  . ALA A  1 369 ? 8.49130   -0.89450   22.00007  1.000 17.10946  ? 349  ALA H CB  1 
ATOM   2744  N N   . ASN A  1 370 ? 5.36446   -2.10615   21.54589  1.000 17.43203  ? 350  ASN H N   1 
ATOM   2745  C CA  . ASN A  1 370 ? 4.15576   -2.77474   22.00780  1.000 18.26372  ? 350  ASN H CA  1 
ATOM   2746  C C   . ASN A  1 370 ? 4.36121   -4.28550   22.09565  1.000 18.69279  ? 350  ASN H C   1 
ATOM   2747  O O   . ASN A  1 370 ? 5.44931   -4.81451   21.84579  1.000 18.34155  ? 350  ASN H O   1 
ATOM   2748  C CB  . ASN A  1 370 ? 2.97160   -2.40238   21.11427  1.000 19.11239  ? 350  ASN H CB  1 
ATOM   2749  C CG  . ASN A  1 370 ? 2.47293   -1.00713   21.39054  1.000 31.23829  ? 350  ASN H CG  1 
ATOM   2750  O OD1 . ASN A  1 370 ? 2.52625   -0.53351   22.52446  1.000 30.31452  ? 350  ASN H OD1 1 
ATOM   2751  N ND2 . ASN A  1 370 ? 2.00147   -0.32450   20.34805  1.000 34.22352  ? 350  ASN H ND2 1 
ATOM   2752  N N   . SER A  1 371 ? 3.30066   -4.96931   22.49971  1.000 19.55462  ? 351  SER H N   1 
ATOM   2753  C CA  . SER A  1 371 ? 3.44295   -6.32454   23.01632  1.000 19.98772  ? 351  SER H CA  1 
ATOM   2754  C C   . SER A  1 371 ? 3.96648   -7.26758   21.94792  1.000 22.12402  ? 351  SER H C   1 
ATOM   2755  O O   . SER A  1 371 ? 3.61198   -7.17144   20.76269  1.000 25.02341  ? 351  SER H O   1 
ATOM   2756  C CB  . SER A  1 371 ? 2.11841   -6.81840   23.60515  1.000 21.97200  ? 351  SER H CB  1 
ATOM   2757  O OG  . SER A  1 371 ? 1.87792   -6.21310   24.88693  1.000 22.40059  ? 351  SER H OG  1 
ATOM   2758  N N   . TYR A  1 372 ? 4.87162   -8.14662   22.36372  1.000 22.97386  ? 352  TYR H N   1 
ATOM   2759  C CA  . TYR A  1 372 ? 5.48436   -9.20897   21.56365  1.000 21.23716  ? 352  TYR H CA  1 
ATOM   2760  C C   . TYR A  1 372 ? 6.47547   -8.68803   20.53112  1.000 20.89903  ? 352  TYR H C   1 
ATOM   2761  O O   . TYR A  1 372 ? 7.08511   -9.51189   19.83921  1.000 22.04742  ? 352  TYR H O   1 
ATOM   2762  C CB  . TYR A  1 372 ? 4.42765   -10.10450  20.88867  1.000 22.52646  ? 352  TYR H CB  1 
ATOM   2763  C CG  . TYR A  1 372 ? 3.37725   -10.56053  21.87440  1.000 22.60535  ? 352  TYR H CG  1 
ATOM   2764  C CD1 . TYR A  1 372 ? 3.67182   -11.52294  22.84251  1.000 22.87575  ? 352  TYR H CD1 1 
ATOM   2765  C CD2 . TYR A  1 372 ? 2.08435   -10.01949  21.84344  1.000 23.11604  ? 352  TYR H CD2 1 
ATOM   2766  C CE1 . TYR A  1 372 ? 2.71955   -11.93227  23.75276  1.000 23.62034  ? 352  TYR H CE1 1 
ATOM   2767  C CE2 . TYR A  1 372 ? 1.12690   -10.42168  22.76633  1.000 24.14082  ? 352  TYR H CE2 1 
ATOM   2768  C CZ  . TYR A  1 372 ? 1.44255   -11.36883  23.71464  1.000 24.10111  ? 352  TYR H CZ  1 
ATOM   2769  O OH  . TYR A  1 372 ? 0.46798   -11.73604  24.61845  1.000 28.56298  ? 352  TYR H OH  1 
ATOM   2770  N N   . SER A  1 373 ? 6.68498   -7.37230   20.42569  1.000 19.26402  ? 353  SER H N   1 
ATOM   2771  C CA  . SER A  1 373 ? 7.72111   -6.86876   19.53998  1.000 24.03984  ? 353  SER H CA  1 
ATOM   2772  C C   . SER A  1 373 ? 9.09365   -7.07622   20.19225  1.000 19.74361  ? 353  SER H C   1 
ATOM   2773  O O   . SER A  1 373 ? 9.22005   -7.27740   21.40323  1.000 17.85032  ? 353  SER H O   1 
ATOM   2774  C CB  . SER A  1 373 ? 7.49100   -5.38569   19.19277  1.000 25.54425  ? 353  SER H CB  1 
ATOM   2775  O OG  . SER A  1 373 ? 7.79090   -4.54015   20.30270  1.000 19.17930  ? 353  SER H OG  1 
ATOM   2776  N N   . ARG A  1 374 ? 10.09994  -7.11757   19.34205  1.000 21.87329  ? 354  ARG H N   1 
ATOM   2777  C CA  . ARG A  1 374 ? 11.49345  -7.33846   19.71609  1.000 25.50928  ? 354  ARG H CA  1 
ATOM   2778  C C   . ARG A  1 374 ? 12.37055  -6.38849   18.91875  1.000 26.84073  ? 354  ARG H C   1 
ATOM   2779  O O   . ARG A  1 374 ? 12.23883  -6.30282   17.69165  1.000 27.39090  ? 354  ARG H O   1 
ATOM   2780  C CB  . ARG A  1 374 ? 11.92712  -8.78118   19.42943  1.000 28.36147  ? 354  ARG H CB  1 
ATOM   2781  C CG  . ARG A  1 374 ? 10.93156  -9.82679   19.88669  1.000 38.81527  ? 354  ARG H CG  1 
ATOM   2782  C CD  . ARG A  1 374 ? 11.47436  -11.21444  19.63907  1.000 48.97877  ? 354  ARG H CD  1 
ATOM   2783  N NE  . ARG A  1 374 ? 12.72093  -11.38912  20.37522  1.000 56.00424  ? 354  ARG H NE  1 
ATOM   2784  C CZ  . ARG A  1 374 ? 12.78541  -11.79394  21.64556  1.000 57.42235  ? 354  ARG H CZ  1 
ATOM   2785  N NH1 . ARG A  1 374 ? 11.66418  -12.08454  22.30545  1.000 57.53959  ? 354  ARG H NH1 1 
ATOM   2786  N NH2 . ARG A  1 374 ? 13.96863  -11.91379  22.25110  1.000 56.26496  ? 354  ARG H NH2 1 
ATOM   2787  N N   . LEU A  1 375 ? 13.26256  -5.67363   19.60054  1.000 16.28829  ? 355  LEU H N   1 
ATOM   2788  C CA  . LEU A  1 375 ? 14.27164  -4.86708   18.92900  1.000 15.92338  ? 355  LEU H CA  1 
ATOM   2789  C C   . LEU A  1 375 ? 15.63956  -5.39467   19.33903  1.000 19.79123  ? 355  LEU H C   1 
ATOM   2790  O O   . LEU A  1 375 ? 15.88049  -5.63892   20.53236  1.000 18.85491  ? 355  LEU H O   1 
ATOM   2791  C CB  . LEU A  1 375 ? 14.16617  -3.38554   19.31960  1.000 19.97366  ? 355  LEU H CB  1 
ATOM   2792  C CG  . LEU A  1 375 ? 12.85370  -2.66058   19.10569  1.000 23.79919  ? 355  LEU H CG  1 
ATOM   2793  C CD1 . LEU A  1 375 ? 12.99005  -1.22319   19.58160  1.000 22.73145  ? 355  LEU H CD1 1 
ATOM   2794  C CD2 . LEU A  1 375 ? 12.57139  -2.63873   17.64052  1.000 27.62308  ? 355  LEU H CD2 1 
ATOM   2795  N N   . GLU A  1 376 ? 16.53835  -5.52072   18.37770  1.000 16.10675  ? 356  GLU H N   1 
ATOM   2796  C CA  . GLU A  1 376 ? 17.92307  -5.88798   18.64228  1.000 16.11202  ? 356  GLU H CA  1 
ATOM   2797  C C   . GLU A  1 376 ? 18.84537  -5.05933   17.75776  1.000 17.52338  ? 356  GLU H C   1 
ATOM   2798  O O   . GLU A  1 376 ? 18.59347  -4.93449   16.55003  1.000 18.81701  ? 356  GLU H O   1 
ATOM   2799  C CB  . GLU A  1 376 ? 18.15963  -7.37499   18.37813  1.000 21.45999  ? 356  GLU H CB  1 
ATOM   2800  C CG  . GLU A  1 376 ? 19.58447  -7.80916   18.63239  1.000 32.59967  ? 356  GLU H CG  1 
ATOM   2801  C CD  . GLU A  1 376 ? 19.66503  -9.14879   19.30125  1.000 43.27003  ? 356  GLU H CD  1 
ATOM   2802  O OE1 . GLU A  1 376 ? 18.97851  -9.34845   20.32474  1.000 45.93474  ? 356  GLU H OE1 1 
ATOM   2803  O OE2 . GLU A  1 376 ? 20.40714  -10.00834  18.78888  1.000 46.46351  ? 356  GLU H OE2 1 
ATOM   2804  N N   . ASN A  1 377 ? 19.95301  -4.56162   18.33568  1.000 15.61044  ? 357  ASN H N   1 
ATOM   2805  C CA  . ASN A  1 377 ? 20.90937  -3.75349   17.56323  1.000 17.24366  ? 357  ASN H CA  1 
ATOM   2806  C C   . ASN A  1 377 ? 20.17751  -2.62570   16.83847  1.000 19.71739  ? 357  ASN H C   1 
ATOM   2807  O O   . ASN A  1 377 ? 20.37960  -2.39615   15.64088  1.000 16.02946  ? 357  ASN H O   1 
ATOM   2808  C CB  . ASN A  1 377 ? 21.66962  -4.61538   16.54516  1.000 20.13536  ? 357  ASN H CB  1 
ATOM   2809  C CG  . ASN A  1 377 ? 22.64837  -5.52334   17.18171  1.000 26.33196  ? 357  ASN H CG  1 
ATOM   2810  O OD1 . ASN A  1 377 ? 22.82738  -5.50825   18.39708  1.000 25.24173  ? 357  ASN H OD1 1 
ATOM   2811  N ND2 . ASN A  1 377 ? 23.30992  -6.34184   16.36581  1.000 29.82644  ? 357  ASN H ND2 1 
ATOM   2812  N N   . ALA A  1 378 ? 19.25846  -1.97168   17.54383  1.000 14.83932  ? 358  ALA H N   1 
ATOM   2813  C CA  . ALA A  1 378 ? 18.39559  -0.96662   16.94042  1.000 19.67575  ? 358  ALA H CA  1 
ATOM   2814  C C   . ALA A  1 378 ? 18.73212  0.42198    17.49384  1.000 14.11797  ? 358  ALA H C   1 
ATOM   2815  O O   . ALA A  1 378 ? 18.86920  0.59603    18.71188  1.000 14.82591  ? 358  ALA H O   1 
ATOM   2816  C CB  . ALA A  1 378 ? 16.93047  -1.29744   17.19647  1.000 14.93138  ? 358  ALA H CB  1 
ATOM   2817  N N   . VAL A  1 379 ? 18.87768  1.39340    16.59581  1.000 14.26339  ? 359  VAL H N   1 
ATOM   2818  C CA  . VAL A  1 379 ? 18.92466  2.80528    16.94519  1.000 13.82099  ? 359  VAL H CA  1 
ATOM   2819  C C   . VAL A  1 379 ? 17.57892  3.40431    16.58007  1.000 13.94969  ? 359  VAL H C   1 
ATOM   2820  O O   . VAL A  1 379 ? 17.20841  3.46142    15.40506  1.000 14.55519  ? 359  VAL H O   1 
ATOM   2821  C CB  . VAL A  1 379 ? 20.07447  3.52909    16.23570  1.000 17.80472  ? 359  VAL H CB  1 
ATOM   2822  C CG1 . VAL A  1 379 ? 20.05229  5.01968    16.59226  1.000 17.42380  ? 359  VAL H CG1 1 
ATOM   2823  C CG2 . VAL A  1 379 ? 21.40819  2.88760    16.59083  1.000 15.37743  ? 359  VAL H CG2 1 
ATOM   2824  N N   . VAL A  1 380 ? 16.86222  3.89997    17.57126  1.000 13.50803  ? 360  VAL H N   1 
ATOM   2825  C CA  . VAL A  1 380 ? 15.45891  4.27679    17.41085  1.000 18.02070  ? 360  VAL H CA  1 
ATOM   2826  C C   . VAL A  1 380 ? 15.30493  5.75249    17.76724  1.000 19.69660  ? 360  VAL H C   1 
ATOM   2827  O O   . VAL A  1 380 ? 15.36923  6.12113    18.93602  1.000 19.23015  ? 360  VAL H O   1 
ATOM   2828  C CB  . VAL A  1 380 ? 14.53742  3.40180    18.27312  1.000 19.76232  ? 360  VAL H CB  1 
ATOM   2829  C CG1 . VAL A  1 380 ? 13.07919  3.68768    17.91789  1.000 14.09133  ? 360  VAL H CG1 1 
ATOM   2830  C CG2 . VAL A  1 380 ? 14.82538  1.89612    18.00341  1.000 18.33256  ? 360  VAL H CG2 1 
ATOM   2831  N N   . LEU A  1 381 ? 15.02519  6.57268    16.76291  1.000 17.50504  ? 361  LEU H N   1 
ATOM   2832  C CA  . LEU A  1 381 ? 14.96824  8.00937    16.93481  1.000 18.37222  ? 361  LEU H CA  1 
ATOM   2833  C C   . LEU A  1 381 ? 13.66398  8.38775    17.64630  1.000 13.84749  ? 361  LEU H C   1 
ATOM   2834  O O   . LEU A  1 381 ? 12.82576  7.52343    17.93183  1.000 13.92887  ? 361  LEU H O   1 
ATOM   2835  C CB  . LEU A  1 381 ? 15.11226  8.67847    15.55442  1.000 17.96794  ? 361  LEU H CB  1 
ATOM   2836  C CG  . LEU A  1 381 ? 16.57223  9.04961    15.23299  1.000 19.13644  ? 361  LEU H CG  1 
ATOM   2837  C CD1 . LEU A  1 381 ? 17.51789  7.83349    15.22829  1.000 16.65554  ? 361  LEU H CD1 1 
ATOM   2838  C CD2 . LEU A  1 381 ? 16.65205  9.76627    13.87369  1.000 22.04027  ? 361  LEU H CD2 1 
ATOM   2839  N N   . PRO A  1 382 ? 13.49437  9.67287    18.00693  1.000 18.06097  ? 362  PRO H N   1 
ATOM   2840  C CA  . PRO A  1 382 ? 12.34596  10.06191   18.84444  1.000 20.27167  ? 362  PRO H CA  1 
ATOM   2841  C C   . PRO A  1 382 ? 10.98861  9.66919    18.27578  1.000 18.49130  ? 362  PRO H C   1 
ATOM   2842  O O   . PRO A  1 382 ? 10.76016  9.71157    17.06623  1.000 20.94369  ? 362  PRO H O   1 
ATOM   2843  C CB  . PRO A  1 382 ? 12.47999  11.59408   18.93344  1.000 16.26760  ? 362  PRO H CB  1 
ATOM   2844  C CG  . PRO A  1 382 ? 13.98712  11.78685   18.94370  1.000 19.24824  ? 362  PRO H CG  1 
ATOM   2845  C CD  . PRO A  1 382 ? 14.47709  10.78249   17.90142  1.000 13.74124  ? 362  PRO H CD  1 
ATOM   2846  N N   . SER A  1 383 ? 10.07944  9.30702    19.18635  1.000 16.27944  ? 363  SER H N   1 
ATOM   2847  C CA  . SER A  1 383 ? 8.64505   9.19102    18.92156  1.000 19.94848  ? 363  SER H CA  1 
ATOM   2848  C C   . SER A  1 383 ? 8.29685   8.03869    17.98201  1.000 20.35488  ? 363  SER H C   1 
ATOM   2849  O O   . SER A  1 383 ? 7.20472   8.00125    17.43178  1.000 25.04720  ? 363  SER H O   1 
ATOM   2850  C CB  . SER A  1 383 ? 8.09484   10.51438   18.38812  1.000 20.33630  ? 363  SER H CB  1 
ATOM   2851  O OG  . SER A  1 383 ? 8.29621   11.52556   19.38149  1.000 25.66390  ? 363  SER H OG  1 
ATOM   2852  N N   . VAL A  1 384 ? 9.20228   7.07856    17.80426  1.000 17.85821  ? 364  VAL H N   1 
ATOM   2853  C CA  . VAL A  1 384 ? 8.89284   5.89745    16.99984  1.000 18.82158  ? 364  VAL H CA  1 
ATOM   2854  C C   . VAL A  1 384 ? 7.86607   5.04367    17.73428  1.000 21.41055  ? 364  VAL H C   1 
ATOM   2855  O O   . VAL A  1 384 ? 7.87949   4.96161    18.96948  1.000 19.37122  ? 364  VAL H O   1 
ATOM   2856  C CB  . VAL A  1 384 ? 10.19494  5.11940    16.73307  1.000 16.77140  ? 364  VAL H CB  1 
ATOM   2857  C CG1 . VAL A  1 384 ? 9.90837   3.67830    16.21023  1.000 15.90983  ? 364  VAL H CG1 1 
ATOM   2858  C CG2 . VAL A  1 384 ? 11.07078  5.90581    15.73452  1.000 17.23308  ? 364  VAL H CG2 1 
ATOM   2859  N N   . LYS A  1 385 ? 6.95549   4.42096    16.98682  1.000 20.58480  ? 365  LYS H N   1 
ATOM   2860  C CA  . LYS A  1 385 ? 6.02964   3.42977    17.52144  1.000 21.98328  ? 365  LYS H CA  1 
ATOM   2861  C C   . LYS A  1 385 ? 6.32819   2.06085    16.91611  1.000 19.45504  ? 365  LYS H C   1 
ATOM   2862  O O   . LYS A  1 385 ? 6.42576   1.92976    15.69394  1.000 21.80700  ? 365  LYS H O   1 
ATOM   2863  C CB  . LYS A  1 385 ? 4.57316   3.80905    17.23462  1.000 27.00511  ? 365  LYS H CB  1 
ATOM   2864  C CG  . LYS A  1 385 ? 3.62322   2.70317    17.69536  1.000 33.72487  ? 365  LYS H CG  1 
ATOM   2865  C CD  . LYS A  1 385 ? 2.26940   3.24382    18.14906  1.000 42.22955  ? 365  LYS H CD  1 
ATOM   2866  C CE  . LYS A  1 385 ? 1.41167   3.66550    16.96010  1.000 47.61374  ? 365  LYS H CE  1 
ATOM   2867  N NZ  . LYS A  1 385 ? 0.00299   3.95359    17.36955  1.000 49.18968  ? 365  LYS H NZ  1 
ATOM   2868  N N   . ILE A  1 386 ? 6.48322   1.04166    17.76494  1.000 20.10201  ? 366  ILE H N   1 
ATOM   2869  C CA  . ILE A  1 386 ? 6.72476   -0.32612   17.30186  1.000 20.42662  ? 366  ILE H CA  1 
ATOM   2870  C C   . ILE A  1 386 ? 5.45021   -1.13733   17.52880  1.000 23.17027  ? 366  ILE H C   1 
ATOM   2871  O O   . ILE A  1 386 ? 5.03585   -1.35265   18.67767  1.000 18.84628  ? 366  ILE H O   1 
ATOM   2872  C CB  . ILE A  1 386 ? 7.91900   -0.97798   18.01940  1.000 22.16773  ? 366  ILE H CB  1 
ATOM   2873  C CG1 . ILE A  1 386 ? 9.15899   -0.04740   18.07403  1.000 20.66399  ? 366  ILE H CG1 1 
ATOM   2874  C CG2 . ILE A  1 386 ? 8.18719   -2.35958   17.41086  1.000 21.72717  ? 366  ILE H CG2 1 
ATOM   2875  C CD1 . ILE A  1 386 ? 9.87954   0.14908    16.68418  1.000 22.43927  ? 366  ILE H CD1 1 
ATOM   2876  N N   . GLY A  1 387 ? 4.81929   -1.58337   16.43030  1.000 21.02108  ? 367  GLY H N   1 
ATOM   2877  C CA  . GLY A  1 387 ? 3.58444   -2.33547   16.54866  1.000 23.17721  ? 367  GLY H CA  1 
ATOM   2878  C C   . GLY A  1 387 ? 3.80174   -3.72621   17.12551  1.000 20.42798  ? 367  GLY H C   1 
ATOM   2879  O O   . GLY A  1 387 ? 4.88629   -4.29816   17.04879  1.000 21.73757  ? 367  GLY H O   1 
ATOM   2880  N N   . ARG A  1 388 ? 2.75451   -4.26547   17.74353  1.000 21.05662  ? 368  ARG H N   1 
ATOM   2881  C CA  . ARG A  1 388 ? 2.82015   -5.62571   18.28001  1.000 27.91071  ? 368  ARG H CA  1 
ATOM   2882  C C   . ARG A  1 388 ? 3.40077   -6.58997   17.26075  1.000 23.67547  ? 368  ARG H C   1 
ATOM   2883  O O   . ARG A  1 388 ? 3.14424   -6.48186   16.05207  1.000 23.40608  ? 368  ARG H O   1 
ATOM   2884  C CB  . ARG A  1 388 ? 1.44092   -6.17387   18.72691  1.000 26.88933  ? 368  ARG H CB  1 
ATOM   2885  C CG  . ARG A  1 388 ? 0.84511   -5.53066   19.97043  1.000 23.50305  ? 368  ARG H CG  1 
ATOM   2886  C CD  . ARG A  1 388 ? -0.55051  -6.07278   20.31184  1.000 26.27978  ? 368  ARG H CD  1 
ATOM   2887  N NE  . ARG A  1 388 ? -0.89087  -5.87055   21.72587  1.000 23.30653  ? 368  ARG H NE  1 
ATOM   2888  C CZ  . ARG A  1 388 ? -1.59016  -6.70030   22.49359  1.000 27.50170  ? 368  ARG H CZ  1 
ATOM   2889  N NH1 . ARG A  1 388 ? -2.04406  -7.85564   22.02685  1.000 30.25740  ? 368  ARG H NH1 1 
ATOM   2890  N NH2 . ARG A  1 388 ? -1.83887  -6.36845   23.75331  1.000 28.66512  ? 368  ARG H NH2 1 
ATOM   2891  N N   . HIS A  1 389 ? 4.18660   -7.53635   17.77929  1.000 23.02719  ? 369  HIS H N   1 
ATOM   2892  C CA  . HIS A  1 389 ? 4.76155   -8.67708   17.08035  1.000 23.23369  ? 369  HIS H CA  1 
ATOM   2893  C C   . HIS A  1 389 ? 5.85118   -8.28925   16.07850  1.000 23.52311  ? 369  HIS H C   1 
ATOM   2894  O O   . HIS A  1 389 ? 6.46390   -9.19950   15.50197  1.000 22.23480  ? 369  HIS H O   1 
ATOM   2895  C CB  . HIS A  1 389 ? 3.68521   -9.53158   16.36687  1.000 23.58640  ? 369  HIS H CB  1 
ATOM   2896  C CG  . HIS A  1 389 ? 2.61255   -10.06737  17.27942  1.000 25.99211  ? 369  HIS H CG  1 
ATOM   2897  N ND1 . HIS A  1 389 ? 2.78477   -11.19390  18.05762  1.000 25.69490  ? 369  HIS H ND1 1 
ATOM   2898  C CD2 . HIS A  1 389 ? 1.35169   -9.63296   17.53084  1.000 24.71066  ? 369  HIS H CD2 1 
ATOM   2899  C CE1 . HIS A  1 389 ? 1.68517   -11.42313  18.75733  1.000 25.12223  ? 369  HIS H CE1 1 
ATOM   2900  N NE2 . HIS A  1 389 ? 0.80269   -10.48694  18.46223  1.000 25.26532  ? 369  HIS H NE2 1 
ATOM   2901  N N   . ALA A  1 390 ? 6.14915   -6.99786   15.86254  1.000 21.05226  ? 370  ALA H N   1 
ATOM   2902  C CA  . ALA A  1 390 ? 7.23878   -6.66731   14.95381  1.000 20.79157  ? 370  ALA H CA  1 
ATOM   2903  C C   . ALA A  1 390 ? 8.57379   -7.12524   15.54022  1.000 26.43167  ? 370  ALA H C   1 
ATOM   2904  O O   . ALA A  1 390 ? 8.78889   -7.10071   16.75677  1.000 25.43971  ? 370  ALA H O   1 
ATOM   2905  C CB  . ALA A  1 390 ? 7.27848   -5.16996   14.65155  1.000 20.48564  ? 370  ALA H CB  1 
ATOM   2906  N N   . GLN A  1 391 ? 9.47412   -7.56130   14.67336  1.000 22.20538  ? 371  GLN H N   1 
ATOM   2907  C CA  . GLN A  1 391 ? 10.79789  -8.00169   15.09821  1.000 19.96359  ? 371  GLN H CA  1 
ATOM   2908  C C   . GLN A  1 391 ? 11.82453  -7.34205   14.18424  1.000 22.14912  ? 371  GLN H C   1 
ATOM   2909  O O   . GLN A  1 391 ? 11.85913  -7.62118   12.97276  1.000 23.96034  ? 371  GLN H O   1 
ATOM   2910  C CB  . GLN A  1 391 ? 10.91502  -9.52312   15.03380  1.000 23.70255  ? 371  GLN H CB  1 
ATOM   2911  C CG  . GLN A  1 391 ? 9.87122   -10.28899  15.82385  1.000 33.07039  ? 371  GLN H CG  1 
ATOM   2912  C CD  . GLN A  1 391 ? 10.22503  -11.75781  15.90941  1.000 40.89877  ? 371  GLN H CD  1 
ATOM   2913  O OE1 . GLN A  1 391 ? 9.51104   -12.54887  16.50922  1.000 45.11461  ? 371  GLN H OE1 1 
ATOM   2914  N NE2 . GLN A  1 391 ? 11.32550  -12.13016  15.28515  1.000 43.08380  ? 371  GLN H NE2 1 
ATOM   2915  N N   . LEU A  1 392 ? 12.64329  -6.45329   14.75243  1.000 18.80452  ? 372  LEU H N   1 
ATOM   2916  C CA  . LEU A  1 392 ? 13.59974  -5.68408   13.97623  1.000 20.26982  ? 372  LEU H CA  1 
ATOM   2917  C C   . LEU A  1 392 ? 14.99944  -5.86492   14.52883  1.000 22.14549  ? 372  LEU H C   1 
ATOM   2918  O O   . LEU A  1 392 ? 15.21173  -5.68300   15.73276  1.000 19.25234  ? 372  LEU H O   1 
ATOM   2919  C CB  . LEU A  1 392 ? 13.25071  -4.18393   14.00418  1.000 25.39661  ? 372  LEU H CB  1 
ATOM   2920  C CG  . LEU A  1 392 ? 11.75797  -3.96220   13.77496  1.000 29.11107  ? 372  LEU H CG  1 
ATOM   2921  C CD1 . LEU A  1 392 ? 11.27164  -2.64785   14.32120  1.000 32.42141  ? 372  LEU H CD1 1 
ATOM   2922  C CD2 . LEU A  1 392 ? 11.46759  -4.05281   12.32130  1.000 28.73502  ? 372  LEU H CD2 1 
ATOM   2923  N N   . SER A  1 393 ? 15.95746  -6.16220   13.64627  1.000 22.69265  ? 373  SER H N   1 
ATOM   2924  C CA  . SER A  1 393 ? 17.36052  -6.29155   14.02047  1.000 22.74599  ? 373  SER H CA  1 
ATOM   2925  C C   . SER A  1 393 ? 18.23648  -5.51395   13.06759  1.000 21.97330  ? 373  SER H C   1 
ATOM   2926  O O   . SER A  1 393 ? 18.05278  -5.59150   11.84125  1.000 23.09272  ? 373  SER H O   1 
ATOM   2927  C CB  . SER A  1 393 ? 17.83574  -7.73113   13.99415  1.000 28.20090  ? 373  SER H CB  1 
ATOM   2928  O OG  . SER A  1 393 ? 16.89511  -8.55716   14.63255  1.000 42.02341  ? 373  SER H OG  1 
ATOM   2929  N N   . ASN A  1 394 ? 19.23868  -4.83092   13.62945  1.000 17.86310  ? 374  ASN H N   1 
ATOM   2930  C CA  . ASN A  1 394 ? 20.26162  -4.11003   12.86896  1.000 25.35271  ? 374  ASN H CA  1 
ATOM   2931  C C   . ASN A  1 394 ? 19.62911  -2.99296   12.03018  1.000 25.97648  ? 374  ASN H C   1 
ATOM   2932  O O   . ASN A  1 394 ? 19.59691  -3.01458   10.78503  1.000 25.70827  ? 374  ASN H O   1 
ATOM   2933  C CB  . ASN A  1 394 ? 21.05523  -5.08550   11.98766  1.000 24.73613  ? 374  ASN H CB  1 
ATOM   2934  C CG  . ASN A  1 394 ? 21.93079  -5.99954   12.79466  1.000 27.48557  ? 374  ASN H CG  1 
ATOM   2935  O OD1 . ASN A  1 394 ? 22.68601  -5.55821   13.66367  1.000 21.28480  ? 374  ASN H OD1 1 
ATOM   2936  N ND2 . ASN A  1 394 ? 21.85314  -7.28802   12.50177  1.000 31.32505  ? 374  ASN H ND2 1 
ATOM   2937  N N   . VAL A  1 395 ? 19.09506  -2.00812   12.74188  1.000 18.41479  ? 375  VAL H N   1 
ATOM   2938  C CA  . VAL A  1 395 ? 18.28467  -1.00812   12.07509  1.000 19.35495  ? 375  VAL H CA  1 
ATOM   2939  C C   . VAL A  1 395 ? 18.56373  0.34933    12.68238  1.000 19.72401  ? 375  VAL H C   1 
ATOM   2940  O O   . VAL A  1 395 ? 18.94755  0.46954    13.85804  1.000 15.87935  ? 375  VAL H O   1 
ATOM   2941  C CB  . VAL A  1 395 ? 16.77921  -1.29250   12.18083  1.000 20.99237  ? 375  VAL H CB  1 
ATOM   2942  C CG1 . VAL A  1 395 ? 16.38148  -2.47645   11.31498  1.000 25.08723  ? 375  VAL H CG1 1 
ATOM   2943  C CG2 . VAL A  1 395 ? 16.40273  -1.49268   13.62880  1.000 16.72793  ? 375  VAL H CG2 1 
ATOM   2944  N N   . VAL A  1 396 ? 18.34852  1.37334    11.85313  1.000 17.33450  ? 376  VAL H N   1 
ATOM   2945  C CA  . VAL A  1 396 ? 18.15894  2.74806    12.30352  1.000 18.71698  ? 376  VAL H CA  1 
ATOM   2946  C C   . VAL A  1 396 ? 16.73660  3.14218    11.92501  1.000 21.46629  ? 376  VAL H C   1 
ATOM   2947  O O   . VAL A  1 396 ? 16.37286  3.13671    10.74030  1.000 21.62453  ? 376  VAL H O   1 
ATOM   2948  C CB  . VAL A  1 396 ? 19.16206  3.69905    11.64884  1.000 16.63072  ? 376  VAL H CB  1 
ATOM   2949  C CG1 . VAL A  1 396 ? 18.84975  5.13319    12.05049  1.000 16.74670  ? 376  VAL H CG1 1 
ATOM   2950  C CG2 . VAL A  1 396 ? 20.61099  3.28771    11.97512  1.000 16.49290  ? 376  VAL H CG2 1 
ATOM   2951  N N   . ILE A  1 397 ? 15.92785  3.49487    12.91118  1.000 18.31424  ? 377  ILE H N   1 
ATOM   2952  C CA  . ILE A  1 397 ? 14.55252  3.88302    12.62867  1.000 20.56017  ? 377  ILE H CA  1 
ATOM   2953  C C   . ILE A  1 397 ? 14.44565  5.39612    12.74711  1.000 20.83820  ? 377  ILE H C   1 
ATOM   2954  O O   . ILE A  1 397 ? 14.74706  5.95100    13.79944  1.000 20.91115  ? 377  ILE H O   1 
ATOM   2955  C CB  . ILE A  1 397 ? 13.56979  3.18705    13.56867  1.000 20.40020  ? 377  ILE H CB  1 
ATOM   2956  C CG1 . ILE A  1 397 ? 13.88911  1.69165    13.58972  1.000 16.37359  ? 377  ILE H CG1 1 
ATOM   2957  C CG2 . ILE A  1 397 ? 12.12937  3.47198    13.13427  1.000 19.88625  ? 377  ILE H CG2 1 
ATOM   2958  C CD1 . ILE A  1 397 ? 12.99598  0.91579    14.53026  1.000 17.25859  ? 377  ILE H CD1 1 
ATOM   2959  N N   . ASP A  1 398 ? 14.02910  6.04858    11.66244  1.000 17.09613  ? 378  ASP H N   1 
ATOM   2960  C CA  . ASP A  1 398 ? 13.97100  7.51169    11.59226  1.000 20.43339  ? 378  ASP H CA  1 
ATOM   2961  C C   . ASP A  1 398 ? 12.91054  8.06459    12.55622  1.000 19.67854  ? 378  ASP H C   1 
ATOM   2962  O O   . ASP A  1 398 ? 11.95679  7.37853    12.95385  1.000 19.46281  ? 378  ASP H O   1 
ATOM   2963  C CB  . ASP A  1 398 ? 13.68248  7.95263    10.13330  1.000 20.16369  ? 378  ASP H CB  1 
ATOM   2964  C CG  . ASP A  1 398 ? 13.73494  9.50046    9.92468   1.000 26.38080  ? 378  ASP H CG  1 
ATOM   2965  O OD1 . ASP A  1 398 ? 14.46272  10.22742   10.65075  1.000 23.37196  ? 378  ASP H OD1 1 
ATOM   2966  O OD2 . ASP A  1 398 ? 13.07261  9.99036    8.97933   1.000 23.97768  ? 378  ASP H OD2 1 
ATOM   2967  N N   . HIS A  1 399 ? 13.08444  9.33085    12.92152  1.000 16.61746  ? 379  HIS H N   1 
ATOM   2968  C CA  . HIS A  1 399 ? 12.17358  10.00040   13.85581  1.000 23.49956  ? 379  HIS H CA  1 
ATOM   2969  C C   . HIS A  1 399 ? 10.70319  9.84295    13.44941  1.000 24.11024  ? 379  HIS H C   1 
ATOM   2970  O O   . HIS A  1 399 ? 10.35750  10.01841   12.28169  1.000 25.20514  ? 379  HIS H O   1 
ATOM   2971  C CB  . HIS A  1 399 ? 12.57097  11.48053   13.90677  1.000 25.55531  ? 379  HIS H CB  1 
ATOM   2972  C CG  . HIS A  1 399 ? 11.62851  12.32967   14.68662  1.000 28.94676  ? 379  HIS H CG  1 
ATOM   2973  N ND1 . HIS A  1 399 ? 12.01986  13.02285   15.81056  1.000 28.91909  ? 379  HIS H ND1 1 
ATOM   2974  C CD2 . HIS A  1 399 ? 10.31329  12.60018   14.51408  1.000 27.52665  ? 379  HIS H CD2 1 
ATOM   2975  C CE1 . HIS A  1 399 ? 10.98462  13.66499   16.31624  1.000 27.02339  ? 379  HIS H CE1 1 
ATOM   2976  N NE2 . HIS A  1 399 ? 9.93606   13.42460   15.54856  1.000 32.45663  ? 379  HIS H NE2 1 
ATOM   2977  N N   . GLY A  1 400 ? 9.83277   9.49026    14.41749  1.000 19.68719  ? 380  GLY H N   1 
ATOM   2978  C CA  . GLY A  1 400 ? 8.37996   9.46591    14.22325  1.000 22.50703  ? 380  GLY H CA  1 
ATOM   2979  C C   . GLY A  1 400 ? 7.80951   8.32055    13.39850  1.000 21.19784  ? 380  GLY H C   1 
ATOM   2980  O O   . GLY A  1 400 ? 6.57903   8.26701    13.18599  1.000 23.13361  ? 380  GLY H O   1 
ATOM   2981  N N   . VAL A  1 401 ? 8.63976   7.38571    12.94815  1.000 21.52991  ? 381  VAL H N   1 
ATOM   2982  C CA  . VAL A  1 401 ? 8.14633   6.24915    12.17585  1.000 24.72243  ? 381  VAL H CA  1 
ATOM   2983  C C   . VAL A  1 401 ? 7.18828   5.38606    12.99846  1.000 23.51287  ? 381  VAL H C   1 
ATOM   2984  O O   . VAL A  1 401 ? 7.39804   5.12208    14.19499  1.000 20.60167  ? 381  VAL H O   1 
ATOM   2985  C CB  . VAL A  1 401 ? 9.35221   5.43915    11.66700  1.000 23.10371  ? 381  VAL H CB  1 
ATOM   2986  C CG1 . VAL A  1 401 ? 8.90476   4.09261    11.10641  1.000 28.55029  ? 381  VAL H CG1 1 
ATOM   2987  C CG2 . VAL A  1 401 ? 10.10399  6.24752    10.59958  1.000 20.25865  ? 381  VAL H CG2 1 
ATOM   2988  N N   . VAL A  1 402 ? 6.11048   4.96363    12.36504  1.000 25.10768  ? 382  VAL H N   1 
ATOM   2989  C CA  . VAL A  1 402 ? 5.21485   3.95649    12.90813  1.000 24.36780  ? 382  VAL H CA  1 
ATOM   2990  C C   . VAL A  1 402 ? 5.52880   2.64334    12.18056  1.000 27.58395  ? 382  VAL H C   1 
ATOM   2991  O O   . VAL A  1 402 ? 5.32880   2.51935    10.96500  1.000 24.82751  ? 382  VAL H O   1 
ATOM   2992  C CB  . VAL A  1 402 ? 3.74623   4.37564    12.75743  1.000 28.14762  ? 382  VAL H CB  1 
ATOM   2993  C CG1 . VAL A  1 402 ? 2.84292   3.26154    13.20966  1.000 29.39382  ? 382  VAL H CG1 1 
ATOM   2994  C CG2 . VAL A  1 402 ? 3.47684   5.61762    13.58866  1.000 30.20974  ? 382  VAL H CG2 1 
ATOM   2995  N N   . ILE A  1 403 ? 6.06820   1.67232    12.91157  1.000 24.33861  ? 383  ILE H N   1 
ATOM   2996  C CA  . ILE A  1 403 ? 6.40281   0.35877    12.37402  1.000 25.05186  ? 383  ILE H CA  1 
ATOM   2997  C C   . ILE A  1 403 ? 5.12122   -0.45953   12.45156  1.000 26.51640  ? 383  ILE H C   1 
ATOM   2998  O O   . ILE A  1 403 ? 4.50935   -0.55210   13.53503  1.000 25.86056  ? 383  ILE H O   1 
ATOM   2999  C CB  . ILE A  1 403 ? 7.55500   -0.29524   13.16424  1.000 25.43067  ? 383  ILE H CB  1 
ATOM   3000  C CG1 . ILE A  1 403 ? 8.85354   0.49569    12.98117  1.000 21.96093  ? 383  ILE H CG1 1 
ATOM   3001  C CG2 . ILE A  1 403 ? 7.71431   -1.79600   12.79233  1.000 23.11307  ? 383  ILE H CG2 1 
ATOM   3002  C CD1 . ILE A  1 403 ? 9.31962   0.54257    11.51994  1.000 22.70220  ? 383  ILE H CD1 1 
ATOM   3003  N N   . PRO A  1 404 ? 4.66583   -1.03209   11.34095  1.000 24.15285  ? 384  PRO H N   1 
ATOM   3004  C CA  . PRO A  1 404 ? 3.42413   -1.81655   11.36475  1.000 24.71639  ? 384  PRO H CA  1 
ATOM   3005  C C   . PRO A  1 404 ? 3.56709   -3.07463   12.20203  1.000 26.28352  ? 384  PRO H C   1 
ATOM   3006  O O   . PRO A  1 404 ? 4.64236   -3.67791   12.26986  1.000 25.94198  ? 384  PRO H O   1 
ATOM   3007  C CB  . PRO A  1 404 ? 3.19934   -2.19147   9.89214   1.000 24.59287  ? 384  PRO H CB  1 
ATOM   3008  C CG  . PRO A  1 404 ? 4.09854   -1.28341   9.10203   1.000 24.42294  ? 384  PRO H CG  1 
ATOM   3009  C CD  . PRO A  1 404 ? 5.24611   -0.91165   9.98400   1.000 22.89144  ? 384  PRO H CD  1 
ATOM   3010  N N   . GLU A  1 405 ? 2.46428   -3.46968   12.83468  1.000 23.48095  ? 385  GLU H N   1 
ATOM   3011  C CA  . GLU A  1 405 ? 2.42638   -4.74709   13.53794  1.000 29.34002  ? 385  GLU H CA  1 
ATOM   3012  C C   . GLU A  1 405 ? 2.97912   -5.86451   12.66322  1.000 27.03902  ? 385  GLU H C   1 
ATOM   3013  O O   . GLU A  1 405 ? 2.68540   -5.94970   11.46602  1.000 25.16871  ? 385  GLU H O   1 
ATOM   3014  C CB  . GLU A  1 405 ? 0.99785   -5.08255   13.97239  1.000 29.82373  ? 385  GLU H CB  1 
ATOM   3015  C CG  . GLU A  1 405 ? 0.39645   -4.00487   14.87417  1.000 35.16514  ? 385  GLU H CG  1 
ATOM   3016  C CD  . GLU A  1 405 ? -1.08825  -4.19980   15.20365  1.000 40.07111  ? 385  GLU H CD  1 
ATOM   3017  O OE1 . GLU A  1 405 ? -1.84614  -4.72514   14.36034  1.000 41.77051  ? 385  GLU H OE1 1 
ATOM   3018  O OE2 . GLU A  1 405 ? -1.51301  -3.80950   16.31355  1.000 41.08732  ? 385  GLU H OE2 1 
ATOM   3019  N N   . GLY A  1 406 ? 3.82563   -6.69651   13.27028  1.000 28.52934  ? 386  GLY H N   1 
ATOM   3020  C CA  . GLY A  1 406 ? 4.35446   -7.89653   12.66492  1.000 29.33395  ? 386  GLY H CA  1 
ATOM   3021  C C   . GLY A  1 406 ? 5.41215   -7.69844   11.60670  1.000 30.07172  ? 386  GLY H C   1 
ATOM   3022  O O   . GLY A  1 406 ? 5.84228   -8.68568   10.99637  1.000 32.23148  ? 386  GLY H O   1 
ATOM   3023  N N   . LEU A  1 407 ? 5.80507   -6.46497   11.32290  1.000 24.77199  ? 387  LEU H N   1 
ATOM   3024  C CA  . LEU A  1 407 ? 6.89443   -6.22033   10.38390  1.000 24.02208  ? 387  LEU H CA  1 
ATOM   3025  C C   . LEU A  1 407 ? 8.15140   -6.93938   10.84895  1.000 26.55442  ? 387  LEU H C   1 
ATOM   3026  O O   . LEU A  1 407 ? 8.53011   -6.83646   12.01442  1.000 23.73316  ? 387  LEU H O   1 
ATOM   3027  C CB  . LEU A  1 407 ? 7.18239   -4.71962   10.30353  1.000 23.63872  ? 387  LEU H CB  1 
ATOM   3028  C CG  . LEU A  1 407 ? 8.17247   -4.34282   9.19884   1.000 27.00441  ? 387  LEU H CG  1 
ATOM   3029  C CD1 . LEU A  1 407 ? 7.48562   -4.48664   7.82609   1.000 29.29459  ? 387  LEU H CD1 1 
ATOM   3030  C CD2 . LEU A  1 407 ? 8.74633   -2.93807   9.41868   1.000 24.44223  ? 387  LEU H CD2 1 
ATOM   3031  N N   . ILE A  1 408 ? 8.82645   -7.62498   9.93703   1.000 24.44428  ? 388  ILE H N   1 
ATOM   3032  C CA  . ILE A  1 408 ? 10.08874  -8.29260   10.24248  1.000 25.68581  ? 388  ILE H CA  1 
ATOM   3033  C C   . ILE A  1 408 ? 11.18155  -7.62797   9.42040   1.000 26.24248  ? 388  ILE H C   1 
ATOM   3034  O O   . ILE A  1 408 ? 11.04627  -7.49617   8.19557   1.000 24.45026  ? 388  ILE H O   1 
ATOM   3035  C CB  . ILE A  1 408 ? 10.02900  -9.80352   9.94574   1.000 27.17439  ? 388  ILE H CB  1 
ATOM   3036  C CG1 . ILE A  1 408 ? 8.84015   -10.44717  10.67475  1.000 24.69961  ? 388  ILE H CG1 1 
ATOM   3037  C CG2 . ILE A  1 408 ? 11.34403  -10.46246  10.31185  1.000 29.42106  ? 388  ILE H CG2 1 
ATOM   3038  C CD1 . ILE A  1 408 ? 9.01753   -10.58566  12.19135  1.000 25.22644  ? 388  ILE H CD1 1 
ATOM   3039  N N   . VAL A  1 409 ? 12.25204  -7.19659   10.09155  1.000 22.13897  ? 389  VAL H N   1 
ATOM   3040  C CA  . VAL A  1 409 ? 13.41850  -6.62625   9.42953   1.000 24.00069  ? 389  VAL H CA  1 
ATOM   3041  C C   . VAL A  1 409 ? 14.66363  -7.28181   10.00799  1.000 23.81354  ? 389  VAL H C   1 
ATOM   3042  O O   . VAL A  1 409 ? 14.80547  -7.39979   11.23498  1.000 26.24015  ? 389  VAL H O   1 
ATOM   3043  C CB  . VAL A  1 409 ? 13.48608  -5.09490   9.58000   1.000 23.09395  ? 389  VAL H CB  1 
ATOM   3044  C CG1 . VAL A  1 409 ? 14.66782  -4.53492   8.79261   1.000 24.61258  ? 389  VAL H CG1 1 
ATOM   3045  C CG2 . VAL A  1 409 ? 12.22990  -4.43040   9.07153   1.000 24.70126  ? 389  VAL H CG2 1 
ATOM   3046  N N   . GLY A  1 410 ? 15.56088  -7.72333   9.13479   1.000 26.28293  ? 390  GLY H N   1 
ATOM   3047  C CA  . GLY A  1 410 ? 16.79273  -8.35372   9.57807   1.000 25.58024  ? 390  GLY H CA  1 
ATOM   3048  C C   . GLY A  1 410 ? 16.83949  -9.84564   9.35046   1.000 28.39616  ? 390  GLY H C   1 
ATOM   3049  O O   . GLY A  1 410 ? 17.85951  -10.46891  9.66355   1.000 29.96752  ? 390  GLY H O   1 
ATOM   3050  N N   . GLU A  1 411 ? 15.77778  -10.43597  8.79734   1.000 26.58880  ? 391  GLU H N   1 
ATOM   3051  C CA  . GLU A  1 411 ? 15.70859  -11.86567  8.51761   1.000 30.35392  ? 391  GLU H CA  1 
ATOM   3052  C C   . GLU A  1 411 ? 16.01877  -12.20022  7.06746   1.000 30.83715  ? 391  GLU H C   1 
ATOM   3053  O O   . GLU A  1 411 ? 16.58327  -13.26487  6.78997   1.000 34.72600  ? 391  GLU H O   1 
ATOM   3054  C CB  . GLU A  1 411 ? 14.31041  -12.40078  8.87640   1.000 30.19989  ? 391  GLU H CB  1 
ATOM   3055  C CG  . GLU A  1 411 ? 14.00145  -13.83927  8.45445   1.000 36.21726  ? 391  GLU H CG  1 
ATOM   3056  C CD  . GLU A  1 411 ? 12.49030  -14.15411  8.52236   1.000 39.43580  ? 391  GLU H CD  1 
ATOM   3057  O OE1 . GLU A  1 411 ? 11.74198  -13.63208  7.66004   1.000 42.10039  ? 391  GLU H OE1 1 
ATOM   3058  O OE2 . GLU A  1 411 ? 12.05270  -14.90274  9.44244   1.000 38.28604  ? 391  GLU H OE2 1 
ATOM   3059  N N   . ASP A  1 412 ? 15.67999  -11.31781  6.13386   1.000 27.54600  ? 392  ASP H N   1 
ATOM   3060  C CA  . ASP A  1 412 ? 15.76707  -11.62839  4.70882   1.000 31.02784  ? 392  ASP H CA  1 
ATOM   3061  C C   . ASP A  1 412 ? 16.44426  -10.45263  4.04298   1.000 30.98033  ? 392  ASP H C   1 
ATOM   3062  O O   . ASP A  1 412 ? 15.78559  -9.43897   3.74987   1.000 29.28675  ? 392  ASP H O   1 
ATOM   3063  C CB  . ASP A  1 412 ? 14.38695  -11.89023  4.12732   1.000 30.73855  ? 392  ASP H CB  1 
ATOM   3064  C CG  . ASP A  1 412 ? 14.40255  -12.22553  2.64759   1.000 38.09227  ? 392  ASP H CG  1 
ATOM   3065  O OD1 . ASP A  1 412 ? 15.45766  -12.19135  1.96852   1.000 39.18879  ? 392  ASP H OD1 1 
ATOM   3066  O OD2 . ASP A  1 412 ? 13.30850  -12.54952  2.17616   1.000 39.23774  ? 392  ASP H OD2 1 
ATOM   3067  N N   . PRO A  1 413 ? 17.75399  -10.54022  3.80873   1.000 30.24825  ? 393  PRO H N   1 
ATOM   3068  C CA  . PRO A  1 413 ? 18.46293  -9.39209   3.22127   1.000 32.85662  ? 393  PRO H CA  1 
ATOM   3069  C C   . PRO A  1 413 ? 17.86671  -8.93799   1.89387   1.000 36.05092  ? 393  PRO H C   1 
ATOM   3070  O O   . PRO A  1 413 ? 17.71505  -7.72518   1.68535   1.000 34.93438  ? 393  PRO H O   1 
ATOM   3071  C CB  . PRO A  1 413 ? 19.89777  -9.91560   3.07187   1.000 34.10890  ? 393  PRO H CB  1 
ATOM   3072  C CG  . PRO A  1 413 ? 20.00598  -11.01227  4.13190   1.000 34.37192  ? 393  PRO H CG  1 
ATOM   3073  C CD  . PRO A  1 413 ? 18.65282  -11.65272  4.15349   1.000 31.02202  ? 393  PRO H CD  1 
ATOM   3074  N N   . GLU A  1 414 ? 17.48201  -9.87628   1.00630   1.000 31.19760  ? 394  GLU H N   1 
ATOM   3075  C CA  . GLU A  1 414 ? 16.88909  -9.49702   -0.27247  1.000 29.46706  ? 394  GLU H CA  1 
ATOM   3076  C C   . GLU A  1 414 ? 15.62174  -8.67316   -0.07978  1.000 31.60367  ? 394  GLU H C   1 
ATOM   3077  O O   . GLU A  1 414 ? 15.49044  -7.58375   -0.64613  1.000 33.65847  ? 394  GLU H O   1 
ATOM   3078  C CB  . GLU A  1 414 ? 16.59651  -10.74434  -1.11923  1.000 37.75393  ? 394  GLU H CB  1 
ATOM   3079  C CG  . GLU A  1 414 ? 16.00321  -10.38235  -2.46869  1.000 46.68674  ? 394  GLU H CG  1 
ATOM   3080  C CD  . GLU A  1 414 ? 15.92233  -11.56786  -3.39886  1.000 56.74223  ? 394  GLU H CD  1 
ATOM   3081  O OE1 . GLU A  1 414 ? 16.20157  -11.40329  -4.61350  1.000 59.94401  ? 394  GLU H OE1 1 
ATOM   3082  O OE2 . GLU A  1 414 ? 15.56482  -12.65897  -2.90777  1.000 58.64556  ? 394  GLU H OE2 1 
ATOM   3083  N N   . LEU A  1 415 ? 14.69192  -9.15499   0.74615   1.000 31.47993  ? 395  LEU H N   1 
ATOM   3084  C CA  . LEU A  1 415 ? 13.44872  -8.41981   0.94572   1.000 30.26847  ? 395  LEU H CA  1 
ATOM   3085  C C   . LEU A  1 415 ? 13.70746  -7.11232   1.67694   1.000 30.86932  ? 395  LEU H C   1 
ATOM   3086  O O   . LEU A  1 415 ? 13.17739  -6.06463   1.28452   1.000 34.19032  ? 395  LEU H O   1 
ATOM   3087  C CB  . LEU A  1 415 ? 12.45307  -9.27825   1.71483   1.000 31.93612  ? 395  LEU H CB  1 
ATOM   3088  C CG  . LEU A  1 415 ? 11.09773  -8.62528   1.95441   1.000 33.68202  ? 395  LEU H CG  1 
ATOM   3089  C CD1 . LEU A  1 415 ? 10.34493  -8.50524   0.63085   1.000 39.35098  ? 395  LEU H CD1 1 
ATOM   3090  C CD2 . LEU A  1 415 ? 10.30961  -9.43667   2.95474   1.000 37.12050  ? 395  LEU H CD2 1 
ATOM   3091  N N   . ASP A  1 416 ? 14.56738  -7.15175   2.70183   1.000 29.27046  ? 396  ASP H N   1 
ATOM   3092  C CA  . ASP A  1 416 ? 14.91315  -5.93520   3.43132   1.000 29.63010  ? 396  ASP H CA  1 
ATOM   3093  C C   . ASP A  1 416 ? 15.49043  -4.87455   2.50879   1.000 31.42561  ? 396  ASP H C   1 
ATOM   3094  O O   . ASP A  1 416 ? 15.16086  -3.69030   2.63346   1.000 26.27421  ? 396  ASP H O   1 
ATOM   3095  C CB  . ASP A  1 416 ? 15.89990  -6.24410   4.55729   1.000 29.50094  ? 396  ASP H CB  1 
ATOM   3096  C CG  . ASP A  1 416 ? 15.25590  -7.01016   5.71309   1.000 32.72595  ? 396  ASP H CG  1 
ATOM   3097  O OD1 . ASP A  1 416 ? 13.99940  -7.13442   5.70578   1.000 29.18072  ? 396  ASP H OD1 1 
ATOM   3098  O OD2 . ASP A  1 416 ? 16.00882  -7.45195   6.62900   1.000 33.20485  ? 396  ASP H OD2 1 
ATOM   3099  N N   . ALA A  1 417 ? 16.35206  -5.28069   1.57826   1.000 35.96796  ? 397  ALA H N   1 
ATOM   3100  C CA  . ALA A  1 417 ? 16.97350  -4.33095   0.65787   1.000 37.49805  ? 397  ALA H CA  1 
ATOM   3101  C C   . ALA A  1 417 ? 15.98508  -3.78624   -0.36919  1.000 38.71667  ? 397  ALA H C   1 
ATOM   3102  O O   . ALA A  1 417 ? 16.16342  -2.66219   -0.85889  1.000 38.48993  ? 397  ALA H O   1 
ATOM   3103  C CB  . ALA A  1 417 ? 18.16045  -4.98643   -0.04620  1.000 40.02263  ? 397  ALA H CB  1 
ATOM   3104  N N   . LYS A  1 418 ? 14.95107  -4.56130   -0.71941  1.000 40.22654  ? 398  LYS H N   1 
ATOM   3105  C CA  . LYS A  1 418 ? 13.91278  -4.04552   -1.61297  1.000 40.62319  ? 398  LYS H CA  1 
ATOM   3106  C C   . LYS A  1 418 ? 13.03190  -3.02174   -0.90066  1.000 40.93554  ? 398  LYS H C   1 
ATOM   3107  O O   . LYS A  1 418 ? 12.65971  -1.99418   -1.48515  1.000 36.41194  ? 398  LYS H O   1 
ATOM   3108  C CB  . LYS A  1 418 ? 13.06359  -5.19493   -2.16728  1.000 38.92141  ? 398  LYS H CB  1 
ATOM   3109  N N   . ARG A  1 419 ? 12.69166  -3.28260   0.35982   1.000 35.65599  ? 399  ARG H N   1 
ATOM   3110  C CA  . ARG A  1 419 ? 11.82258  -2.36952   1.08627   1.000 36.52562  ? 399  ARG H CA  1 
ATOM   3111  C C   . ARG A  1 419 ? 12.58753  -1.18532   1.65119   1.000 33.42398  ? 399  ARG H C   1 
ATOM   3112  O O   . ARG A  1 419 ? 12.01658  -0.10035   1.75036   1.000 30.06806  ? 399  ARG H O   1 
ATOM   3113  C CB  . ARG A  1 419 ? 11.10942  -3.08464   2.23278   1.000 36.41424  ? 399  ARG H CB  1 
ATOM   3114  C CG  . ARG A  1 419 ? 10.46478  -4.37900   1.82885   1.000 39.67619  ? 399  ARG H CG  1 
ATOM   3115  C CD  . ARG A  1 419 ? 10.10732  -5.21951   3.04520   1.000 37.41283  ? 399  ARG H CD  1 
ATOM   3116  N NE  . ARG A  1 419 ? 8.84372   -5.93179   2.84073   1.000 40.16299  ? 399  ARG H NE  1 
ATOM   3117  C CZ  . ARG A  1 419 ? 8.19453   -6.56577   3.81529   1.000 43.20476  ? 399  ARG H CZ  1 
ATOM   3118  N NH1 . ARG A  1 419 ? 8.70142   -6.58164   5.05600   1.000 34.13837  ? 399  ARG H NH1 1 
ATOM   3119  N NH2 . ARG A  1 419 ? 7.05088   -7.18728   3.55808   1.000 46.09032  ? 399  ARG H NH2 1 
ATOM   3120  N N   . PHE A  1 420 ? 13.86380  -1.36198   2.00991   1.000 29.45236  ? 400  PHE H N   1 
ATOM   3121  C CA  . PHE A  1 420 ? 14.54106  -0.37217   2.82377   1.000 31.64424  ? 400  PHE H CA  1 
ATOM   3122  C C   . PHE A  1 420 ? 15.89780  0.02085    2.24448   1.000 34.09928  ? 400  PHE H C   1 
ATOM   3123  O O   . PHE A  1 420 ? 16.37136  -0.52559   1.25238   1.000 40.87107  ? 400  PHE H O   1 
ATOM   3124  C CB  . PHE A  1 420 ? 14.65812  -0.84805   4.29929   1.000 25.33970  ? 400  PHE H CB  1 
ATOM   3125  C CG  . PHE A  1 420 ? 13.32291  -1.21982   4.91314   1.000 24.47156  ? 400  PHE H CG  1 
ATOM   3126  C CD1 . PHE A  1 420 ? 12.31891  -0.26862   5.06424   1.000 26.20092  ? 400  PHE H CD1 1 
ATOM   3127  C CD2 . PHE A  1 420 ? 13.06263  -2.52579   5.30201   1.000 27.96091  ? 400  PHE H CD2 1 
ATOM   3128  C CE1 . PHE A  1 420 ? 11.07120  -0.63693   5.60772   1.000 26.80104  ? 400  PHE H CE1 1 
ATOM   3129  C CE2 . PHE A  1 420 ? 11.85103  -2.89370   5.83534   1.000 23.18676  ? 400  PHE H CE2 1 
ATOM   3130  C CZ  . PHE A  1 420 ? 10.85419  -1.95659   5.99521   1.000 24.80541  ? 400  PHE H CZ  1 
ATOM   3131  N N   . ARG A  1 421 ? 16.48456  1.05614    2.85195   1.000 30.65707  ? 401  ARG H N   1 
ATOM   3132  C CA  . ARG A  1 421 ? 17.85754  1.47032    2.56363   1.000 27.23881  ? 401  ARG H CA  1 
ATOM   3133  C C   . ARG A  1 421 ? 18.74793  0.53937    3.36168   1.000 29.32907  ? 401  ARG H C   1 
ATOM   3134  O O   . ARG A  1 421 ? 18.81416  0.63610    4.58621   1.000 27.23020  ? 401  ARG H O   1 
ATOM   3135  C CB  . ARG A  1 421 ? 18.09054  2.93036    2.93065   1.000 26.18745  ? 401  ARG H CB  1 
ATOM   3136  C CG  . ARG A  1 421 ? 19.55470  3.37000    2.91300   1.000 26.18264  ? 401  ARG H CG  1 
ATOM   3137  C CD  . ARG A  1 421 ? 20.04981  3.59712    1.49016   1.000 31.32915  ? 401  ARG H CD  1 
ATOM   3138  N NE  . ARG A  1 421 ? 19.22719  4.58889    0.81357   1.000 36.20052  ? 401  ARG H NE  1 
ATOM   3139  C CZ  . ARG A  1 421 ? 19.30278  4.87464    -0.48454  1.000 37.64337  ? 401  ARG H CZ  1 
ATOM   3140  N NH1 . ARG A  1 421 ? 20.16432  4.23072    -1.25274  1.000 36.18776  ? 401  ARG H NH1 1 
ATOM   3141  N NH2 . ARG A  1 421 ? 18.51549  5.80463    -1.00121  1.000 33.91659  ? 401  ARG H NH2 1 
ATOM   3142  N N   . ARG A  1 422 ? 19.38022  -0.42238   2.69150   1.000 31.85876  ? 402  ARG H N   1 
ATOM   3143  C CA  . ARG A  1 422 ? 20.16355  -1.44300   3.38334   1.000 32.25301  ? 402  ARG H CA  1 
ATOM   3144  C C   . ARG A  1 422 ? 21.64229  -1.25620   3.07996   1.000 33.78122  ? 402  ARG H C   1 
ATOM   3145  O O   . ARG A  1 422 ? 22.04097  -1.25224   1.91495   1.000 35.47944  ? 402  ARG H O   1 
ATOM   3146  C CB  . ARG A  1 422 ? 19.72138  -2.85102   2.99030   1.000 28.04223  ? 402  ARG H CB  1 
ATOM   3147  C CG  . ARG A  1 422 ? 20.29758  -3.92687   3.92514   1.000 23.61530  ? 402  ARG H CG  1 
ATOM   3148  C CD  . ARG A  1 422 ? 19.59329  -5.26927   3.70575   1.000 26.39401  ? 402  ARG H CD  1 
ATOM   3149  N NE  . ARG A  1 422 ? 20.09021  -6.30569   4.60434   1.000 32.30816  ? 402  ARG H NE  1 
ATOM   3150  C CZ  . ARG A  1 422 ? 21.22234  -6.98010   4.40241   1.000 31.88021  ? 402  ARG H CZ  1 
ATOM   3151  N NH1 . ARG A  1 422 ? 21.96538  -6.71437   3.33477   1.000 36.43844  ? 402  ARG H NH1 1 
ATOM   3152  N NH2 . ARG A  1 422 ? 21.61932  -7.91190   5.25837   1.000 30.54679  ? 402  ARG H NH2 1 
ATOM   3153  N N   . THR A  1 423 ? 22.45266  -1.09888   4.11385   1.000 29.97176  ? 403  THR H N   1 
ATOM   3154  C CA  . THR A  1 423 ? 23.88035  -1.00977   3.85218   1.000 33.34282  ? 403  THR H CA  1 
ATOM   3155  C C   . THR A  1 423 ? 24.43932  -2.37912   3.48111   1.000 34.59943  ? 403  THR H C   1 
ATOM   3156  O O   . THR A  1 423 ? 23.83936  -3.42037   3.75774   1.000 29.07468  ? 403  THR H O   1 
ATOM   3157  C CB  . THR A  1 423 ? 24.63012  -0.45373   5.05759   1.000 25.78506  ? 403  THR H CB  1 
ATOM   3158  O OG1 . THR A  1 423 ? 24.76282  -1.46723   6.08592   1.000 23.34467  ? 403  THR H OG1 1 
ATOM   3159  C CG2 . THR A  1 423 ? 23.86236  0.76691    5.62224   1.000 26.40751  ? 403  THR H CG2 1 
ATOM   3160  N N   . GLU A  1 424 ? 25.61175  -2.35502   2.84452   1.000 43.14975  ? 404  GLU H N   1 
ATOM   3161  C CA  . GLU A  1 424 ? 26.31813  -3.59122   2.52201   1.000 48.48061  ? 404  GLU H CA  1 
ATOM   3162  C C   . GLU A  1 424 ? 26.51280  -4.43877   3.76794   1.000 42.37737  ? 404  GLU H C   1 
ATOM   3163  O O   . GLU A  1 424 ? 26.38596  -5.66826   3.71691   1.000 42.48364  ? 404  GLU H O   1 
ATOM   3164  C CB  . GLU A  1 424 ? 27.67025  -3.27148   1.87618   1.000 55.30536  ? 404  GLU H CB  1 
ATOM   3165  C CG  . GLU A  1 424 ? 28.43114  -2.12547   2.56475   1.000 63.91322  ? 404  GLU H CG  1 
ATOM   3166  C CD  . GLU A  1 424 ? 28.22660  -0.74370   1.90900   1.000 71.61357  ? 404  GLU H CD  1 
ATOM   3167  O OE1 . GLU A  1 424 ? 29.11970  -0.32940   1.13012   1.000 77.64079  ? 404  GLU H OE1 1 
ATOM   3168  O OE2 . GLU A  1 424 ? 27.20965  -0.05502   2.19717   1.000 71.02862  ? 404  GLU H OE2 1 
ATOM   3169  N N   . SER A  1 425 ? 26.77648  -3.80309   4.90552   1.000 37.29597  ? 405  SER H N   1 
ATOM   3170  C CA  . SER A  1 425 ? 26.91806  -4.57485   6.13123   1.000 34.80874  ? 405  SER H CA  1 
ATOM   3171  C C   . SER A  1 425 ? 25.58214  -4.93179   6.78441   1.000 28.64598  ? 405  SER H C   1 
ATOM   3172  O O   . SER A  1 425 ? 25.59203  -5.52436   7.85827   1.000 30.07654  ? 405  SER H O   1 
ATOM   3173  C CB  . SER A  1 425 ? 27.79306  -3.82626   7.12040   1.000 40.04593  ? 405  SER H CB  1 
ATOM   3174  O OG  . SER A  1 425 ? 27.11818  -2.65706   7.50556   1.000 41.46626  ? 405  SER H OG  1 
ATOM   3175  N N   . GLY A  1 426 ? 24.44431  -4.59976   6.17644   1.000 30.25001  ? 406  GLY H N   1 
ATOM   3176  C CA  . GLY A  1 426 ? 23.16656  -5.11868   6.62709   1.000 28.38023  ? 406  GLY H CA  1 
ATOM   3177  C C   . GLY A  1 426 ? 22.42966  -4.27372   7.63837   1.000 29.68119  ? 406  GLY H C   1 
ATOM   3178  O O   . GLY A  1 426 ? 21.55074  -4.79250   8.33735   1.000 25.73030  ? 406  GLY H O   1 
ATOM   3179  N N   . ILE A  1 427 ? 22.79165  -3.00747   7.78272   1.000 26.95730  ? 407  ILE H N   1 
ATOM   3180  C CA  . ILE A  1 427 ? 21.96510  -2.07157   8.52276   1.000 24.45724  ? 407  ILE H CA  1 
ATOM   3181  C C   . ILE A  1 427 ? 20.85381  -1.56259   7.61804   1.000 22.69477  ? 407  ILE H C   1 
ATOM   3182  O O   . ILE A  1 427 ? 21.11434  -1.07224   6.50750   1.000 22.30701  ? 407  ILE H O   1 
ATOM   3183  C CB  . ILE A  1 427 ? 22.80309  -0.90313   9.05785   1.000 21.70324  ? 407  ILE H CB  1 
ATOM   3184  C CG1 . ILE A  1 427 ? 23.97588  -1.39707   9.92630   1.000 22.97465  ? 407  ILE H CG1 1 
ATOM   3185  C CG2 . ILE A  1 427 ? 21.88059  0.08925    9.74888   1.000 20.56163  ? 407  ILE H CG2 1 
ATOM   3186  C CD1 . ILE A  1 427 ? 23.59789  -2.32684   11.07820  1.000 22.31616  ? 407  ILE H CD1 1 
ATOM   3187  N N   . CYS A  1 428 ? 19.60473  -1.63893   8.09871   1.000 19.85708  ? 408  CYS H N   1 
ATOM   3188  C CA  . CYS A  1 428 ? 18.46216  -1.06420   7.39236   1.000 20.13705  ? 408  CYS H CA  1 
ATOM   3189  C C   . CYS A  1 428 ? 18.04890  0.26950    8.01220   1.000 21.64086  ? 408  CYS H C   1 
ATOM   3190  O O   . CYS A  1 428 ? 17.59210  0.30581    9.16128   1.000 21.63919  ? 408  CYS H O   1 
ATOM   3191  C CB  . CYS A  1 428 ? 17.28156  -2.01423   7.43868   1.000 23.86968  ? 408  CYS H CB  1 
ATOM   3192  S SG  . CYS A  1 428 ? 17.47722  -3.40090   6.34108   1.000 26.82753  ? 408  CYS H SG  1 
ATOM   3193  N N   . LEU A  1 429 ? 18.18642  1.35658    7.24659   1.000 22.47527  ? 409  LEU H N   1 
ATOM   3194  C CA  . LEU A  1 429 ? 17.57511  2.62439    7.62832   1.000 21.72325  ? 409  LEU H CA  1 
ATOM   3195  C C   . LEU A  1 429 ? 16.10086  2.57918    7.23331   1.000 26.17165  ? 409  LEU H C   1 
ATOM   3196  O O   . LEU A  1 429 ? 15.76876  2.22398    6.09449   1.000 26.34782  ? 409  LEU H O   1 
ATOM   3197  C CB  . LEU A  1 429 ? 18.29862  3.78466    6.93884   1.000 21.00335  ? 409  LEU H CB  1 
ATOM   3198  C CG  . LEU A  1 429 ? 17.49868  5.06452    6.90480   1.000 19.31054  ? 409  LEU H CG  1 
ATOM   3199  C CD1 . LEU A  1 429 ? 17.39726  5.60666    8.32267   1.000 21.70856  ? 409  LEU H CD1 1 
ATOM   3200  C CD2 . LEU A  1 429 ? 18.19556  6.07177    6.00944   1.000 18.47299  ? 409  LEU H CD2 1 
ATOM   3201  N N   . ILE A  1 430 ? 15.20555  2.93804    8.14691   1.000 20.82094  ? 410  ILE H N   1 
ATOM   3202  C CA  . ILE A  1 430 ? 13.77434  2.84388    7.87686   1.000 21.90436  ? 410  ILE H CA  1 
ATOM   3203  C C   . ILE A  1 430 ? 13.10728  4.20252    8.09478   1.000 27.93572  ? 410  ILE H C   1 
ATOM   3204  O O   . ILE A  1 430 ? 13.14169  4.75399    9.20972   1.000 24.52995  ? 410  ILE H O   1 
ATOM   3205  C CB  . ILE A  1 430 ? 13.11388  1.77882    8.76305   1.000 24.91683  ? 410  ILE H CB  1 
ATOM   3206  C CG1 . ILE A  1 430 ? 13.73381  0.39580    8.51694   1.000 26.76665  ? 410  ILE H CG1 1 
ATOM   3207  C CG2 . ILE A  1 430 ? 11.60904  1.78570    8.54657   1.000 24.14577  ? 410  ILE H CG2 1 
ATOM   3208  C CD1 . ILE A  1 430 ? 13.37793  -0.66737   9.59503   1.000 24.93496  ? 410  ILE H CD1 1 
ATOM   3209  N N   . THR A  1 431 ? 12.46152  4.71896    7.04824   1.000 21.69136  ? 411  THR H N   1 
ATOM   3210  C CA  A THR A  1 431 ? 11.72872  5.97687    7.07648   0.097 21.85299  ? 411  THR H CA  1 
ATOM   3211  C CA  B THR A  1 431 ? 11.72048  5.97458    7.12419   0.903 20.49966  ? 411  THR H CA  1 
ATOM   3212  C C   . THR A  1 431 ? 10.23877  5.70270    6.88774   1.000 22.65888  ? 411  THR H C   1 
ATOM   3213  O O   . THR A  1 431 ? 9.84688   4.63687    6.40283   1.000 22.31932  ? 411  THR H O   1 
ATOM   3214  C CB  A THR A  1 431 ? 12.23150  6.92046    5.97348   0.097 23.28159  ? 411  THR H CB  1 
ATOM   3215  C CB  B THR A  1 431 ? 12.19759  6.99901    6.08080   0.903 23.25214  ? 411  THR H CB  1 
ATOM   3216  O OG1 A THR A  1 431 ? 13.39120  6.35587    5.34885   0.097 23.83097  ? 411  THR H OG1 1 
ATOM   3217  O OG1 B THR A  1 431 ? 11.93955  6.48894    4.75927   0.903 25.57587  ? 411  THR H OG1 1 
ATOM   3218  C CG2 A THR A  1 431 ? 12.61223  8.26122    6.54314   0.097 23.41667  ? 411  THR H CG2 1 
ATOM   3219  C CG2 B THR A  1 431 ? 13.68902  7.31743    6.25206   0.903 23.27130  ? 411  THR H CG2 1 
ATOM   3220  N N   . GLN A  1 432 ? 9.40125   6.68838    7.24214   1.000 20.66711  ? 412  GLN H N   1 
ATOM   3221  C CA  . GLN A  1 432 ? 7.96380   6.49873    7.09102   1.000 23.42562  ? 412  GLN H CA  1 
ATOM   3222  C C   . GLN A  1 432 ? 7.56797   6.44431    5.62300   1.000 29.14592  ? 412  GLN H C   1 
ATOM   3223  O O   . GLN A  1 432 ? 6.59696   5.76289    5.26591   1.000 34.04072  ? 412  GLN H O   1 
ATOM   3224  C CB  . GLN A  1 432 ? 7.19814   7.60334    7.80055   1.000 29.76545  ? 412  GLN H CB  1 
ATOM   3225  C CG  . GLN A  1 432 ? 5.68508   7.40440    7.72876   1.000 30.43267  ? 412  GLN H CG  1 
ATOM   3226  C CD  . GLN A  1 432 ? 5.21662   6.25740    8.61728   1.000 33.67999  ? 412  GLN H CD  1 
ATOM   3227  O OE1 . GLN A  1 432 ? 5.59695   6.17553    9.78329   1.000 31.08360  ? 412  GLN H OE1 1 
ATOM   3228  N NE2 . GLN A  1 432 ? 4.38143   5.37416    8.07171   1.000 37.99093  ? 412  GLN H NE2 1 
ATOM   3229  N N   . SER A  1 433 ? 8.31433   7.13058    4.75906   1.000 27.74826  ? 413  SER H N   1 
ATOM   3230  C CA  . SER A  1 433 ? 8.01740   7.06641    3.32850   1.000 36.99007  ? 413  SER H CA  1 
ATOM   3231  C C   . SER A  1 433 ? 8.15801   5.63144    2.80422   1.000 39.36022  ? 413  SER H C   1 
ATOM   3232  O O   . SER A  1 433 ? 7.35045   5.17535    1.98555   1.000 38.96344  ? 413  SER H O   1 
ATOM   3233  C CB  . SER A  1 433 ? 8.93481   7.99975    2.56110   1.000 37.45218  ? 413  SER H CB  1 
ATOM   3234  O OG  . SER A  1 433 ? 9.02088   7.57752    1.21372   1.000 49.71515  ? 413  SER H OG  1 
ATOM   3235  N N   . MET A  1 434 ? 9.19609   4.91125    3.25911   1.000 36.03721  ? 414  MET H N   1 
ATOM   3236  C CA  . MET A  1 434 ? 9.33441   3.49695    2.87965   1.000 34.07799  ? 414  MET H CA  1 
ATOM   3237  C C   . MET A  1 434 ? 8.23169   2.62359    3.47592   1.000 34.80490  ? 414  MET H C   1 
ATOM   3238  O O   . MET A  1 434 ? 7.67973   1.76779    2.77236   1.000 36.07165  ? 414  MET H O   1 
ATOM   3239  C CB  . MET A  1 434 ? 10.71684  2.94398    3.26362   1.000 29.79321  ? 414  MET H CB  1 
ATOM   3240  C CG  . MET A  1 434 ? 11.98560  3.33488    2.52633   1.000 30.13079  ? 414  MET H CG  1 
ATOM   3241  S SD  . MET A  1 434 ? 13.03840  3.26109    3.92402   1.000 29.10544  ? 414  MET H SD  1 
ATOM   3242  C CE  . MET A  1 434 ? 14.45581  2.82508    3.12595   1.000 43.01232  ? 414  MET H CE  1 
ATOM   3243  N N   . ILE A  1 435 ? 7.90955   2.78670    4.76302   1.000 35.96025  ? 415  ILE H N   1 
ATOM   3244  C CA  . ILE A  1 435 ? 6.77336   2.07278    5.35925   1.000 35.61294  ? 415  ILE H CA  1 
ATOM   3245  C C   . ILE A  1 435 ? 5.50004   2.26916    4.52236   1.000 35.14886  ? 415  ILE H C   1 
ATOM   3246  O O   . ILE A  1 435 ? 4.76813   1.30826    4.25251   1.000 33.96746  ? 415  ILE H O   1 
ATOM   3247  C CB  . ILE A  1 435 ? 6.57131   2.53048    6.81473   1.000 32.33857  ? 415  ILE H CB  1 
ATOM   3248  C CG1 . ILE A  1 435 ? 7.78024   2.13096    7.68860   1.000 27.31311  ? 415  ILE H CG1 1 
ATOM   3249  C CG2 . ILE A  1 435 ? 5.26328   2.02300    7.41645   1.000 31.61647  ? 415  ILE H CG2 1 
ATOM   3250  C CD1 . ILE A  1 435 ? 7.96062   0.62264    7.86312   1.000 25.19021  ? 415  ILE H CD1 1 
ATOM   3251  N N   . ASP A  1 436 ? 5.23741   3.51126    4.07925   1.000 34.20333  ? 416  ASP H N   1 
ATOM   3252  C CA  . ASP A  1 436 ? 3.98154   3.85775    3.39596   1.000 39.50033  ? 416  ASP H CA  1 
ATOM   3253  C C   . ASP A  1 436 ? 3.78662   3.10238    2.09502   1.000 39.75110  ? 416  ASP H C   1 
ATOM   3254  O O   . ASP A  1 436 ? 2.64674   2.92896    1.65158   1.000 41.93778  ? 416  ASP H O   1 
ATOM   3255  C CB  . ASP A  1 436 ? 3.91718   5.36485    3.10624   1.000 38.86401  ? 416  ASP H CB  1 
ATOM   3256  C CG  . ASP A  1 436 ? 3.61772   6.19881    4.36745   1.000 37.06729  ? 416  ASP H CG  1 
ATOM   3257  O OD1 . ASP A  1 436 ? 3.22335   5.61096    5.39549   1.000 34.91629  ? 416  ASP H OD1 1 
ATOM   3258  O OD2 . ASP A  1 436 ? 3.76996   7.43814    4.32098   1.000 35.89925  ? 416  ASP H OD2 1 
ATOM   3259  N N   . LYS A  1 437 ? 4.86462   2.66155    1.47460   1.000 39.34742  ? 417  LYS H N   1 
ATOM   3260  C CA  . LYS A  1 437 ? 4.81472   1.92579    0.22636   1.000 42.68339  ? 417  LYS H CA  1 
ATOM   3261  C C   . LYS A  1 437 ? 4.54485   0.43790    0.39920   1.000 45.71201  ? 417  LYS H C   1 
ATOM   3262  O O   . LYS A  1 437 ? 4.43646   -0.26089   -0.60391  1.000 41.78053  ? 417  LYS H O   1 
ATOM   3263  C CB  . LYS A  1 437 ? 6.13490   2.11128    -0.52328  1.000 44.06940  ? 417  LYS H CB  1 
ATOM   3264  C CG  . LYS A  1 437 ? 6.39857   3.55394    -0.92872  1.000 49.24251  ? 417  LYS H CG  1 
ATOM   3265  C CD  . LYS A  1 437 ? 7.82932   3.76345    -1.41088  1.000 54.69486  ? 417  LYS H CD  1 
ATOM   3266  C CE  . LYS A  1 437 ? 7.96705   5.08515    -2.17797  1.000 59.36733  ? 417  LYS H CE  1 
ATOM   3267  N NZ  . LYS A  1 437 ? 9.16731   5.88582    -1.77106  1.000 59.40333  ? 417  LYS H NZ  1 
ATOM   3268  N N   . LEU A  1 438 ? 4.38134   -0.05799   1.62217   1.000 52.58363  ? 418  LEU H N   1 
ATOM   3269  C CA  . LEU A  1 438 ? 4.65906   -1.46249   1.90187   1.000 59.95524  ? 418  LEU H CA  1 
ATOM   3270  C C   . LEU A  1 438 ? 3.50654   -2.41370   1.58786   1.000 80.45662  ? 418  LEU H C   1 
ATOM   3271  O O   . LEU A  1 438 ? 2.32442   -2.09532   1.76682   1.000 78.28357  ? 418  LEU H O   1 
ATOM   3272  C CB  . LEU A  1 438 ? 5.03595   -1.64360   3.36716   1.000 46.33601  ? 418  LEU H CB  1 
ATOM   3273  C CG  . LEU A  1 438 ? 6.47830   -1.31904   3.72044   1.000 41.63389  ? 418  LEU H CG  1 
ATOM   3274  C CD1 . LEU A  1 438 ? 6.85277   -2.09763   4.96611   1.000 42.66113  ? 418  LEU H CD1 1 
ATOM   3275  C CD2 . LEU A  1 438 ? 7.42635   -1.64069   2.57547   1.000 42.22019  ? 418  LEU H CD2 1 
ATOM   3276  N N   . ASP A  1 439 ? 3.89527   -3.61992   1.15356   1.000 102.88258 ? 419  ASP H N   1 
ATOM   3277  C CA  . ASP A  1 439 ? 3.05552   -4.80965   1.06072   1.000 118.49540 ? 419  ASP H CA  1 
ATOM   3278  C C   . ASP A  1 439 ? 3.81610   -6.01886   1.60912   1.000 124.16671 ? 419  ASP H C   1 
ATOM   3279  O O   . ASP A  1 439 ? 4.08131   -6.09071   2.81444   1.000 125.98354 ? 419  ASP H O   1 
ATOM   3280  C CB  . ASP A  1 439 ? 2.62734   -5.05787   -0.38484  1.000 128.99542 ? 419  ASP H CB  1 
ATOM   3281  C CG  . ASP A  1 439 ? 1.52408   -4.13162   -0.82525  1.000 136.67223 ? 419  ASP H CG  1 
ATOM   3282  O OD1 . ASP A  1 439 ? 0.67299   -3.78499   0.02298   1.000 139.24112 ? 419  ASP H OD1 1 
ATOM   3283  O OD2 . ASP A  1 439 ? 1.51195   -3.74962   -2.01527  1.000 139.46080 ? 419  ASP H OD2 1 
ATOM   3284  N N   . LEU A  1 440 ? 4.17184   -6.96994   0.73837   1.000 125.77975 ? 420  LEU H N   1 
ATOM   3285  C CA  . LEU A  1 440 ? 5.02966   -8.11127   1.10529   1.000 122.72211 ? 420  LEU H CA  1 
ATOM   3286  C C   . LEU A  1 440 ? 6.44505   -7.91952   0.54606   1.000 120.72912 ? 420  LEU H C   1 
ATOM   3287  O O   . LEU A  1 440 ? 6.83222   -8.54968   -0.44336  1.000 120.84112 ? 420  LEU H O   1 
ATOM   3288  C CB  . LEU A  1 440 ? 4.43960   -9.44046   0.59896   1.000 122.19132 ? 420  LEU H CB  1 
ATOM   3289  C CG  . LEU A  1 440 ? 4.64931   -10.73082  1.41204   1.000 119.27308 ? 420  LEU H CG  1 
ATOM   3290  C CD1 . LEU A  1 440 ? 3.94555   -11.92025  0.75167   1.000 120.12690 ? 420  LEU H CD1 1 
ATOM   3291  C CD2 . LEU A  1 440 ? 6.12875   -11.04214  1.63872   1.000 116.74181 ? 420  LEU H CD2 1 
ATOM   3292  N N   . VAL B  1 26  ? -64.20990 -42.86494  74.63665  1.000 55.70701  ? 6    VAL A N   1 
ATOM   3293  C CA  . VAL B  1 26  ? -63.30780 -42.68080  75.77618  1.000 53.93836  ? 6    VAL A CA  1 
ATOM   3294  C C   . VAL B  1 26  ? -61.89322 -42.31036  75.32693  1.000 50.94859  ? 6    VAL A C   1 
ATOM   3295  O O   . VAL B  1 26  ? -61.34710 -41.31677  75.80044  1.000 46.26342  ? 6    VAL A O   1 
ATOM   3296  C CB  . VAL B  1 26  ? -63.25173 -43.93400  76.68120  1.000 54.46461  ? 6    VAL A CB  1 
ATOM   3297  C CG1 . VAL B  1 26  ? -62.11459 -43.81065  77.68743  1.000 50.47513  ? 6    VAL A CG1 1 
ATOM   3298  C CG2 . VAL B  1 26  ? -64.57696 -44.13778  77.40295  1.000 55.95234  ? 6    VAL A CG2 1 
ATOM   3299  N N   . GLN B  1 27  ? -61.28624 -43.12226  74.40791  1.000 49.73644  ? 7    GLN A N   1 
ATOM   3300  C CA  . GLN B  1 27  ? -59.87651 -42.92011  74.05399  1.000 48.41495  ? 7    GLN A CA  1 
ATOM   3301  C C   . GLN B  1 27  ? -59.73856 -41.82315  73.00530  1.000 39.83614  ? 7    GLN A C   1 
ATOM   3302  O O   . GLN B  1 27  ? -60.50325 -41.77833  72.03840  1.000 41.95127  ? 7    GLN A O   1 
ATOM   3303  C CB  . GLN B  1 27  ? -59.24869 -44.19725  73.51352  1.000 52.21209  ? 7    GLN A CB  1 
ATOM   3304  C CG  . GLN B  1 27  ? -59.30920 -45.37923  74.45704  1.000 58.16537  ? 7    GLN A CG  1 
ATOM   3305  C CD  . GLN B  1 27  ? -58.76303 -46.61804  73.79870  1.000 60.84428  ? 7    GLN A CD  1 
ATOM   3306  O OE1 . GLN B  1 27  ? -58.01258 -46.52437  72.81961  1.000 59.58048  ? 7    GLN A OE1 1 
ATOM   3307  N NE2 . GLN B  1 27  ? -59.13768 -47.79058  74.31679  1.000 62.15694  ? 7    GLN A NE2 1 
ATOM   3308  N N   . PRO B  1 28  ? -58.77309 -40.93943  73.16374  1.000 35.08953  ? 8    PRO A N   1 
ATOM   3309  C CA  . PRO B  1 28  ? -58.57441 -39.90926  72.14848  1.000 32.30346  ? 8    PRO A CA  1 
ATOM   3310  C C   . PRO B  1 28  ? -58.31857 -40.56609  70.79795  1.000 27.97684  ? 8    PRO A C   1 
ATOM   3311  O O   . PRO B  1 28  ? -57.69168 -41.62265  70.71515  1.000 25.57347  ? 8    PRO A O   1 
ATOM   3312  C CB  . PRO B  1 28  ? -57.35903 -39.12901  72.66903  1.000 31.28310  ? 8    PRO A CB  1 
ATOM   3313  C CG  . PRO B  1 28  ? -56.74692 -40.01670  73.75981  1.000 32.33256  ? 8    PRO A CG  1 
ATOM   3314  C CD  . PRO B  1 28  ? -57.80823 -40.86382  74.28146  1.000 30.82409  ? 8    PRO A CD  1 
ATOM   3315  N N   . LEU B  1 29  ? -58.87824 -39.97733  69.74401  1.000 23.87943  ? 9    LEU A N   1 
ATOM   3316  C CA  . LEU B  1 29  ? -58.64026 -40.48618  68.39704  1.000 23.85458  ? 9    LEU A CA  1 
ATOM   3317  C C   . LEU B  1 29  ? -57.21073 -40.22524  67.89711  1.000 22.52021  ? 9    LEU A C   1 
ATOM   3318  O O   . LEU B  1 29  ? -56.74333 -40.92880  66.99173  1.000 24.16391  ? 9    LEU A O   1 
ATOM   3319  C CB  . LEU B  1 29  ? -59.65893 -39.87174  67.43026  1.000 24.32647  ? 9    LEU A CB  1 
ATOM   3320  C CG  . LEU B  1 29  ? -61.12147 -40.10592  67.86087  1.000 26.12898  ? 9    LEU A CG  1 
ATOM   3321  C CD1 . LEU B  1 29  ? -62.04510 -39.36322  66.91246  1.000 27.18916  ? 9    LEU A CD1 1 
ATOM   3322  C CD2 . LEU B  1 29  ? -61.49775 -41.57061  67.86051  1.000 27.78343  ? 9    LEU A CD2 1 
ATOM   3323  N N   . ALA B  1 30  ? -56.50579 -39.23855  68.44566  1.000 20.96370  ? 10   ALA A N   1 
ATOM   3324  C CA  . ALA B  1 30  ? -55.14095 -38.98954  67.96521  1.000 21.33379  ? 10   ALA A CA  1 
ATOM   3325  C C   . ALA B  1 30  ? -54.20950 -40.18023  68.19021  1.000 20.58123  ? 10   ALA A C   1 
ATOM   3326  O O   . ALA B  1 30  ? -53.15573 -40.26457  67.53930  1.000 19.42564  ? 10   ALA A O   1 
ATOM   3327  C CB  . ALA B  1 30  ? -54.54635 -37.75203  68.65109  1.000 23.06457  ? 10   ALA A CB  1 
ATOM   3328  N N   . ARG B  1 31  ? -54.55850 -41.08785  69.10770  1.000 21.01993  ? 11   ARG A N   1 
ATOM   3329  C CA  . ARG B  1 31  ? -53.73797 -42.27457  69.32619  1.000 26.21606  ? 11   ARG A CA  1 
ATOM   3330  C C   . ARG B  1 31  ? -53.65375 -43.14360  68.08433  1.000 28.14243  ? 11   ARG A C   1 
ATOM   3331  O O   . ARG B  1 31  ? -52.66465 -43.86793  67.90063  1.000 30.11750  ? 11   ARG A O   1 
ATOM   3332  C CB  . ARG B  1 31  ? -54.28252 -43.11971  70.46954  1.000 29.94589  ? 11   ARG A CB  1 
ATOM   3333  C CG  . ARG B  1 31  ? -54.11657 -42.54011  71.83811  1.000 22.62747  ? 11   ARG A CG  1 
ATOM   3334  C CD  . ARG B  1 31  ? -54.54565 -43.58344  72.81954  1.000 27.42813  ? 11   ARG A CD  1 
ATOM   3335  N NE  . ARG B  1 31  ? -54.59707 -43.09581  74.19954  1.000 26.83861  ? 11   ARG A NE  1 
ATOM   3336  C CZ  . ARG B  1 31  ? -55.11066 -43.80050  75.19607  1.000 25.88234  ? 11   ARG A CZ  1 
ATOM   3337  N NH1 . ARG B  1 31  ? -55.54558 -45.03160  74.96759  1.000 27.36308  ? 11   ARG A NH1 1 
ATOM   3338  N NH2 . ARG B  1 31  ? -55.16381 -43.29236  76.41877  1.000 26.58759  ? 11   ARG A NH2 1 
ATOM   3339  N N   . ASP B  1 32  ? -54.68905 -43.13302  67.25521  1.000 25.33125  ? 12   ASP A N   1 
ATOM   3340  C CA  . ASP B  1 32  ? -54.72256 -43.95053  66.04666  1.000 30.85274  ? 12   ASP A CA  1 
ATOM   3341  C C   . ASP B  1 32  ? -54.57852 -43.11276  64.78107  1.000 28.88012  ? 12   ASP A C   1 
ATOM   3342  O O   . ASP B  1 32  ? -55.02901 -43.51766  63.70522  1.000 33.11304  ? 12   ASP A O   1 
ATOM   3343  C CB  . ASP B  1 32  ? -56.00855 -44.77885  65.98935  1.000 37.82280  ? 12   ASP A CB  1 
ATOM   3344  C CG  . ASP B  1 32  ? -56.37056 -45.38237  67.33530  1.000 46.90473  ? 12   ASP A CG  1 
ATOM   3345  O OD1 . ASP B  1 32  ? -55.53577 -46.12036  67.89456  1.000 45.66021  ? 12   ASP A OD1 1 
ATOM   3346  O OD2 . ASP B  1 32  ? -57.48455 -45.11605  67.84111  1.000 50.71439  ? 12   ASP A OD2 1 
ATOM   3347  N N   . ALA B  1 33  ? -53.96361 -41.94593  64.88074  1.000 22.33718  ? 13   ALA A N   1 
ATOM   3348  C CA  . ALA B  1 33  ? -53.81892 -41.08029  63.72276  1.000 22.60679  ? 13   ALA A CA  1 
ATOM   3349  C C   . ALA B  1 33  ? -52.36412 -40.96415  63.29309  1.000 24.50679  ? 13   ALA A C   1 
ATOM   3350  O O   . ALA B  1 33  ? -51.43347 -41.16241  64.08603  1.000 23.13783  ? 13   ALA A O   1 
ATOM   3351  C CB  . ALA B  1 33  ? -54.36788 -39.69319  64.02547  1.000 25.48402  ? 13   ALA A CB  1 
ATOM   3352  N N   . MET B  1 34  ? -52.17220 -40.63595  62.01756  1.000 19.65901  ? 14   MET A N   1 
ATOM   3353  C CA  . MET B  1 34  ? -50.85659 -40.30267  61.48714  1.000 18.85323  ? 14   MET A CA  1 
ATOM   3354  C C   . MET B  1 34  ? -50.99756 -38.96021  60.80525  1.000 22.74592  ? 14   MET A C   1 
ATOM   3355  O O   . MET B  1 34  ? -51.92690 -38.76516  60.02489  1.000 22.67429  ? 14   MET A O   1 
ATOM   3356  C CB  . MET B  1 34  ? -50.35169 -41.36207  60.48859  1.000 19.95560  ? 14   MET A CB  1 
ATOM   3357  C CG  . MET B  1 34  ? -49.00286 -41.04079  59.82239  1.000 23.76866  ? 14   MET A CG  1 
ATOM   3358  S SD  . MET B  1 34  ? -48.42655 -42.38915  58.69550  1.000 27.87783  ? 14   MET A SD  1 
ATOM   3359  C CE  . MET B  1 34  ? -46.75745 -41.82535  58.29414  1.000 21.78595  ? 14   MET A CE  1 
ATOM   3360  N N   . ALA B  1 35  ? -50.11190 -38.03525  61.12398  1.000 20.82109  ? 15   ALA A N   1 
ATOM   3361  C CA  . ALA B  1 35  ? -50.09247 -36.74090  60.46455  1.000 20.79257  ? 15   ALA A CA  1 
ATOM   3362  C C   . ALA B  1 35  ? -49.16772 -36.85363  59.27915  1.000 22.55684  ? 15   ALA A C   1 
ATOM   3363  O O   . ALA B  1 35  ? -48.08239 -37.41906  59.39372  1.000 23.36341  ? 15   ALA A O   1 
ATOM   3364  C CB  . ALA B  1 35  ? -49.61215 -35.64642  61.42301  1.000 18.08724  ? 15   ALA A CB  1 
ATOM   3365  N N   . TYR B  1 36  ? -49.60599 -36.37019  58.12668  1.000 19.50423  ? 16   TYR A N   1 
ATOM   3366  C CA  . TYR B  1 36  ? -48.78586 -36.44466  56.92396  1.000 20.33671  ? 16   TYR A CA  1 
ATOM   3367  C C   . TYR B  1 36  ? -48.65805 -35.02912  56.38512  1.000 18.39233  ? 16   TYR A C   1 
ATOM   3368  O O   . TYR B  1 36  ? -49.63224 -34.46773  55.87326  1.000 23.77750  ? 16   TYR A O   1 
ATOM   3369  C CB  . TYR B  1 36  ? -49.40534 -37.38597  55.88947  1.000 18.74797  ? 16   TYR A CB  1 
ATOM   3370  C CG  . TYR B  1 36  ? -48.43264 -37.92295  54.86431  1.000 23.50116  ? 16   TYR A CG  1 
ATOM   3371  C CD1 . TYR B  1 36  ? -47.99800 -37.12919  53.81218  1.000 28.63207  ? 16   TYR A CD1 1 
ATOM   3372  C CD2 . TYR B  1 36  ? -47.94024 -39.21897  54.96062  1.000 24.56203  ? 16   TYR A CD2 1 
ATOM   3373  C CE1 . TYR B  1 36  ? -47.09109 -37.61733  52.84516  1.000 26.68069  ? 16   TYR A CE1 1 
ATOM   3374  C CE2 . TYR B  1 36  ? -47.03304 -39.72665  54.01277  1.000 30.16512  ? 16   TYR A CE2 1 
ATOM   3375  C CZ  . TYR B  1 36  ? -46.60647 -38.91817  52.95756  1.000 30.98417  ? 16   TYR A CZ  1 
ATOM   3376  O OH  . TYR B  1 36  ? -45.71826 -39.41082  52.01139  1.000 31.64789  ? 16   TYR A OH  1 
ATOM   3377  N N   . VAL B  1 37  ? -47.47147 -34.47095  56.46190  1.000 17.05406  ? 17   VAL A N   1 
ATOM   3378  C CA  . VAL B  1 37  ? -47.25246 -33.07038  56.15317  1.000 17.18561  ? 17   VAL A CA  1 
ATOM   3379  C C   . VAL B  1 37  ? -46.68782 -32.94566  54.74425  1.000 21.74548  ? 17   VAL A C   1 
ATOM   3380  O O   . VAL B  1 37  ? -45.66846 -33.56443  54.41888  1.000 25.24398  ? 17   VAL A O   1 
ATOM   3381  C CB  . VAL B  1 37  ? -46.29404 -32.43536  57.16391  1.000 15.12283  ? 17   VAL A CB  1 
ATOM   3382  C CG1 . VAL B  1 37  ? -46.10131 -30.97373  56.82694  1.000 17.29788  ? 17   VAL A CG1 1 
ATOM   3383  C CG2 . VAL B  1 37  ? -46.82305 -32.67076  58.59574  1.000 15.98460  ? 17   VAL A CG2 1 
ATOM   3384  N N   . LEU B  1 38  ? -47.31458 -32.11331  53.92604  1.000 22.39751  ? 18   LEU A N   1 
ATOM   3385  C CA  . LEU B  1 38  ? -46.84327 -31.86897  52.56881  1.000 22.12361  ? 18   LEU A CA  1 
ATOM   3386  C C   . LEU B  1 38  ? -45.91487 -30.66749  52.61954  1.000 23.00344  ? 18   LEU A C   1 
ATOM   3387  O O   . LEU B  1 38  ? -46.35510 -29.54168  52.87479  1.000 24.68619  ? 18   LEU A O   1 
ATOM   3388  C CB  . LEU B  1 38  ? -48.01628 -31.62931  51.62544  1.000 22.28905  ? 18   LEU A CB  1 
ATOM   3389  C CG  . LEU B  1 38  ? -49.06435 -32.73557  51.67817  1.000 21.65479  ? 18   LEU A CG  1 
ATOM   3390  C CD1 . LEU B  1 38  ? -50.36697 -32.27520  50.98157  1.000 25.60584  ? 18   LEU A CD1 1 
ATOM   3391  C CD2 . LEU B  1 38  ? -48.52316 -34.05395  51.08315  1.000 20.79207  ? 18   LEU A CD2 1 
ATOM   3392  N N   . ALA B  1 39  ? -44.63094 -30.90271  52.41538  1.000 21.68818  ? 19   ALA A N   1 
ATOM   3393  C CA  . ALA B  1 39  ? -43.64048 -29.85871  52.62020  1.000 19.61196  ? 19   ALA A CA  1 
ATOM   3394  C C   . ALA B  1 39  ? -42.77447 -29.68820  51.38466  1.000 22.28311  ? 19   ALA A C   1 
ATOM   3395  O O   . ALA B  1 39  ? -41.59395 -29.31965  51.48696  1.000 27.90936  ? 19   ALA A O   1 
ATOM   3396  C CB  . ALA B  1 39  ? -42.78432 -30.13920  53.86201  1.000 20.75298  ? 19   ALA A CB  1 
ATOM   3397  N N   . GLY B  1 40  ? -43.34545 -29.95356  50.22096  1.000 18.99034  ? 20   GLY A N   1 
ATOM   3398  C CA  . GLY B  1 40  ? -42.67745 -29.79081  48.94757  1.000 28.67305  ? 20   GLY A CA  1 
ATOM   3399  C C   . GLY B  1 40  ? -42.86309 -28.45075  48.27754  1.000 34.74196  ? 20   GLY A C   1 
ATOM   3400  O O   . GLY B  1 40  ? -42.26936 -28.21310  47.22229  1.000 40.15996  ? 20   GLY A O   1 
ATOM   3401  N N   . GLY B  1 41  ? -43.65024 -27.55301  48.86213  1.000 39.72993  ? 21   GLY A N   1 
ATOM   3402  C CA  . GLY B  1 41  ? -43.95749 -26.29155  48.21261  1.000 40.00701  ? 21   GLY A CA  1 
ATOM   3403  C C   . GLY B  1 41  ? -42.72886 -25.43870  47.98884  1.000 34.89518  ? 21   GLY A C   1 
ATOM   3404  O O   . GLY B  1 41  ? -41.89409 -25.30658  48.88453  1.000 29.55544  ? 21   GLY A O   1 
ATOM   3405  N N   . ARG B  1 42  ? -42.59607 -24.85748  46.79675  1.000 33.61508  ? 22   ARG A N   1 
ATOM   3406  C CA  . ARG B  1 42  ? -41.45693 -23.99428  46.52057  1.000 33.36714  ? 22   ARG A CA  1 
ATOM   3407  C C   . ARG B  1 42  ? -41.61787 -22.61582  47.13444  1.000 38.27877  ? 22   ARG A C   1 
ATOM   3408  O O   . ARG B  1 42  ? -40.61704 -21.98831  47.48787  1.000 47.10436  ? 22   ARG A O   1 
ATOM   3409  C CB  . ARG B  1 42  ? -41.25066 -23.82470  45.00651  1.000 31.38562  ? 22   ARG A CB  1 
ATOM   3410  N N   . GLY B  1 43  ? -42.84568 -22.11876  47.23397  1.000 34.40601  ? 23   GLY A N   1 
ATOM   3411  C CA  . GLY B  1 43  ? -43.06068 -20.72616  47.58149  1.000 33.17919  ? 23   GLY A CA  1 
ATOM   3412  C C   . GLY B  1 43  ? -42.43674 -19.79913  46.55955  1.000 34.53929  ? 23   GLY A C   1 
ATOM   3413  O O   . GLY B  1 43  ? -41.56592 -18.98844  46.90112  1.000 33.58602  ? 23   GLY A O   1 
ATOM   3414  N N   . SER B  1 44  ? -42.88045 -19.91169  45.29838  1.000 36.50316  ? 24   SER A N   1 
ATOM   3415  C CA  . SER B  1 44  ? -42.24129 -19.17350  44.21077  1.000 37.25312  ? 24   SER A CA  1 
ATOM   3416  C C   . SER B  1 44  ? -42.33714 -17.67721  44.41539  1.000 33.04837  ? 24   SER A C   1 
ATOM   3417  O O   . SER B  1 44  ? -41.42091 -16.94080  44.03996  1.000 29.86343  ? 24   SER A O   1 
ATOM   3418  C CB  . SER B  1 44  ? -42.88869 -19.52952  42.87126  1.000 42.50103  ? 24   SER A CB  1 
ATOM   3419  O OG  . SER B  1 44  ? -42.74613 -20.90504  42.61826  1.000 50.42353  ? 24   SER A OG  1 
ATOM   3420  N N   . ARG B  1 45  ? -43.44309 -17.20485  44.98932  1.000 34.00129  ? 25   ARG A N   1 
ATOM   3421  C CA  . ARG B  1 45  ? -43.58840 -15.76758  45.15686  1.000 34.04456  ? 25   ARG A CA  1 
ATOM   3422  C C   . ARG B  1 45  ? -42.65622 -15.20869  46.21755  1.000 30.45888  ? 25   ARG A C   1 
ATOM   3423  O O   . ARG B  1 45  ? -42.51859 -13.98852  46.29127  1.000 30.04467  ? 25   ARG A O   1 
ATOM   3424  C CB  . ARG B  1 45  ? -45.03538 -15.41604  45.48698  1.000 39.09915  ? 25   ARG A CB  1 
ATOM   3425  C CG  . ARG B  1 45  ? -46.02983 -15.78124  44.37582  1.000 45.59542  ? 25   ARG A CG  1 
ATOM   3426  C CD  . ARG B  1 45  ? -47.44427 -15.32830  44.71752  1.000 49.08320  ? 25   ARG A CD  1 
ATOM   3427  N NE  . ARG B  1 45  ? -47.56851 -13.87169  44.63027  1.000 55.38795  ? 25   ARG A NE  1 
ATOM   3428  C CZ  . ARG B  1 45  ? -48.66149 -13.19148  44.97461  1.000 59.88473  ? 25   ARG A CZ  1 
ATOM   3429  N NH1 . ARG B  1 45  ? -49.72886 -13.84566  45.42948  1.000 62.93746  ? 25   ARG A NH1 1 
ATOM   3430  N NH2 . ARG B  1 45  ? -48.68942 -11.86246  44.87309  1.000 58.64928  ? 25   ARG A NH2 1 
ATOM   3431  N N   . LEU B  1 46  ? -42.00461 -16.06120  47.02279  1.000 27.50477  ? 26   LEU A N   1 
ATOM   3432  C CA  . LEU B  1 46  ? -40.97502 -15.57687  47.93472  1.000 27.59983  ? 26   LEU A CA  1 
ATOM   3433  C C   . LEU B  1 46  ? -39.62673 -15.32433  47.24099  1.000 30.21179  ? 26   LEU A C   1 
ATOM   3434  O O   . LEU B  1 46  ? -38.68030 -14.87048  47.89762  1.000 24.07928  ? 26   LEU A O   1 
ATOM   3435  C CB  . LEU B  1 46  ? -40.83741 -16.56698  49.10767  1.000 24.82686  ? 26   LEU A CB  1 
ATOM   3436  C CG  . LEU B  1 46  ? -41.97388 -16.58803  50.13516  1.000 24.34115  ? 26   LEU A CG  1 
ATOM   3437  C CD1 . LEU B  1 46  ? -41.75246 -17.70265  51.16432  1.000 24.31893  ? 26   LEU A CD1 1 
ATOM   3438  C CD2 . LEU B  1 46  ? -42.11930 -15.25160  50.87481  1.000 22.62436  ? 26   LEU A CD2 1 
ATOM   3439  N N   . LYS B  1 47  ? -39.53079 -15.57946  45.92794  1.000 31.91764  ? 27   LYS A N   1 
ATOM   3440  C CA  . LYS B  1 47  ? -38.41375 -15.16982  45.05594  1.000 31.71433  ? 27   LYS A CA  1 
ATOM   3441  C C   . LYS B  1 47  ? -37.10246 -15.68615  45.63909  1.000 27.58006  ? 27   LYS A C   1 
ATOM   3442  O O   . LYS B  1 47  ? -37.03851 -16.87219  45.98800  1.000 28.08670  ? 27   LYS A O   1 
ATOM   3443  C CB  . LYS B  1 47  ? -38.46587 -13.66563  44.83996  1.000 35.30375  ? 27   LYS A CB  1 
ATOM   3444  C CG  . LYS B  1 47  ? -39.74888 -13.18251  44.19688  1.000 43.17163  ? 27   LYS A CG  1 
ATOM   3445  C CD  . LYS B  1 47  ? -39.72945 -13.39552  42.70242  1.000 51.75623  ? 27   LYS A CD  1 
ATOM   3446  C CE  . LYS B  1 47  ? -40.79018 -12.55366  42.02389  1.000 56.97159  ? 27   LYS A CE  1 
ATOM   3447  N NZ  . LYS B  1 47  ? -42.13901 -12.81017  42.61033  1.000 57.48518  ? 27   LYS A NZ  1 
ATOM   3448  N N   . GLU B  1 48  ? -36.05351 -14.85400  45.74483  1.000 29.26657  ? 28   GLU A N   1 
ATOM   3449  C CA  . GLU B  1 48  ? -34.74295 -15.31650  46.20062  1.000 30.10014  ? 28   GLU A CA  1 
ATOM   3450  C C   . GLU B  1 48  ? -34.78661 -15.93525  47.59779  1.000 30.66349  ? 28   GLU A C   1 
ATOM   3451  O O   . GLU B  1 48  ? -33.89292 -16.72066  47.96327  1.000 29.83282  ? 28   GLU A O   1 
ATOM   3452  C CB  . GLU B  1 48  ? -33.74855 -14.14630  46.18069  1.000 30.38275  ? 28   GLU A CB  1 
ATOM   3453  C CG  . GLU B  1 48  ? -33.34779 -13.59465  44.81172  1.000 35.80798  ? 28   GLU A CG  1 
ATOM   3454  C CD  . GLU B  1 48  ? -34.41855 -12.71687  44.19898  1.000 40.57230  ? 28   GLU A CD  1 
ATOM   3455  O OE1 . GLU B  1 48  ? -35.35355 -12.29653  44.92616  1.000 38.06579  ? 28   GLU A OE1 1 
ATOM   3456  O OE2 . GLU B  1 48  ? -34.30701 -12.41615  42.98734  1.000 47.99025  ? 28   GLU A OE2 1 
ATOM   3457  N N   . LEU B  1 49  ? -35.80875 -15.62463  48.39132  1.000 30.35726  ? 29   LEU A N   1 
ATOM   3458  C CA  . LEU B  1 49  ? -35.86844 -16.22173  49.72294  1.000 30.15601  ? 29   LEU A CA  1 
ATOM   3459  C C   . LEU B  1 49  ? -35.99211 -17.73731  49.63960  1.000 32.27996  ? 29   LEU A C   1 
ATOM   3460  O O   . LEU B  1 49  ? -35.53181 -18.44550  50.54334  1.000 32.09960  ? 29   LEU A O   1 
ATOM   3461  C CB  . LEU B  1 49  ? -37.02939 -15.61430  50.51425  1.000 29.31493  ? 29   LEU A CB  1 
ATOM   3462  C CG  . LEU B  1 49  ? -37.02500 -15.76358  52.03093  1.000 30.16350  ? 29   LEU A CG  1 
ATOM   3463  C CD1 . LEU B  1 49  ? -35.78328 -15.08917  52.65232  1.000 26.57838  ? 29   LEU A CD1 1 
ATOM   3464  C CD2 . LEU B  1 49  ? -38.33086 -15.14746  52.54648  1.000 30.17575  ? 29   LEU A CD2 1 
ATOM   3465  N N   . THR B  1 50  ? -36.55202 -18.26301  48.53514  1.000 29.36464  ? 30   THR A N   1 
ATOM   3466  C CA  . THR B  1 50  ? -36.72574 -19.70628  48.38500  1.000 26.62152  ? 30   THR A CA  1 
ATOM   3467  C C   . THR B  1 50  ? -35.91788 -20.26621  47.21482  1.000 33.39008  ? 30   THR A C   1 
ATOM   3468  O O   . THR B  1 50  ? -36.22094 -21.36602  46.72166  1.000 35.17377  ? 30   THR A O   1 
ATOM   3469  C CB  . THR B  1 50  ? -38.20585 -20.07714  48.22156  1.000 24.22147  ? 30   THR A CB  1 
ATOM   3470  O OG1 . THR B  1 50  ? -38.81040 -19.26829  47.19184  1.000 26.77987  ? 30   THR A OG1 1 
ATOM   3471  C CG2 . THR B  1 50  ? -38.98767 -19.91631  49.59486  1.000 21.11106  ? 30   THR A CG2 1 
ATOM   3472  N N   . ASP B  1 51  ? -34.89660 -19.53678  46.76202  1.000 33.46064  ? 31   ASP A N   1 
ATOM   3473  C CA  . ASP B  1 51  ? -34.02739 -20.05361  45.70390  1.000 36.91469  ? 31   ASP A CA  1 
ATOM   3474  C C   . ASP B  1 51  ? -33.26268 -21.29784  46.16407  1.000 40.73915  ? 31   ASP A C   1 
ATOM   3475  O O   . ASP B  1 51  ? -33.06343 -22.23492  45.37916  1.000 41.94405  ? 31   ASP A O   1 
ATOM   3476  C CB  . ASP B  1 51  ? -33.06328 -18.95697  45.23595  1.000 35.26547  ? 31   ASP A CB  1 
ATOM   3477  C CG  . ASP B  1 51  ? -33.66240 -18.09942  44.11926  1.000 39.03403  ? 31   ASP A CG  1 
ATOM   3478  O OD1 . ASP B  1 51  ? -34.76183 -18.43254  43.63471  1.000 39.57795  ? 31   ASP A OD1 1 
ATOM   3479  O OD2 . ASP B  1 51  ? -33.04843 -17.08493  43.73826  1.000 40.07370  ? 31   ASP A OD2 1 
ATOM   3480  N N   . ARG B  1 52  ? -32.82739 -21.34503  47.42875  1.000 40.54392  ? 32   ARG A N   1 
ATOM   3481  C CA  . ARG B  1 52  ? -32.05298 -22.49913  47.87652  1.000 43.83241  ? 32   ARG A CA  1 
ATOM   3482  C C   . ARG B  1 52  ? -32.64672 -23.19618  49.09041  1.000 40.88943  ? 32   ARG A C   1 
ATOM   3483  O O   . ARG B  1 52  ? -31.91640 -23.87156  49.82535  1.000 40.16550  ? 32   ARG A O   1 
ATOM   3484  C CB  . ARG B  1 52  ? -30.61608 -22.10597  48.17207  1.000 53.43788  ? 32   ARG A CB  1 
ATOM   3485  C CG  . ARG B  1 52  ? -30.58297 -21.13183  49.19180  1.000 60.88239  ? 32   ARG A CG  1 
ATOM   3486  C CD  . ARG B  1 52  ? -29.70531 -19.93456  48.83111  1.000 69.22408  ? 32   ARG A CD  1 
ATOM   3487  N NE  . ARG B  1 52  ? -29.72694 -18.91638  49.86581  1.000 73.44712  ? 32   ARG A NE  1 
ATOM   3488  C CZ  . ARG B  1 52  ? -29.10082 -19.06702  51.02492  1.000 74.06997  ? 32   ARG A CZ  1 
ATOM   3489  N NH1 . ARG B  1 52  ? -28.43817 -20.14051  51.24523  1.000 74.99322  ? 32   ARG A NH1 1 
ATOM   3490  N NH2 . ARG B  1 52  ? -29.08103 -18.17972  52.00098  1.000 72.18339  ? 32   ARG A NH2 1 
ATOM   3491  N N   . ARG B  1 53  ? -33.94864 -23.04391  49.31600  1.000 38.12403  ? 33   ARG A N   1 
ATOM   3492  C CA  . ARG B  1 53  ? -34.63896 -23.76765  50.36905  1.000 34.54986  ? 33   ARG A CA  1 
ATOM   3493  C C   . ARG B  1 53  ? -36.11536 -23.76329  50.02200  1.000 31.77740  ? 33   ARG A C   1 
ATOM   3494  O O   . ARG B  1 53  ? -36.61138 -22.84089  49.36709  1.000 29.21520  ? 33   ARG A O   1 
ATOM   3495  C CB  . ARG B  1 53  ? -34.40183 -23.15884  51.76608  1.000 31.68258  ? 33   ARG A CB  1 
ATOM   3496  C CG  . ARG B  1 53  ? -34.89079 -21.72645  51.89958  1.000 30.77872  ? 33   ARG A CG  1 
ATOM   3497  C CD  . ARG B  1 53  ? -34.63717 -21.15152  53.28789  1.000 31.93639  ? 33   ARG A CD  1 
ATOM   3498  N NE  . ARG B  1 53  ? -33.23187 -20.78817  53.49727  1.000 37.39032  ? 33   ARG A NE  1 
ATOM   3499  C CZ  . ARG B  1 53  ? -32.71663 -19.57389  53.28169  1.000 37.46384  ? 33   ARG A CZ  1 
ATOM   3500  N NH1 . ARG B  1 53  ? -33.47288 -18.56790  52.84845  1.000 35.67251  ? 33   ARG A NH1 1 
ATOM   3501  N NH2 . ARG B  1 53  ? -31.43497 -19.35902  53.51919  1.000 36.25233  ? 33   ARG A NH2 1 
ATOM   3502  N N   . ALA B  1 54  ? -36.80484 -24.81420  50.44321  1.000 28.38475  ? 34   ALA A N   1 
ATOM   3503  C CA  . ALA B  1 54  ? -38.23863 -24.89036  50.23331  1.000 26.94568  ? 34   ALA A CA  1 
ATOM   3504  C C   . ALA B  1 54  ? -38.92719 -23.99625  51.25573  1.000 22.07435  ? 34   ALA A C   1 
ATOM   3505  O O   . ALA B  1 54  ? -38.37999 -23.72209  52.32723  1.000 22.14415  ? 34   ALA A O   1 
ATOM   3506  C CB  . ALA B  1 54  ? -38.72908 -26.33939  50.36365  1.000 27.34349  ? 34   ALA A CB  1 
ATOM   3507  N N   . LYS B  1 55  ? -40.11823 -23.51480  50.90248  1.000 20.08912  ? 35   LYS A N   1 
ATOM   3508  C CA  . LYS B  1 55  ? -40.86389 -22.62495  51.78845  1.000 21.27008  ? 35   LYS A CA  1 
ATOM   3509  C C   . LYS B  1 55  ? -41.01967 -23.16146  53.20855  1.000 21.77892  ? 35   LYS A C   1 
ATOM   3510  O O   . LYS B  1 55  ? -40.90954 -22.36176  54.15566  1.000 17.54593  ? 35   LYS A O   1 
ATOM   3511  C CB  . LYS B  1 55  ? -42.25617 -22.33839  51.20831  1.000 22.19208  ? 35   LYS A CB  1 
ATOM   3512  C CG  . LYS B  1 55  ? -42.98728 -21.18488  51.94520  1.000 21.56382  ? 35   LYS A CG  1 
ATOM   3513  C CD  . LYS B  1 55  ? -44.38637 -20.95136  51.37590  1.000 22.74862  ? 35   LYS A CD  1 
ATOM   3514  C CE  . LYS B  1 55  ? -45.21859 -20.10143  52.32010  1.000 22.96875  ? 35   LYS A CE  1 
ATOM   3515  N NZ  . LYS B  1 55  ? -46.63228 -20.22288  51.89048  1.000 20.80284  ? 35   LYS A NZ  1 
ATOM   3516  N N   . PRO B  1 56  ? -41.33033 -24.44094  53.43282  1.000 22.17534  ? 36   PRO A N   1 
ATOM   3517  C CA  . PRO B  1 56  ? -41.43990 -24.92207  54.81712  1.000 15.86358  ? 36   PRO A CA  1 
ATOM   3518  C C   . PRO B  1 56  ? -40.16542 -24.79014  55.60162  1.000 20.54049  ? 36   PRO A C   1 
ATOM   3519  O O   . PRO B  1 56  ? -40.22290 -24.76297  56.84072  1.000 18.93239  ? 36   PRO A O   1 
ATOM   3520  C CB  . PRO B  1 56  ? -41.85435 -26.39042  54.64837  1.000 14.76721  ? 36   PRO A CB  1 
ATOM   3521  C CG  . PRO B  1 56  ? -42.61454 -26.37577  53.27016  1.000 15.05916  ? 36   PRO A CG  1 
ATOM   3522  C CD  . PRO B  1 56  ? -41.74104 -25.47313  52.45444  1.000 21.93723  ? 36   PRO A CD  1 
ATOM   3523  N N   . ALA B  1 57  ? -39.01160 -24.68913  54.94242  1.000 19.23346  ? 37   ALA A N   1 
ATOM   3524  C CA  . ALA B  1 57  ? -37.76958 -24.49963  55.68258  1.000 19.65008  ? 37   ALA A CA  1 
ATOM   3525  C C   . ALA B  1 57  ? -37.48642 -23.04908  55.98379  1.000 18.39261  ? 37   ALA A C   1 
ATOM   3526  O O   . ALA B  1 57  ? -36.48399 -22.76883  56.64994  1.000 21.00500  ? 37   ALA A O   1 
ATOM   3527  C CB  . ALA B  1 57  ? -36.57532 -25.07595  54.90941  1.000 20.36102  ? 37   ALA A CB  1 
ATOM   3528  N N   . VAL B  1 58  ? -38.31172 -22.11437  55.49989  1.000 17.07322  ? 38   VAL A N   1 
ATOM   3529  C CA  . VAL B  1 58  ? -37.99987 -20.69504  55.72007  1.000 18.65338  ? 38   VAL A CA  1 
ATOM   3530  C C   . VAL B  1 58  ? -38.14195 -20.34979  57.20670  1.000 21.91505  ? 38   VAL A C   1 
ATOM   3531  O O   . VAL B  1 58  ? -39.11300 -20.73371  57.86894  1.000 17.55394  ? 38   VAL A O   1 
ATOM   3532  C CB  . VAL B  1 58  ? -38.88883 -19.81896  54.81810  1.000 20.32598  ? 38   VAL A CB  1 
ATOM   3533  C CG1 . VAL B  1 58  ? -38.83677 -18.33904  55.21851  1.000 21.60485  ? 38   VAL A CG1 1 
ATOM   3534  C CG2 . VAL B  1 58  ? -38.49805 -20.00899  53.31415  1.000 16.96925  ? 38   VAL A CG2 1 
ATOM   3535  N N   . TYR B  1 59  ? -37.14989 -19.63656  57.75670  1.000 17.07991  ? 39   TYR A N   1 
ATOM   3536  C CA  . TYR B  1 59  ? -37.19720 -19.25501  59.15846  1.000 16.07256  ? 39   TYR A CA  1 
ATOM   3537  C C   . TYR B  1 59  ? -38.35918 -18.29347  59.42140  1.000 19.34391  ? 39   TYR A C   1 
ATOM   3538  O O   . TYR B  1 59  ? -38.68701 -17.43588  58.58829  1.000 15.79227  ? 39   TYR A O   1 
ATOM   3539  C CB  . TYR B  1 59  ? -35.89834 -18.57187  59.56672  1.000 21.41244  ? 39   TYR A CB  1 
ATOM   3540  C CG  . TYR B  1 59  ? -34.63691 -19.35811  59.33032  1.000 32.46980  ? 39   TYR A CG  1 
ATOM   3541  C CD1 . TYR B  1 59  ? -34.18642 -20.31864  60.24512  1.000 36.35973  ? 39   TYR A CD1 1 
ATOM   3542  C CD2 . TYR B  1 59  ? -33.86920 -19.11003  58.20277  1.000 40.68120  ? 39   TYR A CD2 1 
ATOM   3543  C CE1 . TYR B  1 59  ? -32.99125 -21.00831  60.02333  1.000 40.14343  ? 39   TYR A CE1 1 
ATOM   3544  C CE2 . TYR B  1 59  ? -32.69637 -19.79136  57.96446  1.000 46.72777  ? 39   TYR A CE2 1 
ATOM   3545  C CZ  . TYR B  1 59  ? -32.25225 -20.73556  58.86984  1.000 47.50366  ? 39   TYR A CZ  1 
ATOM   3546  O OH  . TYR B  1 59  ? -31.06618 -21.39181  58.56946  1.000 52.42937  ? 39   TYR A OH  1 
ATOM   3547  N N   . PHE B  1 60  ? -38.95472 -18.41002  60.61526  1.000 20.81729  ? 40   PHE A N   1 
ATOM   3548  C CA  . PHE B  1 60  ? -40.03746 -17.51572  61.01663  1.000 19.64365  ? 40   PHE A CA  1 
ATOM   3549  C C   . PHE B  1 60  ? -39.98974 -17.15260  62.49211  1.000 24.66052  ? 40   PHE A C   1 
ATOM   3550  O O   . PHE B  1 60  ? -39.79095 -18.01203  63.35654  1.000 25.48627  ? 40   PHE A O   1 
ATOM   3551  C CB  . PHE B  1 60  ? -41.43768 -18.11085  60.72846  1.000 18.22278  ? 40   PHE A CB  1 
ATOM   3552  C CG  . PHE B  1 60  ? -42.51237 -17.18573  61.12186  1.000 19.11334  ? 40   PHE A CG  1 
ATOM   3553  C CD1 . PHE B  1 60  ? -42.78778 -16.06388  60.33219  1.000 23.53671  ? 40   PHE A CD1 1 
ATOM   3554  C CD2 . PHE B  1 60  ? -43.19736 -17.36726  62.31939  1.000 17.81729  ? 40   PHE A CD2 1 
ATOM   3555  C CE1 . PHE B  1 60  ? -43.75176 -15.15281  60.71894  1.000 25.32526  ? 40   PHE A CE1 1 
ATOM   3556  C CE2 . PHE B  1 60  ? -44.14648 -16.44971  62.72517  1.000 18.70104  ? 40   PHE A CE2 1 
ATOM   3557  C CZ  . PHE B  1 60  ? -44.43793 -15.35406  61.92703  1.000 23.80665  ? 40   PHE A CZ  1 
ATOM   3558  N N   . GLY B  1 61  ? -40.22107 -15.87616  62.78418  1.000 20.06048  ? 41   GLY A N   1 
ATOM   3559  C CA  . GLY B  1 61  ? -40.54107 -15.45107  64.13339  1.000 24.80591  ? 41   GLY A CA  1 
ATOM   3560  C C   . GLY B  1 61  ? -39.40942 -15.38116  65.13358  1.000 23.60216  ? 41   GLY A C   1 
ATOM   3561  O O   . GLY B  1 61  ? -39.66940 -15.12016  66.31654  1.000 27.48947  ? 41   GLY A O   1 
ATOM   3562  N N   A GLY B  1 62  ? -38.16608 -15.59339  64.70868  0.519 16.57422  ? 42   GLY A N   1 
ATOM   3563  N N   B GLY B  1 62  ? -38.15714 -15.59600  64.72932  0.481 21.40377  ? 42   GLY A N   1 
ATOM   3564  C CA  A GLY B  1 62  ? -37.13383 -15.86385  65.69373  0.519 20.24285  ? 42   GLY A CA  1 
ATOM   3565  C CA  B GLY B  1 62  ? -37.02253 -15.45481  65.62953  0.481 20.13634  ? 42   GLY A CA  1 
ATOM   3566  C C   A GLY B  1 62  ? -37.44195 -17.08675  66.52426  0.519 20.11104  ? 42   GLY A C   1 
ATOM   3567  C C   B GLY B  1 62  ? -36.20920 -16.72287  65.81536  0.481 20.70913  ? 42   GLY A C   1 
ATOM   3568  O O   A GLY B  1 62  ? -36.88040 -17.26297  67.61107  0.519 22.05510  ? 42   GLY A O   1 
ATOM   3569  O O   B GLY B  1 62  ? -34.99915 -16.64253  66.05113  0.481 27.70582  ? 42   GLY A O   1 
ATOM   3570  N N   A LYS B  1 63  ? -38.32067 -17.92713  66.04871  0.519 20.58060  ? 43   LYS A N   1 
ATOM   3571  N N   B LYS B  1 63  ? -36.84488 -17.89475  65.70728  0.481 20.49521  ? 43   LYS A N   1 
ATOM   3572  C CA  A LYS B  1 63  ? -38.95432 -18.93183  66.89624  0.519 23.41376  ? 43   LYS A CA  1 
ATOM   3573  C CA  B LYS B  1 63  ? -36.09031 -19.13926  65.85972  0.481 20.64167  ? 43   LYS A CA  1 
ATOM   3574  C C   A LYS B  1 63  ? -38.81761 -20.34140  66.35510  0.519 18.83484  ? 43   LYS A C   1 
ATOM   3575  C C   B LYS B  1 63  ? -36.53938 -20.28942  64.96027  0.481 18.03180  ? 43   LYS A C   1 
ATOM   3576  O O   A LYS B  1 63  ? -38.60143 -21.26956  67.14036  0.519 17.49405  ? 43   LYS A O   1 
ATOM   3577  O O   B LYS B  1 63  ? -35.72372 -20.88628  64.24514  0.481 19.49104  ? 43   LYS A O   1 
ATOM   3578  C CB  A LYS B  1 63  ? -40.44177 -18.57676  67.07373  0.519 26.51901  ? 43   LYS A CB  1 
ATOM   3579  C CB  B LYS B  1 63  ? -36.15848 -19.60374  67.31184  0.481 22.89417  ? 43   LYS A CB  1 
ATOM   3580  C CG  A LYS B  1 63  ? -41.22590 -19.57809  67.89200  0.519 13.76657  ? 43   LYS A CG  1 
ATOM   3581  C CG  B LYS B  1 63  ? -35.19660 -20.75346  67.59699  0.481 22.83860  ? 43   LYS A CG  1 
ATOM   3582  C CD  A LYS B  1 63  ? -41.01855 -19.31599  69.38760  0.519 14.41232  ? 43   LYS A CD  1 
ATOM   3583  C CD  B LYS B  1 63  ? -35.58978 -21.50890  68.83671  0.481 23.38588  ? 43   LYS A CD  1 
ATOM   3584  C CE  A LYS B  1 63  ? -42.13862 -19.95627  70.15789  0.519 14.27908  ? 43   LYS A CE  1 
ATOM   3585  C CE  B LYS B  1 63  ? -36.13431 -20.58979  69.88080  0.481 24.93047  ? 43   LYS A CE  1 
ATOM   3586  N NZ  A LYS B  1 63  ? -41.90701 -19.93861  71.61667  0.519 14.90263  ? 43   LYS A NZ  1 
ATOM   3587  N NZ  B LYS B  1 63  ? -35.05647 -19.66078  70.30814  0.481 25.74265  ? 43   LYS A NZ  1 
ATOM   3588  N N   A ALA B  1 64  ? -38.90485 -20.51708  65.04372  0.519 14.03145  ? 44   ALA A N   1 
ATOM   3589  N N   B ALA B  1 64  ? -37.82052 -20.62919  65.00354  0.481 14.76867  ? 44   ALA A N   1 
ATOM   3590  C CA  A ALA B  1 64  ? -38.94140 -21.82815  64.39717  0.519 14.76662  ? 44   ALA A CA  1 
ATOM   3591  C CA  B ALA B  1 64  ? -38.29035 -21.84800  64.36318  0.481 14.16981  ? 44   ALA A CA  1 
ATOM   3592  C C   A ALA B  1 64  ? -38.78651 -21.61114  62.89855  0.519 14.97826  ? 44   ALA A C   1 
ATOM   3593  C C   B ALA B  1 64  ? -38.35262 -21.65193  62.85246  0.481 15.62402  ? 44   ALA A C   1 
ATOM   3594  O O   A ALA B  1 64  ? -38.69919 -20.46747  62.42877  0.519 16.71723  ? 44   ALA A O   1 
ATOM   3595  O O   B ALA B  1 64  ? -38.03458 -20.57698  62.31955  0.481 16.60796  ? 44   ALA A O   1 
ATOM   3596  C CB  A ALA B  1 64  ? -40.25249 -22.55116  64.70822  0.519 13.53827  ? 44   ALA A CB  1 
ATOM   3597  C CB  B ALA B  1 64  ? -39.64986 -22.25420  64.93117  0.481 14.58686  ? 44   ALA A CB  1 
ATOM   3598  N N   . ARG B  1 65  ? -38.72841 -22.71552  62.14917  1.000 13.87644  ? 45   ARG A N   1 
ATOM   3599  C CA  . ARG B  1 65  ? -39.00721 -22.64323  60.71990  1.000 14.26761  ? 45   ARG A CA  1 
ATOM   3600  C C   . ARG B  1 65  ? -40.51245 -22.87063  60.53559  1.000 12.98808  ? 45   ARG A C   1 
ATOM   3601  O O   . ARG B  1 65  ? -41.20152 -23.39389  61.41449  1.000 12.68790  ? 45   ARG A O   1 
ATOM   3602  C CB  . ARG B  1 65  ? -38.19244 -23.69290  59.92478  1.000 14.94796  ? 45   ARG A CB  1 
ATOM   3603  C CG  . ARG B  1 65  ? -36.68291 -23.58203  60.11073  1.000 16.65844  ? 45   ARG A CG  1 
ATOM   3604  C CD  . ARG B  1 65  ? -35.98482 -24.66879  59.30319  1.000 14.55478  ? 45   ARG A CD  1 
ATOM   3605  N NE  . ARG B  1 65  ? -34.53381 -24.66189  59.52651  1.000 18.91925  ? 45   ARG A NE  1 
ATOM   3606  C CZ  . ARG B  1 65  ? -33.62426 -24.20205  58.67155  1.000 20.78822  ? 45   ARG A CZ  1 
ATOM   3607  N NH1 . ARG B  1 65  ? -33.97997 -23.71075  57.47934  1.000 18.37536  ? 45   ARG A NH1 1 
ATOM   3608  N NH2 . ARG B  1 65  ? -32.33675 -24.25747  58.99864  1.000 20.92960  ? 45   ARG A NH2 1 
ATOM   3609  N N   . ILE B  1 66  ? -41.01281 -22.52206  59.35123  1.000 12.66098  ? 46   ILE A N   1 
ATOM   3610  C CA  . ILE B  1 66  ? -42.45831 -22.57763  59.08172  1.000 16.13524  ? 46   ILE A CA  1 
ATOM   3611  C C   . ILE B  1 66  ? -43.04508 -23.96859  59.34585  1.000 13.52853  ? 46   ILE A C   1 
ATOM   3612  O O   . ILE B  1 66  ? -44.11714 -24.09915  59.95070  1.000 17.06997  ? 46   ILE A O   1 
ATOM   3613  C CB  . ILE B  1 66  ? -42.73253 -22.09772  57.65043  1.000 14.87438  ? 46   ILE A CB  1 
ATOM   3614  C CG1 . ILE B  1 66  ? -42.28293 -20.62973  57.53981  1.000 19.16445  ? 46   ILE A CG1 1 
ATOM   3615  C CG2 . ILE B  1 66  ? -44.21874 -22.30899  57.28127  1.000 15.51909  ? 46   ILE A CG2 1 
ATOM   3616  C CD1 . ILE B  1 66  ? -42.52807 -20.01900  56.17013  1.000 20.81560  ? 46   ILE A CD1 1 
ATOM   3617  N N   . ILE B  1 67  ? -42.38496 -25.02308  58.86241  1.000 16.22120  ? 47   ILE A N   1 
ATOM   3618  C CA  . ILE B  1 67  ? -42.91980 -26.37989  59.01421  1.000 16.10141  ? 47   ILE A CA  1 
ATOM   3619  C C   . ILE B  1 67  ? -43.11339 -26.75834  60.48855  1.000 16.39358  ? 47   ILE A C   1 
ATOM   3620  O O   . ILE B  1 67  ? -43.93692 -27.64241  60.80892  1.000 14.03829  ? 47   ILE A O   1 
ATOM   3621  C CB  . ILE B  1 67  ? -41.98041 -27.37704  58.31427  1.000 15.84749  ? 47   ILE A CB  1 
ATOM   3622  C CG1 . ILE B  1 67  ? -42.69136 -28.72370  58.14229  1.000 20.39503  ? 47   ILE A CG1 1 
ATOM   3623  C CG2 . ILE B  1 67  ? -40.62197 -27.51247  59.16881  1.000 12.16717  ? 47   ILE A CG2 1 
ATOM   3624  C CD1 . ILE B  1 67  ? -41.93300 -29.68888  57.34219  1.000 20.72456  ? 47   ILE A CD1 1 
ATOM   3625  N N   . ASP B  1 68  ? -42.38812 -26.10540  61.40569  1.000 16.39021  ? 48   ASP A N   1 
ATOM   3626  C CA  . ASP B  1 68  ? -42.45021 -26.51492  62.80622  1.000 15.32974  ? 48   ASP A CA  1 
ATOM   3627  C C   . ASP B  1 68  ? -43.82274 -26.27644  63.41469  1.000 15.46251  ? 48   ASP A C   1 
ATOM   3628  O O   . ASP B  1 68  ? -44.13471 -26.87829  64.45314  1.000 15.79032  ? 48   ASP A O   1 
ATOM   3629  C CB  . ASP B  1 68  ? -41.41882 -25.78326  63.66292  1.000 11.20069  ? 48   ASP A CB  1 
ATOM   3630  C CG  . ASP B  1 68  ? -39.98011 -26.18970  63.33532  1.000 13.22221  ? 48   ASP A CG  1 
ATOM   3631  O OD1 . ASP B  1 68  ? -39.73415 -27.36419  62.96765  1.000 13.15924  ? 48   ASP A OD1 1 
ATOM   3632  O OD2 . ASP B  1 68  ? -39.09799 -25.29560  63.37963  1.000 13.65472  ? 48   ASP A OD2 1 
ATOM   3633  N N   . PHE B  1 69  ? -44.63947 -25.39961  62.80608  1.000 13.90303  ? 49   PHE A N   1 
ATOM   3634  C CA  . PHE B  1 69  ? -45.96278 -25.13183  63.36610  1.000 13.65007  ? 49   PHE A CA  1 
ATOM   3635  C C   . PHE B  1 69  ? -46.88820 -26.32837  63.13752  1.000 13.65416  ? 49   PHE A C   1 
ATOM   3636  O O   . PHE B  1 69  ? -47.45128 -26.87824  64.09500  1.000 11.56952  ? 49   PHE A O   1 
ATOM   3637  C CB  . PHE B  1 69  ? -46.50614 -23.81891  62.78127  1.000 18.35094  ? 49   PHE A CB  1 
ATOM   3638  C CG  . PHE B  1 69  ? -45.83821 -22.60401  63.38277  1.000 15.72341  ? 49   PHE A CG  1 
ATOM   3639  C CD1 . PHE B  1 69  ? -44.61697 -22.13405  62.89119  1.000 13.71147  ? 49   PHE A CD1 1 
ATOM   3640  C CD2 . PHE B  1 69  ? -46.38271 -21.98878  64.48309  1.000 12.37701  ? 49   PHE A CD2 1 
ATOM   3641  C CE1 . PHE B  1 69  ? -43.99999 -21.03553  63.49672  1.000 12.43594  ? 49   PHE A CE1 1 
ATOM   3642  C CE2 . PHE B  1 69  ? -45.76151 -20.89756  65.08934  1.000 20.24132  ? 49   PHE A CE2 1 
ATOM   3643  C CZ  . PHE B  1 69  ? -44.57917 -20.42557  64.61078  1.000 12.77858  ? 49   PHE A CZ  1 
ATOM   3644  N N   . ALA B  1 70  ? -47.01055 -26.78661  61.88731  1.000 14.87427  ? 50   ALA A N   1 
ATOM   3645  C CA  . ALA B  1 70  ? -47.78283 -27.99572  61.62171  1.000 16.01736  ? 50   ALA A CA  1 
ATOM   3646  C C   . ALA B  1 70  ? -47.27142 -29.17989  62.42598  1.000 14.74538  ? 50   ALA A C   1 
ATOM   3647  O O   . ALA B  1 70  ? -48.06935 -29.97600  62.93042  1.000 15.08479  ? 50   ALA A O   1 
ATOM   3648  C CB  . ALA B  1 70  ? -47.75096 -28.33672  60.12960  1.000 14.44466  ? 50   ALA A CB  1 
ATOM   3649  N N   . LEU B  1 71  ? -45.94645 -29.35339  62.50247  1.000 12.28851  ? 51   LEU A N   1 
ATOM   3650  C CA  . LEU B  1 71  ? -45.40471 -30.48038  63.25320  1.000 13.35711  ? 51   LEU A CA  1 
ATOM   3651  C C   . LEU B  1 71  ? -45.75376 -30.36145  64.71698  1.000 13.50692  ? 51   LEU A C   1 
ATOM   3652  O O   . LEU B  1 71  ? -46.08250 -31.36321  65.37662  1.000 11.84889  ? 51   LEU A O   1 
ATOM   3653  C CB  . LEU B  1 71  ? -43.88057 -30.54226  63.11063  1.000 11.39953  ? 51   LEU A CB  1 
ATOM   3654  C CG  . LEU B  1 71  ? -43.41001 -30.79082  61.65033  1.000 15.94025  ? 51   LEU A CG  1 
ATOM   3655  C CD1 . LEU B  1 71  ? -41.83329 -30.69245  61.64248  1.000 14.34146  ? 51   LEU A CD1 1 
ATOM   3656  C CD2 . LEU B  1 71  ? -43.91328 -32.18411  61.25140  1.000 15.15688  ? 51   LEU A CD2 1 
ATOM   3657  N N   . SER B  1 72  ? -45.62472 -29.14635  65.26232  1.000 12.01378  ? 52   SER A N   1 
ATOM   3658  C CA  . SER B  1 72  ? -45.91631 -28.96756  66.68770  1.000 11.92022  ? 52   SER A CA  1 
ATOM   3659  C C   . SER B  1 72  ? -47.40050 -29.13727  66.96203  1.000 11.69144  ? 52   SER A C   1 
ATOM   3660  O O   . SER B  1 72  ? -47.77489 -29.68013  68.01399  1.000 11.99990  ? 52   SER A O   1 
ATOM   3661  C CB  . SER B  1 72  ? -45.42335 -27.60253  67.16618  1.000 11.28072  ? 52   SER A CB  1 
ATOM   3662  O OG  . SER B  1 72  ? -43.99705 -27.57921  67.10083  1.000 13.24711  ? 52   SER A OG  1 
ATOM   3663  N N   . ASN B  1 73  ? -48.25752 -28.71855  66.02424  1.000 14.59445  ? 53   ASN A N   1 
ATOM   3664  C CA  . ASN B  1 73  ? -49.69039 -28.98729  66.16690  1.000 16.01124  ? 53   ASN A CA  1 
ATOM   3665  C C   . ASN B  1 73  ? -49.96533 -30.48346  66.25273  1.000 13.11501  ? 53   ASN A C   1 
ATOM   3666  O O   . ASN B  1 73  ? -50.79530 -30.93496  67.05967  1.000 13.21134  ? 53   ASN A O   1 
ATOM   3667  C CB  . ASN B  1 73  ? -50.44248 -28.38128  64.97832  1.000 12.64971  ? 53   ASN A CB  1 
ATOM   3668  C CG  . ASN B  1 73  ? -50.50267 -26.85343  65.04015  1.000 12.70508  ? 53   ASN A CG  1 
ATOM   3669  O OD1 . ASN B  1 73  ? -50.42938 -26.26587  66.13543  1.000 12.93463  ? 53   ASN A OD1 1 
ATOM   3670  N ND2 . ASN B  1 73  ? -50.59694 -26.21207  63.88898  1.000 12.82992  ? 53   ASN A ND2 1 
ATOM   3671  N N   . ALA B  1 74  ? -49.28548 -31.27703  65.42422  1.000 13.48488  ? 54   ALA A N   1 
ATOM   3672  C CA  . ALA B  1 74  ? -49.49060 -32.71896  65.50731  1.000 13.55118  ? 54   ALA A CA  1 
ATOM   3673  C C   . ALA B  1 74  ? -49.03525 -33.24346  66.85781  1.000 13.99098  ? 54   ALA A C   1 
ATOM   3674  O O   . ALA B  1 74  ? -49.77789 -33.96170  67.54627  1.000 14.87250  ? 54   ALA A O   1 
ATOM   3675  C CB  . ALA B  1 74  ? -48.75178 -33.44525  64.37634  1.000 13.06402  ? 54   ALA A CB  1 
ATOM   3676  N N   . LEU B  1 75  ? -47.79878 -32.90329  67.24310  1.000 12.60096  ? 55   LEU A N   1 
ATOM   3677  C CA  . LEU B  1 75  ? -47.26465 -33.31601  68.53732  1.000 16.76453  ? 55   LEU A CA  1 
ATOM   3678  C C   . LEU B  1 75  ? -48.21588 -32.95313  69.66994  1.000 13.74672  ? 55   LEU A C   1 
ATOM   3679  O O   . LEU B  1 75  ? -48.60100 -33.81186  70.48496  1.000 13.81083  ? 55   LEU A O   1 
ATOM   3680  C CB  . LEU B  1 75  ? -45.89300 -32.65812  68.73323  1.000 14.14729  ? 55   LEU A CB  1 
ATOM   3681  C CG  . LEU B  1 75  ? -45.17612 -32.92848  70.06031  1.000 18.39032  ? 55   LEU A CG  1 
ATOM   3682  C CD1 . LEU B  1 75  ? -44.88499 -34.42128  70.21540  1.000 20.74530  ? 55   LEU A CD1 1 
ATOM   3683  C CD2 . LEU B  1 75  ? -43.89695 -32.08266  70.06678  1.000 17.23240  ? 55   LEU A CD2 1 
ATOM   3684  N N   . ASN B  1 76  ? -48.64327 -31.67884  69.71792  1.000 12.97980  ? 56   ASN A N   1 
ATOM   3685  C CA  . ASN B  1 76  ? -49.44525 -31.19153  70.84873  1.000 15.60047  ? 56   ASN A CA  1 
ATOM   3686  C C   . ASN B  1 76  ? -50.85281 -31.75589  70.85400  1.000 14.24108  ? 56   ASN A C   1 
ATOM   3687  O O   . ASN B  1 76  ? -51.46421 -31.83352  71.92552  1.000 14.95773  ? 56   ASN A O   1 
ATOM   3688  C CB  . ASN B  1 76  ? -49.50487 -29.65373  70.82923  1.000 14.92298  ? 56   ASN A CB  1 
ATOM   3689  C CG  . ASN B  1 76  ? -48.11906 -29.00647  71.00813  1.000 17.78180  ? 56   ASN A CG  1 
ATOM   3690  O OD1 . ASN B  1 76  ? -47.14125 -29.67008  71.42992  1.000 15.86440  ? 56   ASN A OD1 1 
ATOM   3691  N ND2 . ASN B  1 76  ? -48.04414 -27.70684  70.73747  1.000 12.77011  ? 56   ASN A ND2 1 
ATOM   3692  N N   . SER B  1 77  ? -51.35960 -32.18204  69.69445  1.000 14.24802  ? 57   SER A N   1 
ATOM   3693  C CA  . SER B  1 77  ? -52.65545 -32.84741  69.58058  1.000 15.12194  ? 57   SER A CA  1 
ATOM   3694  C C   . SER B  1 77  ? -52.59594 -34.31617  69.97487  1.000 19.78229  ? 57   SER A C   1 
ATOM   3695  O O   . SER B  1 77  ? -53.63992 -34.97626  70.00707  1.000 20.94817  ? 57   SER A O   1 
ATOM   3696  C CB  . SER B  1 77  ? -53.17556 -32.74268  68.13000  1.000 15.12223  ? 57   SER A CB  1 
ATOM   3697  O OG  . SER B  1 77  ? -53.29759 -31.37033  67.71671  1.000 18.02035  ? 57   SER A OG  1 
ATOM   3698  N N   . GLY B  1 78  ? -51.40806 -34.84682  70.25840  1.000 16.22157  ? 58   GLY A N   1 
ATOM   3699  C CA  . GLY B  1 78  ? -51.28871 -36.24346  70.61654  1.000 16.03532  ? 58   GLY A CA  1 
ATOM   3700  C C   . GLY B  1 78  ? -51.05987 -37.18936  69.45510  1.000 20.03355  ? 58   GLY A C   1 
ATOM   3701  O O   . GLY B  1 78  ? -51.10684 -38.40494  69.65834  1.000 18.28117  ? 58   GLY A O   1 
ATOM   3702  N N   . ILE B  1 79  ? -50.80427 -36.68544  68.25332  1.000 18.06197  ? 59   ILE A N   1 
ATOM   3703  C CA  . ILE B  1 79  ? -50.47411 -37.55203  67.12460  1.000 15.89751  ? 59   ILE A CA  1 
ATOM   3704  C C   . ILE B  1 79  ? -48.99070 -37.91284  67.21829  1.000 20.09513  ? 59   ILE A C   1 
ATOM   3705  O O   . ILE B  1 79  ? -48.13077 -37.02956  67.20121  1.000 27.81970  ? 59   ILE A O   1 
ATOM   3706  C CB  . ILE B  1 79  ? -50.79412 -36.85861  65.79721  1.000 16.50003  ? 59   ILE A CB  1 
ATOM   3707  C CG1 . ILE B  1 79  ? -52.29576 -36.60685  65.69111  1.000 16.43955  ? 59   ILE A CG1 1 
ATOM   3708  C CG2 . ILE B  1 79  ? -50.27243 -37.68535  64.64480  1.000 19.30349  ? 59   ILE A CG2 1 
ATOM   3709  C CD1 . ILE B  1 79  ? -52.69724 -35.84519  64.43333  1.000 18.02742  ? 59   ILE A CD1 1 
ATOM   3710  N N   . ARG B  1 80  ? -48.68781 -39.21234  67.31507  1.000 21.31242  ? 60   ARG A N   1 
ATOM   3711  C CA  . ARG B  1 80  ? -47.32149 -39.67952  67.53831  1.000 27.68519  ? 60   ARG A CA  1 
ATOM   3712  C C   . ARG B  1 80  ? -46.66599 -40.28226  66.29799  1.000 23.71898  ? 60   ARG A C   1 
ATOM   3713  O O   . ARG B  1 80  ? -45.48620 -40.64571  66.34521  1.000 19.60193  ? 60   ARG A O   1 
ATOM   3714  C CB  . ARG B  1 80  ? -47.31096 -40.70050  68.67040  1.000 37.75477  ? 60   ARG A CB  1 
ATOM   3715  C CG  . ARG B  1 80  ? -47.72895 -40.10684  70.00271  1.000 45.06224  ? 60   ARG A CG  1 
ATOM   3716  C CD  . ARG B  1 80  ? -46.50155 -39.63736  70.77435  1.000 49.86257  ? 60   ARG A CD  1 
ATOM   3717  N NE  . ARG B  1 80  ? -46.77396 -38.46455  71.59460  1.000 50.86012  ? 60   ARG A NE  1 
ATOM   3718  C CZ  . ARG B  1 80  ? -45.84175 -37.61269  71.99231  1.000 50.97139  ? 60   ARG A CZ  1 
ATOM   3719  N NH1 . ARG B  1 80  ? -44.56878 -37.81176  71.65337  1.000 52.46366  ? 60   ARG A NH1 1 
ATOM   3720  N NH2 . ARG B  1 80  ? -46.18483 -36.56996  72.73826  1.000 51.45443  ? 60   ARG A NH2 1 
ATOM   3721  N N   . ARG B  1 81  ? -47.39420 -40.40597  65.19916  1.000 18.88735  ? 61   ARG A N   1 
ATOM   3722  C CA  . ARG B  1 81  ? -46.83015 -40.84221  63.93749  1.000 17.37940  ? 61   ARG A CA  1 
ATOM   3723  C C   . ARG B  1 81  ? -46.89663 -39.67303  62.96677  1.000 16.66182  ? 61   ARG A C   1 
ATOM   3724  O O   . ARG B  1 81  ? -47.99474 -39.18095  62.65018  1.000 16.97300  ? 61   ARG A O   1 
ATOM   3725  C CB  . ARG B  1 81  ? -47.61049 -42.03620  63.40243  1.000 18.78679  ? 61   ARG A CB  1 
ATOM   3726  C CG  . ARG B  1 81  ? -47.46659 -43.24917  64.32264  1.000 24.28691  ? 61   ARG A CG  1 
ATOM   3727  C CD  . ARG B  1 81  ? -47.29015 -44.49160  63.49010  1.000 24.59035  ? 61   ARG A CD  1 
ATOM   3728  N NE  . ARG B  1 81  ? -47.38510 -45.67651  64.30678  1.000 25.08286  ? 61   ARG A NE  1 
ATOM   3729  C CZ  . ARG B  1 81  ? -46.32930 -46.32144  64.78559  1.000 26.04167  ? 61   ARG A CZ  1 
ATOM   3730  N NH1 . ARG B  1 81  ? -45.09091 -45.87339  64.53732  1.000 22.44783  ? 61   ARG A NH1 1 
ATOM   3731  N NH2 . ARG B  1 81  ? -46.50794 -47.39482  65.51662  1.000 25.99147  ? 61   ARG A NH2 1 
ATOM   3732  N N   . ILE B  1 82  ? -45.74808 -39.27021  62.44006  1.000 16.16261  ? 62   ILE A N   1 
ATOM   3733  C CA  . ILE B  1 82  ? -45.69487 -38.13730  61.52433  1.000 15.74451  ? 62   ILE A CA  1 
ATOM   3734  C C   . ILE B  1 82  ? -44.91110 -38.53157  60.27602  1.000 18.91194  ? 62   ILE A C   1 
ATOM   3735  O O   . ILE B  1 82  ? -43.85344 -39.16791  60.37356  1.000 19.05953  ? 62   ILE A O   1 
ATOM   3736  C CB  . ILE B  1 82  ? -45.07072 -36.90769  62.18674  1.000 16.00745  ? 62   ILE A CB  1 
ATOM   3737  C CG1 . ILE B  1 82  ? -45.93215 -36.44409  63.36216  1.000 15.02869  ? 62   ILE A CG1 1 
ATOM   3738  C CG2 . ILE B  1 82  ? -44.83861 -35.77838  61.14268  1.000 16.80545  ? 62   ILE A CG2 1 
ATOM   3739  C CD1 . ILE B  1 82  ? -45.24225 -35.28969  64.07380  1.000 17.65804  ? 62   ILE A CD1 1 
ATOM   3740  N N   . GLY B  1 83  ? -45.45612 -38.19208  59.10456  1.000 18.56199  ? 63   GLY A N   1 
ATOM   3741  C CA  . GLY B  1 83  ? -44.72723 -38.28856  57.84707  1.000 19.93996  ? 63   GLY A CA  1 
ATOM   3742  C C   . GLY B  1 83  ? -44.53644 -36.90565  57.24289  1.000 16.60435  ? 63   GLY A C   1 
ATOM   3743  O O   . GLY B  1 83  ? -45.40896 -36.04694  57.35494  1.000 22.02052  ? 63   GLY A O   1 
ATOM   3744  N N   . VAL B  1 84  ? -43.40259 -36.69683  56.56444  1.000 17.41224  ? 64   VAL A N   1 
ATOM   3745  C CA  . VAL B  1 84  ? -43.13377 -35.40447  55.91637  1.000 21.12688  ? 64   VAL A CA  1 
ATOM   3746  C C   . VAL B  1 84  ? -42.67281 -35.65596  54.47962  1.000 24.28226  ? 64   VAL A C   1 
ATOM   3747  O O   . VAL B  1 84  ? -41.60119 -36.23110  54.25775  1.000 23.50594  ? 64   VAL A O   1 
ATOM   3748  C CB  . VAL B  1 84  ? -42.08463 -34.55400  56.66967  1.000 22.36243  ? 64   VAL A CB  1 
ATOM   3749  C CG1 . VAL B  1 84  ? -41.91206 -33.18112  55.95023  1.000 22.33053  ? 64   VAL A CG1 1 
ATOM   3750  C CG2 . VAL B  1 84  ? -42.44684 -34.33939  58.14463  1.000 17.59301  ? 64   VAL A CG2 1 
ATOM   3751  N N   . ALA B  1 85  ? -43.45640 -35.21295  53.50074  1.000 23.96525  ? 65   ALA A N   1 
ATOM   3752  C CA  . ALA B  1 85  ? -43.05841 -35.38609  52.10566  1.000 23.81232  ? 65   ALA A CA  1 
ATOM   3753  C C   . ALA B  1 85  ? -42.27329 -34.15998  51.64373  1.000 24.65360  ? 65   ALA A C   1 
ATOM   3754  O O   . ALA B  1 85  ? -42.71041 -33.03137  51.86673  1.000 26.48543  ? 65   ALA A O   1 
ATOM   3755  C CB  . ALA B  1 85  ? -44.28063 -35.62284  51.21744  1.000 29.49568  ? 65   ALA A CB  1 
ATOM   3756  N N   . THR B  1 86  ? -41.09742 -34.37811  51.04536  1.000 25.22176  ? 66   THR A N   1 
ATOM   3757  C CA  . THR B  1 86  ? -40.23867 -33.29394  50.57018  1.000 24.88067  ? 66   THR A CA  1 
ATOM   3758  C C   . THR B  1 86  ? -39.94039 -33.48691  49.08750  1.000 23.83318  ? 66   THR A C   1 
ATOM   3759  O O   . THR B  1 86  ? -40.10058 -34.57782  48.53156  1.000 26.69191  ? 66   THR A O   1 
ATOM   3760  C CB  . THR B  1 86  ? -38.89936 -33.19751  51.35085  1.000 25.06923  ? 66   THR A CB  1 
ATOM   3761  O OG1 . THR B  1 86  ? -38.00791 -34.25320  50.95592  1.000 26.59631  ? 66   THR A OG1 1 
ATOM   3762  C CG2 . THR B  1 86  ? -39.11617 -33.25923  52.86386  1.000 24.16602  ? 66   THR A CG2 1 
ATOM   3763  N N   . GLN B  1 87  ? -39.47560 -32.41018  48.45478  1.000 35.92567  ? 67   GLN A N   1 
ATOM   3764  C CA  . GLN B  1 87  ? -39.28024 -32.39720  47.01177  1.000 42.85351  ? 67   GLN A CA  1 
ATOM   3765  C C   . GLN B  1 87  ? -38.26875 -31.33159  46.63001  1.000 52.30917  ? 67   GLN A C   1 
ATOM   3766  O O   . GLN B  1 87  ? -37.05247 -31.57171  46.65946  1.000 52.53652  ? 67   GLN A O   1 
ATOM   3767  C CB  . GLN B  1 87  ? -40.61554 -32.15370  46.30041  1.000 46.26952  ? 67   GLN A CB  1 
ATOM   3768  C CG  . GLN B  1 87  ? -40.51923 -32.15360  44.78633  1.000 58.05817  ? 67   GLN A CG  1 
ATOM   3769  C CD  . GLN B  1 87  ? -41.02412 -33.42369  44.16447  1.000 63.60467  ? 67   GLN A CD  1 
ATOM   3770  O OE1 . GLN B  1 87  ? -40.24875 -34.34848  43.94119  1.000 64.04078  ? 67   GLN A OE1 1 
ATOM   3771  N NE2 . GLN B  1 87  ? -42.31754 -33.46852  43.84331  1.000 66.38369  ? 67   GLN A NE2 1 
ATOM   3772  N N   . TYR B  1 88  ? -38.78037 -30.14370  46.30304  1.000 60.15188  ? 68   TYR A N   1 
ATOM   3773  C CA  . TYR B  1 88  ? -37.95940 -29.02183  45.86014  1.000 65.02576  ? 68   TYR A CA  1 
ATOM   3774  C C   . TYR B  1 88  ? -36.94380 -28.64189  46.93705  1.000 61.48733  ? 68   TYR A C   1 
ATOM   3775  O O   . TYR B  1 88  ? -37.32057 -28.37872  48.08699  1.000 55.29952  ? 68   TYR A O   1 
ATOM   3776  C CB  . TYR B  1 88  ? -38.87054 -27.82856  45.51991  1.000 68.52895  ? 68   TYR A CB  1 
ATOM   3777  C CG  . TYR B  1 88  ? -38.15266 -26.50669  45.25033  1.000 72.17860  ? 68   TYR A CG  1 
ATOM   3778  C CD1 . TYR B  1 88  ? -37.69136 -26.19508  43.97361  1.000 76.00107  ? 68   TYR A CD1 1 
ATOM   3779  C CD2 . TYR B  1 88  ? -37.95126 -25.56815  46.26618  1.000 70.07080  ? 68   TYR A CD2 1 
ATOM   3780  C CE1 . TYR B  1 88  ? -37.03470 -25.00154  43.71478  1.000 77.57040  ? 68   TYR A CE1 1 
ATOM   3781  C CE2 . TYR B  1 88  ? -37.29518 -24.36793  46.01527  1.000 72.58378  ? 68   TYR A CE2 1 
ATOM   3782  C CZ  . TYR B  1 88  ? -36.83916 -24.09218  44.73297  1.000 76.39231  ? 68   TYR A CZ  1 
ATOM   3783  O OH  . TYR B  1 88  ? -36.18800 -22.90935  44.45373  1.000 77.89439  ? 68   TYR A OH  1 
ATOM   3784  N N   . LYS B  1 89  ? -35.66213 -28.65235  46.55844  1.000 61.54436  ? 69   LYS A N   1 
ATOM   3785  C CA  . LYS B  1 89  ? -34.54480 -28.10505  47.34064  1.000 58.64855  ? 69   LYS A CA  1 
ATOM   3786  C C   . LYS B  1 89  ? -34.65589 -28.44287  48.83135  1.000 53.54155  ? 69   LYS A C   1 
ATOM   3787  O O   . LYS B  1 89  ? -34.77519 -27.56865  49.68816  1.000 53.40020  ? 69   LYS A O   1 
ATOM   3788  C CB  . LYS B  1 89  ? -34.44333 -26.59238  47.13816  1.000 60.49605  ? 69   LYS A CB  1 
ATOM   3789  C CG  . LYS B  1 89  ? -33.83662 -26.17832  45.79806  1.000 65.53614  ? 69   LYS A CG  1 
ATOM   3790  C CD  . LYS B  1 89  ? -32.35505 -26.53045  45.74457  1.000 68.74975  ? 69   LYS A CD  1 
ATOM   3791  C CE  . LYS B  1 89  ? -31.61655 -25.94136  46.93294  1.000 72.95841  ? 69   LYS A CE  1 
ATOM   3792  N NZ  . LYS B  1 89  ? -30.55610 -26.85170  47.46010  1.000 75.55475  ? 69   LYS A NZ  1 
ATOM   3793  N N   . ALA B  1 90  ? -34.58358 -29.74246  49.13601  1.000 46.30583  ? 70   ALA A N   1 
ATOM   3794  C CA  . ALA B  1 90  ? -34.93626 -30.22296  50.46219  1.000 37.39809  ? 70   ALA A CA  1 
ATOM   3795  C C   . ALA B  1 90  ? -33.73577 -30.44095  51.38219  1.000 35.34680  ? 70   ALA A C   1 
ATOM   3796  O O   . ALA B  1 90  ? -33.92003 -30.87223  52.52530  1.000 37.49915  ? 70   ALA A O   1 
ATOM   3797  C CB  . ALA B  1 90  ? -35.75166 -31.50202  50.34648  1.000 35.97948  ? 70   ALA A CB  1 
ATOM   3798  N N   . HIS B  1 91  ? -32.51985 -30.11083  50.93997  1.000 36.95011  ? 71   HIS A N   1 
ATOM   3799  C CA  . HIS B  1 91  ? -31.34159 -30.36748  51.77013  1.000 37.18222  ? 71   HIS A CA  1 
ATOM   3800  C C   . HIS B  1 91  ? -31.44834 -29.69368  53.14228  1.000 31.16658  ? 71   HIS A C   1 
ATOM   3801  O O   . HIS B  1 91  ? -31.27507 -30.33665  54.17857  1.000 29.35618  ? 71   HIS A O   1 
ATOM   3802  C CB  . HIS B  1 91  ? -30.07492 -29.90394  51.05546  1.000 48.39515  ? 71   HIS A CB  1 
ATOM   3803  C CG  . HIS B  1 91  ? -28.86509 -29.93139  51.93517  1.000 56.10146  ? 71   HIS A CG  1 
ATOM   3804  N ND1 . HIS B  1 91  ? -28.46484 -31.06826  52.60664  1.000 57.64006  ? 71   HIS A ND1 1 
ATOM   3805  C CD2 . HIS B  1 91  ? -27.97914 -28.96402  52.27330  1.000 60.96554  ? 71   HIS A CD2 1 
ATOM   3806  C CE1 . HIS B  1 91  ? -27.38544 -30.80222  53.32230  1.000 59.04787  ? 71   HIS A CE1 1 
ATOM   3807  N NE2 . HIS B  1 91  ? -27.06651 -29.53273  53.13332  1.000 60.87464  ? 71   HIS A NE2 1 
ATOM   3808  N N   . GLU B  1 92  ? -31.71085 -28.39342  53.16254  1.000 33.75165  ? 72   GLU A N   1 
ATOM   3809  C CA  . GLU B  1 92  ? -31.78800 -27.66932  54.42475  1.000 31.89844  ? 72   GLU A CA  1 
ATOM   3810  C C   . GLU B  1 92  ? -32.94626 -28.17020  55.27138  1.000 28.36007  ? 72   GLU A C   1 
ATOM   3811  O O   . GLU B  1 92  ? -32.81103 -28.34837  56.49723  1.000 28.19979  ? 72   GLU A O   1 
ATOM   3812  C CB  . GLU B  1 92  ? -31.94139 -26.18577  54.11524  1.000 33.05838  ? 72   GLU A CB  1 
ATOM   3813  C CG  . GLU B  1 92  ? -31.89294 -25.25068  55.27779  1.000 36.20147  ? 72   GLU A CG  1 
ATOM   3814  C CD  . GLU B  1 92  ? -31.80013 -23.81934  54.78512  1.000 43.33720  ? 72   GLU A CD  1 
ATOM   3815  O OE1 . GLU B  1 92  ? -31.11657 -23.58908  53.76362  1.000 49.22045  ? 72   GLU A OE1 1 
ATOM   3816  O OE2 . GLU B  1 92  ? -32.42428 -22.92940  55.39437  1.000 46.01061  ? 72   GLU A OE2 1 
ATOM   3817  N N   . LEU B  1 93  ? -34.09380 -28.40946  54.63043  1.000 24.67894  ? 73   LEU A N   1 
ATOM   3818  C CA  . LEU B  1 93  ? -35.27920 -28.90632  55.32280  1.000 23.26910  ? 73   LEU A CA  1 
ATOM   3819  C C   . LEU B  1 93  ? -35.03158 -30.27115  55.94850  1.000 22.24592  ? 73   LEU A C   1 
ATOM   3820  O O   . LEU B  1 93  ? -35.40953 -30.53292  57.09972  1.000 19.52181  ? 73   LEU A O   1 
ATOM   3821  C CB  . LEU B  1 93  ? -36.42928 -28.99592  54.31477  1.000 23.34039  ? 73   LEU A CB  1 
ATOM   3822  C CG  . LEU B  1 93  ? -37.74391 -29.55768  54.86043  1.000 21.79633  ? 73   LEU A CG  1 
ATOM   3823  C CD1 . LEU B  1 93  ? -38.23417 -28.78329  56.11067  1.000 23.02722  ? 73   LEU A CD1 1 
ATOM   3824  C CD2 . LEU B  1 93  ? -38.79291 -29.51781  53.75725  1.000 24.83954  ? 73   LEU A CD2 1 
ATOM   3825  N N   . ILE B  1 94  ? -34.44570 -31.18413  55.17883  1.000 25.00268  ? 74   ILE A N   1 
ATOM   3826  C CA  . ILE B  1 94  ? -34.24490 -32.52940  55.69125  1.000 21.04666  ? 74   ILE A CA  1 
ATOM   3827  C C   . ILE B  1 94  ? -33.25998 -32.51808  56.85102  1.000 19.85263  ? 74   ILE A C   1 
ATOM   3828  O O   . ILE B  1 94  ? -33.46928 -33.20520  57.85454  1.000 18.44906  ? 74   ILE A O   1 
ATOM   3829  C CB  . ILE B  1 94  ? -33.81155 -33.47393  54.54808  1.000 22.04684  ? 74   ILE A CB  1 
ATOM   3830  C CG1 . ILE B  1 94  ? -34.95826 -33.66208  53.54572  1.000 22.27794  ? 74   ILE A CG1 1 
ATOM   3831  C CG2 . ILE B  1 94  ? -33.40439 -34.81735  55.11347  1.000 26.65957  ? 74   ILE A CG2 1 
ATOM   3832  C CD1 . ILE B  1 94  ? -34.51000 -34.36538  52.24232  1.000 29.67217  ? 74   ILE A CD1 1 
ATOM   3833  N N   . ARG B  1 95  ? -32.20781 -31.70084  56.76629  1.000 21.16292  ? 75   ARG A N   1 
ATOM   3834  C CA  . ARG B  1 95  ? -31.25128 -31.63087  57.86795  1.000 22.65380  ? 75   ARG A CA  1 
ATOM   3835  C C   . ARG B  1 95  ? -31.91566 -31.05587  59.12306  1.000 19.74935  ? 75   ARG A C   1 
ATOM   3836  O O   . ARG B  1 95  ? -31.67451 -31.53928  60.24506  1.000 18.82732  ? 75   ARG A O   1 
ATOM   3837  C CB  . ARG B  1 95  ? -30.02550 -30.80858  57.44852  1.000 26.02058  ? 75   ARG A CB  1 
ATOM   3838  C CG  . ARG B  1 95  ? -28.94235 -30.66083  58.52982  1.000 36.32467  ? 75   ARG A CG  1 
ATOM   3839  C CD  . ARG B  1 95  ? -27.96798 -29.49348  58.22274  1.000 47.53722  ? 75   ARG A CD  1 
ATOM   3840  N NE  . ARG B  1 95  ? -26.58971 -29.93577  57.97081  1.000 56.77959  ? 75   ARG A NE  1 
ATOM   3841  C CZ  . ARG B  1 95  ? -25.48860 -29.23255  58.27652  1.000 61.54686  ? 75   ARG A CZ  1 
ATOM   3842  N NH1 . ARG B  1 95  ? -24.28383 -29.72520  57.98817  1.000 60.27737  ? 75   ARG A NH1 1 
ATOM   3843  N NH2 . ARG B  1 95  ? -25.58050 -28.03611  58.87091  1.000 63.49712  ? 75   ARG A NH2 1 
ATOM   3844  N N   . HIS B  1 96  ? -32.81380 -30.09202  58.94121  1.000 19.88438  ? 76   HIS A N   1 
ATOM   3845  C CA  . HIS B  1 96  ? -33.56915 -29.53335  60.07543  1.000 19.18362  ? 76   HIS A CA  1 
ATOM   3846  C C   . HIS B  1 96  ? -34.45760 -30.58402  60.74319  1.000 19.51130  ? 76   HIS A C   1 
ATOM   3847  O O   . HIS B  1 96  ? -34.58849 -30.62632  61.97902  1.000 16.85588  ? 76   HIS A O   1 
ATOM   3848  C CB  . HIS B  1 96  ? -34.41734 -28.35944  59.58593  1.000 20.01965  ? 76   HIS A CB  1 
ATOM   3849  C CG  . HIS B  1 96  ? -35.39570 -27.86860  60.60957  1.000 21.14312  ? 76   HIS A CG  1 
ATOM   3850  N ND1 . HIS B  1 96  ? -35.05236 -26.96781  61.58385  1.000 20.25261  ? 76   HIS A ND1 1 
ATOM   3851  C CD2 . HIS B  1 96  ? -36.69349 -28.19359  60.83760  1.000 18.46729  ? 76   HIS A CD2 1 
ATOM   3852  C CE1 . HIS B  1 96  ? -36.10622 -26.72176  62.34364  1.000 19.84122  ? 76   HIS A CE1 1 
ATOM   3853  N NE2 . HIS B  1 96  ? -37.11614 -27.44391  61.90463  1.000 18.74741  ? 76   HIS A NE2 1 
ATOM   3854  N N   . LEU B  1 97  ? -35.10735 -31.41901  59.94054  1.000 18.26199  ? 77   LEU A N   1 
ATOM   3855  C CA  . LEU B  1 97  ? -35.98709 -32.44434  60.48347  1.000 19.29021  ? 77   LEU A CA  1 
ATOM   3856  C C   . LEU B  1 97  ? -35.18910 -33.53284  61.18361  1.000 21.29126  ? 77   LEU A C   1 
ATOM   3857  O O   . LEU B  1 97  ? -35.59809 -34.04077  62.23891  1.000 18.12273  ? 77   LEU A O   1 
ATOM   3858  C CB  . LEU B  1 97  ? -36.83384 -33.02797  59.35171  1.000 17.97347  ? 77   LEU A CB  1 
ATOM   3859  C CG  . LEU B  1 97  ? -37.76303 -32.02298  58.66925  1.000 18.16214  ? 77   LEU A CG  1 
ATOM   3860  C CD1 . LEU B  1 97  ? -38.37322 -32.66141  57.46453  1.000 19.49281  ? 77   LEU A CD1 1 
ATOM   3861  C CD2 . LEU B  1 97  ? -38.86707 -31.59268  59.66020  1.000 17.68995  ? 77   LEU A CD2 1 
ATOM   3862  N N   . GLN B  1 98  ? -34.05861 -33.91814  60.58672  1.000 22.46451  ? 78   GLN A N   1 
ATOM   3863  C CA  . GLN B  1 98  ? -33.18511 -34.92103  61.18459  1.000 21.61561  ? 78   GLN A CA  1 
ATOM   3864  C C   . GLN B  1 98  ? -32.64008 -34.44984  62.51922  1.000 22.03131  ? 78   GLN A C   1 
ATOM   3865  O O   . GLN B  1 98  ? -32.59157 -35.22312  63.47833  1.000 25.09028  ? 78   GLN A O   1 
ATOM   3866  C CB  . GLN B  1 98  ? -32.03101 -35.25770  60.22400  1.000 21.32401  ? 78   GLN A CB  1 
ATOM   3867  C CG  . GLN B  1 98  ? -32.46766 -35.94939  58.92267  1.000 26.79790  ? 78   GLN A CG  1 
ATOM   3868  C CD  . GLN B  1 98  ? -31.30144 -36.17358  57.95133  1.000 31.26040  ? 78   GLN A CD  1 
ATOM   3869  O OE1 . GLN B  1 98  ? -31.33883 -37.07678  57.11185  1.000 33.84519  ? 78   GLN A OE1 1 
ATOM   3870  N NE2 . GLN B  1 98  ? -30.27232 -35.34854  58.05979  1.000 32.15795  ? 78   GLN A NE2 1 
ATOM   3871  N N   . ARG B  1 99  ? -32.23946 -33.18424  62.61090  1.000 18.30768  ? 79   ARG A N   1 
ATOM   3872  C CA  . ARG B  1 99  ? -31.64178 -32.68785  63.85305  1.000 21.94885  ? 79   ARG A CA  1 
ATOM   3873  C C   . ARG B  1 99  ? -32.66696 -32.26308  64.88926  1.000 21.10161  ? 79   ARG A C   1 
ATOM   3874  O O   . ARG B  1 99  ? -32.39672 -32.37725  66.08663  1.000 22.03133  ? 79   ARG A O   1 
ATOM   3875  C CB  . ARG B  1 99  ? -30.73695 -31.49255  63.56830  1.000 24.54268  ? 79   ARG A CB  1 
ATOM   3876  C CG  . ARG B  1 99  ? -29.37015 -31.93941  63.12592  1.000 33.01496  ? 79   ARG A CG  1 
ATOM   3877  C CD  . ARG B  1 99  ? -28.59141 -30.89108  62.38574  1.000 35.92545  ? 79   ARG A CD  1 
ATOM   3878  N NE  . ARG B  1 99  ? -27.73595 -31.61139  61.45869  1.000 44.37153  ? 79   ARG A NE  1 
ATOM   3879  C CZ  . ARG B  1 99  ? -26.49487 -31.26731  61.15341  1.000 50.68004  ? 79   ARG A CZ  1 
ATOM   3880  N NH1 . ARG B  1 99  ? -25.94885 -30.17976  61.70348  1.000 54.85144  ? 79   ARG A NH1 1 
ATOM   3881  N NH2 . ARG B  1 99  ? -25.81062 -32.02121  60.29340  1.000 47.01634  ? 79   ARG A NH2 1 
ATOM   3882  N N   . GLY B  1 100 ? -33.79674 -31.72508  64.46377  1.000 15.33732  ? 80   GLY A N   1 
ATOM   3883  C CA  . GLY B  1 100 ? -34.77007 -31.21743  65.41269  1.000 18.59535  ? 80   GLY A CA  1 
ATOM   3884  C C   . GLY B  1 100 ? -35.83668 -32.21286  65.83667  1.000 15.30893  ? 80   GLY A C   1 
ATOM   3885  O O   . GLY B  1 100 ? -36.28452 -32.18823  66.98274  1.000 15.80189  ? 80   GLY A O   1 
ATOM   3886  N N   . TRP B  1 101 ? -36.29664 -33.06059  64.92238  1.000 16.69886  ? 81   TRP A N   1 
ATOM   3887  C CA  . TRP B  1 101 ? -37.47020 -33.89234  65.20735  1.000 17.49184  ? 81   TRP A CA  1 
ATOM   3888  C C   . TRP B  1 101 ? -36.99337 -35.33505  65.39744  1.000 16.84931  ? 81   TRP A C   1 
ATOM   3889  O O   . TRP B  1 101 ? -37.37221 -36.25353  64.65895  1.000 14.06409  ? 81   TRP A O   1 
ATOM   3890  C CB  . TRP B  1 101 ? -38.51121 -33.71621  64.06921  1.000 15.11525  ? 81   TRP A CB  1 
ATOM   3891  C CG  . TRP B  1 101 ? -39.15505 -32.32461  64.21006  1.000 13.12249  ? 81   TRP A CG  1 
ATOM   3892  C CD1 . TRP B  1 101 ? -38.67772 -31.11973  63.73051  1.000 14.13750  ? 81   TRP A CD1 1 
ATOM   3893  C CD2 . TRP B  1 101 ? -40.30133 -32.00401  65.00438  1.000 13.68655  ? 81   TRP A CD2 1 
ATOM   3894  N NE1 . TRP B  1 101 ? -39.49539 -30.08690  64.14767  1.000 14.87455  ? 81   TRP A NE1 1 
ATOM   3895  C CE2 . TRP B  1 101 ? -40.50175 -30.61576  64.92135  1.000 14.30251  ? 81   TRP A CE2 1 
ATOM   3896  C CE3 . TRP B  1 101 ? -41.20582 -32.77781  65.75753  1.000 13.76288  ? 81   TRP A CE3 1 
ATOM   3897  C CZ2 . TRP B  1 101 ? -41.56200 -29.98648  65.55428  1.000 14.98519  ? 81   TRP A CZ2 1 
ATOM   3898  C CZ3 . TRP B  1 101 ? -42.25330 -32.15299  66.36219  1.000 13.30406  ? 81   TRP A CZ3 1 
ATOM   3899  C CH2 . TRP B  1 101 ? -42.41495 -30.76037  66.27256  1.000 14.46053  ? 81   TRP A CH2 1 
ATOM   3900  N N   . ASP B  1 102 ? -36.12945 -35.52109  66.39348  1.000 18.87513  ? 82   ASP A N   1 
ATOM   3901  C CA  . ASP B  1 102 ? -35.32621 -36.72530  66.51009  1.000 14.12991  ? 82   ASP A CA  1 
ATOM   3902  C C   . ASP B  1 102 ? -35.64553 -37.48485  67.78220  1.000 17.41637  ? 82   ASP A C   1 
ATOM   3903  O O   . ASP B  1 102 ? -34.86351 -38.35774  68.17534  1.000 22.45569  ? 82   ASP A O   1 
ATOM   3904  C CB  . ASP B  1 102 ? -33.83493 -36.36958  66.48922  1.000 19.10444  ? 82   ASP A CB  1 
ATOM   3905  C CG  . ASP B  1 102 ? -33.40994 -35.59754  67.74618  1.000 21.42885  ? 82   ASP A CG  1 
ATOM   3906  O OD1 . ASP B  1 102 ? -34.28104 -35.01871  68.45278  1.000 21.67910  ? 82   ASP A OD1 1 
ATOM   3907  O OD2 . ASP B  1 102 ? -32.19751 -35.56664  68.02928  1.000 24.05261  ? 82   ASP A OD2 1 
ATOM   3908  N N   . PHE B  1 103 ? -36.75046 -37.17297  68.44923  1.000 13.18338  ? 83   PHE A N   1 
ATOM   3909  C CA  . PHE B  1 103 ? -37.05840 -37.77997  69.74444  1.000 16.71407  ? 83   PHE A CA  1 
ATOM   3910  C C   . PHE B  1 103 ? -38.17606 -38.81973  69.67615  1.000 16.36048  ? 83   PHE A C   1 
ATOM   3911  O O   . PHE B  1 103 ? -38.71174 -39.20231  70.72185  1.000 16.17700  ? 83   PHE A O   1 
ATOM   3912  C CB  . PHE B  1 103 ? -37.40861 -36.71497  70.78829  1.000 13.33196  ? 83   PHE A CB  1 
ATOM   3913  C CG  . PHE B  1 103 ? -38.51691 -35.76539  70.35890  1.000 15.02954  ? 83   PHE A CG  1 
ATOM   3914  C CD1 . PHE B  1 103 ? -39.83777 -36.00329  70.70552  1.000 17.05998  ? 83   PHE A CD1 1 
ATOM   3915  C CD2 . PHE B  1 103 ? -38.21595 -34.63214  69.57671  1.000 17.59362  ? 83   PHE A CD2 1 
ATOM   3916  C CE1 . PHE B  1 103 ? -40.87447 -35.13225  70.29795  1.000 16.99405  ? 83   PHE A CE1 1 
ATOM   3917  C CE2 . PHE B  1 103 ? -39.22864 -33.75783  69.17165  1.000 17.70988  ? 83   PHE A CE2 1 
ATOM   3918  C CZ  . PHE B  1 103 ? -40.56943 -34.00806  69.52596  1.000 16.58054  ? 83   PHE A CZ  1 
ATOM   3919  N N   . PHE B  1 104 ? -38.52011 -39.32064  68.49595  1.000 11.56925  ? 84   PHE A N   1 
ATOM   3920  C CA  . PHE B  1 104 ? -39.61004 -40.30351  68.39310  1.000 17.25761  ? 84   PHE A CA  1 
ATOM   3921  C C   . PHE B  1 104 ? -39.00564 -41.70623  68.42543  1.000 17.70937  ? 84   PHE A C   1 
ATOM   3922  O O   . PHE B  1 104 ? -38.03709 -41.97704  67.71636  1.000 18.78811  ? 84   PHE A O   1 
ATOM   3923  C CB  . PHE B  1 104 ? -40.43726 -40.13462  67.10026  1.000 21.62311  ? 84   PHE A CB  1 
ATOM   3924  C CG  . PHE B  1 104 ? -41.23263 -38.84300  67.01908  1.000 24.11401  ? 84   PHE A CG  1 
ATOM   3925  C CD1 . PHE B  1 104 ? -40.58980 -37.60963  66.99115  1.000 27.47074  ? 84   PHE A CD1 1 
ATOM   3926  C CD2 . PHE B  1 104 ? -42.61261 -38.86748  66.90878  1.000 24.68708  ? 84   PHE A CD2 1 
ATOM   3927  C CE1 . PHE B  1 104 ? -41.31820 -36.41470  66.92829  1.000 26.36997  ? 84   PHE A CE1 1 
ATOM   3928  C CE2 . PHE B  1 104 ? -43.35442 -37.68043  66.83346  1.000 23.83653  ? 84   PHE A CE2 1 
ATOM   3929  C CZ  . PHE B  1 104 ? -42.69273 -36.45038  66.84688  1.000 24.89123  ? 84   PHE A CZ  1 
ATOM   3930  N N   . ARG B  1 105 ? -39.58871 -42.60949  69.21643  1.000 13.00648  ? 85   ARG A N   1 
ATOM   3931  C CA  . ARG B  1 105 ? -39.06083 -43.97599  69.27431  1.000 14.93001  ? 85   ARG A CA  1 
ATOM   3932  C C   . ARG B  1 105 ? -40.12057 -44.99458  68.86798  1.000 14.89705  ? 85   ARG A C   1 
ATOM   3933  O O   . ARG B  1 105 ? -41.23505 -44.98596  69.42333  1.000 16.27299  ? 85   ARG A O   1 
ATOM   3934  C CB  . ARG B  1 105 ? -38.55885 -44.31643  70.69593  1.000 16.13300  ? 85   ARG A CB  1 
ATOM   3935  C CG  . ARG B  1 105 ? -37.22251 -43.63259  71.10289  1.000 16.11396  ? 85   ARG A CG  1 
ATOM   3936  C CD  . ARG B  1 105 ? -36.09017 -44.06174  70.16281  1.000 22.37021  ? 85   ARG A CD  1 
ATOM   3937  N NE  . ARG B  1 105 ? -35.83814 -45.49904  70.23061  1.000 21.87093  ? 85   ARG A NE  1 
ATOM   3938  C CZ  . ARG B  1 105 ? -34.66560 -46.07046  69.93379  1.000 24.85318  ? 85   ARG A CZ  1 
ATOM   3939  N NH1 . ARG B  1 105 ? -33.60350 -45.34013  69.51362  1.000 19.03849  ? 85   ARG A NH1 1 
ATOM   3940  N NH2 . ARG B  1 105 ? -34.54581 -47.38170  70.04354  1.000 25.65820  ? 85   ARG A NH2 1 
ATOM   3941  N N   . PRO B  1 106 ? -39.80185 -45.92342  67.95928  1.000 17.11319  ? 86   PRO A N   1 
ATOM   3942  C CA  . PRO B  1 106 ? -40.81998 -46.90322  67.53332  1.000 20.01550  ? 86   PRO A CA  1 
ATOM   3943  C C   . PRO B  1 106 ? -41.29525 -47.79915  68.66213  1.000 22.75541  ? 86   PRO A C   1 
ATOM   3944  O O   . PRO B  1 106 ? -42.46676 -48.22131  68.66490  1.000 18.93820  ? 86   PRO A O   1 
ATOM   3945  C CB  . PRO B  1 106 ? -40.10048 -47.70510  66.43405  1.000 21.88624  ? 86   PRO A CB  1 
ATOM   3946  C CG  . PRO B  1 106 ? -39.07115 -46.72842  65.87055  1.000 22.62796  ? 86   PRO A CG  1 
ATOM   3947  C CD  . PRO B  1 106 ? -38.60091 -45.94125  67.10826  1.000 16.74712  ? 86   PRO A CD  1 
ATOM   3948  N N   . GLU B  1 107 ? -40.42891 -48.09731  69.63660  1.000 18.61343  ? 87   GLU A N   1 
ATOM   3949  C CA  . GLU B  1 107 ? -40.86325 -48.89913  70.77516  1.000 19.93613  ? 87   GLU A CA  1 
ATOM   3950  C C   . GLU B  1 107 ? -41.99680 -48.24234  71.52891  1.000 20.42661  ? 87   GLU A C   1 
ATOM   3951  O O   . GLU B  1 107 ? -42.71454 -48.92445  72.27084  1.000 20.66289  ? 87   GLU A O   1 
ATOM   3952  C CB  . GLU B  1 107 ? -39.72033 -49.12570  71.77167  1.000 24.77187  ? 87   GLU A CB  1 
ATOM   3953  C CG  . GLU B  1 107 ? -38.50565 -49.72372  71.18904  1.000 21.47302  ? 87   GLU A CG  1 
ATOM   3954  C CD  . GLU B  1 107 ? -37.44093 -48.66846  70.96218  1.000 20.09709  ? 87   GLU A CD  1 
ATOM   3955  O OE1 . GLU B  1 107 ? -37.80301 -47.66330  70.36430  1.000 18.48341  ? 87   GLU A OE1 1 
ATOM   3956  O OE2 . GLU B  1 107 ? -36.28883 -48.84528  71.41145  1.000 20.88556  ? 87   GLU A OE2 1 
ATOM   3957  N N   . ARG B  1 108 ? -42.12308 -46.92964  71.42903  1.000 17.63768  ? 88   ARG A N   1 
ATOM   3958  C CA  . ARG B  1 108 ? -43.21273 -46.21837  72.07281  1.000 17.32663  ? 88   ARG A CA  1 
ATOM   3959  C C   . ARG B  1 108 ? -44.36621 -45.97352  71.12211  1.000 19.08099  ? 88   ARG A C   1 
ATOM   3960  O O   . ARG B  1 108 ? -45.24925 -45.16011  71.43374  1.000 20.78625  ? 88   ARG A O   1 
ATOM   3961  C CB  . ARG B  1 108 ? -42.70283 -44.89331  72.65208  1.000 16.32470  ? 88   ARG A CB  1 
ATOM   3962  C CG  . ARG B  1 108 ? -41.67386 -45.11271  73.72710  1.000 18.88009  ? 88   ARG A CG  1 
ATOM   3963  C CD  . ARG B  1 108 ? -41.36403 -43.84400  74.58568  1.000 19.41729  ? 88   ARG A CD  1 
ATOM   3964  N NE  . ARG B  1 108 ? -40.80195 -42.75935  73.77633  1.000 19.46843  ? 88   ARG A NE  1 
ATOM   3965  C CZ  . ARG B  1 108 ? -39.51220 -42.42388  73.73151  1.000 18.36011  ? 88   ARG A CZ  1 
ATOM   3966  N NH1 . ARG B  1 108 ? -38.63607 -43.07691  74.46604  1.000 16.46909  ? 88   ARG A NH1 1 
ATOM   3967  N NH2 . ARG B  1 108 ? -39.09724 -41.42231  72.94078  1.000 21.93037  ? 88   ARG A NH2 1 
ATOM   3968  N N   . ASN B  1 109 ? -44.37721 -46.65451  69.95997  1.000 17.63429  ? 89   ASN A N   1 
ATOM   3969  C CA  . ASN B  1 109 ? -45.40583 -46.46962  68.93274  1.000 17.77364  ? 89   ASN A CA  1 
ATOM   3970  C C   . ASN B  1 109 ? -45.40997 -45.04226  68.39755  1.000 18.22283  ? 89   ASN A C   1 
ATOM   3971  O O   . ASN B  1 109 ? -46.45350 -44.47710  68.05823  1.000 21.78386  ? 89   ASN A O   1 
ATOM   3972  C CB  . ASN B  1 109 ? -46.77566 -46.87826  69.44777  1.000 19.10438  ? 89   ASN A CB  1 
ATOM   3973  C CG  . ASN B  1 109 ? -46.88464 -48.35958  69.55906  1.000 28.51234  ? 89   ASN A CG  1 
ATOM   3974  O OD1 . ASN B  1 109 ? -46.33008 -49.08956  68.71915  1.000 26.25248  ? 89   ASN A OD1 1 
ATOM   3975  N ND2 . ASN B  1 109 ? -47.55536 -48.83090  70.59270  1.000 30.08958  ? 89   ASN A ND2 1 
ATOM   3976  N N   . GLU B  1 110 ? -44.22643 -44.48746  68.27543  1.000 16.93484  ? 90   GLU A N   1 
ATOM   3977  C CA  . GLU B  1 110 ? -43.98008 -43.17419  67.72545  1.000 15.04109  ? 90   GLU A CA  1 
ATOM   3978  C C   . GLU B  1 110 ? -43.17262 -43.36227  66.46203  1.000 17.22885  ? 90   GLU A C   1 
ATOM   3979  O O   . GLU B  1 110 ? -42.32651 -44.25453  66.38743  1.000 21.51324  ? 90   GLU A O   1 
ATOM   3980  C CB  . GLU B  1 110 ? -43.16582 -42.29708  68.69097  1.000 14.43611  ? 90   GLU A CB  1 
ATOM   3981  C CG  . GLU B  1 110 ? -43.79675 -42.17881  70.05405  1.000 18.47323  ? 90   GLU A CG  1 
ATOM   3982  C CD  . GLU B  1 110 ? -42.87818 -41.55347  71.07265  1.000 23.87978  ? 90   GLU A CD  1 
ATOM   3983  O OE1 . GLU B  1 110 ? -43.41147 -41.09636  72.10638  1.000 29.48325  ? 90   GLU A OE1 1 
ATOM   3984  O OE2 . GLU B  1 110 ? -41.64607 -41.54482  70.87319  1.000 20.07797  ? 90   GLU A OE2 1 
ATOM   3985  N N   . SER B  1 111 ? -43.35118 -42.46721  65.50205  1.000 17.00723  ? 91   SER A N   1 
ATOM   3986  C CA  . SER B  1 111 ? -42.44093 -42.52248  64.37157  1.000 17.48877  ? 91   SER A CA  1 
ATOM   3987  C C   . SER B  1 111 ? -42.42028 -41.16610  63.70211  1.000 17.88911  ? 91   SER A C   1 
ATOM   3988  O O   . SER B  1 111 ? -43.42083 -40.43934  63.70484  1.000 18.50867  ? 91   SER A O   1 
ATOM   3989  C CB  . SER B  1 111 ? -42.84330 -43.59176  63.34874  1.000 18.71014  ? 91   SER A CB  1 
ATOM   3990  O OG  . SER B  1 111 ? -44.21335 -43.44270  62.98654  1.000 16.44137  ? 91   SER A OG  1 
ATOM   3991  N N   . PHE B  1 112 ? -41.28057 -40.86001  63.11092  1.000 16.27855  ? 92   PHE A N   1 
ATOM   3992  C CA  . PHE B  1 112 ? -41.10819 -39.65044  62.31216  1.000 18.83345  ? 92   PHE A CA  1 
ATOM   3993  C C   . PHE B  1 112 ? -40.38342 -40.02542  61.02552  1.000 20.96313  ? 92   PHE A C   1 
ATOM   3994  O O   . PHE B  1 112 ? -39.18699 -40.34604  61.04112  1.000 18.37290  ? 92   PHE A O   1 
ATOM   3995  C CB  . PHE B  1 112 ? -40.36140 -38.58269  63.12253  1.000 20.02369  ? 92   PHE A CB  1 
ATOM   3996  C CG  . PHE B  1 112 ? -40.48712 -37.19741  62.53343  1.000 17.03675  ? 92   PHE A CG  1 
ATOM   3997  C CD1 . PHE B  1 112 ? -39.79495 -36.85154  61.38676  1.000 19.63113  ? 92   PHE A CD1 1 
ATOM   3998  C CD2 . PHE B  1 112 ? -41.30367 -36.25523  63.13949  1.000 14.45399  ? 92   PHE A CD2 1 
ATOM   3999  C CE1 . PHE B  1 112 ? -39.92192 -35.57447  60.83248  1.000 16.16753  ? 92   PHE A CE1 1 
ATOM   4000  C CE2 . PHE B  1 112 ? -41.45203 -35.00748  62.59728  1.000 16.55212  ? 92   PHE A CE2 1 
ATOM   4001  C CZ  . PHE B  1 112 ? -40.76941 -34.65378  61.45505  1.000 15.31482  ? 92   PHE A CZ  1 
ATOM   4002  N N   . ASP B  1 113 ? -41.11106 -40.01998  59.89362  1.000 15.37822  ? 93   ASP A N   1 
ATOM   4003  C CA  . ASP B  1 113 ? -40.58792 -40.49740  58.62634  1.000 16.34394  ? 93   ASP A CA  1 
ATOM   4004  C C   . ASP B  1 113 ? -40.42326 -39.31187  57.69359  1.000 18.21404  ? 93   ASP A C   1 
ATOM   4005  O O   . ASP B  1 113 ? -41.40097 -38.59774  57.44169  1.000 21.26649  ? 93   ASP A O   1 
ATOM   4006  C CB  . ASP B  1 113 ? -41.53947 -41.52053  57.99719  1.000 19.00912  ? 93   ASP A CB  1 
ATOM   4007  C CG  . ASP B  1 113 ? -41.52112 -42.85745  58.74585  1.000 23.67259  ? 93   ASP A CG  1 
ATOM   4008  O OD1 . ASP B  1 113 ? -42.55956 -43.23718  59.30269  1.000 22.41917  ? 93   ASP A OD1 1 
ATOM   4009  O OD2 . ASP B  1 113 ? -40.46803 -43.52752  58.75981  1.000 22.90707  ? 93   ASP A OD2 1 
ATOM   4010  N N   . ILE B  1 114 ? -39.20634 -39.11705  57.18519  1.000 20.00349  ? 94   ILE A N   1 
ATOM   4011  C CA  . ILE B  1 114 ? -38.88898 -38.11241  56.16955  1.000 22.07693  ? 94   ILE A CA  1 
ATOM   4012  C C   . ILE B  1 114 ? -38.86174 -38.79622  54.80136  1.000 28.08482  ? 94   ILE A C   1 
ATOM   4013  O O   . ILE B  1 114 ? -38.04514 -39.70019  54.56825  1.000 30.28770  ? 94   ILE A O   1 
ATOM   4014  C CB  . ILE B  1 114 ? -37.54151 -37.43157  56.45831  1.000 22.28885  ? 94   ILE A CB  1 
ATOM   4015  C CG1 . ILE B  1 114 ? -37.55420 -36.81225  57.85292  1.000 23.70550  ? 94   ILE A CG1 1 
ATOM   4016  C CG2 . ILE B  1 114 ? -37.19544 -36.39685  55.34603  1.000 23.38717  ? 94   ILE A CG2 1 
ATOM   4017  C CD1 . ILE B  1 114 ? -36.16827 -36.48311  58.37535  1.000 28.10523  ? 94   ILE A CD1 1 
ATOM   4018  N N   . LEU B  1 115 ? -39.73227 -38.34795  53.88229  1.000 24.94241  ? 95   LEU A N   1 
ATOM   4019  C CA  . LEU B  1 115 ? -40.04350 -39.04945  52.63273  1.000 27.73817  ? 95   LEU A CA  1 
ATOM   4020  C C   . LEU B  1 115 ? -39.75515 -38.19125  51.39999  1.000 32.36047  ? 95   LEU A C   1 
ATOM   4021  O O   . LEU B  1 115 ? -40.67869 -37.64468  50.77494  1.000 31.34055  ? 95   LEU A O   1 
ATOM   4022  C CB  . LEU B  1 115 ? -41.50491 -39.48717  52.64133  1.000 26.90749  ? 95   LEU A CB  1 
ATOM   4023  C CG  . LEU B  1 115 ? -41.77488 -40.30763  53.89580  1.000 28.59872  ? 95   LEU A CG  1 
ATOM   4024  C CD1 . LEU B  1 115 ? -43.27649 -40.46379  54.17341  1.000 30.01206  ? 95   LEU A CD1 1 
ATOM   4025  C CD2 . LEU B  1 115 ? -41.08336 -41.64325  53.76876  1.000 29.20739  ? 95   LEU A CD2 1 
ATOM   4026  N N   . PRO B  1 116 ? -38.49248 -38.06574  51.00465  1.000 31.96356  ? 96   PRO A N   1 
ATOM   4027  C CA  . PRO B  1 116 ? -38.17854 -37.34099  49.77320  1.000 33.25101  ? 96   PRO A CA  1 
ATOM   4028  C C   . PRO B  1 116 ? -38.52118 -38.19626  48.56208  1.000 40.22947  ? 96   PRO A C   1 
ATOM   4029  O O   . PRO B  1 116 ? -38.66817 -39.41178  48.66508  1.000 43.29509  ? 96   PRO A O   1 
ATOM   4030  C CB  . PRO B  1 116 ? -36.66852 -37.09425  49.86028  1.000 32.93240  ? 96   PRO A CB  1 
ATOM   4031  C CG  . PRO B  1 116 ? -36.24874 -37.50559  51.23921  1.000 36.47012  ? 96   PRO A CG  1 
ATOM   4032  C CD  . PRO B  1 116 ? -37.28433 -38.46293  51.75062  1.000 31.62700  ? 96   PRO A CD  1 
ATOM   4033  N N   . ALA B  1 117 ? -38.67945 -37.54961  47.41438  1.000 53.45166  ? 97   ALA A N   1 
ATOM   4034  C CA  . ALA B  1 117 ? -38.80562 -38.29437  46.16407  1.000 61.79870  ? 97   ALA A CA  1 
ATOM   4035  C C   . ALA B  1 117 ? -37.40983 -38.70043  45.70391  1.000 72.58097  ? 97   ALA A C   1 
ATOM   4036  O O   . ALA B  1 117 ? -36.53738 -37.84385  45.53122  1.000 78.84330  ? 97   ALA A O   1 
ATOM   4037  C CB  . ALA B  1 117 ? -39.52259 -37.45074  45.11588  1.000 61.26727  ? 97   ALA A CB  1 
ATOM   4038  N N   . SER B  1 118 ? -37.17311 -39.99809  45.55037  1.000 82.72097  ? 98   SER A N   1 
ATOM   4039  C CA  . SER B  1 118 ? -35.80712 -40.46610  45.33593  1.000 96.34003  ? 98   SER A CA  1 
ATOM   4040  C C   . SER B  1 118 ? -35.83013 -41.82930  44.64279  1.000 112.81223 ? 98   SER A C   1 
ATOM   4041  O O   . SER B  1 118 ? -36.88997 -42.35031  44.27782  1.000 114.11268 ? 98   SER A O   1 
ATOM   4042  C CB  . SER B  1 118 ? -35.03120 -40.51054  46.66296  1.000 94.17261  ? 98   SER A CB  1 
ATOM   4043  O OG  . SER B  1 118 ? -35.52997 -41.50619  47.54861  1.000 94.23959  ? 98   SER A OG  1 
ATOM   4044  N N   . GLN B  1 119 ? -34.63142 -42.39140  44.44572  1.000 125.79477 ? 99   GLN A N   1 
ATOM   4045  C CA  . GLN B  1 119 ? -34.43934 -43.71605  43.85006  1.000 136.60853 ? 99   GLN A CA  1 
ATOM   4046  C C   . GLN B  1 119 ? -34.69432 -44.77474  44.91758  1.000 143.44256 ? 99   GLN A C   1 
ATOM   4047  O O   . GLN B  1 119 ? -33.81043 -45.09834  45.71589  1.000 145.39512 ? 99   GLN A O   1 
ATOM   4048  C CB  . GLN B  1 119 ? -33.03382 -43.84564  43.27230  1.000 139.68654 ? 99   GLN A CB  1 
ATOM   4049  N N   . ARG B  1 120 ? -35.90668 -45.33079  44.92253  1.000 147.41908 ? 100  ARG A N   1 
ATOM   4050  C CA  . ARG B  1 120 ? -36.34372 -46.22785  45.98682  1.000 150.08123 ? 100  ARG A CA  1 
ATOM   4051  C C   . ARG B  1 120 ? -37.39868 -47.20375  45.47417  1.000 156.90615 ? 100  ARG A C   1 
ATOM   4052  O O   . ARG B  1 120 ? -37.08097 -48.34858  45.13175  1.000 158.72543 ? 100  ARG A O   1 
ATOM   4053  C CB  . ARG B  1 120 ? -36.88457 -45.40974  47.16555  1.000 143.49877 ? 100  ARG A CB  1 
ATOM   4054  C CG  . ARG B  1 120 ? -37.19429 -46.20463  48.42096  1.000 139.04087 ? 100  ARG A CG  1 
ATOM   4055  C CD  . ARG B  1 120 ? -38.07101 -45.38802  49.37977  1.000 132.71061 ? 100  ARG A CD  1 
ATOM   4056  N NE  . ARG B  1 120 ? -39.32880 -44.97790  48.75936  1.000 128.06810 ? 100  ARG A NE  1 
ATOM   4057  C CZ  . ARG B  1 120 ? -40.53333 -45.29443  49.22612  1.000 122.79905 ? 100  ARG A CZ  1 
ATOM   4058  N NH1 . ARG B  1 120 ? -41.62169 -44.88178  48.59001  1.000 122.23964 ? 100  ARG A NH1 1 
ATOM   4059  N NH2 . ARG B  1 120 ? -40.65150 -46.02474  50.32496  1.000 119.18979 ? 100  ARG A NH2 1 
ATOM   4060  N N   . VAL B  1 121 ? -38.65777 -46.75869  45.42475  1.000 161.38803 ? 101  VAL A N   1 
ATOM   4061  C CA  . VAL B  1 121 ? -39.73345 -47.57111  44.86276  1.000 167.19587 ? 101  VAL A CA  1 
ATOM   4062  C C   . VAL B  1 121 ? -39.93874 -47.30515  43.37377  1.000 174.59318 ? 101  VAL A C   1 
ATOM   4063  O O   . VAL B  1 121 ? -40.59103 -48.11235  42.69488  1.000 176.96101 ? 101  VAL A O   1 
ATOM   4064  C CB  . VAL B  1 121 ? -41.05078 -47.34495  45.63326  1.000 163.78844 ? 101  VAL A CB  1 
ATOM   4065  C CG1 . VAL B  1 121 ? -41.77258 -46.09218  45.13746  1.000 162.09840 ? 101  VAL A CG1 1 
ATOM   4066  C CG2 . VAL B  1 121 ? -41.95149 -48.57385  45.53831  1.000 163.88255 ? 101  VAL A CG2 1 
ATOM   4067  N N   . SER B  1 122 ? -39.39105 -46.20906  42.84621  1.000 178.41835 ? 102  SER A N   1 
ATOM   4068  C CA  . SER B  1 122 ? -39.49098 -45.87773  41.42959  1.000 181.87048 ? 102  SER A CA  1 
ATOM   4069  C C   . SER B  1 122 ? -38.33445 -44.95887  41.05480  1.000 179.71539 ? 102  SER A C   1 
ATOM   4070  O O   . SER B  1 122 ? -37.72501 -44.31766  41.91587  1.000 179.80631 ? 102  SER A O   1 
ATOM   4071  C CB  . SER B  1 122 ? -40.83713 -45.21879  41.09846  1.000 183.41764 ? 102  SER A CB  1 
ATOM   4072  O OG  . SER B  1 122 ? -41.09155 -44.10273  41.93795  1.000 182.46869 ? 102  SER A OG  1 
ATOM   4073  N N   . GLU B  1 123 ? -38.03597 -44.90910  39.75193  1.000 176.28295 ? 103  GLU A N   1 
ATOM   4074  C CA  . GLU B  1 123 ? -36.98940 -44.01728  39.25742  1.000 171.33720 ? 103  GLU A CA  1 
ATOM   4075  C C   . GLU B  1 123 ? -37.34350 -42.56258  39.54156  1.000 164.59699 ? 103  GLU A C   1 
ATOM   4076  O O   . GLU B  1 123 ? -36.61743 -41.86218  40.25710  1.000 163.46317 ? 103  GLU A O   1 
ATOM   4077  C CB  . GLU B  1 123 ? -36.76972 -44.24225  37.75941  1.000 173.18450 ? 103  GLU A CB  1 
ATOM   4078  N N   . THR B  1 124 ? -38.46578 -42.10006  38.97742  1.000 159.62462 ? 104  THR A N   1 
ATOM   4079  C CA  . THR B  1 124 ? -39.10713 -40.81249  39.24780  1.000 153.25971 ? 104  THR A CA  1 
ATOM   4080  C C   . THR B  1 124 ? -38.15134 -39.70569  39.67066  1.000 147.42881 ? 104  THR A C   1 
ATOM   4081  O O   . THR B  1 124 ? -37.66222 -38.93726  38.83621  1.000 148.55846 ? 104  THR A O   1 
ATOM   4082  C CB  . THR B  1 124 ? -40.18830 -40.96380  40.33262  1.000 151.97348 ? 104  THR A CB  1 
ATOM   4083  O OG1 . THR B  1 124 ? -39.66461 -41.67397  41.46447  1.000 152.23738 ? 104  THR A OG1 1 
ATOM   4084  C CG2 . THR B  1 124 ? -41.40505 -41.70103  39.78799  1.000 152.50786 ? 104  THR A CG2 1 
ATOM   4085  N N   . GLN B  1 125 ? -37.89459 -39.63370  40.97535  1.000 140.62426 ? 105  GLN A N   1 
ATOM   4086  C CA  . GLN B  1 125 ? -37.18837 -38.55857  41.65938  1.000 133.90883 ? 105  GLN A CA  1 
ATOM   4087  C C   . GLN B  1 125 ? -38.00237 -37.27131  41.73701  1.000 128.41823 ? 105  GLN A C   1 
ATOM   4088  O O   . GLN B  1 125 ? -37.45607 -36.25447  42.15861  1.000 129.00897 ? 105  GLN A O   1 
ATOM   4089  C CB  . GLN B  1 125 ? -35.81756 -38.26633  41.03243  1.000 134.47405 ? 105  GLN A CB  1 
ATOM   4090  N N   . TRP B  1 126 ? -39.28812 -37.28292  41.35565  1.000 121.86546 ? 106  TRP A N   1 
ATOM   4091  C CA  . TRP B  1 126 ? -40.17392 -36.13914  41.57829  1.000 113.23445 ? 106  TRP A CA  1 
ATOM   4092  C C   . TRP B  1 126 ? -41.60926 -36.62883  41.76948  1.000 96.84645  ? 106  TRP A C   1 
ATOM   4093  O O   . TRP B  1 126 ? -42.09324 -37.43844  40.97512  1.000 99.18657  ? 106  TRP A O   1 
ATOM   4094  C CB  . TRP B  1 126 ? -40.09872 -35.12999  40.41576  1.000 122.80679 ? 106  TRP A CB  1 
ATOM   4095  C CG  . TRP B  1 126 ? -39.93195 -33.65594  40.81112  1.000 129.23714 ? 106  TRP A CG  1 
ATOM   4096  C CD1 . TRP B  1 126 ? -40.80534 -32.63611  40.54123  1.000 130.93114 ? 106  TRP A CD1 1 
ATOM   4097  C CD2 . TRP B  1 126 ? -38.82404 -33.05047  41.50816  1.000 132.62469 ? 106  TRP A CD2 1 
ATOM   4098  N NE1 . TRP B  1 126 ? -40.32060 -31.44747  41.03884  1.000 131.65087 ? 106  TRP A NE1 1 
ATOM   4099  C CE2 . TRP B  1 126 ? -39.10785 -31.67448  41.63508  1.000 132.60039 ? 106  TRP A CE2 1 
ATOM   4100  C CE3 . TRP B  1 126 ? -37.62777 -33.53699  42.03986  1.000 134.44711 ? 106  TRP A CE3 1 
ATOM   4101  C CZ2 . TRP B  1 126 ? -38.23778 -30.78785  42.27518  1.000 132.35177 ? 106  TRP A CZ2 1 
ATOM   4102  C CZ3 . TRP B  1 126 ? -36.77022 -32.66025  42.67445  1.000 134.40239 ? 106  TRP A CZ3 1 
ATOM   4103  C CH2 . TRP B  1 126 ? -37.07682 -31.30172  42.78550  1.000 133.24089 ? 106  TRP A CH2 1 
ATOM   4104  N N   . TYR B  1 127 ? -42.27350 -36.13702  42.82330  1.000 78.52189  ? 107  TYR A N   1 
ATOM   4105  C CA  . TYR B  1 127 ? -43.68966 -36.44163  43.02938  1.000 62.86886  ? 107  TYR A CA  1 
ATOM   4106  C C   . TYR B  1 127 ? -44.53302 -35.63448  42.05094  1.000 58.49107  ? 107  TYR A C   1 
ATOM   4107  O O   . TYR B  1 127 ? -44.27780 -34.45045  41.81668  1.000 58.24124  ? 107  TYR A O   1 
ATOM   4108  C CB  . TYR B  1 127 ? -44.15563 -36.11766  44.45806  1.000 52.79198  ? 107  TYR A CB  1 
ATOM   4109  C CG  . TYR B  1 127 ? -43.52467 -36.92036  45.60630  1.000 45.30596  ? 107  TYR A CG  1 
ATOM   4110  C CD1 . TYR B  1 127 ? -43.23075 -36.30464  46.81208  1.000 40.12566  ? 107  TYR A CD1 1 
ATOM   4111  C CD2 . TYR B  1 127 ? -43.25407 -38.28661  45.49225  1.000 44.95705  ? 107  TYR A CD2 1 
ATOM   4112  C CE1 . TYR B  1 127 ? -42.65083 -37.00422  47.85650  1.000 37.83511  ? 107  TYR A CE1 1 
ATOM   4113  C CE2 . TYR B  1 127 ? -42.67833 -39.00302  46.54242  1.000 41.40359  ? 107  TYR A CE2 1 
ATOM   4114  C CZ  . TYR B  1 127 ? -42.37736 -38.34843  47.72651  1.000 39.55627  ? 107  TYR A CZ  1 
ATOM   4115  O OH  . TYR B  1 127 ? -41.80510 -39.03074  48.78759  1.000 34.83390  ? 107  TYR A OH  1 
ATOM   4116  N N   . GLU B  1 128 ? -45.56902 -36.27531  41.50683  1.000 53.33275  ? 108  GLU A N   1 
ATOM   4117  C CA  . GLU B  1 128 ? -46.39564 -35.66238  40.46993  1.000 50.25752  ? 108  GLU A CA  1 
ATOM   4118  C C   . GLU B  1 128 ? -47.34170 -34.60268  41.01469  1.000 44.65877  ? 108  GLU A C   1 
ATOM   4119  O O   . GLU B  1 128 ? -47.88974 -33.82381  40.22550  1.000 44.98916  ? 108  GLU A O   1 
ATOM   4120  C CB  . GLU B  1 128 ? -47.19120 -36.75082  39.73800  1.000 50.63210  ? 108  GLU A CB  1 
ATOM   4121  C CG  . GLU B  1 128 ? -46.35354 -37.57193  38.78586  1.000 56.63195  ? 108  GLU A CG  1 
ATOM   4122  C CD  . GLU B  1 128 ? -45.67195 -36.71228  37.73352  1.000 65.11326  ? 108  GLU A CD  1 
ATOM   4123  O OE1 . GLU B  1 128 ? -44.51520 -37.02614  37.38011  1.000 70.09726  ? 108  GLU A OE1 1 
ATOM   4124  O OE2 . GLU B  1 128 ? -46.28425 -35.72128  37.26187  1.000 66.75163  ? 108  GLU A OE2 1 
ATOM   4125  N N   . GLY B  1 129 ? -47.51199 -34.53992  42.33003  1.000 33.80164  ? 109  GLY A N   1 
ATOM   4126  C CA  . GLY B  1 129 ? -48.51652 -33.70276  42.94432  1.000 34.69639  ? 109  GLY A CA  1 
ATOM   4127  C C   . GLY B  1 129 ? -48.67508 -34.10107  44.39939  1.000 34.85238  ? 109  GLY A C   1 
ATOM   4128  O O   . GLY B  1 129 ? -48.09059 -35.08952  44.85751  1.000 35.30986  ? 109  GLY A O   1 
ATOM   4129  N N   . THR B  1 130 ? -49.49922 -33.32586  45.11624  1.000 35.80895  ? 110  THR A N   1 
ATOM   4130  C CA  . THR B  1 130 ? -49.65759 -33.56276  46.55625  1.000 39.53211  ? 110  THR A CA  1 
ATOM   4131  C C   . THR B  1 130 ? -50.26509 -34.93244  46.82678  1.000 38.17691  ? 110  THR A C   1 
ATOM   4132  O O   . THR B  1 130 ? -49.92409 -35.58320  47.81919  1.000 34.51660  ? 110  THR A O   1 
ATOM   4133  C CB  . THR B  1 130 ? -50.51655 -32.47526  47.21523  1.000 37.57150  ? 110  THR A CB  1 
ATOM   4134  O OG1 . THR B  1 130 ? -51.81567 -32.43438  46.59464  1.000 37.15361  ? 110  THR A OG1 1 
ATOM   4135  C CG2 . THR B  1 130 ? -49.83096 -31.12228  47.10799  1.000 34.63955  ? 110  THR A CG2 1 
ATOM   4136  N N   . ALA B  1 131 ? -51.16869 -35.39067  45.95502  1.000 33.18494  ? 111  ALA A N   1 
ATOM   4137  C CA  . ALA B  1 131 ? -51.72704 -36.72114  46.13503  1.000 33.61002  ? 111  ALA A CA  1 
ATOM   4138  C C   . ALA B  1 131 ? -50.65419 -37.77753  45.97358  1.000 35.86784  ? 111  ALA A C   1 
ATOM   4139  O O   . ALA B  1 131 ? -50.58248 -38.73528  46.75408  1.000 36.38167  ? 111  ALA A O   1 
ATOM   4140  C CB  . ALA B  1 131 ? -52.83278 -36.97351  45.12239  1.000 39.10959  ? 111  ALA A CB  1 
ATOM   4141  N N   . ASP B  1 132 ? -49.85827 -37.64570  44.91061  1.000 36.68197  ? 112  ASP A N   1 
ATOM   4142  C CA  . ASP B  1 132 ? -48.80679 -38.60482  44.61856  1.000 39.38057  ? 112  ASP A CA  1 
ATOM   4143  C C   . ASP B  1 132 ? -47.81513 -38.68318  45.75881  1.000 33.25780  ? 112  ASP A C   1 
ATOM   4144  O O   . ASP B  1 132 ? -47.28364 -39.76605  46.03708  1.000 33.02720  ? 112  ASP A O   1 
ATOM   4145  C CB  . ASP B  1 132 ? -48.10137 -38.21104  43.31609  1.000 41.71194  ? 112  ASP A CB  1 
ATOM   4146  C CG  . ASP B  1 132 ? -47.16236 -39.28944  42.79230  1.000 42.23767  ? 112  ASP A CG  1 
ATOM   4147  O OD1 . ASP B  1 132 ? -47.55051 -40.47835  42.72035  1.000 42.38711  ? 112  ASP A OD1 1 
ATOM   4148  O OD2 . ASP B  1 132 ? -46.02586 -38.92680  42.42814  1.000 43.73628  ? 112  ASP A OD2 1 
ATOM   4149  N N   . ALA B  1 133 ? -47.55897 -37.53652  46.40968  1.000 30.66647  ? 113  ALA A N   1 
ATOM   4150  C CA  . ALA B  1 133 ? -46.67196 -37.46030  47.56694  1.000 37.36724  ? 113  ALA A CA  1 
ATOM   4151  C C   . ALA B  1 133 ? -47.04464 -38.47252  48.63766  1.000 33.93840  ? 113  ALA A C   1 
ATOM   4152  O O   . ALA B  1 133 ? -46.16679 -39.00044  49.33101  1.000 38.52169  ? 113  ALA A O   1 
ATOM   4153  C CB  . ALA B  1 133 ? -46.70693 -36.04612  48.15531  1.000 33.24865  ? 113  ALA A CB  1 
ATOM   4154  N N   . VAL B  1 134 ? -48.33738 -38.72361  48.82637  1.000 31.15150  ? 114  VAL A N   1 
ATOM   4155  C CA  . VAL B  1 134 ? -48.77016 -39.75655  49.76997  1.000 30.99409  ? 114  VAL A CA  1 
ATOM   4156  C C   . VAL B  1 134 ? -48.78697 -41.12562  49.10985  1.000 34.61421  ? 114  VAL A C   1 
ATOM   4157  O O   . VAL B  1 134 ? -48.25077 -42.10288  49.64709  1.000 33.85543  ? 114  VAL A O   1 
ATOM   4158  C CB  . VAL B  1 134 ? -50.15369 -39.40030  50.35301  1.000 29.80104  ? 114  VAL A CB  1 
ATOM   4159  C CG1 . VAL B  1 134 ? -50.51177 -40.33560  51.50581  1.000 30.62526  ? 114  VAL A CG1 1 
ATOM   4160  C CG2 . VAL B  1 134 ? -50.18741 -37.92815  50.81577  1.000 28.95134  ? 114  VAL A CG2 1 
ATOM   4161  N N   . TYR B  1 135 ? -49.36913 -41.19091  47.91339  1.000 36.43710  ? 115  TYR A N   1 
ATOM   4162  C CA  . TYR B  1 135 ? -49.55873 -42.46088  47.21956  1.000 34.99540  ? 115  TYR A CA  1 
ATOM   4163  C C   . TYR B  1 135 ? -48.26022 -43.25620  47.14153  1.000 35.19005  ? 115  TYR A C   1 
ATOM   4164  O O   . TYR B  1 135 ? -48.22727 -44.44177  47.47584  1.000 35.47748  ? 115  TYR A O   1 
ATOM   4165  C CB  . TYR B  1 135 ? -50.12845 -42.19344  45.81698  1.000 33.66896  ? 115  TYR A CB  1 
ATOM   4166  C CG  . TYR B  1 135 ? -50.08070 -43.39769  44.90531  1.000 39.49342  ? 115  TYR A CG  1 
ATOM   4167  C CD1 . TYR B  1 135 ? -49.09663 -43.51561  43.92789  1.000 45.20315  ? 115  TYR A CD1 1 
ATOM   4168  C CD2 . TYR B  1 135 ? -51.01089 -44.41931  45.02259  1.000 38.01935  ? 115  TYR A CD2 1 
ATOM   4169  C CE1 . TYR B  1 135 ? -49.03966 -44.62129  43.10003  1.000 47.11475  ? 115  TYR A CE1 1 
ATOM   4170  C CE2 . TYR B  1 135 ? -50.96344 -45.53225  44.19028  1.000 39.77174  ? 115  TYR A CE2 1 
ATOM   4171  C CZ  . TYR B  1 135 ? -49.97417 -45.62759  43.23840  1.000 44.28759  ? 115  TYR A CZ  1 
ATOM   4172  O OH  . TYR B  1 135 ? -49.91971 -46.72485  42.41927  1.000 44.54693  ? 115  TYR A OH  1 
ATOM   4173  N N   A GLN B  1 136 ? -47.17406 -42.60498  46.71944  0.735 34.60635  ? 116  GLN A N   1 
ATOM   4174  N N   B GLN B  1 136 ? -47.16686 -42.60885  46.72581  0.265 35.00656  ? 116  GLN A N   1 
ATOM   4175  C CA  A GLN B  1 136 ? -45.88300 -43.26752  46.59153  0.735 36.22471  ? 116  GLN A CA  1 
ATOM   4176  C CA  B GLN B  1 136 ? -45.89083 -43.30693  46.59136  0.265 37.10251  ? 116  GLN A CA  1 
ATOM   4177  C C   A GLN B  1 136 ? -45.36233 -43.83515  47.90979  0.735 38.60017  ? 116  GLN A C   1 
ATOM   4178  C C   B GLN B  1 136 ? -45.34829 -43.82897  47.91682  0.265 38.33985  ? 116  GLN A C   1 
ATOM   4179  O O   A GLN B  1 136 ? -44.46245 -44.68249  47.88097  0.735 41.53381  ? 116  GLN A O   1 
ATOM   4180  O O   B GLN B  1 136 ? -44.39506 -44.61569  47.90466  0.265 40.76791  ? 116  GLN A O   1 
ATOM   4181  C CB  A GLN B  1 136 ? -44.87461 -42.28728  45.99275  0.735 38.36360  ? 116  GLN A CB  1 
ATOM   4182  C CB  B GLN B  1 136 ? -44.84881 -42.39283  45.94258  0.265 38.30532  ? 116  GLN A CB  1 
ATOM   4183  C CG  A GLN B  1 136 ? -45.19537 -41.87379  44.53632  0.735 39.62726  ? 116  GLN A CG  1 
ATOM   4184  C CG  B GLN B  1 136 ? -44.12246 -43.03516  44.75832  0.265 41.50118  ? 116  GLN A CG  1 
ATOM   4185  C CD  A GLN B  1 136 ? -45.21096 -43.05272  43.57841  0.735 42.41765  ? 116  GLN A CD  1 
ATOM   4186  C CD  B GLN B  1 136 ? -42.81412 -42.34398  44.41208  0.265 42.18277  ? 116  GLN A CD  1 
ATOM   4187  O OE1 A GLN B  1 136 ? -44.60328 -44.09017  43.84528  0.735 43.60541  ? 116  GLN A OE1 1 
ATOM   4188  O OE1 B GLN B  1 136 ? -41.74692 -42.95949  44.42925  0.265 42.63497  ? 116  GLN A OE1 1 
ATOM   4189  N NE2 A GLN B  1 136 ? -45.90927 -42.89904  42.45023  0.735 41.60347  ? 116  GLN A NE2 1 
ATOM   4190  N NE2 B GLN B  1 136 ? -42.89337 -41.05996  44.08733  0.265 41.80619  ? 116  GLN A NE2 1 
ATOM   4191  N N   . ASN B  1 137 ? -45.93011 -43.42726  49.04826  1.000 35.88398  ? 117  ASN A N   1 
ATOM   4192  C CA  . ASN B  1 137 ? -45.45086 -43.83706  50.36405  1.000 36.10229  ? 117  ASN A CA  1 
ATOM   4193  C C   . ASN B  1 137 ? -46.48262 -44.66291  51.12749  1.000 37.27196  ? 117  ASN A C   1 
ATOM   4194  O O   . ASN B  1 137 ? -46.38422 -44.79545  52.35168  1.000 31.55454  ? 117  ASN A O   1 
ATOM   4195  C CB  . ASN B  1 137 ? -45.02127 -42.60371  51.15264  1.000 31.50289  ? 117  ASN A CB  1 
ATOM   4196  C CG  . ASN B  1 137 ? -43.81679 -41.92008  50.52204  1.000 39.64314  ? 117  ASN A CG  1 
ATOM   4197  O OD1 . ASN B  1 137 ? -42.75048 -42.51758  50.40840  1.000 38.45038  ? 117  ASN A OD1 1 
ATOM   4198  N ND2 . ASN B  1 137 ? -43.97939 -40.66883  50.10698  1.000 38.69327  ? 117  ASN A ND2 1 
ATOM   4199  N N   . ILE B  1 138 ? -47.44440 -45.26750  50.41553  1.000 36.62714  ? 118  ILE A N   1 
ATOM   4200  C CA  . ILE B  1 138 ? -48.40584 -46.17446  51.04983  1.000 38.08456  ? 118  ILE A CA  1 
ATOM   4201  C C   . ILE B  1 138 ? -47.69245 -47.32237  51.76417  1.000 40.23215  ? 118  ILE A C   1 
ATOM   4202  O O   . ILE B  1 138 ? -48.13707 -47.77898  52.82655  1.000 39.91620  ? 118  ILE A O   1 
ATOM   4203  C CB  . ILE B  1 138 ? -49.41342 -46.69424  49.99770  1.000 42.59205  ? 118  ILE A CB  1 
ATOM   4204  C CG1 . ILE B  1 138 ? -50.26680 -45.53765  49.46306  1.000 41.22578  ? 118  ILE A CG1 1 
ATOM   4205  C CG2 . ILE B  1 138 ? -50.31876 -47.75184  50.59620  1.000 40.91792  ? 118  ILE A CG2 1 
ATOM   4206  C CD1 . ILE B  1 138 ? -51.14867 -45.91338  48.26480  1.000 42.25867  ? 118  ILE A CD1 1 
ATOM   4207  N N   . ASP B  1 139 ? -46.56306 -47.78441  51.22253  1.000 41.41840  ? 119  ASP A N   1 
ATOM   4208  C CA  . ASP B  1 139 ? -45.83655 -48.87445  51.85797  1.000 42.39919  ? 119  ASP A CA  1 
ATOM   4209  C C   . ASP B  1 139 ? -45.16733 -48.45099  53.15481  1.000 39.72966  ? 119  ASP A C   1 
ATOM   4210  O O   . ASP B  1 139 ? -44.74360 -49.32312  53.91902  1.000 43.14229  ? 119  ASP A O   1 
ATOM   4211  C CB  . ASP B  1 139 ? -44.79264 -49.46095  50.91031  1.000 48.92063  ? 119  ASP A CB  1 
ATOM   4212  C CG  . ASP B  1 139 ? -43.82253 -48.41810  50.36819  1.000 54.02038  ? 119  ASP A CG  1 
ATOM   4213  O OD1 . ASP B  1 139 ? -43.95897 -47.22159  50.69817  1.000 53.88970  ? 119  ASP A OD1 1 
ATOM   4214  O OD2 . ASP B  1 139 ? -42.92160 -48.80440  49.58736  1.000 57.96593  ? 119  ASP A OD2 1 
ATOM   4215  N N   . ILE B  1 140 ? -45.03748 -47.14599  53.40679  1.000 37.35988  ? 120  ILE A N   1 
ATOM   4216  C CA  . ILE B  1 140 ? -44.59968 -46.68611  54.72141  1.000 38.82438  ? 120  ILE A CA  1 
ATOM   4217  C C   . ILE B  1 140 ? -45.77264 -46.66496  55.68692  1.000 37.77033  ? 120  ILE A C   1 
ATOM   4218  O O   . ILE B  1 140 ? -45.61360 -46.93854  56.88475  1.000 40.60350  ? 120  ILE A O   1 
ATOM   4219  C CB  . ILE B  1 140 ? -43.92996 -45.29764  54.64056  1.000 38.67239  ? 120  ILE A CB  1 
ATOM   4220  C CG1 . ILE B  1 140 ? -42.78739 -45.27605  53.63211  1.000 43.70579  ? 120  ILE A CG1 1 
ATOM   4221  C CG2 . ILE B  1 140 ? -43.40415 -44.85948  56.02849  1.000 35.77442  ? 120  ILE A CG2 1 
ATOM   4222  C CD1 . ILE B  1 140 ? -41.45610 -45.67387  54.21705  1.000 48.44518  ? 120  ILE A CD1 1 
ATOM   4223  N N   . ILE B  1 141 ? -46.95974 -46.32418  55.19136  1.000 33.09313  ? 121  ILE A N   1 
ATOM   4224  C CA  . ILE B  1 141 ? -48.09750 -46.09551  56.07416  1.000 32.44634  ? 121  ILE A CA  1 
ATOM   4225  C C   . ILE B  1 141 ? -48.69645 -47.40970  56.53947  1.000 36.11901  ? 121  ILE A C   1 
ATOM   4226  O O   . ILE B  1 141 ? -48.97851 -47.59556  57.72910  1.000 33.09184  ? 121  ILE A O   1 
ATOM   4227  C CB  . ILE B  1 141 ? -49.15981 -45.23632  55.37514  1.000 34.15128  ? 121  ILE A CB  1 
ATOM   4228  C CG1 . ILE B  1 141 ? -48.59856 -43.84823  55.06546  1.000 36.66614  ? 121  ILE A CG1 1 
ATOM   4229  C CG2 . ILE B  1 141 ? -50.39216 -45.15832  56.24631  1.000 34.65580  ? 121  ILE A CG2 1 
ATOM   4230  C CD1 . ILE B  1 141 ? -49.40448 -43.05763  54.01364  1.000 38.81871  ? 121  ILE A CD1 1 
ATOM   4231  N N   . GLU B  1 142 ? -48.92177 -48.32772  55.60370  1.000 41.32673  ? 122  GLU A N   1 
ATOM   4232  C CA  . GLU B  1 142 ? -49.67504 -49.53458  55.92511  1.000 41.37279  ? 122  GLU A CA  1 
ATOM   4233  C C   . GLU B  1 142 ? -49.07810 -50.34705  57.06663  1.000 40.09363  ? 122  GLU A C   1 
ATOM   4234  O O   . GLU B  1 142 ? -49.86154 -50.82239  57.90400  1.000 40.57323  ? 122  GLU A O   1 
ATOM   4235  C CB  . GLU B  1 142 ? -49.84092 -50.37529  54.65670  1.000 46.63179  ? 122  GLU A CB  1 
ATOM   4236  C CG  . GLU B  1 142 ? -50.78636 -49.73827  53.65329  1.000 49.75106  ? 122  GLU A CG  1 
ATOM   4237  C CD  . GLU B  1 142 ? -51.00706 -50.61317  52.42315  1.000 55.00900  ? 122  GLU A CD  1 
ATOM   4238  O OE1 . GLU B  1 142 ? -51.98779 -50.34961  51.68982  1.000 57.29924  ? 122  GLU A OE1 1 
ATOM   4239  O OE2 . GLU B  1 142 ? -50.19862 -51.55254  52.19216  1.000 53.56723  ? 122  GLU A OE2 1 
ATOM   4240  N N   . PRO B  1 143 ? -47.74768 -50.53067  57.19107  1.000 42.70494  ? 123  PRO A N   1 
ATOM   4241  C CA  . PRO B  1 143 ? -47.22354 -51.24577  58.37077  1.000 41.73524  ? 123  PRO A CA  1 
ATOM   4242  C C   . PRO B  1 143 ? -47.66099 -50.65019  59.68701  1.000 41.96793  ? 123  PRO A C   1 
ATOM   4243  O O   . PRO B  1 143 ? -47.86510 -51.38562  60.65966  1.000 42.44042  ? 123  PRO A O   1 
ATOM   4244  C CB  . PRO B  1 143 ? -45.70058 -51.14606  58.19692  1.000 44.67371  ? 123  PRO A CB  1 
ATOM   4245  C CG  . PRO B  1 143 ? -45.51857 -51.09713  56.72046  1.000 49.36316  ? 123  PRO A CG  1 
ATOM   4246  C CD  . PRO B  1 143 ? -46.68799 -50.29733  56.19233  1.000 48.05631  ? 123  PRO A CD  1 
ATOM   4247  N N   . TYR B  1 144 ? -47.78504 -49.32434  59.75419  1.000 38.25659  ? 124  TYR A N   1 
ATOM   4248  C CA  . TYR B  1 144 ? -48.26914 -48.69299  60.97543  1.000 35.77711  ? 124  TYR A CA  1 
ATOM   4249  C C   . TYR B  1 144 ? -49.77278 -48.89615  61.13853  1.000 34.86955  ? 124  TYR A C   1 
ATOM   4250  O O   . TYR B  1 144 ? -50.29044 -48.86346  62.26610  1.000 31.30253  ? 124  TYR A O   1 
ATOM   4251  C CB  . TYR B  1 144 ? -47.95635 -47.19358  60.95260  1.000 29.48326  ? 124  TYR A CB  1 
ATOM   4252  C CG  . TYR B  1 144 ? -46.50080 -46.81232  60.83301  1.000 30.13956  ? 124  TYR A CG  1 
ATOM   4253  C CD1 . TYR B  1 144 ? -45.50766 -47.48498  61.53714  1.000 31.02740  ? 124  TYR A CD1 1 
ATOM   4254  C CD2 . TYR B  1 144 ? -46.12144 -45.72189  60.03344  1.000 34.12790  ? 124  TYR A CD2 1 
ATOM   4255  C CE1 . TYR B  1 144 ? -44.16844 -47.08933  61.43174  1.000 34.17082  ? 124  TYR A CE1 1 
ATOM   4256  C CE2 . TYR B  1 144 ? -44.80036 -45.33072  59.92476  1.000 28.50545  ? 124  TYR A CE2 1 
ATOM   4257  C CZ  . TYR B  1 144 ? -43.83349 -46.00363  60.61535  1.000 32.98362  ? 124  TYR A CZ  1 
ATOM   4258  O OH  . TYR B  1 144 ? -42.52755 -45.58854  60.48961  1.000 30.22349  ? 124  TYR A OH  1 
ATOM   4259  N N   . ALA B  1 145 ? -50.48137 -49.05751  60.02798  1.000 34.61119  ? 125  ALA A N   1 
ATOM   4260  C CA  . ALA B  1 145 ? -51.92787 -49.24656  60.02174  1.000 37.08488  ? 125  ALA A CA  1 
ATOM   4261  C C   . ALA B  1 145 ? -52.66140 -48.24004  60.91456  1.000 35.05935  ? 125  ALA A C   1 
ATOM   4262  O O   . ALA B  1 145 ? -53.41062 -48.63398  61.81369  1.000 32.39660  ? 125  ALA A O   1 
ATOM   4263  C CB  . ALA B  1 145 ? -52.26180 -50.67205  60.44131  1.000 38.74682  ? 125  ALA A CB  1 
ATOM   4264  N N   . PRO B  1 146 ? -52.45454 -46.93481  60.71483  1.000 31.39906  ? 126  PRO A N   1 
ATOM   4265  C CA  . PRO B  1 146 ? -53.22196 -45.96568  61.49925  1.000 27.99927  ? 126  PRO A CA  1 
ATOM   4266  C C   . PRO B  1 146 ? -54.67988 -46.01402  61.08151  1.000 24.84534  ? 126  PRO A C   1 
ATOM   4267  O O   . PRO B  1 146 ? -54.99737 -46.27130  59.92063  1.000 25.31998  ? 126  PRO A O   1 
ATOM   4268  C CB  . PRO B  1 146 ? -52.58005 -44.62335  61.13368  1.000 26.37632  ? 126  PRO A CB  1 
ATOM   4269  C CG  . PRO B  1 146 ? -52.09556 -44.82350  59.73512  1.000 28.67202  ? 126  PRO A CG  1 
ATOM   4270  C CD  . PRO B  1 146 ? -51.67916 -46.27692  59.64394  1.000 31.79373  ? 126  PRO A CD  1 
ATOM   4271  N N   . GLU B  1 147 ? -55.56912 -45.75500  62.04119  1.000 31.87454  ? 127  GLU A N   1 
ATOM   4272  C CA  . GLU B  1 147 ? -56.98663 -45.65136  61.70610  1.000 34.11373  ? 127  GLU A CA  1 
ATOM   4273  C C   . GLU B  1 147 ? -57.28902 -44.39507  60.88716  1.000 33.90089  ? 127  GLU A C   1 
ATOM   4274  O O   . GLU B  1 147 ? -58.11046 -44.44006  59.96525  1.000 32.82731  ? 127  GLU A O   1 
ATOM   4275  C CB  . GLU B  1 147 ? -57.83100 -45.66977  62.97483  1.000 36.99424  ? 127  GLU A CB  1 
ATOM   4276  C CG  . GLU B  1 147 ? -59.32550 -45.92382  62.72481  1.000 43.06987  ? 127  GLU A CG  1 
ATOM   4277  C CD  . GLU B  1 147 ? -59.64800 -47.29918  62.10196  1.000 48.27131  ? 127  GLU A CD  1 
ATOM   4278  O OE1 . GLU B  1 147 ? -58.77599 -48.19931  62.06451  1.000 50.55132  ? 127  GLU A OE1 1 
ATOM   4279  O OE2 . GLU B  1 147 ? -60.80226 -47.48221  61.66420  1.000 49.69752  ? 127  GLU A OE2 1 
ATOM   4280  N N   . TYR B  1 148 ? -56.65426 -43.26145  61.21013  1.000 34.07902  ? 128  TYR A N   1 
ATOM   4281  C CA  . TYR B  1 148 ? -56.94326 -41.98017  60.54375  1.000 31.10316  ? 128  TYR A CA  1 
ATOM   4282  C C   . TYR B  1 148 ? -55.66816 -41.36009  59.98102  1.000 28.79970  ? 128  TYR A C   1 
ATOM   4283  O O   . TYR B  1 148 ? -54.56906 -41.55497  60.52296  1.000 28.81165  ? 128  TYR A O   1 
ATOM   4284  C CB  . TYR B  1 148 ? -57.60646 -40.96647  61.51080  1.000 26.26205  ? 128  TYR A CB  1 
ATOM   4285  C CG  . TYR B  1 148 ? -58.61460 -41.62333  62.41131  1.000 27.49868  ? 128  TYR A CG  1 
ATOM   4286  C CD1 . TYR B  1 148 ? -59.87035 -41.98502  61.91503  1.000 30.52810  ? 128  TYR A CD1 1 
ATOM   4287  C CD2 . TYR B  1 148 ? -58.31556 -41.91359  63.73617  1.000 32.31867  ? 128  TYR A CD2 1 
ATOM   4288  C CE1 . TYR B  1 148 ? -60.79892 -42.61239  62.70795  1.000 34.26637  ? 128  TYR A CE1 1 
ATOM   4289  C CE2 . TYR B  1 148 ? -59.24441 -42.54782  64.54893  1.000 37.56901  ? 128  TYR A CE2 1 
ATOM   4290  C CZ  . TYR B  1 148 ? -60.48935 -42.89163  64.01652  1.000 38.91427  ? 128  TYR A CZ  1 
ATOM   4291  O OH  . TYR B  1 148 ? -61.42431 -43.51695  64.79828  1.000 41.88838  ? 128  TYR A OH  1 
ATOM   4292  N N   . MET B  1 149 ? -55.83021 -40.59785  58.90556  1.000 26.81917  ? 129  MET A N   1 
ATOM   4293  C CA  . MET B  1 149 ? -54.76586 -39.81205  58.29705  1.000 26.69865  ? 129  MET A CA  1 
ATOM   4294  C C   . MET B  1 149 ? -55.13978 -38.34518  58.41761  1.000 28.02544  ? 129  MET A C   1 
ATOM   4295  O O   . MET B  1 149 ? -56.25546 -37.96059  58.05666  1.000 26.41160  ? 129  MET A O   1 
ATOM   4296  C CB  . MET B  1 149 ? -54.54827 -40.17897  56.82116  1.000 27.69775  ? 129  MET A CB  1 
ATOM   4297  C CG  . MET B  1 149 ? -54.07354 -41.63690  56.60451  1.000 31.13661  ? 129  MET A CG  1 
ATOM   4298  S SD  . MET B  1 149 ? -52.38627 -41.94024  57.19957  1.000 32.42650  ? 129  MET A SD  1 
ATOM   4299  C CE  . MET B  1 149 ? -51.49495 -40.58717  56.42282  1.000 35.90812  ? 129  MET A CE  1 
ATOM   4300  N N   . VAL B  1 150 ? -54.22876 -37.53684  58.95402  1.000 26.05241  ? 130  VAL A N   1 
ATOM   4301  C CA  . VAL B  1 150 ? -54.39791 -36.08344  59.02212  1.000 20.88003  ? 130  VAL A CA  1 
ATOM   4302  C C   . VAL B  1 150 ? -53.40338 -35.50982  58.02571  1.000 20.87973  ? 130  VAL A C   1 
ATOM   4303  O O   . VAL B  1 150 ? -52.18826 -35.49965  58.27990  1.000 22.57221  ? 130  VAL A O   1 
ATOM   4304  C CB  . VAL B  1 150 ? -54.16088 -35.52746  60.43615  1.000 23.22378  ? 130  VAL A CB  1 
ATOM   4305  C CG1 . VAL B  1 150 ? -54.44259 -34.02034  60.45469  1.000 19.21998  ? 130  VAL A CG1 1 
ATOM   4306  C CG2 . VAL B  1 150 ? -55.03419 -36.23457  61.42989  1.000 21.44168  ? 130  VAL A CG2 1 
ATOM   4307  N N   . ILE B  1 151 ? -53.89579 -35.05530  56.88638  1.000 20.67411  ? 131  ILE A N   1 
ATOM   4308  C CA  . ILE B  1 151 ? -53.06181 -34.47450  55.84948  1.000 21.81173  ? 131  ILE A CA  1 
ATOM   4309  C C   . ILE B  1 151 ? -52.95020 -32.97703  56.11220  1.000 24.45193  ? 131  ILE A C   1 
ATOM   4310  O O   . ILE B  1 151 ? -53.97164 -32.28844  56.23027  1.000 23.35946  ? 131  ILE A O   1 
ATOM   4311  C CB  . ILE B  1 151 ? -53.64777 -34.74300  54.45784  1.000 24.91086  ? 131  ILE A CB  1 
ATOM   4312  C CG1 . ILE B  1 151 ? -53.93979 -36.23684  54.28050  1.000 27.24283  ? 131  ILE A CG1 1 
ATOM   4313  C CG2 . ILE B  1 151 ? -52.72976 -34.13146  53.34054  1.000 22.48741  ? 131  ILE A CG2 1 
ATOM   4314  C CD1 . ILE B  1 151 ? -52.72207 -37.13526  54.31549  1.000 25.29005  ? 131  ILE A CD1 1 
ATOM   4315  N N   . LEU B  1 152 ? -51.72111 -32.46514  56.17445  1.000 21.62994  ? 132  LEU A N   1 
ATOM   4316  C CA  . LEU B  1 152 ? -51.46658 -31.07761  56.56351  1.000 17.23612  ? 132  LEU A CA  1 
ATOM   4317  C C   . LEU B  1 152 ? -50.60260 -30.35875  55.55005  1.000 21.35527  ? 132  LEU A C   1 
ATOM   4318  O O   . LEU B  1 152 ? -49.65448 -30.94069  55.01784  1.000 24.42959  ? 132  LEU A O   1 
ATOM   4319  C CB  . LEU B  1 152 ? -50.75534 -31.03854  57.91424  1.000 16.68339  ? 132  LEU A CB  1 
ATOM   4320  C CG  . LEU B  1 152 ? -51.41981 -31.75418  59.07109  1.000 20.92827  ? 132  LEU A CG  1 
ATOM   4321  C CD1 . LEU B  1 152 ? -50.44658 -31.79915  60.34031  1.000 16.23478  ? 132  LEU A CD1 1 
ATOM   4322  C CD2 . LEU B  1 152 ? -52.71540 -31.02981  59.35424  1.000 20.92176  ? 132  LEU A CD2 1 
ATOM   4323  N N   . ALA B  1 153 ? -50.90797 -29.08321  55.28174  1.000 21.25552  ? 133  ALA A N   1 
ATOM   4324  C CA  . ALA B  1 153 ? -49.96690 -28.25416  54.53597  1.000 22.72689  ? 133  ALA A CA  1 
ATOM   4325  C C   . ALA B  1 153 ? -48.84733 -27.81700  55.47426  1.000 22.74798  ? 133  ALA A C   1 
ATOM   4326  O O   . ALA B  1 153 ? -49.10352 -27.35880  56.59494  1.000 23.37735  ? 133  ALA A O   1 
ATOM   4327  C CB  . ALA B  1 153 ? -50.65241 -27.03786  53.91670  1.000 21.75651  ? 133  ALA A CB  1 
ATOM   4328  N N   . GLY B  1 154 ? -47.60782 -27.98012  55.02960  1.000 20.88820  ? 134  GLY A N   1 
ATOM   4329  C CA  . GLY B  1 154 ? -46.48825 -27.63032  55.88798  1.000 25.55768  ? 134  GLY A CA  1 
ATOM   4330  C C   . GLY B  1 154 ? -45.90819 -26.24609  55.65838  1.000 22.19464  ? 134  GLY A C   1 
ATOM   4331  O O   . GLY B  1 154 ? -44.77393 -25.97817  56.08641  1.000 21.52744  ? 134  GLY A O   1 
ATOM   4332  N N   . ASP B  1 155 ? -46.65589 -25.35648  55.00653  1.000 16.69163  ? 135  ASP A N   1 
ATOM   4333  C CA  . ASP B  1 155 ? -46.12919 -24.01882  54.72132  1.000 18.67150  ? 135  ASP A CA  1 
ATOM   4334  C C   . ASP B  1 155 ? -46.96244 -22.87621  55.32020  1.000 19.42787  ? 135  ASP A C   1 
ATOM   4335  O O   . ASP B  1 155 ? -46.89822 -21.74695  54.81720  1.000 21.26360  ? 135  ASP A O   1 
ATOM   4336  C CB  . ASP B  1 155 ? -45.98175 -23.81924  53.21342  1.000 22.01864  ? 135  ASP A CB  1 
ATOM   4337  C CG  . ASP B  1 155 ? -47.31425 -23.74521  52.51003  1.000 25.97649  ? 135  ASP A CG  1 
ATOM   4338  O OD1 . ASP B  1 155 ? -48.20801 -24.58339  52.79960  1.000 27.38183  ? 135  ASP A OD1 1 
ATOM   4339  O OD2 . ASP B  1 155 ? -47.47004 -22.84383  51.66002  1.000 24.45575  ? 135  ASP A OD2 1 
ATOM   4340  N N   . HIS B  1 156 ? -47.71654 -23.11574  56.38393  1.000 16.90584  ? 136  HIS A N   1 
ATOM   4341  C CA  . HIS B  1 156 ? -48.51016 -22.07719  57.03799  1.000 18.10032  ? 136  HIS A CA  1 
ATOM   4342  C C   . HIS B  1 156 ? -48.16125 -21.96709  58.51947  1.000 16.92557  ? 136  HIS A C   1 
ATOM   4343  O O   . HIS B  1 156 ? -47.78278 -22.95865  59.16032  1.000 15.95696  ? 136  HIS A O   1 
ATOM   4344  C CB  . HIS B  1 156 ? -50.01928 -22.37497  56.97060  1.000 20.99565  ? 136  HIS A CB  1 
ATOM   4345  C CG  . HIS B  1 156 ? -50.54657 -22.58595  55.59543  1.000 21.71574  ? 136  HIS A CG  1 
ATOM   4346  N ND1 . HIS B  1 156 ? -51.72224 -23.26253  55.35940  1.000 20.62452  ? 136  HIS A ND1 1 
ATOM   4347  C CD2 . HIS B  1 156 ? -50.08171 -22.19127  54.38769  1.000 21.53494  ? 136  HIS A CD2 1 
ATOM   4348  C CE1 . HIS B  1 156 ? -51.94896 -23.29198  54.05879  1.000 23.39230  ? 136  HIS A CE1 1 
ATOM   4349  N NE2 . HIS B  1 156 ? -50.96962 -22.64538  53.45044  1.000 23.36014  ? 136  HIS A NE2 1 
ATOM   4350  N N   . ILE B  1 157 ? -48.37845 -20.78231  59.08387  1.000 13.02512  ? 137  ILE A N   1 
ATOM   4351  C CA  . ILE B  1 157 ? -48.14195 -20.52407  60.51045  1.000 16.71122  ? 137  ILE A CA  1 
ATOM   4352  C C   . ILE B  1 157 ? -49.49263 -20.41945  61.21237  1.000 17.00695  ? 137  ILE A C   1 
ATOM   4353  O O   . ILE B  1 157 ? -50.27427 -19.49528  60.95364  1.000 19.23161  ? 137  ILE A O   1 
ATOM   4354  C CB  . ILE B  1 157 ? -47.32005 -19.24976  60.71722  1.000 13.19855  ? 137  ILE A CB  1 
ATOM   4355  C CG1 . ILE B  1 157 ? -45.99467 -19.36690  59.94397  1.000 16.98156  ? 137  ILE A CG1 1 
ATOM   4356  C CG2 . ILE B  1 157 ? -47.02949 -19.02629  62.20758  1.000 11.98398  ? 137  ILE A CG2 1 
ATOM   4357  C CD1 . ILE B  1 157 ? -45.54777 -18.04441  59.30697  1.000 20.88034  ? 137  ILE A CD1 1 
ATOM   4358  N N   . TYR B  1 158 ? -49.76853 -21.35793  62.10975  1.000 15.35471  ? 138  TYR A N   1 
ATOM   4359  C CA  . TYR B  1 158 ? -51.04190 -21.40281  62.82655  1.000 12.29064  ? 138  TYR A CA  1 
ATOM   4360  C C   . TYR B  1 158 ? -50.91334 -22.46219  63.91857  1.000 14.85639  ? 138  TYR A C   1 
ATOM   4361  O O   . TYR B  1 158 ? -50.03201 -23.33014  63.85733  1.000 15.21358  ? 138  TYR A O   1 
ATOM   4362  C CB  . TYR B  1 158 ? -52.21621 -21.75142  61.87947  1.000 12.61109  ? 138  TYR A CB  1 
ATOM   4363  C CG  . TYR B  1 158 ? -52.19217 -23.19272  61.45794  1.000 13.39917  ? 138  TYR A CG  1 
ATOM   4364  C CD1 . TYR B  1 158 ? -51.29174 -23.62023  60.48868  1.000 14.18690  ? 138  TYR A CD1 1 
ATOM   4365  C CD2 . TYR B  1 158 ? -53.06160 -24.13518  62.00832  1.000 13.18581  ? 138  TYR A CD2 1 
ATOM   4366  C CE1 . TYR B  1 158 ? -51.22901 -24.94571  60.09288  1.000 15.40565  ? 138  TYR A CE1 1 
ATOM   4367  C CE2 . TYR B  1 158 ? -53.01946 -25.48378  61.59443  1.000 17.14924  ? 138  TYR A CE2 1 
ATOM   4368  C CZ  . TYR B  1 158 ? -52.10101 -25.86303  60.63267  1.000 15.40000  ? 138  TYR A CZ  1 
ATOM   4369  O OH  . TYR B  1 158 ? -51.98657 -27.16138  60.21294  1.000 18.31587  ? 138  TYR A OH  1 
ATOM   4370  N N   . LYS B  1 159 ? -51.84273 -22.42698  64.87934  1.000 13.17577  ? 139  LYS A N   1 
ATOM   4371  C CA  . LYS B  1 159 ? -51.90196 -23.39145  65.97013  1.000 12.74526  ? 139  LYS A CA  1 
ATOM   4372  C C   . LYS B  1 159 ? -53.31327 -23.97932  66.04174  1.000 14.14769  ? 139  LYS A C   1 
ATOM   4373  O O   . LYS B  1 159 ? -54.30186 -23.23302  66.02324  1.000 16.51831  ? 139  LYS A O   1 
ATOM   4374  C CB  . LYS B  1 159 ? -51.51859 -22.72258  67.29255  1.000 15.67399  ? 139  LYS A CB  1 
ATOM   4375  C CG  . LYS B  1 159 ? -50.01165 -22.40548  67.40273  1.000 12.81873  ? 139  LYS A CG  1 
ATOM   4376  C CD  . LYS B  1 159 ? -49.69179 -21.58177  68.66985  1.000 17.76374  ? 139  LYS A CD  1 
ATOM   4377  C CE  . LYS B  1 159 ? -50.39354 -20.24806  68.69026  1.000 22.79974  ? 139  LYS A CE  1 
ATOM   4378  N NZ  . LYS B  1 159 ? -49.73133 -19.37352  69.74369  1.000 23.17854  ? 139  LYS A NZ  1 
ATOM   4379  N N   . MET B  1 160 ? -53.41043 -25.31026  66.10498  1.000 13.45063  ? 140  MET A N   1 
ATOM   4380  C CA  . MET B  1 160 ? -54.68062 -25.99873  65.93700  1.000 15.09626  ? 140  MET A CA  1 
ATOM   4381  C C   . MET B  1 160 ? -54.62585 -27.31765  66.66652  1.000 15.84741  ? 140  MET A C   1 
ATOM   4382  O O   . MET B  1 160 ? -53.63770 -28.03650  66.52745  1.000 16.61113  ? 140  MET A O   1 
ATOM   4383  C CB  . MET B  1 160 ? -54.93968 -26.30405  64.44943  1.000 15.08644  ? 140  MET A CB  1 
ATOM   4384  C CG  . MET B  1 160 ? -56.43644 -26.45549  64.09320  1.000 20.00950  ? 140  MET A CG  1 
ATOM   4385  S SD  . MET B  1 160 ? -56.68145 -26.59422  62.39405  1.000 21.39766  ? 140  MET A SD  1 
ATOM   4386  C CE  . MET B  1 160 ? -58.16635 -27.57608  62.29986  1.000 22.49139  ? 140  MET A CE  1 
ATOM   4387  N N   . ASP B  1 161 ? -55.72987 -27.69144  67.33074  1.000 18.24690  ? 141  ASP A N   1 
ATOM   4388  C CA  . ASP B  1 161 ? -55.81904 -28.95972  68.06719  1.000 21.37998  ? 141  ASP A CA  1 
ATOM   4389  C C   . ASP B  1 161 ? -56.57897 -29.92815  67.16220  1.000 23.15896  ? 141  ASP A C   1 
ATOM   4390  O O   . ASP B  1 161 ? -57.80865 -29.88140  67.07973  1.000 22.06182  ? 141  ASP A O   1 
ATOM   4391  C CB  . ASP B  1 161 ? -56.49406 -28.70792  69.41925  1.000 17.25528  ? 141  ASP A CB  1 
ATOM   4392  C CG  . ASP B  1 161 ? -56.61381 -29.94785  70.27163  1.000 18.28098  ? 141  ASP A CG  1 
ATOM   4393  O OD1 . ASP B  1 161 ? -56.38603 -31.07336  69.77921  1.000 17.38289  ? 141  ASP A OD1 1 
ATOM   4394  O OD2 . ASP B  1 161 ? -56.95236 -29.79915  71.46142  1.000 21.43845  ? 141  ASP A OD2 1 
ATOM   4395  N N   . TYR B  1 162 ? -55.84777 -30.80165  66.45633  1.000 18.74618  ? 142  TYR A N   1 
ATOM   4396  C CA  . TYR B  1 162 ? -56.51554 -31.66499  65.48018  1.000 21.09754  ? 142  TYR A CA  1 
ATOM   4397  C C   . TYR B  1 162 ? -57.43502 -32.69215  66.12580  1.000 20.42965  ? 142  TYR A C   1 
ATOM   4398  O O   . TYR B  1 162 ? -58.16451 -33.36232  65.39700  1.000 20.31953  ? 142  TYR A O   1 
ATOM   4399  C CB  . TYR B  1 162 ? -55.51666 -32.41573  64.59356  1.000 19.20822  ? 142  TYR A CB  1 
ATOM   4400  C CG  . TYR B  1 162 ? -54.47755 -31.52258  63.92710  1.000 18.80419  ? 142  TYR A CG  1 
ATOM   4401  C CD1 . TYR B  1 162 ? -54.86970 -30.46061  63.13377  1.000 19.01645  ? 142  TYR A CD1 1 
ATOM   4402  C CD2 . TYR B  1 162 ? -53.11622 -31.74333  64.12643  1.000 18.22258  ? 142  TYR A CD2 1 
ATOM   4403  C CE1 . TYR B  1 162 ? -53.94953 -29.63688  62.53947  1.000 18.66437  ? 142  TYR A CE1 1 
ATOM   4404  C CE2 . TYR B  1 162 ? -52.17140 -30.90696  63.53496  1.000 17.87131  ? 142  TYR A CE2 1 
ATOM   4405  C CZ  . TYR B  1 162 ? -52.61418 -29.86812  62.71716  1.000 18.10706  ? 142  TYR A CZ  1 
ATOM   4406  O OH  . TYR B  1 162 ? -51.74592 -29.01436  62.12292  1.000 17.79284  ? 142  TYR A OH  1 
ATOM   4407  N N   . GLU B  1 163 ? -57.43410 -32.83406  67.45173  1.000 19.46396  ? 143  GLU A N   1 
ATOM   4408  C CA  . GLU B  1 163 ? -58.38309 -33.78264  68.03721  1.000 26.07969  ? 143  GLU A CA  1 
ATOM   4409  C C   . GLU B  1 163 ? -59.81530 -33.38627  67.70610  1.000 24.50046  ? 143  GLU A C   1 
ATOM   4410  O O   . GLU B  1 163 ? -60.67315 -34.25458  67.55231  1.000 22.75817  ? 143  GLU A O   1 
ATOM   4411  C CB  . GLU B  1 163 ? -58.18356 -33.89402  69.55721  1.000 24.84004  ? 143  GLU A CB  1 
ATOM   4412  C CG  . GLU B  1 163 ? -59.10661 -34.91893  70.25613  1.000 29.93617  ? 143  GLU A CG  1 
ATOM   4413  C CD  . GLU B  1 163 ? -58.76106 -36.37156  69.96042  1.000 30.16866  ? 143  GLU A CD  1 
ATOM   4414  O OE1 . GLU B  1 163 ? -59.68944 -37.21681  69.93638  1.000 27.38960  ? 143  GLU A OE1 1 
ATOM   4415  O OE2 . GLU B  1 163 ? -57.56784 -36.67926  69.76910  1.000 28.32662  ? 143  GLU A OE2 1 
ATOM   4416  N N   . TYR B  1 164 ? -60.09063 -32.08621  67.54654  1.000 24.15472  ? 144  TYR A N   1 
ATOM   4417  C CA  . TYR B  1 164 ? -61.46038 -31.67213  67.23203  1.000 23.87685  ? 144  TYR A CA  1 
ATOM   4418  C C   . TYR B  1 164 ? -61.86736 -32.12550  65.84345  1.000 27.24932  ? 144  TYR A C   1 
ATOM   4419  O O   . TYR B  1 164 ? -62.99290 -32.61707  65.63001  1.000 27.29510  ? 144  TYR A O   1 
ATOM   4420  C CB  . TYR B  1 164 ? -61.59135 -30.16390  67.33588  1.000 25.25306  ? 144  TYR A CB  1 
ATOM   4421  C CG  . TYR B  1 164 ? -61.55000 -29.62398  68.72238  1.000 29.23364  ? 144  TYR A CG  1 
ATOM   4422  C CD1 . TYR B  1 164 ? -60.33818 -29.48566  69.40505  1.000 33.95235  ? 144  TYR A CD1 1 
ATOM   4423  C CD2 . TYR B  1 164 ? -62.71508 -29.21879  69.35523  1.000 34.74584  ? 144  TYR A CD2 1 
ATOM   4424  C CE1 . TYR B  1 164 ? -60.29137 -28.97204  70.68094  1.000 37.04480  ? 144  TYR A CE1 1 
ATOM   4425  C CE2 . TYR B  1 164 ? -62.68209 -28.69312  70.63907  1.000 39.14742  ? 144  TYR A CE2 1 
ATOM   4426  C CZ  . TYR B  1 164 ? -61.46786 -28.57264  71.29242  1.000 41.31707  ? 144  TYR A CZ  1 
ATOM   4427  O OH  . TYR B  1 164 ? -61.42825 -28.06212  72.56279  1.000 45.28431  ? 144  TYR A OH  1 
ATOM   4428  N N   . MET B  1 165 ? -60.98282 -31.93474  64.86821  1.000 27.94793  ? 145  MET A N   1 
ATOM   4429  C CA  . MET B  1 165 ? -61.28747 -32.37895  63.51479  1.000 30.61450  ? 145  MET A CA  1 
ATOM   4430  C C   . MET B  1 165 ? -61.47294 -33.88527  63.46056  1.000 26.33299  ? 145  MET A C   1 
ATOM   4431  O O   . MET B  1 165 ? -62.33383 -34.38544  62.72628  1.000 25.74477  ? 145  MET A O   1 
ATOM   4432  C CB  . MET B  1 165 ? -60.17245 -31.97595  62.55841  1.000 31.47740  ? 145  MET A CB  1 
ATOM   4433  C CG  . MET B  1 165 ? -60.46526 -30.79402  61.73444  1.000 39.74464  ? 145  MET A CG  1 
ATOM   4434  S SD  . MET B  1 165 ? -59.17069 -30.65192  60.50972  1.000 38.21495  ? 145  MET A SD  1 
ATOM   4435  C CE  . MET B  1 165 ? -59.98784 -31.24061  59.02663  1.000 34.80339  ? 145  MET A CE  1 
ATOM   4436  N N   . LEU B  1 166 ? -60.62840 -34.62300  64.16909  1.000 21.92388  ? 146  LEU A N   1 
ATOM   4437  C CA  . LEU B  1 166 ? -60.79210 -36.06254  64.19104  1.000 23.38243  ? 146  LEU A CA  1 
ATOM   4438  C C   . LEU B  1 166 ? -62.15058 -36.44758  64.76618  1.000 23.90183  ? 146  LEU A C   1 
ATOM   4439  O O   . LEU B  1 166 ? -62.80529 -37.35521  64.25881  1.000 25.26967  ? 146  LEU A O   1 
ATOM   4440  C CB  . LEU B  1 166 ? -59.66636 -36.73873  64.98879  1.000 23.04424  ? 146  LEU A CB  1 
ATOM   4441  C CG  . LEU B  1 166 ? -58.28636 -36.74824  64.32451  1.000 26.27882  ? 146  LEU A CG  1 
ATOM   4442  C CD1 . LEU B  1 166 ? -57.20762 -36.80854  65.40150  1.000 26.69355  ? 146  LEU A CD1 1 
ATOM   4443  C CD2 . LEU B  1 166 ? -58.17692 -37.90424  63.34482  1.000 28.97567  ? 146  LEU A CD2 1 
ATOM   4444  N N   . GLN B  1 167 ? -62.57686 -35.78120  65.83411  1.000 27.46228  ? 147  GLN A N   1 
ATOM   4445  C CA  . GLN B  1 167 ? -63.87850 -36.09528  66.41556  1.000 28.49199  ? 147  GLN A CA  1 
ATOM   4446  C C   . GLN B  1 167 ? -64.98276 -35.79287  65.42575  1.000 27.74306  ? 147  GLN A C   1 
ATOM   4447  O O   . GLN B  1 167 ? -65.85482 -36.63513  65.18412  1.000 25.21028  ? 147  GLN A O   1 
ATOM   4448  C CB  . GLN B  1 167 ? -64.10937 -35.29930  67.69896  1.000 35.26093  ? 147  GLN A CB  1 
ATOM   4449  C CG  . GLN B  1 167 ? -63.08924 -35.49273  68.76902  1.000 41.08358  ? 147  GLN A CG  1 
ATOM   4450  C CD  . GLN B  1 167 ? -63.47846 -36.53971  69.75510  1.000 48.30654  ? 147  GLN A CD  1 
ATOM   4451  O OE1 . GLN B  1 167 ? -64.36758 -37.36122  69.49809  1.000 54.60590  ? 147  GLN A OE1 1 
ATOM   4452  N NE2 . GLN B  1 167 ? -62.81674 -36.53303  70.90144  1.000 48.54141  ? 147  GLN A NE2 1 
ATOM   4453  N N   . GLN B  1 168 ? -64.96953 -34.57765  64.84880  1.000 25.99037  ? 148  GLN A N   1 
ATOM   4454  C CA  . GLN B  1 168 ? -66.01401 -34.21763  63.89124  1.000 27.03443  ? 148  GLN A CA  1 
ATOM   4455  C C   . GLN B  1 168 ? -66.05481 -35.20960  62.73588  1.000 32.55393  ? 148  GLN A C   1 
ATOM   4456  O O   . GLN B  1 168 ? -67.13393 -35.62198  62.30411  1.000 37.36856  ? 148  GLN A O   1 
ATOM   4457  C CB  . GLN B  1 168 ? -65.80481 -32.80215  63.36408  1.000 28.80296  ? 148  GLN A CB  1 
ATOM   4458  C CG  . GLN B  1 168 ? -66.81438 -32.42100  62.27975  1.000 33.19313  ? 148  GLN A CG  1 
ATOM   4459  C CD  . GLN B  1 168 ? -66.54482 -31.06508  61.67809  1.000 35.48840  ? 148  GLN A CD  1 
ATOM   4460  O OE1 . GLN B  1 168 ? -65.72379 -30.31304  62.17698  1.000 37.20247  ? 148  GLN A OE1 1 
ATOM   4461  N NE2 . GLN B  1 168 ? -67.20712 -30.76391  60.57387  1.000 35.24686  ? 148  GLN A NE2 1 
ATOM   4462  N N   . HIS B  1 169 ? -64.88818 -35.62938  62.24129  1.000 31.26748  ? 149  HIS A N   1 
ATOM   4463  C CA  . HIS B  1 169 ? -64.85640 -36.56704  61.12474  1.000 33.26462  ? 149  HIS A CA  1 
ATOM   4464  C C   . HIS B  1 169 ? -65.53049 -37.89106  61.47535  1.000 35.28606  ? 149  HIS A C   1 
ATOM   4465  O O   . HIS B  1 169 ? -66.29080 -38.44273  60.66340  1.000 37.15083  ? 149  HIS A O   1 
ATOM   4466  C CB  . HIS B  1 169 ? -63.41372 -36.80269  60.68147  1.000 31.99734  ? 149  HIS A CB  1 
ATOM   4467  C CG  . HIS B  1 169 ? -63.28806 -37.75742  59.53454  1.000 29.19350  ? 149  HIS A CG  1 
ATOM   4468  N ND1 . HIS B  1 169 ? -63.56817 -37.39666  58.23035  1.000 31.22376  ? 149  HIS A ND1 1 
ATOM   4469  C CD2 . HIS B  1 169 ? -62.93753 -39.06570  59.49865  1.000 28.97466  ? 149  HIS A CD2 1 
ATOM   4470  C CE1 . HIS B  1 169 ? -63.38164 -38.43802  57.43877  1.000 28.85831  ? 149  HIS A CE1 1 
ATOM   4471  N NE2 . HIS B  1 169 ? -63.01206 -39.46735  58.18335  1.000 29.74963  ? 149  HIS A NE2 1 
ATOM   4472  N N   . VAL B  1 170 ? -65.26317 -38.42740  62.66717  1.000 33.32939  ? 150  VAL A N   1 
ATOM   4473  C CA  . VAL B  1 170 ? -65.87800 -39.70532  63.02686  1.000 36.79080  ? 150  VAL A CA  1 
ATOM   4474  C C   . VAL B  1 170 ? -67.36884 -39.51979  63.27735  1.000 40.70041  ? 150  VAL A C   1 
ATOM   4475  O O   . VAL B  1 170 ? -68.20531 -40.26127  62.74426  1.000 40.30656  ? 150  VAL A O   1 
ATOM   4476  C CB  . VAL B  1 170 ? -65.17051 -40.33163  64.23985  1.000 34.22897  ? 150  VAL A CB  1 
ATOM   4477  C CG1 . VAL B  1 170 ? -65.94271 -41.54503  64.72159  1.000 32.31507  ? 150  VAL A CG1 1 
ATOM   4478  C CG2 . VAL B  1 170 ? -63.76618 -40.72757  63.86788  1.000 36.28392  ? 150  VAL A CG2 1 
ATOM   4479  N N   . ASP B  1 171 ? -67.72952 -38.50035  64.05779  1.000 40.63683  ? 151  ASP A N   1 
ATOM   4480  C CA  . ASP B  1 171 ? -69.13463 -38.29765  64.39245  1.000 41.49199  ? 151  ASP A CA  1 
ATOM   4481  C C   . ASP B  1 171 ? -69.97195 -37.98196  63.16168  1.000 41.97729  ? 151  ASP A C   1 
ATOM   4482  O O   . ASP B  1 171 ? -71.13508 -38.39288  63.07397  1.000 44.68837  ? 151  ASP A O   1 
ATOM   4483  C CB  . ASP B  1 171 ? -69.25204 -37.19025  65.42479  1.000 43.62046  ? 151  ASP A CB  1 
ATOM   4484  C CG  . ASP B  1 171 ? -68.58664 -37.56128  66.72214  1.000 48.71068  ? 151  ASP A CG  1 
ATOM   4485  O OD1 . ASP B  1 171 ? -68.39520 -36.66825  67.58282  1.000 54.00065  ? 151  ASP A OD1 1 
ATOM   4486  O OD2 . ASP B  1 171 ? -68.25632 -38.76145  66.87606  1.000 49.57685  ? 151  ASP A OD2 1 
ATOM   4487  N N   . SER B  1 172 ? -69.40278 -37.26640  62.19530  1.000 37.25771  ? 152  SER A N   1 
ATOM   4488  C CA  . SER B  1 172 ? -70.15266 -36.86046  61.01244  1.000 37.24260  ? 152  SER A CA  1 
ATOM   4489  C C   . SER B  1 172 ? -70.34113 -37.98517  60.00455  1.000 36.24657  ? 152  SER A C   1 
ATOM   4490  O O   . SER B  1 172 ? -71.22473 -37.89280  59.14191  1.000 38.81811  ? 152  SER A O   1 
ATOM   4491  C CB  . SER B  1 172 ? -69.44999 -35.68074  60.33117  1.000 38.30473  ? 152  SER A CB  1 
ATOM   4492  O OG  . SER B  1 172 ? -68.33728 -36.11198  59.54342  1.000 38.96020  ? 152  SER A OG  1 
ATOM   4493  N N   . GLY B  1 173 ? -69.55248 -39.04555  60.09786  1.000 33.82268  ? 153  GLY A N   1 
ATOM   4494  C CA  . GLY B  1 173 ? -69.53473 -40.05223  59.06478  1.000 32.35968  ? 153  GLY A CA  1 
ATOM   4495  C C   . GLY B  1 173 ? -68.98132 -39.59493  57.74107  1.000 32.39625  ? 153  GLY A C   1 
ATOM   4496  O O   . GLY B  1 173 ? -69.22833 -40.23900  56.73173  1.000 33.40937  ? 153  GLY A O   1 
ATOM   4497  N N   . ALA B  1 174 ? -68.19587 -38.52615  57.71477  1.000 35.66359  ? 154  ALA A N   1 
ATOM   4498  C CA  . ALA B  1 174 ? -67.71287 -37.99259  56.45357  1.000 34.29272  ? 154  ALA A CA  1 
ATOM   4499  C C   . ALA B  1 174 ? -66.69086 -38.91501  55.79201  1.000 35.26294  ? 154  ALA A C   1 
ATOM   4500  O O   . ALA B  1 174 ? -65.97464 -39.67440  56.45254  1.000 40.82077  ? 154  ALA A O   1 
ATOM   4501  C CB  . ALA B  1 174 ? -67.08600 -36.61214  56.67471  1.000 39.42087  ? 154  ALA A CB  1 
ATOM   4502  N N   . ASP B  1 175 ? -66.61045 -38.80126  54.46629  1.000 31.03300  ? 155  ASP A N   1 
ATOM   4503  C CA  . ASP B  1 175 ? -65.48765 -39.31465  53.68718  1.000 34.00360  ? 155  ASP A CA  1 
ATOM   4504  C C   . ASP B  1 175 ? -64.24973 -38.41899  53.82384  1.000 35.15113  ? 155  ASP A C   1 
ATOM   4505  O O   . ASP B  1 175 ? -63.11508 -38.91202  53.81164  1.000 33.31458  ? 155  ASP A O   1 
ATOM   4506  C CB  . ASP B  1 175 ? -65.87455 -39.42364  52.20786  1.000 33.08751  ? 155  ASP A CB  1 
ATOM   4507  C CG  . ASP B  1 175 ? -66.93197 -40.47762  51.94673  1.000 40.67300  ? 155  ASP A CG  1 
ATOM   4508  O OD1 . ASP B  1 175 ? -67.02390 -41.44683  52.73412  1.000 39.76054  ? 155  ASP A OD1 1 
ATOM   4509  O OD2 . ASP B  1 175 ? -67.69103 -40.31560  50.95569  1.000 41.24348  ? 155  ASP A OD2 1 
ATOM   4510  N N   . VAL B  1 176 ? -64.43203 -37.10788  53.93098  1.000 31.61988  ? 156  VAL A N   1 
ATOM   4511  C CA  . VAL B  1 176 ? -63.30315 -36.23599  54.21848  1.000 32.93382  ? 156  VAL A CA  1 
ATOM   4512  C C   . VAL B  1 176 ? -63.81121 -35.02654  54.97959  1.000 34.17842  ? 156  VAL A C   1 
ATOM   4513  O O   . VAL B  1 176 ? -64.86251 -34.46122  54.65669  1.000 34.93776  ? 156  VAL A O   1 
ATOM   4514  C CB  . VAL B  1 176 ? -62.55372 -35.80226  52.93995  1.000 34.34634  ? 156  VAL A CB  1 
ATOM   4515  C CG1 . VAL B  1 176 ? -63.48554 -35.02465  52.00528  1.000 33.11708  ? 156  VAL A CG1 1 
ATOM   4516  C CG2 . VAL B  1 176 ? -61.30661 -34.97549  53.29213  1.000 36.02692  ? 156  VAL A CG2 1 
ATOM   4517  N N   . THR B  1 177 ? -63.05050 -34.62868  55.98679  1.000 28.72931  ? 157  THR A N   1 
ATOM   4518  C CA  . THR B  1 177 ? -63.29195 -33.40130  56.72354  1.000 27.69488  ? 157  THR A CA  1 
ATOM   4519  C C   . THR B  1 177 ? -62.20097 -32.40330  56.34767  1.000 26.71889  ? 157  THR A C   1 
ATOM   4520  O O   . THR B  1 177 ? -61.00869 -32.74830  56.33412  1.000 27.43766  ? 157  THR A O   1 
ATOM   4521  C CB  . THR B  1 177 ? -63.31592 -33.70205  58.22769  1.000 32.03858  ? 157  THR A CB  1 
ATOM   4522  O OG1 . THR B  1 177 ? -64.38278 -34.62932  58.48787  1.000 30.95335  ? 157  THR A OG1 1 
ATOM   4523  C CG2 . THR B  1 177 ? -63.56498 -32.44606  59.03663  1.000 34.19763  ? 157  THR A CG2 1 
ATOM   4524  N N   . ILE B  1 178 ? -62.59365 -31.17176  56.02813  1.000 24.29034  ? 158  ILE A N   1 
ATOM   4525  C CA  . ILE B  1 178 ? -61.65884 -30.19274  55.48154  1.000 27.08820  ? 158  ILE A CA  1 
ATOM   4526  C C   . ILE B  1 178 ? -61.56678 -28.98933  56.41059  1.000 26.61660  ? 158  ILE A C   1 
ATOM   4527  O O   . ILE B  1 178 ? -62.58688 -28.36884  56.74145  1.000 23.70053  ? 158  ILE A O   1 
ATOM   4528  C CB  . ILE B  1 178 ? -62.07201 -29.75033  54.06598  1.000 28.84152  ? 158  ILE A CB  1 
ATOM   4529  C CG1 . ILE B  1 178 ? -62.38082 -30.97974  53.22737  1.000 29.19246  ? 158  ILE A CG1 1 
ATOM   4530  C CG2 . ILE B  1 178 ? -60.97411 -28.89118  53.44735  1.000 30.22636  ? 158  ILE A CG2 1 
ATOM   4531  C CD1 . ILE B  1 178 ? -62.48711 -30.65989  51.78188  1.000 25.20737  ? 158  ILE A CD1 1 
ATOM   4532  N N   . GLY B  1 179 ? -60.34288 -28.65320  56.81235  1.000 22.65391  ? 159  GLY A N   1 
ATOM   4533  C CA  . GLY B  1 179 ? -60.14161 -27.47913  57.63969  1.000 22.21369  ? 159  GLY A CA  1 
ATOM   4534  C C   . GLY B  1 179 ? -60.28833 -26.19663  56.82608  1.000 23.49292  ? 159  GLY A C   1 
ATOM   4535  O O   . GLY B  1 179 ? -59.65418 -26.03157  55.77764  1.000 25.34188  ? 159  GLY A O   1 
ATOM   4536  N N   . CYS B  1 180 ? -61.07968 -25.25585  57.34489  1.000 22.44462  ? 160  CYS A N   1 
ATOM   4537  C CA  . CYS B  1 180 ? -61.48139 -24.07027  56.59130  1.000 22.65960  ? 160  CYS A CA  1 
ATOM   4538  C C   . CYS B  1 180 ? -61.38597 -22.79476  57.42173  1.000 22.30378  ? 160  CYS A C   1 
ATOM   4539  O O   . CYS B  1 180 ? -61.74547 -22.76192  58.60811  1.000 22.23102  ? 160  CYS A O   1 
ATOM   4540  C CB  . CYS B  1 180 ? -62.90689 -24.23824  56.07243  1.000 27.09357  ? 160  CYS A CB  1 
ATOM   4541  S SG  . CYS B  1 180 ? -63.00726 -25.37924  54.64054  1.000 32.39824  ? 160  CYS A SG  1 
ATOM   4542  N N   . LEU B  1 181 ? -60.87274 -21.74160  56.80225  1.000 22.41652  ? 161  LEU A N   1 
ATOM   4543  C CA  . LEU B  1 181 ? -60.89839 -20.43165  57.42787  1.000 22.80584  ? 161  LEU A CA  1 
ATOM   4544  C C   . LEU B  1 181 ? -62.16832 -19.71138  57.03705  1.000 25.71820  ? 161  LEU A C   1 
ATOM   4545  O O   . LEU B  1 181 ? -62.59503 -19.77996  55.88029  1.000 28.83142  ? 161  LEU A O   1 
ATOM   4546  C CB  . LEU B  1 181 ? -59.68704 -19.58183  57.04226  1.000 22.69195  ? 161  LEU A CB  1 
ATOM   4547  C CG  . LEU B  1 181 ? -58.34861 -20.24890  57.21270  1.000 23.82972  ? 161  LEU A CG  1 
ATOM   4548  C CD1 . LEU B  1 181 ? -57.40068 -19.56892  56.23462  1.000 24.48470  ? 161  LEU A CD1 1 
ATOM   4549  C CD2 . LEU B  1 181 ? -57.94029 -20.10991  58.65181  1.000 20.23486  ? 161  LEU A CD2 1 
ATOM   4550  N N   . GLU B  1 182 ? -62.78202 -19.02841  58.00469  1.000 25.51906  ? 162  GLU A N   1 
ATOM   4551  C CA  . GLU B  1 182 ? -63.92359 -18.17359  57.73484  1.000 30.63665  ? 162  GLU A CA  1 
ATOM   4552  C C   . GLU B  1 182 ? -63.38882 -16.77005  57.47059  1.000 28.76002  ? 162  GLU A C   1 
ATOM   4553  O O   . GLU B  1 182 ? -62.87313 -16.11788  58.37792  1.000 28.10179  ? 162  GLU A O   1 
ATOM   4554  C CB  . GLU B  1 182 ? -64.90622 -18.20683  58.89925  1.000 36.94091  ? 162  GLU A CB  1 
ATOM   4555  C CG  . GLU B  1 182 ? -66.21373 -17.49121  58.60376  1.000 44.67082  ? 162  GLU A CG  1 
ATOM   4556  C CD  . GLU B  1 182 ? -67.26680 -17.76698  59.66187  1.000 55.09712  ? 162  GLU A CD  1 
ATOM   4557  O OE1 . GLU B  1 182 ? -68.19408 -16.93421  59.81296  1.000 58.70241  ? 162  GLU A OE1 1 
ATOM   4558  O OE2 . GLU B  1 182 ? -67.15660 -18.81498  60.34349  1.000 57.14523  ? 162  GLU A OE2 1 
ATOM   4559  N N   . VAL B  1 183 ? -63.46047 -16.32582  56.21835  1.000 26.23602  ? 163  VAL A N   1 
ATOM   4560  C CA  . VAL B  1 183 ? -62.85265 -15.05426  55.82704  1.000 28.76063  ? 163  VAL A CA  1 
ATOM   4561  C C   . VAL B  1 183 ? -63.88192 -14.25816  55.04133  1.000 33.77179  ? 163  VAL A C   1 
ATOM   4562  O O   . VAL B  1 183 ? -64.79774 -14.83586  54.44240  1.000 37.25243  ? 163  VAL A O   1 
ATOM   4563  C CB  . VAL B  1 183 ? -61.58615 -15.26510  54.96614  1.000 30.73111  ? 163  VAL A CB  1 
ATOM   4564  C CG1 . VAL B  1 183 ? -60.60346 -16.21709  55.63697  1.000 29.61313  ? 163  VAL A CG1 1 
ATOM   4565  C CG2 . VAL B  1 183 ? -61.98286 -15.81074  53.62940  1.000 32.56430  ? 163  VAL A CG2 1 
ATOM   4566  N N   . PRO B  1 184 ? -63.74224 -12.92982  54.99843  1.000 33.08477  ? 164  PRO A N   1 
ATOM   4567  C CA  . PRO B  1 184 ? -64.60218 -12.13517  54.11304  1.000 33.43077  ? 164  PRO A CA  1 
ATOM   4568  C C   . PRO B  1 184 ? -64.49244 -12.62878  52.68014  1.000 30.80056  ? 164  PRO A C   1 
ATOM   4569  O O   . PRO B  1 184 ? -63.40222 -12.93994  52.20101  1.000 31.05107  ? 164  PRO A O   1 
ATOM   4570  C CB  . PRO B  1 184 ? -64.04597 -10.71383  54.26285  1.000 33.26173  ? 164  PRO A CB  1 
ATOM   4571  C CG  . PRO B  1 184 ? -63.37072 -10.70671  55.57282  1.000 31.81068  ? 164  PRO A CG  1 
ATOM   4572  C CD  . PRO B  1 184 ? -62.78530 -12.09075  55.74074  1.000 32.41502  ? 164  PRO A CD  1 
ATOM   4573  N N   . ARG B  1 185 ? -65.63939 -12.69921  51.99183  1.000 34.03268  ? 165  ARG A N   1 
ATOM   4574  C CA  . ARG B  1 185 ? -65.67684 -13.26045  50.64156  1.000 31.71790  ? 165  ARG A CA  1 
ATOM   4575  C C   . ARG B  1 185 ? -64.64637 -12.63116  49.71956  1.000 31.78589  ? 165  ARG A C   1 
ATOM   4576  O O   . ARG B  1 185 ? -63.96400 -13.33397  48.97064  1.000 31.40545  ? 165  ARG A O   1 
ATOM   4577  C CB  . ARG B  1 185 ? -67.06168 -13.07883  50.05019  1.000 35.30118  ? 165  ARG A CB  1 
ATOM   4578  C CG  . ARG B  1 185 ? -68.07435 -13.99937  50.63889  1.000 34.22543  ? 165  ARG A CG  1 
ATOM   4579  C CD  . ARG B  1 185 ? -69.32619 -14.06508  49.76127  1.000 36.20710  ? 165  ARG A CD  1 
ATOM   4580  N NE  . ARG B  1 185 ? -69.82784 -12.73688  49.42261  1.000 39.43069  ? 165  ARG A NE  1 
ATOM   4581  C CZ  . ARG B  1 185 ? -69.80762 -12.26078  48.18606  1.000 41.69965  ? 165  ARG A CZ  1 
ATOM   4582  N NH1 . ARG B  1 185 ? -69.31926 -13.03105  47.22219  1.000 36.75758  ? 165  ARG A NH1 1 
ATOM   4583  N NH2 . ARG B  1 185 ? -70.27081 -11.04023  47.90942  1.000 43.52137  ? 165  ARG A NH2 1 
ATOM   4584  N N   . MET B  1 186 ? -64.52289 -11.30523  49.75322  1.000 30.58766  ? 166  MET A N   1 
ATOM   4585  C CA  . MET B  1 186 ? -63.55343 -10.61769  48.90176  1.000 34.94061  ? 166  MET A CA  1 
ATOM   4586  C C   . MET B  1 186 ? -62.12421 -11.10888  49.14317  1.000 35.49646  ? 166  MET A C   1 
ATOM   4587  O O   . MET B  1 186 ? -61.31512 -11.16144  48.20750  1.000 38.43949  ? 166  MET A O   1 
ATOM   4588  C CB  . MET B  1 186 ? -63.66753 -9.11573   49.15072  1.000 44.29770  ? 166  MET A CB  1 
ATOM   4589  C CG  . MET B  1 186 ? -64.20940 -8.85820   50.56142  1.000 54.84271  ? 166  MET A CG  1 
ATOM   4590  S SD  . MET B  1 186 ? -64.48872 -7.14758   51.01561  1.000 64.47528  ? 166  MET A SD  1 
ATOM   4591  C CE  . MET B  1 186 ? -62.82351 -6.46792   50.92233  1.000 65.58454  ? 166  MET A CE  1 
ATOM   4592  N N   . GLU B  1 187 ? -61.80020 -11.50241  50.37387  1.000 28.93054  ? 167  GLU A N   1 
ATOM   4593  C CA  . GLU B  1 187 ? -60.47006 -12.02049  50.65372  1.000 36.74259  ? 167  GLU A CA  1 
ATOM   4594  C C   . GLU B  1 187 ? -60.30435 -13.47452  50.26106  1.000 40.58273  ? 167  GLU A C   1 
ATOM   4595  O O   . GLU B  1 187 ? -59.18089 -13.98467  50.31512  1.000 51.49437  ? 167  GLU A O   1 
ATOM   4596  C CB  . GLU B  1 187 ? -60.14726 -11.89423  52.13269  1.000 39.20301  ? 167  GLU A CB  1 
ATOM   4597  C CG  . GLU B  1 187 ? -60.31365 -10.51032  52.67796  1.000 42.22929  ? 167  GLU A CG  1 
ATOM   4598  C CD  . GLU B  1 187 ? -59.93322 -10.45731  54.14550  1.000 42.64076  ? 167  GLU A CD  1 
ATOM   4599  O OE1 . GLU B  1 187 ? -60.05363 -9.36933   54.73031  1.000 44.37898  ? 167  GLU A OE1 1 
ATOM   4600  O OE2 . GLU B  1 187 ? -59.52756 -11.50492  54.70959  1.000 45.55710  ? 167  GLU A OE2 1 
ATOM   4601  N N   . ALA B  1 188 ? -61.39121 -14.15697  49.91215  1.000 30.71800  ? 168  ALA A N   1 
ATOM   4602  C CA  . ALA B  1 188 ? -61.35888 -15.57266  49.60598  1.000 26.67433  ? 168  ALA A CA  1 
ATOM   4603  C C   . ALA B  1 188 ? -61.01493 -15.87730  48.15078  1.000 31.11326  ? 168  ALA A C   1 
ATOM   4604  O O   . ALA B  1 188 ? -60.82824 -17.05194  47.81522  1.000 32.03270  ? 168  ALA A O   1 
ATOM   4605  C CB  . ALA B  1 188 ? -62.71224 -16.20523  49.95501  1.000 24.35959  ? 168  ALA A CB  1 
ATOM   4606  N N   . THR B  1 189 ? -60.92718 -14.86390  47.27851  1.000 34.69697  ? 169  THR A N   1 
ATOM   4607  C CA  . THR B  1 189 ? -60.72800 -15.12984  45.85337  1.000 35.41702  ? 169  THR A CA  1 
ATOM   4608  C C   . THR B  1 189 ? -59.39119 -15.79882  45.55632  1.000 38.46035  ? 169  THR A C   1 
ATOM   4609  O O   . THR B  1 189 ? -59.24343 -16.41100  44.48883  1.000 39.06196  ? 169  THR A O   1 
ATOM   4610  C CB  . THR B  1 189 ? -60.80951 -13.83728  45.04786  1.000 33.63897  ? 169  THR A CB  1 
ATOM   4611  O OG1 . THR B  1 189 ? -59.82574 -12.94126  45.54035  1.000 31.83062  ? 169  THR A OG1 1 
ATOM   4612  C CG2 . THR B  1 189 ? -62.19983 -13.21293  45.14917  1.000 24.22726  ? 169  THR A CG2 1 
ATOM   4613  N N   . GLY B  1 190 ? -58.41160 -15.66636  46.44908  1.000 33.97563  ? 170  GLY A N   1 
ATOM   4614  C CA  . GLY B  1 190 ? -57.12756 -16.31586  46.30731  1.000 35.01743  ? 170  GLY A CA  1 
ATOM   4615  C C   . GLY B  1 190 ? -57.03042 -17.72079  46.86578  1.000 33.07428  ? 170  GLY A C   1 
ATOM   4616  O O   . GLY B  1 190 ? -55.93262 -18.28268  46.85482  1.000 32.71877  ? 170  GLY A O   1 
ATOM   4617  N N   . PHE B  1 191 ? -58.13555 -18.31636  47.31842  1.000 28.27825  ? 171  PHE A N   1 
ATOM   4618  C CA  . PHE B  1 191 ? -58.14522 -19.61639  47.95739  1.000 28.68588  ? 171  PHE A CA  1 
ATOM   4619  C C   . PHE B  1 191 ? -58.97368 -20.59951  47.15154  1.000 34.22194  ? 171  PHE A C   1 
ATOM   4620  O O   . PHE B  1 191 ? -59.81346 -20.22474  46.31740  1.000 33.27198  ? 171  PHE A O   1 
ATOM   4621  C CB  . PHE B  1 191 ? -58.74795 -19.55686  49.37689  1.000 27.03784  ? 171  PHE A CB  1 
ATOM   4622  C CG  . PHE B  1 191 ? -57.92689 -18.78651  50.36521  1.000 28.08216  ? 171  PHE A CG  1 
ATOM   4623  C CD1 . PHE B  1 191 ? -57.96456 -17.40882  50.40362  1.000 30.27883  ? 171  PHE A CD1 1 
ATOM   4624  C CD2 . PHE B  1 191 ? -57.14182 -19.45510  51.29534  1.000 29.49683  ? 171  PHE A CD2 1 
ATOM   4625  C CE1 . PHE B  1 191 ? -57.20058 -16.69781  51.32356  1.000 28.29809  ? 171  PHE A CE1 1 
ATOM   4626  C CE2 . PHE B  1 191 ? -56.39352 -18.75044  52.21254  1.000 29.76696  ? 171  PHE A CE2 1 
ATOM   4627  C CZ  . PHE B  1 191 ? -56.42255 -17.37217  52.22659  1.000 29.86038  ? 171  PHE A CZ  1 
ATOM   4628  N N   . GLY B  1 192 ? -58.74749 -21.87704  47.43980  1.000 32.56769  ? 172  GLY A N   1 
ATOM   4629  C CA  . GLY B  1 192 ? -59.75398 -22.87254  47.14101  1.000 30.10331  ? 172  GLY A CA  1 
ATOM   4630  C C   . GLY B  1 192 ? -60.90293 -22.72230  48.11531  1.000 32.86621  ? 172  GLY A C   1 
ATOM   4631  O O   . GLY B  1 192 ? -60.69484 -22.66167  49.33275  1.000 31.63107  ? 172  GLY A O   1 
ATOM   4632  N N   . VAL B  1 193 ? -62.12638 -22.63689  47.59168  1.000 29.36514  ? 173  VAL A N   1 
ATOM   4633  C CA  . VAL B  1 193 ? -63.27440 -22.23752  48.39441  1.000 30.90231  ? 173  VAL A CA  1 
ATOM   4634  C C   . VAL B  1 193 ? -64.29691 -23.35893  48.40170  1.000 31.42024  ? 173  VAL A C   1 
ATOM   4635  O O   . VAL B  1 193 ? -64.69661 -23.85579  47.34141  1.000 32.58512  ? 173  VAL A O   1 
ATOM   4636  C CB  . VAL B  1 193 ? -63.90592 -20.92478  47.88997  1.000 29.16290  ? 173  VAL A CB  1 
ATOM   4637  C CG1 . VAL B  1 193 ? -65.14142 -20.57580  48.72605  1.000 30.21679  ? 173  VAL A CG1 1 
ATOM   4638  C CG2 . VAL B  1 193 ? -62.89501 -19.79512  47.93607  1.000 25.89901  ? 173  VAL A CG2 1 
ATOM   4639  N N   . MET B  1 194 ? -64.73655 -23.73328  49.60002  1.000 32.67610  ? 174  MET A N   1 
ATOM   4640  C CA  . MET B  1 194 ? -65.81752 -24.69071  49.78000  1.000 33.42454  ? 174  MET A CA  1 
ATOM   4641  C C   . MET B  1 194 ? -67.15694 -23.95303  49.80133  1.000 35.76271  ? 174  MET A C   1 
ATOM   4642  O O   . MET B  1 194 ? -67.35493 -23.03551  50.60779  1.000 33.39911  ? 174  MET A O   1 
ATOM   4643  C CB  . MET B  1 194 ? -65.58875 -25.48220  51.07108  1.000 32.27758  ? 174  MET A CB  1 
ATOM   4644  C CG  . MET B  1 194 ? -64.21003 -26.16296  51.10693  1.000 36.98674  ? 174  MET A CG  1 
ATOM   4645  S SD  . MET B  1 194 ? -63.92387 -27.34095  49.70987  1.000 38.63517  ? 174  MET A SD  1 
ATOM   4646  C CE  . MET B  1 194 ? -62.14172 -27.46376  49.61024  1.000 33.89312  ? 174  MET A CE  1 
ATOM   4647  N N   . HIS B  1 195 ? -68.06832 -24.33012  48.90201  1.000 36.23483  ? 175  HIS A N   1 
ATOM   4648  C CA  . HIS B  1 195 ? -69.45986 -23.90908  49.01216  1.000 39.37208  ? 175  HIS A CA  1 
ATOM   4649  C C   . HIS B  1 195 ? -70.21245 -24.92308  49.86805  1.000 37.62285  ? 175  HIS A C   1 
ATOM   4650  O O   . HIS B  1 195 ? -70.15748 -26.12901  49.60791  1.000 40.66110  ? 175  HIS A O   1 
ATOM   4651  C CB  . HIS B  1 195 ? -70.11332 -23.76139  47.62865  1.000 47.83324  ? 175  HIS A CB  1 
ATOM   4652  C CG  . HIS B  1 195 ? -71.51973 -23.22985  47.66995  1.000 49.47973  ? 175  HIS A CG  1 
ATOM   4653  N ND1 . HIS B  1 195 ? -72.30354 -23.08391  46.54192  1.000 51.74482  ? 175  HIS A ND1 1 
ATOM   4654  C CD2 . HIS B  1 195 ? -72.28207 -22.81355  48.71025  1.000 50.82105  ? 175  HIS A CD2 1 
ATOM   4655  C CE1 . HIS B  1 195 ? -73.48309 -22.59601  46.88645  1.000 51.68580  ? 175  HIS A CE1 1 
ATOM   4656  N NE2 . HIS B  1 195 ? -73.49886 -22.42924  48.19652  1.000 52.09873  ? 175  HIS A NE2 1 
ATOM   4657  N N   . VAL B  1 196 ? -70.96914 -24.43324  50.84352  1.000 37.31387  ? 176  VAL A N   1 
ATOM   4658  C CA  . VAL B  1 196 ? -71.44370 -25.24619  51.94785  1.000 41.63078  ? 176  VAL A CA  1 
ATOM   4659  C C   . VAL B  1 196 ? -72.96029 -25.08337  52.11667  1.000 46.48110  ? 176  VAL A C   1 
ATOM   4660  O O   . VAL B  1 196 ? -73.54322 -24.08163  51.70460  1.000 44.60018  ? 176  VAL A O   1 
ATOM   4661  C CB  . VAL B  1 196 ? -70.65669 -24.84646  53.21996  1.000 41.74632  ? 176  VAL A CB  1 
ATOM   4662  C CG1 . VAL B  1 196 ? -71.26678 -23.63385  53.92185  1.000 43.80513  ? 176  VAL A CG1 1 
ATOM   4663  C CG2 . VAL B  1 196 ? -70.49146 -25.96784  54.12677  1.000 42.40742  ? 176  VAL A CG2 1 
ATOM   4664  N N   . ASN B  1 197 ? -73.61504 -26.10480  52.70312  1.000 44.88672  ? 177  ASN A N   1 
ATOM   4665  C CA  . ASN B  1 197 ? -75.03550 -26.00890  53.04233  1.000 44.07324  ? 177  ASN A CA  1 
ATOM   4666  C C   . ASN B  1 197 ? -75.19860 -25.51691  54.47838  1.000 42.92262  ? 177  ASN A C   1 
ATOM   4667  O O   . ASN B  1 197 ? -74.24487 -25.09024  55.12566  1.000 42.35187  ? 177  ASN A O   1 
ATOM   4668  C CB  . ASN B  1 197 ? -75.76933 -27.34539  52.84605  1.000 43.15379  ? 177  ASN A CB  1 
ATOM   4669  C CG  . ASN B  1 197 ? -75.72647 -28.24205  54.08311  1.000 42.49902  ? 177  ASN A CG  1 
ATOM   4670  O OD1 . ASN B  1 197 ? -74.71336 -28.31487  54.76909  1.000 35.07320  ? 177  ASN A OD1 1 
ATOM   4671  N ND2 . ASN B  1 197 ? -76.82079 -28.96055  54.34367  1.000 44.48138  ? 177  ASN A ND2 1 
ATOM   4672  N N   . GLU B  1 198 ? -76.42551 -25.57601  54.99045  1.000 44.72208  ? 178  GLU A N   1 
ATOM   4673  C CA  . GLU B  1 198 ? -76.69534 -25.12310  56.34831  1.000 48.84785  ? 178  GLU A CA  1 
ATOM   4674  C C   . GLU B  1 198 ? -76.10450 -26.04756  57.40733  1.000 47.47521  ? 178  GLU A C   1 
ATOM   4675  O O   . GLU B  1 198 ? -76.00179 -25.65258  58.57500  1.000 46.71228  ? 178  GLU A O   1 
ATOM   4676  C CB  . GLU B  1 198 ? -78.20714 -24.98192  56.55977  1.000 55.61038  ? 178  GLU A CB  1 
ATOM   4677  C CG  . GLU B  1 198 ? -78.95044 -26.30920  56.69858  1.000 61.14739  ? 178  GLU A CG  1 
ATOM   4678  C CD  . GLU B  1 198 ? -79.29258 -26.93853  55.35441  1.000 66.03490  ? 178  GLU A CD  1 
ATOM   4679  O OE1 . GLU B  1 198 ? -79.41330 -26.18453  54.35813  1.000 68.66056  ? 178  GLU A OE1 1 
ATOM   4680  O OE2 . GLU B  1 198 ? -79.43887 -28.18318  55.29580  1.000 67.11859  ? 178  GLU A OE2 1 
ATOM   4681  N N   . LYS B  1 199 ? -75.71898 -27.26758  57.04618  1.000 46.17414  ? 179  LYS A N   1 
ATOM   4682  C CA  . LYS B  1 199 ? -75.13733 -28.17764  58.02309  1.000 48.83743  ? 179  LYS A CA  1 
ATOM   4683  C C   . LYS B  1 199 ? -73.62860 -28.29748  57.86511  1.000 46.87152  ? 179  LYS A C   1 
ATOM   4684  O O   . LYS B  1 199 ? -73.02587 -29.22516  58.40909  1.000 44.86310  ? 179  LYS A O   1 
ATOM   4685  C CB  . LYS B  1 199 ? -75.80872 -29.54457  57.92386  1.000 49.44925  ? 179  LYS A CB  1 
ATOM   4686  C CG  . LYS B  1 199 ? -77.31136 -29.46018  58.13550  1.000 53.58887  ? 179  LYS A CG  1 
ATOM   4687  C CD  . LYS B  1 199 ? -77.94553 -30.82946  58.27381  1.000 57.64355  ? 179  LYS A CD  1 
ATOM   4688  C CE  . LYS B  1 199 ? -78.26391 -31.42549  56.91738  1.000 59.93960  ? 179  LYS A CE  1 
ATOM   4689  N NZ  . LYS B  1 199 ? -78.43074 -32.90253  56.99882  1.000 60.12308  ? 179  LYS A NZ  1 
ATOM   4690  N N   . ASP B  1 200 ? -73.01339 -27.37037  57.12781  1.000 45.50171  ? 180  ASP A N   1 
ATOM   4691  C CA  . ASP B  1 200 ? -71.58148 -27.34022  56.85635  1.000 41.52155  ? 180  ASP A CA  1 
ATOM   4692  C C   . ASP B  1 200 ? -71.10879 -28.53481  56.02336  1.000 41.61729  ? 180  ASP A C   1 
ATOM   4693  O O   . ASP B  1 200 ? -69.90434 -28.80358  55.94656  1.000 39.52587  ? 180  ASP A O   1 
ATOM   4694  C CB  . ASP B  1 200 ? -70.76188 -27.21375  58.15048  1.000 39.27587  ? 180  ASP A CB  1 
ATOM   4695  C CG  . ASP B  1 200 ? -70.34258 -25.75241  58.44818  1.000 38.23284  ? 180  ASP A CG  1 
ATOM   4696  O OD1 . ASP B  1 200 ? -70.75863 -24.82935  57.71077  1.000 33.82989  ? 180  ASP A OD1 1 
ATOM   4697  O OD2 . ASP B  1 200 ? -69.59049 -25.51659  59.41273  1.000 34.54059  ? 180  ASP A OD2 1 
ATOM   4698  N N   . GLU B  1 201 ? -72.02691 -29.25393  55.38063  1.000 39.65537  ? 181  GLU A N   1 
ATOM   4699  C CA  . GLU B  1 201 ? -71.66597 -30.21110  54.33603  1.000 41.08290  ? 181  GLU A CA  1 
ATOM   4700  C C   . GLU B  1 201 ? -71.30082 -29.47424  53.05053  1.000 39.03848  ? 181  GLU A C   1 
ATOM   4701  O O   . GLU B  1 201 ? -71.93321 -28.47881  52.70180  1.000 44.13905  ? 181  GLU A O   1 
ATOM   4702  C CB  . GLU B  1 201 ? -72.83234 -31.17386  54.07349  1.000 43.70671  ? 181  GLU A CB  1 
ATOM   4703  C CG  . GLU B  1 201 ? -73.42025 -31.78277  55.35083  1.000 50.73111  ? 181  GLU A CG  1 
ATOM   4704  C CD  . GLU B  1 201 ? -74.56681 -32.77802  55.08859  1.000 59.11154  ? 181  GLU A CD  1 
ATOM   4705  O OE1 . GLU B  1 201 ? -75.19981 -33.23103  56.06763  1.000 60.47922  ? 181  GLU A OE1 1 
ATOM   4706  O OE2 . GLU B  1 201 ? -74.83700 -33.11001  53.91264  1.000 61.92921  ? 181  GLU A OE2 1 
ATOM   4707  N N   . ILE B  1 202 ? -70.28067 -29.96006  52.34277  1.000 36.04344  ? 182  ILE A N   1 
ATOM   4708  C CA  . ILE B  1 202 ? -69.74330 -29.27971  51.15940  1.000 34.20831  ? 182  ILE A CA  1 
ATOM   4709  C C   . ILE B  1 202 ? -70.50775 -29.71927  49.90261  1.000 41.70024  ? 182  ILE A C   1 
ATOM   4710  O O   . ILE B  1 202 ? -70.50088 -30.90263  49.54281  1.000 42.24508  ? 182  ILE A O   1 
ATOM   4711  C CB  . ILE B  1 202 ? -68.24097 -29.55489  50.99574  1.000 31.85231  ? 182  ILE A CB  1 
ATOM   4712  C CG1 . ILE B  1 202 ? -67.44573 -28.90164  52.14071  1.000 29.62714  ? 182  ILE A CG1 1 
ATOM   4713  C CG2 . ILE B  1 202 ? -67.75994 -28.99044  49.66458  1.000 34.86938  ? 182  ILE A CG2 1 
ATOM   4714  C CD1 . ILE B  1 202 ? -65.95354 -29.34270  52.27336  1.000 31.61669  ? 182  ILE A CD1 1 
ATOM   4715  N N   . ILE B  1 203 ? -71.11343 -28.75436  49.20008  1.000 44.84317  ? 183  ILE A N   1 
ATOM   4716  C CA  . ILE B  1 203 ? -71.85351 -29.01247  47.95901  1.000 44.80894  ? 183  ILE A CA  1 
ATOM   4717  C C   . ILE B  1 203 ? -71.04423 -28.68027  46.70829  1.000 44.39224  ? 183  ILE A C   1 
ATOM   4718  O O   . ILE B  1 203 ? -71.31986 -29.24080  45.63498  1.000 50.92365  ? 183  ILE A O   1 
ATOM   4719  C CB  . ILE B  1 203 ? -73.18445 -28.23449  47.97177  1.000 46.31478  ? 183  ILE A CB  1 
ATOM   4720  C CG1 . ILE B  1 203 ? -74.12310 -28.89360  48.95904  1.000 46.66862  ? 183  ILE A CG1 1 
ATOM   4721  C CG2 . ILE B  1 203 ? -73.88032 -28.24013  46.62848  1.000 49.68111  ? 183  ILE A CG2 1 
ATOM   4722  C CD1 . ILE B  1 203 ? -74.18074 -28.18323  50.19356  1.000 45.44916  ? 183  ILE A CD1 1 
ATOM   4723  N N   . ASP B  1 204 ? -70.04528 -27.81463  46.81016  1.000 40.63839  ? 184  ASP A N   1 
ATOM   4724  C CA  . ASP B  1 204 ? -69.15533 -27.59786  45.67932  1.000 44.55828  ? 184  ASP A CA  1 
ATOM   4725  C C   . ASP B  1 204 ? -67.83287 -27.04301  46.17994  1.000 44.93125  ? 184  ASP A C   1 
ATOM   4726  O O   . ASP B  1 204 ? -67.74300 -26.52004  47.29127  1.000 46.79200  ? 184  ASP A O   1 
ATOM   4727  C CB  . ASP B  1 204 ? -69.77936 -26.65828  44.63871  1.000 49.70482  ? 184  ASP A CB  1 
ATOM   4728  C CG  . ASP B  1 204 ? -69.36666 -27.01590  43.22433  1.000 55.22532  ? 184  ASP A CG  1 
ATOM   4729  O OD1 . ASP B  1 204 ? -70.13631 -27.74719  42.56178  1.000 61.45985  ? 184  ASP A OD1 1 
ATOM   4730  O OD2 . ASP B  1 204 ? -68.28334 -26.57417  42.77445  1.000 52.18890  ? 184  ASP A OD2 1 
ATOM   4731  N N   . PHE B  1 205 ? -66.80618 -27.17241  45.33591  1.000 43.91979  ? 185  PHE A N   1 
ATOM   4732  C CA  . PHE B  1 205 ? -65.49683 -26.57967  45.55833  1.000 43.53305  ? 185  PHE A CA  1 
ATOM   4733  C C   . PHE B  1 205 ? -65.10666 -25.80669  44.31105  1.000 45.31672  ? 185  PHE A C   1 
ATOM   4734  O O   . PHE B  1 205 ? -65.38683 -26.24542  43.19069  1.000 46.65145  ? 185  PHE A O   1 
ATOM   4735  C CB  . PHE B  1 205 ? -64.42199 -27.64109  45.86784  1.000 47.10362  ? 185  PHE A CB  1 
ATOM   4736  C CG  . PHE B  1 205 ? -63.00912 -27.17033  45.59216  1.000 45.07159  ? 185  PHE A CG  1 
ATOM   4737  C CD1 . PHE B  1 205 ? -62.31644 -26.44432  46.53716  1.000 41.69713  ? 185  PHE A CD1 1 
ATOM   4738  C CD2 . PHE B  1 205 ? -62.38513 -27.43813  44.37969  1.000 42.05730  ? 185  PHE A CD2 1 
ATOM   4739  C CE1 . PHE B  1 205 ? -61.02261 -25.99998  46.29965  1.000 42.99282  ? 185  PHE A CE1 1 
ATOM   4740  C CE2 . PHE B  1 205 ? -61.09018 -26.99538  44.12404  1.000 41.89434  ? 185  PHE A CE2 1 
ATOM   4741  C CZ  . PHE B  1 205 ? -60.40514 -26.27147  45.08894  1.000 44.36893  ? 185  PHE A CZ  1 
ATOM   4742  N N   . ILE B  1 206 ? -64.45634 -24.66001  44.49840  1.000 40.67573  ? 186  ILE A N   1 
ATOM   4743  C CA  . ILE B  1 206 ? -64.04245 -23.82487  43.38342  1.000 39.20865  ? 186  ILE A CA  1 
ATOM   4744  C C   . ILE B  1 206 ? -62.64003 -23.31658  43.65061  1.000 36.76288  ? 186  ILE A C   1 
ATOM   4745  O O   . ILE B  1 206 ? -62.38518 -22.69260  44.68864  1.000 37.43762  ? 186  ILE A O   1 
ATOM   4746  C CB  . ILE B  1 206 ? -64.98526 -22.62442  43.15733  1.000 42.11248  ? 186  ILE A CB  1 
ATOM   4747  C CG1 . ILE B  1 206 ? -66.43258 -23.07799  42.91089  1.000 45.44016  ? 186  ILE A CG1 1 
ATOM   4748  C CG2 . ILE B  1 206 ? -64.45298 -21.78403  42.00754  1.000 42.72757  ? 186  ILE A CG2 1 
ATOM   4749  C CD1 . ILE B  1 206 ? -67.34800 -23.05590  44.16740  1.000 44.75410  ? 186  ILE A CD1 1 
ATOM   4750  N N   . GLU B  1 207 ? -61.74795 -23.52843  42.69579  1.000 34.23987  ? 187  GLU A N   1 
ATOM   4751  C CA  . GLU B  1 207 ? -60.40245 -22.97866  42.77064  1.000 38.07859  ? 187  GLU A CA  1 
ATOM   4752  C C   . GLU B  1 207 ? -60.43584 -21.49249  42.40580  1.000 39.87442  ? 187  GLU A C   1 
ATOM   4753  O O   . GLU B  1 207 ? -60.89935 -21.12600  41.31912  1.000 39.79109  ? 187  GLU A O   1 
ATOM   4754  C CB  . GLU B  1 207 ? -59.47473 -23.76750  41.83989  1.000 42.49728  ? 187  GLU A CB  1 
ATOM   4755  C CG  . GLU B  1 207 ? -58.06286 -23.19957  41.72588  1.000 47.82830  ? 187  GLU A CG  1 
ATOM   4756  C CD  . GLU B  1 207 ? -57.19865 -23.53930  42.93022  1.000 55.35092  ? 187  GLU A CD  1 
ATOM   4757  O OE1 . GLU B  1 207 ? -57.54947 -24.50444  43.65083  1.000 60.47183  ? 187  GLU A OE1 1 
ATOM   4758  O OE2 . GLU B  1 207 ? -56.18345 -22.83834  43.16411  1.000 52.83200  ? 187  GLU A OE2 1 
ATOM   4759  N N   . LYS B  1 208 ? -59.96454 -20.64436  43.32073  1.000 33.98064  ? 188  LYS A N   1 
ATOM   4760  C CA  . LYS B  1 208 ? -59.87306 -19.19353  43.17047  1.000 31.93939  ? 188  LYS A CA  1 
ATOM   4761  C C   . LYS B  1 208 ? -61.10289 -18.53676  42.51568  1.000 33.87275  ? 188  LYS A C   1 
ATOM   4762  O O   . LYS B  1 208 ? -60.95629 -17.82495  41.51889  1.000 31.77628  ? 188  LYS A O   1 
ATOM   4763  C CB  . LYS B  1 208 ? -58.60241 -18.81586  42.41375  1.000 31.82466  ? 188  LYS A CB  1 
ATOM   4764  C CG  . LYS B  1 208 ? -57.34740 -19.50879  42.88939  1.000 36.44535  ? 188  LYS A CG  1 
ATOM   4765  C CD  . LYS B  1 208 ? -56.16421 -18.53409  42.93448  1.000 38.35988  ? 188  LYS A CD  1 
ATOM   4766  C CE  . LYS B  1 208 ? -54.94607 -19.09815  42.22130  1.000 42.88427  ? 188  LYS A CE  1 
ATOM   4767  N NZ  . LYS B  1 208 ? -54.07996 -19.93303  43.11881  1.000 42.43499  ? 188  LYS A NZ  1 
ATOM   4768  N N   . PRO B  1 209 ? -62.29897 -18.68445  43.09818  1.000 35.80988  ? 189  PRO A N   1 
ATOM   4769  C CA  . PRO B  1 209 ? -63.49905 -18.06980  42.48925  1.000 33.18545  ? 189  PRO A CA  1 
ATOM   4770  C C   . PRO B  1 209 ? -63.42620 -16.54450  42.49727  1.000 35.00195  ? 189  PRO A C   1 
ATOM   4771  O O   . PRO B  1 209 ? -63.11379 -15.93234  43.51671  1.000 31.40765  ? 189  PRO A O   1 
ATOM   4772  C CB  . PRO B  1 209 ? -64.64271 -18.57287  43.37420  1.000 32.31096  ? 189  PRO A CB  1 
ATOM   4773  C CG  . PRO B  1 209 ? -63.98181 -18.76851  44.72810  1.000 35.42088  ? 189  PRO A CG  1 
ATOM   4774  C CD  . PRO B  1 209 ? -62.57833 -19.23796  44.43581  1.000 35.02315  ? 189  PRO A CD  1 
ATOM   4775  N N   . ALA B  1 210 ? -63.74378 -15.91932  41.35000  1.000 30.25546  ? 190  ALA A N   1 
ATOM   4776  C CA  . ALA B  1 210 ? -63.76670 -14.45499  41.31559  1.000 31.05982  ? 190  ALA A CA  1 
ATOM   4777  C C   . ALA B  1 210 ? -64.86397 -13.89059  42.20261  1.000 33.13393  ? 190  ALA A C   1 
ATOM   4778  O O   . ALA B  1 210 ? -64.70311 -12.79883  42.75186  1.000 38.04339  ? 190  ALA A O   1 
ATOM   4779  C CB  . ALA B  1 210 ? -63.94161 -13.94266  39.88995  1.000 34.62546  ? 190  ALA A CB  1 
ATOM   4780  N N   . ASP B  1 211 ? -65.96017 -14.62662  42.38032  1.000 32.65592  ? 191  ASP A N   1 
ATOM   4781  C CA  . ASP B  1 211 ? -67.06614 -14.23218  43.25442  1.000 34.63816  ? 191  ASP A CA  1 
ATOM   4782  C C   . ASP B  1 211 ? -67.34918 -15.39149  44.19720  1.000 32.96445  ? 191  ASP A C   1 
ATOM   4783  O O   . ASP B  1 211 ? -68.26223 -16.19169  43.95971  1.000 29.48734  ? 191  ASP A O   1 
ATOM   4784  C CB  . ASP B  1 211 ? -68.31783 -13.85917  42.44885  1.000 35.06530  ? 191  ASP A CB  1 
ATOM   4785  C CG  . ASP B  1 211 ? -69.33026 -13.04547  43.26644  1.000 39.51059  ? 191  ASP A CG  1 
ATOM   4786  O OD1 . ASP B  1 211 ? -68.94462 -12.40365  44.27648  1.000 43.21588  ? 191  ASP A OD1 1 
ATOM   4787  O OD2 . ASP B  1 211 ? -70.51590 -13.03695  42.89350  1.000 45.14354  ? 191  ASP A OD2 1 
ATOM   4788  N N   . PRO B  1 212 ? -66.60131 -15.50090  45.29245  1.000 34.86602  ? 192  PRO A N   1 
ATOM   4789  C CA  . PRO B  1 212 ? -66.68604 -16.70057  46.12354  1.000 32.52248  ? 192  PRO A CA  1 
ATOM   4790  C C   . PRO B  1 212 ? -68.07929 -16.86737  46.69705  1.000 32.11995  ? 192  PRO A C   1 
ATOM   4791  O O   . PRO B  1 212 ? -68.73349 -15.88629  47.07594  1.000 36.26613  ? 192  PRO A O   1 
ATOM   4792  C CB  . PRO B  1 212 ? -65.64913 -16.44820  47.22954  1.000 32.24938  ? 192  PRO A CB  1 
ATOM   4793  C CG  . PRO B  1 212 ? -64.74927 -15.34246  46.69838  1.000 30.89868  ? 192  PRO A CG  1 
ATOM   4794  C CD  . PRO B  1 212 ? -65.66673 -14.50903  45.83891  1.000 33.46901  ? 192  PRO A CD  1 
ATOM   4795  N N   . PRO B  1 213 ? -68.57234 -18.09447  46.76441  1.000 32.52260  ? 193  PRO A N   1 
ATOM   4796  C CA  . PRO B  1 213 ? -69.87263 -18.33740  47.40651  1.000 35.30305  ? 193  PRO A CA  1 
ATOM   4797  C C   . PRO B  1 213 ? -69.82211 -18.01727  48.88701  1.000 36.43541  ? 193  PRO A C   1 
ATOM   4798  O O   . PRO B  1 213 ? -68.82921 -18.28517  49.55731  1.000 35.09226  ? 193  PRO A O   1 
ATOM   4799  C CB  . PRO B  1 213 ? -70.10674 -19.83652  47.19187  1.000 38.57668  ? 193  PRO A CB  1 
ATOM   4800  C CG  . PRO B  1 213 ? -69.10760 -20.24577  46.12523  1.000 39.99619  ? 193  PRO A CG  1 
ATOM   4801  C CD  . PRO B  1 213 ? -67.94252 -19.31888  46.25369  1.000 34.52583  ? 193  PRO A CD  1 
ATOM   4802  N N   . GLY B  1 214 ? -70.90474 -17.46510  49.40029  1.000 35.44715  ? 194  GLY A N   1 
ATOM   4803  C CA  . GLY B  1 214 ? -70.97132 -17.14498  50.80881  1.000 37.23929  ? 194  GLY A CA  1 
ATOM   4804  C C   . GLY B  1 214 ? -71.54136 -18.28457  51.64232  1.000 39.42719  ? 194  GLY A C   1 
ATOM   4805  O O   . GLY B  1 214 ? -72.12105 -19.24136  51.13859  1.000 39.42052  ? 194  GLY A O   1 
ATOM   4806  N N   . ILE B  1 215 ? -71.38251 -18.15367  52.94548  1.000 40.44843  ? 195  ILE A N   1 
ATOM   4807  C CA  . ILE B  1 215 ? -71.91045 -19.14970  53.88116  1.000 45.08985  ? 195  ILE A CA  1 
ATOM   4808  C C   . ILE B  1 215 ? -73.40405 -18.89927  54.07153  1.000 52.22081  ? 195  ILE A C   1 
ATOM   4809  O O   . ILE B  1 215 ? -73.79829 -17.75153  54.34909  1.000 52.78192  ? 195  ILE A O   1 
ATOM   4810  C CB  . ILE B  1 215 ? -71.17301 -19.07033  55.20778  1.000 41.11805  ? 195  ILE A CB  1 
ATOM   4811  C CG1 . ILE B  1 215 ? -69.68281 -19.34157  55.00009  1.000 38.80231  ? 195  ILE A CG1 1 
ATOM   4812  C CG2 . ILE B  1 215 ? -71.77067 -20.03073  56.23504  1.000 41.87803  ? 195  ILE A CG2 1 
ATOM   4813  C CD1 . ILE B  1 215 ? -68.83220 -18.87532  56.15900  1.000 34.82986  ? 195  ILE A CD1 1 
ATOM   4814  N N   . PRO B  1 216 ? -74.24755 -19.92484  53.93064  1.000 54.24378  ? 196  PRO A N   1 
ATOM   4815  C CA  . PRO B  1 216 ? -75.68233 -19.76754  54.19372  1.000 54.99396  ? 196  PRO A CA  1 
ATOM   4816  C C   . PRO B  1 216 ? -75.96163 -19.04117  55.49783  1.000 54.35989  ? 196  PRO A C   1 
ATOM   4817  O O   . PRO B  1 216 ? -75.42719 -19.38872  56.55419  1.000 53.74159  ? 196  PRO A O   1 
ATOM   4818  C CB  . PRO B  1 216 ? -76.17782 -21.21309  54.24346  1.000 56.08496  ? 196  PRO A CB  1 
ATOM   4819  C CG  . PRO B  1 216 ? -75.29061 -21.91923  53.28616  1.000 56.36422  ? 196  PRO A CG  1 
ATOM   4820  C CD  . PRO B  1 216 ? -73.93450 -21.26476  53.40690  1.000 55.38433  ? 196  PRO A CD  1 
ATOM   4821  N N   . GLY B  1 217 ? -76.81474 -18.02109  55.41690  1.000 52.89594  ? 197  GLY A N   1 
ATOM   4822  C CA  . GLY B  1 217 ? -77.10150 -17.23747  56.59904  1.000 54.90973  ? 197  GLY A CA  1 
ATOM   4823  C C   . GLY B  1 217 ? -75.94489 -16.39354  57.07419  1.000 57.42275  ? 197  GLY A C   1 
ATOM   4824  O O   . GLY B  1 217 ? -75.92638 -15.97184  58.23608  1.000 61.27811  ? 197  GLY A O   1 
ATOM   4825  N N   . ASN B  1 218 ? -74.96562 -16.14231  56.20667  1.000 56.21016  ? 198  ASN A N   1 
ATOM   4826  C CA  . ASN B  1 218 ? -73.80297 -15.33421  56.55912  1.000 53.86294  ? 198  ASN A CA  1 
ATOM   4827  C C   . ASN B  1 218 ? -73.02433 -15.02957  55.28872  1.000 50.29742  ? 198  ASN A C   1 
ATOM   4828  O O   . ASN B  1 218 ? -71.84476 -15.37739  55.17085  1.000 50.84633  ? 198  ASN A O   1 
ATOM   4829  C CB  . ASN B  1 218 ? -72.91446 -16.05034  57.58129  1.000 51.72189  ? 198  ASN A CB  1 
ATOM   4830  C CG  . ASN B  1 218 ? -71.81054 -15.15689  58.11015  1.000 52.19346  ? 198  ASN A CG  1 
ATOM   4831  O OD1 . ASN B  1 218 ? -71.87757 -13.94290  57.95715  1.000 52.38706  ? 198  ASN A OD1 1 
ATOM   4832  N ND2 . ASN B  1 218 ? -70.78958 -15.74765  58.72936  1.000 51.63347  ? 198  ASN A ND2 1 
ATOM   4833  N N   . GLU B  1 219 ? -73.67763 -14.38275  54.32800  1.000 47.38798  ? 199  GLU A N   1 
ATOM   4834  C CA  . GLU B  1 219 ? -73.10562 -14.31645  52.99374  1.000 43.51956  ? 199  GLU A CA  1 
ATOM   4835  C C   . GLU B  1 219 ? -71.93081 -13.36302  52.88791  1.000 37.67010  ? 199  GLU A C   1 
ATOM   4836  O O   . GLU B  1 219 ? -71.29999 -13.33098  51.83151  1.000 38.31710  ? 199  GLU A O   1 
ATOM   4837  C CB  . GLU B  1 219 ? -74.17610 -13.92926  51.96829  1.000 49.25535  ? 199  GLU A CB  1 
ATOM   4838  C CG  . GLU B  1 219 ? -74.97861 -15.12061  51.44970  1.000 53.33504  ? 199  GLU A CG  1 
ATOM   4839  C CD  . GLU B  1 219 ? -74.49343 -15.60898  50.09377  1.000 57.74987  ? 199  GLU A CD  1 
ATOM   4840  O OE1 . GLU B  1 219 ? -73.96632 -14.78541  49.30925  1.000 59.85346  ? 199  GLU A OE1 1 
ATOM   4841  O OE2 . GLU B  1 219 ? -74.64240 -16.81672  49.81521  1.000 60.56352  ? 199  GLU A OE2 1 
ATOM   4842  N N   . GLY B  1 220 ? -71.61835 -12.59931  53.93508  1.000 37.85688  ? 200  GLY A N   1 
ATOM   4843  C CA  . GLY B  1 220 ? -70.42645 -11.76370  53.92741  1.000 39.49412  ? 200  GLY A CA  1 
ATOM   4844  C C   . GLY B  1 220 ? -69.12158 -12.52580  54.01530  1.000 40.86986  ? 200  GLY A C   1 
ATOM   4845  O O   . GLY B  1 220 ? -68.05618 -11.92449  53.83909  1.000 38.93526  ? 200  GLY A O   1 
ATOM   4846  N N   . PHE B  1 221 ? -69.17302 -13.82582  54.28920  1.000 34.49555  ? 201  PHE A N   1 
ATOM   4847  C CA  . PHE B  1 221 ? -67.97459 -14.61299  54.52725  1.000 33.36860  ? 201  PHE A CA  1 
ATOM   4848  C C   . PHE B  1 221 ? -67.98790 -15.85800  53.64938  1.000 34.95584  ? 201  PHE A C   1 
ATOM   4849  O O   . PHE B  1 221 ? -69.04397 -16.31422  53.20124  1.000 34.67041  ? 201  PHE A O   1 
ATOM   4850  C CB  . PHE B  1 221 ? -67.87384 -14.99698  56.00931  1.000 34.45343  ? 201  PHE A CB  1 
ATOM   4851  C CG  . PHE B  1 221 ? -67.55274 -13.83328  56.90644  1.000 31.95679  ? 201  PHE A CG  1 
ATOM   4852  C CD1 . PHE B  1 221 ? -68.54342 -12.94484  57.30191  1.000 34.25155  ? 201  PHE A CD1 1 
ATOM   4853  C CD2 . PHE B  1 221 ? -66.25435 -13.60302  57.31391  1.000 30.97259  ? 201  PHE A CD2 1 
ATOM   4854  C CE1 . PHE B  1 221 ? -68.24053 -11.86103  58.11234  1.000 34.89082  ? 201  PHE A CE1 1 
ATOM   4855  C CE2 . PHE B  1 221 ? -65.94235 -12.51980  58.13654  1.000 34.45188  ? 201  PHE A CE2 1 
ATOM   4856  C CZ  . PHE B  1 221 ? -66.93570 -11.64806  58.52636  1.000 36.43861  ? 201  PHE A CZ  1 
ATOM   4857  N N   . ALA B  1 222 ? -66.80060 -16.40815  53.39363  1.000 29.06267  ? 202  ALA A N   1 
ATOM   4858  C CA  . ALA B  1 222 ? -66.69114 -17.69138  52.71764  1.000 27.31060  ? 202  ALA A CA  1 
ATOM   4859  C C   . ALA B  1 222 ? -65.81490 -18.61857  53.54829  1.000 28.96432  ? 202  ALA A C   1 
ATOM   4860  O O   . ALA B  1 222 ? -65.09625 -18.18246  54.44291  1.000 27.62251  ? 202  ALA A O   1 
ATOM   4861  C CB  . ALA B  1 222 ? -66.11681 -17.56477  51.28595  1.000 28.30160  ? 202  ALA A CB  1 
ATOM   4862  N N   . LEU B  1 223 ? -65.87831 -19.91370  53.22973  1.000 28.68029  ? 203  LEU A N   1 
ATOM   4863  C CA  . LEU B  1 223 ? -64.98921 -20.90821  53.82342  1.000 28.08168  ? 203  LEU A CA  1 
ATOM   4864  C C   . LEU B  1 223 ? -63.84953 -21.16515  52.84271  1.000 27.37837  ? 203  LEU A C   1 
ATOM   4865  O O   . LEU B  1 223 ? -64.07867 -21.68498  51.74529  1.000 32.15556  ? 203  LEU A O   1 
ATOM   4866  C CB  . LEU B  1 223 ? -65.77259 -22.18212  54.13401  1.000 30.62154  ? 203  LEU A CB  1 
ATOM   4867  C CG  . LEU B  1 223 ? -66.82857 -21.97615  55.22577  1.000 29.07862  ? 203  LEU A CG  1 
ATOM   4868  C CD1 . LEU B  1 223 ? -67.76933 -23.17062  55.28790  1.000 32.80819  ? 203  LEU A CD1 1 
ATOM   4869  C CD2 . LEU B  1 223 ? -66.18446 -21.76139  56.57406  1.000 25.87987  ? 203  LEU A CD2 1 
ATOM   4870  N N   . ALA B  1 224 ? -62.62876 -20.77151  53.22293  1.000 24.31874  ? 204  ALA A N   1 
ATOM   4871  C CA  . ALA B  1 224 ? -61.43092 -20.95670  52.40708  1.000 22.63536  ? 204  ALA A CA  1 
ATOM   4872  C C   . ALA B  1 224 ? -60.61120 -22.13569  52.92763  1.000 26.58917  ? 204  ALA A C   1 
ATOM   4873  O O   . ALA B  1 224 ? -60.28673 -22.18844  54.11924  1.000 19.66656  ? 204  ALA A O   1 
ATOM   4874  C CB  . ALA B  1 224 ? -60.56074 -19.70323  52.42343  1.000 19.18934  ? 204  ALA A CB  1 
ATOM   4875  N N   . SER B  1 225 ? -60.23604 -23.05058  52.02846  1.000 22.61416  ? 205  SER A N   1 
ATOM   4876  C CA  . SER B  1 225 ? -59.61017 -24.29720  52.45304  1.000 26.64003  ? 205  SER A CA  1 
ATOM   4877  C C   . SER B  1 225 ? -58.19691 -24.07125  52.99243  1.000 24.92393  ? 205  SER A C   1 
ATOM   4878  O O   . SER B  1 225 ? -57.36406 -23.41306  52.35942  1.000 20.41150  ? 205  SER A O   1 
ATOM   4879  C CB  . SER B  1 225 ? -59.56168 -25.30264  51.30371  1.000 30.38121  ? 205  SER A CB  1 
ATOM   4880  O OG  . SER B  1 225 ? -58.89143 -26.48123  51.74371  1.000 27.30264  ? 205  SER A OG  1 
ATOM   4881  N N   . MET B  1 226 ? -57.92317 -24.66008  54.15917  1.000 21.49035  ? 206  MET A N   1 
ATOM   4882  C CA  . MET B  1 226 ? -56.59725 -24.62858  54.76449  1.000 25.22807  ? 206  MET A CA  1 
ATOM   4883  C C   . MET B  1 226 ? -55.62807 -25.64353  54.16460  1.000 25.19201  ? 206  MET A C   1 
ATOM   4884  O O   . MET B  1 226 ? -54.44824 -25.62740  54.53500  1.000 20.92984  ? 206  MET A O   1 
ATOM   4885  C CB  . MET B  1 226 ? -56.71535 -24.90499  56.25538  1.000 22.24650  ? 206  MET A CB  1 
ATOM   4886  C CG  . MET B  1 226 ? -57.63370 -23.89269  56.92532  1.000 27.35203  ? 206  MET A CG  1 
ATOM   4887  S SD  . MET B  1 226 ? -57.62363 -23.99850  58.70939  1.000 28.73772  ? 206  MET A SD  1 
ATOM   4888  C CE  . MET B  1 226 ? -58.75896 -25.14963  59.32992  1.000 38.17095  ? 206  MET A CE  1 
ATOM   4889  N N   . GLY B  1 227 ? -56.07402 -26.50995  53.25808  1.000 22.14190  ? 207  GLY A N   1 
ATOM   4890  C CA  . GLY B  1 227 ? -55.24126 -27.63408  52.84832  1.000 23.85581  ? 207  GLY A CA  1 
ATOM   4891  C C   . GLY B  1 227 ? -55.02877 -28.65394  53.96353  1.000 25.76530  ? 207  GLY A C   1 
ATOM   4892  O O   . GLY B  1 227 ? -53.97480 -29.31868  54.00701  1.000 24.42583  ? 207  GLY A O   1 
ATOM   4893  N N   . ILE B  1 228 ? -55.98549 -28.76621  54.89038  1.000 21.83908  ? 208  ILE A N   1 
ATOM   4894  C CA  . ILE B  1 228 ? -55.95289 -29.74430  55.97756  1.000 21.97982  ? 208  ILE A CA  1 
ATOM   4895  C C   . ILE B  1 228 ? -57.11629 -30.69534  55.76062  1.000 23.77695  ? 208  ILE A C   1 
ATOM   4896  O O   . ILE B  1 228 ? -58.27511 -30.25038  55.71904  1.000 23.77026  ? 208  ILE A O   1 
ATOM   4897  C CB  . ILE B  1 228 ? -56.05751 -29.07363  57.35478  1.000 22.06649  ? 208  ILE A CB  1 
ATOM   4898  C CG1 . ILE B  1 228 ? -54.87244 -28.12657  57.60777  1.000 26.28216  ? 208  ILE A CG1 1 
ATOM   4899  C CG2 . ILE B  1 228 ? -56.15736 -30.12822  58.45922  1.000 21.26682  ? 208  ILE A CG2 1 
ATOM   4900  C CD1 . ILE B  1 228 ? -55.07135 -27.12985  58.81893  1.000 19.46302  ? 208  ILE A CD1 1 
ATOM   4901  N N   . TYR B  1 229 ? -56.82896 -31.99465  55.65458  1.000 23.31037  ? 209  TYR A N   1 
ATOM   4902  C CA  . TYR B  1 229 ? -57.84142 -33.00544  55.35049  1.000 25.34726  ? 209  TYR A CA  1 
ATOM   4903  C C   . TYR B  1 229 ? -57.71235 -34.18994  56.28426  1.000 25.57044  ? 209  TYR A C   1 
ATOM   4904  O O   . TYR B  1 229 ? -56.60958 -34.72093  56.44380  1.000 27.51350  ? 209  TYR A O   1 
ATOM   4905  C CB  . TYR B  1 229 ? -57.72491 -33.52742  53.91521  1.000 27.38488  ? 209  TYR A CB  1 
ATOM   4906  C CG  . TYR B  1 229 ? -57.38694 -32.49284  52.89962  1.000 30.53329  ? 209  TYR A CG  1 
ATOM   4907  C CD1 . TYR B  1 229 ? -56.13953 -32.46153  52.30403  1.000 31.18030  ? 209  TYR A CD1 1 
ATOM   4908  C CD2 . TYR B  1 229 ? -58.33485 -31.54911  52.50390  1.000 29.60919  ? 209  TYR A CD2 1 
ATOM   4909  C CE1 . TYR B  1 229 ? -55.81414 -31.48655  51.36726  1.000 31.49248  ? 209  TYR A CE1 1 
ATOM   4910  C CE2 . TYR B  1 229 ? -58.03179 -30.59152  51.56058  1.000 31.26122  ? 209  TYR A CE2 1 
ATOM   4911  C CZ  . TYR B  1 229 ? -56.77219 -30.55872  50.99818  1.000 32.96456  ? 209  TYR A CZ  1 
ATOM   4912  O OH  . TYR B  1 229 ? -56.47818 -29.59532  50.05236  1.000 32.37949  ? 209  TYR A OH  1 
ATOM   4913  N N   . VAL B  1 230 ? -58.83761 -34.63023  56.85525  1.000 24.56431  ? 210  VAL A N   1 
ATOM   4914  C CA  . VAL B  1 230 ? -58.88981 -35.82548  57.68980  1.000 24.89621  ? 210  VAL A CA  1 
ATOM   4915  C C   . VAL B  1 230 ? -59.61753 -36.92605  56.93085  1.000 29.78272  ? 210  VAL A C   1 
ATOM   4916  O O   . VAL B  1 230 ? -60.72884 -36.71247  56.42623  1.000 29.94083  ? 210  VAL A O   1 
ATOM   4917  C CB  . VAL B  1 230 ? -59.58473 -35.55199  59.03196  1.000 24.41852  ? 210  VAL A CB  1 
ATOM   4918  C CG1 . VAL B  1 230 ? -59.84298 -36.86576  59.74617  1.000 24.90329  ? 210  VAL A CG1 1 
ATOM   4919  C CG2 . VAL B  1 230 ? -58.74638 -34.61003  59.87910  1.000 23.64653  ? 210  VAL A CG2 1 
ATOM   4920  N N   . PHE B  1 231 ? -58.99206 -38.10329  56.85788  1.000 30.34542  ? 211  PHE A N   1 
ATOM   4921  C CA  . PHE B  1 231 ? -59.53785 -39.27260  56.18527  1.000 29.49468  ? 211  PHE A CA  1 
ATOM   4922  C C   . PHE B  1 231 ? -59.46085 -40.47659  57.10441  1.000 30.94369  ? 211  PHE A C   1 
ATOM   4923  O O   . PHE B  1 231 ? -58.54772 -40.58913  57.93461  1.000 27.22551  ? 211  PHE A O   1 
ATOM   4924  C CB  . PHE B  1 231 ? -58.76540 -39.66209  54.90506  1.000 27.80911  ? 211  PHE A CB  1 
ATOM   4925  C CG  . PHE B  1 231 ? -58.70541 -38.60378  53.84208  1.000 27.62306  ? 211  PHE A CG  1 
ATOM   4926  C CD1 . PHE B  1 231 ? -57.62362 -37.74279  53.76882  1.000 27.02079  ? 211  PHE A CD1 1 
ATOM   4927  C CD2 . PHE B  1 231 ? -59.67147 -38.53090  52.84640  1.000 31.40752  ? 211  PHE A CD2 1 
ATOM   4928  C CE1 . PHE B  1 231 ? -57.52442 -36.79375  52.78871  1.000 29.12792  ? 211  PHE A CE1 1 
ATOM   4929  C CE2 . PHE B  1 231 ? -59.57346 -37.56875  51.83077  1.000 29.50312  ? 211  PHE A CE2 1 
ATOM   4930  C CZ  . PHE B  1 231 ? -58.51480 -36.70864  51.80120  1.000 30.99210  ? 211  PHE A CZ  1 
ATOM   4931  N N   . HIS B  1 232 ? -60.39557 -41.41079  56.91690  1.000 34.15481  ? 212  HIS A N   1 
ATOM   4932  C CA  . HIS B  1 232 ? -60.11951 -42.79254  57.29481  1.000 35.20405  ? 212  HIS A CA  1 
ATOM   4933  C C   . HIS B  1 232 ? -59.04417 -43.34257  56.35879  1.000 29.28492  ? 212  HIS A C   1 
ATOM   4934  O O   . HIS B  1 232 ? -59.07475 -43.11372  55.14990  1.000 29.57528  ? 212  HIS A O   1 
ATOM   4935  C CB  . HIS B  1 232 ? -61.38652 -43.66260  57.23634  1.000 38.20169  ? 212  HIS A CB  1 
ATOM   4936  C CG  . HIS B  1 232 ? -62.31007 -43.47373  58.40080  1.000 36.94279  ? 212  HIS A CG  1 
ATOM   4937  N ND1 . HIS B  1 232 ? -63.34199 -42.56002  58.39000  1.000 36.20598  ? 212  HIS A ND1 1 
ATOM   4938  C CD2 . HIS B  1 232 ? -62.35188 -44.06877  59.61528  1.000 37.10449  ? 212  HIS A CD2 1 
ATOM   4939  C CE1 . HIS B  1 232 ? -63.97985 -42.60125  59.54524  1.000 35.94845  ? 212  HIS A CE1 1 
ATOM   4940  N NE2 . HIS B  1 232 ? -63.40187 -43.50970  60.30571  1.000 36.29171  ? 212  HIS A NE2 1 
ATOM   4941  N N   . THR B  1 233 ? -58.05384 -44.02702  56.93584  1.000 30.30119  ? 213  THR A N   1 
ATOM   4942  C CA  . THR B  1 233 ? -56.85813 -44.38662  56.17400  1.000 32.09166  ? 213  THR A CA  1 
ATOM   4943  C C   . THR B  1 233 ? -57.18887 -45.33296  55.02665  1.000 33.75262  ? 213  THR A C   1 
ATOM   4944  O O   . THR B  1 233 ? -56.70082 -45.15668  53.90180  1.000 36.13530  ? 213  THR A O   1 
ATOM   4945  C CB  . THR B  1 233 ? -55.81577 -45.00631  57.11778  1.000 34.30317  ? 213  THR A CB  1 
ATOM   4946  O OG1 . THR B  1 233 ? -55.50554 -44.07372  58.16534  1.000 30.49149  ? 213  THR A OG1 1 
ATOM   4947  C CG2 . THR B  1 233 ? -54.53697 -45.35064  56.37760  1.000 36.05020  ? 213  THR A CG2 1 
ATOM   4948  N N   . LYS B  1 234 ? -58.01757 -46.34148  55.27883  1.000 35.81432  ? 214  LYS A N   1 
ATOM   4949  C CA  . LYS B  1 234 ? -58.34031 -47.26466  54.20294  1.000 41.25984  ? 214  LYS A CA  1 
ATOM   4950  C C   . LYS B  1 234 ? -59.07974 -46.54491  53.08929  1.000 36.44159  ? 214  LYS A C   1 
ATOM   4951  O O   . LYS B  1 234 ? -58.83526 -46.80553  51.90417  1.000 35.40000  ? 214  LYS A O   1 
ATOM   4952  C CB  . LYS B  1 234 ? -59.15625 -48.44438  54.72057  1.000 46.65544  ? 214  LYS A CB  1 
ATOM   4953  C CG  . LYS B  1 234 ? -59.35881 -49.54722  53.65050  1.000 53.63728  ? 214  LYS A CG  1 
ATOM   4954  C CD  . LYS B  1 234 ? -58.14817 -49.67734  52.68253  1.000 58.94916  ? 214  LYS A CD  1 
ATOM   4955  C CE  . LYS B  1 234 ? -58.54431 -50.27444  51.31684  1.000 62.77929  ? 214  LYS A CE  1 
ATOM   4956  N NZ  . LYS B  1 234 ? -59.19063 -49.29180  50.39504  1.000 62.74854  ? 214  LYS A NZ  1 
ATOM   4957  N N   . PHE B  1 235 ? -59.96398 -45.60840  53.44611  1.000 36.52744  ? 215  PHE A N   1 
ATOM   4958  C CA  . PHE B  1 235 ? -60.67029 -44.85473  52.41241  1.000 36.55518  ? 215  PHE A CA  1 
ATOM   4959  C C   . PHE B  1 235 ? -59.69069 -44.02697  51.58383  1.000 37.99208  ? 215  PHE A C   1 
ATOM   4960  O O   . PHE B  1 235 ? -59.75351 -44.02422  50.34764  1.000 35.68379  ? 215  PHE A O   1 
ATOM   4961  C CB  . PHE B  1 235 ? -61.75843 -43.97055  53.03637  1.000 34.95817  ? 215  PHE A CB  1 
ATOM   4962  C CG  . PHE B  1 235 ? -62.47010 -43.07646  52.03769  1.000 41.56115  ? 215  PHE A CG  1 
ATOM   4963  C CD1 . PHE B  1 235 ? -61.98885 -41.80935  51.74199  1.000 40.64138  ? 215  PHE A CD1 1 
ATOM   4964  C CD2 . PHE B  1 235 ? -63.61945 -43.51474  51.37915  1.000 46.51891  ? 215  PHE A CD2 1 
ATOM   4965  C CE1 . PHE B  1 235 ? -62.64426 -40.99503  50.81932  1.000 43.48950  ? 215  PHE A CE1 1 
ATOM   4966  C CE2 . PHE B  1 235 ? -64.27987 -42.69922  50.44977  1.000 46.76610  ? 215  PHE A CE2 1 
ATOM   4967  C CZ  . PHE B  1 235 ? -63.79207 -41.45026  50.16987  1.000 45.85309  ? 215  PHE A CZ  1 
ATOM   4968  N N   . LEU B  1 236 ? -58.78296 -43.30672  52.24889  1.000 34.21420  ? 216  LEU A N   1 
ATOM   4969  C CA  . LEU B  1 236 ? -57.79884 -42.50873  51.52504  1.000 31.83788  ? 216  LEU A CA  1 
ATOM   4970  C C   . LEU B  1 236 ? -56.94507 -43.38423  50.62217  1.000 32.66781  ? 216  LEU A C   1 
ATOM   4971  O O   . LEU B  1 236 ? -56.66388 -43.02135  49.47035  1.000 31.06717  ? 216  LEU A O   1 
ATOM   4972  C CB  . LEU B  1 236 ? -56.89989 -41.74975  52.50845  1.000 30.57997  ? 216  LEU A CB  1 
ATOM   4973  C CG  . LEU B  1 236 ? -55.75423 -40.96004  51.86638  1.000 29.01911  ? 216  LEU A CG  1 
ATOM   4974  C CD1 . LEU B  1 236 ? -56.29561 -39.97356  50.85607  1.000 28.95997  ? 216  LEU A CD1 1 
ATOM   4975  C CD2 . LEU B  1 236 ? -54.93529 -40.21108  52.94337  1.000 28.12716  ? 216  LEU A CD2 1 
ATOM   4976  N N   . MET B  1 237 ? -56.46896 -44.51666  51.15525  1.000 34.05623  ? 217  MET A N   1 
ATOM   4977  C CA  . MET B  1 237 ? -55.63301 -45.41028  50.36074  1.000 35.89823  ? 217  MET A CA  1 
ATOM   4978  C C   . MET B  1 237 ? -56.33933 -45.76988  49.06054  1.000 40.29545  ? 217  MET A C   1 
ATOM   4979  O O   . MET B  1 237 ? -55.72282 -45.79129  47.98686  1.000 40.63653  ? 217  MET A O   1 
ATOM   4980  C CB  . MET B  1 237 ? -55.31235 -46.68105  51.14217  1.000 34.18545  ? 217  MET A CB  1 
ATOM   4981  C CG  . MET B  1 237 ? -54.39506 -46.49150  52.35402  1.000 40.70403  ? 217  MET A CG  1 
ATOM   4982  S SD  . MET B  1 237 ? -52.89900 -45.53399  52.03655  1.000 48.43292  ? 217  MET A SD  1 
ATOM   4983  C CE  . MET B  1 237 ? -53.27815 -43.90330  52.68769  1.000 42.67623  ? 217  MET A CE  1 
ATOM   4984  N N   . GLU B  1 238 ? -57.64478 -46.03572  49.14393  1.000 42.71477  ? 218  GLU A N   1 
ATOM   4985  C CA  . GLU B  1 238 ? -58.41432 -46.38769  47.95602  1.000 45.74098  ? 218  GLU A CA  1 
ATOM   4986  C C   . GLU B  1 238 ? -58.51509 -45.19857  47.01361  1.000 40.72498  ? 218  GLU A C   1 
ATOM   4987  O O   . GLU B  1 238 ? -58.28244 -45.32464  45.79955  1.000 42.27505  ? 218  GLU A O   1 
ATOM   4988  C CB  . GLU B  1 238 ? -59.80691 -46.87320  48.36403  1.000 50.08790  ? 218  GLU A CB  1 
ATOM   4989  N N   . ALA B  1 239 ? -58.86382 -44.03592  47.56754  1.000 32.64231  ? 219  ALA A N   1 
ATOM   4990  C CA  . ALA B  1 239 ? -58.93533 -42.80425  46.78845  1.000 35.24045  ? 219  ALA A CA  1 
ATOM   4991  C C   . ALA B  1 239 ? -57.61667 -42.51130  46.07447  1.000 39.17521  ? 219  ALA A C   1 
ATOM   4992  O O   . ALA B  1 239 ? -57.61049 -42.07206  44.91652  1.000 41.45501  ? 219  ALA A O   1 
ATOM   4993  C CB  . ALA B  1 239 ? -59.31900 -41.64197  47.71359  1.000 33.41176  ? 219  ALA A CB  1 
ATOM   4994  N N   . LEU B  1 240 ? -56.48788 -42.74619  46.74567  1.000 35.58678  ? 220  LEU A N   1 
ATOM   4995  C CA  . LEU B  1 240 ? -55.18908 -42.48421  46.12637  1.000 31.74394  ? 220  LEU A CA  1 
ATOM   4996  C C   . LEU B  1 240 ? -54.88253 -43.50612  45.03185  1.000 32.60659  ? 220  LEU A C   1 
ATOM   4997  O O   . LEU B  1 240 ? -54.30159 -43.15982  43.99032  1.000 32.71886  ? 220  LEU A O   1 
ATOM   4998  C CB  . LEU B  1 240 ? -54.09935 -42.51019  47.18081  1.000 31.20233  ? 220  LEU A CB  1 
ATOM   4999  C CG  . LEU B  1 240 ? -53.93931 -41.30817  48.13485  1.000 32.54880  ? 220  LEU A CG  1 
ATOM   5000  C CD1 . LEU B  1 240 ? -52.66221 -41.47848  48.95713  1.000 29.94233  ? 220  LEU A CD1 1 
ATOM   5001  C CD2 . LEU B  1 240 ? -53.92733 -39.98745  47.38906  1.000 31.62057  ? 220  LEU A CD2 1 
ATOM   5002  N N   . ARG B  1 241 ? -55.22626 -44.77197  45.26343  1.000 35.72636  ? 221  ARG A N   1 
ATOM   5003  C CA  . ARG B  1 241 ? -55.11088 -45.76387  44.19132  1.000 43.70528  ? 221  ARG A CA  1 
ATOM   5004  C C   . ARG B  1 241 ? -55.94210 -45.35649  42.97758  1.000 46.55061  ? 221  ARG A C   1 
ATOM   5005  O O   . ARG B  1 241 ? -55.43508 -45.34302  41.84979  1.000 48.28698  ? 221  ARG A O   1 
ATOM   5006  C CB  . ARG B  1 241 ? -55.49872 -47.15584  44.70704  1.000 45.04338  ? 221  ARG A CB  1 
ATOM   5007  C CG  . ARG B  1 241 ? -54.56937 -47.62111  45.82896  1.000 45.76322  ? 221  ARG A CG  1 
ATOM   5008  C CD  . ARG B  1 241 ? -54.23320 -49.10133  45.80018  1.000 50.68456  ? 221  ARG A CD  1 
ATOM   5009  N NE  . ARG B  1 241 ? -53.11131 -49.45235  46.68100  1.000 51.97961  ? 221  ARG A NE  1 
ATOM   5010  C CZ  . ARG B  1 241 ? -53.23158 -49.76449  47.97341  1.000 54.62231  ? 221  ARG A CZ  1 
ATOM   5011  N NH1 . ARG B  1 241 ? -54.42387 -49.75677  48.55707  1.000 56.50306  ? 221  ARG A NH1 1 
ATOM   5012  N NH2 . ARG B  1 241 ? -52.15901 -50.08841  48.68859  1.000 54.25847  ? 221  ARG A NH2 1 
ATOM   5013  N N   . ARG B  1 242 ? -57.21433 -44.99037  43.18658  1.000 50.06550  ? 222  ARG A N   1 
ATOM   5014  C CA  . ARG B  1 242 ? -58.04128 -44.51277  42.07370  1.000 50.43938  ? 222  ARG A CA  1 
ATOM   5015  C C   . ARG B  1 242 ? -57.36332 -43.35612  41.35048  1.000 45.55629  ? 222  ARG A C   1 
ATOM   5016  O O   . ARG B  1 242 ? -57.32102 -43.31045  40.11173  1.000 41.66094  ? 222  ARG A O   1 
ATOM   5017  C CB  . ARG B  1 242 ? -59.42466 -44.06400  42.56245  1.000 56.36408  ? 222  ARG A CB  1 
ATOM   5018  C CG  . ARG B  1 242 ? -60.28336 -45.08904  43.29709  1.000 63.90190  ? 222  ARG A CG  1 
ATOM   5019  C CD  . ARG B  1 242 ? -61.53673 -44.40291  43.89963  1.000 71.41178  ? 222  ARG A CD  1 
ATOM   5020  N NE  . ARG B  1 242 ? -61.88764 -44.92269  45.22660  1.000 76.57478  ? 222  ARG A NE  1 
ATOM   5021  C CZ  . ARG B  1 242 ? -62.47349 -44.21436  46.19268  1.000 78.24619  ? 222  ARG A CZ  1 
ATOM   5022  N NH1 . ARG B  1 242 ? -62.74568 -44.78498  47.36322  1.000 78.45996  ? 222  ARG A NH1 1 
ATOM   5023  N NH2 . ARG B  1 242 ? -62.77245 -42.93338  46.00096  1.000 79.18213  ? 222  ARG A NH2 1 
ATOM   5024  N N   . ASP B  1 243 ? -56.83072 -42.40653  42.12120  1.000 41.73346  ? 223  ASP A N   1 
ATOM   5025  C CA  . ASP B  1 243 ? -56.25684 -41.19159  41.55068  1.000 41.65602  ? 223  ASP A CA  1 
ATOM   5026  C C   . ASP B  1 243 ? -55.04240 -41.49909  40.68588  1.000 39.29133  ? 223  ASP A C   1 
ATOM   5027  O O   . ASP B  1 243 ? -54.81217 -40.83211  39.67015  1.000 37.83159  ? 223  ASP A O   1 
ATOM   5028  C CB  . ASP B  1 243 ? -55.87212 -40.21079  42.66884  1.000 38.86896  ? 223  ASP A CB  1 
ATOM   5029  C CG  . ASP B  1 243 ? -55.26256 -38.91863  42.13017  1.000 41.91822  ? 223  ASP A CG  1 
ATOM   5030  O OD1 . ASP B  1 243 ? -56.01214 -38.13765  41.51204  1.000 42.83886  ? 223  ASP A OD1 1 
ATOM   5031  O OD2 . ASP B  1 243 ? -54.04653 -38.67888  42.32087  1.000 41.23376  ? 223  ASP A OD2 1 
ATOM   5032  N N   . ALA B  1 244 ? -54.23540 -42.48291  41.09220  1.000 37.75236  ? 224  ALA A N   1 
ATOM   5033  C CA  . ALA B  1 244 ? -53.01315 -42.80628  40.36869  1.000 37.86629  ? 224  ALA A CA  1 
ATOM   5034  C C   . ALA B  1 244 ? -53.30197 -43.44543  39.01595  1.000 45.94786  ? 224  ALA A C   1 
ATOM   5035  O O   . ALA B  1 244 ? -52.40859 -43.48393  38.15866  1.000 51.13239  ? 224  ALA A O   1 
ATOM   5036  C CB  . ALA B  1 244 ? -52.14316 -43.74276  41.20720  1.000 33.70326  ? 224  ALA A CB  1 
ATOM   5037  N N   . ALA B  1 245 ? -54.52713 -43.94661  38.81499  1.000 43.01296  ? 225  ALA A N   1 
ATOM   5038  C CA  . ALA B  1 245 ? -54.94280 -44.55349  37.55657  1.000 42.64961  ? 225  ALA A CA  1 
ATOM   5039  C C   . ALA B  1 245 ? -55.62292 -43.56967  36.60745  1.000 49.19128  ? 225  ALA A C   1 
ATOM   5040  O O   . ALA B  1 245 ? -55.64423 -43.81503  35.39619  1.000 54.87322  ? 225  ALA A O   1 
ATOM   5041  C CB  . ALA B  1 245 ? -55.87918 -45.73121  37.84349  1.000 37.24685  ? 225  ALA A CB  1 
ATOM   5042  N N   . ASP B  1 246 ? -56.16672 -42.47224  37.12215  1.000 48.07226  ? 226  ASP A N   1 
ATOM   5043  C CA  . ASP B  1 246 ? -56.87479 -41.48510  36.32266  1.000 48.41386  ? 226  ASP A CA  1 
ATOM   5044  C C   . ASP B  1 246 ? -55.88256 -40.65332  35.52983  1.000 47.44719  ? 226  ASP A C   1 
ATOM   5045  O O   . ASP B  1 246 ? -55.21388 -39.78940  36.11137  1.000 44.02982  ? 226  ASP A O   1 
ATOM   5046  C CB  . ASP B  1 246 ? -57.73338 -40.58350  37.21038  1.000 49.36916  ? 226  ASP A CB  1 
ATOM   5047  C CG  . ASP B  1 246 ? -58.63456 -39.62667  36.40367  1.000 55.86480  ? 226  ASP A CG  1 
ATOM   5048  O OD1 . ASP B  1 246 ? -59.39562 -38.84693  37.02514  1.000 57.68491  ? 226  ASP A OD1 1 
ATOM   5049  O OD2 . ASP B  1 246 ? -58.58515 -39.63060  35.14840  1.000 54.97461  ? 226  ASP A OD2 1 
ATOM   5050  N N   . PRO B  1 247 ? -55.79136 -40.83250  34.20653  1.000 46.38679  ? 227  PRO A N   1 
ATOM   5051  C CA  . PRO B  1 247 ? -54.86122 -40.00954  33.41651  1.000 43.90124  ? 227  PRO A CA  1 
ATOM   5052  C C   . PRO B  1 247 ? -55.23456 -38.54550  33.39667  1.000 42.87553  ? 227  PRO A C   1 
ATOM   5053  O O   . PRO B  1 247 ? -54.36078 -37.69613  33.17168  1.000 42.65066  ? 227  PRO A O   1 
ATOM   5054  C CB  . PRO B  1 247 ? -54.95564 -40.62179  32.00727  1.000 43.55390  ? 227  PRO A CB  1 
ATOM   5055  C CG  . PRO B  1 247 ? -55.85019 -41.85348  32.15346  1.000 45.61751  ? 227  PRO A CG  1 
ATOM   5056  C CD  . PRO B  1 247 ? -56.68396 -41.62948  33.35334  1.000 46.33220  ? 227  PRO A CD  1 
ATOM   5057  N N   . THR B  1 248 ? -56.50890 -38.21464  33.61199  1.000 45.40988  ? 228  THR A N   1 
ATOM   5058  C CA  . THR B  1 248 ? -56.92194 -36.81342  33.67625  1.000 46.08238  ? 228  THR A CA  1 
ATOM   5059  C C   . THR B  1 248 ? -56.49624 -36.13271  34.97326  1.000 43.63956  ? 228  THR A C   1 
ATOM   5060  O O   . THR B  1 248 ? -56.48351 -34.89398  35.03080  1.000 38.74367  ? 228  THR A O   1 
ATOM   5061  C CB  . THR B  1 248 ? -58.44345 -36.71952  33.50458  1.000 48.48373  ? 228  THR A CB  1 
ATOM   5062  O OG1 . THR B  1 248 ? -59.09153 -37.57497  34.45929  1.000 48.03931  ? 228  THR A OG1 1 
ATOM   5063  C CG2 . THR B  1 248 ? -58.85117 -37.16296  32.09619  1.000 48.51693  ? 228  THR A CG2 1 
ATOM   5064  N N   . SER B  1 249 ? -56.11425 -36.91087  35.99082  1.000 44.66445  ? 229  SER A N   1 
ATOM   5065  C CA  . SER B  1 249 ? -55.83934 -36.37729  37.32121  1.000 41.11167  ? 229  SER A CA  1 
ATOM   5066  C C   . SER B  1 249 ? -54.51031 -35.62659  37.36171  1.000 41.37531  ? 229  SER A C   1 
ATOM   5067  O O   . SER B  1 249 ? -53.47093 -36.14557  36.94271  1.000 41.21035  ? 229  SER A O   1 
ATOM   5068  C CB  . SER B  1 249 ? -55.82334 -37.50126  38.35722  1.000 41.86835  ? 229  SER A CB  1 
ATOM   5069  O OG  . SER B  1 249 ? -55.27903 -37.01598  39.58398  1.000 44.71939  ? 229  SER A OG  1 
ATOM   5070  N N   . SER B  1 250 ? -54.54393 -34.40893  37.89101  1.000 38.74523  ? 230  SER A N   1 
ATOM   5071  C CA  . SER B  1 250 ? -53.33432 -33.64648  38.16433  1.000 40.42678  ? 230  SER A CA  1 
ATOM   5072  C C   . SER B  1 250 ? -52.62597 -34.09828  39.44632  1.000 38.94632  ? 230  SER A C   1 
ATOM   5073  O O   . SER B  1 250 ? -51.60466 -33.50559  39.82332  1.000 39.68617  ? 230  SER A O   1 
ATOM   5074  C CB  . SER B  1 250 ? -53.69696 -32.16130  38.22795  1.000 43.30709  ? 230  SER A CB  1 
ATOM   5075  O OG  . SER B  1 250 ? -52.89266 -31.46060  39.15016  1.000 46.46228  ? 230  SER A OG  1 
ATOM   5076  N N   . ARG B  1 251 ? -53.15354 -35.12281  40.12100  1.000 36.89665  ? 231  ARG A N   1 
ATOM   5077  C CA  . ARG B  1 251 ? -52.50472 -35.76540  41.27074  1.000 37.26855  ? 231  ARG A CA  1 
ATOM   5078  C C   . ARG B  1 251 ? -52.39677 -34.81098  42.46602  1.000 41.32841  ? 231  ARG A C   1 
ATOM   5079  O O   . ARG B  1 251 ? -51.36006 -34.71881  43.11631  1.000 42.93130  ? 231  ARG A O   1 
ATOM   5080  C CB  . ARG B  1 251 ? -51.13226 -36.33013  40.88681  1.000 35.39757  ? 231  ARG A CB  1 
ATOM   5081  C CG  . ARG B  1 251 ? -51.13540 -37.10312  39.53958  1.000 37.47896  ? 231  ARG A CG  1 
ATOM   5082  C CD  . ARG B  1 251 ? -52.04726 -38.34813  39.57314  1.000 39.20776  ? 231  ARG A CD  1 
ATOM   5083  N NE  . ARG B  1 251 ? -51.86163 -39.17103  40.77196  1.000 41.46220  ? 231  ARG A NE  1 
ATOM   5084  C CZ  . ARG B  1 251 ? -50.77867 -39.90210  41.03024  1.000 42.02651  ? 231  ARG A CZ  1 
ATOM   5085  N NH1 . ARG B  1 251 ? -49.75999 -39.90089  40.18192  1.000 40.57801  ? 231  ARG A NH1 1 
ATOM   5086  N NH2 . ARG B  1 251 ? -50.70125 -40.61450  42.15635  1.000 43.31732  ? 231  ARG A NH2 1 
ATOM   5087  N N   . ASP B  1 252 ? -53.49818 -34.12923  42.77301  1.000 42.49493  ? 232  ASP A N   1 
ATOM   5088  C CA  . ASP B  1 252 ? -53.51214 -33.03731  43.74120  1.000 42.11596  ? 232  ASP A CA  1 
ATOM   5089  C C   . ASP B  1 252 ? -54.69955 -33.22824  44.67201  1.000 38.82212  ? 232  ASP A C   1 
ATOM   5090  O O   . ASP B  1 252 ? -55.80385 -33.52681  44.21149  1.000 32.02651  ? 232  ASP A O   1 
ATOM   5091  C CB  . ASP B  1 252 ? -53.60941 -31.68337  43.01348  1.000 46.57141  ? 232  ASP A CB  1 
ATOM   5092  C CG  . ASP B  1 252 ? -53.36703 -30.50445  43.93096  1.000 44.22406  ? 232  ASP A CG  1 
ATOM   5093  O OD1 . ASP B  1 252 ? -52.19415 -30.23548  44.25087  1.000 42.53828  ? 232  ASP A OD1 1 
ATOM   5094  O OD2 . ASP B  1 252 ? -54.35336 -29.84481  44.31048  1.000 41.87058  ? 232  ASP A OD2 1 
ATOM   5095  N N   . PHE B  1 253 ? -54.48053 -33.07559  45.98183  1.000 37.30352  ? 233  PHE A N   1 
ATOM   5096  C CA  . PHE B  1 253 ? -55.60887 -33.18330  46.90130  1.000 34.40646  ? 233  PHE A CA  1 
ATOM   5097  C C   . PHE B  1 253 ? -56.65964 -32.12789  46.58562  1.000 35.81908  ? 233  PHE A C   1 
ATOM   5098  O O   . PHE B  1 253 ? -57.84648 -32.43860  46.42676  1.000 41.05862  ? 233  PHE A O   1 
ATOM   5099  C CB  . PHE B  1 253 ? -55.13816 -33.04540  48.35635  1.000 30.45899  ? 233  PHE A CB  1 
ATOM   5100  C CG  . PHE B  1 253 ? -54.78051 -34.36764  49.01631  1.000 30.44091  ? 233  PHE A CG  1 
ATOM   5101  C CD1 . PHE B  1 253 ? -55.77575 -35.22896  49.46463  1.000 29.78084  ? 233  PHE A CD1 1 
ATOM   5102  C CD2 . PHE B  1 253 ? -53.45032 -34.74627  49.16753  1.000 28.70929  ? 233  PHE A CD2 1 
ATOM   5103  C CE1 . PHE B  1 253 ? -55.44468 -36.42210  50.07745  1.000 27.30782  ? 233  PHE A CE1 1 
ATOM   5104  C CE2 . PHE B  1 253 ? -53.11280 -35.95870  49.78933  1.000 26.81442  ? 233  PHE A CE2 1 
ATOM   5105  C CZ  . PHE B  1 253 ? -54.10195 -36.77797  50.23794  1.000 27.21367  ? 233  PHE A CZ  1 
ATOM   5106  N N   . GLY B  1 254 ? -56.23905 -30.86379  46.49140  1.000 37.45270  ? 234  GLY A N   1 
ATOM   5107  C CA  . GLY B  1 254 ? -57.20478 -29.78740  46.33251  1.000 41.60600  ? 234  GLY A CA  1 
ATOM   5108  C C   . GLY B  1 254 ? -57.96869 -29.86058  45.02676  1.000 44.25969  ? 234  GLY A C   1 
ATOM   5109  O O   . GLY B  1 254 ? -59.18888 -29.67296  44.99710  1.000 48.00847  ? 234  GLY A O   1 
ATOM   5110  N N   . LYS B  1 255 ? -57.27763 -30.16427  43.93277  1.000 43.38729  ? 235  LYS A N   1 
ATOM   5111  C CA  . LYS B  1 255 ? -57.95647 -30.12101  42.64387  1.000 46.61304  ? 235  LYS A CA  1 
ATOM   5112  C C   . LYS B  1 255 ? -58.53334 -31.45892  42.20952  1.000 46.02477  ? 235  LYS A C   1 
ATOM   5113  O O   . LYS B  1 255 ? -59.48844 -31.46451  41.43155  1.000 50.35479  ? 235  LYS A O   1 
ATOM   5114  C CB  . LYS B  1 255 ? -57.01332 -29.57306  41.56642  1.000 47.06781  ? 235  LYS A CB  1 
ATOM   5115  C CG  . LYS B  1 255 ? -56.80512 -28.06703  41.72399  1.000 48.91353  ? 235  LYS A CG  1 
ATOM   5116  C CD  . LYS B  1 255 ? -56.10290 -27.42856  40.54425  1.000 51.50788  ? 235  LYS A CD  1 
ATOM   5117  C CE  . LYS B  1 255 ? -54.62734 -27.21471  40.85105  1.000 52.01423  ? 235  LYS A CE  1 
ATOM   5118  N NZ  . LYS B  1 255 ? -53.86275 -28.49755  40.69228  1.000 56.86802  ? 235  LYS A NZ  1 
ATOM   5119  N N   . ASP B  1 256 ? -58.02174 -32.58745  42.70573  1.000 42.13995  ? 236  ASP A N   1 
ATOM   5120  C CA  . ASP B  1 256 ? -58.48953 -33.88894  42.23033  1.000 39.55674  ? 236  ASP A CA  1 
ATOM   5121  C C   . ASP B  1 256 ? -59.17952 -34.72556  43.30047  1.000 39.33169  ? 236  ASP A C   1 
ATOM   5122  O O   . ASP B  1 256 ? -60.30121 -35.17547  43.07311  1.000 39.38573  ? 236  ASP A O   1 
ATOM   5123  C CB  . ASP B  1 256 ? -57.31762 -34.67836  41.61547  1.000 40.26953  ? 236  ASP A CB  1 
ATOM   5124  C CG  . ASP B  1 256 ? -56.65492 -33.93292  40.45879  1.000 43.25483  ? 236  ASP A CG  1 
ATOM   5125  O OD1 . ASP B  1 256 ? -55.53849 -33.39562  40.64549  1.000 41.07574  ? 236  ASP A OD1 1 
ATOM   5126  O OD2 . ASP B  1 256 ? -57.24813 -33.88727  39.35969  1.000 43.50563  ? 236  ASP A OD2 1 
ATOM   5127  N N   . ILE B  1 257 ? -58.54205 -34.99292  44.45092  1.000 34.94365  ? 237  ILE A N   1 
ATOM   5128  C CA  . ILE B  1 257 ? -59.13548 -35.93872  45.40309  1.000 32.66348  ? 237  ILE A CA  1 
ATOM   5129  C C   . ILE B  1 257 ? -60.42264 -35.36970  45.98018  1.000 36.10124  ? 237  ILE A C   1 
ATOM   5130  O O   . ILE B  1 257 ? -61.48658 -35.99691  45.90782  1.000 36.51000  ? 237  ILE A O   1 
ATOM   5131  C CB  . ILE B  1 257 ? -58.15172 -36.29722  46.53431  1.000 40.30523  ? 237  ILE A CB  1 
ATOM   5132  C CG1 . ILE B  1 257 ? -57.05328 -37.18641  46.00015  1.000 42.70126  ? 237  ILE A CG1 1 
ATOM   5133  C CG2 . ILE B  1 257 ? -58.86653 -37.08173  47.63843  1.000 29.11314  ? 237  ILE A CG2 1 
ATOM   5134  C CD1 . ILE B  1 257 ? -55.97667 -36.40335  45.47422  1.000 42.62353  ? 237  ILE A CD1 1 
ATOM   5135  N N   . ILE B  1 258 ? -60.33156 -34.17890  46.59107  1.000 33.61947  ? 238  ILE A N   1 
ATOM   5136  C CA  . ILE B  1 258 ? -61.48891 -33.60118  47.27595  1.000 37.62361  ? 238  ILE A CA  1 
ATOM   5137  C C   . ILE B  1 258 ? -62.66132 -33.33356  46.32797  1.000 39.91222  ? 238  ILE A C   1 
ATOM   5138  O O   . ILE B  1 258 ? -63.78855 -33.75487  46.64110  1.000 39.27671  ? 238  ILE A O   1 
ATOM   5139  C CB  . ILE B  1 258 ? -61.07002 -32.36165  48.07732  1.000 36.14798  ? 238  ILE A CB  1 
ATOM   5140  C CG1 . ILE B  1 258 ? -60.29241 -32.72941  49.36895  1.000 37.87319  ? 238  ILE A CG1 1 
ATOM   5141  C CG2 . ILE B  1 258 ? -62.29152 -31.51820  48.37634  1.000 33.45009  ? 238  ILE A CG2 1 
ATOM   5142  C CD1 . ILE B  1 258 ? -58.88717 -33.38492  49.20370  1.000 40.07894  ? 238  ILE A CD1 1 
ATOM   5143  N N   . PRO B  1 259 ? -62.48625 -32.65112  45.18686  1.000 39.97652  ? 239  PRO A N   1 
ATOM   5144  C CA  . PRO B  1 259 ? -63.63269 -32.48170  44.26789  1.000 41.29545  ? 239  PRO A CA  1 
ATOM   5145  C C   . PRO B  1 259 ? -64.31334 -33.79098  43.90575  1.000 42.55506  ? 239  PRO A C   1 
ATOM   5146  O O   . PRO B  1 259 ? -65.54851 -33.85912  43.83386  1.000 41.79928  ? 239  PRO A O   1 
ATOM   5147  C CB  . PRO B  1 259 ? -62.99139 -31.81987  43.04120  1.000 42.88652  ? 239  PRO A CB  1 
ATOM   5148  C CG  . PRO B  1 259 ? -61.81514 -31.08389  43.59509  1.000 40.68017  ? 239  PRO A CG  1 
ATOM   5149  C CD  . PRO B  1 259 ? -61.27653 -31.97719  44.68163  1.000 40.72401  ? 239  PRO A CD  1 
ATOM   5150  N N   . TYR B  1 260 ? -63.52573 -34.84330  43.68381  1.000 43.63566  ? 240  TYR A N   1 
ATOM   5151  C CA  . TYR B  1 260 ? -64.09461 -36.16967  43.45201  1.000 45.50049  ? 240  TYR A CA  1 
ATOM   5152  C C   . TYR B  1 260 ? -65.04152 -36.55376  44.58507  1.000 42.49310  ? 240  TYR A C   1 
ATOM   5153  O O   . TYR B  1 260 ? -66.17904 -36.97470  44.35263  1.000 36.68934  ? 240  TYR A O   1 
ATOM   5154  C CB  . TYR B  1 260 ? -62.95840 -37.18586  43.30876  1.000 53.10289  ? 240  TYR A CB  1 
ATOM   5155  C CG  . TYR B  1 260 ? -63.33114 -38.54847  42.75287  1.000 64.98798  ? 240  TYR A CG  1 
ATOM   5156  C CD1 . TYR B  1 260 ? -64.27236 -39.36149  43.38681  1.000 68.98307  ? 240  TYR A CD1 1 
ATOM   5157  C CD2 . TYR B  1 260 ? -62.71196 -39.04122  41.60614  1.000 71.11845  ? 240  TYR A CD2 1 
ATOM   5158  C CE1 . TYR B  1 260 ? -64.60203 -40.61075  42.87772  1.000 72.52686  ? 240  TYR A CE1 1 
ATOM   5159  C CE2 . TYR B  1 260 ? -63.03693 -40.28772  41.09297  1.000 74.42122  ? 240  TYR A CE2 1 
ATOM   5160  C CZ  . TYR B  1 260 ? -63.98076 -41.06345  41.73299  1.000 75.67364  ? 240  TYR A CZ  1 
ATOM   5161  O OH  . TYR B  1 260 ? -64.29942 -42.29904  41.22615  1.000 79.20929  ? 240  TYR A OH  1 
ATOM   5162  N N   . ILE B  1 261 ? -64.58171 -36.40764  45.83099  1.000 39.98054  ? 241  ILE A N   1 
ATOM   5163  C CA  . ILE B  1 261 ? -65.39621 -36.83313  46.96405  1.000 39.64977  ? 241  ILE A CA  1 
ATOM   5164  C C   . ILE B  1 261 ? -66.59212 -35.90911  47.14014  1.000 42.36432  ? 241  ILE A C   1 
ATOM   5165  O O   . ILE B  1 261 ? -67.67838 -36.35216  47.53385  1.000 43.20969  ? 241  ILE A O   1 
ATOM   5166  C CB  . ILE B  1 261 ? -64.54970 -36.88578  48.25180  1.000 35.26783  ? 241  ILE A CB  1 
ATOM   5167  C CG1 . ILE B  1 261 ? -63.39606 -37.88257  48.12004  1.000 33.57392  ? 241  ILE A CG1 1 
ATOM   5168  C CG2 . ILE B  1 261 ? -65.43035 -37.21416  49.43461  1.000 34.11183  ? 241  ILE A CG2 1 
ATOM   5169  C CD1 . ILE B  1 261 ? -62.36638 -37.77017  49.25547  1.000 31.04413  ? 241  ILE A CD1 1 
ATOM   5170  N N   . VAL B  1 262 ? -66.39194 -34.60010  46.93614  1.000 40.77000  ? 242  VAL A N   1 
ATOM   5171  C CA  . VAL B  1 262 ? -67.50924 -33.67014  47.04624  1.000 44.02782  ? 242  VAL A CA  1 
ATOM   5172  C C   . VAL B  1 262 ? -68.62119 -34.10696  46.10579  1.000 51.45994  ? 242  VAL A C   1 
ATOM   5173  O O   . VAL B  1 262 ? -69.80254 -34.14395  46.47826  1.000 52.46278  ? 242  VAL A O   1 
ATOM   5174  C CB  . VAL B  1 262 ? -67.05877 -32.22978  46.74061  1.000 38.00160  ? 242  VAL A CB  1 
ATOM   5175  C CG1 . VAL B  1 262 ? -68.29286 -31.34575  46.47019  1.000 36.29736  ? 242  VAL A CG1 1 
ATOM   5176  C CG2 . VAL B  1 262 ? -66.19871 -31.66538  47.85798  1.000 35.87737  ? 242  VAL A CG2 1 
ATOM   5177  N N   . GLU B  1 263 ? -68.24125 -34.51533  44.89377  1.000 55.12252  ? 243  GLU A N   1 
ATOM   5178  C CA  . GLU B  1 263 ? -69.22326 -34.90257  43.89285  1.000 59.01857  ? 243  GLU A CA  1 
ATOM   5179  C C   . GLU B  1 263 ? -69.86368 -36.24422  44.22540  1.000 65.08564  ? 243  GLU A C   1 
ATOM   5180  O O   . GLU B  1 263 ? -71.09008 -36.38266  44.15710  1.000 72.62276  ? 243  GLU A O   1 
ATOM   5181  C CB  . GLU B  1 263 ? -68.57145 -34.95420  42.51672  1.000 59.54101  ? 243  GLU A CB  1 
ATOM   5182  C CG  . GLU B  1 263 ? -69.51220 -35.51524  41.45233  1.000 65.53572  ? 243  GLU A CG  1 
ATOM   5183  C CD  . GLU B  1 263 ? -69.00928 -35.28519  40.04683  1.000 70.06260  ? 243  GLU A CD  1 
ATOM   5184  O OE1 . GLU B  1 263 ? -68.46111 -34.18908  39.79063  1.000 70.71107  ? 243  GLU A OE1 1 
ATOM   5185  O OE2 . GLU B  1 263 ? -69.16952 -36.19323  39.19945  1.000 73.46254  ? 243  GLU A OE2 1 
ATOM   5186  N N   . HIS B  1 264 ? -69.05696 -37.24147  44.59152  1.000 62.26132  ? 244  HIS A N   1 
ATOM   5187  C CA  . HIS B  1 264 ? -69.54757 -38.61146  44.70962  1.000 58.33337  ? 244  HIS A CA  1 
ATOM   5188  C C   . HIS B  1 264 ? -69.77806 -39.06870  46.14345  1.000 56.78687  ? 244  HIS A C   1 
ATOM   5189  O O   . HIS B  1 264 ? -70.59836 -39.96563  46.36084  1.000 56.80231  ? 244  HIS A O   1 
ATOM   5190  C CB  . HIS B  1 264 ? -68.57543 -39.58062  44.02378  1.000 59.61282  ? 244  HIS A CB  1 
ATOM   5191  C CG  . HIS B  1 264 ? -68.53948 -39.44348  42.53299  1.000 63.89213  ? 244  HIS A CG  1 
ATOM   5192  N ND1 . HIS B  1 264 ? -67.38041 -39.58841  41.79749  1.000 65.06447  ? 244  HIS A ND1 1 
ATOM   5193  C CD2 . HIS B  1 264 ? -69.52402 -39.18893  41.63607  1.000 64.06414  ? 244  HIS A CD2 1 
ATOM   5194  C CE1 . HIS B  1 264 ? -67.65170 -39.41676  40.51365  1.000 65.02251  ? 244  HIS A CE1 1 
ATOM   5195  N NE2 . HIS B  1 264 ? -68.94345 -39.17164  40.39040  1.000 63.79480  ? 244  HIS A NE2 1 
ATOM   5196  N N   . GLY B  1 265 ? -69.07564 -38.49752  47.12537  1.000 53.51624  ? 245  GLY A N   1 
ATOM   5197  C CA  . GLY B  1 265 ? -69.23941 -38.91248  48.50933  1.000 51.76347  ? 245  GLY A CA  1 
ATOM   5198  C C   . GLY B  1 265 ? -69.64198 -37.77635  49.43116  1.000 48.98730  ? 245  GLY A C   1 
ATOM   5199  O O   . GLY B  1 265 ? -70.33624 -36.84874  48.99641  1.000 46.96921  ? 245  GLY A O   1 
ATOM   5200  N N   . LYS B  1 266 ? -69.21241 -37.81926  50.69815  1.000 42.21221  ? 246  LYS A N   1 
ATOM   5201  C CA  . LYS B  1 266 ? -69.61557 -36.81527  51.67563  1.000 40.68666  ? 246  LYS A CA  1 
ATOM   5202  C C   . LYS B  1 266 ? -68.40495 -36.05585  52.21176  1.000 41.66097  ? 246  LYS A C   1 
ATOM   5203  O O   . LYS B  1 266 ? -67.56023 -36.63064  52.90109  1.000 37.23559  ? 246  LYS A O   1 
ATOM   5204  C CB  . LYS B  1 266 ? -70.39258 -37.44207  52.82841  1.000 41.16700  ? 246  LYS A CB  1 
ATOM   5205  C CG  . LYS B  1 266 ? -71.13757 -36.38090  53.62263  1.000 44.09936  ? 246  LYS A CG  1 
ATOM   5206  C CD  . LYS B  1 266 ? -71.02045 -36.59149  55.10197  1.000 50.56020  ? 246  LYS A CD  1 
ATOM   5207  C CE  . LYS B  1 266 ? -72.29512 -37.21535  55.63773  1.000 57.26229  ? 246  LYS A CE  1 
ATOM   5208  N NZ  . LYS B  1 266 ? -72.50619 -36.87521  57.08366  1.000 61.11729  ? 246  LYS A NZ  1 
ATOM   5209  N N   . ALA B  1 267 ? -68.35022 -34.75826  51.92275  1.000 41.53590  ? 247  ALA A N   1 
ATOM   5210  C CA  . ALA B  1 267 ? -67.31154 -33.86540  52.40926  1.000 39.36834  ? 247  ALA A CA  1 
ATOM   5211  C C   . ALA B  1 267 ? -67.92445 -32.87171  53.38355  1.000 42.40254  ? 247  ALA A C   1 
ATOM   5212  O O   . ALA B  1 267 ? -69.00447 -32.32951  53.13107  1.000 42.51110  ? 247  ALA A O   1 
ATOM   5213  C CB  . ALA B  1 267 ? -66.64591 -33.11671  51.25362  1.000 33.35769  ? 247  ALA A CB  1 
ATOM   5214  N N   . VAL B  1 268 ? -67.24513 -32.62972  54.50072  1.000 36.94008  ? 248  VAL A N   1 
ATOM   5215  C CA  . VAL B  1 268 ? -67.74215 -31.69729  55.50205  1.000 30.89989  ? 248  VAL A CA  1 
ATOM   5216  C C   . VAL B  1 268 ? -66.62545 -30.72945  55.87597  1.000 28.90029  ? 248  VAL A C   1 
ATOM   5217  O O   . VAL B  1 268 ? -65.44803 -31.10814  55.91909  1.000 27.94222  ? 248  VAL A O   1 
ATOM   5218  C CB  . VAL B  1 268 ? -68.30511 -32.43826  56.74134  1.000 32.14264  ? 248  VAL A CB  1 
ATOM   5219  C CG1 . VAL B  1 268 ? -69.28265 -33.57495  56.31917  1.000 37.64499  ? 248  VAL A CG1 1 
ATOM   5220  C CG2 . VAL B  1 268 ? -67.19663 -32.99240  57.61781  1.000 39.46525  ? 248  VAL A CG2 1 
ATOM   5221  N N   . ALA B  1 269 ? -67.00155 -29.47739  56.12428  1.000 30.23470  ? 249  ALA A N   1 
ATOM   5222  C CA  . ALA B  1 269 ? -66.07030 -28.43573  56.53528  1.000 31.19884  ? 249  ALA A CA  1 
ATOM   5223  C C   . ALA B  1 269 ? -65.93107 -28.39346  58.04085  1.000 29.23990  ? 249  ALA A C   1 
ATOM   5224  O O   . ALA B  1 269 ? -66.92045 -28.49480  58.77446  1.000 29.45602  ? 249  ALA A O   1 
ATOM   5225  C CB  . ALA B  1 269 ? -66.53281 -27.06130  56.03516  1.000 29.23508  ? 249  ALA A CB  1 
ATOM   5226  N N   . HIS B  1 270 ? -64.68935 -28.23094  58.50320  1.000 30.32396  ? 250  HIS A N   1 
ATOM   5227  C CA  . HIS B  1 270 ? -64.39200 -27.90016  59.88584  1.000 25.92081  ? 250  HIS A CA  1 
ATOM   5228  C C   . HIS B  1 270 ? -63.83731 -26.48375  59.92673  1.000 26.08291  ? 250  HIS A C   1 
ATOM   5229  O O   . HIS B  1 270 ? -62.89263 -26.16838  59.19544  1.000 27.79778  ? 250  HIS A O   1 
ATOM   5230  C CB  . HIS B  1 270 ? -63.37918 -28.87259  60.49224  1.000 23.68049  ? 250  HIS A CB  1 
ATOM   5231  C CG  . HIS B  1 270 ? -62.92816 -28.49946  61.87273  1.000 23.06835  ? 250  HIS A CG  1 
ATOM   5232  N ND1 . HIS B  1 270 ? -63.62892 -28.86262  63.00234  1.000 22.10191  ? 250  HIS A ND1 1 
ATOM   5233  C CD2 . HIS B  1 270 ? -61.83378 -27.83148  62.31094  1.000 19.90893  ? 250  HIS A CD2 1 
ATOM   5234  C CE1 . HIS B  1 270 ? -63.00296 -28.42251  64.07421  1.000 21.35640  ? 250  HIS A CE1 1 
ATOM   5235  N NE2 . HIS B  1 270 ? -61.90022 -27.80587  63.68321  1.000 23.03655  ? 250  HIS A NE2 1 
ATOM   5236  N N   . ARG B  1 271 ? -64.42667 -25.62904  60.76634  1.000 26.04464  ? 251  ARG A N   1 
ATOM   5237  C CA  . ARG B  1 271 ? -64.00919 -24.23306  60.84644  1.000 25.46920  ? 251  ARG A CA  1 
ATOM   5238  C C   . ARG B  1 271 ? -62.83057 -24.07362  61.79612  1.000 23.77559  ? 251  ARG A C   1 
ATOM   5239  O O   . ARG B  1 271 ? -62.87038 -24.52773  62.94868  1.000 26.69908  ? 251  ARG A O   1 
ATOM   5240  C CB  . ARG B  1 271 ? -65.16580 -23.34191  61.27906  1.000 25.45128  ? 251  ARG A CB  1 
ATOM   5241  C CG  . ARG B  1 271 ? -66.23386 -23.30205  60.16937  1.000 25.09958  ? 251  ARG A CG  1 
ATOM   5242  C CD  . ARG B  1 271 ? -67.48481 -22.71146  60.64756  1.000 28.94825  ? 251  ARG A CD  1 
ATOM   5243  N NE  . ARG B  1 271 ? -68.54663 -22.90954  59.66691  1.000 29.36209  ? 251  ARG A NE  1 
ATOM   5244  C CZ  . ARG B  1 271 ? -69.47413 -22.00548  59.44106  1.000 33.29579  ? 251  ARG A CZ  1 
ATOM   5245  N NH1 . ARG B  1 271 ? -69.43061 -20.85851  60.11278  1.000 34.30353  ? 251  ARG A NH1 1 
ATOM   5246  N NH2 . ARG B  1 271 ? -70.42051 -22.23184  58.54539  1.000 35.15195  ? 251  ARG A NH2 1 
ATOM   5247  N N   . PHE B  1 272 ? -61.77591 -23.44331  61.27976  1.000 21.94451  ? 252  PHE A N   1 
ATOM   5248  C CA  . PHE B  1 272 ? -60.56988 -23.16655  62.06575  1.000 20.33751  ? 252  PHE A CA  1 
ATOM   5249  C C   . PHE B  1 272 ? -60.90094 -22.60091  63.44417  1.000 22.18760  ? 252  PHE A C   1 
ATOM   5250  O O   . PHE B  1 272 ? -60.28322 -22.97869  64.45170  1.000 21.65900  ? 252  PHE A O   1 
ATOM   5251  C CB  . PHE B  1 272 ? -59.69838 -22.18493  61.29652  1.000 20.62886  ? 252  PHE A CB  1 
ATOM   5252  C CG  . PHE B  1 272 ? -58.39920 -21.85768  61.98585  1.000 19.17187  ? 252  PHE A CG  1 
ATOM   5253  C CD1 . PHE B  1 272 ? -57.63051 -22.85883  62.52170  1.000 18.05147  ? 252  PHE A CD1 1 
ATOM   5254  C CD2 . PHE B  1 272 ? -57.94620 -20.54456  62.06454  1.000 22.71920  ? 252  PHE A CD2 1 
ATOM   5255  C CE1 . PHE B  1 272 ? -56.40263 -22.57351  63.15298  1.000 19.53402  ? 252  PHE A CE1 1 
ATOM   5256  C CE2 . PHE B  1 272 ? -56.73781 -20.24040  62.66991  1.000 19.04370  ? 252  PHE A CE2 1 
ATOM   5257  C CZ  . PHE B  1 272 ? -55.95947 -21.25699  63.22271  1.000 17.43717  ? 252  PHE A CZ  1 
ATOM   5258  N N   . ALA B  1 273 ? -61.88780 -21.70684  63.50876  1.000 23.86163  ? 253  ALA A N   1 
ATOM   5259  C CA  . ALA B  1 273 ? -62.21110 -21.07472  64.77952  1.000 26.07681  ? 253  ALA A CA  1 
ATOM   5260  C C   . ALA B  1 273 ? -62.65143 -22.08935  65.82695  1.000 28.28896  ? 253  ALA A C   1 
ATOM   5261  O O   . ALA B  1 273 ? -62.46484 -21.84688  67.02207  1.000 26.97476  ? 253  ALA A O   1 
ATOM   5262  C CB  . ALA B  1 273 ? -63.28454 -20.00834  64.56532  1.000 27.75191  ? 253  ALA A CB  1 
ATOM   5263  N N   . ASP B  1 274 ? -63.19553 -23.24833  65.41288  1.000 27.10001  ? 254  ASP A N   1 
ATOM   5264  C CA  . ASP B  1 274 ? -63.66677 -24.20736  66.41058  1.000 25.64317  ? 254  ASP A CA  1 
ATOM   5265  C C   . ASP B  1 274 ? -62.52615 -24.94365  67.09674  1.000 28.03619  ? 254  ASP A C   1 
ATOM   5266  O O   . ASP B  1 274 ? -62.72054 -25.45874  68.20576  1.000 27.98779  ? 254  ASP A O   1 
ATOM   5267  C CB  . ASP B  1 274 ? -64.63027 -25.20933  65.77657  1.000 29.72574  ? 254  ASP A CB  1 
ATOM   5268  C CG  . ASP B  1 274 ? -65.89298 -24.54574  65.29074  1.000 36.37426  ? 254  ASP A CG  1 
ATOM   5269  O OD1 . ASP B  1 274 ? -66.23722 -23.47210  65.83595  1.000 37.25626  ? 254  ASP A OD1 1 
ATOM   5270  O OD2 . ASP B  1 274 ? -66.51880 -25.06146  64.34400  1.000 37.54921  ? 254  ASP A OD2 1 
ATOM   5271  N N   . SER B  1 275 ? -61.33097 -24.97630  66.49126  1.000 22.74454  ? 255  SER A N   1 
ATOM   5272  C CA  . SER B  1 275 ? -60.23992 -25.74204  67.08500  1.000 22.17889  ? 255  SER A CA  1 
ATOM   5273  C C   . SER B  1 275 ? -58.90278 -25.00084  67.08891  1.000 20.03513  ? 255  SER A C   1 
ATOM   5274  O O   . SER B  1 275 ? -57.87919 -25.60705  67.44736  1.000 19.27964  ? 255  SER A O   1 
ATOM   5275  C CB  . SER B  1 275 ? -60.11568 -27.09677  66.36413  1.000 20.30717  ? 255  SER A CB  1 
ATOM   5276  O OG  . SER B  1 275 ? -59.90056 -26.90775  64.98437  1.000 23.85231  ? 255  SER A OG  1 
ATOM   5277  N N   . CYS B  1 276 ? -58.87863 -23.72396  66.70984  1.000 16.52287  ? 256  CYS A N   1 
ATOM   5278  C CA  . CYS B  1 276 ? -57.68081 -22.90010  66.84812  1.000 16.47101  ? 256  CYS A CA  1 
ATOM   5279  C C   . CYS B  1 276 ? -57.27306 -22.83560  68.31864  1.000 21.64031  ? 256  CYS A C   1 
ATOM   5280  O O   . CYS B  1 276 ? -58.12978 -22.72299  69.19710  1.000 22.11462  ? 256  CYS A O   1 
ATOM   5281  C CB  . CYS B  1 276 ? -57.96310 -21.47902  66.33651  1.000 19.16451  ? 256  CYS A CB  1 
ATOM   5282  S SG  . CYS B  1 276 ? -56.52105 -20.34884  66.59042  1.000 28.10515  ? 256  CYS A SG  1 
ATOM   5283  N N   . VAL B  1 277 ? -55.97797 -22.97109  68.60399  1.000 23.45414  ? 257  VAL A N   1 
ATOM   5284  C CA  . VAL B  1 277 ? -55.48534 -22.84907  69.97757  1.000 22.36851  ? 257  VAL A CA  1 
ATOM   5285  C C   . VAL B  1 277 ? -55.00479 -21.41496  70.15328  1.000 25.04268  ? 257  VAL A C   1 
ATOM   5286  O O   . VAL B  1 277 ? -53.95376 -21.04758  69.61641  1.000 24.53091  ? 257  VAL A O   1 
ATOM   5287  C CB  . VAL B  1 277 ? -54.35586 -23.83973  70.28463  1.000 20.56593  ? 257  VAL A CB  1 
ATOM   5288  C CG1 . VAL B  1 277 ? -53.87880 -23.66808  71.73636  1.000 20.15927  ? 257  VAL A CG1 1 
ATOM   5289  C CG2 . VAL B  1 277 ? -54.82118 -25.26382  70.10043  1.000 18.46633  ? 257  VAL A CG2 1 
ATOM   5290  N N   . ARG B  1 278 ? -55.75263 -20.59632  70.90547  1.000 22.04232  ? 258  ARG A N   1 
ATOM   5291  C CA  . ARG B  1 278 ? -55.35824 -19.20341  71.12700  1.000 30.98522  ? 258  ARG A CA  1 
ATOM   5292  C C   . ARG B  1 278 ? -54.80353 -19.00889  72.52543  1.000 31.64019  ? 258  ARG A C   1 
ATOM   5293  O O   . ARG B  1 278 ? -55.39298 -19.47925  73.51279  1.000 29.40229  ? 258  ARG A O   1 
ATOM   5294  C CB  . ARG B  1 278 ? -56.51915 -18.23564  70.92043  1.000 36.23540  ? 258  ARG A CB  1 
ATOM   5295  C CG  . ARG B  1 278 ? -57.03457 -18.26010  69.54164  1.000 37.72778  ? 258  ARG A CG  1 
ATOM   5296  C CD  . ARG B  1 278 ? -58.08805 -17.21641  69.32465  1.000 40.88356  ? 258  ARG A CD  1 
ATOM   5297  N NE  . ARG B  1 278 ? -58.13922 -16.24600  70.39804  1.000 44.27533  ? 258  ARG A NE  1 
ATOM   5298  C CZ  . ARG B  1 278 ? -59.27102 -15.75568  70.88947  1.000 49.77158  ? 258  ARG A CZ  1 
ATOM   5299  N NH1 . ARG B  1 278 ? -60.43504 -16.14950  70.38128  1.000 50.60054  ? 258  ARG A NH1 1 
ATOM   5300  N NH2 . ARG B  1 278 ? -59.24221 -14.86877  71.87924  1.000 50.27903  ? 258  ARG A NH2 1 
ATOM   5301  N N   . SER B  1 279 ? -53.67897 -18.30444  72.61972  1.000 27.08973  ? 259  SER A N   1 
ATOM   5302  C CA  . SER B  1 279 ? -53.26171 -17.98542  73.96790  1.000 25.35901  ? 259  SER A CA  1 
ATOM   5303  C C   . SER B  1 279 ? -54.11210 -16.82128  74.46971  1.000 23.82826  ? 259  SER A C   1 
ATOM   5304  O O   . SER B  1 279 ? -54.80936 -16.14571  73.69921  1.000 18.87961  ? 259  SER A O   1 
ATOM   5305  C CB  . SER B  1 279 ? -51.75522 -17.65640  74.04234  1.000 29.04422  ? 259  SER A CB  1 
ATOM   5306  O OG  . SER B  1 279 ? -51.50829 -16.26649  74.05226  1.000 26.00593  ? 259  SER A OG  1 
ATOM   5307  N N   . ASP B  1 280 ? -54.07383 -16.60289  75.78622  1.000 22.94578  ? 260  ASP A N   1 
ATOM   5308  C CA  . ASP B  1 280 ? -54.81601 -15.49280  76.37250  1.000 26.97933  ? 260  ASP A CA  1 
ATOM   5309  C C   . ASP B  1 280 ? -54.41927 -14.14808  75.78526  1.000 25.69104  ? 260  ASP A C   1 
ATOM   5310  O O   . ASP B  1 280 ? -55.17103 -13.17932  75.94268  1.000 25.27237  ? 260  ASP A O   1 
ATOM   5311  C CB  . ASP B  1 280 ? -54.59578 -15.43980  77.87533  1.000 30.66983  ? 260  ASP A CB  1 
ATOM   5312  C CG  . ASP B  1 280 ? -55.26332 -16.57906  78.59813  1.000 36.47315  ? 260  ASP A CG  1 
ATOM   5313  O OD1 . ASP B  1 280 ? -56.32491 -17.05207  78.12758  1.000 38.98202  ? 260  ASP A OD1 1 
ATOM   5314  O OD2 . ASP B  1 280 ? -54.72863 -16.97698  79.64783  1.000 37.58018  ? 260  ASP A OD2 1 
ATOM   5315  N N   . PHE B  1 281 ? -53.25946 -14.06756  75.12258  1.000 19.45011  ? 261  PHE A N   1 
ATOM   5316  C CA  . PHE B  1 281 ? -52.72929 -12.81807  74.58461  1.000 20.50243  ? 261  PHE A CA  1 
ATOM   5317  C C   . PHE B  1 281 ? -52.87732 -12.72097  73.07306  1.000 22.48306  ? 261  PHE A C   1 
ATOM   5318  O O   . PHE B  1 281 ? -52.17820 -11.91512  72.42986  1.000 21.25942  ? 261  PHE A O   1 
ATOM   5319  C CB  . PHE B  1 281 ? -51.25943 -12.65113  75.01485  1.000 27.20680  ? 261  PHE A CB  1 
ATOM   5320  C CG  . PHE B  1 281 ? -51.06258 -12.74669  76.51174  1.000 27.39976  ? 261  PHE A CG  1 
ATOM   5321  C CD1 . PHE B  1 281 ? -51.33921 -11.67364  77.32978  1.000 30.23898  ? 261  PHE A CD1 1 
ATOM   5322  C CD2 . PHE B  1 281 ? -50.64003 -13.92754  77.10238  1.000 32.90299  ? 261  PHE A CD2 1 
ATOM   5323  C CE1 . PHE B  1 281 ? -51.18294 -11.77409  78.71661  1.000 32.65443  ? 261  PHE A CE1 1 
ATOM   5324  C CE2 . PHE B  1 281 ? -50.47062 -14.02645  78.47513  1.000 34.31639  ? 261  PHE A CE2 1 
ATOM   5325  C CZ  . PHE B  1 281 ? -50.75370 -12.95211  79.28085  1.000 33.74214  ? 261  PHE A CZ  1 
ATOM   5326  N N   . GLU B  1 282 ? -53.80059 -13.49855  72.48847  1.000 22.49657  ? 262  GLU A N   1 
ATOM   5327  C CA  . GLU B  1 282 ? -54.04983 -13.49809  71.04637  1.000 23.74380  ? 262  GLU A CA  1 
ATOM   5328  C C   . GLU B  1 282 ? -55.51493 -13.12339  70.84783  1.000 25.24484  ? 262  GLU A C   1 
ATOM   5329  O O   . GLU B  1 282 ? -56.41516 -13.86594  71.26154  1.000 25.10669  ? 262  GLU A O   1 
ATOM   5330  C CB  . GLU B  1 282 ? -53.71072 -14.86177  70.41167  1.000 22.21968  ? 262  GLU A CB  1 
ATOM   5331  C CG  . GLU B  1 282 ? -52.19760 -15.13023  70.42039  1.000 20.87067  ? 262  GLU A CG  1 
ATOM   5332  C CD  . GLU B  1 282 ? -51.79531 -16.53789  70.03742  1.000 22.13761  ? 262  GLU A CD  1 
ATOM   5333  O OE1 . GLU B  1 282 ? -52.65196 -17.43653  70.03689  1.000 25.22818  ? 262  GLU A OE1 1 
ATOM   5334  O OE2 . GLU B  1 282 ? -50.59611 -16.75028  69.73683  1.000 18.85815  ? 262  GLU A OE2 1 
ATOM   5335  N N   . HIS B  1 283 ? -55.75017 -11.95459  70.24454  1.000 21.19531  ? 263  HIS A N   1 
ATOM   5336  C CA  . HIS B  1 283 ? -57.09378 -11.39792  70.21332  1.000 27.48819  ? 263  HIS A CA  1 
ATOM   5337  C C   . HIS B  1 283 ? -58.00431 -12.13271  69.24823  1.000 26.57308  ? 263  HIS A C   1 
ATOM   5338  O O   . HIS B  1 283 ? -59.22908 -11.98356  69.33391  1.000 27.41226  ? 263  HIS A O   1 
ATOM   5339  C CB  . HIS B  1 283 ? -57.02048 -9.90976   69.87063  1.000 28.72414  ? 263  HIS A CB  1 
ATOM   5340  C CG  . HIS B  1 283 ? -56.71679 -9.62290   68.43440  1.000 31.63455  ? 263  HIS A CG  1 
ATOM   5341  N ND1 . HIS B  1 283 ? -57.69183 -9.26881   67.52686  1.000 35.17761  ? 263  HIS A ND1 1 
ATOM   5342  C CD2 . HIS B  1 283 ? -55.54569 -9.60183   67.75334  1.000 33.95520  ? 263  HIS A CD2 1 
ATOM   5343  C CE1 . HIS B  1 283 ? -57.14005 -9.06091   66.34383  1.000 34.96986  ? 263  HIS A CE1 1 
ATOM   5344  N NE2 . HIS B  1 283 ? -55.83574 -9.24607   66.45382  1.000 36.03335  ? 263  HIS A NE2 1 
ATOM   5345  N N   . GLU B  1 284 ? -57.44431 -12.91639  68.33099  1.000 22.13036  ? 264  GLU A N   1 
ATOM   5346  C CA  . GLU B  1 284 ? -58.23547 -13.61839  67.33176  1.000 24.22431  ? 264  GLU A CA  1 
ATOM   5347  C C   . GLU B  1 284 ? -57.45242 -14.84070  66.87711  1.000 21.64913  ? 264  GLU A C   1 
ATOM   5348  O O   . GLU B  1 284 ? -56.22776 -14.90021  67.07448  1.000 20.80558  ? 264  GLU A O   1 
ATOM   5349  C CB  . GLU B  1 284 ? -58.54192 -12.69574  66.13093  1.000 23.93302  ? 264  GLU A CB  1 
ATOM   5350  C CG  . GLU B  1 284 ? -57.30092 -12.42676  65.25072  1.000 26.53782  ? 264  GLU A CG  1 
ATOM   5351  C CD  . GLU B  1 284 ? -57.60080 -11.56251  64.00567  1.000 35.16669  ? 264  GLU A CD  1 
ATOM   5352  O OE1 . GLU B  1 284 ? -58.78301 -11.19547  63.78677  1.000 37.45893  ? 264  GLU A OE1 1 
ATOM   5353  O OE2 . GLU B  1 284 ? -56.64352 -11.24732  63.24796  1.000 34.08695  ? 264  GLU A OE2 1 
ATOM   5354  N N   . PRO B  1 285 ? -58.11596 -15.81318  66.22997  1.000 25.00329  ? 265  PRO A N   1 
ATOM   5355  C CA  . PRO B  1 285 ? -57.38916 -16.95358  65.65842  1.000 21.68597  ? 265  PRO A CA  1 
ATOM   5356  C C   . PRO B  1 285 ? -56.32891 -16.49590  64.67432  1.000 17.32366  ? 265  PRO A C   1 
ATOM   5357  O O   . PRO B  1 285 ? -56.56152 -15.61610  63.84662  1.000 18.81569  ? 265  PRO A O   1 
ATOM   5358  C CB  . PRO B  1 285 ? -58.48947 -17.75681  64.95524  1.000 23.71729  ? 265  PRO A CB  1 
ATOM   5359  C CG  . PRO B  1 285 ? -59.72593 -17.39814  65.69233  1.000 24.59515  ? 265  PRO A CG  1 
ATOM   5360  C CD  . PRO B  1 285 ? -59.57287 -15.95811  66.05478  1.000 23.25732  ? 265  PRO A CD  1 
ATOM   5361  N N   . TYR B  1 286 ? -55.15477 -17.10249  64.75694  1.000 19.17423  ? 266  TYR A N   1 
ATOM   5362  C CA  . TYR B  1 286 ? -54.00348 -16.62495  63.99727  1.000 16.29627  ? 266  TYR A CA  1 
ATOM   5363  C C   . TYR B  1 286 ? -53.65288 -17.63893  62.91961  1.000 18.86933  ? 266  TYR A C   1 
ATOM   5364  O O   . TYR B  1 286 ? -53.35851 -18.79492  63.23138  1.000 14.98954  ? 266  TYR A O   1 
ATOM   5365  C CB  . TYR B  1 286 ? -52.81975 -16.41939  64.92349  1.000 13.87856  ? 266  TYR A CB  1 
ATOM   5366  C CG  . TYR B  1 286 ? -51.57987 -15.89102  64.24659  1.000 17.99002  ? 266  TYR A CG  1 
ATOM   5367  C CD1 . TYR B  1 286 ? -50.69722 -16.74949  63.59816  1.000 17.37498  ? 266  TYR A CD1 1 
ATOM   5368  C CD2 . TYR B  1 286 ? -51.30302 -14.53326  64.23223  1.000 18.33118  ? 266  TYR A CD2 1 
ATOM   5369  C CE1 . TYR B  1 286 ? -49.57304 -16.28433  62.97649  1.000 15.39044  ? 266  TYR A CE1 1 
ATOM   5370  C CE2 . TYR B  1 286 ? -50.17754 -14.05871  63.60939  1.000 15.73053  ? 266  TYR A CE2 1 
ATOM   5371  C CZ  . TYR B  1 286 ? -49.31053 -14.93118  63.01910  1.000 13.93054  ? 266  TYR A CZ  1 
ATOM   5372  O OH  . TYR B  1 286 ? -48.17948 -14.45465  62.42821  1.000 13.90875  ? 266  TYR A OH  1 
ATOM   5373  N N   . TRP B  1 287 ? -53.65039 -17.20258  61.66947  1.000 14.28012  ? 267  TRP A N   1 
ATOM   5374  C CA  . TRP B  1 287 ? -53.22787 -18.04437  60.56494  1.000 15.58240  ? 267  TRP A CA  1 
ATOM   5375  C C   . TRP B  1 287 ? -52.53806 -17.13959  59.56020  1.000 17.27608  ? 267  TRP A C   1 
ATOM   5376  O O   . TRP B  1 287 ? -53.06114 -16.06899  59.24290  1.000 21.29681  ? 267  TRP A O   1 
ATOM   5377  C CB  . TRP B  1 287 ? -54.41983 -18.75907  59.92097  1.000 16.25328  ? 267  TRP A CB  1 
ATOM   5378  C CG  . TRP B  1 287 ? -54.06076 -19.69342  58.76205  1.000 18.36992  ? 267  TRP A CG  1 
ATOM   5379  C CD1 . TRP B  1 287 ? -53.85489 -21.04257  58.82113  1.000 17.15510  ? 267  TRP A CD1 1 
ATOM   5380  C CD2 . TRP B  1 287 ? -53.94316 -19.32740  57.37643  1.000 18.35520  ? 267  TRP A CD2 1 
ATOM   5381  N NE1 . TRP B  1 287 ? -53.58322 -21.53603  57.55879  1.000 21.93120  ? 267  TRP A NE1 1 
ATOM   5382  C CE2 . TRP B  1 287 ? -53.62775 -20.50339  56.65838  1.000 21.79022  ? 267  TRP A CE2 1 
ATOM   5383  C CE3 . TRP B  1 287 ? -54.04661 -18.12548  56.68825  1.000 18.17445  ? 267  TRP A CE3 1 
ATOM   5384  C CZ2 . TRP B  1 287 ? -53.43622 -20.50721  55.25984  1.000 25.88613  ? 267  TRP A CZ2 1 
ATOM   5385  C CZ3 . TRP B  1 287 ? -53.85032 -18.12384  55.27956  1.000 21.25230  ? 267  TRP A CZ3 1 
ATOM   5386  C CH2 . TRP B  1 287 ? -53.54221 -19.31306  54.59970  1.000 21.62524  ? 267  TRP A CH2 1 
ATOM   5387  N N   . ARG B  1 288 ? -51.35773 -17.53041  59.09449  1.000 16.99146  ? 268  ARG A N   1 
ATOM   5388  C CA  . ARG B  1 288 ? -50.65568 -16.74679  58.08074  1.000 20.20443  ? 268  ARG A CA  1 
ATOM   5389  C C   . ARG B  1 288 ? -50.02671 -17.69594  57.07490  1.000 22.34574  ? 268  ARG A C   1 
ATOM   5390  O O   . ARG B  1 288 ? -49.49009 -18.73998  57.45982  1.000 21.49679  ? 268  ARG A O   1 
ATOM   5391  C CB  . ARG B  1 288 ? -49.56106 -15.86662  58.70960  1.000 17.89544  ? 268  ARG A CB  1 
ATOM   5392  C CG  . ARG B  1 288 ? -50.05142 -14.83619  59.72552  1.000 16.22392  ? 268  ARG A CG  1 
ATOM   5393  C CD  . ARG B  1 288 ? -50.67028 -13.58533  59.04405  1.000 15.45106  ? 268  ARG A CD  1 
ATOM   5394  N NE  . ARG B  1 288 ? -50.98693 -12.55081  60.05617  1.000 17.21537  ? 268  ARG A NE  1 
ATOM   5395  C CZ  . ARG B  1 288 ? -52.00385 -12.60893  60.91758  1.000 17.67397  ? 268  ARG A CZ  1 
ATOM   5396  N NH1 . ARG B  1 288 ? -52.84788 -13.63093  60.91279  1.000 17.63658  ? 268  ARG A NH1 1 
ATOM   5397  N NH2 . ARG B  1 288 ? -52.20483 -11.62713  61.78905  1.000 16.33270  ? 268  ARG A NH2 1 
ATOM   5398  N N   . ASP B  1 289 ? -50.05231 -17.33582  55.79223  1.000 15.08021  ? 269  ASP A N   1 
ATOM   5399  C CA  . ASP B  1 289 ? -49.37874 -18.17473  54.81817  1.000 15.38159  ? 269  ASP A CA  1 
ATOM   5400  C C   . ASP B  1 289 ? -48.10442 -17.55889  54.28929  1.000 16.12818  ? 269  ASP A C   1 
ATOM   5401  O O   . ASP B  1 289 ? -47.39505 -18.22336  53.53370  1.000 23.56612  ? 269  ASP A O   1 
ATOM   5402  C CB  . ASP B  1 289 ? -50.33309 -18.58356  53.68007  1.000 35.24374  ? 269  ASP A CB  1 
ATOM   5403  C CG  . ASP B  1 289 ? -50.51097 -17.54009  52.63988  1.000 40.84090  ? 269  ASP A CG  1 
ATOM   5404  O OD1 . ASP B  1 289 ? -50.55408 -16.34577  52.99229  1.000 41.35675  ? 269  ASP A OD1 1 
ATOM   5405  O OD2 . ASP B  1 289 ? -50.64153 -17.93471  51.45545  1.000 44.82781  ? 269  ASP A OD2 1 
ATOM   5406  N N   . VAL B  1 290 ? -47.76106 -16.33573  54.71814  1.000 15.58582  ? 270  VAL A N   1 
ATOM   5407  C CA  . VAL B  1 290 ? -46.52895 -15.62088  54.35358  1.000 17.56947  ? 270  VAL A CA  1 
ATOM   5408  C C   . VAL B  1 290 ? -46.05337 -15.94890  52.93295  1.000 24.90610  ? 270  VAL A C   1 
ATOM   5409  O O   . VAL B  1 290 ? -44.87430 -16.26505  52.69995  1.000 25.03077  ? 270  VAL A O   1 
ATOM   5410  C CB  . VAL B  1 290 ? -45.39746 -15.85647  55.39201  1.000 18.09211  ? 270  VAL A CB  1 
ATOM   5411  C CG1 . VAL B  1 290 ? -45.70541 -15.13914  56.74153  1.000 18.94307  ? 270  VAL A CG1 1 
ATOM   5412  C CG2 . VAL B  1 290 ? -45.08352 -17.33106  55.63528  1.000 20.16571  ? 270  VAL A CG2 1 
ATOM   5413  N N   . GLY B  1 291 ? -46.96104 -15.84733  51.97159  1.000 24.63244  ? 271  GLY A N   1 
ATOM   5414  C CA  . GLY B  1 291 ? -46.66928 -16.30134  50.61547  1.000 24.04282  ? 271  GLY A CA  1 
ATOM   5415  C C   . GLY B  1 291 ? -46.01884 -15.27833  49.70669  1.000 24.04589  ? 271  GLY A C   1 
ATOM   5416  O O   . GLY B  1 291 ? -45.62332 -15.63208  48.58959  1.000 28.53070  ? 271  GLY A O   1 
ATOM   5417  N N   . THR B  1 292 ? -45.92352 -14.01926  50.13291  1.000 21.87999  ? 272  THR A N   1 
ATOM   5418  C CA  . THR B  1 292 ? -45.19699 -12.98489  49.40505  1.000 23.24980  ? 272  THR A CA  1 
ATOM   5419  C C   . THR B  1 292 ? -44.15456 -12.36833  50.32363  1.000 23.62662  ? 272  THR A C   1 
ATOM   5420  O O   . THR B  1 292 ? -44.23760 -12.50180  51.54653  1.000 21.15236  ? 272  THR A O   1 
ATOM   5421  C CB  . THR B  1 292 ? -46.12131 -11.88384  48.89590  1.000 25.52050  ? 272  THR A CB  1 
ATOM   5422  O OG1 . THR B  1 292 ? -46.67699 -11.19456  50.02587  1.000 25.85229  ? 272  THR A OG1 1 
ATOM   5423  C CG2 . THR B  1 292 ? -47.24535 -12.50828  48.07476  1.000 26.81892  ? 272  THR A CG2 1 
ATOM   5424  N N   . ILE B  1 293 ? -43.16373 -11.69396  49.72274  1.000 22.79722  ? 273  ILE A N   1 
ATOM   5425  C CA  . ILE B  1 293 ? -42.12911 -11.04362  50.53330  1.000 22.89468  ? 273  ILE A CA  1 
ATOM   5426  C C   . ILE B  1 293 ? -42.76199 -10.01580  51.47068  1.000 20.36035  ? 273  ILE A C   1 
ATOM   5427  O O   . ILE B  1 293 ? -42.37710 -9.89789   52.64258  1.000 22.07787  ? 273  ILE A O   1 
ATOM   5428  C CB  . ILE B  1 293 ? -41.04953 -10.40207  49.63690  1.000 25.09889  ? 273  ILE A CB  1 
ATOM   5429  C CG1 . ILE B  1 293 ? -40.25388 -11.46622  48.86779  1.000 25.48895  ? 273  ILE A CG1 1 
ATOM   5430  C CG2 . ILE B  1 293 ? -40.09802 -9.51812   50.49730  1.000 23.58415  ? 273  ILE A CG2 1 
ATOM   5431  C CD1 . ILE B  1 293 ? -39.34305 -10.87033  47.80493  1.000 28.29058  ? 273  ILE A CD1 1 
ATOM   5432  N N   . ASP B  1 294 ? -43.75220 -9.26573   50.98211  1.000 21.49796  ? 274  ASP A N   1 
ATOM   5433  C CA  . ASP B  1 294 ? -44.43827 -8.31069   51.85062  1.000 18.22102  ? 274  ASP A CA  1 
ATOM   5434  C C   . ASP B  1 294 ? -45.11162 -9.00912   53.02886  1.000 21.93437  ? 274  ASP A C   1 
ATOM   5435  O O   . ASP B  1 294 ? -45.05299 -8.52399   54.15897  1.000 21.83228  ? 274  ASP A O   1 
ATOM   5436  C CB  . ASP B  1 294 ? -45.48895 -7.53310   51.08829  1.000 26.97718  ? 274  ASP A CB  1 
ATOM   5437  C CG  . ASP B  1 294 ? -44.91378 -6.34321   50.34927  1.000 34.65726  ? 274  ASP A CG  1 
ATOM   5438  O OD1 . ASP B  1 294 ? -43.77544 -5.91368   50.66612  1.000 34.70183  ? 274  ASP A OD1 1 
ATOM   5439  O OD2 . ASP B  1 294 ? -45.61492 -5.84810   49.44277  1.000 36.55611  ? 274  ASP A OD2 1 
ATOM   5440  N N   . ALA B  1 295 ? -45.82694 -10.10671  52.76435  1.000 20.74462  ? 275  ALA A N   1 
ATOM   5441  C CA  . ALA B  1 295 ? -46.53272 -10.77211  53.83976  1.000 20.34222  ? 275  ALA A CA  1 
ATOM   5442  C C   . ALA B  1 295 ? -45.56029 -11.45882  54.78008  1.000 19.98698  ? 275  ALA A C   1 
ATOM   5443  O O   . ALA B  1 295 ? -45.81377 -11.52746  55.98625  1.000 18.07892  ? 275  ALA A O   1 
ATOM   5444  C CB  . ALA B  1 295 ? -47.54815 -11.76521  53.29606  1.000 20.13967  ? 275  ALA A CB  1 
ATOM   5445  N N   . TYR B  1 296 ? -44.45900 -11.99451  54.25754  1.000 21.12775  ? 276  TYR A N   1 
ATOM   5446  C CA  . TYR B  1 296 ? -43.45163 -12.55850  55.14880  1.000 21.55753  ? 276  TYR A CA  1 
ATOM   5447  C C   . TYR B  1 296 ? -42.87105 -11.46902  56.05392  1.000 23.06220  ? 276  TYR A C   1 
ATOM   5448  O O   . TYR B  1 296 ? -42.84697 -11.61096  57.28509  1.000 19.08205  ? 276  TYR A O   1 
ATOM   5449  C CB  . TYR B  1 296 ? -42.37529 -13.25376  54.31466  1.000 19.30420  ? 276  TYR A CB  1 
ATOM   5450  C CG  . TYR B  1 296 ? -41.23362 -13.80238  55.12085  1.000 20.67370  ? 276  TYR A CG  1 
ATOM   5451  C CD1 . TYR B  1 296 ? -41.35227 -15.03460  55.78223  1.000 15.64870  ? 276  TYR A CD1 1 
ATOM   5452  C CD2 . TYR B  1 296 ? -40.05412 -13.08122  55.25824  1.000 17.14433  ? 276  TYR A CD2 1 
ATOM   5453  C CE1 . TYR B  1 296 ? -40.28556 -15.54780  56.53022  1.000 16.71922  ? 276  TYR A CE1 1 
ATOM   5454  C CE2 . TYR B  1 296 ? -38.99619 -13.57484  55.98034  1.000 20.90104  ? 276  TYR A CE2 1 
ATOM   5455  C CZ  . TYR B  1 296 ? -39.11596 -14.81661  56.61762  1.000 16.67850  ? 276  TYR A CZ  1 
ATOM   5456  O OH  . TYR B  1 296 ? -38.04992 -15.28023  57.34172  1.000 16.38854  ? 276  TYR A OH  1 
ATOM   5457  N N   . TRP B  1 297 ? -42.47154 -10.33887  55.46114  1.000 16.04535  ? 277  TRP A N   1 
ATOM   5458  C CA  . TRP B  1 297 ? -41.92936 -9.22910   56.23496  1.000 16.75588  ? 277  TRP A CA  1 
ATOM   5459  C C   . TRP B  1 297 ? -42.91582 -8.76550   57.29044  1.000 16.22857  ? 277  TRP A C   1 
ATOM   5460  O O   . TRP B  1 297 ? -42.56050 -8.59690   58.46121  1.000 16.88930  ? 277  TRP A O   1 
ATOM   5461  C CB  . TRP B  1 297 ? -41.58125 -8.06719   55.30251  1.000 19.00391  ? 277  TRP A CB  1 
ATOM   5462  C CG  . TRP B  1 297 ? -41.11078 -6.84158   56.01289  1.000 17.03151  ? 277  TRP A CG  1 
ATOM   5463  C CD1 . TRP B  1 297 ? -39.81907 -6.54911   56.38585  1.000 20.85294  ? 277  TRP A CD1 1 
ATOM   5464  C CD2 . TRP B  1 297 ? -41.91065 -5.72690   56.43647  1.000 18.56347  ? 277  TRP A CD2 1 
ATOM   5465  N NE1 . TRP B  1 297 ? -39.76946 -5.31035   57.00843  1.000 23.92622  ? 277  TRP A NE1 1 
ATOM   5466  C CE2 . TRP B  1 297 ? -41.04094 -4.79801   57.06422  1.000 21.90807  ? 277  TRP A CE2 1 
ATOM   5467  C CE3 . TRP B  1 297 ? -43.28135 -5.42491   56.35284  1.000 18.83469  ? 277  TRP A CE3 1 
ATOM   5468  C CZ2 . TRP B  1 297 ? -41.49502 -3.58796   57.59130  1.000 22.70079  ? 277  TRP A CZ2 1 
ATOM   5469  C CZ3 . TRP B  1 297 ? -43.73149 -4.22797   56.89005  1.000 18.60044  ? 277  TRP A CZ3 1 
ATOM   5470  C CH2 . TRP B  1 297 ? -42.84141 -3.32411   57.49619  1.000 24.12678  ? 277  TRP A CH2 1 
ATOM   5471  N N   . GLN B  1 298 ? -44.17373 -8.57490   56.88919  1.000 15.75875  ? 278  GLN A N   1 
ATOM   5472  C CA  . GLN B  1 298 ? -45.18807 -8.05384   57.79460  1.000 17.69815  ? 278  GLN A CA  1 
ATOM   5473  C C   . GLN B  1 298 ? -45.42616 -8.98460   58.98336  1.000 20.14152  ? 278  GLN A C   1 
ATOM   5474  O O   . GLN B  1 298 ? -45.46314 -8.53447   60.13849  1.000 14.78254  ? 278  GLN A O   1 
ATOM   5475  C CB  . GLN B  1 298 ? -46.49549 -7.85098   57.02932  1.000 18.21880  ? 278  GLN A CB  1 
ATOM   5476  C CG  . GLN B  1 298 ? -47.50669 -7.05486   57.83400  1.000 23.40352  ? 278  GLN A CG  1 
ATOM   5477  C CD  . GLN B  1 298 ? -47.11758 -5.62169   57.92217  1.000 25.68807  ? 278  GLN A CD  1 
ATOM   5478  O OE1 . GLN B  1 298 ? -47.01601 -4.91906   56.90727  1.000 22.42097  ? 278  GLN A OE1 1 
ATOM   5479  N NE2 . GLN B  1 298 ? -46.86269 -5.16679   59.13200  1.000 22.76619  ? 278  GLN A NE2 1 
ATOM   5480  N N   . ALA B  1 299 ? -45.58291 -10.29092  58.71798  1.000 18.28273  ? 279  ALA A N   1 
ATOM   5481  C CA  . ALA B  1 299 ? -45.84438 -11.23515  59.80120  1.000 20.65479  ? 279  ALA A CA  1 
ATOM   5482  C C   . ALA B  1 299 ? -44.72682 -11.21563  60.83152  1.000 20.27301  ? 279  ALA A C   1 
ATOM   5483  O O   . ALA B  1 299 ? -44.99669 -11.27355  62.03578  1.000 18.16385  ? 279  ALA A O   1 
ATOM   5484  C CB  . ALA B  1 299 ? -46.01271 -12.65133  59.25574  1.000 15.68107  ? 279  ALA A CB  1 
ATOM   5485  N N   . ASN B  1 300 ? -43.46429 -11.14344  60.37358  1.000 16.88673  ? 280  ASN A N   1 
ATOM   5486  C CA  . ASN B  1 300 ? -42.31404 -11.07258  61.28606  1.000 16.24586  ? 280  ASN A CA  1 
ATOM   5487  C C   . ASN B  1 300 ? -42.26818 -9.74667   62.05008  1.000 17.01379  ? 280  ASN A C   1 
ATOM   5488  O O   . ASN B  1 300 ? -42.10946 -9.71053   63.28392  1.000 18.57249  ? 280  ASN A O   1 
ATOM   5489  C CB  . ASN B  1 300 ? -41.02132 -11.28663  60.50160  1.000 16.51303  ? 280  ASN A CB  1 
ATOM   5490  C CG  . ASN B  1 300 ? -40.75511 -12.76693  60.21543  1.000 21.20271  ? 280  ASN A CG  1 
ATOM   5491  O OD1 . ASN B  1 300 ? -40.37484 -13.50557  61.13061  1.000 20.30472  ? 280  ASN A OD1 1 
ATOM   5492  N ND2 . ASN B  1 300 ? -40.99965 -13.22033  58.96646  1.000 14.35059  ? 280  ASN A ND2 1 
ATOM   5493  N N   . ILE B  1 301 ? -42.41107 -8.63738   61.32721  1.000 15.09843  ? 281  ILE A N   1 
ATOM   5494  C CA  . ILE B  1 301 ? -42.26850 -7.34267   61.95349  1.000 15.05094  ? 281  ILE A CA  1 
ATOM   5495  C C   . ILE B  1 301 ? -43.41090 -7.08412   62.92504  1.000 14.91191  ? 281  ILE A C   1 
ATOM   5496  O O   . ILE B  1 301 ? -43.23370 -6.39046   63.93707  1.000 17.39229  ? 281  ILE A O   1 
ATOM   5497  C CB  . ILE B  1 301 ? -42.16397 -6.28626   60.83369  1.000 19.21586  ? 281  ILE A CB  1 
ATOM   5498  C CG1 . ILE B  1 301 ? -41.23788 -5.18628   61.28395  1.000 25.02802  ? 281  ILE A CG1 1 
ATOM   5499  C CG2 . ILE B  1 301 ? -43.52549 -5.84168   60.35632  1.000 20.64284  ? 281  ILE A CG2 1 
ATOM   5500  C CD1 . ILE B  1 301 ? -39.82060 -5.66443   61.06770  1.000 22.05146  ? 281  ILE A CD1 1 
ATOM   5501  N N   . ASP B  1 302 ? -44.58101 -7.67207   62.67609  1.000 14.67452  ? 282  ASP A N   1 
ATOM   5502  C CA  . ASP B  1 302 ? -45.66060 -7.53418   63.63603  1.000 17.30604  ? 282  ASP A CA  1 
ATOM   5503  C C   . ASP B  1 302 ? -45.30047 -8.13021   64.99236  1.000 19.00850  ? 282  ASP A C   1 
ATOM   5504  O O   . ASP B  1 302 ? -45.89847 -7.74352   65.99816  1.000 17.86143  ? 282  ASP A O   1 
ATOM   5505  C CB  . ASP B  1 302 ? -46.95008 -8.18291   63.12278  1.000 17.67840  ? 282  ASP A CB  1 
ATOM   5506  C CG  . ASP B  1 302 ? -47.61270 -7.39066   61.97102  1.000 21.94662  ? 282  ASP A CG  1 
ATOM   5507  O OD1 . ASP B  1 302 ? -47.19414 -6.24716   61.63074  1.000 17.59135  ? 282  ASP A OD1 1 
ATOM   5508  O OD2 . ASP B  1 302 ? -48.55162 -7.96299   61.38799  1.000 25.22407  ? 282  ASP A OD2 1 
ATOM   5509  N N   . LEU B  1 303 ? -44.33551 -9.05147   65.05757  1.000 19.32494  ? 283  LEU A N   1 
ATOM   5510  C CA  . LEU B  1 303 ? -43.95374 -9.57425   66.36566  1.000 16.97112  ? 283  LEU A CA  1 
ATOM   5511  C C   . LEU B  1 303 ? -43.28692 -8.53588   67.24324  1.000 15.59390  ? 283  LEU A C   1 
ATOM   5512  O O   . LEU B  1 303 ? -43.14739 -8.77785   68.44342  1.000 16.90277  ? 283  LEU A O   1 
ATOM   5513  C CB  . LEU B  1 303 ? -43.03358 -10.78747  66.22258  1.000 13.81622  ? 283  LEU A CB  1 
ATOM   5514  C CG  . LEU B  1 303 ? -43.81986 -11.95149  65.58940  1.000 18.29910  ? 283  LEU A CG  1 
ATOM   5515  C CD1 . LEU B  1 303 ? -42.86869 -13.01801  65.14204  1.000 14.77117  ? 283  LEU A CD1 1 
ATOM   5516  C CD2 . LEU B  1 303 ? -44.81139 -12.55227  66.58283  1.000 21.63990  ? 283  LEU A CD2 1 
ATOM   5517  N N   . THR B  1 304 ? -42.89228 -7.37957   66.69857  1.000 18.00112  ? 284  THR A N   1 
ATOM   5518  C CA  . THR B  1 304 ? -42.30622 -6.33972   67.53317  1.000 16.08826  ? 284  THR A CA  1 
ATOM   5519  C C   . THR B  1 304 ? -43.36097 -5.43284   68.13698  1.000 17.77999  ? 284  THR A C   1 
ATOM   5520  O O   . THR B  1 304 ? -42.99825 -4.53023   68.88557  1.000 16.53157  ? 284  THR A O   1 
ATOM   5521  C CB  . THR B  1 304 ? -41.30927 -5.46059   66.72416  1.000 19.01294  ? 284  THR A CB  1 
ATOM   5522  O OG1 . THR B  1 304 ? -42.02466 -4.75686   65.70830  1.000 15.84538  ? 284  THR A OG1 1 
ATOM   5523  C CG2 . THR B  1 304 ? -40.20665 -6.31261   66.08188  1.000 18.24208  ? 284  THR A CG2 1 
ATOM   5524  N N   . ASP B  1 305 ? -44.64132 -5.62108   67.80038  1.000 15.97817  ? 285  ASP A N   1 
ATOM   5525  C CA  . ASP B  1 305 ? -45.72219 -4.82828   68.37427  1.000 18.29571  ? 285  ASP A CA  1 
ATOM   5526  C C   . ASP B  1 305 ? -45.74643 -4.92663   69.89826  1.000 16.16449  ? 285  ASP A C   1 
ATOM   5527  O O   . ASP B  1 305 ? -45.28353 -5.91264   70.50350  1.000 17.97062  ? 285  ASP A O   1 
ATOM   5528  C CB  . ASP B  1 305 ? -47.07780 -5.29369   67.83224  1.000 20.91710  ? 285  ASP A CB  1 
ATOM   5529  C CG  . ASP B  1 305 ? -47.28544 -4.92620   66.37055  1.000 25.36423  ? 285  ASP A CG  1 
ATOM   5530  O OD1 . ASP B  1 305 ? -46.42906 -4.23270   65.77044  1.000 23.98570  ? 285  ASP A OD1 1 
ATOM   5531  O OD2 . ASP B  1 305 ? -48.32547 -5.32662   65.81217  1.000 22.00181  ? 285  ASP A OD2 1 
ATOM   5532  N N   . VAL B  1 306 ? -46.34580 -3.91617   70.54131  1.000 16.74434  ? 286  VAL A N   1 
ATOM   5533  C CA  . VAL B  1 306 ? -46.57396 -4.05528   71.98253  1.000 17.15099  ? 286  VAL A CA  1 
ATOM   5534  C C   . VAL B  1 306 ? -47.52358 -5.21669   72.28402  1.000 18.25534  ? 286  VAL A C   1 
ATOM   5535  O O   . VAL B  1 306 ? -47.29619 -5.98650   73.22715  1.000 17.88597  ? 286  VAL A O   1 
ATOM   5536  C CB  . VAL B  1 306 ? -47.08340 -2.74946   72.61466  1.000 19.48633  ? 286  VAL A CB  1 
ATOM   5537  C CG1 . VAL B  1 306 ? -47.18122 -2.94542   74.11374  1.000 22.24849  ? 286  VAL A CG1 1 
ATOM   5538  C CG2 . VAL B  1 306 ? -46.14382 -1.60825   72.29823  1.000 21.80108  ? 286  VAL A CG2 1 
ATOM   5539  N N   . VAL B  1 307 ? -48.59987 -5.35430   71.51885  1.000 19.13792  ? 287  VAL A N   1 
ATOM   5540  C CA  . VAL B  1 307 ? -49.49998 -6.49867   71.70652  1.000 19.97217  ? 287  VAL A CA  1 
ATOM   5541  C C   . VAL B  1 307 ? -49.55460 -7.28259   70.39789  1.000 18.92285  ? 287  VAL A C   1 
ATOM   5542  O O   . VAL B  1 307 ? -50.39553 -7.02699   69.51098  1.000 16.78382  ? 287  VAL A O   1 
ATOM   5543  C CB  . VAL B  1 307 ? -50.88778 -6.05774   72.17269  1.000 21.63855  ? 287  VAL A CB  1 
ATOM   5544  C CG1 . VAL B  1 307 ? -51.79352 -7.25940   72.38769  1.000 18.07646  ? 287  VAL A CG1 1 
ATOM   5545  C CG2 . VAL B  1 307 ? -50.75961 -5.30247   73.49251  1.000 24.61507  ? 287  VAL A CG2 1 
ATOM   5546  N N   . PRO B  1 308 ? -48.65385 -8.22566   70.21585  1.000 16.57692  ? 288  PRO A N   1 
ATOM   5547  C CA  . PRO B  1 308 ? -48.59000 -8.91781   68.92203  1.000 14.79666  ? 288  PRO A CA  1 
ATOM   5548  C C   . PRO B  1 308 ? -49.75823 -9.87437   68.73062  1.000 16.50096  ? 288  PRO A C   1 
ATOM   5549  O O   . PRO B  1 308 ? -50.30294 -10.42624  69.69181  1.000 17.98190  ? 288  PRO A O   1 
ATOM   5550  C CB  . PRO B  1 308 ? -47.23529 -9.64581   68.95622  1.000 17.46856  ? 288  PRO A CB  1 
ATOM   5551  C CG  . PRO B  1 308 ? -46.77877 -9.58099   70.39142  1.000 24.56522  ? 288  PRO A CG  1 
ATOM   5552  C CD  . PRO B  1 308 ? -47.49944 -8.47862   71.09112  1.000 17.92856  ? 288  PRO A CD  1 
ATOM   5553  N N   . ASP B  1 309 ? -50.17764 -10.00854  67.45886  1.000 14.65771  ? 289  ASP A N   1 
ATOM   5554  C CA  . ASP B  1 309 ? -51.20728 -10.97815  67.08933  1.000 19.15752  ? 289  ASP A CA  1 
ATOM   5555  C C   . ASP B  1 309 ? -50.81200 -12.41404  67.42420  1.000 20.14603  ? 289  ASP A C   1 
ATOM   5556  O O   . ASP B  1 309 ? -51.68476 -13.23031  67.74040  1.000 17.92943  ? 289  ASP A O   1 
ATOM   5557  C CB  . ASP B  1 309 ? -51.51422 -10.90218  65.59312  1.000 18.95480  ? 289  ASP A CB  1 
ATOM   5558  C CG  . ASP B  1 309 ? -51.98226 -9.53998   65.17579  1.000 23.48157  ? 289  ASP A CG  1 
ATOM   5559  O OD1 . ASP B  1 309 ? -52.73930 -8.91760   65.95279  1.000 20.78893  ? 289  ASP A OD1 1 
ATOM   5560  O OD2 . ASP B  1 309 ? -51.62047 -9.12157   64.05841  1.000 24.25005  ? 289  ASP A OD2 1 
ATOM   5561  N N   . LEU B  1 310 ? -49.52958 -12.75083  67.31766  1.000 13.78605  ? 290  LEU A N   1 
ATOM   5562  C CA  . LEU B  1 310 ? -49.02951 -14.08537  67.62852  1.000 16.46132  ? 290  LEU A CA  1 
ATOM   5563  C C   . LEU B  1 310 ? -48.26395 -13.99057  68.92741  1.000 14.18483  ? 290  LEU A C   1 
ATOM   5564  O O   . LEU B  1 310 ? -47.37406 -13.14799  69.04963  1.000 14.81353  ? 290  LEU A O   1 
ATOM   5565  C CB  . LEU B  1 310 ? -48.09944 -14.61379  66.51963  1.000 15.43508  ? 290  LEU A CB  1 
ATOM   5566  C CG  . LEU B  1 310 ? -47.48280 -16.01028  66.75868  1.000 16.47926  ? 290  LEU A CG  1 
ATOM   5567  C CD1 . LEU B  1 310 ? -48.61136 -17.06135  66.92696  1.000 13.17680  ? 290  LEU A CD1 1 
ATOM   5568  C CD2 . LEU B  1 310 ? -46.52229 -16.41790  65.62119  1.000 14.91746  ? 290  LEU A CD2 1 
ATOM   5569  N N   . ASP B  1 311 ? -48.57409 -14.86531  69.87861  1.000 14.17911  ? 291  ASP A N   1 
ATOM   5570  C CA  . ASP B  1 311 ? -47.90245 -14.86201  71.17481  1.000 15.24339  ? 291  ASP A CA  1 
ATOM   5571  C C   . ASP B  1 311 ? -46.77481 -15.89030  71.15557  1.000 17.32230  ? 291  ASP A C   1 
ATOM   5572  O O   . ASP B  1 311 ? -46.99639 -17.07572  71.45104  1.000 17.56730  ? 291  ASP A O   1 
ATOM   5573  C CB  . ASP B  1 311 ? -48.89952 -15.15864  72.29708  1.000 14.43706  ? 291  ASP A CB  1 
ATOM   5574  C CG  . ASP B  1 311 ? -48.22330 -15.26739  73.66953  1.000 15.87154  ? 291  ASP A CG  1 
ATOM   5575  O OD1 . ASP B  1 311 ? -47.00774 -14.95648  73.80671  1.000 15.76873  ? 291  ASP A OD1 1 
ATOM   5576  O OD2 . ASP B  1 311 ? -48.90387 -15.67978  74.63847  1.000 17.59810  ? 291  ASP A OD2 1 
ATOM   5577  N N   . ILE B  1 312 ? -45.55171 -15.44589  70.85284  1.000 13.59295  ? 292  ILE A N   1 
ATOM   5578  C CA  . ILE B  1 312 ? -44.43800 -16.38937  70.79987  1.000 16.90955  ? 292  ILE A CA  1 
ATOM   5579  C C   . ILE B  1 312 ? -43.89076 -16.73451  72.18294  1.000 18.03217  ? 292  ILE A C   1 
ATOM   5580  O O   . ILE B  1 312 ? -42.95024 -17.54197  72.27305  1.000 18.57570  ? 292  ILE A O   1 
ATOM   5581  C CB  . ILE B  1 312 ? -43.27508 -15.89047  69.91855  1.000 13.69194  ? 292  ILE A CB  1 
ATOM   5582  C CG1 . ILE B  1 312 ? -42.62725 -14.64183  70.50902  1.000 14.07273  ? 292  ILE A CG1 1 
ATOM   5583  C CG2 . ILE B  1 312 ? -43.72899 -15.69303  68.42772  1.000 16.74993  ? 292  ILE A CG2 1 
ATOM   5584  C CD1 . ILE B  1 312 ? -41.39832 -14.18108  69.68007  1.000 24.08066  ? 292  ILE A CD1 1 
ATOM   5585  N N   . TYR B  1 313 ? -44.41724 -16.13438  73.25346  1.000 14.20428  ? 293  TYR A N   1 
ATOM   5586  C CA  . TYR B  1 313 ? -44.01377 -16.45948  74.61671  1.000 14.69098  ? 293  TYR A CA  1 
ATOM   5587  C C   . TYR B  1 313 ? -44.97426 -17.43677  75.25856  1.000 21.60089  ? 293  TYR A C   1 
ATOM   5588  O O   . TYR B  1 313 ? -44.82041 -17.75871  76.43806  1.000 26.20806  ? 293  TYR A O   1 
ATOM   5589  C CB  . TYR B  1 313 ? -43.87929 -15.16805  75.46887  1.000 15.27956  ? 293  TYR A CB  1 
ATOM   5590  C CG  . TYR B  1 313 ? -42.77268 -14.31080  74.89240  1.000 15.28041  ? 293  TYR A CG  1 
ATOM   5591  C CD1 . TYR B  1 313 ? -41.46631 -14.45952  75.32924  1.000 15.42760  ? 293  TYR A CD1 1 
ATOM   5592  C CD2 . TYR B  1 313 ? -43.02198 -13.43272  73.84772  1.000 15.48134  ? 293  TYR A CD2 1 
ATOM   5593  C CE1 . TYR B  1 313 ? -40.41678 -13.71972  74.75596  1.000 16.70420  ? 293  TYR A CE1 1 
ATOM   5594  C CE2 . TYR B  1 313 ? -41.99346 -12.66456  73.28723  1.000 16.42355  ? 293  TYR A CE2 1 
ATOM   5595  C CZ  . TYR B  1 313 ? -40.69355 -12.82497  73.75112  1.000 19.67158  ? 293  TYR A CZ  1 
ATOM   5596  O OH  . TYR B  1 313 ? -39.65669 -12.11473  73.21498  1.000 26.72167  ? 293  TYR A OH  1 
ATOM   5597  N N   . ASP B  1 314 ? -45.97020 -17.91263  74.51426  1.000 16.02603  ? 294  ASP A N   1 
ATOM   5598  C CA  . ASP B  1 314 ? -46.91461 -18.86141  75.07363  1.000 18.01749  ? 294  ASP A CA  1 
ATOM   5599  C C   . ASP B  1 314 ? -46.26564 -20.22545  75.27728  1.000 21.75179  ? 294  ASP A C   1 
ATOM   5600  O O   . ASP B  1 314 ? -45.64349 -20.76935  74.35974  1.000 28.56781  ? 294  ASP A O   1 
ATOM   5601  C CB  . ASP B  1 314 ? -48.12104 -19.03801  74.14673  1.000 22.39289  ? 294  ASP A CB  1 
ATOM   5602  C CG  . ASP B  1 314 ? -48.89217 -20.29676  74.50528  1.000 22.81590  ? 294  ASP A CG  1 
ATOM   5603  O OD1 . ASP B  1 314 ? -49.47444 -20.32668  75.60965  1.000 23.63740  ? 294  ASP A OD1 1 
ATOM   5604  O OD2 . ASP B  1 314 ? -48.82034 -21.28593  73.74167  1.000 22.78716  ? 294  ASP A OD2 1 
ATOM   5605  N N   . LYS B  1 315 ? -46.46599 -20.80421  76.45659  1.000 15.32708  ? 295  LYS A N   1 
ATOM   5606  C CA  . LYS B  1 315 ? -45.98434 -22.13681  76.77373  1.000 19.98937  ? 295  LYS A CA  1 
ATOM   5607  C C   . LYS B  1 315 ? -47.07735 -23.20043  76.77239  1.000 21.99011  ? 295  LYS A C   1 
ATOM   5608  O O   . LYS B  1 315 ? -46.76597 -24.39642  76.92028  1.000 17.93016  ? 295  LYS A O   1 
ATOM   5609  C CB  . LYS B  1 315 ? -45.31961 -22.11394  78.16033  1.000 26.59354  ? 295  LYS A CB  1 
ATOM   5610  C CG  . LYS B  1 315 ? -44.17665 -21.11136  78.22853  1.000 31.69161  ? 295  LYS A CG  1 
ATOM   5611  C CD  . LYS B  1 315 ? -43.25274 -21.34880  79.39651  1.000 40.55979  ? 295  LYS A CD  1 
ATOM   5612  C CE  . LYS B  1 315 ? -43.96732 -21.20163  80.72815  1.000 49.06811  ? 295  LYS A CE  1 
ATOM   5613  N NZ  . LYS B  1 315 ? -43.10198 -20.50667  81.74955  1.000 56.12910  ? 295  LYS A NZ  1 
ATOM   5614  N N   . SER B  1 316 ? -48.33864 -22.81792  76.63264  1.000 15.69352  ? 296  SER A N   1 
ATOM   5615  C CA  . SER B  1 316 ? -49.38596 -23.82494  76.74518  1.000 16.69221  ? 296  SER A CA  1 
ATOM   5616  C C   . SER B  1 316 ? -49.56996 -24.63072  75.46222  1.000 17.16338  ? 296  SER A C   1 
ATOM   5617  O O   . SER B  1 316 ? -50.11596 -25.73631  75.51212  1.000 16.66972  ? 296  SER A O   1 
ATOM   5618  C CB  . SER B  1 316 ? -50.70204 -23.14115  77.14829  1.000 22.05333  ? 296  SER A CB  1 
ATOM   5619  O OG  . SER B  1 316 ? -51.12629 -22.25975  76.09723  1.000 23.95003  ? 296  SER A OG  1 
ATOM   5620  N N   . TRP B  1 317 ? -49.13309 -24.11445  74.31352  1.000 15.07367  ? 297  TRP A N   1 
ATOM   5621  C CA  . TRP B  1 317 ? -49.19301 -24.84297  73.04329  1.000 14.41066  ? 297  TRP A CA  1 
ATOM   5622  C C   . TRP B  1 317 ? -47.87476 -24.54931  72.35506  1.000 13.89848  ? 297  TRP A C   1 
ATOM   5623  O O   . TRP B  1 317 ? -47.80006 -23.77164  71.39245  1.000 16.80308  ? 297  TRP A O   1 
ATOM   5624  C CB  . TRP B  1 317 ? -50.39925 -24.40969  72.20151  1.000 14.39128  ? 297  TRP A CB  1 
ATOM   5625  C CG  . TRP B  1 317 ? -50.71609 -25.35090  71.03542  1.000 14.55342  ? 297  TRP A CG  1 
ATOM   5626  C CD1 . TRP B  1 317 ? -50.26542 -25.23788  69.76420  1.000 13.79978  ? 297  TRP A CD1 1 
ATOM   5627  C CD2 . TRP B  1 317 ? -51.52346 -26.53385  71.08532  1.000 14.60000  ? 297  TRP A CD2 1 
ATOM   5628  N NE1 . TRP B  1 317 ? -50.74743 -26.28564  69.00364  1.000 15.13215  ? 297  TRP A NE1 1 
ATOM   5629  C CE2 . TRP B  1 317 ? -51.51936 -27.09272  69.79325  1.000 16.51963  ? 297  TRP A CE2 1 
ATOM   5630  C CE3 . TRP B  1 317 ? -52.24946 -27.18018  72.10485  1.000 15.20979  ? 297  TRP A CE3 1 
ATOM   5631  C CZ2 . TRP B  1 317 ? -52.23529 -28.24711  69.46630  1.000 14.72585  ? 297  TRP A CZ2 1 
ATOM   5632  C CZ3 . TRP B  1 317 ? -52.94106 -28.35423  71.79153  1.000 21.63904  ? 297  TRP A CZ3 1 
ATOM   5633  C CH2 . TRP B  1 317 ? -52.92929 -28.86986  70.47137  1.000 15.75053  ? 297  TRP A CH2 1 
ATOM   5634  N N   . PRO B  1 318 ? -46.80074 -25.15436  72.83722  1.000 13.92143  ? 298  PRO A N   1 
ATOM   5635  C CA  . PRO B  1 318 ? -45.45772 -24.71409  72.43756  1.000 15.14480  ? 298  PRO A CA  1 
ATOM   5636  C C   . PRO B  1 318 ? -45.08747 -25.17654  71.03835  1.000 16.18995  ? 298  PRO A C   1 
ATOM   5637  O O   . PRO B  1 318 ? -45.56911 -26.20189  70.54617  1.000 13.66417  ? 298  PRO A O   1 
ATOM   5638  C CB  . PRO B  1 318 ? -44.55188 -25.36280  73.48667  1.000 13.91127  ? 298  PRO A CB  1 
ATOM   5639  C CG  . PRO B  1 318 ? -45.33986 -26.61658  73.91751  1.000 17.19963  ? 298  PRO A CG  1 
ATOM   5640  C CD  . PRO B  1 318 ? -46.80071 -26.25165  73.82564  1.000 14.35893  ? 298  PRO A CD  1 
ATOM   5641  N N   . ILE B  1 319 ? -44.19863 -24.41403  70.39724  1.000 12.96307  ? 299  ILE A N   1 
ATOM   5642  C CA  . ILE B  1 319 ? -43.68900 -24.77894  69.09212  1.000 12.72632  ? 299  ILE A CA  1 
ATOM   5643  C C   . ILE B  1 319 ? -42.31330 -25.38242  69.32430  1.000 15.22336  ? 299  ILE A C   1 
ATOM   5644  O O   . ILE B  1 319 ? -41.39347 -24.67368  69.75278  1.000 12.84829  ? 299  ILE A O   1 
ATOM   5645  C CB  . ILE B  1 319 ? -43.60517 -23.56283  68.16829  1.000 18.91116  ? 299  ILE A CB  1 
ATOM   5646  C CG1 . ILE B  1 319 ? -44.95803 -22.84183  68.11826  1.000 16.50293  ? 299  ILE A CG1 1 
ATOM   5647  C CG2 . ILE B  1 319 ? -43.08033 -23.99455  66.79493  1.000 17.99296  ? 299  ILE A CG2 1 
ATOM   5648  C CD1 . ILE B  1 319 ? -46.12950 -23.74561  67.78393  1.000 13.86239  ? 299  ILE A CD1 1 
ATOM   5649  N N   . TRP B  1 320 ? -42.17139 -26.69076  69.05621  1.000 14.16314  ? 300  TRP A N   1 
ATOM   5650  C CA  . TRP B  1 320 ? -40.86305 -27.34176  69.06487  1.000 12.96407  ? 300  TRP A CA  1 
ATOM   5651  C C   . TRP B  1 320 ? -40.08781 -27.00112  67.80025  1.000 12.85351  ? 300  TRP A C   1 
ATOM   5652  O O   . TRP B  1 320 ? -40.65683 -26.89967  66.70984  1.000 13.09144  ? 300  TRP A O   1 
ATOM   5653  C CB  . TRP B  1 320 ? -41.00798 -28.86687  69.18199  1.000 13.93685  ? 300  TRP A CB  1 
ATOM   5654  C CG  . TRP B  1 320 ? -39.69202 -29.55177  69.28115  1.000 13.34796  ? 300  TRP A CG  1 
ATOM   5655  C CD1 . TRP B  1 320 ? -38.99125 -30.13397  68.25792  1.000 13.39249  ? 300  TRP A CD1 1 
ATOM   5656  C CD2 . TRP B  1 320 ? -38.89438 -29.72203  70.47074  1.000 13.63538  ? 300  TRP A CD2 1 
ATOM   5657  N NE1 . TRP B  1 320 ? -37.82184 -30.65030  68.74791  1.000 13.83493  ? 300  TRP A NE1 1 
ATOM   5658  C CE2 . TRP B  1 320 ? -37.74351 -30.41670  70.10046  1.000 13.81477  ? 300  TRP A CE2 1 
ATOM   5659  C CE3 . TRP B  1 320 ? -39.07322 -29.37299  71.82392  1.000 15.15074  ? 300  TRP A CE3 1 
ATOM   5660  C CZ2 . TRP B  1 320 ? -36.73993 -30.75066  71.01976  1.000 16.04468  ? 300  TRP A CZ2 1 
ATOM   5661  C CZ3 . TRP B  1 320 ? -38.08184 -29.70584  72.74107  1.000 20.18061  ? 300  TRP A CZ3 1 
ATOM   5662  C CH2 . TRP B  1 320 ? -36.93104 -30.38265  72.33999  1.000 17.87698  ? 300  TRP A CH2 1 
ATOM   5663  N N   . THR B  1 321 ? -38.77338 -26.82731  67.93829  1.000 12.98862  ? 301  THR A N   1 
ATOM   5664  C CA  . THR B  1 321 ? -37.91535 -26.63805  66.76879  1.000 13.04148  ? 301  THR A CA  1 
ATOM   5665  C C   . THR B  1 321 ? -36.52603 -27.19036  67.06406  1.000 16.72308  ? 301  THR A C   1 
ATOM   5666  O O   . THR B  1 321 ? -36.25757 -27.68627  68.15485  1.000 13.78804  ? 301  THR A O   1 
ATOM   5667  C CB  . THR B  1 321 ? -37.83657 -25.16360  66.35625  1.000 16.87912  ? 301  THR A CB  1 
ATOM   5668  O OG1 . THR B  1 321 ? -37.20754 -25.08014  65.07816  1.000 15.95781  ? 301  THR A OG1 1 
ATOM   5669  C CG2 . THR B  1 321 ? -37.07811 -24.30445  67.40747  1.000 15.77493  ? 301  THR A CG2 1 
ATOM   5670  N N   . TYR B  1 322 ? -35.63750 -27.12469  66.07190  1.000 15.08210  ? 302  TYR A N   1 
ATOM   5671  C CA  . TYR B  1 322 ? -34.22942 -27.38793  66.33651  1.000 17.13774  ? 302  TYR A CA  1 
ATOM   5672  C C   . TYR B  1 322 ? -33.60845 -26.14084  66.96407  1.000 18.13345  ? 302  TYR A C   1 
ATOM   5673  O O   . TYR B  1 322 ? -33.73026 -25.04551  66.41225  1.000 15.46869  ? 302  TYR A O   1 
ATOM   5674  C CB  . TYR B  1 322 ? -33.49362 -27.73894  65.03940  1.000 17.06642  ? 302  TYR A CB  1 
ATOM   5675  C CG  . TYR B  1 322 ? -32.02332 -27.97201  65.29440  1.000 16.17452  ? 302  TYR A CG  1 
ATOM   5676  C CD1 . TYR B  1 322 ? -31.59837 -28.99878  66.13119  1.000 21.21434  ? 302  TYR A CD1 1 
ATOM   5677  C CD2 . TYR B  1 322 ? -31.06484 -27.14243  64.73268  1.000 22.36476  ? 302  TYR A CD2 1 
ATOM   5678  C CE1 . TYR B  1 322 ? -30.22098 -29.20753  66.39902  1.000 21.12986  ? 302  TYR A CE1 1 
ATOM   5679  C CE2 . TYR B  1 322 ? -29.69683 -27.33554  64.99933  1.000 22.03760  ? 302  TYR A CE2 1 
ATOM   5680  C CZ  . TYR B  1 322 ? -29.29178 -28.37498  65.82455  1.000 19.94435  ? 302  TYR A CZ  1 
ATOM   5681  O OH  . TYR B  1 322 ? -27.94567 -28.57100  66.09246  1.000 21.76615  ? 302  TYR A OH  1 
ATOM   5682  N N   . ALA B  1 323 ? -32.96535 -26.30007  68.11780  1.000 14.28192  ? 303  ALA A N   1 
ATOM   5683  C CA  . ALA B  1 323 ? -32.29998 -25.19809  68.79389  1.000 19.73415  ? 303  ALA A CA  1 
ATOM   5684  C C   . ALA B  1 323 ? -31.02779 -25.72758  69.41725  1.000 20.38831  ? 303  ALA A C   1 
ATOM   5685  O O   . ALA B  1 323 ? -31.01141 -26.85551  69.91439  1.000 18.03808  ? 303  ALA A O   1 
ATOM   5686  C CB  . ALA B  1 323 ? -33.16291 -24.58050  69.90719  1.000 22.03145  ? 303  ALA A CB  1 
ATOM   5687  N N   . GLU B  1 324 ? -29.98465 -24.90502  69.41939  1.000 15.94536  ? 304  GLU A N   1 
ATOM   5688  C CA  . GLU B  1 324 ? -28.75436 -25.19880  70.13476  1.000 17.30977  ? 304  GLU A CA  1 
ATOM   5689  C C   . GLU B  1 324 ? -28.60486 -24.30618  71.36271  1.000 16.44181  ? 304  GLU A C   1 
ATOM   5690  O O   . GLU B  1 324 ? -29.26124 -23.27138  71.48917  1.000 19.99132  ? 304  GLU A O   1 
ATOM   5691  C CB  . GLU B  1 324 ? -27.54515 -25.03590  69.19752  1.000 16.60416  ? 304  GLU A CB  1 
ATOM   5692  C CG  . GLU B  1 324 ? -27.73363 -25.89250  67.90813  1.000 16.58337  ? 304  GLU A CG  1 
ATOM   5693  C CD  . GLU B  1 324 ? -26.55903 -25.74867  66.89918  1.000 26.20904  ? 304  GLU A CD  1 
ATOM   5694  O OE1 . GLU B  1 324 ? -25.79742 -24.76179  66.99592  1.000 24.79861  ? 304  GLU A OE1 1 
ATOM   5695  O OE2 . GLU B  1 324 ? -26.42282 -26.61973  66.01027  1.000 28.75970  ? 304  GLU A OE2 1 
ATOM   5696  N N   . ILE B  1 325 ? -27.76504 -24.75800  72.28266  1.000 16.31465  ? 305  ILE A N   1 
ATOM   5697  C CA  . ILE B  1 325 ? -27.32365 -23.91258  73.37880  1.000 17.44708  ? 305  ILE A CA  1 
ATOM   5698  C C   . ILE B  1 325 ? -26.69668 -22.67012  72.76322  1.000 18.76883  ? 305  ILE A C   1 
ATOM   5699  O O   . ILE B  1 325 ? -25.80380 -22.76680  71.91850  1.000 16.11143  ? 305  ILE A O   1 
ATOM   5700  C CB  . ILE B  1 325 ? -26.32871 -24.66547  74.27112  1.000 16.53823  ? 305  ILE A CB  1 
ATOM   5701  C CG1 . ILE B  1 325 ? -26.94824 -25.95793  74.82177  1.000 22.49254  ? 305  ILE A CG1 1 
ATOM   5702  C CG2 . ILE B  1 325 ? -25.80731 -23.75418  75.38790  1.000 19.40693  ? 305  ILE A CG2 1 
ATOM   5703  C CD1 . ILE B  1 325 ? -25.95819 -26.70038  75.74249  1.000 23.79201  ? 305  ILE A CD1 1 
ATOM   5704  N N   . THR B  1 326 ? -27.22308 -21.49970  73.10448  1.000 15.59307  ? 306  THR A N   1 
ATOM   5705  C CA  . THR B  1 326 ? -26.66351 -20.30170  72.51050  1.000 21.05680  ? 306  THR A CA  1 
ATOM   5706  C C   . THR B  1 326 ? -26.38647 -19.28590  73.60690  1.000 17.57364  ? 306  THR A C   1 
ATOM   5707  O O   . THR B  1 326 ? -27.14180 -19.20061  74.58424  1.000 21.26581  ? 306  THR A O   1 
ATOM   5708  C CB  . THR B  1 326 ? -27.59876 -19.67134  71.46704  1.000 32.92967  ? 306  THR A CB  1 
ATOM   5709  O OG1 . THR B  1 326 ? -28.58207 -18.88526  72.14586  1.000 41.46745  ? 306  THR A OG1 1 
ATOM   5710  C CG2 . THR B  1 326 ? -28.32002 -20.71529  70.62499  1.000 31.66356  ? 306  THR A CG2 1 
ATOM   5711  N N   . PRO B  1 327 ? -25.31922 -18.50660  73.47315  1.000 17.62480  ? 307  PRO A N   1 
ATOM   5712  C CA  . PRO B  1 327 ? -25.05102 -17.43286  74.45152  1.000 19.31053  ? 307  PRO A CA  1 
ATOM   5713  C C   . PRO B  1 327 ? -26.11049 -16.34350  74.37469  1.000 21.57274  ? 307  PRO A C   1 
ATOM   5714  O O   . PRO B  1 327 ? -26.91144 -16.28936  73.42085  1.000 19.92695  ? 307  PRO A O   1 
ATOM   5715  C CB  . PRO B  1 327 ? -23.65581 -16.90853  74.03867  1.000 22.99389  ? 307  PRO A CB  1 
ATOM   5716  C CG  . PRO B  1 327 ? -23.51157 -17.30896  72.58218  1.000 21.88717  ? 307  PRO A CG  1 
ATOM   5717  C CD  . PRO B  1 327 ? -24.26968 -18.62350  72.44681  1.000 19.40697  ? 307  PRO A CD  1 
ATOM   5718  N N   . PRO B  1 328 ? -26.17010 -15.47188  75.38275  1.000 20.46438  ? 308  PRO A N   1 
ATOM   5719  C CA  . PRO B  1 328 ? -27.15408 -14.39227  75.37371  1.000 20.90091  ? 308  PRO A CA  1 
ATOM   5720  C C   . PRO B  1 328 ? -26.78973 -13.34243  74.34434  1.000 18.82486  ? 308  PRO A C   1 
ATOM   5721  O O   . PRO B  1 328 ? -25.73858 -13.38340  73.69147  1.000 15.99662  ? 308  PRO A O   1 
ATOM   5722  C CB  . PRO B  1 328 ? -27.09128 -13.82542  76.80139  1.000 20.57979  ? 308  PRO A CB  1 
ATOM   5723  C CG  . PRO B  1 328 ? -25.67879 -14.16558  77.24986  1.000 23.36547  ? 308  PRO A CG  1 
ATOM   5724  C CD  . PRO B  1 328 ? -25.37887 -15.49246  76.62529  1.000 24.75135  ? 308  PRO A CD  1 
ATOM   5725  N N   . ALA B  1 329 ? -27.70594 -12.38860  74.20369  1.000 15.46991  ? 309  ALA A N   1 
ATOM   5726  C CA  . ALA B  1 329 ? -27.46777 -11.20765  73.38533  1.000 15.67024  ? 309  ALA A CA  1 
ATOM   5727  C C   . ALA B  1 329 ? -26.62729 -10.20248  74.15193  1.000 15.12306  ? 309  ALA A C   1 
ATOM   5728  O O   . ALA B  1 329 ? -26.62953 -10.18205  75.38554  1.000 17.20850  ? 309  ALA A O   1 
ATOM   5729  C CB  . ALA B  1 329 ? -28.80757 -10.58935  72.97614  1.000 15.79442  ? 309  ALA A CB  1 
ATOM   5730  N N   . LYS B  1 330 ? -25.85724 -9.38973   73.42028  1.000 14.18764  ? 310  LYS A N   1 
ATOM   5731  C CA  . LYS B  1 330 ? -24.97166 -8.41395   74.04979  1.000 18.37929  ? 310  LYS A CA  1 
ATOM   5732  C C   . LYS B  1 330 ? -25.12739 -7.07097   73.34978  1.000 17.93553  ? 310  LYS A C   1 
ATOM   5733  O O   . LYS B  1 330 ? -25.24047 -7.00882   72.12228  1.000 17.06456  ? 310  LYS A O   1 
ATOM   5734  C CB  . LYS B  1 330 ? -23.51436 -8.89457   73.99212  1.000 22.54776  ? 310  LYS A CB  1 
ATOM   5735  C CG  . LYS B  1 330 ? -22.47687 -8.01611   74.70287  1.000 23.00833  ? 310  LYS A CG  1 
ATOM   5736  C CD  . LYS B  1 330 ? -21.07861 -8.31098   74.20464  1.000 30.90111  ? 310  LYS A CD  1 
ATOM   5737  C CE  . LYS B  1 330 ? -20.03586 -8.36589   75.32086  1.000 30.00317  ? 310  LYS A CE  1 
ATOM   5738  N NZ  . LYS B  1 330 ? -20.12242 -7.26459   76.28419  1.000 28.41249  ? 310  LYS A NZ  1 
ATOM   5739  N N   . PHE B  1 331 ? -25.15799 -6.00647   74.14359  1.000 15.30371  ? 311  PHE A N   1 
ATOM   5740  C CA  . PHE B  1 331 ? -25.21569 -4.64032   73.65130  1.000 15.76721  ? 311  PHE A CA  1 
ATOM   5741  C C   . PHE B  1 331 ? -24.02623 -3.89590   74.22892  1.000 21.93963  ? 311  PHE A C   1 
ATOM   5742  O O   . PHE B  1 331 ? -23.82826 -3.89972   75.45430  1.000 19.29879  ? 311  PHE A O   1 
ATOM   5743  C CB  . PHE B  1 331 ? -26.49580 -3.94966   74.10675  1.000 15.70478  ? 311  PHE A CB  1 
ATOM   5744  C CG  . PHE B  1 331 ? -27.70908 -4.66392   73.70001  1.000 17.00933  ? 311  PHE A CG  1 
ATOM   5745  C CD1 . PHE B  1 331 ? -28.22471 -5.69718   74.48246  1.000 16.23994  ? 311  PHE A CD1 1 
ATOM   5746  C CD2 . PHE B  1 331 ? -28.32556 -4.35032   72.48926  1.000 18.93649  ? 311  PHE A CD2 1 
ATOM   5747  C CE1 . PHE B  1 331 ? -29.37231 -6.37780   74.09250  1.000 21.95001  ? 311  PHE A CE1 1 
ATOM   5748  C CE2 . PHE B  1 331 ? -29.46205 -5.05399   72.09560  1.000 21.59569  ? 311  PHE A CE2 1 
ATOM   5749  C CZ  . PHE B  1 331 ? -29.98722 -6.04862   72.90733  1.000 22.47650  ? 311  PHE A CZ  1 
ATOM   5750  N N   . VAL B  1 332 ? -23.25519 -3.25595   73.37275  1.000 23.53980  ? 312  VAL A N   1 
ATOM   5751  C CA  . VAL B  1 332 ? -22.01332 -2.62382   73.80604  1.000 26.36373  ? 312  VAL A CA  1 
ATOM   5752  C C   . VAL B  1 332 ? -21.88867 -1.27332   73.11083  1.000 23.42166  ? 312  VAL A C   1 
ATOM   5753  O O   . VAL B  1 332 ? -22.47425 -1.05134   72.04231  1.000 20.10520  ? 312  VAL A O   1 
ATOM   5754  C CB  . VAL B  1 332 ? -20.81031 -3.54852   73.54075  1.000 31.35525  ? 312  VAL A CB  1 
ATOM   5755  C CG1 . VAL B  1 332 ? -20.71072 -3.88169   72.10907  1.000 35.48351  ? 312  VAL A CG1 1 
ATOM   5756  C CG2 . VAL B  1 332 ? -19.53831 -2.93462   73.97084  1.000 36.25463  ? 312  VAL A CG2 1 
ATOM   5757  N N   . HIS B  1 333 ? -21.17131 -0.35906   73.78172  1.000 24.29319  ? 313  HIS A N   1 
ATOM   5758  C CA  . HIS B  1 333 ? -20.86798 1.02963    73.42443  1.000 27.21818  ? 313  HIS A CA  1 
ATOM   5759  C C   . HIS B  1 333 ? -22.00613 1.97982    73.78394  1.000 24.02562  ? 313  HIS A C   1 
ATOM   5760  O O   . HIS B  1 333 ? -23.18956 1.66683    73.60835  1.000 21.67288  ? 313  HIS A O   1 
ATOM   5761  C CB  . HIS B  1 333 ? -20.49024 1.15951    71.95081  1.000 28.57525  ? 313  HIS A CB  1 
ATOM   5762  C CG  . HIS B  1 333 ? -19.19926 0.49421    71.61715  1.000 27.53588  ? 313  HIS A CG  1 
ATOM   5763  N ND1 . HIS B  1 333 ? -18.03152 0.77273    72.29070  1.000 29.86203  ? 313  HIS A ND1 1 
ATOM   5764  C CD2 . HIS B  1 333 ? -18.90565 -0.49513   70.74064  1.000 30.73104  ? 313  HIS A CD2 1 
ATOM   5765  C CE1 . HIS B  1 333 ? -17.05978 0.01743    71.81190  1.000 32.97140  ? 313  HIS A CE1 1 
ATOM   5766  N NE2 . HIS B  1 333 ? -17.56506 -0.76609   70.87344  1.000 29.91082  ? 313  HIS A NE2 1 
ATOM   5767  N N   . ASP B  1 334 ? -21.65007 3.14486    74.31959  1.000 23.34973  ? 314  ASP A N   1 
ATOM   5768  C CA  . ASP B  1 334 ? -22.67935 4.07414    74.77242  1.000 24.82573  ? 314  ASP A CA  1 
ATOM   5769  C C   . ASP B  1 334 ? -22.06199 5.44803    74.97038  1.000 28.39491  ? 314  ASP A C   1 
ATOM   5770  O O   . ASP B  1 334 ? -21.80888 5.87460    76.10482  1.000 30.71925  ? 314  ASP A O   1 
ATOM   5771  C CB  . ASP B  1 334 ? -23.32430 3.54874    76.05275  1.000 24.79650  ? 314  ASP A CB  1 
ATOM   5772  C CG  . ASP B  1 334 ? -24.32798 4.52112    76.66301  1.000 36.28234  ? 314  ASP A CG  1 
ATOM   5773  O OD1 . ASP B  1 334 ? -25.01126 5.23886    75.90288  1.000 39.20476  ? 314  ASP A OD1 1 
ATOM   5774  O OD2 . ASP B  1 334 ? -24.47988 4.51193    77.90396  1.000 40.36502  ? 314  ASP A OD2 1 
ATOM   5775  N N   . ASP B  1 335 ? -21.78528 6.12381    73.86180  1.000 27.04088  ? 315  ASP A N   1 
ATOM   5776  C CA  . ASP B  1 335 ? -21.12422 7.42424    73.93059  1.000 33.27448  ? 315  ASP A CA  1 
ATOM   5777  C C   . ASP B  1 335 ? -21.82419 8.46325    73.06636  1.000 36.89053  ? 315  ASP A C   1 
ATOM   5778  O O   . ASP B  1 335 ? -22.95444 8.24987    72.60906  1.000 33.45337  ? 315  ASP A O   1 
ATOM   5779  C CB  . ASP B  1 335 ? -19.65715 7.30536    73.51746  1.000 33.00575  ? 315  ASP A CB  1 
ATOM   5780  C CG  . ASP B  1 335 ? -19.47087 6.69082    72.16005  1.000 37.86494  ? 315  ASP A CG  1 
ATOM   5781  O OD1 . ASP B  1 335 ? -20.19094 7.06199    71.20509  1.000 39.88287  ? 315  ASP A OD1 1 
ATOM   5782  O OD2 . ASP B  1 335 ? -18.56847 5.83642    72.03379  1.000 41.64964  ? 315  ASP A OD2 1 
ATOM   5783  N N   . GLU B  1 336 ? -21.14589 9.59377    72.83001  1.000 42.08608  ? 316  GLU A N   1 
ATOM   5784  C CA  . GLU B  1 336 ? -21.75687 10.68014   72.07585  1.000 45.26308  ? 316  GLU A CA  1 
ATOM   5785  C C   . GLU B  1 336 ? -22.08031 10.27218   70.65160  1.000 45.01944  ? 316  GLU A C   1 
ATOM   5786  O O   . GLU B  1 336 ? -23.04011 10.78228   70.06198  1.000 51.33270  ? 316  GLU A O   1 
ATOM   5787  C CB  . GLU B  1 336 ? -20.82716 11.88217   72.06773  1.000 52.86857  ? 316  GLU A CB  1 
ATOM   5788  C CG  . GLU B  1 336 ? -21.25901 12.96989   72.99225  1.000 62.71804  ? 316  GLU A CG  1 
ATOM   5789  C CD  . GLU B  1 336 ? -20.10538 13.87759   73.35534  1.000 72.51377  ? 316  GLU A CD  1 
ATOM   5790  O OE1 . GLU B  1 336 ? -18.96800 13.59349   72.90207  1.000 72.85492  ? 316  GLU A OE1 1 
ATOM   5791  O OE2 . GLU B  1 336 ? -20.33880 14.87933   74.07558  1.000 78.59545  ? 316  GLU A OE2 1 
ATOM   5792  N N   . ASP B  1 337 ? -21.29319 9.35986    70.08216  1.000 39.70814  ? 317  ASP A N   1 
ATOM   5793  C CA  . ASP B  1 337 ? -21.39621 9.00650    68.67608  1.000 37.93188  ? 317  ASP A CA  1 
ATOM   5794  C C   . ASP B  1 337 ? -21.96761 7.62632    68.39919  1.000 34.50723  ? 317  ASP A C   1 
ATOM   5795  O O   . ASP B  1 337 ? -22.40728 7.38427    67.27289  1.000 38.87346  ? 317  ASP A O   1 
ATOM   5796  C CB  . ASP B  1 337 ? -20.01268 9.09309    68.02460  1.000 40.58368  ? 317  ASP A CB  1 
ATOM   5797  C CG  . ASP B  1 337 ? -19.35947 10.45391   68.23276  1.000 43.54682  ? 317  ASP A CG  1 
ATOM   5798  O OD1 . ASP B  1 337 ? -20.03877 11.46315   67.89777  1.000 40.92692  ? 317  ASP A OD1 1 
ATOM   5799  O OD2 . ASP B  1 337 ? -18.19427 10.50482   68.72475  1.000 40.34615  ? 317  ASP A OD2 1 
ATOM   5800  N N   . ARG B  1 338 ? -21.95489 6.70696    69.36095  1.000 31.48689  ? 318  ARG A N   1 
ATOM   5801  C CA  . ARG B  1 338 ? -22.47361 5.37090    69.08730  1.000 30.39966  ? 318  ARG A CA  1 
ATOM   5802  C C   . ARG B  1 338 ? -23.05022 4.77727    70.35524  1.000 28.95136  ? 318  ARG A C   1 
ATOM   5803  O O   . ARG B  1 338 ? -22.53815 5.01291    71.45522  1.000 31.71343  ? 318  ARG A O   1 
ATOM   5804  C CB  . ARG B  1 338 ? -21.39864 4.41824    68.52078  1.000 31.02065  ? 318  ARG A CB  1 
ATOM   5805  C CG  . ARG B  1 338 ? -20.19194 4.21655    69.42600  1.000 28.66989  ? 318  ARG A CG  1 
ATOM   5806  C CD  . ARG B  1 338 ? -19.12356 3.36723    68.76843  1.000 28.16839  ? 318  ARG A CD  1 
ATOM   5807  N NE  . ARG B  1 338 ? -17.87895 3.44175    69.51341  1.000 30.07679  ? 318  ARG A NE  1 
ATOM   5808  C CZ  . ARG B  1 338 ? -16.86010 2.59651    69.38413  1.000 33.70238  ? 318  ARG A CZ  1 
ATOM   5809  N NH1 . ARG B  1 338 ? -16.92267 1.56408    68.54399  1.000 31.83415  ? 318  ARG A NH1 1 
ATOM   5810  N NH2 . ARG B  1 338 ? -15.77046 2.77885    70.11171  1.000 39.56226  ? 318  ARG A NH2 1 
ATOM   5811  N N   . ARG B  1 339 ? -24.12039 4.00918    70.18186  1.000 27.66783  ? 319  ARG A N   1 
ATOM   5812  C CA  . ARG B  1 339 ? -24.74409 3.27318    71.27521  1.000 28.53341  ? 319  ARG A CA  1 
ATOM   5813  C C   . ARG B  1 339 ? -25.34611 2.00277    70.68962  1.000 27.46857  ? 319  ARG A C   1 
ATOM   5814  O O   . ARG B  1 339 ? -26.15289 2.07228    69.75472  1.000 24.80273  ? 319  ARG A O   1 
ATOM   5815  C CB  . ARG B  1 339 ? -25.81025 4.12723    71.97231  1.000 27.87514  ? 319  ARG A CB  1 
ATOM   5816  C CG  . ARG B  1 339 ? -26.68046 3.34573    72.94587  1.000 28.97505  ? 319  ARG A CG  1 
ATOM   5817  C CD  . ARG B  1 339 ? -27.33763 4.26781    73.94441  1.000 41.07919  ? 319  ARG A CD  1 
ATOM   5818  N NE  . ARG B  1 339 ? -28.51677 4.89479    73.36358  1.000 46.86628  ? 319  ARG A NE  1 
ATOM   5819  C CZ  . ARG B  1 339 ? -29.02180 6.04559    73.78823  1.000 53.35797  ? 319  ARG A CZ  1 
ATOM   5820  N NH1 . ARG B  1 339 ? -28.44816 6.68125    74.80265  1.000 56.20212  ? 319  ARG A NH1 1 
ATOM   5821  N NH2 . ARG B  1 339 ? -30.10195 6.55635    73.20764  1.000 55.47177  ? 319  ARG A NH2 1 
ATOM   5822  N N   . GLY B  1 340 ? -24.92462 0.84686    71.20113  1.000 20.46705  ? 320  GLY A N   1 
ATOM   5823  C CA  . GLY B  1 340 ? -25.54854 -0.38233   70.78834  1.000 21.42100  ? 320  GLY A CA  1 
ATOM   5824  C C   . GLY B  1 340 ? -26.78885 -0.57399   71.64189  1.000 22.23149  ? 320  GLY A C   1 
ATOM   5825  O O   . GLY B  1 340 ? -26.68317 -0.64416   72.86993  1.000 18.92094  ? 320  GLY A O   1 
ATOM   5826  N N   . SER B  1 341 ? -27.97254 -0.61638   71.02546  1.000 22.03536  ? 321  SER A N   1 
ATOM   5827  C CA  . SER B  1 341 ? -29.19955 -0.84943   71.78871  1.000 21.00704  ? 321  SER A CA  1 
ATOM   5828  C C   . SER B  1 341 ? -30.34755 -1.10635   70.83068  1.000 17.62488  ? 321  SER A C   1 
ATOM   5829  O O   . SER B  1 341 ? -30.30872 -0.71090   69.66961  1.000 21.96927  ? 321  SER A O   1 
ATOM   5830  C CB  . SER B  1 341 ? -29.57338 0.33145    72.69696  1.000 29.45021  ? 321  SER A CB  1 
ATOM   5831  O OG  . SER B  1 341 ? -29.89573 1.46585    71.89670  1.000 35.02729  ? 321  SER A OG  1 
ATOM   5832  N N   . ALA B  1 342 ? -31.41715 -1.70893   71.37245  1.000 17.26185  ? 322  ALA A N   1 
ATOM   5833  C CA  . ALA B  1 342 ? -32.56329 -2.12416   70.57295  1.000 18.20305  ? 322  ALA A CA  1 
ATOM   5834  C C   . ALA B  1 342 ? -33.81767 -1.54582   71.21305  1.000 20.62436  ? 322  ALA A C   1 
ATOM   5835  O O   . ALA B  1 342 ? -34.00757 -1.68705   72.42618  1.000 23.79774  ? 322  ALA A O   1 
ATOM   5836  C CB  . ALA B  1 342 ? -32.65458 -3.67453   70.50301  1.000 17.75228  ? 322  ALA A CB  1 
ATOM   5837  N N   . VAL B  1 343 ? -34.65575 -0.87646   70.42306  1.000 16.60687  ? 323  VAL A N   1 
ATOM   5838  C CA  . VAL B  1 343 ? -35.95027 -0.41516   70.92508  1.000 19.16488  ? 323  VAL A CA  1 
ATOM   5839  C C   . VAL B  1 343 ? -37.01366 -1.03811   70.03815  1.000 18.98293  ? 323  VAL A C   1 
ATOM   5840  O O   . VAL B  1 343 ? -36.78573 -1.23550   68.83676  1.000 16.59923  ? 323  VAL A O   1 
ATOM   5841  C CB  . VAL B  1 343 ? -36.12134 1.12113    70.92238  1.000 23.34265  ? 323  VAL A CB  1 
ATOM   5842  C CG1 . VAL B  1 343 ? -35.32983 1.77140    72.04689  1.000 25.94819  ? 323  VAL A CG1 1 
ATOM   5843  C CG2 . VAL B  1 343 ? -35.72055 1.67660    69.58768  1.000 23.34212  ? 323  VAL A CG2 1 
ATOM   5844  N N   . SER B  1 344 ? -38.18415 -1.31492   70.62576  1.000 18.40495  ? 324  SER A N   1 
ATOM   5845  C CA  . SER B  1 344 ? -39.30974 -1.85644   69.88038  1.000 16.91152  ? 324  SER A CA  1 
ATOM   5846  C C   . SER B  1 344 ? -38.87576 -3.01100   68.98543  1.000 17.91057  ? 324  SER A C   1 
ATOM   5847  O O   . SER B  1 344 ? -39.22229 -3.07787   67.79412  1.000 15.31654  ? 324  SER A O   1 
ATOM   5848  C CB  . SER B  1 344 ? -40.00031 -0.76092   69.07281  1.000 17.90813  ? 324  SER A CB  1 
ATOM   5849  O OG  . SER B  1 344 ? -40.38016 0.32094    69.90940  1.000 17.65101  ? 324  SER A OG  1 
ATOM   5850  N N   . SER B  1 345 ? -38.08052 -3.92162   69.55270  1.000 14.68731  ? 325  SER A N   1 
ATOM   5851  C CA  . SER B  1 345 ? -37.42599 -4.93660   68.73923  1.000 14.23174  ? 325  SER A CA  1 
ATOM   5852  C C   . SER B  1 345 ? -37.39453 -6.27183   69.47186  1.000 13.68603  ? 325  SER A C   1 
ATOM   5853  O O   . SER B  1 345 ? -37.54445 -6.35301   70.69345  1.000 16.62783  ? 325  SER A O   1 
ATOM   5854  C CB  . SER B  1 345 ? -35.98894 -4.55421   68.37655  1.000 15.57206  ? 325  SER A CB  1 
ATOM   5855  O OG  . SER B  1 345 ? -35.91395 -3.42444   67.47549  1.000 16.25057  ? 325  SER A OG  1 
ATOM   5856  N N   . VAL B  1 346 ? -37.15262 -7.31363   68.69363  1.000 13.39475  ? 326  VAL A N   1 
ATOM   5857  C CA  . VAL B  1 346 ? -37.01388 -8.68801   69.15567  1.000 16.19883  ? 326  VAL A CA  1 
ATOM   5858  C C   . VAL B  1 346 ? -35.61281 -9.15399   68.75855  1.000 17.04869  ? 326  VAL A C   1 
ATOM   5859  O O   . VAL B  1 346 ? -35.24674 -9.08321   67.57800  1.000 17.70524  ? 326  VAL A O   1 
ATOM   5860  C CB  . VAL B  1 346 ? -38.10210 -9.58439   68.54235  1.000 18.19493  ? 326  VAL A CB  1 
ATOM   5861  C CG1 . VAL B  1 346 ? -37.90222 -11.03324  68.94908  1.000 12.63878  ? 326  VAL A CG1 1 
ATOM   5862  C CG2 . VAL B  1 346 ? -39.47757 -9.11719   68.97647  1.000 13.58774  ? 326  VAL A CG2 1 
ATOM   5863  N N   . VAL B  1 347 ? -34.82178 -9.60723   69.73682  1.000 16.88570  ? 327  VAL A N   1 
ATOM   5864  C CA  . VAL B  1 347 ? -33.41485 -9.92213   69.51863  1.000 15.75171  ? 327  VAL A CA  1 
ATOM   5865  C C   . VAL B  1 347 ? -33.14513 -11.31720  70.07975  1.000 16.39145  ? 327  VAL A C   1 
ATOM   5866  O O   . VAL B  1 347 ? -33.34308 -11.55436  71.27964  1.000 16.53167  ? 327  VAL A O   1 
ATOM   5867  C CB  . VAL B  1 347 ? -32.47150 -8.89502   70.17631  1.000 17.22847  ? 327  VAL A CB  1 
ATOM   5868  C CG1 . VAL B  1 347 ? -31.02516 -9.22746   69.84298  1.000 18.66099  ? 327  VAL A CG1 1 
ATOM   5869  C CG2 . VAL B  1 347 ? -32.79435 -7.45371   69.74948  1.000 16.73163  ? 327  VAL A CG2 1 
ATOM   5870  N N   . SER B  1 348 ? -32.70067 -12.23702  69.21839  1.000 15.47002  ? 328  SER A N   1 
ATOM   5871  C CA  . SER B  1 348 ? -32.41985 -13.60909  69.61952  1.000 16.84302  ? 328  SER A CA  1 
ATOM   5872  C C   . SER B  1 348 ? -31.05254 -13.70296  70.28754  1.000 19.04783  ? 328  SER A C   1 
ATOM   5873  O O   . SER B  1 348 ? -30.26348 -12.75716  70.30777  1.000 18.86660  ? 328  SER A O   1 
ATOM   5874  C CB  . SER B  1 348 ? -32.44304 -14.56466  68.42406  1.000 16.52658  ? 328  SER A CB  1 
ATOM   5875  O OG  . SER B  1 348 ? -33.62617 -14.42351  67.66227  1.000 16.62767  ? 328  SER A OG  1 
ATOM   5876  N N   . GLY B  1 349 ? -30.76841 -14.88152  70.81760  1.000 19.20717  ? 329  GLY A N   1 
ATOM   5877  C CA  . GLY B  1 349 ? -29.46629 -15.14550  71.41064  1.000 18.43094  ? 329  GLY A CA  1 
ATOM   5878  C C   . GLY B  1 349 ? -28.35253 -15.05661  70.38958  1.000 19.78216  ? 329  GLY A C   1 
ATOM   5879  O O   . GLY B  1 349 ? -28.56453 -14.99792  69.17435  1.000 20.97143  ? 329  GLY A O   1 
ATOM   5880  N N   . ASP B  1 350 ? -27.12046 -14.98401  70.91318  1.000 17.94009  ? 330  ASP A N   1 
ATOM   5881  C CA  . ASP B  1 350 ? -25.92573 -14.92464  70.09357  1.000 21.34673  ? 330  ASP A CA  1 
ATOM   5882  C C   . ASP B  1 350 ? -25.99412 -13.77991  69.09913  1.000 20.69429  ? 330  ASP A C   1 
ATOM   5883  O O   . ASP B  1 350 ? -25.43705 -13.86783  68.00425  1.000 20.71681  ? 330  ASP A O   1 
ATOM   5884  C CB  . ASP B  1 350 ? -25.66904 -16.25476  69.36673  1.000 21.51468  ? 330  ASP A CB  1 
ATOM   5885  C CG  . ASP B  1 350 ? -24.26654 -16.36715  68.84763  1.000 28.40457  ? 330  ASP A CG  1 
ATOM   5886  O OD1 . ASP B  1 350 ? -23.37876 -15.58390  69.28875  1.000 32.18089  ? 330  ASP A OD1 1 
ATOM   5887  O OD2 . ASP B  1 350 ? -24.05088 -17.21140  67.95871  1.000 28.72686  ? 330  ASP A OD2 1 
ATOM   5888  N N   . CYS B  1 351 ? -26.69787 -12.71313  69.46828  1.000 15.65480  ? 331  CYS A N   1 
ATOM   5889  C CA  . CYS B  1 351 ? -26.60655 -11.42759  68.77660  1.000 18.02571  ? 331  CYS A CA  1 
ATOM   5890  C C   . CYS B  1 351 ? -25.71675 -10.47181  69.56085  1.000 14.65155  ? 331  CYS A C   1 
ATOM   5891  O O   . CYS B  1 351 ? -25.92293 -10.28634  70.76792  1.000 17.57297  ? 331  CYS A O   1 
ATOM   5892  C CB  . CYS B  1 351 ? -28.00046 -10.82133  68.62771  1.000 18.01411  ? 331  CYS A CB  1 
ATOM   5893  S SG  . CYS B  1 351 ? -29.01287 -11.75550  67.46162  1.000 19.56384  ? 331  CYS A SG  1 
ATOM   5894  N N   . ILE B  1 352 ? -24.71580 -9.88373   68.89980  1.000 18.60784  ? 332  ILE A N   1 
ATOM   5895  C CA  . ILE B  1 352 ? -23.87203 -8.87304   69.53173  1.000 18.20682  ? 332  ILE A CA  1 
ATOM   5896  C C   . ILE B  1 352 ? -24.12509 -7.55434   68.80514  1.000 19.26043  ? 332  ILE A C   1 
ATOM   5897  O O   . ILE B  1 352 ? -23.78533 -7.39839   67.62056  1.000 20.19125  ? 332  ILE A O   1 
ATOM   5898  C CB  . ILE B  1 352 ? -22.38135 -9.23608   69.51040  1.000 23.80601  ? 332  ILE A CB  1 
ATOM   5899  C CG1 . ILE B  1 352 ? -22.13002 -10.56960  70.23586  1.000 18.37718  ? 332  ILE A CG1 1 
ATOM   5900  C CG2 . ILE B  1 352 ? -21.57000 -8.09940   70.19207  1.000 27.28759  ? 332  ILE A CG2 1 
ATOM   5901  C CD1 . ILE B  1 352 ? -20.63551 -10.92893  70.39543  1.000 24.07825  ? 332  ILE A CD1 1 
ATOM   5902  N N   . ILE B  1 353 ? -24.73215 -6.61242   69.51965  1.000 17.49939  ? 333  ILE A N   1 
ATOM   5903  C CA  . ILE B  1 353 ? -25.20194 -5.35906   68.93493  1.000 16.27916  ? 333  ILE A CA  1 
ATOM   5904  C C   . ILE B  1 353 ? -24.21274 -4.31806   69.42354  1.000 20.63566  ? 333  ILE A C   1 
ATOM   5905  O O   . ILE B  1 353 ? -24.30155 -3.81048   70.55980  1.000 16.54498  ? 333  ILE A O   1 
ATOM   5906  C CB  . ILE B  1 353 ? -26.63772 -5.03387   69.36319  1.000 16.20006  ? 333  ILE A CB  1 
ATOM   5907  C CG1 . ILE B  1 353 ? -27.59517 -6.19904   69.06817  1.000 14.68525  ? 333  ILE A CG1 1 
ATOM   5908  C CG2 . ILE B  1 353 ? -27.09871 -3.72987   68.73514  1.000 16.21896  ? 333  ILE A CG2 1 
ATOM   5909  C CD1 . ILE B  1 353 ? -27.47240 -6.79156   67.65176  1.000 14.73608  ? 333  ILE A CD1 1 
ATOM   5910  N N   . SER B  1 354 ? -23.21263 -4.05944   68.58424  1.000 21.03549  ? 334  SER A N   1 
ATOM   5911  C CA  . SER B  1 354 ? -22.00094 -3.37292   68.99077  1.000 22.34903  ? 334  SER A CA  1 
ATOM   5912  C C   . SER B  1 354 ? -22.03972 -1.95835   68.41780  1.000 22.72742  ? 334  SER A C   1 
ATOM   5913  O O   . SER B  1 354 ? -21.69464 -1.74492   67.25552  1.000 22.21750  ? 334  SER A O   1 
ATOM   5914  C CB  . SER B  1 354 ? -20.77105 -4.15490   68.53535  1.000 23.54071  ? 334  SER A CB  1 
ATOM   5915  O OG  . SER B  1 354 ? -19.58468 -3.44473   68.86738  1.000 22.23018  ? 334  SER A OG  1 
ATOM   5916  N N   . GLY B  1 355 ? -22.52394 -1.00610   69.21589  1.000 22.06503  ? 335  GLY A N   1 
ATOM   5917  C CA  . GLY B  1 355 ? -22.61045 0.36745    68.73657  1.000 24.38402  ? 335  GLY A CA  1 
ATOM   5918  C C   . GLY B  1 355 ? -23.61220 0.56135    67.61283  1.000 27.31689  ? 335  GLY A C   1 
ATOM   5919  O O   . GLY B  1 355 ? -23.56310 1.57578    66.89956  1.000 26.87609  ? 335  GLY A O   1 
ATOM   5920  N N   . ALA B  1 356 ? -24.52540 -0.38356   67.44410  1.000 22.16902  ? 336  ALA A N   1 
ATOM   5921  C CA  . ALA B  1 356 ? -25.52763 -0.36546   66.39054  1.000 22.30679  ? 336  ALA A CA  1 
ATOM   5922  C C   . ALA B  1 356 ? -26.88341 -0.03768   66.99186  1.000 21.57296  ? 336  ALA A C   1 
ATOM   5923  O O   . ALA B  1 356 ? -27.24116 -0.58077   68.03655  1.000 21.19981  ? 336  ALA A O   1 
ATOM   5924  C CB  . ALA B  1 356 ? -25.61820 -1.71975   65.69542  1.000 25.65174  ? 336  ALA A CB  1 
ATOM   5925  N N   . ALA B  1 357 ? -27.66164 0.78636    66.29174  1.000 22.29660  ? 337  ALA A N   1 
ATOM   5926  C CA  . ALA B  1 357 ? -28.99334 1.16459    66.75850  1.000 23.25951  ? 337  ALA A CA  1 
ATOM   5927  C C   . ALA B  1 357 ? -30.02444 0.35218    65.99776  1.000 25.12266  ? 337  ALA A C   1 
ATOM   5928  O O   . ALA B  1 357 ? -30.00069 0.30772    64.76100  1.000 23.47642  ? 337  ALA A O   1 
ATOM   5929  C CB  . ALA B  1 357 ? -29.22461 2.66819    66.57246  1.000 23.87688  ? 337  ALA A CB  1 
ATOM   5930  N N   . LEU B  1 358 ? -30.88516 -0.33822   66.73801  1.000 23.01635  ? 338  LEU A N   1 
ATOM   5931  C CA  . LEU B  1 358 ? -31.94629 -1.15370   66.16486  1.000 18.76861  ? 338  LEU A CA  1 
ATOM   5932  C C   . LEU B  1 358 ? -33.28585 -0.59397   66.62733  1.000 22.01521  ? 338  LEU A C   1 
ATOM   5933  O O   . LEU B  1 358 ? -33.45513 -0.25638   67.81574  1.000 20.58499  ? 338  LEU A O   1 
ATOM   5934  C CB  . LEU B  1 358 ? -31.84319 -2.61819   66.61802  1.000 17.88985  ? 338  LEU A CB  1 
ATOM   5935  C CG  . LEU B  1 358 ? -30.90775 -3.62517   65.98735  1.000 23.28425  ? 338  LEU A CG  1 
ATOM   5936  C CD1 . LEU B  1 358 ? -29.58226 -3.02259   65.60397  1.000 21.86125  ? 338  LEU A CD1 1 
ATOM   5937  C CD2 . LEU B  1 358 ? -30.77770 -4.79522   67.00159  1.000 22.13053  ? 338  LEU A CD2 1 
ATOM   5938  N N   . ASN B  1 359 ? -34.23714 -0.51781   65.69137  1.000 19.99698  ? 339  ASN A N   1 
ATOM   5939  C CA  . ASN B  1 359 ? -35.58594 -0.06315   66.00503  1.000 19.04725  ? 339  ASN A CA  1 
ATOM   5940  C C   . ASN B  1 359 ? -36.58475 -0.81558   65.14650  1.000 16.53883  ? 339  ASN A C   1 
ATOM   5941  O O   . ASN B  1 359 ? -36.37462 -0.97275   63.93566  1.000 16.64502  ? 339  ASN A O   1 
ATOM   5942  C CB  . ASN B  1 359 ? -35.72370 1.43458    65.76515  1.000 25.31936  ? 339  ASN A CB  1 
ATOM   5943  C CG  . ASN B  1 359 ? -37.13104 1.92611    66.02586  1.000 27.30342  ? 339  ASN A CG  1 
ATOM   5944  O OD1 . ASN B  1 359 ? -37.75750 1.55622    67.01176  1.000 22.96932  ? 339  ASN A OD1 1 
ATOM   5945  N ND2 . ASN B  1 359 ? -37.64598 2.74449    65.11753  1.000 32.19699  ? 339  ASN A ND2 1 
ATOM   5946  N N   . ARG B  1 360 ? -37.64218 -1.30924   65.77570  1.000 16.25326  ? 340  ARG A N   1 
ATOM   5947  C CA  . ARG B  1 360 ? -38.68298 -2.04079   65.07296  1.000 16.07020  ? 340  ARG A CA  1 
ATOM   5948  C C   . ARG B  1 360 ? -38.09025 -3.11881   64.17373  1.000 17.62321  ? 340  ARG A C   1 
ATOM   5949  O O   . ARG B  1 360 ? -38.39488 -3.22069   62.98771  1.000 16.38376  ? 340  ARG A O   1 
ATOM   5950  C CB  . ARG B  1 360 ? -39.58571 -1.10147   64.28219  1.000 23.78566  ? 340  ARG A CB  1 
ATOM   5951  C CG  . ARG B  1 360 ? -40.88701 -1.81831   63.86345  1.000 33.09021  ? 340  ARG A CG  1 
ATOM   5952  C CD  . ARG B  1 360 ? -42.01748 -0.87949   63.51398  1.000 40.16307  ? 340  ARG A CD  1 
ATOM   5953  N NE  . ARG B  1 360 ? -43.23545 -1.57835   63.07213  1.000 38.99824  ? 340  ARG A NE  1 
ATOM   5954  C CZ  . ARG B  1 360 ? -43.66658 -1.57002   61.81042  1.000 36.81332  ? 340  ARG A CZ  1 
ATOM   5955  N NH1 . ARG B  1 360 ? -42.96243 -0.91022   60.87734  1.000 38.19506  ? 340  ARG A NH1 1 
ATOM   5956  N NH2 . ARG B  1 360 ? -44.79223 -2.19551   61.47542  1.000 28.72713  ? 340  ARG A NH2 1 
ATOM   5957  N N   . SER B  1 361 ? -37.20158 -3.92317   64.74185  1.000 17.19359  ? 341  SER A N   1 
ATOM   5958  C CA  . SER B  1 361 ? -36.54478 -4.96824   63.97665  1.000 18.04282  ? 341  SER A CA  1 
ATOM   5959  C C   . SER B  1 361 ? -36.63780 -6.29159   64.71996  1.000 15.49379  ? 341  SER A C   1 
ATOM   5960  O O   . SER B  1 361 ? -36.82247 -6.32635   65.94386  1.000 14.64110  ? 341  SER A O   1 
ATOM   5961  C CB  . SER B  1 361 ? -35.08768 -4.62789   63.69130  1.000 16.73268  ? 341  SER A CB  1 
ATOM   5962  O OG  . SER B  1 361 ? -35.00412 -3.51896   62.80354  1.000 15.67570  ? 341  SER A OG  1 
ATOM   5963  N N   . LEU B  1 362 ? -36.56867 -7.37541   63.94768  1.000 14.51510  ? 342  LEU A N   1 
ATOM   5964  C CA  . LEU B  1 362 ? -36.55311 -8.73787   64.48223  1.000 14.24289  ? 342  LEU A CA  1 
ATOM   5965  C C   . LEU B  1 362 ? -35.26705 -9.42548   64.02409  1.000 15.22407  ? 342  LEU A C   1 
ATOM   5966  O O   . LEU B  1 362 ? -35.02344 -9.55673   62.81668  1.000 17.32572  ? 342  LEU A O   1 
ATOM   5967  C CB  . LEU B  1 362 ? -37.80151 -9.50280   64.02938  1.000 13.72058  ? 342  LEU A CB  1 
ATOM   5968  C CG  . LEU B  1 362 ? -37.96782 -10.88562  64.65747  1.000 20.16807  ? 342  LEU A CG  1 
ATOM   5969  C CD1 . LEU B  1 362 ? -39.43477 -11.06080  64.95118  1.000 24.58203  ? 342  LEU A CD1 1 
ATOM   5970  C CD2 . LEU B  1 362 ? -37.49541 -11.94380  63.67786  1.000 17.97409  ? 342  LEU A CD2 1 
ATOM   5971  N N   . LEU B  1 363 ? -34.43306 -9.83522   64.98614  1.000 14.07425  ? 343  LEU A N   1 
ATOM   5972  C CA  . LEU B  1 363 ? -33.16929 -10.50776  64.71785  1.000 18.54813  ? 343  LEU A CA  1 
ATOM   5973  C C   . LEU B  1 363 ? -33.24969 -11.97292  65.12030  1.000 22.81677  ? 343  LEU A C   1 
ATOM   5974  O O   . LEU B  1 363 ? -33.59940 -12.29356  66.25858  1.000 16.44222  ? 343  LEU A O   1 
ATOM   5975  C CB  . LEU B  1 363 ? -32.00650 -9.85308   65.45769  1.000 17.04354  ? 343  LEU A CB  1 
ATOM   5976  C CG  . LEU B  1 363 ? -31.41608 -8.64374   64.72636  1.000 19.67711  ? 343  LEU A CG  1 
ATOM   5977  C CD1 . LEU B  1 363 ? -32.43275 -7.56867   64.35008  1.000 14.44186  ? 343  LEU A CD1 1 
ATOM   5978  C CD2 . LEU B  1 363 ? -30.28955 -8.06276   65.54751  1.000 20.31957  ? 343  LEU A CD2 1 
ATOM   5979  N N   . PHE B  1 364 ? -32.91032 -12.85694  64.18649  1.000 13.66615  ? 344  PHE A N   1 
ATOM   5980  C CA  . PHE B  1 364 ? -32.69641 -14.26175  64.50952  1.000 14.61067  ? 344  PHE A CA  1 
ATOM   5981  C C   . PHE B  1 364 ? -31.31371 -14.42676  65.16259  1.000 14.59506  ? 344  PHE A C   1 
ATOM   5982  O O   . PHE B  1 364 ? -30.55312 -13.45506  65.32121  1.000 16.17508  ? 344  PHE A O   1 
ATOM   5983  C CB  . PHE B  1 364 ? -32.83671 -15.08610  63.22672  1.000 16.04498  ? 344  PHE A CB  1 
ATOM   5984  C CG  . PHE B  1 364 ? -34.26808 -15.17612  62.69707  1.000 16.04344  ? 344  PHE A CG  1 
ATOM   5985  C CD1 . PHE B  1 364 ? -34.87157 -14.09108  62.05985  1.000 16.85267  ? 344  PHE A CD1 1 
ATOM   5986  C CD2 . PHE B  1 364 ? -34.97267 -16.38217  62.77578  1.000 20.07885  ? 344  PHE A CD2 1 
ATOM   5987  C CE1 . PHE B  1 364 ? -36.16580 -14.21035  61.53324  1.000 18.03348  ? 344  PHE A CE1 1 
ATOM   5988  C CE2 . PHE B  1 364 ? -36.26416 -16.50054  62.24735  1.000 18.62850  ? 344  PHE A CE2 1 
ATOM   5989  C CZ  . PHE B  1 364 ? -36.85011 -15.42521  61.63261  1.000 17.24575  ? 344  PHE A CZ  1 
ATOM   5990  N N   A THR B  1 365 ? -30.95427 -15.66339  65.48620  0.391 15.25598  ? 345  THR A N   1 
ATOM   5991  N N   B THR B  1 365 ? -30.97216 -15.66020  65.56270  0.609 14.69752  ? 345  THR A N   1 
ATOM   5992  C CA  A THR B  1 365 ? -29.71014 -15.94283  66.19885  0.391 16.41750  ? 345  THR A CA  1 
ATOM   5993  C CA  B THR B  1 365 ? -29.70371 -15.88564  66.26610  0.609 16.53542  ? 345  THR A CA  1 
ATOM   5994  C C   A THR B  1 365 ? -28.45816 -15.61113  65.38478  0.391 17.08611  ? 345  THR A C   1 
ATOM   5995  C C   B THR B  1 365 ? -28.48701 -15.54512  65.40733  0.609 16.77021  ? 345  THR A C   1 
ATOM   5996  O O   A THR B  1 365 ? -28.40080 -15.80607  64.16534  0.391 17.68697  ? 345  THR A O   1 
ATOM   5997  O O   B THR B  1 365 ? -28.47988 -15.69169  64.17919  0.609 18.55980  ? 345  THR A O   1 
ATOM   5998  C CB  A THR B  1 365 ? -29.65558 -17.41428  66.58002  0.391 17.72912  ? 345  THR A CB  1 
ATOM   5999  C CB  B THR B  1 365 ? -29.52349 -17.34044  66.73480  0.609 17.51550  ? 345  THR A CB  1 
ATOM   6000  O OG1 A THR B  1 365 ? -30.97124 -17.84559  66.93768  0.391 18.83881  ? 345  THR A OG1 1 
ATOM   6001  O OG1 B THR B  1 365 ? -29.66666 -18.24288  65.62437  0.609 18.15078  ? 345  THR A OG1 1 
ATOM   6002  C CG2 A THR B  1 365 ? -28.70355 -17.63619  67.72570  0.391 14.89764  ? 345  THR A CG2 1 
ATOM   6003  C CG2 B THR B  1 365 ? -30.47647 -17.71200  67.87526  0.609 17.88331  ? 345  THR A CG2 1 
ATOM   6004  N N   . GLY B  1 366 ? -27.41363 -15.17572  66.08670  1.000 14.57275  ? 346  GLY A N   1 
ATOM   6005  C CA  . GLY B  1 366 ? -26.10984 -15.09617  65.45641  1.000 15.19083  ? 346  GLY A CA  1 
ATOM   6006  C C   . GLY B  1 366 ? -25.79163 -13.79440  64.76266  1.000 19.63795  ? 346  GLY A C   1 
ATOM   6007  O O   . GLY B  1 366 ? -24.74176 -13.70284  64.08899  1.000 17.37915  ? 346  GLY A O   1 
ATOM   6008  N N   . VAL B  1 367 ? -26.63832 -12.77295  64.89845  1.000 16.72600  ? 347  VAL A N   1 
ATOM   6009  C CA  . VAL B  1 367 ? -26.36417 -11.53177  64.16814  1.000 15.24279  ? 347  VAL A CA  1 
ATOM   6010  C C   . VAL B  1 367 ? -25.21272 -10.77326  64.82183  1.000 19.95913  ? 347  VAL A C   1 
ATOM   6011  O O   . VAL B  1 367 ? -25.05144 -10.77901  66.04605  1.000 20.27951  ? 347  VAL A O   1 
ATOM   6012  C CB  . VAL B  1 367 ? -27.64919 -10.68397  64.10081  1.000 19.55118  ? 347  VAL A CB  1 
ATOM   6013  C CG1 . VAL B  1 367 ? -27.36929 -9.31647   63.43086  1.000 15.26972  ? 347  VAL A CG1 1 
ATOM   6014  C CG2 . VAL B  1 367 ? -28.72570 -11.46440  63.36476  1.000 14.76220  ? 347  VAL A CG2 1 
ATOM   6015  N N   . ARG B  1 368 ? -24.40458 -10.08642  64.00775  1.000 19.38911  ? 348  ARG A N   1 
ATOM   6016  C CA  . ARG B  1 368 ? -23.40742 -9.15408   64.52290  1.000 18.64166  ? 348  ARG A CA  1 
ATOM   6017  C C   . ARG B  1 368 ? -23.60796 -7.83110   63.78606  1.000 20.72929  ? 348  ARG A C   1 
ATOM   6018  O O   . ARG B  1 368 ? -23.40625 -7.75593   62.56930  1.000 27.83596  ? 348  ARG A O   1 
ATOM   6019  C CB  . ARG B  1 368 ? -21.97319 -9.70879   64.35122  1.000 23.33076  ? 348  ARG A CB  1 
ATOM   6020  C CG  . ARG B  1 368 ? -21.77487 -11.10320  65.01560  1.000 27.43365  ? 348  ARG A CG  1 
ATOM   6021  C CD  . ARG B  1 368 ? -21.18551 -10.96149  66.43181  1.000 29.75951  ? 348  ARG A CD  1 
ATOM   6022  N NE  . ARG B  1 368 ? -20.83349 -12.22335  67.09817  1.000 33.32629  ? 348  ARG A NE  1 
ATOM   6023  C CZ  . ARG B  1 368 ? -21.71967 -13.11032  67.54730  1.000 38.20826  ? 348  ARG A CZ  1 
ATOM   6024  N NH1 . ARG B  1 368 ? -21.30652 -14.21377  68.14281  1.000 34.10433  ? 348  ARG A NH1 1 
ATOM   6025  N NH2 . ARG B  1 368 ? -23.01075 -12.89191  67.39106  1.000 51.52135  ? 348  ARG A NH2 1 
ATOM   6026  N N   . ALA B  1 369 ? -24.07023 -6.81378   64.50386  1.000 19.70132  ? 349  ALA A N   1 
ATOM   6027  C CA  . ALA B  1 369 ? -24.27820 -5.47922   63.96104  1.000 20.82029  ? 349  ALA A CA  1 
ATOM   6028  C C   . ALA B  1 369 ? -23.20726 -4.58300   64.55828  1.000 24.39999  ? 349  ALA A C   1 
ATOM   6029  O O   . ALA B  1 369 ? -23.00769 -4.59560   65.77732  1.000 21.53800  ? 349  ALA A O   1 
ATOM   6030  C CB  . ALA B  1 369 ? -25.68502 -4.95703   64.29801  1.000 16.48554  ? 349  ALA A CB  1 
ATOM   6031  N N   . ASN B  1 370 ? -22.49730 -3.81874   63.71991  1.000 21.59842  ? 350  ASN A N   1 
ATOM   6032  C CA  . ASN B  1 370 ? -21.30584 -3.14373   64.22670  1.000 24.14512  ? 350  ASN A CA  1 
ATOM   6033  C C   . ASN B  1 370 ? -21.49988 -1.63011   64.26491  1.000 24.93001  ? 350  ASN A C   1 
ATOM   6034  O O   . ASN B  1 370 ? -22.56007 -1.09886   63.93033  1.000 26.83639  ? 350  ASN A O   1 
ATOM   6035  C CB  . ASN B  1 370 ? -20.06903 -3.53731   63.41184  1.000 32.09692  ? 350  ASN A CB  1 
ATOM   6036  C CG  . ASN B  1 370 ? -19.68259 -4.99333   63.63368  1.000 34.45750  ? 350  ASN A CG  1 
ATOM   6037  O OD1 . ASN B  1 370 ? -19.54568 -5.45235   64.76661  1.000 33.90029  ? 350  ASN A OD1 1 
ATOM   6038  N ND2 . ASN B  1 370 ? -19.55080 -5.73344   62.55161  1.000 36.26282  ? 350  ASN A ND2 1 
ATOM   6039  N N   . SER B  1 371 ? -20.45062 -0.93856   64.69734  1.000 23.62516  ? 351  SER A N   1 
ATOM   6040  C CA  . SER B  1 371 ? -20.60654 0.42178    65.18690  1.000 24.29900  ? 351  SER A CA  1 
ATOM   6041  C C   . SER B  1 371 ? -21.14837 1.34925    64.11252  1.000 24.43702  ? 351  SER A C   1 
ATOM   6042  O O   . SER B  1 371 ? -20.79858 1.23439    62.93875  1.000 24.70416  ? 351  SER A O   1 
ATOM   6043  C CB  . SER B  1 371 ? -19.27173 0.93635    65.70602  1.000 23.67455  ? 351  SER A CB  1 
ATOM   6044  O OG  . SER B  1 371 ? -18.98621 0.33328    66.95393  1.000 22.93388  ? 351  SER A OG  1 
ATOM   6045  N N   . TYR B  1 372 ? -22.01025 2.28138    64.52473  1.000 23.49719  ? 352  TYR A N   1 
ATOM   6046  C CA  . TYR B  1 372 ? -22.61543 3.32139    63.68196  1.000 24.50007  ? 352  TYR A CA  1 
ATOM   6047  C C   . TYR B  1 372 ? -23.59945 2.75736    62.66973  1.000 25.97123  ? 352  TYR A C   1 
ATOM   6048  O O   . TYR B  1 372 ? -24.20352 3.53770    61.91408  1.000 27.86419  ? 352  TYR A O   1 
ATOM   6049  C CB  . TYR B  1 372 ? -21.55301 4.18549    62.95678  1.000 25.33086  ? 352  TYR A CB  1 
ATOM   6050  C CG  . TYR B  1 372 ? -20.47644 4.63817    63.92202  1.000 28.50265  ? 352  TYR A CG  1 
ATOM   6051  C CD1 . TYR B  1 372 ? -20.75813 5.58120    64.91097  1.000 24.02182  ? 352  TYR A CD1 1 
ATOM   6052  C CD2 . TYR B  1 372 ? -19.19498 4.08250    63.88389  1.000 23.87837  ? 352  TYR A CD2 1 
ATOM   6053  C CE1 . TYR B  1 372 ? -19.80614 5.96549    65.82300  1.000 24.63000  ? 352  TYR A CE1 1 
ATOM   6054  C CE2 . TYR B  1 372 ? -18.23078 4.46000    64.80162  1.000 24.46993  ? 352  TYR A CE2 1 
ATOM   6055  C CZ  . TYR B  1 372 ? -18.53456 5.39973    65.76035  1.000 26.98625  ? 352  TYR A CZ  1 
ATOM   6056  O OH  . TYR B  1 372 ? -17.56488 5.76643    66.66680  1.000 31.33952  ? 352  TYR A OH  1 
ATOM   6057  N N   . SER B  1 373 ? -23.80136 1.44891    62.62619  1.000 20.43615  ? 353  SER A N   1 
ATOM   6058  C CA  . SER B  1 373 ? -24.84490 0.92178    61.76070  1.000 21.99569  ? 353  SER A CA  1 
ATOM   6059  C C   . SER B  1 373 ? -26.22313 1.13475    62.40589  1.000 21.69105  ? 353  SER A C   1 
ATOM   6060  O O   . SER B  1 373 ? -26.35652 1.31966    63.61562  1.000 19.36653  ? 353  SER A O   1 
ATOM   6061  C CB  . SER B  1 373 ? -24.61751 -0.56985   61.44827  1.000 20.45041  ? 353  SER A CB  1 
ATOM   6062  O OG  . SER B  1 373 ? -24.90743 -1.40575   62.58430  1.000 23.01139  ? 353  SER A OG  1 
ATOM   6063  N N   . ARG B  1 374 ? -27.24971 1.11479    61.56023  1.000 24.61518  ? 354  ARG A N   1 
ATOM   6064  C CA  . ARG B  1 374 ? -28.62284 1.37881    61.96846  1.000 26.19607  ? 354  ARG A CA  1 
ATOM   6065  C C   . ARG B  1 374 ? -29.53473 0.39383    61.25587  1.000 25.60172  ? 354  ARG A C   1 
ATOM   6066  O O   . ARG B  1 374 ? -29.43384 0.22675    60.03961  1.000 27.84861  ? 354  ARG A O   1 
ATOM   6067  C CB  . ARG B  1 374 ? -29.02731 2.81632    61.61953  1.000 31.91596  ? 354  ARG A CB  1 
ATOM   6068  C CG  . ARG B  1 374 ? -28.24573 3.87554    62.35843  1.000 38.57641  ? 354  ARG A CG  1 
ATOM   6069  C CD  . ARG B  1 374 ? -28.91128 5.23461    62.21064  1.000 47.82955  ? 354  ARG A CD  1 
ATOM   6070  N NE  . ARG B  1 374 ? -28.08536 6.29352    62.77867  1.000 54.56159  ? 354  ARG A NE  1 
ATOM   6071  C CZ  . ARG B  1 374 ? -28.14851 6.67838    64.05325  1.000 55.94432  ? 354  ARG A CZ  1 
ATOM   6072  N NH1 . ARG B  1 374 ? -29.00274 6.09040    64.89517  1.000 51.03020  ? 354  ARG A NH1 1 
ATOM   6073  N NH2 . ARG B  1 374 ? -27.35606 7.65312    64.48785  1.000 56.30371  ? 354  ARG A NH2 1 
ATOM   6074  N N   . LEU B  1 375 ? -30.42809 -0.25430   61.99684  1.000 17.84629  ? 355  LEU A N   1 
ATOM   6075  C CA  . LEU B  1 375 ? -31.44490 -1.09771   61.38557  1.000 17.42971  ? 355  LEU A CA  1 
ATOM   6076  C C   . LEU B  1 375 ? -32.81183 -0.57850   61.80113  1.000 22.89952  ? 355  LEU A C   1 
ATOM   6077  O O   . LEU B  1 375 ? -33.05472 -0.33073   62.98842  1.000 22.93514  ? 355  LEU A O   1 
ATOM   6078  C CB  . LEU B  1 375 ? -31.29088 -2.55457   61.80340  1.000 18.80460  ? 355  LEU A CB  1 
ATOM   6079  C CG  . LEU B  1 375 ? -29.98819 -3.29800   61.51880  1.000 19.74872  ? 355  LEU A CG  1 
ATOM   6080  C CD1 . LEU B  1 375 ? -30.10344 -4.79280   61.92985  1.000 16.00284  ? 355  LEU A CD1 1 
ATOM   6081  C CD2 . LEU B  1 375 ? -29.67123 -3.21135   60.04977  1.000 27.74734  ? 355  LEU A CD2 1 
ATOM   6082  N N   . GLU B  1 376 ? -33.71197 -0.43597   60.83846  1.000 19.73878  ? 356  GLU A N   1 
ATOM   6083  C CA  . GLU B  1 376 ? -35.08670 -0.07576   61.14235  1.000 20.82703  ? 356  GLU A CA  1 
ATOM   6084  C C   . GLU B  1 376 ? -36.01714 -0.89346   60.26044  1.000 19.08293  ? 356  GLU A C   1 
ATOM   6085  O O   . GLU B  1 376 ? -35.73673 -1.07290   59.07855  1.000 18.72708  ? 356  GLU A O   1 
ATOM   6086  C CB  . GLU B  1 376 ? -35.34436 1.40824    60.90685  1.000 26.01734  ? 356  GLU A CB  1 
ATOM   6087  C CG  . GLU B  1 376 ? -36.76825 1.81760    61.25677  1.000 33.09558  ? 356  GLU A CG  1 
ATOM   6088  C CD  . GLU B  1 376 ? -36.91720 3.31236    61.37741  1.000 41.20394  ? 356  GLU A CD  1 
ATOM   6089  O OE1 . GLU B  1 376 ? -36.88057 3.81931    62.50887  1.000 43.67774  ? 356  GLU A OE1 1 
ATOM   6090  O OE2 . GLU B  1 376 ? -37.03849 3.98521    60.33517  1.000 44.41727  ? 356  GLU A OE2 1 
ATOM   6091  N N   . ASN B  1 377 ? -37.12267 -1.37608   60.83564  1.000 17.67190  ? 357  ASN A N   1 
ATOM   6092  C CA  . ASN B  1 377 ? -38.09931 -2.17103   60.08574  1.000 17.09598  ? 357  ASN A CA  1 
ATOM   6093  C C   . ASN B  1 377 ? -37.42728 -3.34012   59.37707  1.000 21.67023  ? 357  ASN A C   1 
ATOM   6094  O O   . ASN B  1 377 ? -37.71742 -3.61613   58.21332  1.000 18.36211  ? 357  ASN A O   1 
ATOM   6095  C CB  . ASN B  1 377 ? -38.84113 -1.32741   59.05922  1.000 17.89283  ? 357  ASN A CB  1 
ATOM   6096  C CG  . ASN B  1 377 ? -39.88142 -0.39159   59.66818  1.000 28.73302  ? 357  ASN A CG  1 
ATOM   6097  O OD1 . ASN B  1 377 ? -40.56121 0.31414    58.93169  1.000 31.62942  ? 357  ASN A OD1 1 
ATOM   6098  N ND2 . ASN B  1 377 ? -39.99081 -0.35673   60.99325  1.000 19.91114  ? 357  ASN A ND2 1 
ATOM   6099  N N   . ALA B  1 378 ? -36.50629 -4.00937   60.07331  1.000 16.26532  ? 358  ALA A N   1 
ATOM   6100  C CA  . ALA B  1 378 ? -35.60861 -4.99312   59.48055  1.000 20.64043  ? 358  ALA A CA  1 
ATOM   6101  C C   . ALA B  1 378 ? -35.93686 -6.37654   60.02676  1.000 20.55543  ? 358  ALA A C   1 
ATOM   6102  O O   . ALA B  1 378 ? -36.05678 -6.55424   61.24587  1.000 17.39710  ? 358  ALA A O   1 
ATOM   6103  C CB  . ALA B  1 378 ? -34.14396 -4.63911   59.77980  1.000 16.36758  ? 358  ALA A CB  1 
ATOM   6104  N N   . VAL B  1 379 ? -36.07002 -7.35433   59.13290  1.000 16.33798  ? 359  VAL A N   1 
ATOM   6105  C CA  . VAL B  1 379 ? -36.18499 -8.75603   59.51881  1.000 18.39848  ? 359  VAL A CA  1 
ATOM   6106  C C   . VAL B  1 379 ? -34.86233 -9.38010   59.13297  1.000 16.62691  ? 359  VAL A C   1 
ATOM   6107  O O   . VAL B  1 379 ? -34.50192 -9.41225   57.95049  1.000 16.33785  ? 359  VAL A O   1 
ATOM   6108  C CB  . VAL B  1 379 ? -37.35757 -9.46086   58.82974  1.000 17.12772  ? 359  VAL A CB  1 
ATOM   6109  C CG1 . VAL B  1 379 ? -37.41070 -10.94090  59.22323  1.000 20.70722  ? 359  VAL A CG1 1 
ATOM   6110  C CG2 . VAL B  1 379 ? -38.65278 -8.79146   59.19110  1.000 18.15339  ? 359  VAL A CG2 1 
ATOM   6111  N N   . VAL B  1 380 ? -34.12497 -9.84943   60.11445  1.000 15.35702  ? 360  VAL A N   1 
ATOM   6112  C CA  . VAL B  1 380 ? -32.71636 -10.18280  59.93912  1.000 18.87249  ? 360  VAL A CA  1 
ATOM   6113  C C   . VAL B  1 380 ? -32.53258 -11.65076  60.28678  1.000 20.18497  ? 360  VAL A C   1 
ATOM   6114  O O   . VAL B  1 380 ? -32.54992 -12.00725  61.46832  1.000 16.22128  ? 360  VAL A O   1 
ATOM   6115  C CB  . VAL B  1 380 ? -31.81881 -9.30772   60.81790  1.000 18.77791  ? 360  VAL A CB  1 
ATOM   6116  C CG1 . VAL B  1 380 ? -30.34567 -9.64926   60.54696  1.000 24.05422  ? 360  VAL A CG1 1 
ATOM   6117  C CG2 . VAL B  1 380 ? -32.06253 -7.81387   60.54353  1.000 18.19574  ? 360  VAL A CG2 1 
ATOM   6118  N N   . LEU B  1 381 ? -32.33253 -12.49627  59.26690  1.000 18.13610  ? 361  LEU A N   1 
ATOM   6119  C CA  . LEU B  1 381 ? -32.27153 -13.94102  59.43180  1.000 16.70048  ? 361  LEU A CA  1 
ATOM   6120  C C   . LEU B  1 381 ? -30.96911 -14.33355  60.12998  1.000 18.11195  ? 361  LEU A C   1 
ATOM   6121  O O   . LEU B  1 381 ? -30.10527 -13.47713  60.37877  1.000 16.69506  ? 361  LEU A O   1 
ATOM   6122  C CB  . LEU B  1 381 ? -32.41125 -14.60878  58.04980  1.000 20.11768  ? 361  LEU A CB  1 
ATOM   6123  C CG  . LEU B  1 381 ? -33.84840 -15.01371  57.73758  1.000 21.50907  ? 361  LEU A CG  1 
ATOM   6124  C CD1 . LEU B  1 381 ? -34.84944 -13.80319  57.86169  1.000 18.25900  ? 361  LEU A CD1 1 
ATOM   6125  C CD2 . LEU B  1 381 ? -33.91320 -15.67583  56.35913  1.000 24.77130  ? 361  LEU A CD2 1 
ATOM   6126  N N   . PRO B  1 382 ? -30.78097 -15.63052  60.45009  1.000 19.98592  ? 362  PRO A N   1 
ATOM   6127  C CA  . PRO B  1 382 ? -29.61620 -16.00621  61.27562  1.000 19.76601  ? 362  PRO A CA  1 
ATOM   6128  C C   . PRO B  1 382 ? -28.25680 -15.63230  60.67508  1.000 19.23111  ? 362  PRO A C   1 
ATOM   6129  O O   . PRO B  1 382 ? -28.03162 -15.68344  59.46397  1.000 20.16321  ? 362  PRO A O   1 
ATOM   6130  C CB  . PRO B  1 382 ? -29.75255 -17.52779  61.41414  1.000 16.18502  ? 362  PRO A CB  1 
ATOM   6131  C CG  . PRO B  1 382 ? -31.29710 -17.74071  61.43065  1.000 15.73659  ? 362  PRO A CG  1 
ATOM   6132  C CD  . PRO B  1 382 ? -31.75587 -16.74183  60.35739  1.000 15.76342  ? 362  PRO A CD  1 
ATOM   6133  N N   . SER B  1 383 ? -27.33026 -15.30466  61.57423  1.000 16.16192  ? 363  SER A N   1 
ATOM   6134  C CA  . SER B  1 383 ? -25.89655 -15.17525  61.29174  1.000 19.34274  ? 363  SER A CA  1 
ATOM   6135  C C   . SER B  1 383 ? -25.57542 -14.05226  60.30824  1.000 18.80078  ? 363  SER A C   1 
ATOM   6136  O O   . SER B  1 383 ? -24.51801 -14.06209  59.67376  1.000 24.08132  ? 363  SER A O   1 
ATOM   6137  C CB  . SER B  1 383 ? -25.31001 -16.49733  60.80381  1.000 26.46197  ? 363  SER A CB  1 
ATOM   6138  O OG  . SER B  1 383 ? -25.51217 -17.49662  61.78869  1.000 27.24278  ? 363  SER A OG  1 
ATOM   6139  N N   . VAL B  1 384 ? -26.45445 -13.06304  60.18580  1.000 17.90364  ? 364  VAL A N   1 
ATOM   6140  C CA  . VAL B  1 384 ? -26.13654 -11.90576  59.35391  1.000 19.96414  ? 364  VAL A CA  1 
ATOM   6141  C C   . VAL B  1 384 ? -25.06548 -11.05133  60.03738  1.000 22.92188  ? 364  VAL A C   1 
ATOM   6142  O O   . VAL B  1 384 ? -25.01700 -10.94660  61.27831  1.000 21.85577  ? 364  VAL A O   1 
ATOM   6143  C CB  . VAL B  1 384 ? -27.44008 -11.12341  59.10237  1.000 18.35993  ? 364  VAL A CB  1 
ATOM   6144  C CG1 . VAL B  1 384 ? -27.14680 -9.72151   58.52413  1.000 17.19080  ? 364  VAL A CG1 1 
ATOM   6145  C CG2 . VAL B  1 384 ? -28.31721 -11.91561  58.12947  1.000 17.22124  ? 364  VAL A CG2 1 
ATOM   6146  N N   . LYS B  1 385 ? -24.20431 -10.41380  59.23936  1.000 23.16348  ? 365  LYS A N   1 
ATOM   6147  C CA  . LYS B  1 385 ? -23.26994 -9.41908   59.75593  1.000 26.53161  ? 365  LYS A CA  1 
ATOM   6148  C C   . LYS B  1 385 ? -23.60458 -8.06338   59.14863  1.000 20.46575  ? 365  LYS A C   1 
ATOM   6149  O O   . LYS B  1 385 ? -23.80918 -7.95869   57.93898  1.000 22.25551  ? 365  LYS A O   1 
ATOM   6150  C CB  . LYS B  1 385 ? -21.81945 -9.79440   59.43186  1.000 38.69930  ? 365  LYS A CB  1 
ATOM   6151  C CG  . LYS B  1 385 ? -21.42518 -11.21383  59.89365  1.000 52.67019  ? 365  LYS A CG  1 
ATOM   6152  C CD  . LYS B  1 385 ? -20.34096 -11.17272  60.97999  1.000 62.67318  ? 365  LYS A CD  1 
ATOM   6153  C CE  . LYS B  1 385 ? -20.49020 -12.33119  61.96962  1.000 68.60249  ? 365  LYS A CE  1 
ATOM   6154  N NZ  . LYS B  1 385 ? -21.06362 -13.54527  61.33774  1.000 75.73977  ? 365  LYS A NZ  1 
ATOM   6155  N N   . ILE B  1 386 ? -23.71377 -7.03790   59.98265  1.000 20.03462  ? 366  ILE A N   1 
ATOM   6156  C CA  . ILE B  1 386 ? -23.98082 -5.67821   59.51490  1.000 22.24665  ? 366  ILE A CA  1 
ATOM   6157  C C   . ILE B  1 386 ? -22.71650 -4.85843   59.72075  1.000 22.61002  ? 366  ILE A C   1 
ATOM   6158  O O   . ILE B  1 386 ? -22.31609 -4.61064   60.86293  1.000 20.24404  ? 366  ILE A O   1 
ATOM   6159  C CB  . ILE B  1 386 ? -25.16742 -5.04502   60.25156  1.000 21.89921  ? 366  ILE A CB  1 
ATOM   6160  C CG1 . ILE B  1 386 ? -26.38863 -5.96923   60.21734  1.000 22.04982  ? 366  ILE A CG1 1 
ATOM   6161  C CG2 . ILE B  1 386 ? -25.44086 -3.66171   59.69372  1.000 21.99353  ? 366  ILE A CG2 1 
ATOM   6162  C CD1 . ILE B  1 386 ? -27.19252 -5.90646   58.94881  1.000 21.04801  ? 366  ILE A CD1 1 
ATOM   6163  N N   . GLY B  1 387 ? -22.08047 -4.42801   58.62895  1.000 23.12654  ? 367  GLY A N   1 
ATOM   6164  C CA  . GLY B  1 387 ? -20.85718 -3.66524   58.75949  1.000 22.86715  ? 367  GLY A CA  1 
ATOM   6165  C C   . GLY B  1 387 ? -21.07550 -2.26999   59.32729  1.000 20.95414  ? 367  GLY A C   1 
ATOM   6166  O O   . GLY B  1 387 ? -22.16071 -1.70616   59.28101  1.000 24.81098  ? 367  GLY A O   1 
ATOM   6167  N N   . ARG B  1 388 ? -20.01152 -1.72267   59.89621  1.000 21.49178  ? 368  ARG A N   1 
ATOM   6168  C CA  . ARG B  1 388 ? -20.03363 -0.37164   60.44036  1.000 25.33697  ? 368  ARG A CA  1 
ATOM   6169  C C   . ARG B  1 388 ? -20.65658 0.60229    59.45561  1.000 25.06173  ? 368  ARG A C   1 
ATOM   6170  O O   . ARG B  1 388 ? -20.45263 0.48890    58.24643  1.000 24.95066  ? 368  ARG A O   1 
ATOM   6171  C CB  . ARG B  1 388 ? -18.60445 0.10649    60.74053  1.000 29.17449  ? 368  ARG A CB  1 
ATOM   6172  C CG  . ARG B  1 388 ? -17.98560 -0.47704   62.00688  1.000 29.04983  ? 368  ARG A CG  1 
ATOM   6173  C CD  . ARG B  1 388 ? -16.70017 0.24763    62.37021  1.000 30.60606  ? 368  ARG A CD  1 
ATOM   6174  N NE  . ARG B  1 388 ? -16.32058 0.00588    63.76291  1.000 30.74693  ? 368  ARG A NE  1 
ATOM   6175  C CZ  . ARG B  1 388 ? -15.54562 0.81122    64.47589  1.000 35.43100  ? 368  ARG A CZ  1 
ATOM   6176  N NH1 . ARG B  1 388 ? -15.08989 1.92769    63.92286  1.000 37.41151  ? 368  ARG A NH1 1 
ATOM   6177  N NH2 . ARG B  1 388 ? -15.24843 0.51832    65.74822  1.000 37.86914  ? 368  ARG A NH2 1 
ATOM   6178  N N   . HIS B  1 389 ? -21.41192 1.57407    59.98398  1.000 26.00290  ? 369  HIS A N   1 
ATOM   6179  C CA  . HIS B  1 389 ? -21.97679 2.68763    59.22063  1.000 26.58122  ? 369  HIS A CA  1 
ATOM   6180  C C   . HIS B  1 389 ? -23.07605 2.27436    58.23280  1.000 26.75483  ? 369  HIS A C   1 
ATOM   6181  O O   . HIS B  1 389 ? -23.64871 3.15410    57.59252  1.000 26.04129  ? 369  HIS A O   1 
ATOM   6182  C CB  . HIS B  1 389 ? -20.89982 3.47973    58.43443  1.000 29.44947  ? 369  HIS A CB  1 
ATOM   6183  C CG  . HIS B  1 389 ? -19.82937 4.05578    59.30486  1.000 27.69609  ? 369  HIS A CG  1 
ATOM   6184  N ND1 . HIS B  1 389 ? -20.00188 5.22630    60.01810  1.000 28.47864  ? 369  HIS A ND1 1 
ATOM   6185  C CD2 . HIS B  1 389 ? -18.59697 3.59306    59.63059  1.000 27.41949  ? 369  HIS A CD2 1 
ATOM   6186  C CE1 . HIS B  1 389 ? -18.91416 5.46661    60.73270  1.000 28.17234  ? 369  HIS A CE1 1 
ATOM   6187  N NE2 . HIS B  1 389 ? -18.04188 4.49837    60.50724  1.000 29.05065  ? 369  HIS A NE2 1 
ATOM   6188  N N   . ALA B  1 390 ? -23.40238 0.99039    58.08959  1.000 21.95647  ? 370  ALA A N   1 
ATOM   6189  C CA  . ALA B  1 390 ? -24.52574 0.63205    57.23203  1.000 22.61328  ? 370  ALA A CA  1 
ATOM   6190  C C   . ALA B  1 390 ? -25.83143 1.16008    57.82650  1.000 27.06303  ? 370  ALA A C   1 
ATOM   6191  O O   . ALA B  1 390 ? -26.00414 1.23850    59.05294  1.000 25.95991  ? 370  ALA A O   1 
ATOM   6192  C CB  . ALA B  1 390 ? -24.61599 -0.88045   57.05003  1.000 24.19822  ? 370  ALA A CB  1 
ATOM   6193  N N   . GLN B  1 391 ? -26.76308 1.51504    56.94527  1.000 23.01064  ? 371  GLN A N   1 
ATOM   6194  C CA  . GLN B  1 391 ? -28.08434 1.98929    57.36288  1.000 24.06178  ? 371  GLN A CA  1 
ATOM   6195  C C   . GLN B  1 391 ? -29.13623 1.33178    56.48595  1.000 23.65364  ? 371  GLN A C   1 
ATOM   6196  O O   . GLN B  1 391 ? -29.19174 1.59807    55.27764  1.000 28.34354  ? 371  GLN A O   1 
ATOM   6197  C CB  . GLN B  1 391 ? -28.17734 3.50828    57.26967  1.000 26.20828  ? 371  GLN A CB  1 
ATOM   6198  C CG  . GLN B  1 391 ? -27.18366 4.23834    58.14260  1.000 32.20458  ? 371  GLN A CG  1 
ATOM   6199  C CD  . GLN B  1 391 ? -27.40881 5.71581    58.07766  1.000 42.31586  ? 371  GLN A CD  1 
ATOM   6200  O OE1 . GLN B  1 391 ? -28.33966 6.17485    57.40678  1.000 46.87532  ? 371  GLN A OE1 1 
ATOM   6201  N NE2 . GLN B  1 391 ? -26.55742 6.48243    58.75020  1.000 43.27267  ? 371  GLN A NE2 1 
ATOM   6202  N N   . LEU B  1 392 ? -29.98209 0.49332    57.09172  1.000 20.10509  ? 372  LEU A N   1 
ATOM   6203  C CA  . LEU B  1 392 ? -30.94719 -0.30908   56.35620  1.000 22.65489  ? 372  LEU A CA  1 
ATOM   6204  C C   . LEU B  1 392 ? -32.34134 -0.12873   56.93816  1.000 24.34569  ? 372  LEU A C   1 
ATOM   6205  O O   . LEU B  1 392 ? -32.54214 -0.30032   58.14655  1.000 25.75213  ? 372  LEU A O   1 
ATOM   6206  C CB  . LEU B  1 392 ? -30.56610 -1.79063   56.39114  1.000 24.58829  ? 372  LEU A CB  1 
ATOM   6207  C CG  . LEU B  1 392 ? -29.08055 -2.09622   56.21545  1.000 30.29682  ? 372  LEU A CG  1 
ATOM   6208  C CD1 . LEU B  1 392 ? -28.84214 -3.57358   56.40111  1.000 33.00748  ? 372  LEU A CD1 1 
ATOM   6209  C CD2 . LEU B  1 392 ? -28.62461 -1.67021   54.85854  1.000 34.62708  ? 372  LEU A CD2 1 
ATOM   6210  N N   . SER B  1 393 ? -33.31201 0.17577    56.07034  1.000 26.43129  ? 373  SER A N   1 
ATOM   6211  C CA  . SER B  1 393 ? -34.70947 0.32354    56.44938  1.000 25.03414  ? 373  SER A CA  1 
ATOM   6212  C C   . SER B  1 393 ? -35.59366 -0.49089   55.52651  1.000 27.19628  ? 373  SER A C   1 
ATOM   6213  O O   . SER B  1 393 ? -35.39598 -0.48537   54.30574  1.000 27.11514  ? 373  SER A O   1 
ATOM   6214  C CB  . SER B  1 393 ? -35.17092 1.77313    56.39600  1.000 26.99648  ? 373  SER A CB  1 
ATOM   6215  O OG  . SER B  1 393 ? -34.31794 2.58850    57.16922  1.000 36.45634  ? 373  SER A OG  1 
ATOM   6216  N N   . ASN B  1 394 ? -36.59248 -1.17018   56.12680  1.000 21.91927  ? 374  ASN A N   1 
ATOM   6217  C CA  . ASN B  1 394 ? -37.63640 -1.89006   55.40256  1.000 23.15099  ? 374  ASN A CA  1 
ATOM   6218  C C   . ASN B  1 394 ? -37.02355 -3.00300   54.54884  1.000 22.97083  ? 374  ASN A C   1 
ATOM   6219  O O   . ASN B  1 394 ? -37.05186 -2.97628   53.31178  1.000 21.24208  ? 374  ASN A O   1 
ATOM   6220  C CB  . ASN B  1 394 ? -38.46738 -0.92861   54.54371  1.000 27.04425  ? 374  ASN A CB  1 
ATOM   6221  C CG  . ASN B  1 394 ? -39.29853 0.03429    55.38036  1.000 31.22631  ? 374  ASN A CG  1 
ATOM   6222  O OD1 . ASN B  1 394 ? -40.03216 -0.37063   56.29684  1.000 26.67290  ? 374  ASN A OD1 1 
ATOM   6223  N ND2 . ASN B  1 394 ? -39.19909 1.32187    55.04866  1.000 35.38023  ? 374  ASN A ND2 1 
ATOM   6224  N N   . VAL B  1 395 ? -36.41916 -3.96533   55.23619  1.000 18.52861  ? 375  VAL A N   1 
ATOM   6225  C CA  . VAL B  1 395 ? -35.63666 -4.98999   54.56741  1.000 18.27847  ? 375  VAL A CA  1 
ATOM   6226  C C   . VAL B  1 395 ? -35.92053 -6.34531   55.18461  1.000 23.15862  ? 375  VAL A C   1 
ATOM   6227  O O   . VAL B  1 395 ? -36.36123 -6.47022   56.33771  1.000 20.61810  ? 375  VAL A O   1 
ATOM   6228  C CB  . VAL B  1 395 ? -34.11738 -4.71918   54.59257  1.000 18.44363  ? 375  VAL A CB  1 
ATOM   6229  C CG1 . VAL B  1 395 ? -33.75335 -3.43857   53.83066  1.000 20.41503  ? 375  VAL A CG1 1 
ATOM   6230  C CG2 . VAL B  1 395 ? -33.60683 -4.66056   56.04582  1.000 17.79429  ? 375  VAL A CG2 1 
ATOM   6231  N N   . VAL B  1 396 ? -35.68011 -7.36729   54.37382  1.000 17.90917  ? 376  VAL A N   1 
ATOM   6232  C CA  . VAL B  1 396 ? -35.55939 -8.74721   54.82564  1.000 20.30638  ? 376  VAL A CA  1 
ATOM   6233  C C   . VAL B  1 396 ? -34.17575 -9.19694   54.40739  1.000 23.95696  ? 376  VAL A C   1 
ATOM   6234  O O   . VAL B  1 396 ? -33.84937 -9.16112   53.21473  1.000 24.26944  ? 376  VAL A O   1 
ATOM   6235  C CB  . VAL B  1 396 ? -36.61549 -9.66194   54.19988  1.000 17.64811  ? 376  VAL A CB  1 
ATOM   6236  C CG1 . VAL B  1 396 ? -36.29249 -11.11612  54.58660  1.000 17.40238  ? 376  VAL A CG1 1 
ATOM   6237  C CG2 . VAL B  1 396 ? -37.99010 -9.25684   54.66099  1.000 21.36576  ? 376  VAL A CG2 1 
ATOM   6238  N N   . ILE B  1 397 ? -33.32863 -9.53427   55.37619  1.000 21.11636  ? 377  ILE A N   1 
ATOM   6239  C CA  . ILE B  1 397 ? -31.95190 -9.91521   55.08141  1.000 22.20814  ? 377  ILE A CA  1 
ATOM   6240  C C   . ILE B  1 397 ? -31.83197 -11.42545  55.23755  1.000 22.96646  ? 377  ILE A C   1 
ATOM   6241  O O   . ILE B  1 397 ? -32.12553 -11.96977  56.31605  1.000 20.48428  ? 377  ILE A O   1 
ATOM   6242  C CB  . ILE B  1 397 ? -30.94326 -9.18261   55.97682  1.000 22.84770  ? 377  ILE A CB  1 
ATOM   6243  C CG1 . ILE B  1 397 ? -31.26538 -7.66437   56.03877  1.000 22.96966  ? 377  ILE A CG1 1 
ATOM   6244  C CG2 . ILE B  1 397 ? -29.52123 -9.47406   55.47364  1.000 20.17677  ? 377  ILE A CG2 1 
ATOM   6245  C CD1 . ILE B  1 397 ? -30.26919 -6.85214   56.86326  1.000 24.64324  ? 377  ILE A CD1 1 
ATOM   6246  N N   . ASP B  1 398 ? -31.39013 -12.09216  54.16477  1.000 21.14790  ? 378  ASP A N   1 
ATOM   6247  C CA  . ASP B  1 398 ? -31.31199 -13.55406  54.09461  1.000 18.82445  ? 378  ASP A CA  1 
ATOM   6248  C C   . ASP B  1 398 ? -30.26704 -14.08171  55.08335  1.000 18.31103  ? 378  ASP A C   1 
ATOM   6249  O O   . ASP B  1 398 ? -29.34035 -13.37757  55.50009  1.000 18.22157  ? 378  ASP A O   1 
ATOM   6250  C CB  . ASP B  1 398 ? -30.96367 -13.98660  52.65285  1.000 23.01277  ? 378  ASP A CB  1 
ATOM   6251  C CG  . ASP B  1 398 ? -31.12518 -15.50142  52.39286  1.000 26.99468  ? 378  ASP A CG  1 
ATOM   6252  O OD1 . ASP B  1 398 ? -31.96330 -16.18028  53.03744  1.000 26.98523  ? 378  ASP A OD1 1 
ATOM   6253  O OD2 . ASP B  1 398 ? -30.46218 -15.99738  51.45159  1.000 27.91386  ? 378  ASP A OD2 1 
ATOM   6254  N N   . HIS B  1 399 ? -30.41752 -15.35320  55.44843  1.000 19.60131  ? 379  HIS A N   1 
ATOM   6255  C CA  . HIS B  1 399 ? -29.48533 -16.00542  56.35898  1.000 24.73466  ? 379  HIS A CA  1 
ATOM   6256  C C   . HIS B  1 399 ? -28.02249 -15.85091  55.90963  1.000 29.17965  ? 379  HIS A C   1 
ATOM   6257  O O   . HIS B  1 399 ? -27.70115 -16.06048  54.74241  1.000 33.83632  ? 379  HIS A O   1 
ATOM   6258  C CB  . HIS B  1 399 ? -29.89958 -17.48124  56.42362  1.000 28.79942  ? 379  HIS A CB  1 
ATOM   6259  C CG  . HIS B  1 399 ? -29.01079 -18.32966  57.26043  1.000 32.44972  ? 379  HIS A CG  1 
ATOM   6260  N ND1 . HIS B  1 399 ? -29.48582 -19.19382  58.22093  1.000 32.42102  ? 379  HIS A ND1 1 
ATOM   6261  C CD2 . HIS B  1 399 ? -27.66806 -18.48235  57.24584  1.000 34.03796  ? 379  HIS A CD2 1 
ATOM   6262  C CE1 . HIS B  1 399 ? -28.47068 -19.80905  58.79731  1.000 31.79240  ? 379  HIS A CE1 1 
ATOM   6263  N NE2 . HIS B  1 399 ? -27.35722 -19.39331  58.22733  1.000 35.78129  ? 379  HIS A NE2 1 
ATOM   6264  N N   . GLY B  1 400 ? -27.13130 -15.47365  56.83732  1.000 24.50118  ? 380  GLY A N   1 
ATOM   6265  C CA  . GLY B  1 400 ? -25.69930 -15.48894  56.56194  1.000 25.28006  ? 380  GLY A CA  1 
ATOM   6266  C C   . GLY B  1 400 ? -25.15194 -14.33376  55.74319  1.000 25.25064  ? 380  GLY A C   1 
ATOM   6267  O O   . GLY B  1 400 ? -23.92083 -14.24007  55.57921  1.000 26.22946  ? 380  GLY A O   1 
ATOM   6268  N N   . VAL B  1 401 ? -26.01400 -13.45074  55.22252  1.000 25.50828  ? 381  VAL A N   1 
ATOM   6269  C CA  . VAL B  1 401 ? -25.54766 -12.31786  54.41983  1.000 28.14333  ? 381  VAL A CA  1 
ATOM   6270  C C   . VAL B  1 401 ? -24.54491 -11.47135  55.21037  1.000 27.73586  ? 381  VAL A C   1 
ATOM   6271  O O   . VAL B  1 401 ? -24.66376 -11.28476  56.43401  1.000 24.50028  ? 381  VAL A O   1 
ATOM   6272  C CB  . VAL B  1 401 ? -26.75497 -11.48500  53.95107  1.000 24.50371  ? 381  VAL A CB  1 
ATOM   6273  C CG1 . VAL B  1 401 ? -26.30387 -10.20532  53.24941  1.000 24.71334  ? 381  VAL A CG1 1 
ATOM   6274  C CG2 . VAL B  1 401 ? -27.60344 -12.29593  53.01564  1.000 23.96069  ? 381  VAL A CG2 1 
ATOM   6275  N N   . VAL B  1 402 ? -23.53657 -10.96750  54.52261  1.000 26.25754  ? 382  VAL A N   1 
ATOM   6276  C CA  . VAL B  1 402 ? -22.61627 -9.99796   55.10477  1.000 24.81323  ? 382  VAL A CA  1 
ATOM   6277  C C   . VAL B  1 402 ? -22.90370 -8.64395   54.45962  1.000 26.68245  ? 382  VAL A C   1 
ATOM   6278  O O   . VAL B  1 402 ? -22.62978 -8.44601   53.26569  1.000 27.65082  ? 382  VAL A O   1 
ATOM   6279  C CB  . VAL B  1 402 ? -21.14709 -10.41099  54.91848  1.000 28.21527  ? 382  VAL A CB  1 
ATOM   6280  C CG1 . VAL B  1 402 ? -20.22599 -9.26516   55.34528  1.000 28.29608  ? 382  VAL A CG1 1 
ATOM   6281  C CG2 . VAL B  1 402 ? -20.84688 -11.61265  55.75014  1.000 32.83447  ? 382  VAL A CG2 1 
ATOM   6282  N N   . ILE B  1 403 ? -23.45738 -7.70827   55.22453  1.000 23.27224  ? 383  ILE A N   1 
ATOM   6283  C CA  . ILE B  1 403 ? -23.74819 -6.38141   54.68133  1.000 20.84540  ? 383  ILE A CA  1 
ATOM   6284  C C   . ILE B  1 403 ? -22.46107 -5.55750   54.68442  1.000 25.54741  ? 383  ILE A C   1 
ATOM   6285  O O   . ILE B  1 403 ? -21.80641 -5.43180   55.74038  1.000 26.56179  ? 383  ILE A O   1 
ATOM   6286  C CB  . ILE B  1 403 ? -24.83581 -5.68405   55.48927  1.000 21.09137  ? 383  ILE A CB  1 
ATOM   6287  C CG1 . ILE B  1 403 ? -26.13368 -6.49518   55.52812  1.000 19.50512  ? 383  ILE A CG1 1 
ATOM   6288  C CG2 . ILE B  1 403 ? -25.08476 -4.26743   54.91477  1.000 22.09399  ? 383  ILE A CG2 1 
ATOM   6289  C CD1 . ILE B  1 403 ? -26.79622 -6.59391   54.16913  1.000 22.77694  ? 383  ILE A CD1 1 
ATOM   6290  N N   . PRO B  1 404 ? -22.06611 -4.99260   53.55576  1.000 27.06759  ? 384  PRO A N   1 
ATOM   6291  C CA  . PRO B  1 404 ? -20.83046 -4.20356   53.52863  1.000 28.28364  ? 384  PRO A CA  1 
ATOM   6292  C C   . PRO B  1 404 ? -20.93567 -2.92134   54.33620  1.000 27.81477  ? 384  PRO A C   1 
ATOM   6293  O O   . PRO B  1 404 ? -21.99191 -2.28535   54.41207  1.000 26.03187  ? 384  PRO A O   1 
ATOM   6294  C CB  . PRO B  1 404 ? -20.64079 -3.88451   52.03395  1.000 28.00761  ? 384  PRO A CB  1 
ATOM   6295  C CG  . PRO B  1 404 ? -21.54328 -4.80030   51.31884  1.000 26.07329  ? 384  PRO A CG  1 
ATOM   6296  C CD  . PRO B  1 404 ? -22.67849 -5.12890   52.21825  1.000 23.74741  ? 384  PRO A CD  1 
ATOM   6297  N N   . GLU B  1 405 ? -19.80424 -2.53438   54.92403  1.000 31.57154  ? 385  GLU A N   1 
ATOM   6298  C CA  . GLU B  1 405 ? -19.72022 -1.27668   55.65736  1.000 31.92051  ? 385  GLU A CA  1 
ATOM   6299  C C   . GLU B  1 405 ? -20.23319 -0.11250   54.81838  1.000 27.69325  ? 385  GLU A C   1 
ATOM   6300  O O   . GLU B  1 405 ? -19.84752 0.05373    53.65942  1.000 30.79323  ? 385  GLU A O   1 
ATOM   6301  C CB  . GLU B  1 405 ? -18.27793 -1.02944   56.08329  1.000 34.15647  ? 385  GLU A CB  1 
ATOM   6302  C CG  . GLU B  1 405 ? -17.70405 -2.23546   56.79836  1.000 41.87644  ? 385  GLU A CG  1 
ATOM   6303  C CD  . GLU B  1 405 ? -16.34085 -1.97303   57.39772  1.000 50.21007  ? 385  GLU A CD  1 
ATOM   6304  O OE1 . GLU B  1 405 ? -15.76034 -0.93699   57.05931  1.000 53.64145  ? 385  GLU A OE1 1 
ATOM   6305  O OE2 . GLU B  1 405 ? -15.85081 -2.78332   58.21787  1.000 53.41195  ? 385  GLU A OE2 1 
ATOM   6306  N N   . GLY B  1 406 ? -21.13208 0.67332    55.40283  1.000 27.75689  ? 386  GLY A N   1 
ATOM   6307  C CA  . GLY B  1 406 ? -21.65269 1.86352    54.77381  1.000 29.75261  ? 386  GLY A CA  1 
ATOM   6308  C C   . GLY B  1 406 ? -22.76807 1.64279    53.77725  1.000 31.05483  ? 386  GLY A C   1 
ATOM   6309  O O   . GLY B  1 406 ? -23.24162 2.61970    53.18341  1.000 31.18356  ? 386  GLY A O   1 
ATOM   6310  N N   . LEU B  1 407 ? -23.22487 0.41358    53.57280  1.000 27.46172  ? 387  LEU A N   1 
ATOM   6311  C CA  . LEU B  1 407 ? -24.33741 0.22281    52.64915  1.000 28.55926  ? 387  LEU A CA  1 
ATOM   6312  C C   . LEU B  1 407 ? -25.58126 0.95402    53.14602  1.000 29.39551  ? 387  LEU A C   1 
ATOM   6313  O O   . LEU B  1 407 ? -25.90500 0.92055    54.33958  1.000 25.42466  ? 387  LEU A O   1 
ATOM   6314  C CB  . LEU B  1 407 ? -24.64291 -1.26078   52.47035  1.000 31.23875  ? 387  LEU A CB  1 
ATOM   6315  C CG  . LEU B  1 407 ? -25.68743 -1.57448   51.39456  1.000 27.57853  ? 387  LEU A CG  1 
ATOM   6316  C CD1 . LEU B  1 407 ? -25.10373 -1.40020   50.00314  1.000 28.26005  ? 387  LEU A CD1 1 
ATOM   6317  C CD2 . LEU B  1 407 ? -26.17022 -3.01086   51.59998  1.000 27.49590  ? 387  LEU A CD2 1 
ATOM   6318  N N   . ILE B  1 408 ? -26.26362 1.63675    52.22650  1.000 25.61850  ? 388  ILE A N   1 
ATOM   6319  C CA  . ILE B  1 408 ? -27.51176 2.32925    52.51940  1.000 27.14029  ? 388  ILE A CA  1 
ATOM   6320  C C   . ILE B  1 408 ? -28.60724 1.65236    51.71964  1.000 29.29210  ? 388  ILE A C   1 
ATOM   6321  O O   . ILE B  1 408 ? -28.51077 1.53941    50.49043  1.000 26.84504  ? 388  ILE A O   1 
ATOM   6322  C CB  . ILE B  1 408 ? -27.44853 3.82850    52.19327  1.000 31.18995  ? 388  ILE A CB  1 
ATOM   6323  C CG1 . ILE B  1 408 ? -26.20043 4.47976    52.81364  1.000 31.82321  ? 388  ILE A CG1 1 
ATOM   6324  C CG2 . ILE B  1 408 ? -28.71461 4.51900    52.65117  1.000 30.04081  ? 388  ILE A CG2 1 
ATOM   6325  C CD1 . ILE B  1 408 ? -26.23852 4.60310    54.32849  1.000 31.58521  ? 388  ILE A CD1 1 
ATOM   6326  N N   . VAL B  1 409 ? -29.63396 1.17581    52.41828  1.000 24.92545  ? 389  VAL A N   1 
ATOM   6327  C CA  . VAL B  1 409 ? -30.82885 0.62728    51.78611  1.000 27.82922  ? 389  VAL A CA  1 
ATOM   6328  C C   . VAL B  1 409 ? -32.03113 1.28911    52.43787  1.000 29.90719  ? 389  VAL A C   1 
ATOM   6329  O O   . VAL B  1 409 ? -32.08122 1.44053    53.66707  1.000 28.88917  ? 389  VAL A O   1 
ATOM   6330  C CB  . VAL B  1 409 ? -30.92222 -0.91909   51.90649  1.000 28.11568  ? 389  VAL A CB  1 
ATOM   6331  C CG1 . VAL B  1 409 ? -32.10193 -1.46704   51.08464  1.000 21.75454  ? 389  VAL A CG1 1 
ATOM   6332  C CG2 . VAL B  1 409 ? -29.62569 -1.61126   51.43577  1.000 26.40937  ? 389  VAL A CG2 1 
ATOM   6333  N N   . GLY B  1 410 ? -33.00391 1.67971    51.61448  1.000 31.55321  ? 390  GLY A N   1 
ATOM   6334  C CA  . GLY B  1 410 ? -34.20490 2.32733    52.10137  1.000 25.94214  ? 390  GLY A CA  1 
ATOM   6335  C C   . GLY B  1 410 ? -34.22485 3.82876    51.91659  1.000 30.45335  ? 390  GLY A C   1 
ATOM   6336  O O   . GLY B  1 410 ? -35.21131 4.46751    52.30066  1.000 31.67192  ? 390  GLY A O   1 
ATOM   6337  N N   . GLU B  1 411 ? -33.16900 4.41106    51.33393  1.000 30.15166  ? 391  GLU A N   1 
ATOM   6338  C CA  . GLU B  1 411 ? -33.09905 5.83759    51.06468  1.000 30.92082  ? 391  GLU A CA  1 
ATOM   6339  C C   . GLU B  1 411 ? -33.46643 6.16476    49.62273  1.000 32.55849  ? 391  GLU A C   1 
ATOM   6340  O O   . GLU B  1 411 ? -34.11417 7.18493    49.37205  1.000 32.84318  ? 391  GLU A O   1 
ATOM   6341  C CB  . GLU B  1 411 ? -31.68991 6.37266    51.39253  1.000 37.16354  ? 391  GLU A CB  1 
ATOM   6342  C CG  . GLU B  1 411 ? -31.32421 7.73318    50.73257  1.000 44.92105  ? 391  GLU A CG  1 
ATOM   6343  C CD  . GLU B  1 411 ? -29.80023 8.10430    50.76072  1.000 47.89066  ? 391  GLU A CD  1 
ATOM   6344  O OE1 . GLU B  1 411 ? -28.99113 7.43884    50.06476  1.000 47.50614  ? 391  GLU A OE1 1 
ATOM   6345  O OE2 . GLU B  1 411 ? -29.41841 9.08639    51.45392  1.000 45.81158  ? 391  GLU A OE2 1 
ATOM   6346  N N   . ASP B  1 412 ? -33.11382 5.29985    48.67276  1.000 31.17925  ? 392  ASP A N   1 
ATOM   6347  C CA  . ASP B  1 412 ? -33.25605 5.59730    47.24548  1.000 32.18793  ? 392  ASP A CA  1 
ATOM   6348  C C   . ASP B  1 412 ? -34.00256 4.45792    46.57446  1.000 31.66599  ? 392  ASP A C   1 
ATOM   6349  O O   . ASP B  1 412 ? -33.39449 3.42365    46.24953  1.000 29.04156  ? 392  ASP A O   1 
ATOM   6350  C CB  . ASP B  1 412 ? -31.89321 5.80552    46.60948  1.000 33.29282  ? 392  ASP A CB  1 
ATOM   6351  C CG  . ASP B  1 412 ? -31.95277 6.11348    45.11909  1.000 37.46947  ? 392  ASP A CG  1 
ATOM   6352  O OD1 . ASP B  1 412 ? -33.03266 6.06222    44.48215  1.000 38.51520  ? 392  ASP A OD1 1 
ATOM   6353  O OD2 . ASP B  1 412 ? -30.86683 6.41742    44.59769  1.000 34.20020  ? 392  ASP A OD2 1 
ATOM   6354  N N   . PRO B  1 413 ? -35.30844 4.60401    46.35629  1.000 29.68803  ? 393  PRO A N   1 
ATOM   6355  C CA  . PRO B  1 413 ? -36.09112 3.49461    45.78142  1.000 28.12702  ? 393  PRO A CA  1 
ATOM   6356  C C   . PRO B  1 413 ? -35.54182 2.97065    44.46569  1.000 35.47480  ? 393  PRO A C   1 
ATOM   6357  O O   . PRO B  1 413 ? -35.48712 1.74898    44.26072  1.000 37.85658  ? 393  PRO A O   1 
ATOM   6358  C CB  . PRO B  1 413 ? -37.47686 4.12461    45.61170  1.000 31.32216  ? 393  PRO A CB  1 
ATOM   6359  C CG  . PRO B  1 413 ? -37.53516 5.17710    46.65399  1.000 33.66040  ? 393  PRO A CG  1 
ATOM   6360  C CD  . PRO B  1 413 ? -36.15324 5.73750    46.75220  1.000 30.15559  ? 393  PRO A CD  1 
ATOM   6361  N N   . GLU B  1 414 ? -35.11216 3.87056    43.57210  1.000 31.70818  ? 394  GLU A N   1 
ATOM   6362  C CA  . GLU B  1 414 ? -34.61825 3.45183    42.26704  1.000 32.79808  ? 394  GLU A CA  1 
ATOM   6363  C C   . GLU B  1 414 ? -33.34673 2.61702    42.37939  1.000 31.10531  ? 394  GLU A C   1 
ATOM   6364  O O   . GLU B  1 414 ? -33.24690 1.54308    41.77635  1.000 33.99305  ? 394  GLU A O   1 
ATOM   6365  C CB  . GLU B  1 414 ? -34.37399 4.68132    41.40358  1.000 41.85512  ? 394  GLU A CB  1 
ATOM   6366  C CG  . GLU B  1 414 ? -35.63976 5.32340    40.92984  1.000 48.70733  ? 394  GLU A CG  1 
ATOM   6367  C CD  . GLU B  1 414 ? -35.36130 6.34990    39.85496  1.000 60.25145  ? 394  GLU A CD  1 
ATOM   6368  O OE1 . GLU B  1 414 ? -36.22824 6.52272    38.97154  1.000 64.85189  ? 394  GLU A OE1 1 
ATOM   6369  O OE2 . GLU B  1 414 ? -34.26710 6.97074    39.88812  1.000 63.58821  ? 394  GLU A OE2 1 
ATOM   6370  N N   . LEU B  1 415 ? -32.36173 3.09784    43.14628  1.000 29.70230  ? 395  LEU A N   1 
ATOM   6371  C CA  . LEU B  1 415 ? -31.10239 2.37420    43.31844  1.000 32.27771  ? 395  LEU A CA  1 
ATOM   6372  C C   . LEU B  1 415 ? -31.31413 1.06551    44.06644  1.000 33.92661  ? 395  LEU A C   1 
ATOM   6373  O O   . LEU B  1 415 ? -30.74099 0.02660    43.69988  1.000 30.60734  ? 395  LEU A O   1 
ATOM   6374  C CB  . LEU B  1 415 ? -30.10413 3.24948    44.06960  1.000 33.42567  ? 395  LEU A CB  1 
ATOM   6375  C CG  . LEU B  1 415 ? -28.69542 2.70044    44.28609  1.000 38.21032  ? 395  LEU A CG  1 
ATOM   6376  C CD1 . LEU B  1 415 ? -27.98879 2.53633    42.92698  1.000 42.46100  ? 395  LEU A CD1 1 
ATOM   6377  C CD2 . LEU B  1 415 ? -27.89943 3.63034    45.19241  1.000 37.51792  ? 395  LEU A CD2 1 
ATOM   6378  N N   . ASP B  1 416 ? -32.13588 1.10588    45.12461  1.000 31.31954  ? 396  ASP A N   1 
ATOM   6379  C CA  . ASP B  1 416 ? -32.50614 -0.10138   45.85470  1.000 28.71374  ? 396  ASP A CA  1 
ATOM   6380  C C   . ASP B  1 416 ? -33.12748 -1.14651   44.93865  1.000 31.52067  ? 396  ASP A C   1 
ATOM   6381  O O   . ASP B  1 416 ? -32.79533 -2.33342   45.03437  1.000 27.78977  ? 396  ASP A O   1 
ATOM   6382  C CB  . ASP B  1 416 ? -33.48066 0.26177    46.97989  1.000 28.98265  ? 396  ASP A CB  1 
ATOM   6383  C CG  . ASP B  1 416 ? -32.82018 1.03489    48.10858  1.000 32.14248  ? 396  ASP A CG  1 
ATOM   6384  O OD1 . ASP B  1 416 ? -31.57537 1.22667    48.08560  1.000 35.14635  ? 396  ASP A OD1 1 
ATOM   6385  O OD2 . ASP B  1 416 ? -33.54689 1.44393    49.03527  1.000 33.32920  ? 396  ASP A OD2 1 
ATOM   6386  N N   . ALA B  1 417 ? -34.03594 -0.73102   44.04226  1.000 35.40541  ? 397  ALA A N   1 
ATOM   6387  C CA  . ALA B  1 417 ? -34.68836 -1.69890   43.16114  1.000 37.08864  ? 397  ALA A CA  1 
ATOM   6388  C C   . ALA B  1 417 ? -33.72767 -2.26866   42.12516  1.000 38.19252  ? 397  ALA A C   1 
ATOM   6389  O O   . ALA B  1 417 ? -33.87808 -3.42583   41.70988  1.000 36.86250  ? 397  ALA A O   1 
ATOM   6390  C CB  . ALA B  1 417 ? -35.89037 -1.07214   42.45375  1.000 38.23652  ? 397  ALA A CB  1 
ATOM   6391  N N   . LYS B  1 418 ? -32.74992 -1.48151   41.68319  1.000 38.91314  ? 398  LYS A N   1 
ATOM   6392  C CA  . LYS B  1 418 ? -31.75212 -2.03601   40.78229  1.000 41.46231  ? 398  LYS A CA  1 
ATOM   6393  C C   . LYS B  1 418 ? -30.92673 -3.09863   41.48945  1.000 42.64439  ? 398  LYS A C   1 
ATOM   6394  O O   . LYS B  1 418 ? -30.61401 -4.14287   40.89971  1.000 39.50261  ? 398  LYS A O   1 
ATOM   6395  C CB  . LYS B  1 418 ? -30.84614 -0.92692   40.23135  1.000 42.28334  ? 398  LYS A CB  1 
ATOM   6396  N N   . ARG B  1 419 ? -30.59620 -2.86233   42.76793  1.000 39.72479  ? 399  ARG A N   1 
ATOM   6397  C CA  . ARG B  1 419 ? -29.61411 -3.68554   43.46362  1.000 34.87122  ? 399  ARG A CA  1 
ATOM   6398  C C   . ARG B  1 419 ? -30.22641 -4.90980   44.11349  1.000 29.72871  ? 399  ARG A C   1 
ATOM   6399  O O   . ARG B  1 419 ? -29.56613 -5.95121   44.18291  1.000 30.11591  ? 399  ARG A O   1 
ATOM   6400  C CB  . ARG B  1 419 ? -28.89133 -2.88472   44.55848  1.000 34.17544  ? 399  ARG A CB  1 
ATOM   6401  C CG  . ARG B  1 419 ? -28.02304 -1.72893   44.10676  1.000 37.80591  ? 399  ARG A CG  1 
ATOM   6402  C CD  . ARG B  1 419 ? -27.70255 -0.83879   45.32476  1.000 39.89653  ? 399  ARG A CD  1 
ATOM   6403  N NE  . ARG B  1 419 ? -26.47802 -0.05905   45.15445  1.000 44.39645  ? 399  ARG A NE  1 
ATOM   6404  C CZ  . ARG B  1 419 ? -25.92141 0.68152    46.10971  1.000 49.61365  ? 399  ARG A CZ  1 
ATOM   6405  N NH1 . ARG B  1 419 ? -26.47224 0.75724    47.32858  1.000 47.81313  ? 399  ARG A NH1 1 
ATOM   6406  N NH2 . ARG B  1 419 ? -24.80343 1.34867    45.85202  1.000 52.03566  ? 399  ARG A NH2 1 
ATOM   6407  N N   . PHE B  1 420 ? -31.45247 -4.80431   44.61302  1.000 27.60711  ? 400  PHE A N   1 
ATOM   6408  C CA  . PHE B  1 420 ? -32.05027 -5.83960   45.44241  1.000 26.80905  ? 400  PHE A CA  1 
ATOM   6409  C C   . PHE B  1 420 ? -33.41479 -6.21762   44.87993  1.000 30.22419  ? 400  PHE A C   1 
ATOM   6410  O O   . PHE B  1 420 ? -33.87159 -5.65951   43.88298  1.000 34.20620  ? 400  PHE A O   1 
ATOM   6411  C CB  . PHE B  1 420 ? -32.12926 -5.34971   46.89161  1.000 28.68097  ? 400  PHE A CB  1 
ATOM   6412  C CG  . PHE B  1 420 ? -30.81414 -4.85470   47.41086  1.000 27.10219  ? 400  PHE A CG  1 
ATOM   6413  C CD1 . PHE B  1 420 ? -29.73094 -5.73352   47.54266  1.000 27.59671  ? 400  PHE A CD1 1 
ATOM   6414  C CD2 . PHE B  1 420 ? -30.63411 -3.51778   47.71588  1.000 27.26201  ? 400  PHE A CD2 1 
ATOM   6415  C CE1 . PHE B  1 420 ? -28.50217 -5.27835   48.04110  1.000 27.24384  ? 400  PHE A CE1 1 
ATOM   6416  C CE2 . PHE B  1 420 ? -29.40448 -3.04595   48.19137  1.000 25.63867  ? 400  PHE A CE2 1 
ATOM   6417  C CZ  . PHE B  1 420 ? -28.34159 -3.92990   48.35317  1.000 25.54464  ? 400  PHE A CZ  1 
ATOM   6418  N N   . ARG B  1 421 ? -34.06088 -7.20503   45.49558  1.000 26.67648  ? 401  ARG A N   1 
ATOM   6419  C CA  . ARG B  1 421 ? -35.44158 -7.52634   45.15995  1.000 25.35397  ? 401  ARG A CA  1 
ATOM   6420  C C   . ARG B  1 421 ? -36.32176 -6.58388   45.96383  1.000 29.64156  ? 401  ARG A C   1 
ATOM   6421  O O   . ARG B  1 421 ? -36.41476 -6.71769   47.18984  1.000 32.08355  ? 401  ARG A O   1 
ATOM   6422  C CB  . ARG B  1 421 ? -35.74155 -8.99165   45.46589  1.000 26.65611  ? 401  ARG A CB  1 
ATOM   6423  C CG  . ARG B  1 421 ? -37.20375 -9.35444   45.49619  1.000 29.33953  ? 401  ARG A CG  1 
ATOM   6424  C CD  . ARG B  1 421 ? -37.70627 -9.57081   44.08145  1.000 35.32571  ? 401  ARG A CD  1 
ATOM   6425  N NE  . ARG B  1 421 ? -36.87329 -10.54434  43.40772  1.000 39.17763  ? 401  ARG A NE  1 
ATOM   6426  C CZ  . ARG B  1 421 ? -36.99016 -10.86418  42.12411  1.000 44.44395  ? 401  ARG A CZ  1 
ATOM   6427  N NH1 . ARG B  1 421 ? -37.91987 -10.28098  41.37894  1.000 44.76800  ? 401  ARG A NH1 1 
ATOM   6428  N NH2 . ARG B  1 421 ? -36.18458 -11.77836  41.59708  1.000 44.41915  ? 401  ARG A NH2 1 
ATOM   6429  N N   . ARG B  1 422 ? -36.94045 -5.59902   45.30594  1.000 27.99776  ? 402  ARG A N   1 
ATOM   6430  C CA  . ARG B  1 422 ? -37.74808 -4.59754   46.01221  1.000 31.34728  ? 402  ARG A CA  1 
ATOM   6431  C C   . ARG B  1 422 ? -39.22879 -4.82157   45.72660  1.000 33.09978  ? 402  ARG A C   1 
ATOM   6432  O O   . ARG B  1 422 ? -39.62628 -4.89198   44.55870  1.000 32.45065  ? 402  ARG A O   1 
ATOM   6433  C CB  . ARG B  1 422 ? -37.35439 -3.16561   45.61101  1.000 28.05711  ? 402  ARG A CB  1 
ATOM   6434  C CG  . ARG B  1 422 ? -37.96842 -2.10058   46.55061  1.000 27.52194  ? 402  ARG A CG  1 
ATOM   6435  C CD  . ARG B  1 422 ? -37.33940 -0.74669   46.23280  1.000 29.60168  ? 402  ARG A CD  1 
ATOM   6436  N NE  . ARG B  1 422 ? -37.72468 0.28859    47.18525  1.000 28.97527  ? 402  ARG A NE  1 
ATOM   6437  C CZ  . ARG B  1 422 ? -38.85677 0.97763    47.12143  1.000 29.60641  ? 402  ARG A CZ  1 
ATOM   6438  N NH1 . ARG B  1 422 ? -39.72104 0.71740    46.14998  1.000 30.50565  ? 402  ARG A NH1 1 
ATOM   6439  N NH2 . ARG B  1 422 ? -39.12803 1.91844    48.03397  1.000 27.37845  ? 402  ARG A NH2 1 
ATOM   6440  N N   . THR B  1 423 ? -40.04156 -4.93960   46.77743  1.000 27.94040  ? 403  THR A N   1 
ATOM   6441  C CA  . THR B  1 423 ? -41.46843 -5.06719   46.52121  1.000 29.57199  ? 403  THR A CA  1 
ATOM   6442  C C   . THR B  1 423 ? -42.05110 -3.71276   46.15448  1.000 32.24973  ? 403  THR A C   1 
ATOM   6443  O O   . THR B  1 423 ? -41.44572 -2.66127   46.38847  1.000 28.46670  ? 403  THR A O   1 
ATOM   6444  C CB  . THR B  1 423 ? -42.25297 -5.61566   47.71993  1.000 26.42898  ? 403  THR A CB  1 
ATOM   6445  O OG1 . THR B  1 423 ? -42.29404 -4.64781   48.78016  1.000 23.78857  ? 403  THR A OG1 1 
ATOM   6446  C CG2 . THR B  1 423 ? -41.61897 -6.87776   48.21934  1.000 29.53120  ? 403  THR A CG2 1 
ATOM   6447  N N   . GLU B  1 424 ? -43.27205 -3.76397   45.61722  1.000 35.14524  ? 404  GLU A N   1 
ATOM   6448  C CA  . GLU B  1 424 ? -43.99514 -2.54917   45.27891  1.000 41.37217  ? 404  GLU A CA  1 
ATOM   6449  C C   . GLU B  1 424 ? -44.14933 -1.66298   46.49978  1.000 39.21293  ? 404  GLU A C   1 
ATOM   6450  O O   . GLU B  1 424 ? -44.01206 -0.43933   46.40467  1.000 41.32725  ? 404  GLU A O   1 
ATOM   6451  C CB  . GLU B  1 424 ? -45.35188 -2.91234   44.67547  1.000 49.40301  ? 404  GLU A CB  1 
ATOM   6452  C CG  . GLU B  1 424 ? -46.42782 -1.86553   44.85285  1.000 60.18635  ? 404  GLU A CG  1 
ATOM   6453  C CD  . GLU B  1 424 ? -46.33789 -0.74206   43.83094  1.000 67.83378  ? 404  GLU A CD  1 
ATOM   6454  O OE1 . GLU B  1 424 ? -45.98022 -1.01634   42.65762  1.000 71.30849  ? 404  GLU A OE1 1 
ATOM   6455  O OE2 . GLU B  1 424 ? -46.62928 0.41618    44.21278  1.000 69.73023  ? 404  GLU A OE2 1 
ATOM   6456  N N   . SER B  1 425 ? -44.37346 -2.26585   47.66751  1.000 33.58637  ? 405  SER A N   1 
ATOM   6457  C CA  . SER B  1 425 ? -44.56127 -1.48220   48.87359  1.000 32.25221  ? 405  SER A CA  1 
ATOM   6458  C C   . SER B  1 425 ? -43.24659 -1.04996   49.52282  1.000 30.72661  ? 405  SER A C   1 
ATOM   6459  O O   . SER B  1 425 ? -43.28685 -0.41783   50.57688  1.000 35.10709  ? 405  SER A O   1 
ATOM   6460  C CB  . SER B  1 425 ? -45.41854 -2.26712   49.85695  1.000 36.42843  ? 405  SER A CB  1 
ATOM   6461  O OG  . SER B  1 425 ? -44.70490 -3.40070   50.26866  1.000 36.09281  ? 405  SER A OG  1 
ATOM   6462  N N   . GLY B  1 426 ? -42.09485 -1.36810   48.93779  1.000 24.70375  ? 406  GLY A N   1 
ATOM   6463  C CA  . GLY B  1 426 ? -40.82880 -0.81696   49.37237  1.000 24.37251  ? 406  GLY A CA  1 
ATOM   6464  C C   . GLY B  1 426 ? -39.98000 -1.67405   50.29176  1.000 26.46850  ? 406  GLY A C   1 
ATOM   6465  O O   . GLY B  1 426 ? -39.03610 -1.14700   50.89602  1.000 26.22040  ? 406  GLY A O   1 
ATOM   6466  N N   . ILE B  1 427 ? -40.28301 -2.96261   50.43391  1.000 26.02328  ? 407  ILE A N   1 
ATOM   6467  C CA  . ILE B  1 427 ? -39.43468 -3.88590   51.18286  1.000 24.18127  ? 407  ILE A CA  1 
ATOM   6468  C C   . ILE B  1 427 ? -38.36116 -4.42669   50.24129  1.000 21.77413  ? 407  ILE A C   1 
ATOM   6469  O O   . ILE B  1 427 ? -38.68267 -4.95972   49.17903  1.000 22.35706  ? 407  ILE A O   1 
ATOM   6470  C CB  . ILE B  1 427 ? -40.26910 -5.04403   51.77770  1.000 24.01047  ? 407  ILE A CB  1 
ATOM   6471  C CG1 . ILE B  1 427 ? -41.46107 -4.51625   52.57301  1.000 24.92205  ? 407  ILE A CG1 1 
ATOM   6472  C CG2 . ILE B  1 427 ? -39.38994 -5.96028   52.63554  1.000 26.79357  ? 407  ILE A CG2 1 
ATOM   6473  C CD1 . ILE B  1 427 ? -41.07810 -3.77242   53.82603  1.000 26.55480  ? 407  ILE A CD1 1 
ATOM   6474  N N   . CYS B  1 428 ? -37.08423 -4.30125   50.61943  1.000 23.57295  ? 408  CYS A N   1 
ATOM   6475  C CA  . CYS B  1 428 ? -35.99442 -4.95480   49.88964  1.000 22.93254  ? 408  CYS A CA  1 
ATOM   6476  C C   . CYS B  1 428 ? -35.64332 -6.28542   50.54562  1.000 22.67529  ? 408  CYS A C   1 
ATOM   6477  O O   . CYS B  1 428 ? -35.30630 -6.32882   51.73642  1.000 19.99045  ? 408  CYS A O   1 
ATOM   6478  C CB  . CYS B  1 428 ? -34.74309 -4.07810   49.83373  1.000 23.08945  ? 408  CYS A CB  1 
ATOM   6479  S SG  . CYS B  1 428 ? -35.04046 -2.56444   48.91783  1.000 27.21016  ? 408  CYS A SG  1 
ATOM   6480  N N   . LEU B  1 429 ? -35.67508 -7.34908   49.76367  1.000 24.68367  ? 409  LEU A N   1 
ATOM   6481  C CA  . LEU B  1 429 ? -35.09834 -8.63011   50.15626  1.000 23.66915  ? 409  LEU A CA  1 
ATOM   6482  C C   . LEU B  1 429 ? -33.63368 -8.62499   49.73547  1.000 30.26190  ? 409  LEU A C   1 
ATOM   6483  O O   . LEU B  1 429 ? -33.32598 -8.38130   48.56218  1.000 28.83170  ? 409  LEU A O   1 
ATOM   6484  C CB  . LEU B  1 429 ? -35.86506 -9.77640   49.50625  1.000 22.10235  ? 409  LEU A CB  1 
ATOM   6485  C CG  . LEU B  1 429 ? -35.18284 -11.12912  49.58587  1.000 23.39564  ? 409  LEU A CG  1 
ATOM   6486  C CD1 . LEU B  1 429 ? -35.27331 -11.64305  51.03560  1.000 21.15824  ? 409  LEU A CD1 1 
ATOM   6487  C CD2 . LEU B  1 429 ? -35.83950 -12.07915  48.61137  1.000 27.33880  ? 409  LEU A CD2 1 
ATOM   6488  N N   . ILE B  1 430 ? -32.72116 -8.83191   50.68316  1.000 25.47257  ? 410  ILE A N   1 
ATOM   6489  C CA  . ILE B  1 430 ? -31.29239 -8.75740   50.38130  1.000 25.98568  ? 410  ILE A CA  1 
ATOM   6490  C C   . ILE B  1 430 ? -30.67235 -10.15311  50.51427  1.000 28.61558  ? 410  ILE A C   1 
ATOM   6491  O O   . ILE B  1 430 ? -30.81658 -10.80402  51.55213  1.000 27.81815  ? 410  ILE A O   1 
ATOM   6492  C CB  . ILE B  1 430 ? -30.58435 -7.73837   51.28266  1.000 25.42202  ? 410  ILE A CB  1 
ATOM   6493  C CG1 . ILE B  1 430 ? -31.19550 -6.33349   51.06311  1.000 23.49621  ? 410  ILE A CG1 1 
ATOM   6494  C CG2 . ILE B  1 430 ? -29.10757 -7.75597   50.95093  1.000 26.11704  ? 410  ILE A CG2 1 
ATOM   6495  C CD1 . ILE B  1 430 ? -30.90386 -5.28245   52.16157  1.000 20.03620  ? 410  ILE A CD1 1 
ATOM   6496  N N   . THR B  1 431 ? -29.99474 -10.62762  49.45728  1.000 27.62323  ? 411  THR A N   1 
ATOM   6497  C CA  A THR B  1 431 ? -29.32614 -11.92225  49.43185  0.121 28.24840  ? 411  THR A CA  1 
ATOM   6498  C CA  B THR B  1 431 ? -29.31145 -11.91954  49.50445  0.879 27.31895  ? 411  THR A CA  1 
ATOM   6499  C C   . THR B  1 431 ? -27.82365 -11.71845  49.24491  1.000 30.24582  ? 411  THR A C   1 
ATOM   6500  O O   . THR B  1 431 ? -27.37450 -10.66567  48.76822  1.000 26.43636  ? 411  THR A O   1 
ATOM   6501  C CB  A THR B  1 431 ? -29.89369 -12.80407  48.29964  0.121 28.46732  ? 411  THR A CB  1 
ATOM   6502  C CB  B THR B  1 431 ? -29.85958 -12.93185  48.47218  0.879 28.91074  ? 411  THR A CB  1 
ATOM   6503  O OG1 A THR B  1 431 ? -31.28032 -12.50196  48.10422  0.121 28.10554  ? 411  THR A OG1 1 
ATOM   6504  O OG1 B THR B  1 431 ? -29.71825 -12.39819  47.14321  0.879 28.78737  ? 411  THR A OG1 1 
ATOM   6505  C CG2 A THR B  1 431 ? -29.77668 -14.27702  48.62528  0.121 28.40593  ? 411  THR A CG2 1 
ATOM   6506  C CG2 B THR B  1 431 ? -31.31012 -13.28260  48.74926  0.879 26.95264  ? 411  THR A CG2 1 
ATOM   6507  N N   . GLN B  1 432 ? -27.03336 -12.73623  49.59254  1.000 30.30611  ? 412  GLN A N   1 
ATOM   6508  C CA  . GLN B  1 432 ? -25.60418 -12.57380  49.37258  1.000 28.07294  ? 412  GLN A CA  1 
ATOM   6509  C C   . GLN B  1 432 ? -25.29697 -12.45990  47.88402  1.000 31.66373  ? 412  GLN A C   1 
ATOM   6510  O O   . GLN B  1 432 ? -24.43033 -11.66165  47.49189  1.000 27.33698  ? 412  GLN A O   1 
ATOM   6511  C CB  . GLN B  1 432 ? -24.83146 -13.71561  50.01343  1.000 28.20173  ? 412  GLN A CB  1 
ATOM   6512  C CG  . GLN B  1 432 ? -23.30061 -13.53753  49.94687  1.000 30.97799  ? 412  GLN A CG  1 
ATOM   6513  C CD  . GLN B  1 432 ? -22.81974 -12.32018  50.70295  1.000 32.17223  ? 412  GLN A CD  1 
ATOM   6514  O OE1 . GLN B  1 432 ? -23.13611 -12.15512  51.87958  1.000 32.68808  ? 412  GLN A OE1 1 
ATOM   6515  N NE2 . GLN B  1 432 ? -22.04221 -11.47264  50.04503  1.000 28.45688  ? 412  GLN A NE2 1 
ATOM   6516  N N   . SER B  1 433 ? -26.04761 -13.18269  47.04199  1.000 29.65379  ? 413  SER A N   1 
ATOM   6517  C CA  . SER B  1 433 ? -25.92709 -13.02214  45.59505  1.000 37.13069  ? 413  SER A CA  1 
ATOM   6518  C C   . SER B  1 433 ? -25.98074 -11.56096  45.17403  1.000 38.93939  ? 413  SER A C   1 
ATOM   6519  O O   . SER B  1 433 ? -25.11819 -11.08214  44.42640  1.000 38.66337  ? 413  SER A O   1 
ATOM   6520  C CB  . SER B  1 433 ? -27.03656 -13.79481  44.89576  1.000 46.94381  ? 413  SER A CB  1 
ATOM   6521  O OG  . SER B  1 433 ? -26.61631 -15.10909  44.63916  1.000 53.41587  ? 413  SER A OG  1 
ATOM   6522  N N   . MET B  1 434 ? -27.00550 -10.83505  45.63356  1.000 35.17029  ? 414  MET A N   1 
ATOM   6523  C CA  . MET B  1 434 ? -27.13142 -9.42800   45.27020  1.000 31.66936  ? 414  MET A CA  1 
ATOM   6524  C C   . MET B  1 434 ? -25.96002 -8.59347   45.80104  1.000 34.13662  ? 414  MET A C   1 
ATOM   6525  O O   . MET B  1 434 ? -25.41468 -7.75313   45.07354  1.000 36.23965  ? 414  MET A O   1 
ATOM   6526  C CB  . MET B  1 434 ? -28.45974 -8.88752   45.77933  1.000 28.86592  ? 414  MET A CB  1 
ATOM   6527  C CG  . MET B  1 434 ? -29.64764 -9.70536   45.36515  1.000 27.05529  ? 414  MET A CG  1 
ATOM   6528  S SD  . MET B  1 434 ? -30.96832 -9.23514   46.50033  1.000 30.55264  ? 414  MET A SD  1 
ATOM   6529  C CE  . MET B  1 434 ? -32.28230 -10.33574  45.99132  1.000 25.38982  ? 414  MET A CE  1 
ATOM   6530  N N   . ILE B  1 435 ? -25.55169 -8.80925   47.05959  1.000 29.12805  ? 415  ILE A N   1 
ATOM   6531  C CA  . ILE B  1 435 ? -24.41063 -8.06248   47.60705  1.000 31.95530  ? 415  ILE A CA  1 
ATOM   6532  C C   . ILE B  1 435 ? -23.16084 -8.27208   46.75480  1.000 33.95571  ? 415  ILE A C   1 
ATOM   6533  O O   . ILE B  1 435 ? -22.34582 -7.35841   46.58800  1.000 37.90070  ? 415  ILE A O   1 
ATOM   6534  C CB  . ILE B  1 435 ? -24.13204 -8.45934   49.06921  1.000 29.22116  ? 415  ILE A CB  1 
ATOM   6535  C CG1 . ILE B  1 435 ? -25.29555 -8.09059   50.00465  1.000 25.84428  ? 415  ILE A CG1 1 
ATOM   6536  C CG2 . ILE B  1 435 ? -22.82783 -7.81849   49.56171  1.000 31.01385  ? 415  ILE A CG2 1 
ATOM   6537  C CD1 . ILE B  1 435 ? -25.63387 -6.65411   50.00930  1.000 25.91785  ? 415  ILE A CD1 1 
ATOM   6538  N N   . ASP B  1 436 ? -22.97004 -9.48775   46.23540  1.000 38.57234  ? 416  ASP A N   1 
ATOM   6539  C CA  . ASP B  1 436 ? -21.73548 -9.81612   45.51743  1.000 37.29195  ? 416  ASP A CA  1 
ATOM   6540  C C   . ASP B  1 436 ? -21.60289 -9.05173   44.20789  1.000 39.77306  ? 416  ASP A C   1 
ATOM   6541  O O   . ASP B  1 436 ? -20.48156 -8.81533   43.74216  1.000 43.03294  ? 416  ASP A O   1 
ATOM   6542  C CB  . ASP B  1 436 ? -21.67674 -11.31354  45.25851  1.000 38.65971  ? 416  ASP A CB  1 
ATOM   6543  C CG  . ASP B  1 436 ? -21.28508 -12.11320  46.50574  1.000 47.15089  ? 416  ASP A CG  1 
ATOM   6544  O OD1 . ASP B  1 436 ? -20.81180 -11.50214  47.49267  1.000 49.89967  ? 416  ASP A OD1 1 
ATOM   6545  O OD2 . ASP B  1 436 ? -21.43549 -13.35563  46.50294  1.000 54.84228  ? 416  ASP A OD2 1 
ATOM   6546  N N   . LYS B  1 437 ? -22.71438 -8.66670   43.59562  1.000 40.95510  ? 417  LYS A N   1 
ATOM   6547  C CA  . LYS B  1 437 ? -22.68311 -7.91503   42.34931  1.000 47.41145  ? 417  LYS A CA  1 
ATOM   6548  C C   . LYS B  1 437 ? -22.43244 -6.42573   42.54585  1.000 53.34418  ? 417  LYS A C   1 
ATOM   6549  O O   . LYS B  1 437 ? -22.49890 -5.67796   41.56080  1.000 52.76163  ? 417  LYS A O   1 
ATOM   6550  C CB  . LYS B  1 437 ? -24.00363 -8.09650   41.58877  1.000 46.26808  ? 417  LYS A CB  1 
ATOM   6551  C CG  . LYS B  1 437 ? -24.40551 -9.54048   41.39025  1.000 47.06317  ? 417  LYS A CG  1 
ATOM   6552  C CD  . LYS B  1 437 ? -25.71773 -9.64245   40.64996  1.000 49.94812  ? 417  LYS A CD  1 
ATOM   6553  C CE  . LYS B  1 437 ? -25.91636 -11.03658  40.05281  1.000 52.73607  ? 417  LYS A CE  1 
ATOM   6554  N NZ  . LYS B  1 437 ? -25.91309 -12.09851  41.10527  1.000 55.20441  ? 417  LYS A NZ  1 
ATOM   6555  N N   . LEU B  1 438 ? -22.11933 -5.97507   43.75783  1.000 58.33212  ? 418  LEU A N   1 
ATOM   6556  C CA  . LEU B  1 438 ? -22.35762 -4.58122   44.11963  1.000 65.43966  ? 418  LEU A CA  1 
ATOM   6557  C C   . LEU B  1 438 ? -21.24307 -3.63511   43.68346  1.000 76.75058  ? 418  LEU A C   1 
ATOM   6558  O O   . LEU B  1 438 ? -20.05520 -3.96782   43.73409  1.000 74.57151  ? 418  LEU A O   1 
ATOM   6559  C CB  . LEU B  1 438 ? -22.56006 -4.44728   45.62625  1.000 59.26342  ? 418  LEU A CB  1 
ATOM   6560  C CG  . LEU B  1 438 ? -24.00161 -4.45144   46.13983  1.000 56.92615  ? 418  LEU A CG  1 
ATOM   6561  C CD1 . LEU B  1 438 ? -24.04667 -3.80042   47.52354  1.000 56.00720  ? 418  LEU A CD1 1 
ATOM   6562  C CD2 . LEU B  1 438 ? -24.98014 -3.77684   45.18611  1.000 55.03777  ? 418  LEU A CD2 1 
ATOM   6563  N N   . ASP B  1 439 ? -21.65964 -2.43442   43.27163  1.000 89.97831  ? 419  ASP A N   1 
ATOM   6564  C CA  . ASP B  1 439 ? -20.81019 -1.26501   43.08104  1.000 104.23887 ? 419  ASP A CA  1 
ATOM   6565  C C   . ASP B  1 439 ? -21.51843 -0.03715   43.65092  1.000 108.72138 ? 419  ASP A C   1 
ATOM   6566  O O   . ASP B  1 439 ? -21.71734 0.05447    44.86706  1.000 109.16909 ? 419  ASP A O   1 
ATOM   6567  C CB  . ASP B  1 439 ? -20.48839 -1.06576   41.60205  1.000 112.60506 ? 419  ASP A CB  1 
ATOM   6568  C CG  . ASP B  1 439 ? -19.42406 -2.00969   41.11731  1.000 119.28080 ? 419  ASP A CG  1 
ATOM   6569  O OD1 . ASP B  1 439 ? -18.55027 -2.37184   41.93566  1.000 121.94999 ? 419  ASP A OD1 1 
ATOM   6570  O OD2 . ASP B  1 439 ? -19.46585 -2.39225   39.92752  1.000 121.44660 ? 419  ASP A OD2 1 
ATOM   6571  N N   . LEU B  1 440 ? -21.91155 0.90350    42.78735  1.000 110.86143 ? 420  LEU A N   1 
ATOM   6572  C CA  . LEU B  1 440 ? -22.74718 2.04201    43.19538  1.000 108.56560 ? 420  LEU A CA  1 
ATOM   6573  C C   . LEU B  1 440 ? -24.17271 1.88981    42.65742  1.000 105.53589 ? 420  LEU A C   1 
ATOM   6574  O O   . LEU B  1 440 ? -24.58201 2.60065    41.73753  1.000 104.45301 ? 420  LEU A O   1 
ATOM   6575  C CB  . LEU B  1 440 ? -22.14665 3.37486    42.71848  1.000 109.53091 ? 420  LEU A CB  1 
ATOM   6576  C CG  . LEU B  1 440 ? -22.31602 4.59450    43.64298  1.000 107.70406 ? 420  LEU A CG  1 
ATOM   6577  C CD1 . LEU B  1 440 ? -21.34685 5.71798    43.27323  1.000 107.87066 ? 420  LEU A CD1 1 
ATOM   6578  C CD2 . LEU B  1 440 ? -23.75982 5.10702    43.65897  1.000 106.46385 ? 420  LEU A CD2 1 
ATOM   6579  N N   . VAL C  1 26  ? 1.14136   -42.55343  71.66188  1.000 58.07728  ? 6    VAL B N   1 
ATOM   6580  C CA  . VAL C  1 26  ? 0.12297   -42.46207  70.61788  1.000 58.06236  ? 6    VAL B CA  1 
ATOM   6581  C C   . VAL C  1 26  ? -1.25320  -42.15713  71.20928  1.000 58.78420  ? 6    VAL B C   1 
ATOM   6582  O O   . VAL C  1 26  ? -1.81725  -41.09219  70.93599  1.000 60.08005  ? 6    VAL B O   1 
ATOM   6583  C CB  . VAL C  1 26  ? 0.05470   -43.75045  69.76602  1.000 57.01298  ? 6    VAL B CB  1 
ATOM   6584  C CG1 . VAL C  1 26  ? -1.23145  -43.78687  68.92482  1.000 50.60468  ? 6    VAL B CG1 1 
ATOM   6585  C CG2 . VAL C  1 26  ? 1.30230   -43.87342  68.86567  1.000 58.13746  ? 6    VAL B CG2 1 
ATOM   6586  N N   . GLN C  1 27  ? -1.79255  -43.08947  72.01154  1.000 54.45742  ? 7    GLN B N   1 
ATOM   6587  C CA  . GLN C  1 27  ? -3.18861  -42.98058  72.45121  1.000 50.29504  ? 7    GLN B CA  1 
ATOM   6588  C C   . GLN C  1 27  ? -3.31076  -41.89168  73.50376  1.000 42.39058  ? 7    GLN B C   1 
ATOM   6589  O O   . GLN C  1 27  ? -2.49750  -41.83880  74.43095  1.000 42.11637  ? 7    GLN B O   1 
ATOM   6590  C CB  . GLN C  1 27  ? -3.70839  -44.30533  73.00695  1.000 51.25525  ? 7    GLN B CB  1 
ATOM   6591  C CG  . GLN C  1 27  ? -3.89514  -45.36695  71.92665  1.000 54.91065  ? 7    GLN B CG  1 
ATOM   6592  C CD  . GLN C  1 27  ? -4.28408  -46.72149  72.49199  1.000 57.63683  ? 7    GLN B CD  1 
ATOM   6593  O OE1 . GLN C  1 27  ? -3.88041  -47.76316  71.96418  1.000 60.16977  ? 7    GLN B OE1 1 
ATOM   6594  N NE2 . GLN C  1 27  ? -5.07568  -46.71583  73.56752  1.000 57.18229  ? 7    GLN B NE2 1 
ATOM   6595  N N   . PRO C  1 28  ? -4.27655  -40.99558  73.38154  1.000 35.71981  ? 8    PRO B N   1 
ATOM   6596  C CA  . PRO C  1 28  ? -4.45448  -39.98779  74.41966  1.000 31.37357  ? 8    PRO B CA  1 
ATOM   6597  C C   . PRO C  1 28  ? -4.70312  -40.67204  75.75732  1.000 30.60960  ? 8    PRO B C   1 
ATOM   6598  O O   . PRO C  1 28  ? -5.34159  -41.73029  75.84003  1.000 31.68938  ? 8    PRO B O   1 
ATOM   6599  C CB  . PRO C  1 28  ? -5.66693  -39.18620  73.92940  1.000 34.02519  ? 8    PRO B CB  1 
ATOM   6600  C CG  . PRO C  1 28  ? -6.31303  -40.02936  72.92420  1.000 32.22916  ? 8    PRO B CG  1 
ATOM   6601  C CD  . PRO C  1 28  ? -5.28580  -40.89321  72.31915  1.000 34.10938  ? 8    PRO B CD  1 
ATOM   6602  N N   . LEU C  1 29  ? -4.14948  -40.09083  76.80770  1.000 25.33156  ? 9    LEU B N   1 
ATOM   6603  C CA  . LEU C  1 29  ? -4.38339  -40.62364  78.13722  1.000 24.80428  ? 9    LEU B CA  1 
ATOM   6604  C C   . LEU C  1 29  ? -5.81980  -40.42017  78.61374  1.000 25.40201  ? 9    LEU B C   1 
ATOM   6605  O O   . LEU C  1 29  ? -6.27549  -41.17314  79.48291  1.000 23.31822  ? 9    LEU B O   1 
ATOM   6606  C CB  . LEU C  1 29  ? -3.42209  -39.98204  79.12699  1.000 24.78853  ? 9    LEU B CB  1 
ATOM   6607  C CG  . LEU C  1 29  ? -1.96093  -40.15685  78.72443  1.000 31.44746  ? 9    LEU B CG  1 
ATOM   6608  C CD1 . LEU C  1 29  ? -1.05937  -39.53218  79.75749  1.000 31.16620  ? 9    LEU B CD1 1 
ATOM   6609  C CD2 . LEU C  1 29  ? -1.64075  -41.63915  78.55523  1.000 27.39471  ? 9    LEU B CD2 1 
ATOM   6610  N N   . ALA C  1 30  ? -6.53272  -39.41568  78.09344  1.000 25.62168  ? 10   ALA B N   1 
ATOM   6611  C CA  . ALA C  1 30  ? -7.89598  -39.15965  78.55962  1.000 24.87150  ? 10   ALA B CA  1 
ATOM   6612  C C   . ALA C  1 30  ? -8.84011  -40.32570  78.29566  1.000 21.54373  ? 10   ALA B C   1 
ATOM   6613  O O   . ALA C  1 30  ? -9.85624  -40.46697  78.99708  1.000 20.40880  ? 10   ALA B O   1 
ATOM   6614  C CB  . ALA C  1 30  ? -8.45151  -37.90025  77.89264  1.000 25.91787  ? 10   ALA B CB  1 
ATOM   6615  N N   . ARG C  1 31  ? -8.54634  -41.14644  77.28716  1.000 22.31384  ? 11   ARG B N   1 
ATOM   6616  C CA  . ARG C  1 31  ? -9.33042  -42.34394  77.04982  1.000 26.47144  ? 11   ARG B CA  1 
ATOM   6617  C C   . ARG C  1 31  ? -9.32865  -43.26743  78.25237  1.000 26.47301  ? 11   ARG B C   1 
ATOM   6618  O O   . ARG C  1 31  ? -10.23809 -44.08338  78.39159  1.000 27.54904  ? 11   ARG B O   1 
ATOM   6619  C CB  . ARG C  1 31  ? -8.78162  -43.12267  75.84983  1.000 27.84836  ? 11   ARG B CB  1 
ATOM   6620  C CG  . ARG C  1 31  ? -9.07268  -42.55437  74.50045  1.000 24.34922  ? 11   ARG B CG  1 
ATOM   6621  C CD  . ARG C  1 31  ? -8.76372  -43.62269  73.45735  1.000 26.16778  ? 11   ARG B CD  1 
ATOM   6622  N NE  . ARG C  1 31  ? -8.54136  -43.09937  72.11733  1.000 29.21800  ? 11   ARG B NE  1 
ATOM   6623  C CZ  . ARG C  1 31  ? -7.98050  -43.80975  71.15104  1.000 29.49094  ? 11   ARG B CZ  1 
ATOM   6624  N NH1 . ARG C  1 31  ? -7.59660  -45.05882  71.39962  1.000 32.17698  ? 11   ARG B NH1 1 
ATOM   6625  N NH2 . ARG C  1 31  ? -7.80166  -43.28908  69.94123  1.000 30.42639  ? 11   ARG B NH2 1 
ATOM   6626  N N   . ASP C  1 32  ? -8.30663  -43.19420  79.09681  1.000 25.89616  ? 12   ASP B N   1 
ATOM   6627  C CA  . ASP C  1 32  ? -8.19622  -44.09936  80.22793  1.000 28.29733  ? 12   ASP B CA  1 
ATOM   6628  C C   . ASP C  1 32  ? -8.36778  -43.38795  81.56647  1.000 24.76099  ? 12   ASP B C   1 
ATOM   6629  O O   . ASP C  1 32  ? -7.96564  -43.92231  82.59878  1.000 22.03090  ? 12   ASP B O   1 
ATOM   6630  C CB  . ASP C  1 32  ? -6.86459  -44.82379  80.15917  1.000 35.65365  ? 12   ASP B CB  1 
ATOM   6631  C CG  . ASP C  1 32  ? -6.78179  -45.71390  78.95071  1.000 44.28597  ? 12   ASP B CG  1 
ATOM   6632  O OD1 . ASP C  1 32  ? -7.72114  -46.52318  78.76884  1.000 44.27970  ? 12   ASP B OD1 1 
ATOM   6633  O OD2 . ASP C  1 32  ? -5.81336  -45.58502  78.17181  1.000 47.36911  ? 12   ASP B OD2 1 
ATOM   6634  N N   . ALA C  1 33  ? -9.01932  -42.22922  81.56694  1.000 23.40049  ? 13   ALA B N   1 
ATOM   6635  C CA  . ALA C  1 33  ? -9.17773  -41.40456  82.75109  1.000 20.83758  ? 13   ALA B CA  1 
ATOM   6636  C C   . ALA C  1 33  ? -10.64144 -41.30853  83.15774  1.000 21.34335  ? 13   ALA B C   1 
ATOM   6637  O O   . ALA C  1 33  ? -11.55302 -41.43039  82.32763  1.000 23.04681  ? 13   ALA B O   1 
ATOM   6638  C CB  . ALA C  1 33  ? -8.59879  -40.00373  82.50102  1.000 22.51032  ? 13   ALA B CB  1 
ATOM   6639  N N   . MET C  1 34  ? -10.86892 -41.11761  84.45706  1.000 18.53806  ? 14   MET B N   1 
ATOM   6640  C CA  . MET C  1 34  ? -12.17141 -40.74140  84.96793  1.000 17.67190  ? 14   MET B CA  1 
ATOM   6641  C C   . MET C  1 34  ? -12.01851 -39.46861  85.78464  1.000 21.18203  ? 14   MET B C   1 
ATOM   6642  O O   . MET C  1 34  ? -11.11095 -39.36015  86.62023  1.000 20.74450  ? 14   MET B O   1 
ATOM   6643  C CB  . MET C  1 34  ? -12.81447 -41.86200  85.78934  1.000 23.98856  ? 14   MET B CB  1 
ATOM   6644  C CG  . MET C  1 34  ? -14.02412 -41.45634  86.63907  1.000 24.51482  ? 14   MET B CG  1 
ATOM   6645  S SD  . MET C  1 34  ? -14.45950 -42.78258  87.76551  1.000 26.09945  ? 14   MET B SD  1 
ATOM   6646  C CE  . MET C  1 34  ? -16.24261 -42.69771  87.94932  1.000 28.71902  ? 14   MET B CE  1 
ATOM   6647  N N   . ALA C  1 35  ? -12.84126 -38.49029  85.45089  1.000 19.05776  ? 15   ALA B N   1 
ATOM   6648  C CA  . ALA C  1 35  ? -12.92305 -37.25202  86.21366  1.000 18.86565  ? 15   ALA B CA  1 
ATOM   6649  C C   . ALA C  1 35  ? -13.85735 -37.45078  87.39405  1.000 19.80731  ? 15   ALA B C   1 
ATOM   6650  O O   . ALA C  1 35  ? -14.93762 -38.04364  87.26775  1.000 19.12909  ? 15   ALA B O   1 
ATOM   6651  C CB  . ALA C  1 35  ? -13.43541 -36.12076  85.31777  1.000 18.79207  ? 15   ALA B CB  1 
ATOM   6652  N N   . TYR C  1 36  ? -13.44401 -36.96052  88.56259  1.000 17.23539  ? 16   TYR B N   1 
ATOM   6653  C CA  . TYR C  1 36  ? -14.24387 -37.08675  89.77545  1.000 16.22525  ? 16   TYR B CA  1 
ATOM   6654  C C   . TYR C  1 36  ? -14.38571 -35.70579  90.40552  1.000 17.97959  ? 16   TYR B C   1 
ATOM   6655  O O   . TYR C  1 36  ? -13.40960 -35.16423  90.92991  1.000 19.95376  ? 16   TYR B O   1 
ATOM   6656  C CB  . TYR C  1 36  ? -13.61857 -38.07349  90.74341  1.000 17.05388  ? 16   TYR B CB  1 
ATOM   6657  C CG  . TYR C  1 36  ? -14.60460 -38.62010  91.72343  1.000 21.54978  ? 16   TYR B CG  1 
ATOM   6658  C CD1 . TYR C  1 36  ? -14.90335 -37.92811  92.89820  1.000 26.23532  ? 16   TYR B CD1 1 
ATOM   6659  C CD2 . TYR C  1 36  ? -15.22700 -39.83526  91.49616  1.000 28.05985  ? 16   TYR B CD2 1 
ATOM   6660  C CE1 . TYR C  1 36  ? -15.81000 -38.43669  93.80683  1.000 25.48852  ? 16   TYR B CE1 1 
ATOM   6661  C CE2 . TYR C  1 36  ? -16.14271 -40.35303  92.40334  1.000 30.58032  ? 16   TYR B CE2 1 
ATOM   6662  C CZ  . TYR C  1 36  ? -16.42602 -39.64788  93.55844  1.000 29.20209  ? 16   TYR B CZ  1 
ATOM   6663  O OH  . TYR C  1 36  ? -17.34236 -40.17461  94.45305  1.000 28.50494  ? 16   TYR B OH  1 
ATOM   6664  N N   . VAL C  1 37  ? -15.58785 -35.13441  90.33382  1.000 19.96424  ? 17   VAL B N   1 
ATOM   6665  C CA  . VAL C  1 37  ? -15.82887 -33.73862  90.70951  1.000 19.09019  ? 17   VAL B CA  1 
ATOM   6666  C C   . VAL C  1 37  ? -16.37793 -33.68458  92.12285  1.000 19.85100  ? 17   VAL B C   1 
ATOM   6667  O O   . VAL C  1 37  ? -17.43954 -34.24988  92.41966  1.000 18.70659  ? 17   VAL B O   1 
ATOM   6668  C CB  . VAL C  1 37  ? -16.79440 -33.04912  89.73202  1.000 19.05256  ? 17   VAL B CB  1 
ATOM   6669  C CG1 . VAL C  1 37  ? -16.92955 -31.58222  90.08870  1.000 20.11823  ? 17   VAL B CG1 1 
ATOM   6670  C CG2 . VAL C  1 37  ? -16.31957 -33.22629  88.33974  1.000 14.82854  ? 17   VAL B CG2 1 
ATOM   6671  N N   . LEU C  1 38  ? -15.69330 -32.93023  92.98218  1.000 18.75616  ? 18   LEU B N   1 
ATOM   6672  C CA  . LEU C  1 38  ? -16.15349 -32.66933  94.33560  1.000 22.95817  ? 18   LEU B CA  1 
ATOM   6673  C C   . LEU C  1 38  ? -17.06380 -31.44490  94.27656  1.000 25.97714  ? 18   LEU B C   1 
ATOM   6674  O O   . LEU C  1 38  ? -16.60523 -30.33435  93.98578  1.000 25.03751  ? 18   LEU B O   1 
ATOM   6675  C CB  . LEU C  1 38  ? -14.97007 -32.43705  95.27761  1.000 23.98061  ? 18   LEU B CB  1 
ATOM   6676  C CG  . LEU C  1 38  ? -13.86260 -33.50193  95.19453  1.000 28.34950  ? 18   LEU B CG  1 
ATOM   6677  C CD1 . LEU C  1 38  ? -12.61087 -33.08601  95.98963  1.000 28.16606  ? 18   LEU B CD1 1 
ATOM   6678  C CD2 . LEU C  1 38  ? -14.40694 -34.79719  95.71697  1.000 29.26983  ? 18   LEU B CD2 1 
ATOM   6679  N N   . ALA C  1 39  ? -18.35390 -31.65613  94.53758  1.000 21.77676  ? 19   ALA B N   1 
ATOM   6680  C CA  . ALA C  1 39  ? -19.36933 -30.62612  94.41689  1.000 22.89840  ? 19   ALA B CA  1 
ATOM   6681  C C   . ALA C  1 39  ? -20.18291 -30.51011  95.69811  1.000 22.49639  ? 19   ALA B C   1 
ATOM   6682  O O   . ALA C  1 39  ? -21.38582 -30.25864  95.66225  1.000 23.04921  ? 19   ALA B O   1 
ATOM   6683  C CB  . ALA C  1 39  ? -20.26657 -30.91314  93.21065  1.000 24.11002  ? 19   ALA B CB  1 
ATOM   6684  N N   . GLY C  1 40  ? -19.56311 -30.73722  96.84334  1.000 21.72928  ? 20   GLY B N   1 
ATOM   6685  C CA  . GLY C  1 40  ? -20.30249 -30.66320  98.08565  1.000 26.78256  ? 20   GLY B CA  1 
ATOM   6686  C C   . GLY C  1 40  ? -20.11225 -29.36176  98.81307  1.000 31.18628  ? 20   GLY B C   1 
ATOM   6687  O O   . GLY C  1 40  ? -20.66285 -29.18085  99.90585  1.000 35.32564  ? 20   GLY B O   1 
ATOM   6688  N N   . GLY C  1 41  ? -19.34239 -28.44209  98.24148  1.000 32.66668  ? 21   GLY B N   1 
ATOM   6689  C CA  . GLY C  1 41  ? -18.98078 -27.23749  98.96887  1.000 30.23866  ? 21   GLY B CA  1 
ATOM   6690  C C   . GLY C  1 41  ? -20.16627 -26.30900  99.13966  1.000 31.00144  ? 21   GLY B C   1 
ATOM   6691  O O   . GLY C  1 41  ? -20.97130 -26.11024  98.22637  1.000 30.63307  ? 21   GLY B O   1 
ATOM   6692  N N   . ARG C  1 42  ? -20.25022 -25.69963  100.32078 1.000 35.96147  ? 22   ARG B N   1 
ATOM   6693  C CA  . ARG C  1 42  ? -21.42243 -24.90137  100.65440 1.000 38.13182  ? 22   ARG B CA  1 
ATOM   6694  C C   . ARG C  1 42  ? -21.35029 -23.49917  100.07343 1.000 38.14086  ? 22   ARG B C   1 
ATOM   6695  O O   . ARG C  1 42  ? -22.38611 -22.91554  99.76416  1.000 43.48925  ? 22   ARG B O   1 
ATOM   6696  C CB  . ARG C  1 42  ? -21.59165 -24.80879  102.17284 1.000 42.29269  ? 22   ARG B CB  1 
ATOM   6697  N N   . GLY C  1 43  ? -20.16110 -22.93558  99.92319  1.000 35.52019  ? 23   GLY B N   1 
ATOM   6698  C CA  . GLY C  1 43  ? -20.09618 -21.54775  99.50465  1.000 34.67361  ? 23   GLY B CA  1 
ATOM   6699  C C   . GLY C  1 43  ? -20.61038 -20.64573  100.60519 1.000 33.10131  ? 23   GLY B C   1 
ATOM   6700  O O   . GLY C  1 43  ? -21.46097 -19.78199  100.36698 1.000 33.61265  ? 23   GLY B O   1 
ATOM   6701  N N   . SER C  1 44  ? -20.06754 -20.83109  101.81113 1.000 33.16975  ? 24   SER B N   1 
ATOM   6702  C CA  . SER C  1 44  ? -20.62300 -20.19406  103.00649 1.000 37.01909  ? 24   SER B CA  1 
ATOM   6703  C C   . SER C  1 44  ? -20.61235 -18.67938  102.90608 1.000 30.77167  ? 24   SER B C   1 
ATOM   6704  O O   . SER C  1 44  ? -21.53433 -18.01416  103.39203 1.000 32.94194  ? 24   SER B O   1 
ATOM   6705  C CB  . SER C  1 44  ? -19.84254 -20.63024  104.25976 1.000 42.31918  ? 24   SER B CB  1 
ATOM   6706  O OG  . SER C  1 44  ? -20.29927 -21.88360  104.72675 1.000 46.62507  ? 24   SER B OG  1 
ATOM   6707  N N   . ARG C  1 45  ? -19.56618 -18.11193  102.31540 1.000 29.70820  ? 25   ARG B N   1 
ATOM   6708  C CA  . ARG C  1 45  ? -19.48144 -16.66103  102.22483 1.000 32.78847  ? 25   ARG B CA  1 
ATOM   6709  C C   . ARG C  1 45  ? -20.34462 -16.07415  101.11286 1.000 33.08535  ? 25   ARG B C   1 
ATOM   6710  O O   . ARG C  1 45  ? -20.43634 -14.84321  101.00052 1.000 28.79225  ? 25   ARG B O   1 
ATOM   6711  C CB  . ARG C  1 45  ? -18.02344 -16.23376  102.06043 1.000 35.33248  ? 25   ARG B CB  1 
ATOM   6712  C CG  . ARG C  1 45  ? -17.20363 -16.41782  103.35453 1.000 42.25634  ? 25   ARG B CG  1 
ATOM   6713  C CD  . ARG C  1 45  ? -15.75559 -15.99847  103.15957 1.000 46.36484  ? 25   ARG B CD  1 
ATOM   6714  N NE  . ARG C  1 45  ? -15.18330 -16.66060  101.98958 1.000 51.34727  ? 25   ARG B NE  1 
ATOM   6715  C CZ  . ARG C  1 45  ? -14.26212 -16.11545  101.20170 1.000 53.40268  ? 25   ARG B CZ  1 
ATOM   6716  N NH1 . ARG C  1 45  ? -13.79534 -14.89766  101.47498 1.000 55.72568  ? 25   ARG B NH1 1 
ATOM   6717  N NH2 . ARG C  1 45  ? -13.80726 -16.79002  100.14830 1.000 50.29981  ? 25   ARG B NH2 1 
ATOM   6718  N N   . LEU C  1 46  ? -20.99209 -16.90986  100.29665 1.000 32.64153  ? 26   LEU B N   1 
ATOM   6719  C CA  . LEU C  1 46  ? -22.01133 -16.39762  99.39280  1.000 31.67308  ? 26   LEU B CA  1 
ATOM   6720  C C   . LEU C  1 46  ? -23.34874 -16.15317  100.09683 1.000 30.71906  ? 26   LEU B C   1 
ATOM   6721  O O   . LEU C  1 46  ? -24.29268 -15.67286  99.45987  1.000 29.84706  ? 26   LEU B O   1 
ATOM   6722  C CB  . LEU C  1 46  ? -22.16701 -17.36462  98.21414  1.000 29.14876  ? 26   LEU B CB  1 
ATOM   6723  C CG  . LEU C  1 46  ? -20.90494 -17.38557  97.34205  1.000 23.97550  ? 26   LEU B CG  1 
ATOM   6724  C CD1 . LEU C  1 46  ? -20.92287 -18.52536  96.30013  1.000 24.77317  ? 26   LEU B CD1 1 
ATOM   6725  C CD2 . LEU C  1 46  ? -20.76937 -16.01946  96.67653  1.000 25.80830  ? 26   LEU B CD2 1 
ATOM   6726  N N   . LYS C  1 47  ? -23.44731 -16.47221  101.39054 1.000 29.39579  ? 27   LYS B N   1 
ATOM   6727  C CA  . LYS C  1 47  ? -24.56691 -16.06443  102.24346 1.000 32.27193  ? 27   LYS B CA  1 
ATOM   6728  C C   . LYS C  1 47  ? -25.87927 -16.62207  101.68969 1.000 30.91855  ? 27   LYS B C   1 
ATOM   6729  O O   . LYS C  1 47  ? -25.93853 -17.81123  101.32658 1.000 31.79764  ? 27   LYS B O   1 
ATOM   6730  C CB  . LYS C  1 47  ? -24.49827 -14.55111  102.38519 1.000 35.46718  ? 27   LYS B CB  1 
ATOM   6731  C CG  . LYS C  1 47  ? -23.16626 -14.03084  102.97643 1.000 39.17061  ? 27   LYS B CG  1 
ATOM   6732  C CD  . LYS C  1 47  ? -22.79282 -14.74940  104.26424 1.000 41.67472  ? 27   LYS B CD  1 
ATOM   6733  C CE  . LYS C  1 47  ? -22.16264 -13.80907  105.28691 1.000 48.28532  ? 27   LYS B CE  1 
ATOM   6734  N NZ  . LYS C  1 47  ? -20.86362 -13.21692  104.84906 1.000 49.14978  ? 27   LYS B NZ  1 
ATOM   6735  N N   . GLU C  1 48  ? -26.95650 -15.82746  101.62080 1.000 24.52123  ? 28   GLU B N   1 
ATOM   6736  C CA  . GLU C  1 48  ? -28.25042 -16.38284  101.23577 1.000 22.99344  ? 28   GLU B CA  1 
ATOM   6737  C C   . GLU C  1 48  ? -28.23986 -16.92724  99.81168  1.000 25.26488  ? 28   GLU B C   1 
ATOM   6738  O O   . GLU C  1 48  ? -29.07980 -17.76844  99.46863  1.000 24.09889  ? 28   GLU B O   1 
ATOM   6739  C CB  . GLU C  1 48  ? -29.32499 -15.29903  101.40580 1.000 24.05973  ? 28   GLU B CB  1 
ATOM   6740  C CG  . GLU C  1 48  ? -29.50009 -14.82942  102.86821 1.000 31.19014  ? 28   GLU B CG  1 
ATOM   6741  C CD  . GLU C  1 48  ? -28.54935 -13.70346  103.27305 1.000 34.09717  ? 28   GLU B CD  1 
ATOM   6742  O OE1 . GLU C  1 48  ? -27.63056 -13.38443  102.49432 1.000 33.11326  ? 28   GLU B OE1 1 
ATOM   6743  O OE2 . GLU C  1 48  ? -28.72025 -13.13588  104.38611 1.000 36.01919  ? 28   GLU B OE2 1 
ATOM   6744  N N   . LEU C  1 49  ? -27.29204 -16.48839  98.97940  1.000 25.12637  ? 29   LEU B N   1 
ATOM   6745  C CA  . LEU C  1 49  ? -27.18442 -17.05113  97.63532  1.000 23.95167  ? 29   LEU B CA  1 
ATOM   6746  C C   . LEU C  1 49  ? -27.01390 -18.57266  97.66497  1.000 30.02078  ? 29   LEU B C   1 
ATOM   6747  O O   . LEU C  1 49  ? -27.46137 -19.26006  96.73911  1.000 27.70128  ? 29   LEU B O   1 
ATOM   6748  C CB  . LEU C  1 49  ? -26.03632 -16.37326  96.89085  1.000 24.90870  ? 29   LEU B CB  1 
ATOM   6749  C CG  . LEU C  1 49  ? -25.96536 -16.44323  95.36758  1.000 29.08832  ? 29   LEU B CG  1 
ATOM   6750  C CD1 . LEU C  1 49  ? -27.23479 -15.92988  94.69785  1.000 23.92228  ? 29   LEU B CD1 1 
ATOM   6751  C CD2 . LEU C  1 49  ? -24.75924 -15.62087  94.97003  1.000 33.19192  ? 29   LEU B CD2 1 
ATOM   6752  N N   . THR C  1 50  ? -26.43528 -19.13448  98.73612  1.000 29.58171  ? 30   THR B N   1 
ATOM   6753  C CA  . THR C  1 50  ? -26.28315 -20.58750  98.82539  1.000 29.23725  ? 30   THR B CA  1 
ATOM   6754  C C   . THR C  1 50  ? -27.05707 -21.19231  99.98591  1.000 32.08267  ? 30   THR B C   1 
ATOM   6755  O O   . THR C  1 50  ? -26.73205 -22.30368  100.42519 1.000 32.12799  ? 30   THR B O   1 
ATOM   6756  C CB  . THR C  1 50  ? -24.81712 -21.00419  98.93360  1.000 27.59417  ? 30   THR B CB  1 
ATOM   6757  O OG1 . THR C  1 50  ? -24.14504 -20.21457  99.92121  1.000 26.15875  ? 30   THR B OG1 1 
ATOM   6758  C CG2 . THR C  1 50  ? -24.13020 -20.81244  97.58127  1.000 30.00202  ? 30   THR B CG2 1 
ATOM   6759  N N   . ASP C  1 51  ? -28.08503 -20.49678  100.48156 1.000 31.64380  ? 31   ASP B N   1 
ATOM   6760  C CA  . ASP C  1 51  ? -28.89232 -21.05394  101.56327 1.000 35.65282  ? 31   ASP B CA  1 
ATOM   6761  C C   . ASP C  1 51  ? -29.69750 -22.25165  101.08509 1.000 38.46766  ? 31   ASP B C   1 
ATOM   6762  O O   . ASP C  1 51  ? -29.92041 -23.19328  101.85266 1.000 38.58864  ? 31   ASP B O   1 
ATOM   6763  C CB  . ASP C  1 51  ? -29.81464 -19.97694  102.14390 1.000 37.10834  ? 31   ASP B CB  1 
ATOM   6764  C CG  . ASP C  1 51  ? -29.12879 -19.13142  103.22036 1.000 39.74205  ? 31   ASP B CG  1 
ATOM   6765  O OD1 . ASP C  1 51  ? -28.03684 -19.53265  103.70899 1.000 39.27544  ? 31   ASP B OD1 1 
ATOM   6766  O OD2 . ASP C  1 51  ? -29.68091 -18.06295  103.57688 1.000 37.84601  ? 31   ASP B OD2 1 
ATOM   6767  N N   . ARG C  1 52  ? -30.09142 -22.25892  99.80962  1.000 36.85178  ? 32   ARG B N   1 
ATOM   6768  C CA  . ARG C  1 52  ? -30.94686 -23.29832  99.26364  1.000 40.51393  ? 32   ARG B CA  1 
ATOM   6769  C C   . ARG C  1 52  ? -30.26839 -24.12057  98.16698  1.000 39.07460  ? 32   ARG B C   1 
ATOM   6770  O O   . ARG C  1 52  ? -30.94534 -24.91076  97.49785  1.000 39.85321  ? 32   ARG B O   1 
ATOM   6771  C CB  . ARG C  1 52  ? -32.23621 -22.66192  98.72669  1.000 47.62711  ? 32   ARG B CB  1 
ATOM   6772  C CG  . ARG C  1 52  ? -33.25833 -22.26139  99.81839  1.000 57.30388  ? 32   ARG B CG  1 
ATOM   6773  C CD  . ARG C  1 52  ? -33.30246 -23.31060  100.93623 1.000 64.93633  ? 32   ARG B CD  1 
ATOM   6774  N NE  . ARG C  1 52  ? -33.56496 -24.66059  100.42060 1.000 71.66250  ? 32   ARG B NE  1 
ATOM   6775  C CZ  . ARG C  1 52  ? -33.82679 -25.71900  101.18929 1.000 73.92330  ? 32   ARG B CZ  1 
ATOM   6776  N NH1 . ARG C  1 52  ? -33.86643 -25.60358  102.52173 1.000 76.81904  ? 32   ARG B NH1 1 
ATOM   6777  N NH2 . ARG C  1 52  ? -34.03931 -26.90425  100.62605 1.000 73.16442  ? 32   ARG B NH2 1 
ATOM   6778  N N   . ARG C  1 53  ? -28.96418 -23.94537  97.94417  1.000 31.79594  ? 33   ARG B N   1 
ATOM   6779  C CA  . ARG C  1 53  ? -28.26838 -24.68797  96.90250  1.000 26.64556  ? 33   ARG B CA  1 
ATOM   6780  C C   . ARG C  1 53  ? -26.77606 -24.66881  97.19892  1.000 27.30381  ? 33   ARG B C   1 
ATOM   6781  O O   . ARG C  1 53  ? -26.24180 -23.66742  97.68872  1.000 26.90034  ? 33   ARG B O   1 
ATOM   6782  C CB  . ARG C  1 53  ? -28.53384 -24.08718  95.51629  1.000 22.82495  ? 33   ARG B CB  1 
ATOM   6783  C CG  . ARG C  1 53  ? -28.00898 -22.65033  95.41453  1.000 27.36540  ? 33   ARG B CG  1 
ATOM   6784  C CD  . ARG C  1 53  ? -28.25448 -22.04367  94.05441  1.000 30.28263  ? 33   ARG B CD  1 
ATOM   6785  N NE  . ARG C  1 53  ? -29.63833 -21.60179  93.85004  1.000 39.63506  ? 33   ARG B NE  1 
ATOM   6786  C CZ  . ARG C  1 53  ? -30.08661 -20.36164  94.04348  1.000 41.67692  ? 33   ARG B CZ  1 
ATOM   6787  N NH1 . ARG C  1 53  ? -29.27450 -19.39679  94.47467  1.000 40.25643  ? 33   ARG B NH1 1 
ATOM   6788  N NH2 . ARG C  1 53  ? -31.35841 -20.08559  93.79375  1.000 41.17741  ? 33   ARG B NH2 1 
ATOM   6789  N N   . ALA C  1 54  ? -26.10471 -25.77601  96.90256  1.000 25.65370  ? 34   ALA B N   1 
ATOM   6790  C CA  . ALA C  1 54  ? -24.65539 -25.78492  97.05377  1.000 26.60303  ? 34   ALA B CA  1 
ATOM   6791  C C   . ALA C  1 54  ? -24.00770 -24.86962  96.00813  1.000 21.27138  ? 34   ALA B C   1 
ATOM   6792  O O   . ALA C  1 54  ? -24.58136 -24.54475  94.96897  1.000 20.72864  ? 34   ALA B O   1 
ATOM   6793  C CB  . ALA C  1 54  ? -24.11528 -27.21364  96.94559  1.000 25.14443  ? 34   ALA B CB  1 
ATOM   6794  N N   . LYS C  1 55  ? -22.81146 -24.39948  96.32493  1.000 18.01280  ? 35   LYS B N   1 
ATOM   6795  C CA  . LYS C  1 55  ? -22.16762 -23.43077  95.44409  1.000 18.27915  ? 35   LYS B CA  1 
ATOM   6796  C C   . LYS C  1 55  ? -21.99493 -23.91873  94.00243  1.000 19.17625  ? 35   LYS B C   1 
ATOM   6797  O O   . LYS C  1 55  ? -22.12433 -23.08994  93.08331  1.000 16.54866  ? 35   LYS B O   1 
ATOM   6798  C CB  . LYS C  1 55  ? -20.82403 -23.02195  96.04999  1.000 16.15335  ? 35   LYS B CB  1 
ATOM   6799  C CG  . LYS C  1 55  ? -19.96712 -22.13724  95.13980  1.000 16.09035  ? 35   LYS B CG  1 
ATOM   6800  C CD  . LYS C  1 55  ? -18.67473 -21.75527  95.85696  1.000 20.68161  ? 35   LYS B CD  1 
ATOM   6801  C CE  . LYS C  1 55  ? -17.82996 -20.91185  94.92883  1.000 22.98065  ? 35   LYS B CE  1 
ATOM   6802  N NZ  . LYS C  1 55  ? -16.40027 -20.92784  95.33850  1.000 23.04443  ? 35   LYS B NZ  1 
ATOM   6803  N N   . PRO C  1 56  ? -21.68887 -25.18799  93.71598  1.000 17.62243  ? 36   PRO B N   1 
ATOM   6804  C CA  . PRO C  1 56  ? -21.55734 -25.56692  92.29985  1.000 17.08396  ? 36   PRO B CA  1 
ATOM   6805  C C   . PRO C  1 56  ? -22.84549 -25.39129  91.52628  1.000 19.13536  ? 36   PRO B C   1 
ATOM   6806  O O   . PRO C  1 56  ? -22.80108 -25.31191  90.28814  1.000 18.90460  ? 36   PRO B O   1 
ATOM   6807  C CB  . PRO C  1 56  ? -21.10610 -27.03475  92.35339  1.000 17.57403  ? 36   PRO B CB  1 
ATOM   6808  C CG  . PRO C  1 56  ? -20.41322 -27.15616  93.66874  1.000 19.05661  ? 36   PRO B CG  1 
ATOM   6809  C CD  . PRO C  1 56  ? -21.20035 -26.25262  94.61680  1.000 19.64753  ? 36   PRO B CD  1 
ATOM   6810  N N   . ALA C  1 57  ? -23.99491 -25.30266  92.21168  1.000 14.64556  ? 37   ALA B N   1 
ATOM   6811  C CA  . ALA C  1 57  ? -25.26348 -25.13516  91.51671  1.000 14.86567  ? 37   ALA B CA  1 
ATOM   6812  C C   . ALA C  1 57  ? -25.53804 -23.67819  91.18694  1.000 16.42654  ? 37   ALA B C   1 
ATOM   6813  O O   . ALA C  1 57  ? -26.50664 -23.38186  90.47782  1.000 18.24141  ? 37   ALA B O   1 
ATOM   6814  C CB  . ALA C  1 57  ? -26.40477 -25.72193  92.36053  1.000 14.32422  ? 37   ALA B CB  1 
ATOM   6815  N N   . VAL C  1 58  ? -24.71027 -22.75944  91.67546  1.000 20.42220  ? 38   VAL B N   1 
ATOM   6816  C CA  . VAL C  1 58  ? -25.00788 -21.33543  91.50903  1.000 19.09172  ? 38   VAL B CA  1 
ATOM   6817  C C   . VAL C  1 58  ? -24.86623 -20.95755  90.04082  1.000 16.50977  ? 38   VAL B C   1 
ATOM   6818  O O   . VAL C  1 58  ? -23.90217 -21.34864  89.37118  1.000 16.42068  ? 38   VAL B O   1 
ATOM   6819  C CB  . VAL C  1 58  ? -24.08434 -20.47886  92.39260  1.000 18.09637  ? 38   VAL B CB  1 
ATOM   6820  C CG1 . VAL C  1 58  ? -24.18218 -18.99647  91.98625  1.000 19.10541  ? 38   VAL B CG1 1 
ATOM   6821  C CG2 . VAL C  1 58  ? -24.44345 -20.67032  93.87406  1.000 19.90815  ? 38   VAL B CG2 1 
ATOM   6822  N N   . TYR C  1 59  ? -25.84830 -20.20977  89.53283  1.000 15.36159  ? 39   TYR B N   1 
ATOM   6823  C CA  . TYR C  1 59  ? -25.83551 -19.71872  88.16727  1.000 17.33311  ? 39   TYR B CA  1 
ATOM   6824  C C   . TYR C  1 59  ? -24.67919 -18.75153  87.94157  1.000 20.86179  ? 39   TYR B C   1 
ATOM   6825  O O   . TYR C  1 59  ? -24.32842 -17.95904  88.82576  1.000 19.68987  ? 39   TYR B O   1 
ATOM   6826  C CB  . TYR C  1 59  ? -27.14032 -19.01627  87.88043  1.000 21.73785  ? 39   TYR B CB  1 
ATOM   6827  C CG  . TYR C  1 59  ? -28.25584 -19.96948  87.54583  1.000 28.40067  ? 39   TYR B CG  1 
ATOM   6828  C CD1 . TYR C  1 59  ? -28.26749 -20.60286  86.31391  1.000 35.06148  ? 39   TYR B CD1 1 
ATOM   6829  C CD2 . TYR C  1 59  ? -29.28999 -20.22349  88.43478  1.000 31.27708  ? 39   TYR B CD2 1 
ATOM   6830  C CE1 . TYR C  1 59  ? -29.27225 -21.47616  85.96006  1.000 37.78685  ? 39   TYR B CE1 1 
ATOM   6831  C CE2 . TYR C  1 59  ? -30.31713 -21.11762  88.08975  1.000 34.69845  ? 39   TYR B CE2 1 
ATOM   6832  C CZ  . TYR C  1 59  ? -30.29500 -21.73407  86.83693  1.000 37.75623  ? 39   TYR B CZ  1 
ATOM   6833  O OH  . TYR C  1 59  ? -31.27522 -22.62389  86.41517  1.000 39.90271  ? 39   TYR B OH  1 
ATOM   6834  N N   . PHE C  1 60  ? -24.10641 -18.79346  86.73444  1.000 17.01634  ? 40   PHE B N   1 
ATOM   6835  C CA  . PHE C  1 60  ? -23.01180 -17.87686  86.40473  1.000 19.46777  ? 40   PHE B CA  1 
ATOM   6836  C C   . PHE C  1 60  ? -22.97316 -17.56276  84.91672  1.000 24.97882  ? 40   PHE B C   1 
ATOM   6837  O O   . PHE C  1 60  ? -23.06130 -18.46833  84.08440  1.000 22.61203  ? 40   PHE B O   1 
ATOM   6838  C CB  . PHE C  1 60  ? -21.64707 -18.43736  86.80277  1.000 20.48123  ? 40   PHE B CB  1 
ATOM   6839  C CG  . PHE C  1 60  ? -20.51286 -17.52122  86.39967  1.000 23.52803  ? 40   PHE B CG  1 
ATOM   6840  C CD1 . PHE C  1 60  ? -20.13443 -16.47567  87.22939  1.000 26.26440  ? 40   PHE B CD1 1 
ATOM   6841  C CD2 . PHE C  1 60  ? -19.90044 -17.63456  85.14821  1.000 21.70689  ? 40   PHE B CD2 1 
ATOM   6842  C CE1 . PHE C  1 60  ? -19.13005 -15.60486  86.84755  1.000 26.35211  ? 40   PHE B CE1 1 
ATOM   6843  C CE2 . PHE C  1 60  ? -18.87571 -16.76592  84.77000  1.000 24.60455  ? 40   PHE B CE2 1 
ATOM   6844  C CZ  . PHE C  1 60  ? -18.50150 -15.74601  85.61882  1.000 25.07653  ? 40   PHE B CZ  1 
ATOM   6845  N N   . GLY C  1 61  ? -22.79588 -16.28330  84.58793  1.000 25.08823  ? 41   GLY B N   1 
ATOM   6846  C CA  . GLY C  1 61  ? -22.45102 -15.86202  83.24088  1.000 22.39579  ? 41   GLY B CA  1 
ATOM   6847  C C   . GLY C  1 61  ? -23.58189 -15.76401  82.24384  1.000 23.62982  ? 41   GLY B C   1 
ATOM   6848  O O   . GLY C  1 61  ? -23.32497 -15.50280  81.06351  1.000 24.63928  ? 41   GLY B O   1 
ATOM   6849  N N   A GLY C  1 62  ? -24.82439 -16.00364  82.66474  0.438 18.49574  ? 42   GLY B N   1 
ATOM   6850  N N   B GLY C  1 62  ? -24.82675 -15.90488  82.67005  0.562 17.83280  ? 42   GLY B N   1 
ATOM   6851  C CA  A GLY C  1 62  ? -25.90512 -16.21146  81.71949  0.438 20.70744  ? 42   GLY B CA  1 
ATOM   6852  C CA  B GLY C  1 62  ? -25.95701 -15.73714  81.79061  0.562 20.45791  ? 42   GLY B CA  1 
ATOM   6853  C C   A GLY C  1 62  ? -25.54172 -17.36722  80.81296  0.438 19.60767  ? 42   GLY B C   1 
ATOM   6854  C C   B GLY C  1 62  ? -26.73150 -17.00518  81.54172  0.562 19.39841  ? 42   GLY B C   1 
ATOM   6855  O O   A GLY C  1 62  ? -26.09523 -17.52517  79.71726  0.438 20.40472  ? 42   GLY B O   1 
ATOM   6856  O O   B GLY C  1 62  ? -27.92622 -16.92516  81.22582  0.562 21.31629  ? 42   GLY B O   1 
ATOM   6857  N N   A LYS C  1 63  ? -24.57839 -18.16890  81.27274  0.438 20.52363  ? 43   LYS B N   1 
ATOM   6858  N N   B LYS C  1 63  ? -26.10753 -18.17657  81.72748  0.562 19.56068  ? 43   LYS B N   1 
ATOM   6859  C CA  A LYS C  1 63  ? -23.92184 -19.19450  80.47414  0.438 22.62992  ? 43   LYS B CA  1 
ATOM   6860  C CA  B LYS C  1 63  ? -26.79607 -19.42489  81.41253  0.562 19.41245  ? 43   LYS B CA  1 
ATOM   6861  C C   A LYS C  1 63  ? -24.15118 -20.59786  81.01192  0.438 21.09402  ? 43   LYS B C   1 
ATOM   6862  C C   B LYS C  1 63  ? -26.42664 -20.60195  82.30853  0.562 18.24505  ? 43   LYS B C   1 
ATOM   6863  O O   A LYS C  1 63  ? -24.48445 -21.50549  80.23375  0.438 20.65361  ? 43   LYS B O   1 
ATOM   6864  O O   B LYS C  1 63  ? -27.29906 -21.22365  82.93447  0.562 20.15380  ? 43   LYS B O   1 
ATOM   6865  C CB  A LYS C  1 63  ? -22.41295 -18.90799  80.39908  0.438 27.57369  ? 43   LYS B CB  1 
ATOM   6866  C CB  B LYS C  1 63  ? -26.51330 -19.80739  79.96222  0.562 23.59255  ? 43   LYS B CB  1 
ATOM   6867  C CG  A LYS C  1 63  ? -21.66632 -19.78991  79.43151  0.438 15.39099  ? 43   LYS B CG  1 
ATOM   6868  C CG  B LYS C  1 63  ? -27.25840 -21.03136  79.51644  0.562 27.51028  ? 43   LYS B CG  1 
ATOM   6869  C CD  A LYS C  1 63  ? -21.97910 -19.41621  77.97702  0.438 24.46123  ? 43   LYS B CD  1 
ATOM   6870  C CD  B LYS C  1 63  ? -26.68537 -21.55941  78.20248  0.562 30.44250  ? 43   LYS B CD  1 
ATOM   6871  C CE  A LYS C  1 63  ? -20.86469 -19.91192  77.04965  0.438 23.15527  ? 43   LYS B CE  1 
ATOM   6872  C CE  B LYS C  1 63  ? -26.34552 -20.41314  77.29940  0.562 28.71133  ? 43   LYS B CE  1 
ATOM   6873  N NZ  A LYS C  1 63  ? -21.24579 -19.88235  75.59764  0.438 22.05507  ? 43   LYS B NZ  1 
ATOM   6874  N NZ  B LYS C  1 63  ? -27.60592 -19.68455  76.95393  0.562 28.95293  ? 43   LYS B NZ  1 
ATOM   6875  N N   A ALA C  1 64  ? -23.98538 -20.80687  82.31769  0.438 17.80832  ? 44   ALA B N   1 
ATOM   6876  N N   B ALA C  1 64  ? -25.13884 -20.93173  82.34094  0.562 16.68583  ? 44   ALA B N   1 
ATOM   6877  C CA  A ALA C  1 64  ? -24.07223 -22.13900  82.90489  0.438 16.61732  ? 44   ALA B CA  1 
ATOM   6878  C CA  B ALA C  1 64  ? -24.64418 -22.15773  82.94505  0.562 16.25685  ? 44   ALA B CA  1 
ATOM   6879  C C   A ALA C  1 64  ? -24.24174 -22.00971  84.41365  0.438 16.05899  ? 44   ALA B C   1 
ATOM   6880  C C   B ALA C  1 64  ? -24.67246 -22.07123  84.46494  0.562 15.54350  ? 44   ALA B C   1 
ATOM   6881  O O   A ALA C  1 64  ? -24.39453 -20.90670  84.94861  0.438 16.38881  ? 44   ALA B O   1 
ATOM   6882  O O   B ALA C  1 64  ? -25.04698 -21.05378  85.05983  0.562 14.78138  ? 44   ALA B O   1 
ATOM   6883  C CB  A ALA C  1 64  ? -22.82936 -22.96420  82.55986  0.438 18.21775  ? 44   ALA B CB  1 
ATOM   6884  C CB  B ALA C  1 64  ? -23.21594 -22.43984  82.48259  0.562 17.96213  ? 44   ALA B CB  1 
ATOM   6885  N N   . ARG C  1 65  ? -24.23416 -23.15060  85.09823  1.000 13.49906  ? 45   ARG B N   1 
ATOM   6886  C CA  . ARG C  1 65  ? -24.00344 -23.15813  86.54023  1.000 13.49366  ? 45   ARG B CA  1 
ATOM   6887  C C   . ARG C  1 65  ? -22.50855 -23.38617  86.76227  1.000 14.52606  ? 45   ARG B C   1 
ATOM   6888  O O   . ARG C  1 65  ? -21.80408 -23.88354  85.86962  1.000 15.43257  ? 45   ARG B O   1 
ATOM   6889  C CB  . ARG C  1 65  ? -24.81173 -24.24340  87.24221  1.000 16.53507  ? 45   ARG B CB  1 
ATOM   6890  C CG  . ARG C  1 65  ? -26.34529 -24.13784  87.04124  1.000 14.59527  ? 45   ARG B CG  1 
ATOM   6891  C CD  . ARG C  1 65  ? -27.07770 -25.20158  87.83650  1.000 13.59867  ? 45   ARG B CD  1 
ATOM   6892  N NE  . ARG C  1 65  ? -28.54187 -25.15736  87.60628  1.000 14.93300  ? 45   ARG B NE  1 
ATOM   6893  C CZ  . ARG C  1 65  ? -29.40627 -24.64543  88.48378  1.000 19.67207  ? 45   ARG B CZ  1 
ATOM   6894  N NH1 . ARG C  1 65  ? -28.96402 -24.11677  89.62254  1.000 17.18144  ? 45   ARG B NH1 1 
ATOM   6895  N NH2 . ARG C  1 65  ? -30.72101 -24.66309  88.23398  1.000 21.80757  ? 45   ARG B NH2 1 
ATOM   6896  N N   . ILE C  1 66  ? -22.02375 -23.04718  87.95330  1.000 13.61219  ? 46   ILE B N   1 
ATOM   6897  C CA  . ILE C  1 66  ? -20.57786 -23.09412  88.16814  1.000 16.16933  ? 46   ILE B CA  1 
ATOM   6898  C C   . ILE C  1 66  ? -20.02875 -24.48125  87.84861  1.000 14.98531  ? 46   ILE B C   1 
ATOM   6899  O O   . ILE C  1 66  ? -18.96716 -24.62224  87.21754  1.000 17.41309  ? 46   ILE B O   1 
ATOM   6900  C CB  . ILE C  1 66  ? -20.22418 -22.67128  89.59774  1.000 17.97363  ? 46   ILE B CB  1 
ATOM   6901  C CG1 . ILE C  1 66  ? -20.55213 -21.18283  89.78064  1.000 15.99470  ? 46   ILE B CG1 1 
ATOM   6902  C CG2 . ILE C  1 66  ? -18.72135 -22.98077  89.84639  1.000 14.30348  ? 46   ILE B CG2 1 
ATOM   6903  C CD1 . ILE C  1 66  ? -20.35770 -20.66077  91.22888  1.000 17.27410  ? 46   ILE B CD1 1 
ATOM   6904  N N   . ILE C  1 67  ? -20.74241 -25.52430  88.26654  1.000 13.52107  ? 47   ILE B N   1 
ATOM   6905  C CA  . ILE C  1 67  ? -20.22535 -26.87081  88.07909  1.000 16.32902  ? 47   ILE B CA  1 
ATOM   6906  C C   . ILE C  1 67  ? -20.02578 -27.21298  86.61481  1.000 16.01589  ? 47   ILE B C   1 
ATOM   6907  O O   . ILE C  1 67  ? -19.16821 -28.04759  86.28859  1.000 17.85697  ? 47   ILE B O   1 
ATOM   6908  C CB  . ILE C  1 67  ? -21.12983 -27.90175  88.75447  1.000 19.57065  ? 47   ILE B CB  1 
ATOM   6909  C CG1 . ILE C  1 67  ? -20.38079 -29.22449  88.85341  1.000 19.83215  ? 47   ILE B CG1 1 
ATOM   6910  C CG2 . ILE C  1 67  ? -22.43079 -28.09065  87.96691  1.000 18.63411  ? 47   ILE B CG2 1 
ATOM   6911  C CD1 . ILE C  1 67  ? -21.18404 -30.29962  89.51357  1.000 22.88336  ? 47   ILE B CD1 1 
ATOM   6912  N N   . ASP C  1 68  ? -20.73219 -26.54367  85.70457  1.000 12.99987  ? 48   ASP B N   1 
ATOM   6913  C CA  . ASP C  1 68  ? -20.58492 -26.94479  84.31155  1.000 13.01587  ? 48   ASP B CA  1 
ATOM   6914  C C   . ASP C  1 68  ? -19.21058 -26.62485  83.75518  1.000 15.42664  ? 48   ASP B C   1 
ATOM   6915  O O   . ASP C  1 68  ? -18.87244 -27.13099  82.68769  1.000 16.82389  ? 48   ASP B O   1 
ATOM   6916  C CB  . ASP C  1 68  ? -21.62710 -26.27437  83.42222  1.000 13.09755  ? 48   ASP B CB  1 
ATOM   6917  C CG  . ASP C  1 68  ? -23.06619 -26.63835  83.84086  1.000 16.66444  ? 48   ASP B CG  1 
ATOM   6918  O OD1 . ASP C  1 68  ? -23.33206 -27.84175  84.05596  1.000 14.59228  ? 48   ASP B OD1 1 
ATOM   6919  O OD2 . ASP C  1 68  ? -23.91621 -25.71818  83.92595  1.000 13.26631  ? 48   ASP B OD2 1 
ATOM   6920  N N   . PHE C  1 69  ? -18.41784 -25.79766  84.43208  1.000 18.14702  ? 49   PHE B N   1 
ATOM   6921  C CA  . PHE C  1 69  ? -17.10478 -25.49014  83.86972  1.000 13.87617  ? 49   PHE B CA  1 
ATOM   6922  C C   . PHE C  1 69  ? -16.18258 -26.68990  83.99424  1.000 14.16150  ? 49   PHE B C   1 
ATOM   6923  O O   . PHE C  1 69  ? -15.63847 -27.15374  82.99341  1.000 16.56176  ? 49   PHE B O   1 
ATOM   6924  C CB  . PHE C  1 69  ? -16.54903 -24.21423  84.51207  1.000 15.18871  ? 49   PHE B CB  1 
ATOM   6925  C CG  . PHE C  1 69  ? -17.19241 -22.99439  83.93267  1.000 18.62986  ? 49   PHE B CG  1 
ATOM   6926  C CD1 . PHE C  1 69  ? -18.40197 -22.55610  84.43187  1.000 18.62588  ? 49   PHE B CD1 1 
ATOM   6927  C CD2 . PHE C  1 69  ? -16.63308 -22.32613  82.84135  1.000 21.87623  ? 49   PHE B CD2 1 
ATOM   6928  C CE1 . PHE C  1 69  ? -19.07021 -21.47446  83.85207  1.000 18.31828  ? 49   PHE B CE1 1 
ATOM   6929  C CE2 . PHE C  1 69  ? -17.28596 -21.23451  82.27246  1.000 21.21783  ? 49   PHE B CE2 1 
ATOM   6930  C CZ  . PHE C  1 69  ? -18.53112 -20.82865  82.78712  1.000 18.31000  ? 49   PHE B CZ  1 
ATOM   6931  N N   . ALA C  1 70  ? -16.00552 -27.21367  85.21864  1.000 17.00657  ? 50   ALA B N   1 
ATOM   6932  C CA  . ALA C  1 70  ? -15.25227 -28.45326  85.40546  1.000 16.72661  ? 50   ALA B CA  1 
ATOM   6933  C C   . ALA C  1 70  ? -15.80000 -29.59315  84.53054  1.000 17.11810  ? 50   ALA B C   1 
ATOM   6934  O O   . ALA C  1 70  ? -15.02199 -30.35959  83.93679  1.000 14.22159  ? 50   ALA B O   1 
ATOM   6935  C CB  . ALA C  1 70  ? -15.29043 -28.86658  86.86529  1.000 16.21003  ? 50   ALA B CB  1 
ATOM   6936  N N   . LEU C  1 71  ? -17.13211 -29.72854  84.44495  1.000 15.94802  ? 51   LEU B N   1 
ATOM   6937  C CA  . LEU C  1 71  ? -17.67177 -30.83611  83.65315  1.000 13.96201  ? 51   LEU B CA  1 
ATOM   6938  C C   . LEU C  1 71  ? -17.35141 -30.66000  82.17895  1.000 16.03331  ? 51   LEU B C   1 
ATOM   6939  O O   . LEU C  1 71  ? -17.03177 -31.63365  81.47203  1.000 14.56047  ? 51   LEU B O   1 
ATOM   6940  C CB  . LEU C  1 71  ? -19.20002 -30.95929  83.85471  1.000 13.21766  ? 51   LEU B CB  1 
ATOM   6941  C CG  . LEU C  1 71  ? -19.62949 -31.27757  85.28540  1.000 16.36057  ? 51   LEU B CG  1 
ATOM   6942  C CD1 . LEU C  1 71  ? -21.18359 -31.12719  85.37361  1.000 15.74271  ? 51   LEU B CD1 1 
ATOM   6943  C CD2 . LEU C  1 71  ? -19.15782 -32.71731  85.71869  1.000 13.23732  ? 51   LEU B CD2 1 
ATOM   6944  N N   . SER C  1 72  ? -17.45335 -29.42792  81.68477  1.000 15.22350  ? 52   SER B N   1 
ATOM   6945  C CA  . SER C  1 72  ? -17.14791 -29.18786  80.28900  1.000 14.72458  ? 52   SER B CA  1 
ATOM   6946  C C   . SER C  1 72  ? -15.65752 -29.36732  80.01578  1.000 18.54513  ? 52   SER B C   1 
ATOM   6947  O O   . SER C  1 72  ? -15.28846 -29.86546  78.94357  1.000 15.70293  ? 52   SER B O   1 
ATOM   6948  C CB  . SER C  1 72  ? -17.62469 -27.80158  79.88019  1.000 14.56767  ? 52   SER B CB  1 
ATOM   6949  O OG  . SER C  1 72  ? -19.03129 -27.79535  79.99060  1.000 16.67476  ? 52   SER B OG  1 
ATOM   6950  N N   . ASN C  1 73  ? -14.79409 -28.98740  80.97320  1.000 16.29177  ? 53   ASN B N   1 
ATOM   6951  C CA  . ASN C  1 73  ? -13.36386 -29.27810  80.83260  1.000 19.73104  ? 53   ASN B CA  1 
ATOM   6952  C C   . ASN C  1 73  ? -13.12690 -30.77640  80.65461  1.000 17.25776  ? 53   ASN B C   1 
ATOM   6953  O O   . ASN C  1 73  ? -12.36601 -31.19214  79.77720  1.000 17.63738  ? 53   ASN B O   1 
ATOM   6954  C CB  . ASN C  1 73  ? -12.58639 -28.73539  82.05302  1.000 17.91817  ? 53   ASN B CB  1 
ATOM   6955  C CG  . ASN C  1 73  ? -12.47432 -27.22520  82.05018  1.000 15.70916  ? 53   ASN B CG  1 
ATOM   6956  O OD1 . ASN C  1 73  ? -12.59452 -26.59409  81.01234  1.000 19.74409  ? 53   ASN B OD1 1 
ATOM   6957  N ND2 . ASN C  1 73  ? -12.29364 -26.63272  83.22623  1.000 16.12568  ? 53   ASN B ND2 1 
ATOM   6958  N N   . ALA C  1 74  ? -13.74716 -31.59891  81.50466  1.000 18.71663  ? 54   ALA B N   1 
ATOM   6959  C CA  . ALA C  1 74  ? -13.54674 -33.03963  81.40447  1.000 18.51813  ? 54   ALA B CA  1 
ATOM   6960  C C   . ALA C  1 74  ? -13.97412 -33.53912  80.02715  1.000 15.86964  ? 54   ALA B C   1 
ATOM   6961  O O   . ALA C  1 74  ? -13.22208 -34.24030  79.34185  1.000 19.78725  ? 54   ALA B O   1 
ATOM   6962  C CB  . ALA C  1 74  ? -14.30987 -33.76084  82.52758  1.000 15.39487  ? 54   ALA B CB  1 
ATOM   6963  N N   . LEU C  1 75  ? -15.18759 -33.16956  79.60182  1.000 15.50797  ? 55   LEU B N   1 
ATOM   6964  C CA  . LEU C  1 75  ? -15.71224 -33.56520  78.29077  1.000 15.91760  ? 55   LEU B CA  1 
ATOM   6965  C C   . LEU C  1 75  ? -14.80764 -33.10747  77.14278  1.000 21.36304  ? 55   LEU B C   1 
ATOM   6966  O O   . LEU C  1 75  ? -14.42661 -33.89689  76.26558  1.000 17.93908  ? 55   LEU B O   1 
ATOM   6967  C CB  . LEU C  1 75  ? -17.10749 -32.96695  78.12767  1.000 15.48234  ? 55   LEU B CB  1 
ATOM   6968  C CG  . LEU C  1 75  ? -17.79323 -33.21714  76.78528  1.000 24.86237  ? 55   LEU B CG  1 
ATOM   6969  C CD1 . LEU C  1 75  ? -18.15098 -34.66505  76.61282  1.000 29.58187  ? 55   LEU B CD1 1 
ATOM   6970  C CD2 . LEU C  1 75  ? -19.05459 -32.36980  76.73985  1.000 24.10284  ? 55   LEU B CD2 1 
ATOM   6971  N N   . ASN C  1 76  ? -14.47935 -31.81518  77.11280  1.000 16.59431  ? 56   ASN B N   1 
ATOM   6972  C CA  . ASN C  1 76  ? -13.65836 -31.29875  76.02454  1.000 20.23022  ? 56   ASN B CA  1 
ATOM   6973  C C   . ASN C  1 76  ? -12.25056 -31.89258  76.03640  1.000 19.63265  ? 56   ASN B C   1 
ATOM   6974  O O   . ASN C  1 76  ? -11.59260 -31.93470  75.00022  1.000 22.10184  ? 56   ASN B O   1 
ATOM   6975  C CB  . ASN C  1 76  ? -13.58508 -29.76524  76.13019  1.000 22.51053  ? 56   ASN B CB  1 
ATOM   6976  C CG  . ASN C  1 76  ? -14.93590 -29.10937  75.95830  1.000 20.42412  ? 56   ASN B CG  1 
ATOM   6977  O OD1 . ASN C  1 76  ? -15.89463 -29.74139  75.53081  1.000 23.23651  ? 56   ASN B OD1 1 
ATOM   6978  N ND2 . ASN C  1 76  ? -15.02216 -27.83292  76.33027  1.000 18.18526  ? 56   ASN B ND2 1 
ATOM   6979  N N   . SER C  1 77  ? -11.74869 -32.29746  77.19553  1.000 19.19547  ? 57   SER B N   1 
ATOM   6980  C CA  . SER C  1 77  ? -10.44024 -32.93178  77.24174  1.000 18.60950  ? 57   SER B CA  1 
ATOM   6981  C C   . SER C  1 77  ? -10.48945 -34.40168  76.83220  1.000 21.23534  ? 57   SER B C   1 
ATOM   6982  O O   . SER C  1 77  ? -9.43830  -35.04878  76.81871  1.000 22.81763  ? 57   SER B O   1 
ATOM   6983  C CB  . SER C  1 77  ? -9.84688  -32.81591  78.65528  1.000 18.57105  ? 57   SER B CB  1 
ATOM   6984  O OG  . SER C  1 77  ? -9.77479  -31.45992  79.10095  1.000 21.80504  ? 57   SER B OG  1 
ATOM   6985  N N   . GLY C  1 78  ? -11.66722 -34.93625  76.48784  1.000 23.73211  ? 58   GLY B N   1 
ATOM   6986  C CA  . GLY C  1 78  ? -11.77208 -36.31493  76.06306  1.000 25.81332  ? 58   GLY B CA  1 
ATOM   6987  C C   . GLY C  1 78  ? -12.02276 -37.31576  77.17502  1.000 25.44364  ? 58   GLY B C   1 
ATOM   6988  O O   . GLY C  1 78  ? -11.95644 -38.52881  76.92296  1.000 21.30036  ? 58   GLY B O   1 
ATOM   6989  N N   . ILE C  1 79  ? -12.33037 -36.86604  78.38376  1.000 18.02979  ? 59   ILE B N   1 
ATOM   6990  C CA  . ILE C  1 79  ? -12.62553 -37.77758  79.48422  1.000 17.94329  ? 59   ILE B CA  1 
ATOM   6991  C C   . ILE C  1 79  ? -14.12054 -38.09837  79.41582  1.000 20.38825  ? 59   ILE B C   1 
ATOM   6992  O O   . ILE C  1 79  ? -14.95520 -37.20822  79.58097  1.000 26.60641  ? 59   ILE B O   1 
ATOM   6993  C CB  . ILE C  1 79  ? -12.25393 -37.16123  80.84210  1.000 18.17368  ? 59   ILE B CB  1 
ATOM   6994  C CG1 . ILE C  1 79  ? -10.75399 -36.85652  80.91086  1.000 18.88051  ? 59   ILE B CG1 1 
ATOM   6995  C CG2 . ILE C  1 79  ? -12.69268 -38.06409  81.99483  1.000 17.57300  ? 59   ILE B CG2 1 
ATOM   6996  C CD1 . ILE C  1 79  ? -10.40928 -36.07418  82.15462  1.000 17.79872  ? 59   ILE B CD1 1 
ATOM   6997  N N   . ARG C  1 80  ? -14.44617 -39.36078  79.21879  1.000 20.92838  ? 60   ARG B N   1 
ATOM   6998  C CA  . ARG C  1 80  ? -15.82164 -39.78439  79.01767  1.000 21.80068  ? 60   ARG B CA  1 
ATOM   6999  C C   . ARG C  1 80  ? -16.42925 -40.50080  80.20712  1.000 21.14870  ? 60   ARG B C   1 
ATOM   7000  O O   . ARG C  1 80  ? -17.59262 -40.92837  80.11745  1.000 21.54622  ? 60   ARG B O   1 
ATOM   7001  C CB  . ARG C  1 80  ? -15.89442 -40.68720  77.78948  1.000 30.46242  ? 60   ARG B CB  1 
ATOM   7002  C CG  . ARG C  1 80  ? -15.08366 -40.15115  76.63002  1.000 40.17747  ? 60   ARG B CG  1 
ATOM   7003  C CD  . ARG C  1 80  ? -15.88340 -40.18473  75.33533  1.000 49.97967  ? 60   ARG B CD  1 
ATOM   7004  N NE  . ARG C  1 80  ? -17.15514 -39.44622  75.40418  1.000 52.66877  ? 60   ARG B NE  1 
ATOM   7005  C CZ  . ARG C  1 80  ? -17.35806 -38.22339  74.91775  1.000 50.87136  ? 60   ARG B CZ  1 
ATOM   7006  N NH1 . ARG C  1 80  ? -16.36658 -37.55968  74.33520  1.000 49.39998  ? 60   ARG B NH1 1 
ATOM   7007  N NH2 . ARG C  1 80  ? -18.56407 -37.66577  75.01365  1.000 52.38535  ? 60   ARG B NH2 1 
ATOM   7008  N N   . ARG C  1 81  ? -15.68738 -40.66740  81.30002  1.000 17.17022  ? 61   ARG B N   1 
ATOM   7009  C CA  . ARG C  1 81  ? -16.25390 -41.13702  82.55406  1.000 16.89005  ? 61   ARG B CA  1 
ATOM   7010  C C   . ARG C  1 81  ? -16.15618 -40.01558  83.57368  1.000 16.23174  ? 61   ARG B C   1 
ATOM   7011  O O   . ARG C  1 81  ? -15.05643 -39.51884  83.85118  1.000 17.83550  ? 61   ARG B O   1 
ATOM   7012  C CB  . ARG C  1 81  ? -15.52195 -42.37059  83.04813  1.000 20.47201  ? 61   ARG B CB  1 
ATOM   7013  C CG  . ARG C  1 81  ? -15.62879 -43.52576  82.11490  1.000 19.74209  ? 61   ARG B CG  1 
ATOM   7014  C CD  . ARG C  1 81  ? -15.52874 -44.84088  82.85645  1.000 20.03385  ? 61   ARG B CD  1 
ATOM   7015  N NE  . ARG C  1 81  ? -15.51501 -45.96856  81.92961  1.000 20.05602  ? 61   ARG B NE  1 
ATOM   7016  C CZ  . ARG C  1 81  ? -16.61537 -46.53967  81.43177  1.000 20.34024  ? 61   ARG B CZ  1 
ATOM   7017  N NH1 . ARG C  1 81  ? -17.80996 -46.08036  81.75801  1.000 20.53355  ? 61   ARG B NH1 1 
ATOM   7018  N NH2 . ARG C  1 81  ? -16.52100 -47.55547  80.61212  1.000 21.39031  ? 61   ARG B NH2 1 
ATOM   7019  N N   . ILE C  1 82  ? -17.29494 -39.64852  84.15673  1.000 15.65025  ? 62   ILE B N   1 
ATOM   7020  C CA  . ILE C  1 82  ? -17.37183 -38.54747  85.10570  1.000 19.18728  ? 62   ILE B CA  1 
ATOM   7021  C C   . ILE C  1 82  ? -18.20747 -38.98663  86.29848  1.000 18.61507  ? 62   ILE B C   1 
ATOM   7022  O O   . ILE C  1 82  ? -19.28236 -39.58875  86.13474  1.000 16.34106  ? 62   ILE B O   1 
ATOM   7023  C CB  . ILE C  1 82  ? -17.98390 -37.28920  84.44986  1.000 16.90341  ? 62   ILE B CB  1 
ATOM   7024  C CG1 . ILE C  1 82  ? -17.10521 -36.76095  83.30409  1.000 14.80103  ? 62   ILE B CG1 1 
ATOM   7025  C CG2 . ILE C  1 82  ? -18.23528 -36.19153  85.50633  1.000 20.12012  ? 62   ILE B CG2 1 
ATOM   7026  C CD1 . ILE C  1 82  ? -17.80412 -35.65850  82.50952  1.000 17.32147  ? 62   ILE B CD1 1 
ATOM   7027  N N   . GLY C  1 83  ? -17.73540 -38.64766  87.49947  1.000 15.74786  ? 63   GLY B N   1 
ATOM   7028  C CA  . GLY C  1 83  ? -18.48502 -38.90748  88.72079  1.000 15.75155  ? 63   GLY B CA  1 
ATOM   7029  C C   . GLY C  1 83  ? -18.54909 -37.60150  89.49915  1.000 14.70728  ? 63   GLY B C   1 
ATOM   7030  O O   . GLY C  1 83  ? -17.61212 -36.81479  89.46520  1.000 18.37619  ? 63   GLY B O   1 
ATOM   7031  N N   . VAL C  1 84  ? -19.72532 -37.30295  90.04402  1.000 14.36529  ? 64   VAL B N   1 
ATOM   7032  C CA  . VAL C  1 84  ? -19.94007 -36.04521  90.79743  1.000 14.11824  ? 64   VAL B CA  1 
ATOM   7033  C C   . VAL C  1 84  ? -20.39843 -36.40812  92.19345  1.000 20.36148  ? 64   VAL B C   1 
ATOM   7034  O O   . VAL C  1 84  ? -21.49057 -36.96491  92.37014  1.000 16.73072  ? 64   VAL B O   1 
ATOM   7035  C CB  . VAL C  1 84  ? -20.94720 -35.10263  90.12981  1.000 13.72212  ? 64   VAL B CB  1 
ATOM   7036  C CG1 . VAL C  1 84  ? -21.06052 -33.79418  90.96871  1.000 16.93744  ? 64   VAL B CG1 1 
ATOM   7037  C CG2 . VAL C  1 84  ? -20.52768 -34.78477  88.70329  1.000 13.55648  ? 64   VAL B CG2 1 
ATOM   7038  N N   . ALA C  1 85  ? -19.57590 -36.08685  93.18631  1.000 21.17171  ? 65   ALA B N   1 
ATOM   7039  C CA  . ALA C  1 85  ? -19.91876 -36.31440  94.58839  1.000 19.12932  ? 65   ALA B CA  1 
ATOM   7040  C C   . ALA C  1 85  ? -20.63327 -35.08525  95.15057  1.000 19.83595  ? 65   ALA B C   1 
ATOM   7041  O O   . ALA C  1 85  ? -20.11935 -33.97078  95.03961  1.000 19.86152  ? 65   ALA B O   1 
ATOM   7042  C CB  . ALA C  1 85  ? -18.64213 -36.60095  95.38741  1.000 22.01846  ? 65   ALA B CB  1 
ATOM   7043  N N   . THR C  1 86  ? -21.83385 -35.27070  95.69801  1.000 22.06881  ? 66   THR B N   1 
ATOM   7044  C CA  . THR C  1 86  ? -22.59841 -34.15396  96.25837  1.000 23.90178  ? 66   THR B CA  1 
ATOM   7045  C C   . THR C  1 86  ? -22.90012 -34.36973  97.73546  1.000 21.23526  ? 66   THR B C   1 
ATOM   7046  O O   . THR C  1 86  ? -22.82164 -35.48235  98.26500  1.000 22.47076  ? 66   THR B O   1 
ATOM   7047  C CB  . THR C  1 86  ? -23.91668 -33.92179  95.51386  1.000 24.78744  ? 66   THR B CB  1 
ATOM   7048  O OG1 . THR C  1 86  ? -24.80995 -35.02929  95.74127  1.000 27.08682  ? 66   THR B OG1 1 
ATOM   7049  C CG2 . THR C  1 86  ? -23.67418 -33.76294  94.02958  1.000 22.46887  ? 66   THR B CG2 1 
ATOM   7050  N N   . GLN C  1 87  ? -23.25725 -33.28065  98.40941  1.000 28.44881  ? 67   GLN B N   1 
ATOM   7051  C CA  . GLN C  1 87  ? -23.52031 -33.37719  99.83362  1.000 33.95383  ? 67   GLN B CA  1 
ATOM   7052  C C   . GLN C  1 87  ? -24.48482 -32.28053  100.26046 1.000 38.07756  ? 67   GLN B C   1 
ATOM   7053  O O   . GLN C  1 87  ? -25.69540 -32.51074  100.29332 1.000 38.41020  ? 67   GLN B O   1 
ATOM   7054  C CB  . GLN C  1 87  ? -22.20518 -33.29329  100.61567 1.000 42.73361  ? 67   GLN B CB  1 
ATOM   7055  C CG  . GLN C  1 87  ? -22.33410 -33.31600  102.13353 1.000 58.24714  ? 67   GLN B CG  1 
ATOM   7056  C CD  . GLN C  1 87  ? -21.19526 -34.06918  102.80522 1.000 68.04037  ? 67   GLN B CD  1 
ATOM   7057  O OE1 . GLN C  1 87  ? -21.39494 -35.14845  103.34638 1.000 68.41289  ? 67   GLN B OE1 1 
ATOM   7058  N NE2 . GLN C  1 87  ? -19.99678 -33.50136  102.76673 1.000 80.78752  ? 67   GLN B NE2 1 
ATOM   7059  N N   . TYR C  1 88  ? -23.95718 -31.08739  100.55445 1.000 45.08754  ? 68   TYR B N   1 
ATOM   7060  C CA  . TYR C  1 88  ? -24.77186 -29.96401  101.02455 1.000 52.14675  ? 68   TYR B CA  1 
ATOM   7061  C C   . TYR C  1 88  ? -25.84275 -29.59691  100.00425 1.000 48.91280  ? 68   TYR B C   1 
ATOM   7062  O O   . TYR C  1 88  ? -25.54097 -29.42747  98.81507  1.000 46.04872  ? 68   TYR B O   1 
ATOM   7063  C CB  . TYR C  1 88  ? -23.88095 -28.74603  101.28784 1.000 55.24809  ? 68   TYR B CB  1 
ATOM   7064  C CG  . TYR C  1 88  ? -24.63050 -27.45858  101.61459 1.000 59.02312  ? 68   TYR B CG  1 
ATOM   7065  C CD1 . TYR C  1 88  ? -24.88519 -26.49891  100.63580 1.000 57.70380  ? 68   TYR B CD1 1 
ATOM   7066  C CD2 . TYR C  1 88  ? -25.06518 -27.19837  102.91474 1.000 62.46685  ? 68   TYR B CD2 1 
ATOM   7067  C CE1 . TYR C  1 88  ? -25.56245 -25.31456  100.94395 1.000 59.54633  ? 68   TYR B CE1 1 
ATOM   7068  C CE2 . TYR C  1 88  ? -25.74398 -26.02565  103.23436 1.000 64.22985  ? 68   TYR B CE2 1 
ATOM   7069  C CZ  . TYR C  1 88  ? -25.99130 -25.08469  102.25314 1.000 63.36163  ? 68   TYR B CZ  1 
ATOM   7070  O OH  . TYR C  1 88  ? -26.66990 -23.92944  102.59526 1.000 62.53433  ? 68   TYR B OH  1 
ATOM   7071  N N   . LYS C  1 89  ? -27.09357 -29.48831  100.48117 1.000 42.55211  ? 69   LYS B N   1 
ATOM   7072  C CA  . LYS C  1 89  ? -28.24436 -29.02392  99.70016  1.000 44.15714  ? 69   LYS B CA  1 
ATOM   7073  C C   . LYS C  1 89  ? -28.12670 -29.32381  98.21255  1.000 42.87982  ? 69   LYS B C   1 
ATOM   7074  O O   . LYS C  1 89  ? -27.84522 -28.41114  97.42655  1.000 43.80145  ? 69   LYS B O   1 
ATOM   7075  C CB  . LYS C  1 89  ? -28.43631 -27.51814  99.87781  1.000 47.22219  ? 69   LYS B CB  1 
ATOM   7076  C CG  . LYS C  1 89  ? -28.42415 -27.08549  101.30579 1.000 49.55601  ? 69   LYS B CG  1 
ATOM   7077  C CD  . LYS C  1 89  ? -29.69951 -27.46965  101.97985 1.000 54.83459  ? 69   LYS B CD  1 
ATOM   7078  C CE  . LYS C  1 89  ? -30.34233 -26.25051  102.61538 1.000 59.59607  ? 69   LYS B CE  1 
ATOM   7079  N NZ  . LYS C  1 89  ? -30.71169 -26.47481  104.03287 1.000 63.18208  ? 69   LYS B NZ  1 
ATOM   7080  N N   . ALA C  1 90  ? -28.33510 -30.58427  97.81287  1.000 36.88533  ? 70   ALA B N   1 
ATOM   7081  C CA  . ALA C  1 90  ? -27.97905 -31.01711  96.47663  1.000 30.46700  ? 70   ALA B CA  1 
ATOM   7082  C C   . ALA C  1 90  ? -29.16191 -31.19226  95.52899  1.000 30.43659  ? 70   ALA B C   1 
ATOM   7083  O O   . ALA C  1 90  ? -28.93920 -31.58468  94.37835  1.000 26.66257  ? 70   ALA B O   1 
ATOM   7084  C CB  . ALA C  1 90  ? -27.19739 -32.32265  96.55675  1.000 28.11660  ? 70   ALA B CB  1 
ATOM   7085  N N   . HIS C  1 91  ? -30.40147 -30.88636  95.95495  1.000 30.40443  ? 71   HIS B N   1 
ATOM   7086  C CA  . HIS C  1 91  ? -31.56587 -31.20944  95.12220  1.000 34.46024  ? 71   HIS B CA  1 
ATOM   7087  C C   . HIS C  1 91  ? -31.52107 -30.47222  93.78864  1.000 29.48263  ? 71   HIS B C   1 
ATOM   7088  O O   . HIS C  1 91  ? -31.67031 -31.08033  92.71787  1.000 26.10907  ? 71   HIS B O   1 
ATOM   7089  C CB  . HIS C  1 91  ? -32.86637 -30.87539  95.85774  1.000 47.84192  ? 71   HIS B CB  1 
ATOM   7090  C CG  . HIS C  1 91  ? -34.03751 -30.67142  94.93854  1.000 57.11538  ? 71   HIS B CG  1 
ATOM   7091  N ND1 . HIS C  1 91  ? -34.50850 -31.66046  94.09580  1.000 57.60811  ? 71   HIS B ND1 1 
ATOM   7092  C CD2 . HIS C  1 91  ? -34.81273 -29.58270  94.70933  1.000 59.94645  ? 71   HIS B CD2 1 
ATOM   7093  C CE1 . HIS C  1 91  ? -35.53074 -31.19349  93.39843  1.000 58.80696  ? 71   HIS B CE1 1 
ATOM   7094  N NE2 . HIS C  1 91  ? -35.73478 -29.93592  93.75140  1.000 60.15671  ? 71   HIS B NE2 1 
ATOM   7095  N N   . GLU C  1 92  ? -31.32806 -29.15076  93.84259  1.000 27.27875  ? 72   GLU B N   1 
ATOM   7096  C CA  . GLU C  1 92  ? -31.20872 -28.34403  92.63742  1.000 25.25674  ? 72   GLU B CA  1 
ATOM   7097  C C   . GLU C  1 92  ? -30.03471 -28.81605  91.77721  1.000 20.90289  ? 72   GLU B C   1 
ATOM   7098  O O   . GLU C  1 92  ? -30.15657 -28.95935  90.55294  1.000 20.05774  ? 72   GLU B O   1 
ATOM   7099  C CB  . GLU C  1 92  ? -31.05313 -26.88153  93.06612  1.000 25.82276  ? 72   GLU B CB  1 
ATOM   7100  C CG  . GLU C  1 92  ? -31.09722 -25.86198  91.96800  1.000 32.63909  ? 72   GLU B CG  1 
ATOM   7101  C CD  . GLU C  1 92  ? -31.31683 -24.44851  92.51058  1.000 39.28837  ? 72   GLU B CD  1 
ATOM   7102  O OE1 . GLU C  1 92  ? -31.94155 -24.30364  93.58657  1.000 35.70739  ? 72   GLU B OE1 1 
ATOM   7103  O OE2 . GLU C  1 92  ? -30.85699 -23.48381  91.85137  1.000 45.80542  ? 72   GLU B OE2 1 
ATOM   7104  N N   . LEU C  1 93  ? -28.89663 -29.09531  92.42010  1.000 20.45199  ? 73   LEU B N   1 
ATOM   7105  C CA  . LEU C  1 93  ? -27.71347 -29.57171  91.71092  1.000 18.94949  ? 73   LEU B CA  1 
ATOM   7106  C C   . LEU C  1 93  ? -27.97489 -30.90674  91.02345  1.000 17.70854  ? 73   LEU B C   1 
ATOM   7107  O O   . LEU C  1 93  ? -27.66764 -31.08396  89.83891  1.000 16.69622  ? 73   LEU B O   1 
ATOM   7108  C CB  . LEU C  1 93  ? -26.54808 -29.68947  92.70073  1.000 20.75810  ? 73   LEU B CB  1 
ATOM   7109  C CG  . LEU C  1 93  ? -25.21364 -30.19233  92.12158  1.000 18.10536  ? 73   LEU B CG  1 
ATOM   7110  C CD1 . LEU C  1 93  ? -24.75497 -29.36678  90.91151  1.000 22.74352  ? 73   LEU B CD1 1 
ATOM   7111  C CD2 . LEU C  1 93  ? -24.13080 -30.21452  93.21551  1.000 18.95571  ? 73   LEU B CD2 1 
ATOM   7112  N N   . ILE C  1 94  ? -28.57853 -31.85381  91.74375  1.000 19.00057  ? 74   ILE B N   1 
ATOM   7113  C CA  . ILE C  1 94  ? -28.76977 -33.17562  91.16261  1.000 18.18650  ? 74   ILE B CA  1 
ATOM   7114  C C   . ILE C  1 94  ? -29.74347 -33.10390  89.98968  1.000 17.05469  ? 74   ILE B C   1 
ATOM   7115  O O   . ILE C  1 94  ? -29.49198 -33.68788  88.93356  1.000 16.67931  ? 74   ILE B O   1 
ATOM   7116  C CB  . ILE C  1 94  ? -29.22394 -34.16158  92.25715  1.000 18.86084  ? 74   ILE B CB  1 
ATOM   7117  C CG1 . ILE C  1 94  ? -28.05037 -34.51592  93.17322  1.000 20.26316  ? 74   ILE B CG1 1 
ATOM   7118  C CG2 . ILE C  1 94  ? -29.80101 -35.44092  91.65168  1.000 20.95021  ? 74   ILE B CG2 1 
ATOM   7119  C CD1 . ILE C  1 94  ? -28.49535 -34.97299  94.55439  1.000 21.89759  ? 74   ILE B CD1 1 
ATOM   7120  N N   . ARG C  1 95  ? -30.84169 -32.34713  90.14601  1.000 18.32672  ? 75   ARG B N   1 
ATOM   7121  C CA  . ARG C  1 95  ? -31.80812 -32.11799  89.05701  1.000 21.56049  ? 75   ARG B CA  1 
ATOM   7122  C C   . ARG C  1 95  ? -31.12146 -31.55815  87.79980  1.000 18.61749  ? 75   ARG B C   1 
ATOM   7123  O O   . ARG C  1 95  ? -31.41254 -31.97880  86.67183  1.000 17.46503  ? 75   ARG B O   1 
ATOM   7124  C CB  . ARG C  1 95  ? -32.89901 -31.14796  89.54822  1.000 23.51044  ? 75   ARG B CB  1 
ATOM   7125  C CG  . ARG C  1 95  ? -34.22496 -31.19923  88.77897  1.000 39.47747  ? 75   ARG B CG  1 
ATOM   7126  C CD  . ARG C  1 95  ? -34.57451 -29.83312  88.13243  1.000 54.18102  ? 75   ARG B CD  1 
ATOM   7127  N NE  . ARG C  1 95  ? -33.66653 -29.48507  87.03758  1.000 63.83894  ? 75   ARG B NE  1 
ATOM   7128  C CZ  . ARG C  1 95  ? -33.01887 -28.32626  86.91084  1.000 60.83905  ? 75   ARG B CZ  1 
ATOM   7129  N NH1 . ARG C  1 95  ? -32.22531 -28.18293  85.88030  1.000 52.76900  ? 75   ARG B NH1 1 
ATOM   7130  N NH2 . ARG C  1 95  ? -33.14791 -27.33100  87.79404  1.000 61.99638  ? 75   ARG B NH2 1 
ATOM   7131  N N   . HIS C  1 96  ? -30.22929 -30.58533  87.98783  1.000 17.69306  ? 76   HIS B N   1 
ATOM   7132  C CA  . HIS C  1 96  ? -29.42732 -30.03933  86.89081  1.000 17.14065  ? 76   HIS B CA  1 
ATOM   7133  C C   . HIS C  1 96  ? -28.60613 -31.11809  86.21250  1.000 17.32065  ? 76   HIS B C   1 
ATOM   7134  O O   . HIS C  1 96  ? -28.59545 -31.21838  84.97724  1.000 15.58336  ? 76   HIS B O   1 
ATOM   7135  C CB  . HIS C  1 96  ? -28.50986 -28.94693  87.42634  1.000 17.58567  ? 76   HIS B CB  1 
ATOM   7136  C CG  . HIS C  1 96  ? -27.58471 -28.35970  86.39952  1.000 17.40005  ? 76   HIS B CG  1 
ATOM   7137  N ND1 . HIS C  1 96  ? -27.99513 -27.43516  85.47492  1.000 18.36995  ? 76   HIS B ND1 1 
ATOM   7138  C CD2 . HIS C  1 96  ? -26.24516 -28.47852  86.24123  1.000 16.78693  ? 76   HIS B CD2 1 
ATOM   7139  C CE1 . HIS C  1 96  ? -26.96086 -27.04211  84.74827  1.000 18.33207  ? 76   HIS B CE1 1 
ATOM   7140  N NE2 . HIS C  1 96  ? -25.88478 -27.66529  85.18707  1.000 17.37188  ? 76   HIS B NE2 1 
ATOM   7141  N N   . LEU C  1 97  ? -27.87467 -31.90881  87.00010  1.000 16.17795  ? 77   LEU B N   1 
ATOM   7142  C CA  . LEU C  1 97  ? -27.01098 -32.91652  86.38227  1.000 16.37225  ? 77   LEU B CA  1 
ATOM   7143  C C   . LEU C  1 97  ? -27.85284 -33.96749  85.65326  1.000 15.21880  ? 77   LEU B C   1 
ATOM   7144  O O   . LEU C  1 97  ? -27.52789 -34.35194  84.51033  1.000 14.41626  ? 77   LEU B O   1 
ATOM   7145  C CB  . LEU C  1 97  ? -26.10151 -33.54548  87.45346  1.000 14.85421  ? 77   LEU B CB  1 
ATOM   7146  C CG  . LEU C  1 97  ? -25.16155 -32.60336  88.23064  1.000 16.03816  ? 77   LEU B CG  1 
ATOM   7147  C CD1 . LEU C  1 97  ? -24.49137 -33.37697  89.35609  1.000 19.27359  ? 77   LEU B CD1 1 
ATOM   7148  C CD2 . LEU C  1 97  ? -24.13814 -32.05504  87.30403  1.000 16.84939  ? 77   LEU B CD2 1 
ATOM   7149  N N   . GLN C  1 98  ? -28.95655 -34.40257  86.27084  1.000 15.62864  ? 78   GLN B N   1 
ATOM   7150  C CA  . GLN C  1 98  ? -29.84845 -35.37228  85.62995  1.000 16.41585  ? 78   GLN B CA  1 
ATOM   7151  C C   . GLN C  1 98  ? -30.35838 -34.85373  84.29968  1.000 16.10714  ? 78   GLN B C   1 
ATOM   7152  O O   . GLN C  1 98  ? -30.47796 -35.61247  83.32668  1.000 17.18787  ? 78   GLN B O   1 
ATOM   7153  C CB  . GLN C  1 98  ? -31.03703 -35.71089  86.53713  1.000 17.03872  ? 78   GLN B CB  1 
ATOM   7154  C CG  . GLN C  1 98  ? -30.64533 -36.32523  87.87104  1.000 21.46696  ? 78   GLN B CG  1 
ATOM   7155  C CD  . GLN C  1 98  ? -31.83385 -36.59540  88.83328  1.000 30.90651  ? 78   GLN B CD  1 
ATOM   7156  O OE1 . GLN C  1 98  ? -31.86414 -37.62144  89.52305  1.000 32.64546  ? 78   GLN B OE1 1 
ATOM   7157  N NE2 . GLN C  1 98  ? -32.79207 -35.66469  88.89771  1.000 39.23420  ? 78   GLN B NE2 1 
ATOM   7158  N N   . ARG C  1 99  ? -30.73739 -33.58324  84.24783  1.000 15.73038  ? 79   ARG B N   1 
ATOM   7159  C CA  . ARG C  1 99  ? -31.37906 -33.10563  83.03357  1.000 16.55414  ? 79   ARG B CA  1 
ATOM   7160  C C   . ARG C  1 99  ? -30.39380 -32.56953  82.00690  1.000 16.74976  ? 79   ARG B C   1 
ATOM   7161  O O   . ARG C  1 99  ? -30.65285 -32.67162  80.78935  1.000 16.63717  ? 79   ARG B O   1 
ATOM   7162  C CB  . ARG C  1 99  ? -32.40588 -32.01854  83.37635  1.000 23.30083  ? 79   ARG B CB  1 
ATOM   7163  C CG  . ARG C  1 99  ? -33.71773 -32.62204  83.86093  1.000 32.47787  ? 79   ARG B CG  1 
ATOM   7164  C CD  . ARG C  1 99  ? -34.41995 -31.67518  84.80735  1.000 41.13680  ? 79   ARG B CD  1 
ATOM   7165  N NE  . ARG C  1 99  ? -35.29403 -32.40079  85.73398  1.000 48.70074  ? 79   ARG B NE  1 
ATOM   7166  C CZ  . ARG C  1 99  ? -36.57977 -32.11748  85.89508  1.000 51.03520  ? 79   ARG B CZ  1 
ATOM   7167  N NH1 . ARG C  1 99  ? -37.12992 -31.15286  85.15688  1.000 56.06995  ? 79   ARG B NH1 1 
ATOM   7168  N NH2 . ARG C  1 99  ? -37.32043 -32.80463  86.76023  1.000 46.21526  ? 79   ARG B NH2 1 
ATOM   7169  N N   . GLY C  1 100 ? -29.30425 -31.97136  82.46019  1.000 15.53629  ? 80   GLY B N   1 
ATOM   7170  C CA  . GLY C  1 100 ? -28.33189 -31.45925  81.50917  1.000 17.97837  ? 80   GLY B CA  1 
ATOM   7171  C C   . GLY C  1 100 ? -27.28147 -32.45244  81.02641  1.000 15.88835  ? 80   GLY B C   1 
ATOM   7172  O O   . GLY C  1 100 ? -26.87837 -32.39181  79.85659  1.000 18.27834  ? 80   GLY B O   1 
ATOM   7173  N N   . TRP C  1 101 ? -26.78500 -33.32900  81.90512  1.000 13.98290  ? 81   TRP B N   1 
ATOM   7174  C CA  . TRP C  1 101 ? -25.62775 -34.17171  81.60599  1.000 15.43733  ? 81   TRP B CA  1 
ATOM   7175  C C   . TRP C  1 101 ? -26.07519 -35.62054  81.36378  1.000 16.21955  ? 81   TRP B C   1 
ATOM   7176  O O   . TRP C  1 101 ? -25.64425 -36.55084  82.06148  1.000 14.17182  ? 81   TRP B O   1 
ATOM   7177  C CB  . TRP C  1 101 ? -24.59012 -34.05758  82.73278  1.000 14.59078  ? 81   TRP B CB  1 
ATOM   7178  C CG  . TRP C  1 101 ? -23.91462 -32.68510  82.66211  1.000 15.75353  ? 81   TRP B CG  1 
ATOM   7179  C CD1 . TRP C  1 101 ? -24.32660 -31.52935  83.27204  1.000 13.80754  ? 81   TRP B CD1 1 
ATOM   7180  C CD2 . TRP C  1 101 ? -22.77024 -32.33377  81.87462  1.000 14.84493  ? 81   TRP B CD2 1 
ATOM   7181  N NE1 . TRP C  1 101 ? -23.50802 -30.48138  82.91112  1.000 17.02801  ? 81   TRP B NE1 1 
ATOM   7182  C CE2 . TRP C  1 101 ? -22.54177 -30.94877  82.05618  1.000 14.44920  ? 81   TRP B CE2 1 
ATOM   7183  C CE3 . TRP C  1 101 ? -21.91269 -33.05712  81.02536  1.000 16.79317  ? 81   TRP B CE3 1 
ATOM   7184  C CZ2 . TRP C  1 101 ? -21.48490 -30.28336  81.45513  1.000 15.35903  ? 81   TRP B CZ2 1 
ATOM   7185  C CZ3 . TRP C  1 101 ? -20.86282 -32.39144  80.41966  1.000 16.94390  ? 81   TRP B CZ3 1 
ATOM   7186  C CH2 . TRP C  1 101 ? -20.66194 -31.00925  80.62130  1.000 15.75210  ? 81   TRP B CH2 1 
ATOM   7187  N N   . ASP C  1 102 ? -26.93751 -35.79598  80.36841  1.000 18.22666  ? 82   ASP B N   1 
ATOM   7188  C CA  . ASP C  1 102 ? -27.73068 -37.01406  80.19155  1.000 15.23578  ? 82   ASP B CA  1 
ATOM   7189  C C   . ASP C  1 102 ? -27.40726 -37.73575  78.89046  1.000 17.68747  ? 82   ASP B C   1 
ATOM   7190  O O   . ASP C  1 102 ? -28.21349 -38.56933  78.43426  1.000 19.40901  ? 82   ASP B O   1 
ATOM   7191  C CB  . ASP C  1 102 ? -29.21093 -36.67857  80.20267  1.000 14.94735  ? 82   ASP B CB  1 
ATOM   7192  C CG  . ASP C  1 102 ? -29.60415 -35.76149  79.06184  1.000 19.81277  ? 82   ASP B CG  1 
ATOM   7193  O OD1 . ASP C  1 102 ? -28.71391 -35.13935  78.45042  1.000 22.95432  ? 82   ASP B OD1 1 
ATOM   7194  O OD2 . ASP C  1 102 ? -30.80237 -35.65507  78.76869  1.000 23.87088  ? 82   ASP B OD2 1 
ATOM   7195  N N   . PHE C  1 103 ? -26.28058 -37.43331  78.26068  1.000 15.09518  ? 83   PHE B N   1 
ATOM   7196  C CA  . PHE C  1 103 ? -26.01205 -37.97370  76.92133  1.000 16.05349  ? 83   PHE B CA  1 
ATOM   7197  C C   . PHE C  1 103 ? -24.87328 -38.99709  76.90880  1.000 17.22591  ? 83   PHE B C   1 
ATOM   7198  O O   . PHE C  1 103 ? -24.38813 -39.34831  75.83393  1.000 24.00501  ? 83   PHE B O   1 
ATOM   7199  C CB  . PHE C  1 103 ? -25.72924 -36.81568  75.93927  1.000 19.01134  ? 83   PHE B CB  1 
ATOM   7200  C CG  . PHE C  1 103 ? -24.64731 -35.86425  76.43108  1.000 19.85062  ? 83   PHE B CG  1 
ATOM   7201  C CD1 . PHE C  1 103 ? -24.97080 -34.77097  77.24518  1.000 19.52166  ? 83   PHE B CD1 1 
ATOM   7202  C CD2 . PHE C  1 103 ? -23.30428 -36.09236  76.12676  1.000 19.49631  ? 83   PHE B CD2 1 
ATOM   7203  C CE1 . PHE C  1 103 ? -23.96470 -33.89509  77.71612  1.000 14.12665  ? 83   PHE B CE1 1 
ATOM   7204  C CE2 . PHE C  1 103 ? -22.29615 -35.24027  76.58399  1.000 18.07224  ? 83   PHE B CE2 1 
ATOM   7205  C CZ  . PHE C  1 103 ? -22.62509 -34.13112  77.38178  1.000 19.25383  ? 83   PHE B CZ  1 
ATOM   7206  N N   . PHE C  1 104 ? -24.44095 -39.47417  78.06578  1.000 15.14251  ? 84   PHE B N   1 
ATOM   7207  C CA  . PHE C  1 104 ? -23.38266 -40.47968  78.18088  1.000 15.92104  ? 84   PHE B CA  1 
ATOM   7208  C C   . PHE C  1 104 ? -24.03051 -41.86526  78.10183  1.000 21.29106  ? 84   PHE B C   1 
ATOM   7209  O O   . PHE C  1 104 ? -24.98850 -42.13678  78.82515  1.000 18.76632  ? 84   PHE B O   1 
ATOM   7210  C CB  . PHE C  1 104 ? -22.62635 -40.32843  79.51207  1.000 17.63738  ? 84   PHE B CB  1 
ATOM   7211  C CG  . PHE C  1 104 ? -21.73082 -39.10909  79.57516  1.000 27.02379  ? 84   PHE B CG  1 
ATOM   7212  C CD1 . PHE C  1 104 ? -22.26554 -37.82234  79.55364  1.000 34.21184  ? 84   PHE B CD1 1 
ATOM   7213  C CD2 . PHE C  1 104 ? -20.35525 -39.24152  79.66475  1.000 27.96518  ? 84   PHE B CD2 1 
ATOM   7214  C CE1 . PHE C  1 104 ? -21.41664 -36.69778  79.59049  1.000 33.39340  ? 84   PHE B CE1 1 
ATOM   7215  C CE2 . PHE C  1 104 ? -19.50471 -38.11631  79.67836  1.000 26.12714  ? 84   PHE B CE2 1 
ATOM   7216  C CZ  . PHE C  1 104 ? -20.04387 -36.86056  79.65018  1.000 28.51782  ? 84   PHE B CZ  1 
ATOM   7217  N N   . ARG C  1 105 ? -23.49712 -42.75139  77.25337  1.000 13.39169  ? 85   ARG B N   1 
ATOM   7218  C CA  . ARG C  1 105 ? -24.08359 -44.09742  77.16353  1.000 14.20030  ? 85   ARG B CA  1 
ATOM   7219  C C   . ARG C  1 105 ? -23.04126 -45.14498  77.53641  1.000 16.29047  ? 85   ARG B C   1 
ATOM   7220  O O   . ARG C  1 105 ? -21.95967 -45.15188  76.94242  1.000 14.28847  ? 85   ARG B O   1 
ATOM   7221  C CB  . ARG C  1 105 ? -24.61737 -44.39195  75.70920  1.000 14.88291  ? 85   ARG B CB  1 
ATOM   7222  C CG  . ARG C  1 105 ? -25.94906 -43.68934  75.41870  1.000 15.95356  ? 85   ARG B CG  1 
ATOM   7223  C CD  . ARG C  1 105 ? -27.10653 -44.11744  76.35562  1.000 18.55474  ? 85   ARG B CD  1 
ATOM   7224  N NE  . ARG C  1 105 ? -27.42331 -45.53382  76.19500  1.000 23.76389  ? 85   ARG B NE  1 
ATOM   7225  C CZ  . ARG C  1 105 ? -28.57482 -46.13865  76.50671  1.000 26.48321  ? 85   ARG B CZ  1 
ATOM   7226  N NH1 . ARG C  1 105 ? -29.61872 -45.46841  77.00423  1.000 24.28192  ? 85   ARG B NH1 1 
ATOM   7227  N NH2 . ARG C  1 105 ? -28.70355 -47.43685  76.25625  1.000 23.38059  ? 85   ARG B NH2 1 
ATOM   7228  N N   . PRO C  1 106 ? -23.33636 -46.06566  78.44831  1.000 14.29675  ? 86   PRO B N   1 
ATOM   7229  C CA  . PRO C  1 106 ? -22.30963 -47.04818  78.86174  1.000 17.13614  ? 86   PRO B CA  1 
ATOM   7230  C C   . PRO C  1 106 ? -21.84099 -47.94832  77.73431  1.000 15.84380  ? 86   PRO B C   1 
ATOM   7231  O O   . PRO C  1 106 ? -20.69472 -48.41229  77.78085  1.000 17.10674  ? 86   PRO B O   1 
ATOM   7232  C CB  . PRO C  1 106 ? -23.01245 -47.85869  79.97566  1.000 19.55694  ? 86   PRO B CB  1 
ATOM   7233  C CG  . PRO C  1 106 ? -24.05223 -46.89155  80.54388  1.000 27.23903  ? 86   PRO B CG  1 
ATOM   7234  C CD  . PRO C  1 106 ? -24.52586 -46.08870  79.33191  1.000 25.98347  ? 86   PRO B CD  1 
ATOM   7235  N N   . GLU C  1 107 ? -22.67301 -48.17564  76.71158  1.000 16.44255  ? 87   GLU B N   1 
ATOM   7236  C CA  . GLU C  1 107 ? -22.23068 -48.98080  75.56446  1.000 17.67431  ? 87   GLU B CA  1 
ATOM   7237  C C   . GLU C  1 107 ? -21.07417 -48.33953  74.84236  1.000 17.60974  ? 87   GLU B C   1 
ATOM   7238  O O   . GLU C  1 107 ? -20.31192 -49.03764  74.17082  1.000 18.84112  ? 87   GLU B O   1 
ATOM   7239  C CB  . GLU C  1 107 ? -23.34433 -49.20432  74.53442  1.000 18.59632  ? 87   GLU B CB  1 
ATOM   7240  C CG  . GLU C  1 107 ? -24.58115 -49.76643  75.11115  1.000 19.07078  ? 87   GLU B CG  1 
ATOM   7241  C CD  . GLU C  1 107 ? -25.61952 -48.70802  75.35856  1.000 19.16452  ? 87   GLU B CD  1 
ATOM   7242  O OE1 . GLU C  1 107 ? -25.28529 -47.75254  76.06360  1.000 17.00365  ? 87   GLU B OE1 1 
ATOM   7243  O OE2 . GLU C  1 107 ? -26.76201 -48.84217  74.85041  1.000 19.34345  ? 87   GLU B OE2 1 
ATOM   7244  N N   . ARG C  1 108 ? -20.96505 -47.02093  74.90981  1.000 16.61989  ? 88   ARG B N   1 
ATOM   7245  C CA  . ARG C  1 108 ? -19.85277 -46.31799  74.29143  1.000 17.15003  ? 88   ARG B CA  1 
ATOM   7246  C C   . ARG C  1 108 ? -18.70114 -46.10041  75.25953  1.000 19.41845  ? 88   ARG B C   1 
ATOM   7247  O O   . ARG C  1 108 ? -17.81313 -45.28683  74.96630  1.000 21.01575  ? 88   ARG B O   1 
ATOM   7248  C CB  . ARG C  1 108 ? -20.33907 -44.98821  73.70278  1.000 17.85286  ? 88   ARG B CB  1 
ATOM   7249  C CG  . ARG C  1 108 ? -21.47612 -45.22578  72.64801  1.000 23.02805  ? 88   ARG B CG  1 
ATOM   7250  C CD  . ARG C  1 108 ? -21.77813 -43.97343  71.80358  1.000 22.21793  ? 88   ARG B CD  1 
ATOM   7251  N NE  . ARG C  1 108 ? -22.26978 -42.88492  72.65832  1.000 21.34459  ? 88   ARG B NE  1 
ATOM   7252  C CZ  . ARG C  1 108 ? -23.52899 -42.44246  72.73554  1.000 16.72672  ? 88   ARG B CZ  1 
ATOM   7253  N NH1 . ARG C  1 108 ? -24.51572 -42.94515  71.99882  1.000 17.39218  ? 88   ARG B NH1 1 
ATOM   7254  N NH2 . ARG C  1 108 ? -23.79364 -41.44330  73.54523  1.000 23.68152  ? 88   ARG B NH2 1 
ATOM   7255  N N   . ASN C  1 109 ? -18.72572 -46.77328  76.41841  1.000 16.24387  ? 89   ASN B N   1 
ATOM   7256  C CA  . ASN C  1 109 ? -17.70690 -46.60965  77.48107  1.000 16.17995  ? 89   ASN B CA  1 
ATOM   7257  C C   . ASN C  1 109 ? -17.69893 -45.18517  78.03212  1.000 17.20031  ? 89   ASN B C   1 
ATOM   7258  O O   . ASN C  1 109 ? -16.65378 -44.59017  78.28294  1.000 17.31885  ? 89   ASN B O   1 
ATOM   7259  C CB  . ASN C  1 109 ? -16.32394 -47.01623  76.97300  1.000 17.51587  ? 89   ASN B CB  1 
ATOM   7260  C CG  . ASN C  1 109 ? -16.21536 -48.51289  76.84297  1.000 24.12571  ? 89   ASN B CG  1 
ATOM   7261  O OD1 . ASN C  1 109 ? -16.66141 -49.24255  77.74142  1.000 21.81546  ? 89   ASN B OD1 1 
ATOM   7262  N ND2 . ASN C  1 109 ? -15.69700 -48.98983  75.71754  1.000 20.58520  ? 89   ASN B ND2 1 
ATOM   7263  N N   . GLU C  1 110 ? -18.87832 -44.63012  78.17149  1.000 14.55202  ? 90   GLU B N   1 
ATOM   7264  C CA  . GLU C  1 110 ? -19.11242 -43.35579  78.79483  1.000 18.24552  ? 90   GLU B CA  1 
ATOM   7265  C C   . GLU C  1 110 ? -19.86749 -43.62769  80.07768  1.000 22.37154  ? 90   GLU B C   1 
ATOM   7266  O O   . GLU C  1 110 ? -20.67957 -44.56260  80.14801  1.000 17.07821  ? 90   GLU B O   1 
ATOM   7267  C CB  . GLU C  1 110 ? -19.92860 -42.44288  77.86386  1.000 18.22659  ? 90   GLU B CB  1 
ATOM   7268  C CG  . GLU C  1 110 ? -19.29717 -42.27017  76.50567  1.000 21.48367  ? 90   GLU B CG  1 
ATOM   7269  C CD  . GLU C  1 110 ? -20.22749 -41.72722  75.44821  1.000 24.78564  ? 90   GLU B CD  1 
ATOM   7270  O OE1 . GLU C  1 110 ? -21.47292 -41.72700  75.60822  1.000 20.01283  ? 90   GLU B OE1 1 
ATOM   7271  O OE2 . GLU C  1 110 ? -19.70126 -41.32834  74.39338  1.000 23.00137  ? 90   GLU B OE2 1 
ATOM   7272  N N   . SER C  1 111 ? -19.64135 -42.80603  81.09727  1.000 15.47127  ? 91   SER B N   1 
ATOM   7273  C CA  . SER C  1 111 ? -20.54933 -42.93400  82.23000  1.000 15.21800  ? 91   SER B CA  1 
ATOM   7274  C C   . SER C  1 111 ? -20.63107 -41.55373  82.88897  1.000 16.37433  ? 91   SER B C   1 
ATOM   7275  O O   . SER C  1 111 ? -19.67928 -40.79179  82.84079  1.000 14.71248  ? 91   SER B O   1 
ATOM   7276  C CB  . SER C  1 111 ? -20.09342 -43.97512  83.26676  1.000 14.39998  ? 91   SER B CB  1 
ATOM   7277  O OG  . SER C  1 111 ? -18.75746 -43.71029  83.64139  1.000 17.43049  ? 91   SER B OG  1 
ATOM   7278  N N   . PHE C  1 112 ? -21.78700 -41.25722  83.46918  1.000 16.26128  ? 92   PHE B N   1 
ATOM   7279  C CA  . PHE C  1 112 ? -21.95648 -40.05736  84.30797  1.000 17.20208  ? 92   PHE B CA  1 
ATOM   7280  C C   . PHE C  1 112 ? -22.67948 -40.48878  85.57047  1.000 15.56696  ? 92   PHE B C   1 
ATOM   7281  O O   . PHE C  1 112 ? -23.88549 -40.76978  85.53184  1.000 19.08023  ? 92   PHE B O   1 
ATOM   7282  C CB  . PHE C  1 112 ? -22.73603 -38.97423  83.55685  1.000 17.74271  ? 92   PHE B CB  1 
ATOM   7283  C CG  . PHE C  1 112 ? -22.57112 -37.58720  84.15252  1.000 14.43994  ? 92   PHE B CG  1 
ATOM   7284  C CD1 . PHE C  1 112 ? -23.30789 -37.20751  85.27216  1.000 17.31938  ? 92   PHE B CD1 1 
ATOM   7285  C CD2 . PHE C  1 112 ? -21.71749 -36.66534  83.56021  1.000 18.89806  ? 92   PHE B CD2 1 
ATOM   7286  C CE1 . PHE C  1 112 ? -23.13134 -35.89981  85.83742  1.000 16.84350  ? 92   PHE B CE1 1 
ATOM   7287  C CE2 . PHE C  1 112 ? -21.53458 -35.38415  84.10389  1.000 19.68292  ? 92   PHE B CE2 1 
ATOM   7288  C CZ  . PHE C  1 112 ? -22.23436 -35.00687  85.24500  1.000 12.20872  ? 92   PHE B CZ  1 
ATOM   7289  N N   . ASP C  1 113 ? -21.95641 -40.53317  86.69461  1.000 17.22396  ? 93   ASP B N   1 
ATOM   7290  C CA  . ASP C  1 113 ? -22.48361 -41.00388  87.97114  1.000 20.83576  ? 93   ASP B CA  1 
ATOM   7291  C C   . ASP C  1 113 ? -22.65987 -39.81868  88.92327  1.000 20.44399  ? 93   ASP B C   1 
ATOM   7292  O O   . ASP C  1 113 ? -21.70476 -39.08809  89.18513  1.000 21.47806  ? 93   ASP B O   1 
ATOM   7293  C CB  . ASP C  1 113 ? -21.55410 -42.04817  88.59760  1.000 18.27153  ? 93   ASP B CB  1 
ATOM   7294  C CG  . ASP C  1 113 ? -21.52227 -43.34658  87.79743  1.000 25.09479  ? 93   ASP B CG  1 
ATOM   7295  O OD1 . ASP C  1 113 ? -20.49582 -43.66095  87.17297  1.000 25.61881  ? 93   ASP B OD1 1 
ATOM   7296  O OD2 . ASP C  1 113 ? -22.55780 -44.02557  87.76523  1.000 27.90005  ? 93   ASP B OD2 1 
ATOM   7297  N N   . ILE C  1 114 ? -23.87885 -39.64398  89.42103  1.000 19.37141  ? 94   ILE B N   1 
ATOM   7298  C CA  . ILE C  1 114 ? -24.21327 -38.65676  90.44510  1.000 17.62720  ? 94   ILE B CA  1 
ATOM   7299  C C   . ILE C  1 114 ? -24.23263 -39.37976  91.78469  1.000 21.79822  ? 94   ILE B C   1 
ATOM   7300  O O   . ILE C  1 114 ? -25.03795 -40.29187  91.98383  1.000 23.68046  ? 94   ILE B O   1 
ATOM   7301  C CB  . ILE C  1 114 ? -25.57061 -38.00469  90.15009  1.000 18.73211  ? 94   ILE B CB  1 
ATOM   7302  C CG1 . ILE C  1 114 ? -25.55415 -37.33329  88.74740  1.000 16.02436  ? 94   ILE B CG1 1 
ATOM   7303  C CG2 . ILE C  1 114 ? -25.93339 -37.03136  91.26366  1.000 21.57108  ? 94   ILE B CG2 1 
ATOM   7304  C CD1 . ILE C  1 114 ? -26.97092 -36.95889  88.23177  1.000 19.49090  ? 94   ILE B CD1 1 
ATOM   7305  N N   . LEU C  1 115 ? -23.35253 -38.98385  92.71111  1.000 21.85619  ? 95   LEU B N   1 
ATOM   7306  C CA  . LEU C  1 115 ? -23.05542 -39.77608  93.90208  1.000 23.41695  ? 95   LEU B CA  1 
ATOM   7307  C C   . LEU C  1 115 ? -23.26460 -38.94100  95.15877  1.000 26.17565  ? 95   LEU B C   1 
ATOM   7308  O O   . LEU C  1 115 ? -22.29511 -38.44334  95.75100  1.000 27.58409  ? 95   LEU B O   1 
ATOM   7309  C CB  . LEU C  1 115 ? -21.62809 -40.30945  93.84748  1.000 25.95016  ? 95   LEU B CB  1 
ATOM   7310  C CG  . LEU C  1 115 ? -21.27544 -41.06767  92.57573  1.000 25.91584  ? 95   LEU B CG  1 
ATOM   7311  C CD1 . LEU C  1 115 ? -19.77736 -41.20173  92.47115  1.000 28.49179  ? 95   LEU B CD1 1 
ATOM   7312  C CD2 . LEU C  1 115 ? -21.96651 -42.42116  92.60606  1.000 25.92429  ? 95   LEU B CD2 1 
ATOM   7313  N N   . PRO C  1 116 ? -24.50532 -38.78963  95.60970  1.000 27.03294  ? 96   PRO B N   1 
ATOM   7314  C CA  . PRO C  1 116 ? -24.74563 -38.13462  96.89995  1.000 31.58890  ? 96   PRO B CA  1 
ATOM   7315  C C   . PRO C  1 116 ? -24.46577 -39.08204  98.04825  1.000 33.50266  ? 96   PRO B C   1 
ATOM   7316  O O   . PRO C  1 116 ? -24.68384 -40.29117  97.95659  1.000 35.82708  ? 96   PRO B O   1 
ATOM   7317  C CB  . PRO C  1 116 ? -26.23471 -37.76761  96.85090  1.000 33.08296  ? 96   PRO B CB  1 
ATOM   7318  C CG  . PRO C  1 116 ? -26.76539 -38.29581  95.53646  1.000 33.65249  ? 96   PRO B CG  1 
ATOM   7319  C CD  . PRO C  1 116 ? -25.75630 -39.25584  94.98711  1.000 29.78795  ? 96   PRO B CD  1 
ATOM   7320  N N   . ALA C  1 117 ? -23.97109 -38.52387  99.14505  1.000 42.76035  ? 97   ALA B N   1 
ATOM   7321  C CA  . ALA C  1 117 ? -23.88805 -39.31632  100.36054 1.000 52.53740  ? 97   ALA B CA  1 
ATOM   7322  C C   . ALA C  1 117 ? -25.29314 -39.73984  100.77403 1.000 63.61841  ? 97   ALA B C   1 
ATOM   7323  O O   . ALA C  1 117 ? -26.20379 -38.91101  100.84378 1.000 63.26471  ? 97   ALA B O   1 
ATOM   7324  C CB  . ALA C  1 117 ? -23.20701 -38.51111  101.46000 1.000 54.77225  ? 97   ALA B CB  1 
ATOM   7325  N N   . SER C  1 118 ? -25.48984 -41.03801  100.99416 1.000 78.36582  ? 98   SER B N   1 
ATOM   7326  C CA  . SER C  1 118 ? -26.83121 -41.53985  101.27698 1.000 94.48297  ? 98   SER B CA  1 
ATOM   7327  C C   . SER C  1 118 ? -26.73456 -42.87360  102.01254 1.000 109.48558 ? 98   SER B C   1 
ATOM   7328  O O   . SER C  1 118 ? -25.65312 -43.45311  102.15565 1.000 110.01803 ? 98   SER B O   1 
ATOM   7329  C CB  . SER C  1 118 ? -27.66620 -41.67567  99.98942  1.000 92.72302  ? 98   SER B CB  1 
ATOM   7330  O OG  . SER C  1 118 ? -26.99269 -42.40903  98.97415  1.000 89.25252  ? 98   SER B OG  1 
ATOM   7331  N N   . GLN C  1 119 ? -27.89433 -43.34306  102.49396 1.000 121.04823 ? 99   GLN B N   1 
ATOM   7332  C CA  . GLN C  1 119 ? -28.03719 -44.65804  103.12757 1.000 129.78815 ? 99   GLN B CA  1 
ATOM   7333  C C   . GLN C  1 119 ? -28.06074 -45.72111  102.02991 1.000 134.24824 ? 99   GLN B C   1 
ATOM   7334  O O   . GLN C  1 119 ? -29.11160 -46.19228  101.58354 1.000 135.97536 ? 99   GLN B O   1 
ATOM   7335  C CB  . GLN C  1 119 ? -29.29211 -44.71101  103.99294 1.000 134.28199 ? 99   GLN B CB  1 
ATOM   7336  N N   . ARG C  1 120 ? -26.85895 -46.10640  101.59752 1.000 136.86344 ? 100  ARG B N   1 
ATOM   7337  C CA  . ARG C  1 120 ? -26.66781 -47.00230  100.46188 1.000 139.95291 ? 100  ARG B CA  1 
ATOM   7338  C C   . ARG C  1 120 ? -25.79028 -48.18758  100.85809 1.000 144.30913 ? 100  ARG B C   1 
ATOM   7339  O O   . ARG C  1 120 ? -26.27159 -49.32137  100.95890 1.000 145.29915 ? 100  ARG B O   1 
ATOM   7340  C CB  . ARG C  1 120 ? -26.05477 -46.22442  99.29091  1.000 135.62298 ? 100  ARG B CB  1 
ATOM   7341  C CG  . ARG C  1 120 ? -25.71944 -47.05136  98.06044  1.000 133.21708 ? 100  ARG B CG  1 
ATOM   7342  C CD  . ARG C  1 120 ? -24.95834 -46.21170  97.04125  1.000 129.06985 ? 100  ARG B CD  1 
ATOM   7343  N NE  . ARG C  1 120 ? -23.68494 -45.73677  97.57412  1.000 126.56131 ? 100  ARG B NE  1 
ATOM   7344  C CZ  . ARG C  1 120 ? -22.49691 -46.06714  97.08092  1.000 123.34569 ? 100  ARG B CZ  1 
ATOM   7345  N NH1 . ARG C  1 120 ? -21.39439 -45.58995  97.63711  1.000 123.52661 ? 100  ARG B NH1 1 
ATOM   7346  N NH2 . ARG C  1 120 ? -22.41038 -46.86858  96.03132  1.000 120.53189 ? 100  ARG B NH2 1 
ATOM   7347  N N   . VAL C  1 121 ? -24.49968 -47.93353  101.07595 1.000 147.74496 ? 101  VAL B N   1 
ATOM   7348  C CA  . VAL C  1 121 ? -23.57953 -48.90663  101.65625 1.000 153.72685 ? 101  VAL B CA  1 
ATOM   7349  C C   . VAL C  1 121 ? -23.18420 -48.53513  103.08047 1.000 163.88868 ? 101  VAL B C   1 
ATOM   7350  O O   . VAL C  1 121 ? -22.44577 -49.29276  103.72990 1.000 165.55343 ? 101  VAL B O   1 
ATOM   7351  C CB  . VAL C  1 121 ? -22.32874 -49.09141  100.76939 1.000 146.71394 ? 101  VAL B CB  1 
ATOM   7352  C CG1 . VAL C  1 121 ? -21.62530 -50.41312  101.06441 1.000 145.68137 ? 101  VAL B CG1 1 
ATOM   7353  C CG2 . VAL C  1 121 ? -22.70514 -49.02289  99.29303  1.000 143.55587 ? 101  VAL B CG2 1 
ATOM   7354  N N   . SER C  1 122 ? -23.66818 -47.40110  103.59354 1.000 172.64094 ? 102  SER B N   1 
ATOM   7355  C CA  . SER C  1 122 ? -23.39955 -46.96548  104.95884 1.000 177.07111 ? 102  SER B CA  1 
ATOM   7356  C C   . SER C  1 122 ? -24.52964 -46.05667  105.43032 1.000 174.87790 ? 102  SER B C   1 
ATOM   7357  O O   . SER C  1 122 ? -25.14375 -45.34632  104.62932 1.000 176.40883 ? 102  SER B O   1 
ATOM   7358  C CB  . SER C  1 122 ? -22.05517 -46.23013  105.06335 1.000 180.42048 ? 102  SER B CB  1 
ATOM   7359  O OG  . SER C  1 122 ? -21.98886 -45.13517  104.16067 1.000 179.62127 ? 102  SER B OG  1 
ATOM   7360  N N   . GLU C  1 123 ? -24.79637 -46.08330  106.74172 1.000 168.17616 ? 103  GLU B N   1 
ATOM   7361  C CA  . GLU C  1 123 ? -25.82168 -45.21447  107.31790 1.000 160.42642 ? 103  GLU B CA  1 
ATOM   7362  C C   . GLU C  1 123 ? -25.47181 -43.74406  107.10709 1.000 150.33911 ? 103  GLU B C   1 
ATOM   7363  O O   . GLU C  1 123 ? -26.24412 -42.99059  106.50248 1.000 148.61728 ? 103  GLU B O   1 
ATOM   7364  C CB  . GLU C  1 123 ? -25.99665 -45.52485  108.80642 1.000 162.61930 ? 103  GLU B CB  1 
ATOM   7365  N N   . THR C  1 124 ? -24.30836 -43.32505  107.62417 1.000 143.00286 ? 104  THR B N   1 
ATOM   7366  C CA  . THR C  1 124 ? -23.64711 -42.03569  107.39760 1.000 134.30343 ? 104  THR B CA  1 
ATOM   7367  C C   . THR C  1 124 ? -24.55744 -40.90699  106.92326 1.000 127.91595 ? 104  THR B C   1 
ATOM   7368  O O   . THR C  1 124 ? -24.87407 -39.98871  107.68905 1.000 127.14809 ? 104  THR B O   1 
ATOM   7369  C CB  . THR C  1 124 ? -22.50238 -42.20277  106.38297 1.000 130.61339 ? 104  THR B CB  1 
ATOM   7370  O OG1 . THR C  1 124 ? -22.96945 -42.89283  105.21294 1.000 129.71591 ? 104  THR B OG1 1 
ATOM   7371  C CG2 . THR C  1 124 ? -21.34826 -42.97856  106.99608 1.000 130.57391 ? 104  THR B CG2 1 
ATOM   7372  N N   . GLN C  1 125 ? -24.94481 -40.97229  105.64586 1.000 121.99674 ? 105  GLN B N   1 
ATOM   7373  C CA  . GLN C  1 125 ? -25.74247 -39.97352  104.94002 1.000 116.11625 ? 105  GLN B CA  1 
ATOM   7374  C C   . GLN C  1 125 ? -24.92832 -38.73491  104.56887 1.000 108.69902 ? 105  GLN B C   1 
ATOM   7375  O O   . GLN C  1 125 ? -25.34969 -37.97846  103.68986 1.000 109.87645 ? 105  GLN B O   1 
ATOM   7376  C CB  . GLN C  1 125 ? -26.98416 -39.57494  105.74894 1.000 119.16393 ? 105  GLN B CB  1 
ATOM   7377  N N   . TRP C  1 126 ? -23.76280 -38.51814  105.19275 1.000 100.23558 ? 106  TRP B N   1 
ATOM   7378  C CA  . TRP C  1 126 ? -22.91921 -37.36875  104.86657 1.000 89.29591  ? 106  TRP B CA  1 
ATOM   7379  C C   . TRP C  1 126 ? -21.44736 -37.78071  104.77231 1.000 77.11382  ? 106  TRP B C   1 
ATOM   7380  O O   . TRP C  1 126 ? -20.96864 -38.59246  105.57033 1.000 79.28411  ? 106  TRP B O   1 
ATOM   7381  C CB  . TRP C  1 126 ? -23.11403 -36.23363  105.89336 1.000 92.85165  ? 106  TRP B CB  1 
ATOM   7382  C CG  . TRP C  1 126 ? -24.21356 -35.25504  105.49314 1.000 96.26147  ? 106  TRP B CG  1 
ATOM   7383  C CD1 . TRP C  1 126 ? -25.48510 -35.56619  105.08966 1.000 98.06857  ? 106  TRP B CD1 1 
ATOM   7384  C CD2 . TRP C  1 126 ? -24.12694 -33.81996  105.44795 1.000 96.58307  ? 106  TRP B CD2 1 
ATOM   7385  N NE1 . TRP C  1 126 ? -26.18992 -34.42322  104.79548 1.000 97.70476  ? 106  TRP B NE1 1 
ATOM   7386  C CE2 . TRP C  1 126 ? -25.38104 -33.33728  105.00619 1.000 96.95496  ? 106  TRP B CE2 1 
ATOM   7387  C CE3 . TRP C  1 126 ? -23.11478 -32.89766  105.73862 1.000 95.76633  ? 106  TRP B CE3 1 
ATOM   7388  C CZ2 . TRP C  1 126 ? -25.64589 -31.97481  104.84813 1.000 96.32817  ? 106  TRP B CZ2 1 
ATOM   7389  C CZ3 . TRP C  1 126 ? -23.38106 -31.54182  105.57749 1.000 95.04719  ? 106  TRP B CZ3 1 
ATOM   7390  C CH2 . TRP C  1 126 ? -24.63532 -31.09661  105.13681 1.000 95.49584  ? 106  TRP B CH2 1 
ATOM   7391  N N   . TYR C  1 127 ? -20.73774 -37.22888  103.77949 1.000 63.26070  ? 107  TYR B N   1 
ATOM   7392  C CA  . TYR C  1 127 ? -19.32502 -37.55117  103.57586 1.000 52.88940  ? 107  TYR B CA  1 
ATOM   7393  C C   . TYR C  1 127 ? -18.46408 -36.87062  104.63234 1.000 51.53450  ? 107  TYR B C   1 
ATOM   7394  O O   . TYR C  1 127 ? -18.63630 -35.68289  104.92226 1.000 54.98382  ? 107  TYR B O   1 
ATOM   7395  C CB  . TYR C  1 127 ? -18.83757 -37.10518  102.18691 1.000 45.03511  ? 107  TYR B CB  1 
ATOM   7396  C CG  . TYR C  1 127 ? -19.42588 -37.84665  100.99226 1.000 37.08771  ? 107  TYR B CG  1 
ATOM   7397  C CD1 . TYR C  1 127 ? -19.44198 -39.23449  100.94213 1.000 34.58431  ? 107  TYR B CD1 1 
ATOM   7398  C CD2 . TYR C  1 127 ? -19.98186 -37.14342  99.92817  1.000 35.96525  ? 107  TYR B CD2 1 
ATOM   7399  C CE1 . TYR C  1 127 ? -19.99175 -39.90810  99.86269  1.000 35.35767  ? 107  TYR B CE1 1 
ATOM   7400  C CE2 . TYR C  1 127 ? -20.53529 -37.80503  98.83087  1.000 36.80020  ? 107  TYR B CE2 1 
ATOM   7401  C CZ  . TYR C  1 127 ? -20.53785 -39.18992  98.79982  1.000 35.40835  ? 107  TYR B CZ  1 
ATOM   7402  O OH  . TYR C  1 127 ? -21.08127 -39.86576  97.71022  1.000 30.10312  ? 107  TYR B OH  1 
ATOM   7403  N N   . GLU C  1 128 ? -17.50960 -37.62243  105.18512 1.000 47.33590  ? 108  GLU B N   1 
ATOM   7404  C CA  . GLU C  1 128 ? -16.64287 -37.11932  106.24542 1.000 44.94061  ? 108  GLU B CA  1 
ATOM   7405  C C   . GLU C  1 128 ? -15.55760 -36.17766  105.74264 1.000 42.12139  ? 108  GLU B C   1 
ATOM   7406  O O   . GLU C  1 128 ? -14.87628 -35.54780  106.55324 1.000 41.18003  ? 108  GLU B O   1 
ATOM   7407  C CB  . GLU C  1 128 ? -16.00449 -38.29040  106.97272 1.000 47.92739  ? 108  GLU B CB  1 
ATOM   7408  C CG  . GLU C  1 128 ? -17.02195 -39.19768  107.58907 1.000 53.94430  ? 108  GLU B CG  1 
ATOM   7409  C CD  . GLU C  1 128 ? -16.70866 -39.48826  109.02925 1.000 61.75907  ? 108  GLU B CD  1 
ATOM   7410  O OE1 . GLU C  1 128 ? -16.27095 -40.62445  109.31663 1.000 65.51370  ? 108  GLU B OE1 1 
ATOM   7411  O OE2 . GLU C  1 128 ? -16.88968 -38.58011  109.87259 1.000 64.63486  ? 108  GLU B OE2 1 
ATOM   7412  N N   . GLY C  1 129 ? -15.40259 -36.04139  104.44111 1.000 38.41902  ? 109  GLY B N   1 
ATOM   7413  C CA  . GLY C  1 129 ? -14.35420 -35.21946  103.87753 1.000 37.73469  ? 109  GLY B CA  1 
ATOM   7414  C C   . GLY C  1 129 ? -14.19464 -35.55971  102.41750 1.000 34.67487  ? 109  GLY B C   1 
ATOM   7415  O O   . GLY C  1 129 ? -14.68705 -36.57843  101.93918 1.000 37.06720  ? 109  GLY B O   1 
ATOM   7416  N N   . THR C  1 130 ? -13.47636 -34.68612  101.70786 1.000 33.63618  ? 110  THR B N   1 
ATOM   7417  C CA  . THR C  1 130 ? -13.36200 -34.83921  100.26233 1.000 35.61985  ? 110  THR B CA  1 
ATOM   7418  C C   . THR C  1 130 ? -12.66711 -36.13484  99.87690  1.000 35.99293  ? 110  THR B C   1 
ATOM   7419  O O   . THR C  1 130 ? -12.90602 -36.66419  98.78398  1.000 37.61229  ? 110  THR B O   1 
ATOM   7420  C CB  . THR C  1 130 ? -12.61229 -33.65924  99.66521  1.000 37.94708  ? 110  THR B CB  1 
ATOM   7421  O OG1 . THR C  1 130 ? -11.33889 -33.54832  100.29975 1.000 44.83907  ? 110  THR B OG1 1 
ATOM   7422  C CG2 . THR C  1 130 ? -13.38677 -32.39877  99.88198  1.000 35.14274  ? 110  THR B CG2 1 
ATOM   7423  N N   . ALA C  1 131 ? -11.78076 -36.64821  100.72912 1.000 31.46372  ? 111  ALA B N   1 
ATOM   7424  C CA  . ALA C  1 131 ? -11.22535 -37.96473  100.45180 1.000 35.63035  ? 111  ALA B CA  1 
ATOM   7425  C C   . ALA C  1 131 ? -12.27366 -39.04207  100.68869 1.000 37.34014  ? 111  ALA B C   1 
ATOM   7426  O O   . ALA C  1 131 ? -12.39795 -39.99078  99.90146  1.000 40.42499  ? 111  ALA B O   1 
ATOM   7427  C CB  . ALA C  1 131 ? -9.97467  -38.21425  101.30031 1.000 37.48382  ? 111  ALA B CB  1 
ATOM   7428  N N   . ASP C  1 132 ? -13.05251 -38.90198  101.75933 1.000 31.16883  ? 112  ASP B N   1 
ATOM   7429  C CA  . ASP C  1 132 ? -14.09678 -39.87554  102.00344 1.000 32.14159  ? 112  ASP B CA  1 
ATOM   7430  C C   . ASP C  1 132 ? -15.13352 -39.85243  100.89025 1.000 34.21560  ? 112  ASP B C   1 
ATOM   7431  O O   . ASP C  1 132 ? -15.73412 -40.88950  100.59514 1.000 35.28732  ? 112  ASP B O   1 
ATOM   7432  C CB  . ASP C  1 132 ? -14.73143 -39.61624  103.36200 1.000 30.53344  ? 112  ASP B CB  1 
ATOM   7433  C CG  . ASP C  1 132 ? -15.74843 -40.67088  103.75121 1.000 32.06976  ? 112  ASP B CG  1 
ATOM   7434  O OD1 . ASP C  1 132 ? -15.44106 -41.88543  103.70616 1.000 37.32671  ? 112  ASP B OD1 1 
ATOM   7435  O OD2 . ASP C  1 132 ? -16.87801 -40.27212  104.10222 1.000 38.74905  ? 112  ASP B OD2 1 
ATOM   7436  N N   . ALA C  1 133 ? -15.33259 -38.69059  100.24754 1.000 30.81951  ? 113  ALA B N   1 
ATOM   7437  C CA  . ALA C  1 133 ? -16.26836 -38.60936  99.12498  1.000 32.38219  ? 113  ALA B CA  1 
ATOM   7438  C C   . ALA C  1 133 ? -15.87156 -39.55298  97.99378  1.000 33.37536  ? 113  ALA B C   1 
ATOM   7439  O O   . ALA C  1 133 ? -16.73931 -40.14906  97.34367  1.000 37.75478  ? 113  ALA B O   1 
ATOM   7440  C CB  . ALA C  1 133 ? -16.35627 -37.18078  98.60424  1.000 29.60605  ? 113  ALA B CB  1 
ATOM   7441  N N   . VAL C  1 134 ? -14.57371 -39.67980  97.71683  1.000 32.74574  ? 114  VAL B N   1 
ATOM   7442  C CA  . VAL C  1 134 ? -14.12436 -40.67305  96.74100  1.000 29.04278  ? 114  VAL B CA  1 
ATOM   7443  C C   . VAL C  1 134 ? -14.08942 -42.06604  97.35584  1.000 32.14929  ? 114  VAL B C   1 
ATOM   7444  O O   . VAL C  1 134 ? -14.54264 -43.04171  96.73598  1.000 32.01996  ? 114  VAL B O   1 
ATOM   7445  C CB  . VAL C  1 134 ? -12.74795 -40.28720  96.16569  1.000 26.51927  ? 114  VAL B CB  1 
ATOM   7446  C CG1 . VAL C  1 134 ? -12.37069 -41.21692  95.00788  1.000 22.87949  ? 114  VAL B CG1 1 
ATOM   7447  C CG2 . VAL C  1 134 ? -12.72003 -38.81813  95.73599  1.000 22.47595  ? 114  VAL B CG2 1 
ATOM   7448  N N   . TYR C  1 135 ? -13.55497 -42.18252  98.58119  1.000 31.05623  ? 115  TYR B N   1 
ATOM   7449  C CA  . TYR C  1 135 ? -13.34068 -43.49101  99.18844  1.000 30.89959  ? 115  TYR B CA  1 
ATOM   7450  C C   . TYR C  1 135 ? -14.63301 -44.28758  99.25778  1.000 31.32522  ? 115  TYR B C   1 
ATOM   7451  O O   . TYR C  1 135 ? -14.63245 -45.49860  99.01076  1.000 35.22666  ? 115  TYR B O   1 
ATOM   7452  C CB  . TYR C  1 135 ? -12.73565 -43.34566  100.59504 1.000 31.94300  ? 115  TYR B CB  1 
ATOM   7453  C CG  . TYR C  1 135 ? -12.78020 -44.62858  101.40902 1.000 31.70751  ? 115  TYR B CG  1 
ATOM   7454  C CD1 . TYR C  1 135 ? -13.71757 -44.80624  102.42337 1.000 34.51302  ? 115  TYR B CD1 1 
ATOM   7455  C CD2 . TYR C  1 135 ? -11.89849 -45.66821  101.15409 1.000 30.43346  ? 115  TYR B CD2 1 
ATOM   7456  C CE1 . TYR C  1 135 ? -13.76631 -45.97509  103.16919 1.000 37.42759  ? 115  TYR B CE1 1 
ATOM   7457  C CE2 . TYR C  1 135 ? -11.94553 -46.84627  101.89203 1.000 36.93838  ? 115  TYR B CE2 1 
ATOM   7458  C CZ  . TYR C  1 135 ? -12.87580 -46.99515  102.89908 1.000 38.62978  ? 115  TYR B CZ  1 
ATOM   7459  O OH  . TYR C  1 135 ? -12.90914 -48.16766  103.62249 1.000 43.44738  ? 115  TYR B OH  1 
ATOM   7460  N N   A GLN C  1 136 ? -15.74719 -43.62909  99.57966  0.836 29.27308  ? 116  GLN B N   1 
ATOM   7461  N N   B GLN C  1 136 ? -15.74551 -43.62691  99.58992  0.164 29.98931  ? 116  GLN B N   1 
ATOM   7462  C CA  A GLN C  1 136 ? -17.01371 -44.34346  99.70513  0.836 30.49126  ? 116  GLN B CA  1 
ATOM   7463  C CA  B GLN C  1 136 ? -17.03172 -44.30376  99.71553  0.164 30.94776  ? 116  GLN B CA  1 
ATOM   7464  C C   A GLN C  1 136 ? -17.54251 -44.83391  98.36726  0.836 29.07140  ? 116  GLN B C   1 
ATOM   7465  C C   B GLN C  1 136 ? -17.59500 -44.76280  98.37728  0.164 29.01227  ? 116  GLN B C   1 
ATOM   7466  O O   A GLN C  1 136 ? -18.44488 -45.67163  98.35181  0.836 29.26531  ? 116  GLN B O   1 
ATOM   7467  O O   B GLN C  1 136 ? -18.57600 -45.51225  98.36648  0.164 29.88340  ? 116  GLN B O   1 
ATOM   7468  C CB  A GLN C  1 136 ? -18.06933 -43.45547  100.36331 0.836 33.53886  ? 116  GLN B CB  1 
ATOM   7469  C CB  B GLN C  1 136 ? -18.04554 -43.38574  100.40546 0.164 33.32753  ? 116  GLN B CB  1 
ATOM   7470  C CG  A GLN C  1 136 ? -17.76238 -43.08554  101.81201 0.836 35.92370  ? 116  GLN B CG  1 
ATOM   7471  C CG  B GLN C  1 136 ? -18.75530 -44.01484  101.59854 0.164 38.51391  ? 116  GLN B CG  1 
ATOM   7472  C CD  A GLN C  1 136 ? -17.83089 -44.28593  102.73844 0.836 40.97246  ? 116  GLN B CD  1 
ATOM   7473  C CD  B GLN C  1 136 ? -20.02495 -43.27563  101.99101 0.164 41.22988  ? 116  GLN B CD  1 
ATOM   7474  O OE1 A GLN C  1 136 ? -18.44855 -45.30671  102.41108 0.836 43.07808  ? 116  GLN B OE1 1 
ATOM   7475  O OE1 B GLN C  1 136 ? -21.13552 -43.75055  101.74571 0.164 43.41553  ? 116  GLN B OE1 1 
ATOM   7476  N NE2 A GLN C  1 136 ? -17.20327 -44.17008  103.90705 0.836 44.69649  ? 116  GLN B NE2 1 
ATOM   7477  N NE2 B GLN C  1 136 ? -19.86577 -42.11106  102.61312 0.164 41.16967  ? 116  GLN B NE2 1 
ATOM   7478  N N   . ASN C  1 137 ? -17.00879 -44.33703  97.25938  1.000 26.25096  ? 117  ASN B N   1 
ATOM   7479  C CA  . ASN C  1 137 ? -17.50584 -44.69198  95.93691  1.000 28.87955  ? 117  ASN B CA  1 
ATOM   7480  C C   . ASN C  1 137 ? -16.48259 -45.48766  95.14977  1.000 30.94312  ? 117  ASN B C   1 
ATOM   7481  O O   . ASN C  1 137 ? -16.54197 -45.53450  93.91639  1.000 28.38291  ? 117  ASN B O   1 
ATOM   7482  C CB  . ASN C  1 137 ? -17.94081 -43.42507  95.20315  1.000 26.38947  ? 117  ASN B CB  1 
ATOM   7483  C CG  . ASN C  1 137 ? -19.15256 -42.78941  95.86331  1.000 28.73018  ? 117  ASN B CG  1 
ATOM   7484  O OD1 . ASN C  1 137 ? -20.22902 -43.39821  95.91756  1.000 28.42153  ? 117  ASN B OD1 1 
ATOM   7485  N ND2 . ASN C  1 137 ? -18.97494 -41.60037  96.41798  1.000 28.35364  ? 117  ASN B ND2 1 
ATOM   7486  N N   . ILE C  1 138 ? -15.55713 -46.14079  95.85643  1.000 32.18805  ? 118  ILE B N   1 
ATOM   7487  C CA  . ILE C  1 138 ? -14.58529 -47.02064  95.20740  1.000 33.01545  ? 118  ILE B CA  1 
ATOM   7488  C C   . ILE C  1 138 ? -15.28191 -48.14233  94.45130  1.000 35.30454  ? 118  ILE B C   1 
ATOM   7489  O O   . ILE C  1 138 ? -14.80335 -48.58086  93.39731  1.000 37.20121  ? 118  ILE B O   1 
ATOM   7490  C CB  . ILE C  1 138 ? -13.59646 -47.56848  96.26301  1.000 33.22626  ? 118  ILE B CB  1 
ATOM   7491  C CG1 . ILE C  1 138 ? -12.60132 -46.47734  96.67996  1.000 36.09639  ? 118  ILE B CG1 1 
ATOM   7492  C CG2 . ILE C  1 138 ? -12.85915 -48.77775  95.74897  1.000 33.98570  ? 118  ILE B CG2 1 
ATOM   7493  C CD1 . ILE C  1 138 ? -11.41716 -46.99704  97.53340  1.000 38.24987  ? 118  ILE B CD1 1 
ATOM   7494  N N   . ASP C  1 139 ? -16.41570 -48.62472  94.96328  1.000 35.65005  ? 119  ASP B N   1 
ATOM   7495  C CA  . ASP C  1 139 ? -17.12418 -49.71280  94.30049  1.000 34.90535  ? 119  ASP B CA  1 
ATOM   7496  C C   . ASP C  1 139 ? -17.83285 -49.26021  93.03320  1.000 34.06829  ? 119  ASP B C   1 
ATOM   7497  O O   . ASP C  1 139 ? -18.28145 -50.11593  92.26410  1.000 33.69232  ? 119  ASP B O   1 
ATOM   7498  C CB  . ASP C  1 139 ? -18.12442 -50.37168  95.26769  1.000 39.43009  ? 119  ASP B CB  1 
ATOM   7499  C CG  . ASP C  1 139 ? -19.17129 -49.40119  95.79518  1.000 45.31004  ? 119  ASP B CG  1 
ATOM   7500  O OD1 . ASP C  1 139 ? -19.00512 -48.17301  95.61274  1.000 45.96747  ? 119  ASP B OD1 1 
ATOM   7501  O OD2 . ASP C  1 139 ? -20.16266 -49.86424  96.40396  1.000 49.53340  ? 119  ASP B OD2 1 
ATOM   7502  N N   . ILE C  1 140 ? -17.96027 -47.95151  92.81055  1.000 34.50994  ? 120  ILE B N   1 
ATOM   7503  C CA  . ILE C  1 140 ? -18.41820 -47.42925  91.52415  1.000 36.22852  ? 120  ILE B CA  1 
ATOM   7504  C C   . ILE C  1 140 ? -17.24212 -47.28217  90.56171  1.000 34.93926  ? 120  ILE B C   1 
ATOM   7505  O O   . ILE C  1 140 ? -17.34748 -47.60738  89.37045  1.000 33.82659  ? 120  ILE B O   1 
ATOM   7506  C CB  . ILE C  1 140 ? -19.14146 -46.08300  91.71996  1.000 33.53288  ? 120  ILE B CB  1 
ATOM   7507  C CG1 . ILE C  1 140 ? -20.30661 -46.22787  92.69620  1.000 41.93595  ? 120  ILE B CG1 1 
ATOM   7508  C CG2 . ILE C  1 140 ? -19.56147 -45.49520  90.36723  1.000 28.04228  ? 120  ILE B CG2 1 
ATOM   7509  C CD1 . ILE C  1 140 ? -21.59664 -46.63607  92.05709  1.000 47.25979  ? 120  ILE B CD1 1 
ATOM   7510  N N   . ILE C  1 141 ? -16.10346 -46.82166  91.07601  1.000 34.42053  ? 121  ILE B N   1 
ATOM   7511  C CA  . ILE C  1 141 ? -14.92565 -46.58581  90.24483  1.000 33.14702  ? 121  ILE B CA  1 
ATOM   7512  C C   . ILE C  1 141 ? -14.34458 -47.89788  89.72699  1.000 35.63063  ? 121  ILE B C   1 
ATOM   7513  O O   . ILE C  1 141 ? -14.13090 -48.06187  88.51905  1.000 32.32475  ? 121  ILE B O   1 
ATOM   7514  C CB  . ILE C  1 141 ? -13.87500 -45.78533  91.03328  1.000 31.89041  ? 121  ILE B CB  1 
ATOM   7515  C CG1 . ILE C  1 141 ? -14.39287 -44.38788  91.36093  1.000 26.78957  ? 121  ILE B CG1 1 
ATOM   7516  C CG2 . ILE C  1 141 ? -12.57022 -45.72142  90.25466  1.000 30.83455  ? 121  ILE B CG2 1 
ATOM   7517  C CD1 . ILE C  1 141 ? -13.63845 -43.69539  92.52053  1.000 25.37360  ? 121  ILE B CD1 1 
ATOM   7518  N N   . GLU C  1 142 ? -14.07052 -48.85085  90.62498  1.000 37.27071  ? 122  GLU B N   1 
ATOM   7519  C CA  . GLU C  1 142 ? -13.30061 -50.03254  90.23154  1.000 38.23706  ? 122  GLU B CA  1 
ATOM   7520  C C   . GLU C  1 142 ? -13.91853 -50.84930  89.09660  1.000 36.89928  ? 122  GLU B C   1 
ATOM   7521  O O   . GLU C  1 142 ? -13.15073 -51.33059  88.24372  1.000 35.83313  ? 122  GLU B O   1 
ATOM   7522  C CB  . GLU C  1 142 ? -13.03235 -50.90667  91.46581  1.000 43.77503  ? 122  GLU B CB  1 
ATOM   7523  C CG  . GLU C  1 142 ? -12.13299 -50.20280  92.49161  1.000 46.97650  ? 122  GLU B CG  1 
ATOM   7524  C CD  . GLU C  1 142 ? -11.52479 -51.13831  93.54320  1.000 51.25396  ? 122  GLU B CD  1 
ATOM   7525  O OE1 . GLU C  1 142 ? -10.34270 -50.93903  93.91179  1.000 50.90107  ? 122  GLU B OE1 1 
ATOM   7526  O OE2 . GLU C  1 142 ? -12.23544 -52.05310  94.02022  1.000 53.43276  ? 122  GLU B OE2 1 
ATOM   7527  N N   . PRO C  1 143 ? -15.24419 -51.04048  88.99810  1.000 37.12149  ? 123  PRO B N   1 
ATOM   7528  C CA  . PRO C  1 143 ? -15.77619 -51.72092  87.80899  1.000 34.29223  ? 123  PRO B CA  1 
ATOM   7529  C C   . PRO C  1 143 ? -15.33193 -51.08492  86.51873  1.000 32.72701  ? 123  PRO B C   1 
ATOM   7530  O O   . PRO C  1 143 ? -15.19991 -51.78242  85.50338  1.000 31.56397  ? 123  PRO B O   1 
ATOM   7531  C CB  . PRO C  1 143 ? -17.29872 -51.60808  87.98364  1.000 39.18517  ? 123  PRO B CB  1 
ATOM   7532  C CG  . PRO C  1 143 ? -17.49518 -51.54211  89.46684  1.000 40.01499  ? 123  PRO B CG  1 
ATOM   7533  C CD  . PRO C  1 143 ? -16.30235 -50.78163  89.99636  1.000 40.28930  ? 123  PRO B CD  1 
ATOM   7534  N N   . TYR C  1 144 ? -15.11620 -49.76450  86.51639  1.000 27.41451  ? 124  TYR B N   1 
ATOM   7535  C CA  . TYR C  1 144 ? -14.71487 -49.09062  85.28786  1.000 30.02801  ? 124  TYR B CA  1 
ATOM   7536  C C   . TYR C  1 144 ? -13.22475 -49.23280  85.02848  1.000 33.64936  ? 124  TYR B C   1 
ATOM   7537  O O   . TYR C  1 144 ? -12.79412 -49.07243  83.88013  1.000 31.36133  ? 124  TYR B O   1 
ATOM   7538  C CB  . TYR C  1 144 ? -15.06204 -47.60639  85.33131  1.000 23.93945  ? 124  TYR B CB  1 
ATOM   7539  C CG  . TYR C  1 144 ? -16.51828 -47.24308  85.44776  1.000 21.09892  ? 124  TYR B CG  1 
ATOM   7540  C CD1 . TYR C  1 144 ? -17.50950 -47.92668  84.72410  1.000 22.76231  ? 124  TYR B CD1 1 
ATOM   7541  C CD2 . TYR C  1 144 ? -16.90697 -46.17290  86.23893  1.000 24.51898  ? 124  TYR B CD2 1 
ATOM   7542  C CE1 . TYR C  1 144 ? -18.86344 -47.54984  84.83593  1.000 25.18741  ? 124  TYR B CE1 1 
ATOM   7543  C CE2 . TYR C  1 144 ? -18.23576 -45.79543  86.35844  1.000 24.24699  ? 124  TYR B CE2 1 
ATOM   7544  C CZ  . TYR C  1 144 ? -19.20332 -46.47684  85.65632  1.000 25.43124  ? 124  TYR B CZ  1 
ATOM   7545  O OH  . TYR C  1 144 ? -20.50556 -46.07419  85.78891  1.000 23.90197  ? 124  TYR B OH  1 
ATOM   7546  N N   . ALA C  1 145 ? -12.44534 -49.51420  86.07089  1.000 31.61591  ? 125  ALA B N   1 
ATOM   7547  C CA  . ALA C  1 145 ? -10.99899 -49.69042  85.98052  1.000 28.95845  ? 125  ALA B CA  1 
ATOM   7548  C C   . ALA C  1 145 ? -10.29267 -48.60223  85.16482  1.000 25.94560  ? 125  ALA B C   1 
ATOM   7549  O O   . ALA C  1 145 ? -9.47357  -48.90598  84.29726  1.000 24.66424  ? 125  ALA B O   1 
ATOM   7550  C CB  . ALA C  1 145 ? -10.66835 -51.06276  85.40893  1.000 27.94615  ? 125  ALA B CB  1 
ATOM   7551  N N   . PRO C  1 146 ? -10.58051 -47.32789  85.41655  1.000 25.26404  ? 126  PRO B N   1 
ATOM   7552  C CA  . PRO C  1 146 ? -9.84586  -46.28407  84.68639  1.000 23.80815  ? 126  PRO B CA  1 
ATOM   7553  C C   . PRO C  1 146 ? -8.38221  -46.33603  85.10013  1.000 28.21345  ? 126  PRO B C   1 
ATOM   7554  O O   . PRO C  1 146 ? -8.04848  -46.68748  86.24178  1.000 29.99947  ? 126  PRO B O   1 
ATOM   7555  C CB  . PRO C  1 146 ? -10.51753 -44.98563  85.14352  1.000 22.07809  ? 126  PRO B CB  1 
ATOM   7556  C CG  . PRO C  1 146 ? -10.89644 -45.29518  86.56991  1.000 25.45739  ? 126  PRO B CG  1 
ATOM   7557  C CD  . PRO C  1 146 ? -11.24885 -46.78742  86.61065  1.000 27.31477  ? 126  PRO B CD  1 
ATOM   7558  N N   . GLU C  1 147 ? -7.49314  -46.01275  84.15532  1.000 26.02379  ? 127  GLU B N   1 
ATOM   7559  C CA  . GLU C  1 147 ? -6.07189  -45.98114  84.50354  1.000 28.42200  ? 127  GLU B CA  1 
ATOM   7560  C C   . GLU C  1 147 ? -5.74766  -44.80378  85.41543  1.000 21.49000  ? 127  GLU B C   1 
ATOM   7561  O O   . GLU C  1 147 ? -4.91819  -44.92592  86.32365  1.000 22.37621  ? 127  GLU B O   1 
ATOM   7562  C CB  . GLU C  1 147 ? -5.21553  -45.91368  83.24446  1.000 35.17832  ? 127  GLU B CB  1 
ATOM   7563  C CG  . GLU C  1 147 ? -3.73855  -46.25781  83.47345  1.000 43.13602  ? 127  GLU B CG  1 
ATOM   7564  C CD  . GLU C  1 147 ? -3.52373  -47.65231  84.06224  1.000 47.41275  ? 127  GLU B CD  1 
ATOM   7565  O OE1 . GLU C  1 147 ? -4.43465  -48.50105  83.92535  1.000 49.69151  ? 127  GLU B OE1 1 
ATOM   7566  O OE2 . GLU C  1 147 ? -2.44083  -47.89413  84.66004  1.000 47.59526  ? 127  GLU B OE2 1 
ATOM   7567  N N   . TYR C  1 148 ? -6.40359  -43.67928  85.20124  1.000 19.56035  ? 128  TYR B N   1 
ATOM   7568  C CA  . TYR C  1 148 ? -6.10777  -42.43588  85.91937  1.000 21.08255  ? 128  TYR B CA  1 
ATOM   7569  C C   . TYR C  1 148 ? -7.38002  -41.84147  86.49158  1.000 25.06837  ? 128  TYR B C   1 
ATOM   7570  O O   . TYR C  1 148 ? -8.46369  -42.01816  85.91837  1.000 19.90560  ? 128  TYR B O   1 
ATOM   7571  C CB  . TYR C  1 148 ? -5.46858  -41.40588  85.00008  1.000 22.22048  ? 128  TYR B CB  1 
ATOM   7572  C CG  . TYR C  1 148 ? -4.41672  -41.99683  84.11393  1.000 21.20777  ? 128  TYR B CG  1 
ATOM   7573  C CD1 . TYR C  1 148 ? -3.17957  -42.37990  84.63419  1.000 24.37516  ? 128  TYR B CD1 1 
ATOM   7574  C CD2 . TYR C  1 148 ? -4.65709  -42.17979  82.76850  1.000 24.30634  ? 128  TYR B CD2 1 
ATOM   7575  C CE1 . TYR C  1 148 ? -2.21257  -42.95520  83.81914  1.000 31.79409  ? 128  TYR B CE1 1 
ATOM   7576  C CE2 . TYR C  1 148 ? -3.69926  -42.75601  81.93763  1.000 28.77128  ? 128  TYR B CE2 1 
ATOM   7577  C CZ  . TYR C  1 148 ? -2.47618  -43.12757  82.47000  1.000 35.37210  ? 128  TYR B CZ  1 
ATOM   7578  O OH  . TYR C  1 148 ? -1.52532  -43.68270  81.64031  1.000 45.15610  ? 128  TYR B OH  1 
ATOM   7579  N N   . MET C  1 149 ? -7.23029  -41.12562  87.62050  1.000 23.20572  ? 129  MET B N   1 
ATOM   7580  C CA  . MET C  1 149 ? -8.29361  -40.33818  88.23282  1.000 24.38606  ? 129  MET B CA  1 
ATOM   7581  C C   . MET C  1 149 ? -7.87244  -38.88441  88.21783  1.000 25.87043  ? 129  MET B C   1 
ATOM   7582  O O   . MET C  1 149 ? -6.73755  -38.56957  88.58463  1.000 23.86232  ? 129  MET B O   1 
ATOM   7583  C CB  . MET C  1 149 ? -8.55999  -40.75579  89.67067  1.000 28.46845  ? 129  MET B CB  1 
ATOM   7584  C CG  . MET C  1 149 ? -8.95810  -42.18016  89.77520  1.000 28.79314  ? 129  MET B CG  1 
ATOM   7585  S SD  . MET C  1 149 ? -10.66802 -42.37677  89.28429  1.000 27.35342  ? 129  MET B SD  1 
ATOM   7586  C CE  . MET C  1 149 ? -11.41628 -41.68984  90.75595  1.000 30.37716  ? 129  MET B CE  1 
ATOM   7587  N N   . VAL C  1 150 ? -8.77125  -38.01552  87.76559  1.000 20.70781  ? 130  VAL B N   1 
ATOM   7588  C CA  . VAL C  1 150 ? -8.59224  -36.56894  87.79644  1.000 23.88030  ? 130  VAL B CA  1 
ATOM   7589  C C   . VAL C  1 150 ? -9.60899  -36.02219  88.78897  1.000 23.26425  ? 130  VAL B C   1 
ATOM   7590  O O   . VAL C  1 150 ? -10.81609 -36.00798  88.49404  1.000 23.93882  ? 130  VAL B O   1 
ATOM   7591  C CB  . VAL C  1 150 ? -8.79844  -35.95572  86.40853  1.000 19.97267  ? 130  VAL B CB  1 
ATOM   7592  C CG1 . VAL C  1 150 ? -8.62311  -34.44476  86.45059  1.000 19.90842  ? 130  VAL B CG1 1 
ATOM   7593  C CG2 . VAL C  1 150 ? -7.94911  -36.62862  85.37895  1.000 18.97655  ? 130  VAL B CG2 1 
ATOM   7594  N N   . ILE C  1 151 ? -9.14403  -35.62214  89.98676  1.000 23.06952  ? 131  ILE B N   1 
ATOM   7595  C CA  . ILE C  1 151 ? -10.00319 -35.06267  91.02195  1.000 24.79278  ? 131  ILE B CA  1 
ATOM   7596  C C   . ILE C  1 151 ? -10.14556 -33.57567  90.74807  1.000 27.05578  ? 131  ILE B C   1 
ATOM   7597  O O   . ILE C  1 151 ? -9.13744  -32.88578  90.57811  1.000 24.92187  ? 131  ILE B O   1 
ATOM   7598  C CB  . ILE C  1 151 ? -9.41777  -35.29191  92.43029  1.000 25.42831  ? 131  ILE B CB  1 
ATOM   7599  C CG1 . ILE C  1 151 ? -9.06679  -36.76786  92.66254  1.000 24.32516  ? 131  ILE B CG1 1 
ATOM   7600  C CG2 . ILE C  1 151 ? -10.38819 -34.77462  93.50571  1.000 25.27055  ? 131  ILE B CG2 1 
ATOM   7601  C CD1 . ILE C  1 151 ? -10.16363 -37.72892  92.37038  1.000 22.10263  ? 131  ILE B CD1 1 
ATOM   7602  N N   . LEU C  1 152 ? -11.38985 -33.06706  90.73920  1.000 22.53478  ? 132  LEU B N   1 
ATOM   7603  C CA  . LEU C  1 152 ? -11.66194 -31.70945  90.28913  1.000 20.78841  ? 132  LEU B CA  1 
ATOM   7604  C C   . LEU C  1 152 ? -12.46446 -30.96316  91.35029  1.000 23.10957  ? 132  LEU B C   1 
ATOM   7605  O O   . LEU C  1 152 ? -13.36246 -31.53313  91.98137  1.000 23.12563  ? 132  LEU B O   1 
ATOM   7606  C CB  . LEU C  1 152 ? -12.41667 -31.72239  88.93824  1.000 15.63958  ? 132  LEU B CB  1 
ATOM   7607  C CG  . LEU C  1 152 ? -11.70982 -32.27666  87.70590  1.000 17.53612  ? 132  LEU B CG  1 
ATOM   7608  C CD1 . LEU C  1 152 ? -12.59569 -32.17750  86.46492  1.000 17.70456  ? 132  LEU B CD1 1 
ATOM   7609  C CD2 . LEU C  1 152 ? -10.38590 -31.51432  87.48580  1.000 16.48557  ? 132  LEU B CD2 1 
ATOM   7610  N N   . ALA C  1 153 ? -12.12718 -29.69563  91.59226  1.000 22.03556  ? 133  ALA B N   1 
ATOM   7611  C CA  . ALA C  1 153 ? -13.00231 -28.85638  92.40352  1.000 21.54327  ? 133  ALA B CA  1 
ATOM   7612  C C   . ALA C  1 153 ? -14.18499 -28.42032  91.54098  1.000 20.95780  ? 133  ALA B C   1 
ATOM   7613  O O   . ALA C  1 153 ? -14.00433 -27.96413  90.40328  1.000 23.29605  ? 133  ALA B O   1 
ATOM   7614  C CB  . ALA C  1 153 ? -12.23280 -27.64353  92.93615  1.000 20.70366  ? 133  ALA B CB  1 
ATOM   7615  N N   . GLY C  1 154 ? -15.38954 -28.61419  92.03666  1.000 21.04707  ? 134  GLY B N   1 
ATOM   7616  C CA  . GLY C  1 154 ? -16.49597 -28.24691  91.17444  1.000 20.52163  ? 134  GLY B CA  1 
ATOM   7617  C C   . GLY C  1 154 ? -17.05568 -26.85627  91.38145  1.000 19.65108  ? 134  GLY B C   1 
ATOM   7618  O O   . GLY C  1 154 ? -18.16770 -26.59078  90.90641  1.000 19.34416  ? 134  GLY B O   1 
ATOM   7619  N N   . ASP C  1 155 ? -16.33109 -25.95200  92.05647  1.000 19.38800  ? 135  ASP B N   1 
ATOM   7620  C CA  . ASP C  1 155 ? -16.88344 -24.65181  92.42809  1.000 21.26609  ? 135  ASP B CA  1 
ATOM   7621  C C   . ASP C  1 155 ? -16.07596 -23.48562  91.86763  1.000 20.65573  ? 135  ASP B C   1 
ATOM   7622  O O   . ASP C  1 155 ? -16.14811 -22.37277  92.40011  1.000 22.92045  ? 135  ASP B O   1 
ATOM   7623  C CB  . ASP C  1 155 ? -16.99678 -24.54658  93.94416  1.000 24.69574  ? 135  ASP B CB  1 
ATOM   7624  C CG  . ASP C  1 155 ? -15.63329 -24.43848  94.64892  1.000 26.67098  ? 135  ASP B CG  1 
ATOM   7625  O OD1 . ASP C  1 155 ? -14.75390 -25.28739  94.39973  1.000 25.71905  ? 135  ASP B OD1 1 
ATOM   7626  O OD2 . ASP C  1 155 ? -15.47091 -23.52863  95.50253  1.000 25.87453  ? 135  ASP B OD2 1 
ATOM   7627  N N   . HIS C  1 156 ? -15.28788 -23.71014  90.81824  1.000 19.51363  ? 136  HIS B N   1 
ATOM   7628  C CA  . HIS C  1 156 ? -14.51072 -22.63248  90.20896  1.000 22.51652  ? 136  HIS B CA  1 
ATOM   7629  C C   . HIS C  1 156 ? -14.89994 -22.49908  88.74512  1.000 21.52987  ? 136  HIS B C   1 
ATOM   7630  O O   . HIS C  1 156 ? -15.37663 -23.44602  88.12554  1.000 19.03614  ? 136  HIS B O   1 
ATOM   7631  C CB  . HIS C  1 156 ? -12.99740 -22.87473  90.29216  1.000 22.09759  ? 136  HIS B CB  1 
ATOM   7632  C CG  . HIS C  1 156 ? -12.47833 -23.12025  91.68354  1.000 22.81074  ? 136  HIS B CG  1 
ATOM   7633  N ND1 . HIS C  1 156 ? -11.46797 -24.02390  91.94426  1.000 23.85905  ? 136  HIS B ND1 1 
ATOM   7634  C CD2 . HIS C  1 156 ? -12.82417 -22.59363  92.88063  1.000 24.01857  ? 136  HIS B CD2 1 
ATOM   7635  C CE1 . HIS C  1 156 ? -11.21291 -24.04718  93.24217  1.000 26.45010  ? 136  HIS B CE1 1 
ATOM   7636  N NE2 . HIS C  1 156 ? -12.02192 -23.18843  93.83578  1.000 25.16965  ? 136  HIS B NE2 1 
ATOM   7637  N N   . ILE C  1 157 ? -14.68732 -21.30402  88.20090  1.000 18.85683  ? 137  ILE B N   1 
ATOM   7638  C CA  . ILE C  1 157 ? -14.93746 -20.99203  86.80175  1.000 18.76598  ? 137  ILE B CA  1 
ATOM   7639  C C   . ILE C  1 157 ? -13.59938 -20.90537  86.08996  1.000 23.47641  ? 137  ILE B C   1 
ATOM   7640  O O   . ILE C  1 157 ? -12.79529 -20.02270  86.40987  1.000 25.13883  ? 137  ILE B O   1 
ATOM   7641  C CB  . ILE C  1 157 ? -15.72109 -19.68148  86.65733  1.000 18.28155  ? 137  ILE B CB  1 
ATOM   7642  C CG1 . ILE C  1 157 ? -17.04183 -19.81983  87.42044  1.000 27.46668  ? 137  ILE B CG1 1 
ATOM   7643  C CG2 . ILE C  1 157 ? -16.04187 -19.43010  85.16117  1.000 18.34677  ? 137  ILE B CG2 1 
ATOM   7644  C CD1 . ILE C  1 157 ? -17.42068 -18.59323  88.14963  1.000 29.53210  ? 137  ILE B CD1 1 
ATOM   7645  N N   . TYR C  1 158 ? -13.36084 -21.79905  85.12124  1.000 18.43747  ? 138  TYR B N   1 
ATOM   7646  C CA  . TYR C  1 158 ? -12.07121 -21.83914  84.41296  1.000 18.50219  ? 138  TYR B CA  1 
ATOM   7647  C C   . TYR C  1 158 ? -12.16102 -22.84058  83.28048  1.000 20.72387  ? 138  TYR B C   1 
ATOM   7648  O O   . TYR C  1 158 ? -12.97577 -23.76841  83.32213  1.000 18.88522  ? 138  TYR B O   1 
ATOM   7649  C CB  . TYR C  1 158 ? -10.92837 -22.22493  85.35745  1.000 19.06675  ? 138  TYR B CB  1 
ATOM   7650  C CG  . TYR C  1 158 ? -10.95075 -23.67722  85.77025  1.000 19.37255  ? 138  TYR B CG  1 
ATOM   7651  C CD1 . TYR C  1 158 ? -10.04849 -24.61667  85.20835  1.000 21.44829  ? 138  TYR B CD1 1 
ATOM   7652  C CD2 . TYR C  1 158 ? -11.87183 -24.13921  86.71083  1.000 18.35782  ? 138  TYR B CD2 1 
ATOM   7653  C CE1 . TYR C  1 158 ? -10.06391 -25.94976  85.59442  1.000 20.76898  ? 138  TYR B CE1 1 
ATOM   7654  C CE2 . TYR C  1 158 ? -11.90508 -25.51105  87.08586  1.000 18.28707  ? 138  TYR B CE2 1 
ATOM   7655  C CZ  . TYR C  1 158 ? -11.00337 -26.40278  86.52161  1.000 22.26421  ? 138  TYR B CZ  1 
ATOM   7656  O OH  . TYR C  1 158 ? -11.04672 -27.73773  86.91252  1.000 23.30104  ? 138  TYR B OH  1 
ATOM   7657  N N   . LYS C  1 159 ? -11.30410 -22.66566  82.27282  1.000 20.14182  ? 139  LYS B N   1 
ATOM   7658  C CA  . LYS C  1 159 ? -11.17932 -23.63482  81.19342  1.000 22.28174  ? 139  LYS B CA  1 
ATOM   7659  C C   . LYS C  1 159 ? -9.77375  -24.21056  81.14634  1.000 26.86888  ? 139  LYS B C   1 
ATOM   7660  O O   . LYS C  1 159 ? -8.78590  -23.45348  81.16666  1.000 28.47069  ? 139  LYS B O   1 
ATOM   7661  C CB  . LYS C  1 159 ? -11.57550 -23.00606  79.87146  1.000 21.55292  ? 139  LYS B CB  1 
ATOM   7662  C CG  . LYS C  1 159 ? -12.80951 -22.17842  79.98196  1.000 25.82591  ? 139  LYS B CG  1 
ATOM   7663  C CD  . LYS C  1 159 ? -13.17399 -21.66941  78.63710  1.000 27.62529  ? 139  LYS B CD  1 
ATOM   7664  C CE  . LYS C  1 159 ? -12.67646 -20.22836  78.50444  1.000 29.95000  ? 139  LYS B CE  1 
ATOM   7665  N NZ  . LYS C  1 159 ? -13.39615 -19.49631  77.44121  1.000 30.61812  ? 139  LYS B NZ  1 
ATOM   7666  N N   . MET C  1 160 ? -9.69063  -25.54682  81.10801  1.000 22.88491  ? 140  MET B N   1 
ATOM   7667  C CA  . MET C  1 160 ? -8.40762  -26.23740  81.22573  1.000 23.84775  ? 140  MET B CA  1 
ATOM   7668  C C   . MET C  1 160 ? -8.47448  -27.57161  80.50211  1.000 27.36699  ? 140  MET B C   1 
ATOM   7669  O O   . MET C  1 160 ? -9.46202  -28.29703  80.63551  1.000 23.10534  ? 140  MET B O   1 
ATOM   7670  C CB  . MET C  1 160 ? -8.05557  -26.46664  82.68981  1.000 26.21591  ? 140  MET B CB  1 
ATOM   7671  C CG  . MET C  1 160 ? -6.68884  -27.11310  82.96161  1.000 25.68189  ? 140  MET B CG  1 
ATOM   7672  S SD  . MET C  1 160 ? -6.52287  -27.08655  84.75168  1.000 30.58062  ? 140  MET B SD  1 
ATOM   7673  C CE  . MET C  1 160 ? -4.90167  -27.80083  85.01081  1.000 37.77355  ? 140  MET B CE  1 
ATOM   7674  N N   . ASP C  1 161 ? -7.42786  -27.89505  79.74024  1.000 21.03250  ? 141  ASP B N   1 
ATOM   7675  C CA  . ASP C  1 161 ? -7.34966  -29.15407  78.99497  1.000 20.34030  ? 141  ASP B CA  1 
ATOM   7676  C C   . ASP C  1 161 ? -6.51727  -30.12678  79.82643  1.000 33.08871  ? 141  ASP B C   1 
ATOM   7677  O O   . ASP C  1 161 ? -5.27979  -30.02516  79.88251  1.000 28.11071  ? 141  ASP B O   1 
ATOM   7678  C CB  . ASP C  1 161 ? -6.75625  -28.89384  77.61271  1.000 23.78694  ? 141  ASP B CB  1 
ATOM   7679  C CG  . ASP C  1 161 ? -6.59708  -30.15677  76.76109  1.000 28.47506  ? 141  ASP B CG  1 
ATOM   7680  O OD1 . ASP C  1 161 ? -6.66913  -31.29904  77.28409  1.000 24.61517  ? 141  ASP B OD1 1 
ATOM   7681  O OD2 . ASP C  1 161 ? -6.36366  -29.99003  75.54090  1.000 29.63774  ? 141  ASP B OD2 1 
ATOM   7682  N N   . TYR C  1 162 ? -7.19427  -31.09833  80.44218  1.000 28.23619  ? 142  TYR B N   1 
ATOM   7683  C CA  . TYR C  1 162 ? -6.54006  -31.99938  81.37623  1.000 28.61966  ? 142  TYR B CA  1 
ATOM   7684  C C   . TYR C  1 162 ? -5.60935  -33.01181  80.70193  1.000 28.65922  ? 142  TYR B C   1 
ATOM   7685  O O   . TYR C  1 162 ? -4.86060  -33.69422  81.41391  1.000 29.08276  ? 142  TYR B O   1 
ATOM   7686  C CB  . TYR C  1 162 ? -7.59535  -32.74845  82.20304  1.000 28.15944  ? 142  TYR B CB  1 
ATOM   7687  C CG  . TYR C  1 162 ? -8.57229  -31.84028  82.92404  1.000 28.09949  ? 142  TYR B CG  1 
ATOM   7688  C CD1 . TYR C  1 162 ? -8.14433  -30.79514  83.71834  1.000 28.79052  ? 142  TYR B CD1 1 
ATOM   7689  C CD2 . TYR C  1 162 ? -9.94622  -32.03297  82.78454  1.000 27.34118  ? 142  TYR B CD2 1 
ATOM   7690  C CE1 . TYR C  1 162 ? -9.03873  -29.97093  84.36987  1.000 33.44443  ? 142  TYR B CE1 1 
ATOM   7691  C CE2 . TYR C  1 162 ? -10.85107 -31.20710  83.41848  1.000 27.28446  ? 142  TYR B CE2 1 
ATOM   7692  C CZ  . TYR C  1 162 ? -10.39701 -30.17534  84.21578  1.000 27.98920  ? 142  TYR B CZ  1 
ATOM   7693  O OH  . TYR C  1 162 ? -11.28331 -29.34469  84.86346  1.000 27.95883  ? 142  TYR B OH  1 
ATOM   7694  N N   . GLU C  1 163 ? -5.64354  -33.14956  79.37143  1.000 28.23325  ? 143  GLU B N   1 
ATOM   7695  C CA  . GLU C  1 163 ? -4.67453  -34.02287  78.70261  1.000 30.52199  ? 143  GLU B CA  1 
ATOM   7696  C C   . GLU C  1 163 ? -3.24085  -33.62408  79.05096  1.000 30.71447  ? 143  GLU B C   1 
ATOM   7697  O O   . GLU C  1 163 ? -2.39368  -34.49342  79.30716  1.000 29.57061  ? 143  GLU B O   1 
ATOM   7698  C CB  . GLU C  1 163 ? -4.90246  -33.99413  77.18754  1.000 32.72507  ? 143  GLU B CB  1 
ATOM   7699  C CG  . GLU C  1 163 ? -4.10998  -35.02839  76.31142  1.000 30.79779  ? 143  GLU B CG  1 
ATOM   7700  C CD  . GLU C  1 163 ? -4.36635  -36.49684  76.65799  1.000 32.59079  ? 143  GLU B CD  1 
ATOM   7701  O OE1 . GLU C  1 163 ? -3.36744  -37.25521  76.77252  1.000 30.29528  ? 143  GLU B OE1 1 
ATOM   7702  O OE2 . GLU C  1 163 ? -5.56258  -36.89549  76.79077  1.000 29.55713  ? 143  GLU B OE2 1 
ATOM   7703  N N   . TYR C  1 164 ? -2.96822  -32.31345  79.12085  1.000 29.72057  ? 144  TYR B N   1 
ATOM   7704  C CA  . TYR C  1 164 ? -1.63455  -31.83104  79.48392  1.000 30.62178  ? 144  TYR B CA  1 
ATOM   7705  C C   . TYR C  1 164 ? -1.21459  -32.34056  80.84966  1.000 32.61556  ? 144  TYR B C   1 
ATOM   7706  O O   . TYR C  1 164 ? -0.07473  -32.78208  81.04051  1.000 31.63606  ? 144  TYR B O   1 
ATOM   7707  C CB  . TYR C  1 164 ? -1.60809  -30.30166  79.47996  1.000 32.28552  ? 144  TYR B CB  1 
ATOM   7708  C CG  . TYR C  1 164 ? -1.59577  -29.72050  78.09338  1.000 38.21299  ? 144  TYR B CG  1 
ATOM   7709  C CD1 . TYR C  1 164 ? -0.40505  -29.25415  77.52192  1.000 40.94301  ? 144  TYR B CD1 1 
ATOM   7710  C CD2 . TYR C  1 164 ? -2.75449  -29.65747  77.34293  1.000 39.01715  ? 144  TYR B CD2 1 
ATOM   7711  C CE1 . TYR C  1 164 ? -0.39115  -28.72890  76.24239  1.000 43.64929  ? 144  TYR B CE1 1 
ATOM   7712  C CE2 . TYR C  1 164 ? -2.75614  -29.14296  76.05749  1.000 43.20487  ? 144  TYR B CE2 1 
ATOM   7713  C CZ  . TYR C  1 164 ? -1.56399  -28.67799  75.50453  1.000 47.89456  ? 144  TYR B CZ  1 
ATOM   7714  O OH  . TYR C  1 164 ? -1.56176  -28.15860  74.21936  1.000 49.40620  ? 144  TYR B OH  1 
ATOM   7715  N N   . MET C  1 165 ? -2.11702  -32.25737  81.82834  1.000 30.92416  ? 145  MET B N   1 
ATOM   7716  C CA  . MET C  1 165 ? -1.77978  -32.70641  83.17385  1.000 33.66534  ? 145  MET B CA  1 
ATOM   7717  C C   . MET C  1 165 ? -1.57017  -34.20889  83.21412  1.000 31.14139  ? 145  MET B C   1 
ATOM   7718  O O   . MET C  1 165 ? -0.67577  -34.69704  83.91028  1.000 34.25411  ? 145  MET B O   1 
ATOM   7719  C CB  . MET C  1 165 ? -2.87900  -32.32364  84.16201  1.000 37.63207  ? 145  MET B CB  1 
ATOM   7720  C CG  . MET C  1 165 ? -2.53418  -31.19302  85.06691  1.000 41.45572  ? 145  MET B CG  1 
ATOM   7721  S SD  . MET C  1 165 ? -3.81447  -31.00364  86.32453  1.000 43.26674  ? 145  MET B SD  1 
ATOM   7722  C CE  . MET C  1 165 ? -3.06894  -31.80874  87.73855  1.000 36.06964  ? 145  MET B CE  1 
ATOM   7723  N N   . LEU C  1 166 ? -2.41786  -34.95736  82.51688  1.000 32.56408  ? 146  LEU B N   1 
ATOM   7724  C CA  . LEU C  1 166 ? -2.22971  -36.39881  82.42876  1.000 30.10026  ? 146  LEU B CA  1 
ATOM   7725  C C   . LEU C  1 166 ? -0.86559  -36.72555  81.83213  1.000 32.05714  ? 146  LEU B C   1 
ATOM   7726  O O   . LEU C  1 166 ? -0.13748  -37.58024  82.34926  1.000 30.89593  ? 146  LEU B O   1 
ATOM   7727  C CB  . LEU C  1 166 ? -3.35668  -37.01593  81.59261  1.000 29.16088  ? 146  LEU B CB  1 
ATOM   7728  C CG  . LEU C  1 166 ? -4.73196  -37.05535  82.26197  1.000 28.64653  ? 146  LEU B CG  1 
ATOM   7729  C CD1 . LEU C  1 166 ? -5.76038  -37.54901  81.25662  1.000 27.74085  ? 146  LEU B CD1 1 
ATOM   7730  C CD2 . LEU C  1 166 ? -4.69849  -37.93349  83.49053  1.000 28.82549  ? 146  LEU B CD2 1 
ATOM   7731  N N   . GLN C  1 167 ? -0.49781  -36.03599  80.75013  1.000 33.43101  ? 147  GLN B N   1 
ATOM   7732  C CA  . GLN C  1 167 ? 0.78535   -36.29940  80.09858  1.000 32.33501  ? 147  GLN B CA  1 
ATOM   7733  C C   . GLN C  1 167 ? 1.93601   -36.05863  81.05788  1.000 33.70816  ? 147  GLN B C   1 
ATOM   7734  O O   . GLN C  1 167 ? 2.84702   -36.88539  81.17833  1.000 35.59767  ? 147  GLN B O   1 
ATOM   7735  C CB  . GLN C  1 167 ? 0.94405   -35.41619  78.86052  1.000 31.88285  ? 147  GLN B CB  1 
ATOM   7736  C CG  . GLN C  1 167 ? -0.05030  -35.64877  77.75906  1.000 37.90915  ? 147  GLN B CG  1 
ATOM   7737  C CD  . GLN C  1 167 ? 0.26737   -36.86135  76.93131  1.000 44.92113  ? 147  GLN B CD  1 
ATOM   7738  O OE1 . GLN C  1 167 ? 1.29996   -37.51719  77.12323  1.000 49.46307  ? 147  GLN B OE1 1 
ATOM   7739  N NE2 . GLN C  1 167 ? -0.62384  -37.18079  75.99987  1.000 44.68466  ? 147  GLN B NE2 1 
ATOM   7740  N N   . GLN C  1 168 ? 1.90437   -34.92531  81.76561  1.000 35.04551  ? 148  GLN B N   1 
ATOM   7741  C CA  . GLN C  1 168 ? 2.99434   -34.61175  82.67249  1.000 33.86917  ? 148  GLN B CA  1 
ATOM   7742  C C   . GLN C  1 168 ? 3.00118   -35.56649  83.85108  1.000 36.64251  ? 148  GLN B C   1 
ATOM   7743  O O   . GLN C  1 168 ? 4.07001   -35.94905  84.33564  1.000 37.93567  ? 148  GLN B O   1 
ATOM   7744  C CB  . GLN C  1 168 ? 2.90037   -33.16660  83.15432  1.000 33.67355  ? 148  GLN B CB  1 
ATOM   7745  C CG  . GLN C  1 168 ? 3.84419   -32.87886  84.33327  1.000 37.48832  ? 148  GLN B CG  1 
ATOM   7746  C CD  . GLN C  1 168 ? 3.51273   -31.61770  85.08186  1.000 41.89971  ? 148  GLN B CD  1 
ATOM   7747  O OE1 . GLN C  1 168 ? 3.58212   -31.58796  86.30605  1.000 47.51385  ? 148  GLN B OE1 1 
ATOM   7748  N NE2 . GLN C  1 168 ? 3.18422   -30.54770  84.34929  1.000 40.68455  ? 148  GLN B NE2 1 
ATOM   7749  N N   . HIS C  1 169 ? 1.82323   -35.99091  84.30513  1.000 34.51159  ? 149  HIS B N   1 
ATOM   7750  C CA  . HIS C  1 169 ? 1.77461   -36.91006  85.43403  1.000 34.51495  ? 149  HIS B CA  1 
ATOM   7751  C C   . HIS C  1 169 ? 2.48148   -38.22198  85.11542  1.000 37.84307  ? 149  HIS B C   1 
ATOM   7752  O O   . HIS C  1 169 ? 3.29240   -38.70966  85.91134  1.000 38.07663  ? 149  HIS B O   1 
ATOM   7753  C CB  . HIS C  1 169 ? 0.33611   -37.19591  85.83391  1.000 34.29873  ? 149  HIS B CB  1 
ATOM   7754  C CG  . HIS C  1 169 ? 0.24297   -38.13694  86.98734  1.000 34.51789  ? 149  HIS B CG  1 
ATOM   7755  N ND1 . HIS C  1 169 ? 0.40467   -37.72410  88.29256  1.000 35.76032  ? 149  HIS B ND1 1 
ATOM   7756  C CD2 . HIS C  1 169 ? 0.07135   -39.47986  87.03318  1.000 32.75821  ? 149  HIS B CD2 1 
ATOM   7757  C CE1 . HIS C  1 169 ? 0.30703   -38.76632  89.09648  1.000 33.77508  ? 149  HIS B CE1 1 
ATOM   7758  N NE2 . HIS C  1 169 ? 0.09398   -39.84166  88.35775  1.000 35.34773  ? 149  HIS B NE2 1 
ATOM   7759  N N   . VAL C  1 170 ? 2.15581   -38.83011  83.97078  1.000 36.31292  ? 150  VAL B N   1 
ATOM   7760  C CA  . VAL C  1 170 ? 2.74380   -40.12979  83.65737  1.000 35.70426  ? 150  VAL B CA  1 
ATOM   7761  C C   . VAL C  1 170 ? 4.22232   -39.97112  83.32835  1.000 39.85155  ? 150  VAL B C   1 
ATOM   7762  O O   . VAL C  1 170 ? 5.04765   -40.78273  83.75567  1.000 42.26936  ? 150  VAL B O   1 
ATOM   7763  C CB  . VAL C  1 170 ? 1.97538   -40.84955  82.53168  1.000 37.17464  ? 150  VAL B CB  1 
ATOM   7764  C CG1 . VAL C  1 170 ? 0.53824   -41.11509  82.93980  1.000 34.56723  ? 150  VAL B CG1 1 
ATOM   7765  C CG2 . VAL C  1 170 ? 2.01380   -40.07204  81.23849  1.000 40.41150  ? 150  VAL B CG2 1 
ATOM   7766  N N   . ASP C  1 171 ? 4.59281   -38.89903  82.62006  1.000 41.90976  ? 151  ASP B N   1 
ATOM   7767  C CA  . ASP C  1 171 ? 5.99658   -38.71163  82.25361  1.000 42.98619  ? 151  ASP B CA  1 
ATOM   7768  C C   . ASP C  1 171 ? 6.84987   -38.35118  83.46417  1.000 44.92107  ? 151  ASP B C   1 
ATOM   7769  O O   . ASP C  1 171 ? 7.99103   -38.81101  83.58753  1.000 46.87846  ? 151  ASP B O   1 
ATOM   7770  C CB  . ASP C  1 171 ? 6.12385   -37.63599  81.17707  1.000 47.02613  ? 151  ASP B CB  1 
ATOM   7771  C CG  . ASP C  1 171 ? 5.46422   -38.03344  79.86246  1.000 54.11357  ? 151  ASP B CG  1 
ATOM   7772  O OD1 . ASP C  1 171 ? 5.26753   -39.25213  79.62239  1.000 52.66713  ? 151  ASP B OD1 1 
ATOM   7773  O OD2 . ASP C  1 171 ? 5.13187   -37.11897  79.06285  1.000 58.03167  ? 151  ASP B OD2 1 
ATOM   7774  N N   . SER C  1 172 ? 6.32447   -37.53260  84.37000  1.000 42.55262  ? 152  SER B N   1 
ATOM   7775  C CA  . SER C  1 172 ? 7.07674   -37.17608  85.56216  1.000 41.55441  ? 152  SER B CA  1 
ATOM   7776  C C   . SER C  1 172 ? 7.26154   -38.34549  86.51305  1.000 42.02257  ? 152  SER B C   1 
ATOM   7777  O O   . SER C  1 172 ? 8.11954   -38.27179  87.39530  1.000 48.44506  ? 152  SER B O   1 
ATOM   7778  C CB  . SER C  1 172 ? 6.36918   -36.04916  86.31245  1.000 40.29727  ? 152  SER B CB  1 
ATOM   7779  O OG  . SER C  1 172 ? 5.30112   -36.57756  87.07935  1.000 37.63094  ? 152  SER B OG  1 
ATOM   7780  N N   . GLY C  1 173 ? 6.45942   -39.39961  86.38637  1.000 39.14844  ? 153  GLY B N   1 
ATOM   7781  C CA  . GLY C  1 173 ? 6.44857   -40.44867  87.39134  1.000 36.52247  ? 153  GLY B CA  1 
ATOM   7782  C C   . GLY C  1 173 ? 5.97909   -40.04050  88.77466  1.000 38.03324  ? 153  GLY B C   1 
ATOM   7783  O O   . GLY C  1 173 ? 6.25971   -40.74577  89.74755  1.000 42.21511  ? 153  GLY B O   1 
ATOM   7784  N N   . ALA C  1 174 ? 5.27121   -38.92378  88.89749  1.000 37.22730  ? 154  ALA B N   1 
ATOM   7785  C CA  . ALA C  1 174 ? 4.77944   -38.48056  90.19265  1.000 40.96844  ? 154  ALA B CA  1 
ATOM   7786  C C   . ALA C  1 174 ? 3.72850   -39.43055  90.75305  1.000 40.46968  ? 154  ALA B C   1 
ATOM   7787  O O   . ALA C  1 174 ? 3.03297   -40.13825  90.01137  1.000 39.87938  ? 154  ALA B O   1 
ATOM   7788  C CB  . ALA C  1 174 ? 4.17411   -37.08328  90.07804  1.000 41.54000  ? 154  ALA B CB  1 
ATOM   7789  N N   . ASP C  1 175 ? 3.60862   -39.42868  92.08377  1.000 36.45527  ? 155  ASP B N   1 
ATOM   7790  C CA  . ASP C  1 175 ? 2.45872   -40.04693  92.72685  1.000 37.69149  ? 155  ASP B CA  1 
ATOM   7791  C C   . ASP C  1 175 ? 1.22348   -39.17142  92.60113  1.000 38.76673  ? 155  ASP B C   1 
ATOM   7792  O O   . ASP C  1 175 ? 0.10178   -39.68237  92.54029  1.000 38.08861  ? 155  ASP B O   1 
ATOM   7793  C CB  . ASP C  1 175 ? 2.73185   -40.30617  94.20726  1.000 40.49846  ? 155  ASP B CB  1 
ATOM   7794  C CG  . ASP C  1 175 ? 3.85087   -41.27601  94.42984  1.000 45.46956  ? 155  ASP B CG  1 
ATOM   7795  O OD1 . ASP C  1 175 ? 4.69524   -41.01197  95.31645  1.000 49.21189  ? 155  ASP B OD1 1 
ATOM   7796  O OD2 . ASP C  1 175 ? 3.88588   -42.30326  93.72165  1.000 47.45603  ? 155  ASP B OD2 1 
ATOM   7797  N N   . VAL C  1 176 ? 1.40885   -37.85819  92.59808  1.000 38.45959  ? 156  VAL B N   1 
ATOM   7798  C CA  . VAL C  1 176 ? 0.30602   -36.91960  92.49956  1.000 36.73842  ? 156  VAL B CA  1 
ATOM   7799  C C   . VAL C  1 176 ? 0.80191   -35.70573  91.74223  1.000 37.38144  ? 156  VAL B C   1 
ATOM   7800  O O   . VAL C  1 176 ? 1.92361   -35.23314  91.95477  1.000 38.90462  ? 156  VAL B O   1 
ATOM   7801  C CB  . VAL C  1 176 ? -0.24044  -36.53899  93.89039  1.000 37.24462  ? 156  VAL B CB  1 
ATOM   7802  C CG1 . VAL C  1 176 ? 0.75276   -35.65512  94.63150  1.000 35.22751  ? 156  VAL B CG1 1 
ATOM   7803  C CG2 . VAL C  1 176 ? -1.57733  -35.81670  93.74650  1.000 36.24292  ? 156  VAL B CG2 1 
ATOM   7804  N N   . THR C  1 177 ? -0.01342  -35.23859  90.81177  1.000 33.84214  ? 157  THR B N   1 
ATOM   7805  C CA  . THR C  1 177 ? 0.24189   -33.98034  90.13624  1.000 37.34595  ? 157  THR B CA  1 
ATOM   7806  C C   . THR C  1 177 ? -0.87092  -33.02152  90.53553  1.000 35.35185  ? 157  THR B C   1 
ATOM   7807  O O   . THR C  1 177 ? -2.04872  -33.39600  90.53329  1.000 34.08185  ? 157  THR B O   1 
ATOM   7808  C CB  . THR C  1 177 ? 0.31608   -34.16548  88.62326  1.000 35.38325  ? 157  THR B CB  1 
ATOM   7809  O OG1 . THR C  1 177 ? 1.31707   -35.14612  88.31400  1.000 33.82678  ? 157  THR B OG1 1 
ATOM   7810  C CG2 . THR C  1 177 ? 0.66664   -32.85606  87.94351  1.000 33.91855  ? 157  THR B CG2 1 
ATOM   7811  N N   . ILE C  1 178 ? -0.50044  -31.80467  90.91498  1.000 34.42719  ? 158  ILE B N   1 
ATOM   7812  C CA  . ILE C  1 178 ? -1.44140  -30.86173  91.50285  1.000 34.35746  ? 158  ILE B CA  1 
ATOM   7813  C C   . ILE C  1 178 ? -1.49337  -29.62405  90.62039  1.000 42.27563  ? 158  ILE B C   1 
ATOM   7814  O O   . ILE C  1 178 ? -0.46733  -28.97096  90.39986  1.000 34.99029  ? 158  ILE B O   1 
ATOM   7815  C CB  . ILE C  1 178 ? -1.03450  -30.50429  92.93759  1.000 36.44830  ? 158  ILE B CB  1 
ATOM   7816  C CG1 . ILE C  1 178 ? -0.79266  -31.78380  93.74263  1.000 35.91000  ? 158  ILE B CG1 1 
ATOM   7817  C CG2 . ILE C  1 178 ? -2.10446  -29.59964  93.59625  1.000 34.95609  ? 158  ILE B CG2 1 
ATOM   7818  C CD1 . ILE C  1 178 ? -0.86158  -31.59931  95.24674  1.000 37.41325  ? 158  ILE B CD1 1 
ATOM   7819  N N   . GLY C  1 179 ? -2.67736  -29.31253  90.09913  1.000 38.87617  ? 159  GLY B N   1 
ATOM   7820  C CA  . GLY C  1 179 ? -2.83692  -28.09563  89.32344  1.000 33.71772  ? 159  GLY B CA  1 
ATOM   7821  C C   . GLY C  1 179 ? -2.72431  -26.86754  90.21593  1.000 40.30244  ? 159  GLY B C   1 
ATOM   7822  O O   . GLY C  1 179 ? -3.38660  -26.77324  91.25688  1.000 34.35451  ? 159  GLY B O   1 
ATOM   7823  N N   . CYS C  1 180 ? -1.88716  -25.91963  89.80635  1.000 34.89311  ? 160  CYS B N   1 
ATOM   7824  C CA  . CYS C  1 180 ? -1.54969  -24.77270  90.64560  1.000 35.61101  ? 160  CYS B CA  1 
ATOM   7825  C C   . CYS C  1 180 ? -1.71242  -23.47245  89.87688  1.000 35.65690  ? 160  CYS B C   1 
ATOM   7826  O O   . CYS C  1 180 ? -1.33198  -23.37733  88.70701  1.000 35.53267  ? 160  CYS B O   1 
ATOM   7827  C CB  . CYS C  1 180 ? -0.11418  -24.91590  91.15707  1.000 36.43883  ? 160  CYS B CB  1 
ATOM   7828  S SG  . CYS C  1 180 ? 0.02071   -26.10210  92.53543  1.000 40.26351  ? 160  CYS B SG  1 
ATOM   7829  N N   . LEU C  1 181 ? -2.26375  -22.46218  90.54507  1.000 35.85660  ? 161  LEU B N   1 
ATOM   7830  C CA  . LEU C  1 181 ? -2.26317  -21.12039  89.99744  1.000 36.07133  ? 161  LEU B CA  1 
ATOM   7831  C C   . LEU C  1 181 ? -0.95486  -20.42998  90.34180  1.000 37.02237  ? 161  LEU B C   1 
ATOM   7832  O O   . LEU C  1 181 ? -0.47992  -20.50142  91.48367  1.000 37.57435  ? 161  LEU B O   1 
ATOM   7833  C CB  . LEU C  1 181 ? -3.41295  -20.28896  90.56176  1.000 35.90475  ? 161  LEU B CB  1 
ATOM   7834  C CG  . LEU C  1 181 ? -4.84319  -20.74970  90.33286  1.000 35.00152  ? 161  LEU B CG  1 
ATOM   7835  C CD1 . LEU C  1 181 ? -5.75504  -19.87981  91.18661  1.000 35.06253  ? 161  LEU B CD1 1 
ATOM   7836  C CD2 . LEU C  1 181 ? -5.17886  -20.61401  88.85504  1.000 34.43276  ? 161  LEU B CD2 1 
ATOM   7837  N N   . GLU C  1 182 ? -0.39893  -19.72761  89.36586  1.000 37.21913  ? 162  GLU B N   1 
ATOM   7838  C CA  . GLU C  1 182 ? 0.81267   -18.92184  89.57816  1.000 45.36376  ? 162  GLU B CA  1 
ATOM   7839  C C   . GLU C  1 182 ? 0.39451   -17.47555  89.83942  1.000 46.13549  ? 162  GLU B C   1 
ATOM   7840  O O   . GLU C  1 182 ? 0.09689   -16.72288  88.90996  1.000 60.55496  ? 162  GLU B O   1 
ATOM   7841  C CB  . GLU C  1 182 ? 1.75323   -19.02168  88.38490  1.000 45.21925  ? 162  GLU B CB  1 
ATOM   7842  C CG  . GLU C  1 182 ? 3.10546   -18.40229  88.68007  1.000 55.18352  ? 162  GLU B CG  1 
ATOM   7843  C CD  . GLU C  1 182 ? 4.03865   -18.40477  87.48803  1.000 63.63112  ? 162  GLU B CD  1 
ATOM   7844  O OE1 . GLU C  1 182 ? 4.25444   -19.48909  86.89384  1.000 64.15816  ? 162  GLU B OE1 1 
ATOM   7845  O OE2 . GLU C  1 182 ? 4.58900   -17.32725  87.17386  1.000 69.18624  ? 162  GLU B OE2 1 
ATOM   7846  N N   . VAL C  1 183 ? 0.39743   -17.08338  91.10770  1.000 40.48496  ? 163  VAL B N   1 
ATOM   7847  C CA  . VAL C  1 183 ? -0.18133  -15.80602  91.51899  1.000 41.33832  ? 163  VAL B CA  1 
ATOM   7848  C C   . VAL C  1 183 ? 0.85386   -15.00486  92.29996  1.000 41.44659  ? 163  VAL B C   1 
ATOM   7849  O O   . VAL C  1 183 ? 1.77122   -15.57087  92.91259  1.000 40.58842  ? 163  VAL B O   1 
ATOM   7850  C CB  . VAL C  1 183 ? -1.44449  -16.01415  92.37832  1.000 38.68373  ? 163  VAL B CB  1 
ATOM   7851  C CG1 . VAL C  1 183 ? -2.50232  -16.73814  91.55840  1.000 40.54903  ? 163  VAL B CG1 1 
ATOM   7852  C CG2 . VAL C  1 183 ? -1.08164  -16.81126  93.61951  1.000 38.99215  ? 163  VAL B CG2 1 
ATOM   7853  N N   . PRO C  1 184 ? 0.70399   -13.67915  92.33458  1.000 40.46890  ? 164  PRO B N   1 
ATOM   7854  C CA  . PRO C  1 184 ? 1.53903   -12.86630  93.22717  1.000 42.68171  ? 164  PRO B CA  1 
ATOM   7855  C C   . PRO C  1 184 ? 1.41243   -13.31220  94.67967  1.000 43.62266  ? 164  PRO B C   1 
ATOM   7856  O O   . PRO C  1 184 ? 0.31871   -13.61080  95.16609  1.000 43.10600  ? 164  PRO B O   1 
ATOM   7857  C CB  . PRO C  1 184 ? 0.99686   -11.45002  93.02676  1.000 41.53306  ? 164  PRO B CB  1 
ATOM   7858  C CG  . PRO C  1 184 ? 0.33011   -11.46793  91.69451  1.000 43.88792  ? 164  PRO B CG  1 
ATOM   7859  C CD  . PRO C  1 184 ? -0.20704  -12.85802  91.51299  1.000 44.10739  ? 164  PRO B CD  1 
ATOM   7860  N N   . ARG C  1 185 ? 2.54884   -13.32338  95.38083  1.000 42.40875  ? 165  ARG B N   1 
ATOM   7861  C CA  . ARG C  1 185 ? 2.60443   -13.89982  96.72581  1.000 42.65206  ? 165  ARG B CA  1 
ATOM   7862  C C   . ARG C  1 185 ? 1.54806   -13.31815  97.66504  1.000 42.59045  ? 165  ARG B C   1 
ATOM   7863  O O   . ARG C  1 185 ? 0.90937   -14.06551  98.41621  1.000 42.26402  ? 165  ARG B O   1 
ATOM   7864  C CB  . ARG C  1 185 ? 3.99291   -13.70004  97.33417  1.000 54.44424  ? 165  ARG B CB  1 
ATOM   7865  C CG  . ARG C  1 185 ? 5.12014   -14.44918  96.66713  1.000 43.73028  ? 165  ARG B CG  1 
ATOM   7866  C CD  . ARG C  1 185 ? 6.37603   -14.62034  97.58887  1.000 44.58364  ? 165  ARG B CD  1 
ATOM   7867  N NE  . ARG C  1 185 ? 6.43377   -13.75941  98.78179  1.000 45.23258  ? 165  ARG B NE  1 
ATOM   7868  C CZ  . ARG C  1 185 ? 6.60068   -12.43588  98.77549  1.000 52.41098  ? 165  ARG B CZ  1 
ATOM   7869  N NH1 . ARG C  1 185 ? 6.70861   -11.75675  97.63371  1.000 50.96970  ? 165  ARG B NH1 1 
ATOM   7870  N NH2 . ARG C  1 185 ? 6.64053   -11.77937  99.92540  1.000 52.32749  ? 165  ARG B NH2 1 
ATOM   7871  N N   . MET C  1 186 ? 1.35064   -11.99165  97.65602  1.000 42.91590  ? 166  MET B N   1 
ATOM   7872  C CA  . MET C  1 186 ? 0.33262   -11.42456  98.53794  1.000 50.51738  ? 166  MET B CA  1 
ATOM   7873  C C   . MET C  1 186 ? -1.07274  -11.89935  98.18049  1.000 50.85601  ? 166  MET B C   1 
ATOM   7874  O O   . MET C  1 186 ? -1.95929  -11.89214  99.04349  1.000 49.82468  ? 166  MET B O   1 
ATOM   7875  C CB  . MET C  1 186 ? 0.36572   -9.89229   98.53594  1.000 56.02535  ? 166  MET B CB  1 
ATOM   7876  C CG  . MET C  1 186 ? -0.60795  -9.28002   99.58146  1.000 61.39282  ? 166  MET B CG  1 
ATOM   7877  S SD  . MET C  1 186 ? -0.36236  -7.53945   100.06240 1.000 65.62082  ? 166  MET B SD  1 
ATOM   7878  C CE  . MET C  1 186 ? -1.77766  -7.22234   101.12876 1.000 60.86258  ? 166  MET B CE  1 
ATOM   7879  N N   . GLU C  1 187 ? -1.29222  -12.33321  96.93943  1.000 51.33923  ? 167  GLU B N   1 
ATOM   7880  C CA  . GLU C  1 187 ? -2.57719  -12.89079  96.55866  1.000 56.49037  ? 167  GLU B CA  1 
ATOM   7881  C C   . GLU C  1 187 ? -2.70624  -14.36050  96.91721  1.000 63.29932  ? 167  GLU B C   1 
ATOM   7882  O O   . GLU C  1 187 ? -3.80087  -14.91492  96.79474  1.000 82.16896  ? 167  GLU B O   1 
ATOM   7883  C CB  . GLU C  1 187 ? -2.79390  -12.70935  95.05816  1.000 57.16200  ? 167  GLU B CB  1 
ATOM   7884  C CG  . GLU C  1 187 ? -2.72137  -11.25213  94.61695  1.000 61.68621  ? 167  GLU B CG  1 
ATOM   7885  C CD  . GLU C  1 187 ? -3.31924  -11.02496  93.24165  1.000 63.33227  ? 167  GLU B CD  1 
ATOM   7886  O OE1 . GLU C  1 187 ? -3.18284  -9.89196   92.73798  1.000 64.62167  ? 167  GLU B OE1 1 
ATOM   7887  O OE2 . GLU C  1 187 ? -3.91570  -11.97097  92.66850  1.000 62.10284  ? 167  GLU B OE2 1 
ATOM   7888  N N   . ALA C  1 188 ? -1.62660  -15.00341  97.34964  1.000 51.60741  ? 168  ALA B N   1 
ATOM   7889  C CA  . ALA C  1 188 ? -1.65310  -16.43269  97.62107  1.000 44.00137  ? 168  ALA B CA  1 
ATOM   7890  C C   . ALA C  1 188 ? -2.00150  -16.75021  99.06547  1.000 44.07854  ? 168  ALA B C   1 
ATOM   7891  O O   . ALA C  1 188 ? -2.10311  -17.93226  99.42591  1.000 42.91333  ? 168  ALA B O   1 
ATOM   7892  C CB  . ALA C  1 188 ? -0.30297  -17.07042  97.26330  1.000 41.48196  ? 168  ALA B CB  1 
ATOM   7893  N N   . THR C  1 189 ? -2.19140  -15.72656  99.89683  1.000 43.15181  ? 169  THR B N   1 
ATOM   7894  C CA  . THR C  1 189 ? -2.35908  -15.94465  101.32527 1.000 45.78290  ? 169  THR B CA  1 
ATOM   7895  C C   . THR C  1 189 ? -3.67619  -16.63339  101.64929 1.000 44.75956  ? 169  THR B C   1 
ATOM   7896  O O   . THR C  1 189 ? -3.84108  -17.16293  102.75834 1.000 44.99418  ? 169  THR B O   1 
ATOM   7897  C CB  . THR C  1 189 ? -2.28662  -14.61082  102.05783 1.000 51.69394  ? 169  THR B CB  1 
ATOM   7898  O OG1 . THR C  1 189 ? -2.63207  -14.81577  103.42754 1.000 59.53267  ? 169  THR B OG1 1 
ATOM   7899  C CG2 . THR C  1 189 ? -3.27790  -13.64571  101.46275 1.000 41.31036  ? 169  THR B CG2 1 
ATOM   7900  N N   . GLY C  1 190 ? -4.62229  -16.60924  100.72662 1.000 41.45761  ? 170  GLY B N   1 
ATOM   7901  C CA  . GLY C  1 190 ? -5.88568  -17.26254  100.96458 1.000 39.96449  ? 170  GLY B CA  1 
ATOM   7902  C C   . GLY C  1 190 ? -5.96273  -18.67893  100.44992 1.000 42.10421  ? 170  GLY B C   1 
ATOM   7903  O O   . GLY C  1 190 ? -7.02120  -19.30495  100.55364 1.000 45.38987  ? 170  GLY B O   1 
ATOM   7904  N N   . PHE C  1 191 ? -4.87102  -19.21565  99.92195  1.000 38.37065  ? 171  PHE B N   1 
ATOM   7905  C CA  . PHE C  1 191 ? -4.85977  -20.49588  99.24706  1.000 39.57760  ? 171  PHE B CA  1 
ATOM   7906  C C   . PHE C  1 191 ? -4.04161  -21.52623  100.01350 1.000 42.02625  ? 171  PHE B C   1 
ATOM   7907  O O   . PHE C  1 191 ? -3.27858  -21.21861  100.92902 1.000 41.64895  ? 171  PHE B O   1 
ATOM   7908  C CB  . PHE C  1 191 ? -4.26402  -20.36223  97.84322  1.000 43.12893  ? 171  PHE B CB  1 
ATOM   7909  C CG  . PHE C  1 191 ? -5.14678  -19.66092  96.84535  1.000 37.15206  ? 171  PHE B CG  1 
ATOM   7910  C CD1 . PHE C  1 191 ? -5.16360  -18.28094  96.76863  1.000 45.70636  ? 171  PHE B CD1 1 
ATOM   7911  C CD2 . PHE C  1 191 ? -5.90828  -20.39805  95.93605  1.000 43.68954  ? 171  PHE B CD2 1 
ATOM   7912  C CE1 . PHE C  1 191 ? -5.95646  -17.62581  95.83429  1.000 46.25206  ? 171  PHE B CE1 1 
ATOM   7913  C CE2 . PHE C  1 191 ? -6.70725  -19.75400  95.00179  1.000 35.81058  ? 171  PHE B CE2 1 
ATOM   7914  C CZ  . PHE C  1 191 ? -6.73227  -18.36568  94.94990  1.000 36.18809  ? 171  PHE B CZ  1 
ATOM   7915  N N   . GLY C  1 192 ? -4.19168  -22.76924  99.58421  1.000 37.56872  ? 172  GLY B N   1 
ATOM   7916  C CA  . GLY C  1 192 ? -3.22707  -23.80851  99.87224  1.000 39.35636  ? 172  GLY B CA  1 
ATOM   7917  C C   . GLY C  1 192 ? -2.03851  -23.59419  98.96332  1.000 40.76250  ? 172  GLY B C   1 
ATOM   7918  O O   . GLY C  1 192 ? -2.18962  -23.59620  97.74439  1.000 40.84565  ? 172  GLY B O   1 
ATOM   7919  N N   . VAL C  1 193 ? -0.85396  -23.36082  99.51331  1.000 38.97961  ? 173  VAL B N   1 
ATOM   7920  C CA  . VAL C  1 193 ? 0.28799   -22.96123  98.69966  1.000 39.40003  ? 173  VAL B CA  1 
ATOM   7921  C C   . VAL C  1 193 ? 1.29553   -24.10200  98.65687  1.000 46.41309  ? 173  VAL B C   1 
ATOM   7922  O O   . VAL C  1 193 ? 1.51136   -24.80462  99.65420  1.000 42.63380  ? 173  VAL B O   1 
ATOM   7923  C CB  . VAL C  1 193 ? 0.90385   -21.64629  99.22358  1.000 40.22901  ? 173  VAL B CB  1 
ATOM   7924  C CG1 . VAL C  1 193 ? 2.18450   -21.25888  98.43051  1.000 40.73288  ? 173  VAL B CG1 1 
ATOM   7925  C CG2 . VAL C  1 193 ? -0.14685  -20.53520  99.13956  1.000 40.00971  ? 173  VAL B CG2 1 
ATOM   7926  N N   . MET C  1 194 ? 1.86877   -24.31853  97.48238  1.000 49.29139  ? 174  MET B N   1 
ATOM   7927  C CA  . MET C  1 194 ? 2.84546   -25.37614  97.28203  1.000 52.12006  ? 174  MET B CA  1 
ATOM   7928  C C   . MET C  1 194 ? 4.23436   -24.75257  97.31818  1.000 57.66628  ? 174  MET B C   1 
ATOM   7929  O O   . MET C  1 194 ? 4.50343   -23.78279  96.60302  1.000 72.09007  ? 174  MET B O   1 
ATOM   7930  C CB  . MET C  1 194 ? 2.61163   -26.12263  95.95353  1.000 46.61112  ? 174  MET B CB  1 
ATOM   7931  C CG  . MET C  1 194 ? 1.22059   -26.83128  95.79754  1.000 44.70621  ? 174  MET B CG  1 
ATOM   7932  S SD  . MET C  1 194 ? 0.84466   -27.98803  97.15881  1.000 48.61012  ? 174  MET B SD  1 
ATOM   7933  C CE  . MET C  1 194 ? -0.91433  -28.27248  97.03454  1.000 51.18233  ? 174  MET B CE  1 
ATOM   7934  N N   . HIS C  1 195 ? 5.10821   -25.29801  98.15697  1.000 53.45897  ? 175  HIS B N   1 
ATOM   7935  C CA  . HIS C  1 195 ? 6.51423   -24.91269  98.13749  1.000 48.88779  ? 175  HIS B CA  1 
ATOM   7936  C C   . HIS C  1 195 ? 7.27572   -25.79364  97.14551  1.000 43.89501  ? 175  HIS B C   1 
ATOM   7937  O O   . HIS C  1 195 ? 7.38930   -27.01012  97.32963  1.000 41.44798  ? 175  HIS B O   1 
ATOM   7938  C CB  . HIS C  1 195 ? 7.13205   -24.99279  99.53319  1.000 52.48713  ? 175  HIS B CB  1 
ATOM   7939  C CG  . HIS C  1 195 ? 8.46330   -24.31492  99.62910  1.000 53.72297  ? 175  HIS B CG  1 
ATOM   7940  N ND1 . HIS C  1 195 ? 9.28926   -24.43555  100.72627 1.000 54.86472  ? 175  HIS B ND1 1 
ATOM   7941  C CD2 . HIS C  1 195 ? 9.11167   -23.50736  98.75514  1.000 54.38082  ? 175  HIS B CD2 1 
ATOM   7942  C CE1 . HIS C  1 195 ? 10.39036  -23.73263  100.52190 1.000 56.52650  ? 175  HIS B CE1 1 
ATOM   7943  N NE2 . HIS C  1 195 ? 10.30548  -23.15540  99.33573  1.000 55.95916  ? 175  HIS B NE2 1 
ATOM   7944  N N   . VAL C  1 196 ? 7.81907   -25.16795  96.11253  1.000 44.48783  ? 176  VAL B N   1 
ATOM   7945  C CA  . VAL C  1 196 ? 8.33676   -25.84822  94.93480  1.000 46.22999  ? 176  VAL B CA  1 
ATOM   7946  C C   . VAL C  1 196 ? 9.85384   -25.67467  94.85318  1.000 51.50804  ? 176  VAL B C   1 
ATOM   7947  O O   . VAL C  1 196 ? 10.41673  -24.71763  95.39604  1.000 54.63739  ? 176  VAL B O   1 
ATOM   7948  C CB  . VAL C  1 196 ? 7.58756   -25.27513  93.70976  1.000 46.85187  ? 176  VAL B CB  1 
ATOM   7949  C CG1 . VAL C  1 196 ? 8.38307   -25.34910  92.43899  1.000 47.39090  ? 176  VAL B CG1 1 
ATOM   7950  C CG2 . VAL C  1 196 ? 6.24747   -26.00944  93.53441  1.000 43.09325  ? 176  VAL B CG2 1 
ATOM   7951  N N   . ASN C  1 197 ? 10.52885  -26.63130  94.20704  1.000 50.53824  ? 177  ASN B N   1 
ATOM   7952  C CA  . ASN C  1 197 ? 11.95159  -26.47527  93.95992  1.000 54.95877  ? 177  ASN B CA  1 
ATOM   7953  C C   . ASN C  1 197 ? 12.18699  -26.09568  92.49575  1.000 55.86211  ? 177  ASN B C   1 
ATOM   7954  O O   . ASN C  1 197 ? 11.26063  -25.74367  91.75848  1.000 51.77474  ? 177  ASN B O   1 
ATOM   7955  C CB  . ASN C  1 197 ? 12.70648  -27.74040  94.36532  1.000 55.73677  ? 177  ASN B CB  1 
ATOM   7956  C CG  . ASN C  1 197 ? 12.32122  -28.95072  93.53666  1.000 59.68815  ? 177  ASN B CG  1 
ATOM   7957  O OD1 . ASN C  1 197 ? 12.00689  -28.84677  92.34528  1.000 59.62741  ? 177  ASN B OD1 1 
ATOM   7958  N ND2 . ASN C  1 197 ? 12.35596  -30.12087  94.16777  1.000 61.35733  ? 177  ASN B ND2 1 
ATOM   7959  N N   . GLU C  1 198 ? 13.44190  -26.19541  92.05949  1.000 55.98403  ? 178  GLU B N   1 
ATOM   7960  C CA  . GLU C  1 198 ? 13.80335  -25.83390  90.69463  1.000 58.80752  ? 178  GLU B CA  1 
ATOM   7961  C C   . GLU C  1 198 ? 13.14517  -26.73781  89.65634  1.000 56.84823  ? 178  GLU B C   1 
ATOM   7962  O O   . GLU C  1 198 ? 13.05977  -26.35578  88.48082  1.000 55.09434  ? 178  GLU B O   1 
ATOM   7963  C CB  . GLU C  1 198 ? 15.33634  -25.86787  90.54866  1.000 67.17065  ? 178  GLU B CB  1 
ATOM   7964  C CG  . GLU C  1 198 ? 15.97713  -27.25969  90.76960  1.000 72.50226  ? 178  GLU B CG  1 
ATOM   7965  C CD  . GLU C  1 198 ? 16.14035  -27.62744  92.25208  1.000 77.11546  ? 178  GLU B CD  1 
ATOM   7966  O OE1 . GLU C  1 198 ? 16.69903  -28.71710  92.54223  1.000 77.71570  ? 178  GLU B OE1 1 
ATOM   7967  O OE2 . GLU C  1 198 ? 15.71730  -26.82144  93.12129  1.000 78.57917  ? 178  GLU B OE2 1 
ATOM   7968  N N   . LYS C  1 199 ? 12.66478  -27.91825  90.06080  1.000 54.80515  ? 179  LYS B N   1 
ATOM   7969  C CA  . LYS C  1 199 ? 12.06922  -28.88492  89.14395  1.000 51.32950  ? 179  LYS B CA  1 
ATOM   7970  C C   . LYS C  1 199 ? 10.54697  -28.93022  89.25245  1.000 50.10972  ? 179  LYS B C   1 
ATOM   7971  O O   . LYS C  1 199 ? 9.93318   -29.92735  88.86665  1.000 51.77738  ? 179  LYS B O   1 
ATOM   7972  C CB  . LYS C  1 199 ? 12.65569  -30.28134  89.39024  1.000 51.13921  ? 179  LYS B CB  1 
ATOM   7973  C CG  . LYS C  1 199 ? 14.18139  -30.39515  89.24657  1.000 51.32345  ? 179  LYS B CG  1 
ATOM   7974  C CD  . LYS C  1 199 ? 14.62127  -31.77685  88.73274  1.000 53.60755  ? 179  LYS B CD  1 
ATOM   7975  C CE  . LYS C  1 199 ? 14.83759  -32.76899  89.88985  1.000 54.96323  ? 179  LYS B CE  1 
ATOM   7976  N NZ  . LYS C  1 199 ? 16.26383  -33.21841  90.06500  1.000 51.93611  ? 179  LYS B NZ  1 
ATOM   7977  N N   . ASP C  1 200 ? 9.92982   -27.87226  89.77369  1.000 48.30150  ? 180  ASP B N   1 
ATOM   7978  C CA  . ASP C  1 200 ? 8.50657   -27.84594  90.12235  1.000 48.13568  ? 180  ASP B CA  1 
ATOM   7979  C C   . ASP C  1 200 ? 8.07490   -29.06846  90.94641  1.000 47.52973  ? 180  ASP B C   1 
ATOM   7980  O O   . ASP C  1 200 ? 6.89550   -29.42575  90.95150  1.000 43.80331  ? 180  ASP B O   1 
ATOM   7981  C CB  . ASP C  1 200 ? 7.62792   -27.70148  88.87264  1.000 45.35617  ? 180  ASP B CB  1 
ATOM   7982  C CG  . ASP C  1 200 ? 7.26551   -26.24421  88.57783  1.000 44.60524  ? 180  ASP B CG  1 
ATOM   7983  O OD1 . ASP C  1 200 ? 7.73001   -25.35762  89.32740  1.000 42.18007  ? 180  ASP B OD1 1 
ATOM   7984  O OD2 . ASP C  1 200 ? 6.53356   -25.97332  87.59151  1.000 42.30912  ? 180  ASP B OD2 1 
ATOM   7985  N N   . GLU C  1 201 ? 9.00421   -29.73457  91.63888  1.000 44.67948  ? 181  GLU B N   1 
ATOM   7986  C CA  . GLU C  1 201 ? 8.65555   -30.79714  92.57766  1.000 44.66620  ? 181  GLU B CA  1 
ATOM   7987  C C   . GLU C  1 201 ? 8.30592   -30.20433  93.93647  1.000 47.29431  ? 181  GLU B C   1 
ATOM   7988  O O   . GLU C  1 201 ? 8.99164   -29.29678  94.43103  1.000 54.73356  ? 181  GLU B O   1 
ATOM   7989  C CB  . GLU C  1 201 ? 9.80096   -31.80078  92.72098  1.000 46.86665  ? 181  GLU B CB  1 
ATOM   7990  C CG  . GLU C  1 201 ? 10.25284  -32.36495  91.39373  1.000 52.43430  ? 181  GLU B CG  1 
ATOM   7991  C CD  . GLU C  1 201 ? 11.54672  -33.16187  91.47026  1.000 58.22689  ? 181  GLU B CD  1 
ATOM   7992  O OE1 . GLU C  1 201 ? 12.27679  -33.06877  92.48475  1.000 60.56710  ? 181  GLU B OE1 1 
ATOM   7993  O OE2 . GLU C  1 201 ? 11.83001  -33.89980  90.50170  1.000 58.83198  ? 181  GLU B OE2 1 
ATOM   7994  N N   . ILE C  1 202 ? 7.25328   -30.74040  94.54732  1.000 43.97445  ? 182  ILE B N   1 
ATOM   7995  C CA  . ILE C  1 202 ? 6.66132   -30.15335  95.74772  1.000 46.96406  ? 182  ILE B CA  1 
ATOM   7996  C C   . ILE C  1 202 ? 7.43436   -30.61516  96.97103  1.000 49.41371  ? 182  ILE B C   1 
ATOM   7997  O O   . ILE C  1 202 ? 7.42926   -31.80376  97.30882  1.000 47.90847  ? 182  ILE B O   1 
ATOM   7998  C CB  . ILE C  1 202 ? 5.17540   -30.52205  95.87756  1.000 47.71874  ? 182  ILE B CB  1 
ATOM   7999  C CG1 . ILE C  1 202 ? 4.45366   -30.29368  94.55166  1.000 50.00361  ? 182  ILE B CG1 1 
ATOM   8000  C CG2 . ILE C  1 202 ? 4.52319   -29.74812  97.04737  1.000 44.51551  ? 182  ILE B CG2 1 
ATOM   8001  C CD1 . ILE C  1 202 ? 4.18486   -28.85493  94.25823  1.000 51.82759  ? 182  ILE B CD1 1 
ATOM   8002  N N   . ILE C  1 203 ? 8.07757   -29.66605  97.65263  1.000 52.42986  ? 183  ILE B N   1 
ATOM   8003  C CA  . ILE C  1 203 ? 8.78170   -29.95484  98.89673  1.000 50.90578  ? 183  ILE B CA  1 
ATOM   8004  C C   . ILE C  1 203 ? 7.97524   -29.58953  100.14964 1.000 51.20982  ? 183  ILE B C   1 
ATOM   8005  O O   . ILE C  1 203 ? 8.31256   -30.06786  101.24416 1.000 56.31895  ? 183  ILE B O   1 
ATOM   8006  C CB  . ILE C  1 203 ? 10.15237  -29.24705  98.90101  1.000 49.15817  ? 183  ILE B CB  1 
ATOM   8007  C CG1 . ILE C  1 203 ? 9.98510   -27.74681  99.10050  1.000 50.43037  ? 183  ILE B CG1 1 
ATOM   8008  C CG2 . ILE C  1 203 ? 10.86412  -29.46162  97.56841  1.000 48.49663  ? 183  ILE B CG2 1 
ATOM   8009  C CD1 . ILE C  1 203 ? 11.21321  -26.94934  98.66790  1.000 49.81746  ? 183  ILE B CD1 1 
ATOM   8010  N N   . ASP C  1 204 ? 6.92984   -28.76394  100.02882 1.000 45.00805  ? 184  ASP B N   1 
ATOM   8011  C CA  . ASP C  1 204 ? 6.09160   -28.44458  101.18067 1.000 46.83903  ? 184  ASP B CA  1 
ATOM   8012  C C   . ASP C  1 204 ? 4.71396   -27.95281  100.72890 1.000 44.76249  ? 184  ASP B C   1 
ATOM   8013  O O   . ASP C  1 204 ? 4.53576   -27.46360  99.60934  1.000 46.20489  ? 184  ASP B O   1 
ATOM   8014  C CB  . ASP C  1 204 ? 6.77194   -27.39424  102.08554 1.000 51.34202  ? 184  ASP B CB  1 
ATOM   8015  C CG  . ASP C  1 204 ? 6.19549   -27.36406  103.50491 1.000 56.46607  ? 184  ASP B CG  1 
ATOM   8016  O OD1 . ASP C  1 204 ? 5.33530   -28.20694  103.85408 1.000 56.87086  ? 184  ASP B OD1 1 
ATOM   8017  O OD2 . ASP C  1 204 ? 6.62260   -26.49191  104.29254 1.000 59.35359  ? 184  ASP B OD2 1 
ATOM   8018  N N   . PHE C  1 205 ? 3.74491   -28.07278  101.63620 1.000 45.06135  ? 185  PHE B N   1 
ATOM   8019  C CA  . PHE C  1 205 ? 2.37624   -27.60954  101.42106 1.000 47.71050  ? 185  PHE B CA  1 
ATOM   8020  C C   . PHE C  1 205 ? 1.92041   -26.82415  102.63871 1.000 47.34407  ? 185  PHE B C   1 
ATOM   8021  O O   . PHE C  1 205 ? 1.87606   -27.37016  103.74562 1.000 50.88519  ? 185  PHE B O   1 
ATOM   8022  C CB  . PHE C  1 205 ? 1.41380   -28.77574  101.19518 1.000 49.72029  ? 185  PHE B CB  1 
ATOM   8023  C CG  . PHE C  1 205 ? 0.00549   -28.47894  101.65182 1.000 55.17168  ? 185  PHE B CG  1 
ATOM   8024  C CD1 . PHE C  1 205 ? -0.78970  -27.56299  100.96865 1.000 55.07977  ? 185  PHE B CD1 1 
ATOM   8025  C CD2 . PHE C  1 205 ? -0.49328  -29.05674  102.81786 1.000 58.49768  ? 185  PHE B CD2 1 
ATOM   8026  C CE1 . PHE C  1 205 ? -2.09056  -27.26508  101.41483 1.000 56.80499  ? 185  PHE B CE1 1 
ATOM   8027  C CE2 . PHE C  1 205 ? -1.79060  -28.77088  103.26683 1.000 58.22356  ? 185  PHE B CE2 1 
ATOM   8028  C CZ  . PHE C  1 205 ? -2.58707  -27.87376  102.56629 1.000 56.86903  ? 185  PHE B CZ  1 
ATOM   8029  N N   . ILE C  1 206 ? 1.53524   -25.56748  102.44312 1.000 47.00481  ? 186  ILE B N   1 
ATOM   8030  C CA  . ILE C  1 206 ? 1.17647   -24.69066  103.55407 1.000 45.07142  ? 186  ILE B CA  1 
ATOM   8031  C C   . ILE C  1 206 ? -0.24501  -24.19195  103.35565 1.000 42.13476  ? 186  ILE B C   1 
ATOM   8032  O O   . ILE C  1 206 ? -0.54394  -23.53824  102.35058 1.000 42.49441  ? 186  ILE B O   1 
ATOM   8033  C CB  . ILE C  1 206 ? 2.14611   -23.50703  103.70188 1.000 49.05741  ? 186  ILE B CB  1 
ATOM   8034  C CG1 . ILE C  1 206 ? 3.60224   -23.99764  103.72545 1.000 50.13502  ? 186  ILE B CG1 1 
ATOM   8035  C CG2 . ILE C  1 206 ? 1.83372   -22.74674  104.98525 1.000 50.94002  ? 186  ILE B CG2 1 
ATOM   8036  C CD1 . ILE C  1 206 ? 4.35540   -23.83489  102.40076 1.000 48.32541  ? 186  ILE B CD1 1 
ATOM   8037  N N   . GLU C  1 207 ? -1.10997  -24.49213  104.31862 1.000 40.01746  ? 187  GLU B N   1 
ATOM   8038  C CA  . GLU C  1 207 ? -2.48138  -23.98384  104.34565 1.000 41.91994  ? 187  GLU B CA  1 
ATOM   8039  C C   . GLU C  1 207 ? -2.48975  -22.50401  104.72074 1.000 46.98218  ? 187  GLU B C   1 
ATOM   8040  O O   . GLU C  1 207 ? -2.15479  -22.14652  105.85740 1.000 52.03786  ? 187  GLU B O   1 
ATOM   8041  C CB  . GLU C  1 207 ? -3.29246  -24.79669  105.35281 1.000 44.71604  ? 187  GLU B CB  1 
ATOM   8042  C CG  . GLU C  1 207 ? -4.81237  -24.55944  105.37172 1.000 50.46754  ? 187  GLU B CG  1 
ATOM   8043  C CD  . GLU C  1 207 ? -5.44554  -24.57910  103.98399 1.000 55.93090  ? 187  GLU B CD  1 
ATOM   8044  O OE1 . GLU C  1 207 ? -5.06909  -25.45686  103.17969 1.000 58.17051  ? 187  GLU B OE1 1 
ATOM   8045  O OE2 . GLU C  1 207 ? -6.34145  -23.74858  103.70726 1.000 56.25682  ? 187  GLU B OE2 1 
ATOM   8046  N N   . LYS C  1 208 ? -2.87238  -21.63874  103.78103 1.000 42.47932  ? 188  LYS B N   1 
ATOM   8047  C CA  . LYS C  1 208 ? -3.11369  -20.23387  104.09729 1.000 42.09071  ? 188  LYS B CA  1 
ATOM   8048  C C   . LYS C  1 208 ? -1.88559  -19.52278  104.68279 1.000 43.33304  ? 188  LYS B C   1 
ATOM   8049  O O   . LYS C  1 208 ? -1.99851  -18.90927  105.75813 1.000 41.64645  ? 188  LYS B O   1 
ATOM   8050  C CB  . LYS C  1 208 ? -4.26339  -20.13675  105.10069 1.000 42.96343  ? 188  LYS B CB  1 
ATOM   8051  C CG  . LYS C  1 208 ? -5.62943  -20.62353  104.60893 1.000 48.41709  ? 188  LYS B CG  1 
ATOM   8052  C CD  . LYS C  1 208 ? -6.42570  -19.50484  103.97737 1.000 52.21371  ? 188  LYS B CD  1 
ATOM   8053  C CE  . LYS C  1 208 ? -7.88021  -19.54134  104.45545 1.000 57.36395  ? 188  LYS B CE  1 
ATOM   8054  N NZ  . LYS C  1 208 ? -8.57722  -18.22501  104.24989 1.000 61.44624  ? 188  LYS B NZ  1 
ATOM   8055  N N   . PRO C  1 209 ? -0.71633  -19.56611  104.03180 1.000 45.48735  ? 189  PRO B N   1 
ATOM   8056  C CA  . PRO C  1 209 ? 0.46791   -18.91413  104.62383 1.000 45.87210  ? 189  PRO B CA  1 
ATOM   8057  C C   . PRO C  1 209 ? 0.31967   -17.40300  104.63202 1.000 47.38935  ? 189  PRO B C   1 
ATOM   8058  O O   . PRO C  1 209 ? -0.04615  -16.79336  103.62508 1.000 42.54475  ? 189  PRO B O   1 
ATOM   8059  C CB  . PRO C  1 209 ? 1.61545   -19.34630  103.70849 1.000 45.67117  ? 189  PRO B CB  1 
ATOM   8060  C CG  . PRO C  1 209 ? 0.94434   -19.56943  102.39318 1.000 43.24637  ? 189  PRO B CG  1 
ATOM   8061  C CD  . PRO C  1 209 ? -0.39825  -20.15757  102.71845 1.000 45.62561  ? 189  PRO B CD  1 
ATOM   8062  N N   . ALA C  1 210 ? 0.64169   -16.80537  105.78053 1.000 45.70964  ? 190  ALA B N   1 
ATOM   8063  C CA  . ALA C  1 210 ? 0.71122   -15.35226  105.87523 1.000 46.11405  ? 190  ALA B CA  1 
ATOM   8064  C C   . ALA C  1 210 ? 1.77838   -14.78458  104.94692 1.000 46.22991  ? 190  ALA B C   1 
ATOM   8065  O O   . ALA C  1 210 ? 1.55747   -13.75744  104.29705 1.000 45.57145  ? 190  ALA B O   1 
ATOM   8066  C CB  . ALA C  1 210 ? 0.98051   -14.95497  107.31651 1.000 48.20677  ? 190  ALA B CB  1 
ATOM   8067  N N   . ASP C  1 211 ? 2.94154   -15.43931  104.86288 1.000 44.78630  ? 191  ASP B N   1 
ATOM   8068  C CA  . ASP C  1 211 ? 4.04326   -15.00489  104.00468 1.000 45.19912  ? 191  ASP B CA  1 
ATOM   8069  C C   . ASP C  1 211 ? 4.36204   -16.12224  103.02119 1.000 47.09092  ? 191  ASP B C   1 
ATOM   8070  O O   . ASP C  1 211 ? 5.27397   -16.92848  103.25742 1.000 46.33266  ? 191  ASP B O   1 
ATOM   8071  C CB  . ASP C  1 211 ? 5.27898   -14.63780  104.82382 1.000 47.71839  ? 191  ASP B CB  1 
ATOM   8072  C CG  . ASP C  1 211 ? 6.21365   -13.69991  104.07469 1.000 49.97867  ? 191  ASP B CG  1 
ATOM   8073  O OD1 . ASP C  1 211 ? 7.34683   -13.47687  104.56543 1.000 47.48897  ? 191  ASP B OD1 1 
ATOM   8074  O OD2 . ASP C  1 211 ? 5.80373   -13.18007  102.99952 1.000 46.34762  ? 191  ASP B OD2 1 
ATOM   8075  N N   . PRO C  1 212 ? 3.64482   -16.19656  101.90276 1.000 47.76136  ? 192  PRO B N   1 
ATOM   8076  C CA  . PRO C  1 212 ? 3.71343   -17.39679  101.05121 1.000 46.01135  ? 192  PRO B CA  1 
ATOM   8077  C C   . PRO C  1 212 ? 5.09507   -17.58619  100.45471 1.000 49.86685  ? 192  PRO B C   1 
ATOM   8078  O O   . PRO C  1 212 ? 5.73251   -16.62214  100.00073 1.000 48.24772  ? 192  PRO B O   1 
ATOM   8079  C CB  . PRO C  1 212 ? 2.66987   -17.11837  99.95889  1.000 42.65067  ? 192  PRO B CB  1 
ATOM   8080  C CG  . PRO C  1 212 ? 1.77249   -16.08514  100.54594 1.000 43.31870  ? 192  PRO B CG  1 
ATOM   8081  C CD  . PRO C  1 212 ? 2.68146   -15.21581  101.38045 1.000 43.67030  ? 192  PRO B CD  1 
ATOM   8082  N N   . PRO C  1 213 ? 5.59229   -18.82316  100.44485 1.000 54.77975  ? 193  PRO B N   1 
ATOM   8083  C CA  . PRO C  1 213 ? 6.84261   -19.11687  99.73273  1.000 52.48742  ? 193  PRO B CA  1 
ATOM   8084  C C   . PRO C  1 213 ? 6.74471   -18.72800  98.26456  1.000 49.24928  ? 193  PRO B C   1 
ATOM   8085  O O   . PRO C  1 213 ? 5.75480   -19.02527  97.58444  1.000 47.92082  ? 193  PRO B O   1 
ATOM   8086  C CB  . PRO C  1 213 ? 6.99628   -20.63459  99.89921  1.000 56.22296  ? 193  PRO B CB  1 
ATOM   8087  C CG  . PRO C  1 213 ? 6.14154   -20.98216  101.08282 1.000 57.02837  ? 193  PRO B CG  1 
ATOM   8088  C CD  . PRO C  1 213 ? 5.00648   -20.02554  101.06754 1.000 56.08722  ? 193  PRO B CD  1 
ATOM   8089  N N   . GLY C  1 214 ? 7.77797   -18.05269  97.77787  1.000 44.84152  ? 194  GLY B N   1 
ATOM   8090  C CA  . GLY C  1 214 ? 7.87209   -17.74777  96.36687  1.000 44.03705  ? 194  GLY B CA  1 
ATOM   8091  C C   . GLY C  1 214 ? 8.38376   -18.92615  95.54137  1.000 48.52289  ? 194  GLY B C   1 
ATOM   8092  O O   . GLY C  1 214 ? 8.82647   -19.95511  96.05453  1.000 43.78716  ? 194  GLY B O   1 
ATOM   8093  N N   . ILE C  1 215 ? 8.30866   -18.75766  94.22970  1.000 50.70525  ? 195  ILE B N   1 
ATOM   8094  C CA  . ILE C  1 215 ? 8.80196   -19.77432  93.29698  1.000 54.47346  ? 195  ILE B CA  1 
ATOM   8095  C C   . ILE C  1 215 ? 10.30589  -19.57956  93.11190  1.000 59.29580  ? 195  ILE B C   1 
ATOM   8096  O O   . ILE C  1 215 ? 10.74640  -18.44212  92.85710  1.000 60.47056  ? 195  ILE B O   1 
ATOM   8097  C CB  . ILE C  1 215 ? 8.07722   -19.66587  91.95992  1.000 51.62716  ? 195  ILE B CB  1 
ATOM   8098  C CG1 . ILE C  1 215 ? 6.58740   -19.99540  92.10225  1.000 41.50198  ? 195  ILE B CG1 1 
ATOM   8099  C CG2 . ILE C  1 215 ? 8.75338   -20.54228  90.90348  1.000 51.10093  ? 195  ILE B CG2 1 
ATOM   8100  C CD1 . ILE C  1 215 ? 5.81454   -19.70781  90.83549  1.000 41.98071  ? 195  ILE B CD1 1 
ATOM   8101  N N   . PRO C  1 216 ? 11.11639  -20.63663  93.21378  1.000 63.18977  ? 196  PRO B N   1 
ATOM   8102  C CA  . PRO C  1 216 ? 12.53046  -20.52120  92.81525  1.000 66.76448  ? 196  PRO B CA  1 
ATOM   8103  C C   . PRO C  1 216 ? 12.63282  -20.04949  91.37176  1.000 68.48245  ? 196  PRO B C   1 
ATOM   8104  O O   . PRO C  1 216 ? 12.17014  -20.72290  90.44612  1.000 67.33370  ? 196  PRO B O   1 
ATOM   8105  C CB  . PRO C  1 216 ? 13.06527  -21.94779  92.98422  1.000 66.89483  ? 196  PRO B CB  1 
ATOM   8106  C CG  . PRO C  1 216 ? 12.09228  -22.63383  93.87899  1.000 66.21148  ? 196  PRO B CG  1 
ATOM   8107  C CD  . PRO C  1 216 ? 10.76565  -22.00785  93.61893  1.000 63.33874  ? 196  PRO B CD  1 
ATOM   8108  N N   . GLY C  1 217 ? 13.21280  -18.86057  91.18450  1.000 69.43812  ? 197  GLY B N   1 
ATOM   8109  C CA  . GLY C  1 217 ? 13.34792  -18.26016  89.87496  1.000 65.74062  ? 197  GLY B CA  1 
ATOM   8110  C C   . GLY C  1 217 ? 12.49891  -17.02886  89.65244  1.000 64.06412  ? 197  GLY B C   1 
ATOM   8111  O O   . GLY C  1 217 ? 12.83037  -16.22408  88.77558  1.000 64.45108  ? 197  GLY B O   1 
ATOM   8112  N N   . ASN C  1 218 ? 11.39023  -16.87210  90.38187  1.000 63.40762  ? 198  ASN B N   1 
ATOM   8113  C CA  . ASN C  1 218 ? 10.72383  -15.56364  90.45641  1.000 64.72660  ? 198  ASN B CA  1 
ATOM   8114  C C   . ASN C  1 218 ? 9.97873   -15.51022  91.79271  1.000 62.39012  ? 198  ASN B C   1 
ATOM   8115  O O   . ASN C  1 218 ? 8.82384   -15.93575  91.90822  1.000 59.02338  ? 198  ASN B O   1 
ATOM   8116  C CB  . ASN C  1 218 ? 9.81568   -15.25864  89.26516  1.000 65.55666  ? 198  ASN B CB  1 
ATOM   8117  C CG  . ASN C  1 218 ? 8.63756   -16.19659  89.14344  1.000 69.13896  ? 198  ASN B CG  1 
ATOM   8118  O OD1 . ASN C  1 218 ? 8.68156   -17.33749  89.60512  1.000 72.86879  ? 198  ASN B OD1 1 
ATOM   8119  N ND2 . ASN C  1 218 ? 7.57291   -15.72262  88.50191  1.000 66.53304  ? 198  ASN B ND2 1 
ATOM   8120  N N   . GLU C  1 219 ? 10.66981  -14.96749  92.79480  1.000 61.70037  ? 199  GLU B N   1 
ATOM   8121  C CA  . GLU C  1 219 ? 10.15791  -14.83064  94.14861  1.000 59.94862  ? 199  GLU B CA  1 
ATOM   8122  C C   . GLU C  1 219 ? 8.93897   -13.93249  94.22991  1.000 52.54232  ? 199  GLU B C   1 
ATOM   8123  O O   . GLU C  1 219 ? 8.28655   -13.91911  95.27607  1.000 45.12409  ? 199  GLU B O   1 
ATOM   8124  C CB  . GLU C  1 219 ? 11.24747  -14.27412  95.07187  1.000 64.94136  ? 199  GLU B CB  1 
ATOM   8125  C CG  . GLU C  1 219 ? 12.35312  -15.25659  95.41448  1.000 70.24396  ? 199  GLU B CG  1 
ATOM   8126  C CD  . GLU C  1 219 ? 11.86011  -16.39778  96.27318  1.000 73.97262  ? 199  GLU B CD  1 
ATOM   8127  O OE1 . GLU C  1 219 ? 11.12569  -16.12870  97.25900  1.000 73.60822  ? 199  GLU B OE1 1 
ATOM   8128  O OE2 . GLU C  1 219 ? 12.20119  -17.56213  95.95152  1.000 75.93891  ? 199  GLU B OE2 1 
ATOM   8129  N N   . GLY C  1 220 ? 8.63086   -13.17111  93.17690  1.000 47.26134  ? 200  GLY B N   1 
ATOM   8130  C CA  . GLY C  1 220 ? 7.43066   -12.35290  93.18656  1.000 49.27244  ? 200  GLY B CA  1 
ATOM   8131  C C   . GLY C  1 220 ? 6.12164   -13.13948  93.14424  1.000 49.18622  ? 200  GLY B C   1 
ATOM   8132  O O   . GLY C  1 220 ? 5.06365   -12.55902  93.41717  1.000 43.35938  ? 200  GLY B O   1 
ATOM   8133  N N   . PHE C  1 221 ? 6.17371   -14.43645  92.83028  1.000 45.85667  ? 201  PHE B N   1 
ATOM   8134  C CA  . PHE C  1 221 ? 4.97675   -15.24273  92.62511  1.000 47.40871  ? 201  PHE B CA  1 
ATOM   8135  C C   . PHE C  1 221 ? 5.05607   -16.52126  93.44427  1.000 49.95003  ? 201  PHE B C   1 
ATOM   8136  O O   . PHE C  1 221 ? 6.13703   -16.95256  93.86533  1.000 42.67011  ? 201  PHE B O   1 
ATOM   8137  C CB  . PHE C  1 221 ? 4.77328   -15.57824  91.14096  1.000 47.90671  ? 201  PHE B CB  1 
ATOM   8138  C CG  . PHE C  1 221 ? 4.52218   -14.36868  90.28579  1.000 51.88678  ? 201  PHE B CG  1 
ATOM   8139  C CD1 . PHE C  1 221 ? 5.57666   -13.55151  89.89163  1.000 54.73719  ? 201  PHE B CD1 1 
ATOM   8140  C CD2 . PHE C  1 221 ? 3.23373   -14.02967  89.89257  1.000 53.20288  ? 201  PHE B CD2 1 
ATOM   8141  C CE1 . PHE C  1 221 ? 5.34645   -12.42177  89.11307  1.000 55.36550  ? 201  PHE B CE1 1 
ATOM   8142  C CE2 . PHE C  1 221 ? 2.99867   -12.90689  89.11480  1.000 53.45056  ? 201  PHE B CE2 1 
ATOM   8143  C CZ  . PHE C  1 221 ? 4.05007   -12.10414  88.72020  1.000 53.78077  ? 201  PHE B CZ  1 
ATOM   8144  N N   . ALA C  1 222 ? 3.88006   -17.10452  93.68373  1.000 41.41527  ? 202  ALA B N   1 
ATOM   8145  C CA  . ALA C  1 222 ? 3.73631   -18.35715  94.40788  1.000 41.17664  ? 202  ALA B CA  1 
ATOM   8146  C C   . ALA C  1 222 ? 2.77549   -19.26529  93.64653  1.000 42.34742  ? 202  ALA B C   1 
ATOM   8147  O O   . ALA C  1 222 ? 2.01002   -18.81089  92.79216  1.000 39.69926  ? 202  ALA B O   1 
ATOM   8148  C CB  . ALA C  1 222 ? 3.22928   -18.12345  95.83878  1.000 41.40679  ? 202  ALA B CB  1 
ATOM   8149  N N   . LEU C  1 223 ? 2.82056   -20.56045  93.96808  1.000 39.94143  ? 203  LEU B N   1 
ATOM   8150  C CA  . LEU C  1 223 ? 1.96349   -21.56338  93.33698  1.000 39.03971  ? 203  LEU B CA  1 
ATOM   8151  C C   . LEU C  1 223 ? 0.83879   -21.93206  94.29928  1.000 38.65327  ? 203  LEU B C   1 
ATOM   8152  O O   . LEU C  1 223 ? 1.08455   -22.52897  95.35351  1.000 38.91819  ? 203  LEU B O   1 
ATOM   8153  C CB  . LEU C  1 223 ? 2.78540   -22.78725  92.95133  1.000 45.18236  ? 203  LEU B CB  1 
ATOM   8154  C CG  . LEU C  1 223 ? 3.68389   -22.54554  91.74023  1.000 42.53701  ? 203  LEU B CG  1 
ATOM   8155  C CD1 . LEU C  1 223 ? 4.52032   -23.76996  91.42916  1.000 42.65876  ? 203  LEU B CD1 1 
ATOM   8156  C CD2 . LEU C  1 223 ? 2.84061   -22.16061  90.53289  1.000 38.50970  ? 203  LEU B CD2 1 
ATOM   8157  N N   . ALA C  1 224 ? -0.39673  -21.57920  93.93521  1.000 39.92528  ? 204  ALA B N   1 
ATOM   8158  C CA  . ALA C  1 224 ? -1.56498  -21.80122  94.77719  1.000 37.64296  ? 204  ALA B CA  1 
ATOM   8159  C C   . ALA C  1 224 ? -2.39313  -22.95555  94.21245  1.000 36.88414  ? 204  ALA B C   1 
ATOM   8160  O O   . ALA C  1 224 ? -2.69196  -22.97185  93.01632  1.000 36.23720  ? 204  ALA B O   1 
ATOM   8161  C CB  . ALA C  1 224 ? -2.40291  -20.53404  94.86153  1.000 37.61846  ? 204  ALA B CB  1 
ATOM   8162  N N   . SER C  1 225 ? -2.76892  -23.89751  95.08303  1.000 36.56492  ? 205  SER B N   1 
ATOM   8163  C CA  . SER C  1 225 ? -3.45562  -25.12429  94.67366  1.000 36.70364  ? 205  SER B CA  1 
ATOM   8164  C C   . SER C  1 225 ? -4.87886  -24.84162  94.20454  1.000 36.71705  ? 205  SER B C   1 
ATOM   8165  O O   . SER C  1 225 ? -5.67808  -24.21994  94.91624  1.000 35.02389  ? 205  SER B