data_6V99
# 
_entry.id   6V99 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.336 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6V99         
WWPDB D_1000245873 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6V99 
_pdbx_database_status.recvd_initial_deposition_date   2019-12-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zheng, Y.'       1 ? 
'Alghamdi, M.A.'  2 ? 
'Ballicora, M.A.' 3 ? 
'Liu, D.'         4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
;Site directed mutagenesis of Serine-72 reveals  
the location of the fructose 6-phosphate regulatory site of the Agrobacterium tumefaciens ADP-glucose pyrophosphorylase
;
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Alghamdi, M.A.'  1 ? 
primary 'Hussien, R.'     2 ? 
primary 'Zheng, Y.'       3 ? 
primary 'Patel, H.P.'     4 ? 
primary 'Iglesias, A.A.'  5 ? 
primary 'Liu, D.'         6 ? 
primary 'Ballicora, M.A.' 7 ? 
# 
_cell.angle_alpha                  108.067 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   101.846 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  89.998 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6V99 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     93.416 
_cell.length_a_esd                 ? 
_cell.length_b                     141.581 
_cell.length_b_esd                 ? 
_cell.length_c                     228.316 
_cell.length_c_esd                 ? 
_cell.volume                       2803103.017 
_cell.volume_esd                   ? 
_cell.Z_PDB                        20 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6V99 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            'P 1' 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucose-1-phosphate adenylyltransferase' 49300.516 20   2.7.7.27 S72D ? ? 
2 non-polymer syn 'SULFATE ION'                             96.063    136  ?        ?    ? ? 
3 water       nat water                                     18.015    2590 ?        ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ADP-glucose pyrophosphorylase,ADPGlc PPase,ADP-glucose synthase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMSEKRVQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIR
RIGVATQYKAHDLIRHLQRGWDFFRPERNESFDILPASQRVSETQWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKM
DYEYMLQQHVDSGADVTIGCLEVPRMEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFLMEAL
RRDAADPTSSRDFGKDIIPYIVEHGKAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPIW
TYAEITPPAKFVHDDEDRRGSAVSSVVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHG
VVIPEGLIVGEDPELDAKRFRRTESGICLITQSMIDKLDL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMSEKRVQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIR
RIGVATQYKAHDLIRHLQRGWDFFRPERNESFDILPASQRVSETQWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKM
DYEYMLQQHVDSGADVTIGCLEVPRMEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFLMEAL
RRDAADPTSSRDFGKDIIPYIVEHGKAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPIW
TYAEITPPAKFVHDDEDRRGSAVSSVVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHG
VVIPEGLIVGEDPELDAKRFRRTESGICLITQSMIDKLDL
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,W,T 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  SER n 
1 23  GLU n 
1 24  LYS n 
1 25  ARG n 
1 26  VAL n 
1 27  GLN n 
1 28  PRO n 
1 29  LEU n 
1 30  ALA n 
1 31  ARG n 
1 32  ASP n 
1 33  ALA n 
1 34  MET n 
1 35  ALA n 
1 36  TYR n 
1 37  VAL n 
1 38  LEU n 
1 39  ALA n 
1 40  GLY n 
1 41  GLY n 
1 42  ARG n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  LEU n 
1 47  LYS n 
1 48  GLU n 
1 49  LEU n 
1 50  THR n 
1 51  ASP n 
1 52  ARG n 
1 53  ARG n 
1 54  ALA n 
1 55  LYS n 
1 56  PRO n 
1 57  ALA n 
1 58  VAL n 
1 59  TYR n 
1 60  PHE n 
1 61  GLY n 
1 62  GLY n 
1 63  LYS n 
1 64  ALA n 
1 65  ARG n 
1 66  ILE n 
1 67  ILE n 
1 68  ASP n 
1 69  PHE n 
1 70  ALA n 
1 71  LEU n 
1 72  SER n 
1 73  ASN n 
1 74  ALA n 
1 75  LEU n 
1 76  ASN n 
1 77  SER n 
1 78  GLY n 
1 79  ILE n 
1 80  ARG n 
1 81  ARG n 
1 82  ILE n 
1 83  GLY n 
1 84  VAL n 
1 85  ALA n 
1 86  THR n 
1 87  GLN n 
1 88  TYR n 
1 89  LYS n 
1 90  ALA n 
1 91  HIS n 
1 92  ASP n 
1 93  LEU n 
1 94  ILE n 
1 95  ARG n 
1 96  HIS n 
1 97  LEU n 
1 98  GLN n 
1 99  ARG n 
1 100 GLY n 
1 101 TRP n 
1 102 ASP n 
1 103 PHE n 
1 104 PHE n 
1 105 ARG n 
1 106 PRO n 
1 107 GLU n 
1 108 ARG n 
1 109 ASN n 
1 110 GLU n 
1 111 SER n 
1 112 PHE n 
1 113 ASP n 
1 114 ILE n 
1 115 LEU n 
1 116 PRO n 
1 117 ALA n 
1 118 SER n 
1 119 GLN n 
1 120 ARG n 
1 121 VAL n 
1 122 SER n 
1 123 GLU n 
1 124 THR n 
1 125 GLN n 
1 126 TRP n 
1 127 TYR n 
1 128 GLU n 
1 129 GLY n 
1 130 THR n 
1 131 ALA n 
1 132 ASP n 
1 133 ALA n 
1 134 VAL n 
1 135 TYR n 
1 136 GLN n 
1 137 ASN n 
1 138 ILE n 
1 139 ASP n 
1 140 ILE n 
1 141 ILE n 
1 142 GLU n 
1 143 PRO n 
1 144 TYR n 
1 145 ALA n 
1 146 PRO n 
1 147 GLU n 
1 148 TYR n 
1 149 MET n 
1 150 VAL n 
1 151 ILE n 
1 152 LEU n 
1 153 ALA n 
1 154 GLY n 
1 155 ASP n 
1 156 HIS n 
1 157 ILE n 
1 158 TYR n 
1 159 LYS n 
1 160 MET n 
1 161 ASP n 
1 162 TYR n 
1 163 GLU n 
1 164 TYR n 
1 165 MET n 
1 166 LEU n 
1 167 GLN n 
1 168 GLN n 
1 169 HIS n 
1 170 VAL n 
1 171 ASP n 
1 172 SER n 
1 173 GLY n 
1 174 ALA n 
1 175 ASP n 
1 176 VAL n 
1 177 THR n 
1 178 ILE n 
1 179 GLY n 
1 180 CYS n 
1 181 LEU n 
1 182 GLU n 
1 183 VAL n 
1 184 PRO n 
1 185 ARG n 
1 186 MET n 
1 187 GLU n 
1 188 ALA n 
1 189 THR n 
1 190 GLY n 
1 191 PHE n 
1 192 GLY n 
1 193 VAL n 
1 194 MET n 
1 195 HIS n 
1 196 VAL n 
1 197 ASN n 
1 198 GLU n 
1 199 LYS n 
1 200 ASP n 
1 201 GLU n 
1 202 ILE n 
1 203 ILE n 
1 204 ASP n 
1 205 PHE n 
1 206 ILE n 
1 207 GLU n 
1 208 LYS n 
1 209 PRO n 
1 210 ALA n 
1 211 ASP n 
1 212 PRO n 
1 213 PRO n 
1 214 GLY n 
1 215 ILE n 
1 216 PRO n 
1 217 GLY n 
1 218 ASN n 
1 219 GLU n 
1 220 GLY n 
1 221 PHE n 
1 222 ALA n 
1 223 LEU n 
1 224 ALA n 
1 225 SER n 
1 226 MET n 
1 227 GLY n 
1 228 ILE n 
1 229 TYR n 
1 230 VAL n 
1 231 PHE n 
1 232 HIS n 
1 233 THR n 
1 234 LYS n 
1 235 PHE n 
1 236 LEU n 
1 237 MET n 
1 238 GLU n 
1 239 ALA n 
1 240 LEU n 
1 241 ARG n 
1 242 ARG n 
1 243 ASP n 
1 244 ALA n 
1 245 ALA n 
1 246 ASP n 
1 247 PRO n 
1 248 THR n 
1 249 SER n 
1 250 SER n 
1 251 ARG n 
1 252 ASP n 
1 253 PHE n 
1 254 GLY n 
1 255 LYS n 
1 256 ASP n 
1 257 ILE n 
1 258 ILE n 
1 259 PRO n 
1 260 TYR n 
1 261 ILE n 
1 262 VAL n 
1 263 GLU n 
1 264 HIS n 
1 265 GLY n 
1 266 LYS n 
1 267 ALA n 
1 268 VAL n 
1 269 ALA n 
1 270 HIS n 
1 271 ARG n 
1 272 PHE n 
1 273 ALA n 
1 274 ASP n 
1 275 SER n 
1 276 CYS n 
1 277 VAL n 
1 278 ARG n 
1 279 SER n 
1 280 ASP n 
1 281 PHE n 
1 282 GLU n 
1 283 HIS n 
1 284 GLU n 
1 285 PRO n 
1 286 TYR n 
1 287 TRP n 
1 288 ARG n 
1 289 ASP n 
1 290 VAL n 
1 291 GLY n 
1 292 THR n 
1 293 ILE n 
1 294 ASP n 
1 295 ALA n 
1 296 TYR n 
1 297 TRP n 
1 298 GLN n 
1 299 ALA n 
1 300 ASN n 
1 301 ILE n 
1 302 ASP n 
1 303 LEU n 
1 304 THR n 
1 305 ASP n 
1 306 VAL n 
1 307 VAL n 
1 308 PRO n 
1 309 ASP n 
1 310 LEU n 
1 311 ASP n 
1 312 ILE n 
1 313 TYR n 
1 314 ASP n 
1 315 LYS n 
1 316 SER n 
1 317 TRP n 
1 318 PRO n 
1 319 ILE n 
1 320 TRP n 
1 321 THR n 
1 322 TYR n 
1 323 ALA n 
1 324 GLU n 
1 325 ILE n 
1 326 THR n 
1 327 PRO n 
1 328 PRO n 
1 329 ALA n 
1 330 LYS n 
1 331 PHE n 
1 332 VAL n 
1 333 HIS n 
1 334 ASP n 
1 335 ASP n 
1 336 GLU n 
1 337 ASP n 
1 338 ARG n 
1 339 ARG n 
1 340 GLY n 
1 341 SER n 
1 342 ALA n 
1 343 VAL n 
1 344 SER n 
1 345 SER n 
1 346 VAL n 
1 347 VAL n 
1 348 SER n 
1 349 GLY n 
1 350 ASP n 
1 351 CYS n 
1 352 ILE n 
1 353 ILE n 
1 354 SER n 
1 355 GLY n 
1 356 ALA n 
1 357 ALA n 
1 358 LEU n 
1 359 ASN n 
1 360 ARG n 
1 361 SER n 
1 362 LEU n 
1 363 LEU n 
1 364 PHE n 
1 365 THR n 
1 366 GLY n 
1 367 VAL n 
1 368 ARG n 
1 369 ALA n 
1 370 ASN n 
1 371 SER n 
1 372 TYR n 
1 373 SER n 
1 374 ARG n 
1 375 LEU n 
1 376 GLU n 
1 377 ASN n 
1 378 ALA n 
1 379 VAL n 
1 380 VAL n 
1 381 LEU n 
1 382 PRO n 
1 383 SER n 
1 384 VAL n 
1 385 LYS n 
1 386 ILE n 
1 387 GLY n 
1 388 ARG n 
1 389 HIS n 
1 390 ALA n 
1 391 GLN n 
1 392 LEU n 
1 393 SER n 
1 394 ASN n 
1 395 VAL n 
1 396 VAL n 
1 397 ILE n 
1 398 ASP n 
1 399 HIS n 
1 400 GLY n 
1 401 VAL n 
1 402 VAL n 
1 403 ILE n 
1 404 PRO n 
1 405 GLU n 
1 406 GLY n 
1 407 LEU n 
1 408 ILE n 
1 409 VAL n 
1 410 GLY n 
1 411 GLU n 
1 412 ASP n 
1 413 PRO n 
1 414 GLU n 
1 415 LEU n 
1 416 ASP n 
1 417 ALA n 
1 418 LYS n 
1 419 ARG n 
1 420 PHE n 
1 421 ARG n 
1 422 ARG n 
1 423 THR n 
1 424 GLU n 
1 425 SER n 
1 426 GLY n 
1 427 ILE n 
1 428 CYS n 
1 429 LEU n 
1 430 ILE n 
1 431 THR n 
1 432 GLN n 
1 433 SER n 
1 434 MET n 
1 435 ILE n 
1 436 ASP n 
1 437 LYS n 
1 438 LEU n 
1 439 ASP n 
1 440 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   440 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'glgC, Atu4076, AGR_L_1560' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'C58 / ATCC 33970' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Agrobacterium fabrum (strain C58 / ATCC 33970)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     176299 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GLGC_AGRFC 
_struct_ref.pdbx_db_accession          Q8U8L5 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSEKRVQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRG
WDFFRPERNESFDILPASQRVSETQWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKMDYEYMLQQHVDSGADVTIGC
LEVPRMEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFLMEALRRDAADPTSSRDFGKDIIPY
IVEHGKAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPIWTYAEITPPAKFVHDDEDRRG
SAVSSVVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHGVVIPEGLIVGEDPELDAKRF
RRTESGICLITQSMIDKLDL
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6V99 A 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
2  1 6V99 B 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
3  1 6V99 C 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
4  1 6V99 D 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
5  1 6V99 E 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
6  1 6V99 F 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
7  1 6V99 G 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
8  1 6V99 H 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
9  1 6V99 I 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
10 1 6V99 J 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
11 1 6V99 K 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
12 1 6V99 L 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
13 1 6V99 M 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
14 1 6V99 N 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
15 1 6V99 O 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
16 1 6V99 P 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
17 1 6V99 Q 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
18 1 6V99 R 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
19 1 6V99 W 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
20 1 6V99 T 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  6V99 MET A 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 1   
1  6V99 GLY A 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 2   
1  6V99 SER A 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 3   
1  6V99 SER A 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 4   
1  6V99 HIS A 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 5   
1  6V99 HIS A 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 6   
1  6V99 HIS A 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 7   
1  6V99 HIS A 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 8   
1  6V99 HIS A 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 9   
1  6V99 HIS A 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 10  
1  6V99 SER A 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  11  
1  6V99 SER A 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  12  
1  6V99 GLY A 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  13  
1  6V99 LEU A 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  14  
1  6V99 VAL A 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  15  
1  6V99 PRO A 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  16  
1  6V99 ARG A 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  17  
1  6V99 GLY A 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  18  
1  6V99 SER A 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  19  
1  6V99 HIS A 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   20  
1  6V99 ASP A 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  21  
2  6V99 MET B 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 22  
2  6V99 GLY B 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 23  
2  6V99 SER B 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 24  
2  6V99 SER B 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 25  
2  6V99 HIS B 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 26  
2  6V99 HIS B 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 27  
2  6V99 HIS B 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 28  
2  6V99 HIS B 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 29  
2  6V99 HIS B 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 30  
2  6V99 HIS B 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 31  
2  6V99 SER B 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  32  
2  6V99 SER B 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  33  
2  6V99 GLY B 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  34  
2  6V99 LEU B 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  35  
2  6V99 VAL B 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  36  
2  6V99 PRO B 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  37  
2  6V99 ARG B 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  38  
2  6V99 GLY B 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  39  
2  6V99 SER B 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  40  
2  6V99 HIS B 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   41  
2  6V99 ASP B 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  42  
3  6V99 MET C 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 43  
3  6V99 GLY C 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 44  
3  6V99 SER C 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 45  
3  6V99 SER C 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 46  
3  6V99 HIS C 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 47  
3  6V99 HIS C 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 48  
3  6V99 HIS C 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 49  
3  6V99 HIS C 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 50  
3  6V99 HIS C 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 51  
3  6V99 HIS C 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 52  
3  6V99 SER C 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  53  
3  6V99 SER C 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  54  
3  6V99 GLY C 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  55  
3  6V99 LEU C 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  56  
3  6V99 VAL C 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  57  
3  6V99 PRO C 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  58  
3  6V99 ARG C 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  59  
3  6V99 GLY C 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  60  
3  6V99 SER C 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  61  
3  6V99 HIS C 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   62  
3  6V99 ASP C 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  63  
4  6V99 MET D 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 64  
4  6V99 GLY D 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 65  
4  6V99 SER D 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 66  
4  6V99 SER D 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 67  
4  6V99 HIS D 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 68  
4  6V99 HIS D 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 69  
4  6V99 HIS D 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 70  
4  6V99 HIS D 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 71  
4  6V99 HIS D 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 72  
4  6V99 HIS D 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 73  
4  6V99 SER D 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  74  
4  6V99 SER D 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  75  
4  6V99 GLY D 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  76  
4  6V99 LEU D 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  77  
4  6V99 VAL D 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  78  
4  6V99 PRO D 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  79  
4  6V99 ARG D 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  80  
4  6V99 GLY D 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  81  
4  6V99 SER D 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  82  
4  6V99 HIS D 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   83  
4  6V99 ASP D 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  84  
5  6V99 MET E 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 85  
5  6V99 GLY E 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 86  
5  6V99 SER E 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 87  
5  6V99 SER E 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 88  
5  6V99 HIS E 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 89  
5  6V99 HIS E 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 90  
5  6V99 HIS E 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 91  
5  6V99 HIS E 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 92  
5  6V99 HIS E 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 93  
5  6V99 HIS E 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 94  
5  6V99 SER E 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  95  
5  6V99 SER E 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  96  
5  6V99 GLY E 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  97  
5  6V99 LEU E 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  98  
5  6V99 VAL E 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  99  
5  6V99 PRO E 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  100 
5  6V99 ARG E 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  101 
5  6V99 GLY E 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  102 
5  6V99 SER E 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  103 
5  6V99 HIS E 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   104 
5  6V99 ASP E 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  105 
6  6V99 MET F 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 106 
6  6V99 GLY F 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 107 
6  6V99 SER F 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 108 
6  6V99 SER F 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 109 
6  6V99 HIS F 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 110 
6  6V99 HIS F 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 111 
6  6V99 HIS F 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 112 
6  6V99 HIS F 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 113 
6  6V99 HIS F 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 114 
6  6V99 HIS F 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 115 
6  6V99 SER F 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  116 
6  6V99 SER F 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  117 
6  6V99 GLY F 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  118 
6  6V99 LEU F 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  119 
6  6V99 VAL F 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  120 
6  6V99 PRO F 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  121 
6  6V99 ARG F 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  122 
6  6V99 GLY F 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  123 
6  6V99 SER F 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  124 
6  6V99 HIS F 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   125 
6  6V99 ASP F 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  126 
7  6V99 MET G 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 127 
7  6V99 GLY G 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 128 
7  6V99 SER G 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 129 
7  6V99 SER G 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 130 
7  6V99 HIS G 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 131 
7  6V99 HIS G 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 132 
7  6V99 HIS G 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 133 
7  6V99 HIS G 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 134 
7  6V99 HIS G 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 135 
7  6V99 HIS G 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 136 
7  6V99 SER G 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  137 
7  6V99 SER G 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  138 
7  6V99 GLY G 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  139 
7  6V99 LEU G 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  140 
7  6V99 VAL G 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  141 
7  6V99 PRO G 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  142 
7  6V99 ARG G 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  143 
7  6V99 GLY G 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  144 
7  6V99 SER G 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  145 
7  6V99 HIS G 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   146 
7  6V99 ASP G 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  147 
8  6V99 MET H 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 148 
8  6V99 GLY H 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 149 
8  6V99 SER H 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 150 
8  6V99 SER H 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 151 
8  6V99 HIS H 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 152 
8  6V99 HIS H 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 153 
8  6V99 HIS H 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 154 
8  6V99 HIS H 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 155 
8  6V99 HIS H 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 156 
8  6V99 HIS H 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 157 
8  6V99 SER H 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  158 
8  6V99 SER H 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  159 
8  6V99 GLY H 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  160 
8  6V99 LEU H 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  161 
8  6V99 VAL H 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  162 
8  6V99 PRO H 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  163 
8  6V99 ARG H 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  164 
8  6V99 GLY H 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  165 
8  6V99 SER H 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  166 
8  6V99 HIS H 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   167 
8  6V99 ASP H 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  168 
9  6V99 MET I 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 169 
9  6V99 GLY I 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 170 
9  6V99 SER I 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 171 
9  6V99 SER I 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 172 
9  6V99 HIS I 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 173 
9  6V99 HIS I 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 174 
9  6V99 HIS I 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 175 
9  6V99 HIS I 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 176 
9  6V99 HIS I 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 177 
9  6V99 HIS I 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 178 
9  6V99 SER I 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  179 
9  6V99 SER I 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  180 
9  6V99 GLY I 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  181 
9  6V99 LEU I 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  182 
9  6V99 VAL I 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  183 
9  6V99 PRO I 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  184 
9  6V99 ARG I 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  185 
9  6V99 GLY I 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  186 
9  6V99 SER I 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  187 
9  6V99 HIS I 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   188 
9  6V99 ASP I 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  189 
10 6V99 MET J 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 190 
10 6V99 GLY J 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 191 
10 6V99 SER J 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 192 
10 6V99 SER J 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 193 
10 6V99 HIS J 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 194 
10 6V99 HIS J 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 195 
10 6V99 HIS J 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 196 
10 6V99 HIS J 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 197 
10 6V99 HIS J 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 198 
10 6V99 HIS J 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 199 
10 6V99 SER J 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  200 
10 6V99 SER J 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  201 
10 6V99 GLY J 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  202 
10 6V99 LEU J 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  203 
10 6V99 VAL J 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  204 
10 6V99 PRO J 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  205 
10 6V99 ARG J 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  206 
10 6V99 GLY J 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  207 
10 6V99 SER J 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  208 
10 6V99 HIS J 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   209 
10 6V99 ASP J 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  210 
11 6V99 MET K 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 211 
11 6V99 GLY K 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 212 
11 6V99 SER K 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 213 
11 6V99 SER K 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 214 
11 6V99 HIS K 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 215 
11 6V99 HIS K 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 216 
11 6V99 HIS K 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 217 
11 6V99 HIS K 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 218 
11 6V99 HIS K 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 219 
11 6V99 HIS K 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 220 
11 6V99 SER K 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  221 
11 6V99 SER K 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  222 
11 6V99 GLY K 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  223 
11 6V99 LEU K 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  224 
11 6V99 VAL K 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  225 
11 6V99 PRO K 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  226 
11 6V99 ARG K 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  227 
11 6V99 GLY K 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  228 
11 6V99 SER K 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  229 
11 6V99 HIS K 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   230 
11 6V99 ASP K 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  231 
12 6V99 MET L 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 232 
12 6V99 GLY L 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 233 
12 6V99 SER L 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 234 
12 6V99 SER L 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 235 
12 6V99 HIS L 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 236 
12 6V99 HIS L 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 237 
12 6V99 HIS L 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 238 
12 6V99 HIS L 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 239 
12 6V99 HIS L 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 240 
12 6V99 HIS L 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 241 
12 6V99 SER L 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  242 
12 6V99 SER L 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  243 
12 6V99 GLY L 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  244 
12 6V99 LEU L 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  245 
12 6V99 VAL L 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  246 
12 6V99 PRO L 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  247 
12 6V99 ARG L 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  248 
12 6V99 GLY L 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  249 
12 6V99 SER L 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  250 
12 6V99 HIS L 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   251 
12 6V99 ASP L 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  252 
13 6V99 MET M 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 253 
13 6V99 GLY M 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 254 
13 6V99 SER M 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 255 
13 6V99 SER M 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 256 
13 6V99 HIS M 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 257 
13 6V99 HIS M 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 258 
13 6V99 HIS M 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 259 
13 6V99 HIS M 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 260 
13 6V99 HIS M 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 261 
13 6V99 HIS M 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 262 
13 6V99 SER M 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  263 
13 6V99 SER M 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  264 
13 6V99 GLY M 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  265 
13 6V99 LEU M 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  266 
13 6V99 VAL M 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  267 
13 6V99 PRO M 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  268 
13 6V99 ARG M 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  269 
13 6V99 GLY M 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  270 
13 6V99 SER M 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  271 
13 6V99 HIS M 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   272 
13 6V99 ASP M 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  273 
14 6V99 MET N 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 274 
14 6V99 GLY N 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 275 
14 6V99 SER N 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 276 
14 6V99 SER N 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 277 
14 6V99 HIS N 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 278 
14 6V99 HIS N 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 279 
14 6V99 HIS N 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 280 
14 6V99 HIS N 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 281 
14 6V99 HIS N 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 282 
14 6V99 HIS N 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 283 
14 6V99 SER N 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  284 
14 6V99 SER N 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  285 
14 6V99 GLY N 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  286 
14 6V99 LEU N 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  287 
14 6V99 VAL N 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  288 
14 6V99 PRO N 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  289 
14 6V99 ARG N 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  290 
14 6V99 GLY N 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  291 
14 6V99 SER N 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  292 
14 6V99 HIS N 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   293 
14 6V99 ASP N 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  294 
15 6V99 MET O 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 295 
15 6V99 GLY O 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 296 
15 6V99 SER O 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 297 
15 6V99 SER O 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 298 
15 6V99 HIS O 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 299 
15 6V99 HIS O 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 300 
15 6V99 HIS O 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 301 
15 6V99 HIS O 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 302 
15 6V99 HIS O 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 303 
15 6V99 HIS O 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 304 
15 6V99 SER O 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  305 
15 6V99 SER O 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  306 
15 6V99 GLY O 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  307 
15 6V99 LEU O 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  308 
15 6V99 VAL O 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  309 
15 6V99 PRO O 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  310 
15 6V99 ARG O 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  311 
15 6V99 GLY O 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  312 
15 6V99 SER O 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  313 
15 6V99 HIS O 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   314 
15 6V99 ASP O 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  315 
16 6V99 MET P 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 316 
16 6V99 GLY P 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 317 
16 6V99 SER P 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 318 
16 6V99 SER P 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 319 
16 6V99 HIS P 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 320 
16 6V99 HIS P 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 321 
16 6V99 HIS P 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 322 
16 6V99 HIS P 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 323 
16 6V99 HIS P 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 324 
16 6V99 HIS P 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 325 
16 6V99 SER P 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  326 
16 6V99 SER P 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  327 
16 6V99 GLY P 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  328 
16 6V99 LEU P 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  329 
16 6V99 VAL P 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  330 
16 6V99 PRO P 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  331 
16 6V99 ARG P 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  332 
16 6V99 GLY P 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  333 
16 6V99 SER P 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  334 
16 6V99 HIS P 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   335 
16 6V99 ASP P 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  336 
17 6V99 MET Q 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 337 
17 6V99 GLY Q 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 338 
17 6V99 SER Q 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 339 
17 6V99 SER Q 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 340 
17 6V99 HIS Q 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 341 
17 6V99 HIS Q 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 342 
17 6V99 HIS Q 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 343 
17 6V99 HIS Q 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 344 
17 6V99 HIS Q 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 345 
17 6V99 HIS Q 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 346 
17 6V99 SER Q 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  347 
17 6V99 SER Q 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  348 
17 6V99 GLY Q 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  349 
17 6V99 LEU Q 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  350 
17 6V99 VAL Q 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  351 
17 6V99 PRO Q 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  352 
17 6V99 ARG Q 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  353 
17 6V99 GLY Q 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  354 
17 6V99 SER Q 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  355 
17 6V99 HIS Q 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   356 
17 6V99 ASP Q 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  357 
18 6V99 MET R 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 358 
18 6V99 GLY R 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 359 
18 6V99 SER R 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 360 
18 6V99 SER R 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 361 
18 6V99 HIS R 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 362 
18 6V99 HIS R 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 363 
18 6V99 HIS R 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 364 
18 6V99 HIS R 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 365 
18 6V99 HIS R 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 366 
18 6V99 HIS R 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 367 
18 6V99 SER R 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  368 
18 6V99 SER R 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  369 
18 6V99 GLY R 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  370 
18 6V99 LEU R 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  371 
18 6V99 VAL R 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  372 
18 6V99 PRO R 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  373 
18 6V99 ARG R 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  374 
18 6V99 GLY R 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  375 
18 6V99 SER R 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  376 
18 6V99 HIS R 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   377 
18 6V99 ASP R 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  378 
19 6V99 MET W 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 379 
19 6V99 GLY W 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 380 
19 6V99 SER W 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 381 
19 6V99 SER W 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 382 
19 6V99 HIS W 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 383 
19 6V99 HIS W 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 384 
19 6V99 HIS W 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 385 
19 6V99 HIS W 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 386 
19 6V99 HIS W 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 387 
19 6V99 HIS W 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 388 
19 6V99 SER W 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  389 
19 6V99 SER W 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  390 
19 6V99 GLY W 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  391 
19 6V99 LEU W 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  392 
19 6V99 VAL W 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  393 
19 6V99 PRO W 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  394 
19 6V99 ARG W 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  395 
19 6V99 GLY W 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  396 
19 6V99 SER W 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  397 
19 6V99 HIS W 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   398 
19 6V99 ASP W 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  399 
20 6V99 MET T 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 400 
20 6V99 GLY T 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 401 
20 6V99 SER T 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 402 
20 6V99 SER T 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 403 
20 6V99 HIS T 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 404 
20 6V99 HIS T 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 405 
20 6V99 HIS T 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 406 
20 6V99 HIS T 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 407 
20 6V99 HIS T 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 408 
20 6V99 HIS T 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 409 
20 6V99 SER T 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  410 
20 6V99 SER T 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  411 
20 6V99 GLY T 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  412 
20 6V99 LEU T 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  413 
20 6V99 VAL T 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  414 
20 6V99 PRO T 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  415 
20 6V99 ARG T 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  416 
20 6V99 GLY T 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  417 
20 6V99 SER T 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  418 
20 6V99 HIS T 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   419 
20 6V99 ASP T 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  420 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6V99 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.84 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.73 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            297 
_exptl_crystal_grow.temp_details    'room temperature' 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'Lithium sulfate, Tris, PEG 400' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX300HE' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-02-06 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9787 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9787 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            23.24 
_reflns.entry_id                         6V99 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.28 
_reflns.d_resolution_low                 72.74 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       478212 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.1 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.0 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            5.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.093 
_reflns.pdbx_Rpim_I_all                  0.066 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.28 
_reflns_shell.d_res_low                   6.21 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           22545 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.648 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               57.5084519255 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6V99 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.287 
_refine.ls_d_res_low                             72.7 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     478200 
_refine.ls_number_reflns_R_free                  24319 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.46 
_refine.ls_percent_reflns_R_free                 5.09 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2107 
_refine.ls_R_factor_R_free                       0.2543 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2084 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.96 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5W6J 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.029 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.342658826812 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.287 
_refine_hist.d_res_low                        72.7 
_refine_hist.number_atoms_solvent             2590 
_refine_hist.number_atoms_total               68019 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        64749 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         680 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.00798302586147 ? 67146 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.939662804633   ? 91420 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.055738358575   ? 9945  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.00600809070959 ? 11943 ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 6.86592441692    ? 54589 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.3131 2.3403 . . 773 15060 96.9327782539 . . . 0.3508         . 0.3041         . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3403 2.3689 . . 829 15063 97.3595540036 . . . 0.353927728872 . 0.293964219563 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3689 2.3989 . . 742 15379 97.3666727064 . . . 0.361539132014 . 0.285768928247 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3989 2.4304 . . 819 14984 97.3990755008 . . . 0.33989321526  . 0.282321948019 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4304 2.4637 . . 855 15009 96.8379929191 . . . 0.31935986057  . 0.284798290094 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4637 2.4989 . . 823 15011 97.5540632124 . . . 0.311376961752 . 0.263264734675 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4989 2.5362 . . 777 15387 97.7681001633 . . . 0.309121554834 . 0.258877641694 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5362 2.5758 . . 814 15169 97.8271514261 . . . 0.326985529414 . 0.257482420818 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5758 2.6181 . . 786 15194 97.6235567231 . . . 0.311836672677 . 0.25643794412  . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6181 2.6632 . . 792 15053 96.6217452284 . . . 0.333061485104 . 0.287140038272 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6632 2.7117 . . 869 15015 97.7597242738 . . . 0.321558419523 . 0.264237547988 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7117 2.7638 . . 722 15263 97.9713164991 . . . 0.280303019847 . 0.244934967299 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7638 2.8202 . . 795 15295 98.0201035638 . . . 0.282876773861 . 0.244632242497 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8202 2.8816 . . 744 15273 97.981280969  . . . 0.320704823482 . 0.245225923225 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8816 2.9486 . . 847 15120 97.9029983445 . . . 0.276426071863 . 0.23590273557  . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9486 3.0223 . . 929 15230 98.1772890212 . . . 0.284266358811 . 0.225055222676 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0223 3.104  . . 865 15148 98.154958931  . . . 0.272703725714 . 0.227452976223 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.104  3.1954 . . 874 15233 98.2913284921 . . . 0.261921569734 . 0.220901126439 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1954 3.2985 . . 919 15229 98.5655862785 . . . 0.259567668419 . 0.213219838087 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2985 3.4164 . . 838 15228 98.6188693143 . . . 0.23766432689  . 0.211591270985 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4164 3.5532 . . 818 15342 98.7473266117 . . . 0.263486770918 . 0.193334129891 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5532 3.7149 . . 843 15352 98.7981942411 . . . 0.2362337721   . 0.189921152115 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7149 3.9108 . . 870 15196 98.691565821  . . . 0.231396380877 . 0.176462769586 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9    4.9    . . 723 13739 88.6314886315 . . . 0.376559298583 . 0.318684090523 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9108 4.1558 . . 812 15396 98.8413221125 . . . 0.201624732843 . 0.166905049597 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1558 4.4766 . . 736 15495 98.9272871335 . . . 0.198975862652 . 0.155958738871 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4766 4.927  . . 771 15332 98.9796545577 . . . 0.181111660601 . 0.15614591749  . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.927  5.6397 . . 857 15360 99.0774682307 . . . 0.235022265777 . 0.181478263111 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.6397 7.1045 . . 833 15437 99.1287394139 . . . 0.253804135671 . 0.210030340112 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.1045 72.7   . . 644 13903 89.0923566879 . . . 0.220005796244 . 0.193812542075 . . . . . . . . . . . 
# 
_struct.entry_id                     6V99 
_struct.title                        'Agrobacterium tumefaciens ADP-Glucose pyrophosphorylase- S72D in the presence of sulfate' 
_struct.pdbx_descriptor              'Glucose-1-phosphate adenylyltransferase (E.C.2.7.7.27)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6V99 
_struct_keywords.text            'Allosteric regulation, Fructose 6-phosphate, Glycogen synthesis, enzyme structure, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 1 ? 
R  N N 1 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 2 ? 
Z  N N 2 ? 
AA N N 2 ? 
BA N N 2 ? 
CA N N 2 ? 
DA N N 2 ? 
EA N N 2 ? 
FA N N 2 ? 
GA N N 2 ? 
HA N N 2 ? 
IA N N 2 ? 
JA N N 2 ? 
KA N N 2 ? 
LA N N 2 ? 
MA N N 2 ? 
NA N N 2 ? 
OA N N 2 ? 
PA N N 2 ? 
QA N N 2 ? 
RA N N 2 ? 
SA N N 2 ? 
TA N N 2 ? 
UA N N 2 ? 
VA N N 2 ? 
WA N N 2 ? 
XA N N 2 ? 
YA N N 2 ? 
ZA N N 2 ? 
AB N N 2 ? 
BB N N 2 ? 
CB N N 2 ? 
DB N N 2 ? 
EB N N 2 ? 
FB N N 2 ? 
GB N N 2 ? 
HB N N 2 ? 
IB N N 2 ? 
JB N N 2 ? 
KB N N 2 ? 
LB N N 2 ? 
MB N N 2 ? 
NB N N 2 ? 
OB N N 2 ? 
PB N N 2 ? 
QB N N 2 ? 
RB N N 2 ? 
SB N N 2 ? 
TB N N 2 ? 
UB N N 2 ? 
VB N N 2 ? 
WB N N 2 ? 
XB N N 2 ? 
YB N N 2 ? 
ZB N N 2 ? 
AC N N 2 ? 
BC N N 2 ? 
CC N N 2 ? 
DC N N 2 ? 
EC N N 2 ? 
FC N N 2 ? 
GC N N 2 ? 
HC N N 2 ? 
IC N N 2 ? 
JC N N 2 ? 
KC N N 2 ? 
LC N N 2 ? 
MC N N 2 ? 
NC N N 2 ? 
OC N N 2 ? 
PC N N 2 ? 
QC N N 2 ? 
RC N N 2 ? 
SC N N 2 ? 
TC N N 2 ? 
UC N N 2 ? 
VC N N 2 ? 
WC N N 2 ? 
XC N N 2 ? 
YC N N 2 ? 
ZC N N 2 ? 
AD N N 2 ? 
BD N N 2 ? 
CD N N 2 ? 
DD N N 2 ? 
ED N N 2 ? 
FD N N 2 ? 
GD N N 2 ? 
HD N N 2 ? 
ID N N 2 ? 
JD N N 2 ? 
KD N N 2 ? 
LD N N 2 ? 
MD N N 2 ? 
ND N N 2 ? 
OD N N 2 ? 
PD N N 2 ? 
QD N N 2 ? 
RD N N 2 ? 
SD N N 2 ? 
TD N N 2 ? 
UD N N 2 ? 
VD N N 2 ? 
WD N N 2 ? 
XD N N 2 ? 
YD N N 2 ? 
ZD N N 2 ? 
AE N N 2 ? 
BE N N 2 ? 
CE N N 2 ? 
DE N N 2 ? 
EE N N 2 ? 
FE N N 2 ? 
GE N N 2 ? 
HE N N 2 ? 
IE N N 2 ? 
JE N N 2 ? 
KE N N 2 ? 
LE N N 2 ? 
ME N N 2 ? 
NE N N 2 ? 
OE N N 2 ? 
PE N N 2 ? 
QE N N 2 ? 
RE N N 2 ? 
SE N N 2 ? 
TE N N 2 ? 
UE N N 2 ? 
VE N N 2 ? 
WE N N 2 ? 
XE N N 2 ? 
YE N N 2 ? 
ZE N N 2 ? 
AF N N 3 ? 
BF N N 3 ? 
CF N N 3 ? 
DF N N 3 ? 
EF N N 3 ? 
FF N N 3 ? 
GF N N 3 ? 
HF N N 3 ? 
IF N N 3 ? 
JF N N 3 ? 
KF N N 3 ? 
LF N N 3 ? 
MF N N 3 ? 
NF N N 3 ? 
OF N N 3 ? 
PF N N 3 ? 
QF N N 3 ? 
RF N N 3 ? 
SF N N 3 ? 
TF N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 PRO A 28  ? ARG A 31  ? PRO A 8   ARG A 11  5 ? 4  
HELX_P HELX_P2   AA2 GLY A 43  ? ASP A 51  ? GLY A 23  ASP A 31  5 ? 9  
HELX_P HELX_P3   AA3 ALA A 54  ? ALA A 57  ? ALA A 34  ALA A 37  5 ? 4  
HELX_P HELX_P4   AA4 ILE A 66  ? SER A 77  ? ILE A 46  SER A 57  1 ? 12 
HELX_P HELX_P5   AA5 ALA A 90  ? TRP A 101 ? ALA A 70  TRP A 81  1 ? 12 
HELX_P HELX_P6   AA6 ARG A 105 ? ASN A 109 ? ARG A 85  ASN A 89  5 ? 5  
HELX_P HELX_P7   AA7 GLY A 129 ? GLN A 136 ? GLY A 109 GLN A 116 1 ? 8  
HELX_P HELX_P8   AA8 ASN A 137 ? ALA A 145 ? ASN A 117 ALA A 125 1 ? 9  
HELX_P HELX_P9   AA9 ASP A 161 ? GLY A 173 ? ASP A 141 GLY A 153 1 ? 13 
HELX_P HELX_P10  AB1 MET A 186 ? GLY A 190 ? MET A 166 GLY A 170 5 ? 5  
HELX_P HELX_P11  AB2 THR A 233 ? ASP A 246 ? THR A 213 ASP A 226 1 ? 14 
HELX_P HELX_P12  AB3 ASP A 256 ? GLY A 265 ? ASP A 236 GLY A 245 1 ? 10 
HELX_P HELX_P13  AB4 PHE A 272 ? CYS A 276 ? PHE A 252 CYS A 256 1 ? 5  
HELX_P HELX_P14  AB5 THR A 292 ? ASP A 302 ? THR A 272 ASP A 282 1 ? 11 
HELX_P HELX_P15  AB6 LEU A 303 ? ASP A 305 ? LEU A 283 ASP A 285 5 ? 3  
HELX_P HELX_P16  AB7 ASP A 412 ? PHE A 420 ? ASP A 392 PHE A 400 1 ? 9  
HELX_P HELX_P17  AB8 THR A 431 ? LYS A 437 ? THR A 411 LYS A 417 1 ? 7  
HELX_P HELX_P18  AB9 PRO B 28  ? ARG B 31  ? PRO B 8   ARG B 11  5 ? 4  
HELX_P HELX_P19  AC1 GLY B 43  ? ASP B 51  ? GLY B 23  ASP B 31  5 ? 9  
HELX_P HELX_P20  AC2 ALA B 54  ? VAL B 58  ? ALA B 34  VAL B 38  5 ? 5  
HELX_P HELX_P21  AC3 ILE B 67  ? SER B 77  ? ILE B 47  SER B 57  1 ? 11 
HELX_P HELX_P22  AC4 ALA B 90  ? TRP B 101 ? ALA B 70  TRP B 81  1 ? 12 
HELX_P HELX_P23  AC5 ARG B 105 ? ASN B 109 ? ARG B 85  ASN B 89  5 ? 5  
HELX_P HELX_P24  AC6 GLY B 129 ? GLN B 136 ? GLY B 109 GLN B 116 1 ? 8  
HELX_P HELX_P25  AC7 ASN B 137 ? ALA B 145 ? ASN B 117 ALA B 125 1 ? 9  
HELX_P HELX_P26  AC8 ASP B 161 ? GLY B 173 ? ASP B 141 GLY B 153 1 ? 13 
HELX_P HELX_P27  AC9 ARG B 185 ? THR B 189 ? ARG B 165 THR B 169 1 ? 5  
HELX_P HELX_P28  AD1 THR B 233 ? ALA B 245 ? THR B 213 ALA B 225 1 ? 13 
HELX_P HELX_P29  AD2 ASP B 256 ? GLY B 265 ? ASP B 236 GLY B 245 1 ? 10 
HELX_P HELX_P30  AD3 PHE B 272 ? CYS B 276 ? PHE B 252 CYS B 256 1 ? 5  
HELX_P HELX_P31  AD4 THR B 292 ? ASP B 302 ? THR B 272 ASP B 282 1 ? 11 
HELX_P HELX_P32  AD5 LEU B 303 ? ASP B 305 ? LEU B 283 ASP B 285 5 ? 3  
HELX_P HELX_P33  AD6 ASP B 412 ? PHE B 420 ? ASP B 392 PHE B 400 1 ? 9  
HELX_P HELX_P34  AD7 THR B 431 ? LYS B 437 ? THR B 411 LYS B 417 1 ? 7  
HELX_P HELX_P35  AD8 PRO C 28  ? ARG C 31  ? PRO C 8   ARG C 11  5 ? 4  
HELX_P HELX_P36  AD9 GLY C 43  ? ASP C 51  ? GLY C 23  ASP C 31  5 ? 9  
HELX_P HELX_P37  AE1 ALA C 54  ? ALA C 57  ? ALA C 34  ALA C 37  5 ? 4  
HELX_P HELX_P38  AE2 ILE C 67  ? GLY C 78  ? ILE C 47  GLY C 58  1 ? 12 
HELX_P HELX_P39  AE3 ALA C 90  ? TRP C 101 ? ALA C 70  TRP C 81  1 ? 12 
HELX_P HELX_P40  AE4 ARG C 105 ? ASN C 109 ? ARG C 85  ASN C 89  5 ? 5  
HELX_P HELX_P41  AE5 GLY C 129 ? GLN C 136 ? GLY C 109 GLN C 116 1 ? 8  
HELX_P HELX_P42  AE6 ASN C 137 ? ALA C 145 ? ASN C 117 ALA C 125 1 ? 9  
HELX_P HELX_P43  AE7 ASP C 161 ? GLY C 173 ? ASP C 141 GLY C 153 1 ? 13 
HELX_P HELX_P44  AE8 MET C 186 ? GLY C 190 ? MET C 166 GLY C 170 5 ? 5  
HELX_P HELX_P45  AE9 THR C 233 ? ALA C 245 ? THR C 213 ALA C 225 1 ? 13 
HELX_P HELX_P46  AF1 ASP C 256 ? GLY C 265 ? ASP C 236 GLY C 245 1 ? 10 
HELX_P HELX_P47  AF2 PHE C 272 ? CYS C 276 ? PHE C 252 CYS C 256 1 ? 5  
HELX_P HELX_P48  AF3 THR C 292 ? ASP C 302 ? THR C 272 ASP C 282 1 ? 11 
HELX_P HELX_P49  AF4 LEU C 303 ? ASP C 305 ? LEU C 283 ASP C 285 5 ? 3  
HELX_P HELX_P50  AF5 ASP C 412 ? PHE C 420 ? ASP C 392 PHE C 400 1 ? 9  
HELX_P HELX_P51  AF6 THR C 431 ? LYS C 437 ? THR C 411 LYS C 417 1 ? 7  
HELX_P HELX_P52  AF7 PRO D 28  ? ARG D 31  ? PRO D 8   ARG D 11  5 ? 4  
HELX_P HELX_P53  AF8 GLY D 43  ? ASP D 51  ? GLY D 23  ASP D 31  5 ? 9  
HELX_P HELX_P54  AF9 ALA D 54  ? VAL D 58  ? ALA D 34  VAL D 38  5 ? 5  
HELX_P HELX_P55  AG1 ILE D 67  ? GLY D 78  ? ILE D 47  GLY D 58  1 ? 12 
HELX_P HELX_P56  AG2 ALA D 90  ? TRP D 101 ? ALA D 70  TRP D 81  1 ? 12 
HELX_P HELX_P57  AG3 ARG D 105 ? ASN D 109 ? ARG D 85  ASN D 89  5 ? 5  
HELX_P HELX_P58  AG4 GLY D 129 ? GLN D 136 ? GLY D 109 GLN D 116 1 ? 8  
HELX_P HELX_P59  AG5 ASN D 137 ? GLU D 142 ? ASN D 117 GLU D 122 1 ? 6  
HELX_P HELX_P60  AG6 PRO D 143 ? ALA D 145 ? PRO D 123 ALA D 125 5 ? 3  
HELX_P HELX_P61  AG7 ASP D 161 ? GLY D 173 ? ASP D 141 GLY D 153 1 ? 13 
HELX_P HELX_P62  AG8 MET D 186 ? GLY D 190 ? MET D 166 GLY D 170 5 ? 5  
HELX_P HELX_P63  AG9 THR D 233 ? ASP D 246 ? THR D 213 ASP D 226 1 ? 14 
HELX_P HELX_P64  AH1 ASP D 256 ? GLY D 265 ? ASP D 236 GLY D 245 1 ? 10 
HELX_P HELX_P65  AH2 PHE D 272 ? CYS D 276 ? PHE D 252 CYS D 256 1 ? 5  
HELX_P HELX_P66  AH3 THR D 292 ? ASP D 302 ? THR D 272 ASP D 282 1 ? 11 
HELX_P HELX_P67  AH4 LEU D 303 ? ASP D 305 ? LEU D 283 ASP D 285 5 ? 3  
HELX_P HELX_P68  AH5 ASP D 412 ? PHE D 420 ? ASP D 392 PHE D 400 1 ? 9  
HELX_P HELX_P69  AH6 THR D 431 ? LEU D 438 ? THR D 411 LEU D 418 1 ? 8  
HELX_P HELX_P70  AH7 PRO E 28  ? ARG E 31  ? PRO E 8   ARG E 11  5 ? 4  
HELX_P HELX_P71  AH8 GLY E 43  ? ASP E 51  ? GLY E 23  ASP E 31  5 ? 9  
HELX_P HELX_P72  AH9 ALA E 54  ? VAL E 58  ? ALA E 34  VAL E 38  5 ? 5  
HELX_P HELX_P73  AI1 ILE E 67  ? SER E 77  ? ILE E 47  SER E 57  1 ? 11 
HELX_P HELX_P74  AI2 ALA E 90  ? TRP E 101 ? ALA E 70  TRP E 81  1 ? 12 
HELX_P HELX_P75  AI3 ARG E 105 ? ASN E 109 ? ARG E 85  ASN E 89  5 ? 5  
HELX_P HELX_P76  AI4 ALA E 131 ? GLN E 136 ? ALA E 111 GLN E 116 1 ? 6  
HELX_P HELX_P77  AI5 ASN E 137 ? ALA E 145 ? ASN E 117 ALA E 125 1 ? 9  
HELX_P HELX_P78  AI6 ASP E 161 ? GLY E 173 ? ASP E 141 GLY E 153 1 ? 13 
HELX_P HELX_P79  AI7 ARG E 185 ? THR E 189 ? ARG E 165 THR E 169 1 ? 5  
HELX_P HELX_P80  AI8 THR E 233 ? ALA E 245 ? THR E 213 ALA E 225 1 ? 13 
HELX_P HELX_P81  AI9 ASP E 256 ? GLY E 265 ? ASP E 236 GLY E 245 1 ? 10 
HELX_P HELX_P82  AJ1 ALA E 273 ? SER E 275 ? ALA E 253 SER E 255 5 ? 3  
HELX_P HELX_P83  AJ2 THR E 292 ? ASP E 302 ? THR E 272 ASP E 282 1 ? 11 
HELX_P HELX_P84  AJ3 LEU E 303 ? ASP E 305 ? LEU E 283 ASP E 285 5 ? 3  
HELX_P HELX_P85  AJ4 ASP E 412 ? PHE E 420 ? ASP E 392 PHE E 400 1 ? 9  
HELX_P HELX_P86  AJ5 THR E 431 ? LYS E 437 ? THR E 411 LYS E 417 1 ? 7  
HELX_P HELX_P87  AJ6 PRO F 28  ? ARG F 31  ? PRO F 8   ARG F 11  5 ? 4  
HELX_P HELX_P88  AJ7 GLY F 43  ? ASP F 51  ? GLY F 23  ASP F 31  5 ? 9  
HELX_P HELX_P89  AJ8 ALA F 54  ? ALA F 57  ? ALA F 34  ALA F 37  5 ? 4  
HELX_P HELX_P90  AJ9 ILE F 67  ? SER F 77  ? ILE F 47  SER F 57  1 ? 11 
HELX_P HELX_P91  AK1 ALA F 90  ? TRP F 101 ? ALA F 70  TRP F 81  1 ? 12 
HELX_P HELX_P92  AK2 ARG F 105 ? ASN F 109 ? ARG F 85  ASN F 89  5 ? 5  
HELX_P HELX_P93  AK3 ALA F 131 ? GLN F 136 ? ALA F 111 GLN F 116 1 ? 6  
HELX_P HELX_P94  AK4 ASN F 137 ? ALA F 145 ? ASN F 117 ALA F 125 1 ? 9  
HELX_P HELX_P95  AK5 ASP F 161 ? GLY F 173 ? ASP F 141 GLY F 153 1 ? 13 
HELX_P HELX_P96  AK6 ARG F 185 ? THR F 189 ? ARG F 165 THR F 169 1 ? 5  
HELX_P HELX_P97  AK7 THR F 233 ? ALA F 245 ? THR F 213 ALA F 225 1 ? 13 
HELX_P HELX_P98  AK8 ASP F 256 ? GLY F 265 ? ASP F 236 GLY F 245 1 ? 10 
HELX_P HELX_P99  AK9 ALA F 273 ? SER F 275 ? ALA F 253 SER F 255 5 ? 3  
HELX_P HELX_P100 AL1 THR F 292 ? LEU F 303 ? THR F 272 LEU F 283 1 ? 12 
HELX_P HELX_P101 AL2 ASP F 412 ? PHE F 420 ? ASP F 392 PHE F 400 1 ? 9  
HELX_P HELX_P102 AL3 THR F 431 ? LYS F 437 ? THR F 411 LYS F 417 1 ? 7  
HELX_P HELX_P103 AL4 PRO G 28  ? ARG G 31  ? PRO G 8   ARG G 11  5 ? 4  
HELX_P HELX_P104 AL5 GLY G 43  ? ASP G 51  ? GLY G 23  ASP G 31  5 ? 9  
HELX_P HELX_P105 AL6 ALA G 54  ? VAL G 58  ? ALA G 34  VAL G 38  5 ? 5  
HELX_P HELX_P106 AL7 ILE G 66  ? GLY G 78  ? ILE G 46  GLY G 58  1 ? 13 
HELX_P HELX_P107 AL8 ALA G 90  ? TRP G 101 ? ALA G 70  TRP G 81  1 ? 12 
HELX_P HELX_P108 AL9 ARG G 105 ? ASN G 109 ? ARG G 85  ASN G 89  5 ? 5  
HELX_P HELX_P109 AM1 GLY G 129 ? GLN G 136 ? GLY G 109 GLN G 116 1 ? 8  
HELX_P HELX_P110 AM2 ASN G 137 ? ALA G 145 ? ASN G 117 ALA G 125 1 ? 9  
HELX_P HELX_P111 AM3 ASP G 161 ? GLY G 173 ? ASP G 141 GLY G 153 1 ? 13 
HELX_P HELX_P112 AM4 ARG G 185 ? THR G 189 ? ARG G 165 THR G 169 1 ? 5  
HELX_P HELX_P113 AM5 THR G 233 ? ALA G 245 ? THR G 213 ALA G 225 1 ? 13 
HELX_P HELX_P114 AM6 ASP G 256 ? GLY G 265 ? ASP G 236 GLY G 245 1 ? 10 
HELX_P HELX_P115 AM7 PHE G 272 ? CYS G 276 ? PHE G 252 CYS G 256 1 ? 5  
HELX_P HELX_P116 AM8 THR G 292 ? ASP G 302 ? THR G 272 ASP G 282 1 ? 11 
HELX_P HELX_P117 AM9 LEU G 303 ? ASP G 305 ? LEU G 283 ASP G 285 5 ? 3  
HELX_P HELX_P118 AN1 ASP G 412 ? PHE G 420 ? ASP G 392 PHE G 400 1 ? 9  
HELX_P HELX_P119 AN2 THR G 431 ? LYS G 437 ? THR G 411 LYS G 417 1 ? 7  
HELX_P HELX_P120 AN3 PRO H 28  ? ARG H 31  ? PRO H 8   ARG H 11  5 ? 4  
HELX_P HELX_P121 AN4 GLY H 43  ? ASP H 51  ? GLY H 23  ASP H 31  5 ? 9  
HELX_P HELX_P122 AN5 ALA H 54  ? ALA H 57  ? ALA H 34  ALA H 37  5 ? 4  
HELX_P HELX_P123 AN6 ILE H 67  ? SER H 77  ? ILE H 47  SER H 57  1 ? 11 
HELX_P HELX_P124 AN7 ALA H 90  ? TRP H 101 ? ALA H 70  TRP H 81  1 ? 12 
HELX_P HELX_P125 AN8 ARG H 105 ? ASN H 109 ? ARG H 85  ASN H 89  5 ? 5  
HELX_P HELX_P126 AN9 GLY H 129 ? GLN H 136 ? GLY H 109 GLN H 116 1 ? 8  
HELX_P HELX_P127 AO1 ASN H 137 ? ALA H 145 ? ASN H 117 ALA H 125 1 ? 9  
HELX_P HELX_P128 AO2 ASP H 161 ? GLY H 173 ? ASP H 141 GLY H 153 1 ? 13 
HELX_P HELX_P129 AO3 MET H 186 ? GLY H 190 ? MET H 166 GLY H 170 5 ? 5  
HELX_P HELX_P130 AO4 THR H 233 ? ALA H 244 ? THR H 213 ALA H 224 1 ? 12 
HELX_P HELX_P131 AO5 ASP H 256 ? GLY H 265 ? ASP H 236 GLY H 245 1 ? 10 
HELX_P HELX_P132 AO6 PHE H 272 ? CYS H 276 ? PHE H 252 CYS H 256 1 ? 5  
HELX_P HELX_P133 AO7 THR H 292 ? ASP H 302 ? THR H 272 ASP H 282 1 ? 11 
HELX_P HELX_P134 AO8 LEU H 303 ? ASP H 305 ? LEU H 283 ASP H 285 5 ? 3  
HELX_P HELX_P135 AO9 ASP H 412 ? PHE H 420 ? ASP H 392 PHE H 400 1 ? 9  
HELX_P HELX_P136 AP1 THR H 431 ? LYS H 437 ? THR H 411 LYS H 417 1 ? 7  
HELX_P HELX_P137 AP2 PRO I 28  ? ARG I 31  ? PRO I 8   ARG I 11  5 ? 4  
HELX_P HELX_P138 AP3 GLY I 43  ? ASP I 51  ? GLY I 23  ASP I 31  5 ? 9  
HELX_P HELX_P139 AP4 ALA I 54  ? VAL I 58  ? ALA I 34  VAL I 38  5 ? 5  
HELX_P HELX_P140 AP5 ILE I 67  ? SER I 77  ? ILE I 47  SER I 57  1 ? 11 
HELX_P HELX_P141 AP6 ALA I 90  ? TRP I 101 ? ALA I 70  TRP I 81  1 ? 12 
HELX_P HELX_P142 AP7 ARG I 105 ? ASN I 109 ? ARG I 85  ASN I 89  5 ? 5  
HELX_P HELX_P143 AP8 ALA I 131 ? GLN I 136 ? ALA I 111 GLN I 116 1 ? 6  
HELX_P HELX_P144 AP9 ASN I 137 ? GLU I 142 ? ASN I 117 GLU I 122 1 ? 6  
HELX_P HELX_P145 AQ1 ASP I 161 ? GLY I 173 ? ASP I 141 GLY I 153 1 ? 13 
HELX_P HELX_P146 AQ2 MET I 186 ? GLY I 190 ? MET I 166 GLY I 170 5 ? 5  
HELX_P HELX_P147 AQ3 THR I 233 ? ASP I 246 ? THR I 213 ASP I 226 1 ? 14 
HELX_P HELX_P148 AQ4 ASP I 256 ? GLY I 265 ? ASP I 236 GLY I 245 1 ? 10 
HELX_P HELX_P149 AQ5 PHE I 272 ? CYS I 276 ? PHE I 252 CYS I 256 1 ? 5  
HELX_P HELX_P150 AQ6 THR I 292 ? ASP I 302 ? THR I 272 ASP I 282 1 ? 11 
HELX_P HELX_P151 AQ7 LEU I 303 ? ASP I 305 ? LEU I 283 ASP I 285 5 ? 3  
HELX_P HELX_P152 AQ8 ASP I 412 ? PHE I 420 ? ASP I 392 PHE I 400 1 ? 9  
HELX_P HELX_P153 AQ9 THR I 431 ? LYS I 437 ? THR I 411 LYS I 417 1 ? 7  
HELX_P HELX_P154 AR1 PRO J 28  ? ARG J 31  ? PRO J 8   ARG J 11  5 ? 4  
HELX_P HELX_P155 AR2 GLY J 43  ? ASP J 51  ? GLY J 23  ASP J 31  5 ? 9  
HELX_P HELX_P156 AR3 ALA J 54  ? VAL J 58  ? ALA J 34  VAL J 38  5 ? 5  
HELX_P HELX_P157 AR4 ILE J 67  ? SER J 77  ? ILE J 47  SER J 57  1 ? 11 
HELX_P HELX_P158 AR5 ALA J 90  ? TRP J 101 ? ALA J 70  TRP J 81  1 ? 12 
HELX_P HELX_P159 AR6 ARG J 105 ? ASN J 109 ? ARG J 85  ASN J 89  5 ? 5  
HELX_P HELX_P160 AR7 GLY J 129 ? GLN J 136 ? GLY J 109 GLN J 116 1 ? 8  
HELX_P HELX_P161 AR8 ASN J 137 ? ALA J 145 ? ASN J 117 ALA J 125 1 ? 9  
HELX_P HELX_P162 AR9 ASP J 161 ? GLY J 173 ? ASP J 141 GLY J 153 1 ? 13 
HELX_P HELX_P163 AS1 MET J 186 ? GLY J 190 ? MET J 166 GLY J 170 5 ? 5  
HELX_P HELX_P164 AS2 THR J 233 ? ASP J 246 ? THR J 213 ASP J 226 1 ? 14 
HELX_P HELX_P165 AS3 ASP J 256 ? GLY J 265 ? ASP J 236 GLY J 245 1 ? 10 
HELX_P HELX_P166 AS4 PHE J 272 ? CYS J 276 ? PHE J 252 CYS J 256 1 ? 5  
HELX_P HELX_P167 AS5 THR J 292 ? ASP J 302 ? THR J 272 ASP J 282 1 ? 11 
HELX_P HELX_P168 AS6 LEU J 303 ? ASP J 305 ? LEU J 283 ASP J 285 5 ? 3  
HELX_P HELX_P169 AS7 ASP J 412 ? PHE J 420 ? ASP J 392 PHE J 400 1 ? 9  
HELX_P HELX_P170 AS8 THR J 431 ? LYS J 437 ? THR J 411 LYS J 417 1 ? 7  
HELX_P HELX_P171 AS9 PRO K 28  ? ARG K 31  ? PRO K 8   ARG K 11  5 ? 4  
HELX_P HELX_P172 AT1 GLY K 43  ? ASP K 51  ? GLY K 23  ASP K 31  5 ? 9  
HELX_P HELX_P173 AT2 ALA K 54  ? ALA K 57  ? ALA K 34  ALA K 37  5 ? 4  
HELX_P HELX_P174 AT3 ILE K 67  ? SER K 77  ? ILE K 47  SER K 57  1 ? 11 
HELX_P HELX_P175 AT4 ALA K 90  ? TRP K 101 ? ALA K 70  TRP K 81  1 ? 12 
HELX_P HELX_P176 AT5 ARG K 105 ? ASN K 109 ? ARG K 85  ASN K 89  5 ? 5  
HELX_P HELX_P177 AT6 ALA K 131 ? GLN K 136 ? ALA K 111 GLN K 116 1 ? 6  
HELX_P HELX_P178 AT7 ASN K 137 ? ALA K 145 ? ASN K 117 ALA K 125 1 ? 9  
HELX_P HELX_P179 AT8 ASP K 161 ? GLY K 173 ? ASP K 141 GLY K 153 1 ? 13 
HELX_P HELX_P180 AT9 MET K 186 ? GLY K 190 ? MET K 166 GLY K 170 5 ? 5  
HELX_P HELX_P181 AU1 THR K 233 ? ALA K 244 ? THR K 213 ALA K 224 1 ? 12 
HELX_P HELX_P182 AU2 ASP K 256 ? GLY K 265 ? ASP K 236 GLY K 245 1 ? 10 
HELX_P HELX_P183 AU3 PHE K 272 ? CYS K 276 ? PHE K 252 CYS K 256 1 ? 5  
HELX_P HELX_P184 AU4 THR K 292 ? ASP K 302 ? THR K 272 ASP K 282 1 ? 11 
HELX_P HELX_P185 AU5 LEU K 303 ? ASP K 305 ? LEU K 283 ASP K 285 5 ? 3  
HELX_P HELX_P186 AU6 ASP K 412 ? PHE K 420 ? ASP K 392 PHE K 400 1 ? 9  
HELX_P HELX_P187 AU7 THR K 431 ? LYS K 437 ? THR K 411 LYS K 417 1 ? 7  
HELX_P HELX_P188 AU8 PRO L 28  ? ARG L 31  ? PRO L 8   ARG L 11  5 ? 4  
HELX_P HELX_P189 AU9 GLY L 43  ? ASP L 51  ? GLY L 23  ASP L 31  5 ? 9  
HELX_P HELX_P190 AV1 ALA L 54  ? ALA L 57  ? ALA L 34  ALA L 37  5 ? 4  
HELX_P HELX_P191 AV2 ILE L 66  ? SER L 77  ? ILE L 46  SER L 57  1 ? 12 
HELX_P HELX_P192 AV3 ALA L 90  ? TRP L 101 ? ALA L 70  TRP L 81  1 ? 12 
HELX_P HELX_P193 AV4 ARG L 105 ? ASN L 109 ? ARG L 85  ASN L 89  5 ? 5  
HELX_P HELX_P194 AV5 GLY L 129 ? GLN L 136 ? GLY L 109 GLN L 116 1 ? 8  
HELX_P HELX_P195 AV6 ASN L 137 ? ALA L 145 ? ASN L 117 ALA L 125 1 ? 9  
HELX_P HELX_P196 AV7 ASP L 161 ? GLY L 173 ? ASP L 141 GLY L 153 1 ? 13 
HELX_P HELX_P197 AV8 MET L 186 ? GLY L 190 ? MET L 166 GLY L 170 5 ? 5  
HELX_P HELX_P198 AV9 THR L 233 ? ASP L 246 ? THR L 213 ASP L 226 1 ? 14 
HELX_P HELX_P199 AW1 ASP L 256 ? GLY L 265 ? ASP L 236 GLY L 245 1 ? 10 
HELX_P HELX_P200 AW2 PHE L 272 ? CYS L 276 ? PHE L 252 CYS L 256 1 ? 5  
HELX_P HELX_P201 AW3 THR L 292 ? ASP L 302 ? THR L 272 ASP L 282 1 ? 11 
HELX_P HELX_P202 AW4 LEU L 303 ? ASP L 305 ? LEU L 283 ASP L 285 5 ? 3  
HELX_P HELX_P203 AW5 ASP L 412 ? PHE L 420 ? ASP L 392 PHE L 400 1 ? 9  
HELX_P HELX_P204 AW6 THR L 431 ? LYS L 437 ? THR L 411 LYS L 417 1 ? 7  
HELX_P HELX_P205 AW7 PRO M 28  ? ARG M 31  ? PRO M 8   ARG M 11  5 ? 4  
HELX_P HELX_P206 AW8 GLY M 43  ? ASP M 51  ? GLY M 23  ASP M 31  5 ? 9  
HELX_P HELX_P207 AW9 ALA M 54  ? ALA M 57  ? ALA M 34  ALA M 37  5 ? 4  
HELX_P HELX_P208 AX1 ILE M 67  ? SER M 77  ? ILE M 47  SER M 57  1 ? 11 
HELX_P HELX_P209 AX2 LYS M 89  ? TRP M 101 ? LYS M 69  TRP M 81  1 ? 13 
HELX_P HELX_P210 AX3 ARG M 105 ? ASN M 109 ? ARG M 85  ASN M 89  5 ? 5  
HELX_P HELX_P211 AX4 GLY M 129 ? GLN M 136 ? GLY M 109 GLN M 116 1 ? 8  
HELX_P HELX_P212 AX5 ASN M 137 ? ALA M 145 ? ASN M 117 ALA M 125 1 ? 9  
HELX_P HELX_P213 AX6 ASP M 161 ? GLY M 173 ? ASP M 141 GLY M 153 1 ? 13 
HELX_P HELX_P214 AX7 ARG M 185 ? THR M 189 ? ARG M 165 THR M 169 1 ? 5  
HELX_P HELX_P215 AX8 THR M 233 ? ALA M 245 ? THR M 213 ALA M 225 1 ? 13 
HELX_P HELX_P216 AX9 ASP M 256 ? GLY M 265 ? ASP M 236 GLY M 245 1 ? 10 
HELX_P HELX_P217 AY1 PHE M 272 ? CYS M 276 ? PHE M 252 CYS M 256 1 ? 5  
HELX_P HELX_P218 AY2 THR M 292 ? ASP M 302 ? THR M 272 ASP M 282 1 ? 11 
HELX_P HELX_P219 AY3 LEU M 303 ? ASP M 305 ? LEU M 283 ASP M 285 5 ? 3  
HELX_P HELX_P220 AY4 ASP M 412 ? PHE M 420 ? ASP M 392 PHE M 400 1 ? 9  
HELX_P HELX_P221 AY5 THR M 431 ? LYS M 437 ? THR M 411 LYS M 417 1 ? 7  
HELX_P HELX_P222 AY6 PRO N 28  ? ARG N 31  ? PRO N 8   ARG N 11  5 ? 4  
HELX_P HELX_P223 AY7 GLY N 43  ? ASP N 51  ? GLY N 23  ASP N 31  5 ? 9  
HELX_P HELX_P224 AY8 ALA N 54  ? VAL N 58  ? ALA N 34  VAL N 38  5 ? 5  
HELX_P HELX_P225 AY9 ILE N 66  ? GLY N 78  ? ILE N 46  GLY N 58  1 ? 13 
HELX_P HELX_P226 AZ1 ALA N 90  ? TRP N 101 ? ALA N 70  TRP N 81  1 ? 12 
HELX_P HELX_P227 AZ2 ARG N 105 ? ASN N 109 ? ARG N 85  ASN N 89  5 ? 5  
HELX_P HELX_P228 AZ3 GLY N 129 ? GLN N 136 ? GLY N 109 GLN N 116 1 ? 8  
HELX_P HELX_P229 AZ4 ASN N 137 ? ALA N 145 ? ASN N 117 ALA N 125 1 ? 9  
HELX_P HELX_P230 AZ5 ASP N 161 ? GLY N 173 ? ASP N 141 GLY N 153 1 ? 13 
HELX_P HELX_P231 AZ6 MET N 186 ? GLY N 190 ? MET N 166 GLY N 170 5 ? 5  
HELX_P HELX_P232 AZ7 THR N 233 ? ASP N 246 ? THR N 213 ASP N 226 1 ? 14 
HELX_P HELX_P233 AZ8 ASP N 256 ? GLY N 265 ? ASP N 236 GLY N 245 1 ? 10 
HELX_P HELX_P234 AZ9 ALA N 273 ? SER N 275 ? ALA N 253 SER N 255 5 ? 3  
HELX_P HELX_P235 BA1 THR N 292 ? ASP N 302 ? THR N 272 ASP N 282 1 ? 11 
HELX_P HELX_P236 BA2 LEU N 303 ? ASP N 305 ? LEU N 283 ASP N 285 5 ? 3  
HELX_P HELX_P237 BA3 ASP N 412 ? PHE N 420 ? ASP N 392 PHE N 400 1 ? 9  
HELX_P HELX_P238 BA4 THR N 431 ? LYS N 437 ? THR N 411 LYS N 417 1 ? 7  
HELX_P HELX_P239 BA5 PRO O 28  ? ARG O 31  ? PRO O 8   ARG O 11  5 ? 4  
HELX_P HELX_P240 BA6 GLY O 43  ? ASP O 51  ? GLY O 23  ASP O 31  5 ? 9  
HELX_P HELX_P241 BA7 ALA O 54  ? ALA O 57  ? ALA O 34  ALA O 37  5 ? 4  
HELX_P HELX_P242 BA8 ILE O 67  ? SER O 77  ? ILE O 47  SER O 57  1 ? 11 
HELX_P HELX_P243 BA9 ALA O 90  ? TRP O 101 ? ALA O 70  TRP O 81  1 ? 12 
HELX_P HELX_P244 BB1 ARG O 105 ? ASN O 109 ? ARG O 85  ASN O 89  5 ? 5  
HELX_P HELX_P245 BB2 ALA O 131 ? GLN O 136 ? ALA O 111 GLN O 116 1 ? 6  
HELX_P HELX_P246 BB3 ASN O 137 ? GLU O 142 ? ASN O 117 GLU O 122 1 ? 6  
HELX_P HELX_P247 BB4 ASP O 161 ? GLY O 173 ? ASP O 141 GLY O 153 1 ? 13 
HELX_P HELX_P248 BB5 MET O 186 ? GLY O 190 ? MET O 166 GLY O 170 5 ? 5  
HELX_P HELX_P249 BB6 THR O 233 ? ASP O 246 ? THR O 213 ASP O 226 1 ? 14 
HELX_P HELX_P250 BB7 ASP O 256 ? GLY O 265 ? ASP O 236 GLY O 245 1 ? 10 
HELX_P HELX_P251 BB8 PHE O 272 ? CYS O 276 ? PHE O 252 CYS O 256 1 ? 5  
HELX_P HELX_P252 BB9 THR O 292 ? ASP O 302 ? THR O 272 ASP O 282 1 ? 11 
HELX_P HELX_P253 BC1 LEU O 303 ? ASP O 305 ? LEU O 283 ASP O 285 5 ? 3  
HELX_P HELX_P254 BC2 ASP O 412 ? PHE O 420 ? ASP O 392 PHE O 400 1 ? 9  
HELX_P HELX_P255 BC3 THR O 431 ? LEU O 438 ? THR O 411 LEU O 418 1 ? 8  
HELX_P HELX_P256 BC4 PRO P 28  ? ARG P 31  ? PRO P 8   ARG P 11  5 ? 4  
HELX_P HELX_P257 BC5 GLY P 43  ? ASP P 51  ? GLY P 23  ASP P 31  5 ? 9  
HELX_P HELX_P258 BC6 ALA P 54  ? VAL P 58  ? ALA P 34  VAL P 38  5 ? 5  
HELX_P HELX_P259 BC7 ILE P 67  ? GLY P 78  ? ILE P 47  GLY P 58  1 ? 12 
HELX_P HELX_P260 BC8 ALA P 90  ? TRP P 101 ? ALA P 70  TRP P 81  1 ? 12 
HELX_P HELX_P261 BC9 ARG P 105 ? ASN P 109 ? ARG P 85  ASN P 89  5 ? 5  
HELX_P HELX_P262 BD1 GLY P 129 ? GLN P 136 ? GLY P 109 GLN P 116 1 ? 8  
HELX_P HELX_P263 BD2 ASN P 137 ? GLU P 142 ? ASN P 117 GLU P 122 1 ? 6  
HELX_P HELX_P264 BD3 PRO P 143 ? ALA P 145 ? PRO P 123 ALA P 125 5 ? 3  
HELX_P HELX_P265 BD4 ASP P 161 ? GLY P 173 ? ASP P 141 GLY P 153 1 ? 13 
HELX_P HELX_P266 BD5 MET P 186 ? GLY P 190 ? MET P 166 GLY P 170 5 ? 5  
HELX_P HELX_P267 BD6 THR P 233 ? ASP P 246 ? THR P 213 ASP P 226 1 ? 14 
HELX_P HELX_P268 BD7 ASP P 256 ? GLY P 265 ? ASP P 236 GLY P 245 1 ? 10 
HELX_P HELX_P269 BD8 PHE P 272 ? CYS P 276 ? PHE P 252 CYS P 256 1 ? 5  
HELX_P HELX_P270 BD9 THR P 292 ? ASP P 302 ? THR P 272 ASP P 282 1 ? 11 
HELX_P HELX_P271 BE1 LEU P 303 ? ASP P 305 ? LEU P 283 ASP P 285 5 ? 3  
HELX_P HELX_P272 BE2 ASP P 412 ? PHE P 420 ? ASP P 392 PHE P 400 1 ? 9  
HELX_P HELX_P273 BE3 THR P 431 ? LYS P 437 ? THR P 411 LYS P 417 1 ? 7  
HELX_P HELX_P274 BE4 PRO Q 28  ? ARG Q 31  ? PRO Q 8   ARG Q 11  5 ? 4  
HELX_P HELX_P275 BE5 GLY Q 43  ? ASP Q 51  ? GLY Q 23  ASP Q 31  5 ? 9  
HELX_P HELX_P276 BE6 ALA Q 54  ? ALA Q 57  ? ALA Q 34  ALA Q 37  5 ? 4  
HELX_P HELX_P277 BE7 ILE Q 67  ? SER Q 77  ? ILE Q 47  SER Q 57  1 ? 11 
HELX_P HELX_P278 BE8 ALA Q 90  ? TRP Q 101 ? ALA Q 70  TRP Q 81  1 ? 12 
HELX_P HELX_P279 BE9 ARG Q 105 ? ASN Q 109 ? ARG Q 85  ASN Q 89  5 ? 5  
HELX_P HELX_P280 BF1 GLY Q 129 ? GLN Q 136 ? GLY Q 109 GLN Q 116 1 ? 8  
HELX_P HELX_P281 BF2 ASN Q 137 ? ALA Q 145 ? ASN Q 117 ALA Q 125 1 ? 9  
HELX_P HELX_P282 BF3 TYR Q 162 ? GLY Q 173 ? TYR Q 142 GLY Q 153 1 ? 12 
HELX_P HELX_P283 BF4 MET Q 186 ? GLY Q 190 ? MET Q 166 GLY Q 170 5 ? 5  
HELX_P HELX_P284 BF5 THR Q 233 ? ASP Q 246 ? THR Q 213 ASP Q 226 1 ? 14 
HELX_P HELX_P285 BF6 ASP Q 256 ? GLY Q 265 ? ASP Q 236 GLY Q 245 1 ? 10 
HELX_P HELX_P286 BF7 PHE Q 272 ? CYS Q 276 ? PHE Q 252 CYS Q 256 1 ? 5  
HELX_P HELX_P287 BF8 THR Q 292 ? ASP Q 302 ? THR Q 272 ASP Q 282 1 ? 11 
HELX_P HELX_P288 BF9 LEU Q 303 ? ASP Q 305 ? LEU Q 283 ASP Q 285 5 ? 3  
HELX_P HELX_P289 BG1 ASP Q 412 ? PHE Q 420 ? ASP Q 392 PHE Q 400 1 ? 9  
HELX_P HELX_P290 BG2 THR Q 431 ? LYS Q 437 ? THR Q 411 LYS Q 417 1 ? 7  
HELX_P HELX_P291 BG3 PRO R 28  ? ARG R 31  ? PRO R 8   ARG R 11  5 ? 4  
HELX_P HELX_P292 BG4 GLY R 43  ? ASP R 51  ? GLY R 23  ASP R 31  5 ? 9  
HELX_P HELX_P293 BG5 ALA R 54  ? VAL R 58  ? ALA R 34  VAL R 38  5 ? 5  
HELX_P HELX_P294 BG6 ILE R 67  ? GLY R 78  ? ILE R 47  GLY R 58  1 ? 12 
HELX_P HELX_P295 BG7 ALA R 90  ? TRP R 101 ? ALA R 70  TRP R 81  1 ? 12 
HELX_P HELX_P296 BG8 ARG R 105 ? ASN R 109 ? ARG R 85  ASN R 89  5 ? 5  
HELX_P HELX_P297 BG9 GLY R 129 ? GLN R 136 ? GLY R 109 GLN R 116 1 ? 8  
HELX_P HELX_P298 BH1 ASN R 137 ? ALA R 145 ? ASN R 117 ALA R 125 1 ? 9  
HELX_P HELX_P299 BH2 TYR R 162 ? GLY R 173 ? TYR R 142 GLY R 153 1 ? 12 
HELX_P HELX_P300 BH3 ARG R 185 ? THR R 189 ? ARG R 165 THR R 169 1 ? 5  
HELX_P HELX_P301 BH4 THR R 233 ? ASP R 246 ? THR R 213 ASP R 226 1 ? 14 
HELX_P HELX_P302 BH5 ASP R 256 ? GLY R 265 ? ASP R 236 GLY R 245 1 ? 10 
HELX_P HELX_P303 BH6 PHE R 272 ? CYS R 276 ? PHE R 252 CYS R 256 1 ? 5  
HELX_P HELX_P304 BH7 THR R 292 ? ASP R 302 ? THR R 272 ASP R 282 1 ? 11 
HELX_P HELX_P305 BH8 LEU R 303 ? ASP R 305 ? LEU R 283 ASP R 285 5 ? 3  
HELX_P HELX_P306 BH9 ASP R 412 ? PHE R 420 ? ASP R 392 PHE R 400 1 ? 9  
HELX_P HELX_P307 BI1 THR R 431 ? LYS R 437 ? THR R 411 LYS R 417 1 ? 7  
HELX_P HELX_P308 BI2 PRO S 28  ? ARG S 31  ? PRO W 8   ARG W 11  5 ? 4  
HELX_P HELX_P309 BI3 GLY S 43  ? ASP S 51  ? GLY W 23  ASP W 31  5 ? 9  
HELX_P HELX_P310 BI4 ALA S 54  ? ALA S 57  ? ALA W 34  ALA W 37  5 ? 4  
HELX_P HELX_P311 BI5 ILE S 67  ? GLY S 78  ? ILE W 47  GLY W 58  1 ? 12 
HELX_P HELX_P312 BI6 ALA S 90  ? TRP S 101 ? ALA W 70  TRP W 81  1 ? 12 
HELX_P HELX_P313 BI7 ARG S 105 ? ASN S 109 ? ARG W 85  ASN W 89  5 ? 5  
HELX_P HELX_P314 BI8 ALA S 131 ? GLN S 136 ? ALA W 111 GLN W 116 1 ? 6  
HELX_P HELX_P315 BI9 ASN S 137 ? ALA S 145 ? ASN W 117 ALA W 125 1 ? 9  
HELX_P HELX_P316 BJ1 ASP S 161 ? GLY S 173 ? ASP W 141 GLY W 153 1 ? 13 
HELX_P HELX_P317 BJ2 MET S 186 ? GLY S 190 ? MET W 166 GLY W 170 5 ? 5  
HELX_P HELX_P318 BJ3 THR S 233 ? ASP S 246 ? THR W 213 ASP W 226 1 ? 14 
HELX_P HELX_P319 BJ4 ASP S 256 ? GLY S 265 ? ASP W 236 GLY W 245 1 ? 10 
HELX_P HELX_P320 BJ5 PHE S 272 ? CYS S 276 ? PHE W 252 CYS W 256 1 ? 5  
HELX_P HELX_P321 BJ6 THR S 292 ? ASP S 302 ? THR W 272 ASP W 282 1 ? 11 
HELX_P HELX_P322 BJ7 LEU S 303 ? ASP S 305 ? LEU W 283 ASP W 285 5 ? 3  
HELX_P HELX_P323 BJ8 ASP S 412 ? PHE S 420 ? ASP W 392 PHE W 400 1 ? 9  
HELX_P HELX_P324 BJ9 THR S 431 ? LYS S 437 ? THR W 411 LYS W 417 1 ? 7  
HELX_P HELX_P325 BK1 PRO T 28  ? ARG T 31  ? PRO T 8   ARG T 11  5 ? 4  
HELX_P HELX_P326 BK2 GLY T 43  ? ASP T 51  ? GLY T 23  ASP T 31  5 ? 9  
HELX_P HELX_P327 BK3 ALA T 54  ? ALA T 57  ? ALA T 34  ALA T 37  5 ? 4  
HELX_P HELX_P328 BK4 ILE T 67  ? SER T 77  ? ILE T 47  SER T 57  1 ? 11 
HELX_P HELX_P329 BK5 LYS T 89  ? TRP T 101 ? LYS T 69  TRP T 81  1 ? 13 
HELX_P HELX_P330 BK6 ARG T 105 ? ASN T 109 ? ARG T 85  ASN T 89  5 ? 5  
HELX_P HELX_P331 BK7 GLY T 129 ? GLN T 136 ? GLY T 109 GLN T 116 1 ? 8  
HELX_P HELX_P332 BK8 ASN T 137 ? ALA T 145 ? ASN T 117 ALA T 125 1 ? 9  
HELX_P HELX_P333 BK9 ASP T 161 ? GLY T 173 ? ASP T 141 GLY T 153 1 ? 13 
HELX_P HELX_P334 BL1 MET T 186 ? GLY T 190 ? MET T 166 GLY T 170 5 ? 5  
HELX_P HELX_P335 BL2 THR T 233 ? ASP T 246 ? THR T 213 ASP T 226 1 ? 14 
HELX_P HELX_P336 BL3 ASP T 256 ? GLY T 265 ? ASP T 236 GLY T 245 1 ? 10 
HELX_P HELX_P337 BL4 PHE T 272 ? CYS T 276 ? PHE T 252 CYS T 256 1 ? 5  
HELX_P HELX_P338 BL5 THR T 292 ? ASP T 302 ? THR T 272 ASP T 282 1 ? 11 
HELX_P HELX_P339 BL6 LEU T 303 ? ASP T 305 ? LEU T 283 ASP T 285 5 ? 3  
HELX_P HELX_P340 BL7 ASP T 412 ? PHE T 420 ? ASP T 392 PHE T 400 1 ? 9  
HELX_P HELX_P341 BL8 THR T 431 ? LYS T 437 ? THR T 411 LYS T 417 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7  ? 
AA2 ? 7  ? 
AA3 ? 2  ? 
AA4 ? 2  ? 
AA5 ? 10 ? 
AA6 ? 6  ? 
AA7 ? 6  ? 
AA8 ? 10 ? 
AA9 ? 7  ? 
AB1 ? 7  ? 
AB2 ? 2  ? 
AB3 ? 7  ? 
AB4 ? 7  ? 
AB5 ? 2  ? 
AB6 ? 2  ? 
AB7 ? 10 ? 
AB8 ? 6  ? 
AB9 ? 6  ? 
AC1 ? 10 ? 
AC2 ? 7  ? 
AC3 ? 7  ? 
AC4 ? 2  ? 
AC5 ? 7  ? 
AC6 ? 7  ? 
AC7 ? 2  ? 
AC8 ? 10 ? 
AC9 ? 6  ? 
AD1 ? 6  ? 
AD2 ? 10 ? 
AD3 ? 7  ? 
AD4 ? 7  ? 
AD5 ? 2  ? 
AD6 ? 2  ? 
AD7 ? 7  ? 
AD8 ? 7  ? 
AD9 ? 2  ? 
AE1 ? 10 ? 
AE2 ? 6  ? 
AE3 ? 6  ? 
AE4 ? 10 ? 
AE5 ? 7  ? 
AE6 ? 7  ? 
AE7 ? 2  ? 
AE8 ? 2  ? 
AE9 ? 7  ? 
AF1 ? 7  ? 
AF2 ? 2  ? 
AF3 ? 10 ? 
AF4 ? 6  ? 
AF5 ? 6  ? 
AF6 ? 10 ? 
AF7 ? 7  ? 
AF8 ? 7  ? 
AF9 ? 2  ? 
AG1 ? 7  ? 
AG2 ? 2  ? 
AG3 ? 2  ? 
AG4 ? 2  ? 
AG5 ? 10 ? 
AG6 ? 6  ? 
AG7 ? 6  ? 
AG8 ? 10 ? 
AG9 ? 7  ? 
AH1 ? 7  ? 
AH2 ? 2  ? 
AH3 ? 2  ? 
AH4 ? 7  ? 
AH5 ? 7  ? 
AH6 ? 2  ? 
AH7 ? 2  ? 
AH8 ? 10 ? 
AH9 ? 6  ? 
AI1 ? 6  ? 
AI2 ? 10 ? 
AI3 ? 7  ? 
AI4 ? 7  ? 
AI5 ? 2  ? 
AI6 ? 7  ? 
AI7 ? 7  ? 
AI8 ? 2  ? 
AI9 ? 2  ? 
AJ1 ? 10 ? 
AJ2 ? 6  ? 
AJ3 ? 6  ? 
AJ4 ? 10 ? 
AJ5 ? 7  ? 
AJ6 ? 7  ? 
AJ7 ? 2  ? 
AJ8 ? 7  ? 
AJ9 ? 7  ? 
AK1 ? 2  ? 
AK2 ? 2  ? 
AK3 ? 10 ? 
AK4 ? 6  ? 
AK5 ? 6  ? 
AK6 ? 10 ? 
AK7 ? 7  ? 
AK8 ? 7  ? 
AK9 ? 2  ? 
AL1 ? 7  ? 
AL2 ? 7  ? 
AL3 ? 2  ? 
AL4 ? 2  ? 
AL5 ? 10 ? 
AL6 ? 6  ? 
AL7 ? 6  ? 
AL8 ? 10 ? 
AL9 ? 7  ? 
AM1 ? 2  ? 
AM2 ? 2  ? 
AM3 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? parallel      
AA1 2 3  ? parallel      
AA1 3 4  ? parallel      
AA1 4 5  ? anti-parallel 
AA1 5 6  ? anti-parallel 
AA1 6 7  ? anti-parallel 
AA2 1 2  ? parallel      
AA2 2 3  ? parallel      
AA2 3 4  ? parallel      
AA2 4 5  ? anti-parallel 
AA2 5 6  ? anti-parallel 
AA2 6 7  ? parallel      
AA3 1 2  ? anti-parallel 
AA4 1 2  ? anti-parallel 
AA5 1 2  ? parallel      
AA5 2 3  ? parallel      
AA5 3 4  ? parallel      
AA5 4 5  ? parallel      
AA5 5 6  ? anti-parallel 
AA5 6 7  ? parallel      
AA5 7 8  ? parallel      
AA5 8 9  ? parallel      
AA5 9 10 ? parallel      
AA6 1 2  ? parallel      
AA6 2 3  ? parallel      
AA6 3 4  ? parallel      
AA6 4 5  ? parallel      
AA6 5 6  ? anti-parallel 
AA7 1 2  ? parallel      
AA7 2 3  ? parallel      
AA7 3 4  ? parallel      
AA7 4 5  ? parallel      
AA7 5 6  ? anti-parallel 
AA8 1 2  ? parallel      
AA8 2 3  ? parallel      
AA8 3 4  ? parallel      
AA8 4 5  ? parallel      
AA8 5 6  ? anti-parallel 
AA8 6 7  ? parallel      
AA8 7 8  ? parallel      
AA8 8 9  ? parallel      
AA8 9 10 ? parallel      
AA9 1 2  ? parallel      
AA9 2 3  ? parallel      
AA9 3 4  ? parallel      
AA9 4 5  ? anti-parallel 
AA9 5 6  ? anti-parallel 
AA9 6 7  ? anti-parallel 
AB1 1 2  ? parallel      
AB1 2 3  ? parallel      
AB1 3 4  ? parallel      
AB1 4 5  ? anti-parallel 
AB1 5 6  ? anti-parallel 
AB1 6 7  ? parallel      
AB2 1 2  ? anti-parallel 
AB3 1 2  ? parallel      
AB3 2 3  ? parallel      
AB3 3 4  ? parallel      
AB3 4 5  ? anti-parallel 
AB3 5 6  ? anti-parallel 
AB3 6 7  ? anti-parallel 
AB4 1 2  ? parallel      
AB4 2 3  ? parallel      
AB4 3 4  ? parallel      
AB4 4 5  ? anti-parallel 
AB4 5 6  ? anti-parallel 
AB4 6 7  ? parallel      
AB5 1 2  ? anti-parallel 
AB6 1 2  ? anti-parallel 
AB7 1 2  ? parallel      
AB7 2 3  ? parallel      
AB7 3 4  ? parallel      
AB7 4 5  ? parallel      
AB7 5 6  ? anti-parallel 
AB7 6 7  ? parallel      
AB7 7 8  ? parallel      
AB7 8 9  ? parallel      
AB7 9 10 ? parallel      
AB8 1 2  ? parallel      
AB8 2 3  ? parallel      
AB8 3 4  ? parallel      
AB8 4 5  ? parallel      
AB8 5 6  ? anti-parallel 
AB9 1 2  ? parallel      
AB9 2 3  ? parallel      
AB9 3 4  ? parallel      
AB9 4 5  ? parallel      
AB9 5 6  ? anti-parallel 
AC1 1 2  ? parallel      
AC1 2 3  ? parallel      
AC1 3 4  ? parallel      
AC1 4 5  ? parallel      
AC1 5 6  ? anti-parallel 
AC1 6 7  ? parallel      
AC1 7 8  ? parallel      
AC1 8 9  ? parallel      
AC1 9 10 ? parallel      
AC2 1 2  ? parallel      
AC2 2 3  ? parallel      
AC2 3 4  ? parallel      
AC2 4 5  ? anti-parallel 
AC2 5 6  ? anti-parallel 
AC2 6 7  ? anti-parallel 
AC3 1 2  ? parallel      
AC3 2 3  ? parallel      
AC3 3 4  ? parallel      
AC3 4 5  ? anti-parallel 
AC3 5 6  ? anti-parallel 
AC3 6 7  ? parallel      
AC4 1 2  ? anti-parallel 
AC5 1 2  ? parallel      
AC5 2 3  ? parallel      
AC5 3 4  ? parallel      
AC5 4 5  ? anti-parallel 
AC5 5 6  ? anti-parallel 
AC5 6 7  ? anti-parallel 
AC6 1 2  ? parallel      
AC6 2 3  ? parallel      
AC6 3 4  ? parallel      
AC6 4 5  ? anti-parallel 
AC6 5 6  ? anti-parallel 
AC6 6 7  ? parallel      
AC7 1 2  ? anti-parallel 
AC8 1 2  ? parallel      
AC8 2 3  ? parallel      
AC8 3 4  ? parallel      
AC8 4 5  ? parallel      
AC8 5 6  ? anti-parallel 
AC8 6 7  ? parallel      
AC8 7 8  ? parallel      
AC8 8 9  ? parallel      
AC8 9 10 ? parallel      
AC9 1 2  ? parallel      
AC9 2 3  ? parallel      
AC9 3 4  ? parallel      
AC9 4 5  ? parallel      
AC9 5 6  ? anti-parallel 
AD1 1 2  ? parallel      
AD1 2 3  ? parallel      
AD1 3 4  ? parallel      
AD1 4 5  ? parallel      
AD1 5 6  ? anti-parallel 
AD2 1 2  ? parallel      
AD2 2 3  ? parallel      
AD2 3 4  ? parallel      
AD2 4 5  ? parallel      
AD2 5 6  ? anti-parallel 
AD2 6 7  ? parallel      
AD2 7 8  ? parallel      
AD2 8 9  ? parallel      
AD2 9 10 ? parallel      
AD3 1 2  ? parallel      
AD3 2 3  ? parallel      
AD3 3 4  ? parallel      
AD3 4 5  ? anti-parallel 
AD3 5 6  ? anti-parallel 
AD3 6 7  ? anti-parallel 
AD4 1 2  ? parallel      
AD4 2 3  ? parallel      
AD4 3 4  ? parallel      
AD4 4 5  ? anti-parallel 
AD4 5 6  ? anti-parallel 
AD4 6 7  ? parallel      
AD5 1 2  ? anti-parallel 
AD6 1 2  ? anti-parallel 
AD7 1 2  ? parallel      
AD7 2 3  ? parallel      
AD7 3 4  ? parallel      
AD7 4 5  ? anti-parallel 
AD7 5 6  ? anti-parallel 
AD7 6 7  ? anti-parallel 
AD8 1 2  ? parallel      
AD8 2 3  ? parallel      
AD8 3 4  ? parallel      
AD8 4 5  ? anti-parallel 
AD8 5 6  ? anti-parallel 
AD8 6 7  ? parallel      
AD9 1 2  ? anti-parallel 
AE1 1 2  ? parallel      
AE1 2 3  ? parallel      
AE1 3 4  ? parallel      
AE1 4 5  ? parallel      
AE1 5 6  ? anti-parallel 
AE1 6 7  ? parallel      
AE1 7 8  ? parallel      
AE1 8 9  ? parallel      
AE1 9 10 ? parallel      
AE2 1 2  ? parallel      
AE2 2 3  ? parallel      
AE2 3 4  ? parallel      
AE2 4 5  ? parallel      
AE2 5 6  ? anti-parallel 
AE3 1 2  ? parallel      
AE3 2 3  ? parallel      
AE3 3 4  ? parallel      
AE3 4 5  ? parallel      
AE3 5 6  ? anti-parallel 
AE4 1 2  ? parallel      
AE4 2 3  ? parallel      
AE4 3 4  ? parallel      
AE4 4 5  ? parallel      
AE4 5 6  ? anti-parallel 
AE4 6 7  ? parallel      
AE4 7 8  ? parallel      
AE4 8 9  ? parallel      
AE4 9 10 ? parallel      
AE5 1 2  ? parallel      
AE5 2 3  ? parallel      
AE5 3 4  ? parallel      
AE5 4 5  ? anti-parallel 
AE5 5 6  ? anti-parallel 
AE5 6 7  ? anti-parallel 
AE6 1 2  ? parallel      
AE6 2 3  ? parallel      
AE6 3 4  ? parallel      
AE6 4 5  ? anti-parallel 
AE6 5 6  ? anti-parallel 
AE6 6 7  ? parallel      
AE7 1 2  ? anti-parallel 
AE8 1 2  ? anti-parallel 
AE9 1 2  ? parallel      
AE9 2 3  ? parallel      
AE9 3 4  ? parallel      
AE9 4 5  ? anti-parallel 
AE9 5 6  ? anti-parallel 
AE9 6 7  ? anti-parallel 
AF1 1 2  ? parallel      
AF1 2 3  ? parallel      
AF1 3 4  ? parallel      
AF1 4 5  ? anti-parallel 
AF1 5 6  ? anti-parallel 
AF1 6 7  ? parallel      
AF2 1 2  ? anti-parallel 
AF3 1 2  ? parallel      
AF3 2 3  ? parallel      
AF3 3 4  ? parallel      
AF3 4 5  ? parallel      
AF3 5 6  ? anti-parallel 
AF3 6 7  ? parallel      
AF3 7 8  ? parallel      
AF3 8 9  ? parallel      
AF3 9 10 ? parallel      
AF4 1 2  ? parallel      
AF4 2 3  ? parallel      
AF4 3 4  ? parallel      
AF4 4 5  ? parallel      
AF4 5 6  ? anti-parallel 
AF5 1 2  ? parallel      
AF5 2 3  ? parallel      
AF5 3 4  ? parallel      
AF5 4 5  ? parallel      
AF5 5 6  ? anti-parallel 
AF6 1 2  ? parallel      
AF6 2 3  ? parallel      
AF6 3 4  ? parallel      
AF6 4 5  ? parallel      
AF6 5 6  ? anti-parallel 
AF6 6 7  ? parallel      
AF6 7 8  ? parallel      
AF6 8 9  ? parallel      
AF6 9 10 ? parallel      
AF7 1 2  ? parallel      
AF7 2 3  ? parallel      
AF7 3 4  ? parallel      
AF7 4 5  ? anti-parallel 
AF7 5 6  ? anti-parallel 
AF7 6 7  ? anti-parallel 
AF8 1 2  ? parallel      
AF8 2 3  ? parallel      
AF8 3 4  ? parallel      
AF8 4 5  ? anti-parallel 
AF8 5 6  ? anti-parallel 
AF8 6 7  ? parallel      
AF9 1 2  ? anti-parallel 
AG1 1 2  ? parallel      
AG1 2 3  ? parallel      
AG1 3 4  ? parallel      
AG1 4 5  ? anti-parallel 
AG1 5 6  ? anti-parallel 
AG1 6 7  ? parallel      
AG2 1 2  ? anti-parallel 
AG3 1 2  ? anti-parallel 
AG4 1 2  ? anti-parallel 
AG5 1 2  ? parallel      
AG5 2 3  ? parallel      
AG5 3 4  ? parallel      
AG5 4 5  ? parallel      
AG5 5 6  ? anti-parallel 
AG5 6 7  ? parallel      
AG5 7 8  ? parallel      
AG5 8 9  ? parallel      
AG5 9 10 ? parallel      
AG6 1 2  ? parallel      
AG6 2 3  ? parallel      
AG6 3 4  ? parallel      
AG6 4 5  ? parallel      
AG6 5 6  ? anti-parallel 
AG7 1 2  ? parallel      
AG7 2 3  ? parallel      
AG7 3 4  ? parallel      
AG7 4 5  ? parallel      
AG7 5 6  ? anti-parallel 
AG8 1 2  ? parallel      
AG8 2 3  ? parallel      
AG8 3 4  ? parallel      
AG8 4 5  ? parallel      
AG8 5 6  ? anti-parallel 
AG8 6 7  ? parallel      
AG8 7 8  ? parallel      
AG8 8 9  ? parallel      
AG8 9 10 ? parallel      
AG9 1 2  ? parallel      
AG9 2 3  ? parallel      
AG9 3 4  ? parallel      
AG9 4 5  ? anti-parallel 
AG9 5 6  ? anti-parallel 
AG9 6 7  ? anti-parallel 
AH1 1 2  ? parallel      
AH1 2 3  ? parallel      
AH1 3 4  ? parallel      
AH1 4 5  ? anti-parallel 
AH1 5 6  ? anti-parallel 
AH1 6 7  ? parallel      
AH2 1 2  ? anti-parallel 
AH3 1 2  ? anti-parallel 
AH4 1 2  ? parallel      
AH4 2 3  ? parallel      
AH4 3 4  ? parallel      
AH4 4 5  ? anti-parallel 
AH4 5 6  ? anti-parallel 
AH4 6 7  ? anti-parallel 
AH5 1 2  ? parallel      
AH5 2 3  ? parallel      
AH5 3 4  ? parallel      
AH5 4 5  ? anti-parallel 
AH5 5 6  ? anti-parallel 
AH5 6 7  ? parallel      
AH6 1 2  ? anti-parallel 
AH7 1 2  ? anti-parallel 
AH8 1 2  ? parallel      
AH8 2 3  ? parallel      
AH8 3 4  ? parallel      
AH8 4 5  ? parallel      
AH8 5 6  ? anti-parallel 
AH8 6 7  ? parallel      
AH8 7 8  ? parallel      
AH8 8 9  ? parallel      
AH8 9 10 ? parallel      
AH9 1 2  ? parallel      
AH9 2 3  ? parallel      
AH9 3 4  ? parallel      
AH9 4 5  ? parallel      
AH9 5 6  ? anti-parallel 
AI1 1 2  ? parallel      
AI1 2 3  ? parallel      
AI1 3 4  ? parallel      
AI1 4 5  ? parallel      
AI1 5 6  ? anti-parallel 
AI2 1 2  ? parallel      
AI2 2 3  ? parallel      
AI2 3 4  ? parallel      
AI2 4 5  ? parallel      
AI2 5 6  ? anti-parallel 
AI2 6 7  ? parallel      
AI2 7 8  ? parallel      
AI2 8 9  ? parallel      
AI2 9 10 ? parallel      
AI3 1 2  ? parallel      
AI3 2 3  ? parallel      
AI3 3 4  ? parallel      
AI3 4 5  ? anti-parallel 
AI3 5 6  ? anti-parallel 
AI3 6 7  ? anti-parallel 
AI4 1 2  ? parallel      
AI4 2 3  ? parallel      
AI4 3 4  ? parallel      
AI4 4 5  ? anti-parallel 
AI4 5 6  ? anti-parallel 
AI4 6 7  ? parallel      
AI5 1 2  ? anti-parallel 
AI6 1 2  ? parallel      
AI6 2 3  ? parallel      
AI6 3 4  ? parallel      
AI6 4 5  ? anti-parallel 
AI6 5 6  ? anti-parallel 
AI6 6 7  ? anti-parallel 
AI7 1 2  ? parallel      
AI7 2 3  ? parallel      
AI7 3 4  ? parallel      
AI7 4 5  ? anti-parallel 
AI7 5 6  ? anti-parallel 
AI7 6 7  ? parallel      
AI8 1 2  ? anti-parallel 
AI9 1 2  ? anti-parallel 
AJ1 1 2  ? parallel      
AJ1 2 3  ? parallel      
AJ1 3 4  ? parallel      
AJ1 4 5  ? parallel      
AJ1 5 6  ? anti-parallel 
AJ1 6 7  ? parallel      
AJ1 7 8  ? parallel      
AJ1 8 9  ? parallel      
AJ1 9 10 ? parallel      
AJ2 1 2  ? parallel      
AJ2 2 3  ? parallel      
AJ2 3 4  ? parallel      
AJ2 4 5  ? parallel      
AJ2 5 6  ? anti-parallel 
AJ3 1 2  ? parallel      
AJ3 2 3  ? parallel      
AJ3 3 4  ? parallel      
AJ3 4 5  ? parallel      
AJ3 5 6  ? anti-parallel 
AJ4 1 2  ? parallel      
AJ4 2 3  ? parallel      
AJ4 3 4  ? parallel      
AJ4 4 5  ? parallel      
AJ4 5 6  ? anti-parallel 
AJ4 6 7  ? parallel      
AJ4 7 8  ? parallel      
AJ4 8 9  ? parallel      
AJ4 9 10 ? parallel      
AJ5 1 2  ? parallel      
AJ5 2 3  ? parallel      
AJ5 3 4  ? parallel      
AJ5 4 5  ? anti-parallel 
AJ5 5 6  ? anti-parallel 
AJ5 6 7  ? anti-parallel 
AJ6 1 2  ? parallel      
AJ6 2 3  ? parallel      
AJ6 3 4  ? parallel      
AJ6 4 5  ? anti-parallel 
AJ6 5 6  ? anti-parallel 
AJ6 6 7  ? parallel      
AJ7 1 2  ? anti-parallel 
AJ8 1 2  ? parallel      
AJ8 2 3  ? parallel      
AJ8 3 4  ? parallel      
AJ8 4 5  ? anti-parallel 
AJ8 5 6  ? anti-parallel 
AJ8 6 7  ? anti-parallel 
AJ9 1 2  ? parallel      
AJ9 2 3  ? parallel      
AJ9 3 4  ? parallel      
AJ9 4 5  ? anti-parallel 
AJ9 5 6  ? anti-parallel 
AJ9 6 7  ? parallel      
AK1 1 2  ? anti-parallel 
AK2 1 2  ? anti-parallel 
AK3 1 2  ? parallel      
AK3 2 3  ? parallel      
AK3 3 4  ? parallel      
AK3 4 5  ? parallel      
AK3 5 6  ? anti-parallel 
AK3 6 7  ? parallel      
AK3 7 8  ? parallel      
AK3 8 9  ? parallel      
AK3 9 10 ? parallel      
AK4 1 2  ? parallel      
AK4 2 3  ? parallel      
AK4 3 4  ? parallel      
AK4 4 5  ? parallel      
AK4 5 6  ? anti-parallel 
AK5 1 2  ? parallel      
AK5 2 3  ? parallel      
AK5 3 4  ? parallel      
AK5 4 5  ? parallel      
AK5 5 6  ? anti-parallel 
AK6 1 2  ? parallel      
AK6 2 3  ? parallel      
AK6 3 4  ? parallel      
AK6 4 5  ? parallel      
AK6 5 6  ? anti-parallel 
AK6 6 7  ? parallel      
AK6 7 8  ? parallel      
AK6 8 9  ? parallel      
AK6 9 10 ? parallel      
AK7 1 2  ? parallel      
AK7 2 3  ? parallel      
AK7 3 4  ? parallel      
AK7 4 5  ? anti-parallel 
AK7 5 6  ? anti-parallel 
AK7 6 7  ? anti-parallel 
AK8 1 2  ? parallel      
AK8 2 3  ? parallel      
AK8 3 4  ? parallel      
AK8 4 5  ? anti-parallel 
AK8 5 6  ? anti-parallel 
AK8 6 7  ? parallel      
AK9 1 2  ? anti-parallel 
AL1 1 2  ? parallel      
AL1 2 3  ? parallel      
AL1 3 4  ? parallel      
AL1 4 5  ? anti-parallel 
AL1 5 6  ? anti-parallel 
AL1 6 7  ? anti-parallel 
AL2 1 2  ? parallel      
AL2 2 3  ? parallel      
AL2 3 4  ? parallel      
AL2 4 5  ? anti-parallel 
AL2 5 6  ? anti-parallel 
AL2 6 7  ? parallel      
AL3 1 2  ? anti-parallel 
AL4 1 2  ? anti-parallel 
AL5 1 2  ? parallel      
AL5 2 3  ? parallel      
AL5 3 4  ? parallel      
AL5 4 5  ? parallel      
AL5 5 6  ? anti-parallel 
AL5 6 7  ? parallel      
AL5 7 8  ? parallel      
AL5 8 9  ? parallel      
AL5 9 10 ? parallel      
AL6 1 2  ? parallel      
AL6 2 3  ? parallel      
AL6 3 4  ? parallel      
AL6 4 5  ? parallel      
AL6 5 6  ? anti-parallel 
AL7 1 2  ? parallel      
AL7 2 3  ? parallel      
AL7 3 4  ? parallel      
AL7 4 5  ? parallel      
AL7 5 6  ? anti-parallel 
AL8 1 2  ? parallel      
AL8 2 3  ? parallel      
AL8 3 4  ? parallel      
AL8 4 5  ? parallel      
AL8 5 6  ? anti-parallel 
AL8 6 7  ? parallel      
AL8 7 8  ? parallel      
AL8 8 9  ? parallel      
AL8 9 10 ? parallel      
AL9 1 2  ? parallel      
AL9 2 3  ? parallel      
AL9 3 4  ? parallel      
AL9 4 5  ? anti-parallel 
AL9 5 6  ? anti-parallel 
AL9 6 7  ? parallel      
AM1 1 2  ? anti-parallel 
AM2 1 2  ? anti-parallel 
AM3 1 2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  SER A 111 ? PRO A 116 ? SER A 91  PRO A 96  
AA1 2  ARG A 81  ? THR A 86  ? ARG A 61  THR A 66  
AA1 3  ALA A 33  ? LEU A 38  ? ALA A 13  LEU A 18  
AA1 4  TYR A 148 ? ALA A 153 ? TYR A 128 ALA A 133 
AA1 5  PHE A 221 ? HIS A 232 ? PHE A 201 HIS A 212 
AA1 6  GLY A 192 ? VAL A 196 ? GLY A 172 VAL A 176 
AA1 7  ILE A 202 ? GLU A 207 ? ILE A 182 GLU A 187 
AA2 1  SER A 111 ? PRO A 116 ? SER A 91  PRO A 96  
AA2 2  ARG A 81  ? THR A 86  ? ARG A 61  THR A 66  
AA2 3  ALA A 33  ? LEU A 38  ? ALA A 13  LEU A 18  
AA2 4  TYR A 148 ? ALA A 153 ? TYR A 128 ALA A 133 
AA2 5  PHE A 221 ? HIS A 232 ? PHE A 201 HIS A 212 
AA2 6  VAL A 176 ? PRO A 184 ? VAL A 156 PRO A 164 
AA2 7  ALA A 267 ? ARG A 271 ? ALA A 247 ARG A 251 
AA3 1  TYR A 59  ? PHE A 60  ? TYR A 39  PHE A 40  
AA3 2  ALA A 64  ? ARG A 65  ? ALA A 44  ARG A 45  
AA4 1  ILE A 157 ? TYR A 158 ? ILE A 137 TYR A 138 
AA4 2  TRP A 287 ? ARG A 288 ? TRP A 267 ARG A 268 
AA5 1  VAL A 402 ? ILE A 403 ? VAL A 382 ILE A 383 
AA5 2  LYS A 385 ? ILE A 386 ? LYS A 365 ILE A 366 
AA5 3  ARG A 368 ? ALA A 369 ? ARG A 348 ALA A 349 
AA5 4  ILE A 352 ? SER A 354 ? ILE A 332 SER A 334 
AA5 5  ALA A 329 ? VAL A 332 ? ALA A 309 VAL A 312 
AA5 6  SER B 345 ? VAL B 347 ? SER B 325 VAL B 327 
AA5 7  ALA B 357 ? LEU B 363 ? ALA B 337 LEU B 343 
AA5 8  ARG B 374 ? VAL B 380 ? ARG B 354 VAL B 360 
AA5 9  GLN B 391 ? ILE B 397 ? GLN B 371 ILE B 377 
AA5 10 ILE B 408 ? VAL B 409 ? ILE B 388 VAL B 389 
AA6 1  SER B 341 ? VAL B 343 ? SER B 321 VAL B 323 
AA6 2  ALA B 357 ? LEU B 363 ? ALA B 337 LEU B 343 
AA6 3  ARG B 374 ? VAL B 380 ? ARG B 354 VAL B 360 
AA6 4  GLN B 391 ? ILE B 397 ? GLN B 371 ILE B 377 
AA6 5  CYS B 428 ? ILE B 430 ? CYS B 408 ILE B 410 
AA6 6  ARG B 421 ? ARG B 422 ? ARG B 401 ARG B 402 
AA7 1  SER A 341 ? VAL A 343 ? SER A 321 VAL A 323 
AA7 2  ALA A 357 ? ASN A 359 ? ALA A 337 ASN A 339 
AA7 3  ARG A 374 ? VAL A 380 ? ARG A 354 VAL A 360 
AA7 4  GLN A 391 ? ILE A 397 ? GLN A 371 ILE A 377 
AA7 5  CYS A 428 ? ILE A 430 ? CYS A 408 ILE A 410 
AA7 6  ARG A 421 ? ARG A 422 ? ARG A 401 ARG A 402 
AA8 1  ILE A 408 ? VAL A 409 ? ILE A 388 VAL A 389 
AA8 2  GLN A 391 ? ILE A 397 ? GLN A 371 ILE A 377 
AA8 3  ARG A 374 ? VAL A 380 ? ARG A 354 VAL A 360 
AA8 4  LEU A 362 ? LEU A 363 ? LEU A 342 LEU A 343 
AA8 5  SER A 345 ? VAL A 347 ? SER A 325 VAL A 327 
AA8 6  ALA B 329 ? VAL B 332 ? ALA B 309 VAL B 312 
AA8 7  ILE B 352 ? SER B 354 ? ILE B 332 SER B 334 
AA8 8  ARG B 368 ? ALA B 369 ? ARG B 348 ALA B 349 
AA8 9  LYS B 385 ? ILE B 386 ? LYS B 365 ILE B 366 
AA8 10 VAL B 402 ? ILE B 403 ? VAL B 382 ILE B 383 
AA9 1  SER B 111 ? PRO B 116 ? SER B 91  PRO B 96  
AA9 2  ARG B 81  ? THR B 86  ? ARG B 61  THR B 66  
AA9 3  ALA B 33  ? LEU B 38  ? ALA B 13  LEU B 18  
AA9 4  TYR B 148 ? ALA B 153 ? TYR B 128 ALA B 133 
AA9 5  PHE B 221 ? HIS B 232 ? PHE B 201 HIS B 212 
AA9 6  GLY B 192 ? HIS B 195 ? GLY B 172 HIS B 175 
AA9 7  ASP B 204 ? GLU B 207 ? ASP B 184 GLU B 187 
AB1 1  SER B 111 ? PRO B 116 ? SER B 91  PRO B 96  
AB1 2  ARG B 81  ? THR B 86  ? ARG B 61  THR B 66  
AB1 3  ALA B 33  ? LEU B 38  ? ALA B 13  LEU B 18  
AB1 4  TYR B 148 ? ALA B 153 ? TYR B 128 ALA B 133 
AB1 5  PHE B 221 ? HIS B 232 ? PHE B 201 HIS B 212 
AB1 6  VAL B 176 ? PRO B 184 ? VAL B 156 PRO B 164 
AB1 7  ALA B 267 ? ARG B 271 ? ALA B 247 ARG B 251 
AB2 1  ILE B 157 ? TYR B 158 ? ILE B 137 TYR B 138 
AB2 2  TRP B 287 ? ARG B 288 ? TRP B 267 ARG B 268 
AB3 1  SER C 111 ? PRO C 116 ? SER C 91  PRO C 96  
AB3 2  ARG C 81  ? THR C 86  ? ARG C 61  THR C 66  
AB3 3  ALA C 33  ? LEU C 38  ? ALA C 13  LEU C 18  
AB3 4  TYR C 148 ? ALA C 153 ? TYR C 128 ALA C 133 
AB3 5  PHE C 221 ? HIS C 232 ? PHE C 201 HIS C 212 
AB3 6  GLY C 192 ? VAL C 196 ? GLY C 172 VAL C 176 
AB3 7  ILE C 202 ? GLU C 207 ? ILE C 182 GLU C 187 
AB4 1  SER C 111 ? PRO C 116 ? SER C 91  PRO C 96  
AB4 2  ARG C 81  ? THR C 86  ? ARG C 61  THR C 66  
AB4 3  ALA C 33  ? LEU C 38  ? ALA C 13  LEU C 18  
AB4 4  TYR C 148 ? ALA C 153 ? TYR C 128 ALA C 133 
AB4 5  PHE C 221 ? HIS C 232 ? PHE C 201 HIS C 212 
AB4 6  VAL C 176 ? PRO C 184 ? VAL C 156 PRO C 164 
AB4 7  ALA C 267 ? ARG C 271 ? ALA C 247 ARG C 251 
AB5 1  TYR C 59  ? PHE C 60  ? TYR C 39  PHE C 40  
AB5 2  ALA C 64  ? ARG C 65  ? ALA C 44  ARG C 45  
AB6 1  ILE C 157 ? TYR C 158 ? ILE C 137 TYR C 138 
AB6 2  TRP C 287 ? ARG C 288 ? TRP C 267 ARG C 268 
AB7 1  VAL C 402 ? ILE C 403 ? VAL C 382 ILE C 383 
AB7 2  LYS C 385 ? ILE C 386 ? LYS C 365 ILE C 366 
AB7 3  ARG C 368 ? ALA C 369 ? ARG C 348 ALA C 349 
AB7 4  ILE C 352 ? SER C 354 ? ILE C 332 SER C 334 
AB7 5  ALA C 329 ? VAL C 332 ? ALA C 309 VAL C 312 
AB7 6  SER D 345 ? VAL D 347 ? SER D 325 VAL D 327 
AB7 7  ALA D 357 ? LEU D 363 ? ALA D 337 LEU D 343 
AB7 8  ARG D 374 ? VAL D 380 ? ARG D 354 VAL D 360 
AB7 9  GLN D 391 ? ILE D 397 ? GLN D 371 ILE D 377 
AB7 10 ILE D 408 ? VAL D 409 ? ILE D 388 VAL D 389 
AB8 1  SER D 341 ? VAL D 343 ? SER D 321 VAL D 323 
AB8 2  ALA D 357 ? LEU D 363 ? ALA D 337 LEU D 343 
AB8 3  ARG D 374 ? VAL D 380 ? ARG D 354 VAL D 360 
AB8 4  GLN D 391 ? ILE D 397 ? GLN D 371 ILE D 377 
AB8 5  CYS D 428 ? ILE D 430 ? CYS D 408 ILE D 410 
AB8 6  ARG D 421 ? ARG D 422 ? ARG D 401 ARG D 402 
AB9 1  SER C 341 ? VAL C 343 ? SER C 321 VAL C 323 
AB9 2  ALA C 357 ? ASN C 359 ? ALA C 337 ASN C 339 
AB9 3  ARG C 374 ? VAL C 380 ? ARG C 354 VAL C 360 
AB9 4  GLN C 391 ? ILE C 397 ? GLN C 371 ILE C 377 
AB9 5  CYS C 428 ? ILE C 430 ? CYS C 408 ILE C 410 
AB9 6  ARG C 421 ? ARG C 422 ? ARG C 401 ARG C 402 
AC1 1  ILE C 408 ? VAL C 409 ? ILE C 388 VAL C 389 
AC1 2  GLN C 391 ? ILE C 397 ? GLN C 371 ILE C 377 
AC1 3  ARG C 374 ? VAL C 380 ? ARG C 354 VAL C 360 
AC1 4  LEU C 362 ? LEU C 363 ? LEU C 342 LEU C 343 
AC1 5  SER C 345 ? VAL C 347 ? SER C 325 VAL C 327 
AC1 6  ALA D 329 ? VAL D 332 ? ALA D 309 VAL D 312 
AC1 7  ILE D 352 ? SER D 354 ? ILE D 332 SER D 334 
AC1 8  ARG D 368 ? ALA D 369 ? ARG D 348 ALA D 349 
AC1 9  LYS D 385 ? ILE D 386 ? LYS D 365 ILE D 366 
AC1 10 VAL D 402 ? ILE D 403 ? VAL D 382 ILE D 383 
AC2 1  SER D 111 ? LEU D 115 ? SER D 91  LEU D 95  
AC2 2  ARG D 81  ? ALA D 85  ? ARG D 61  ALA D 65  
AC2 3  ALA D 33  ? LEU D 38  ? ALA D 13  LEU D 18  
AC2 4  TYR D 148 ? ALA D 153 ? TYR D 128 ALA D 133 
AC2 5  PHE D 221 ? HIS D 232 ? PHE D 201 HIS D 212 
AC2 6  GLY D 192 ? VAL D 196 ? GLY D 172 VAL D 176 
AC2 7  ILE D 202 ? GLU D 207 ? ILE D 182 GLU D 187 
AC3 1  SER D 111 ? LEU D 115 ? SER D 91  LEU D 95  
AC3 2  ARG D 81  ? ALA D 85  ? ARG D 61  ALA D 65  
AC3 3  ALA D 33  ? LEU D 38  ? ALA D 13  LEU D 18  
AC3 4  TYR D 148 ? ALA D 153 ? TYR D 128 ALA D 133 
AC3 5  PHE D 221 ? HIS D 232 ? PHE D 201 HIS D 212 
AC3 6  VAL D 176 ? PRO D 184 ? VAL D 156 PRO D 164 
AC3 7  ALA D 267 ? ARG D 271 ? ALA D 247 ARG D 251 
AC4 1  ILE D 157 ? TYR D 158 ? ILE D 137 TYR D 138 
AC4 2  TRP D 287 ? ARG D 288 ? TRP D 267 ARG D 268 
AC5 1  SER E 111 ? PRO E 116 ? SER E 91  PRO E 96  
AC5 2  ARG E 81  ? THR E 86  ? ARG E 61  THR E 66  
AC5 3  ALA E 33  ? LEU E 38  ? ALA E 13  LEU E 18  
AC5 4  TYR E 148 ? ALA E 153 ? TYR E 128 ALA E 133 
AC5 5  PHE E 221 ? HIS E 232 ? PHE E 201 HIS E 212 
AC5 6  GLY E 192 ? VAL E 196 ? GLY E 172 VAL E 176 
AC5 7  ILE E 202 ? GLU E 207 ? ILE E 182 GLU E 187 
AC6 1  SER E 111 ? PRO E 116 ? SER E 91  PRO E 96  
AC6 2  ARG E 81  ? THR E 86  ? ARG E 61  THR E 66  
AC6 3  ALA E 33  ? LEU E 38  ? ALA E 13  LEU E 18  
AC6 4  TYR E 148 ? ALA E 153 ? TYR E 128 ALA E 133 
AC6 5  PHE E 221 ? HIS E 232 ? PHE E 201 HIS E 212 
AC6 6  VAL E 176 ? PRO E 184 ? VAL E 156 PRO E 164 
AC6 7  ALA E 267 ? ARG E 271 ? ALA E 247 ARG E 251 
AC7 1  ILE E 157 ? TYR E 158 ? ILE E 137 TYR E 138 
AC7 2  TRP E 287 ? ARG E 288 ? TRP E 267 ARG E 268 
AC8 1  VAL E 402 ? ILE E 403 ? VAL E 382 ILE E 383 
AC8 2  LYS E 385 ? ILE E 386 ? LYS E 365 ILE E 366 
AC8 3  ARG E 368 ? ALA E 369 ? ARG E 348 ALA E 349 
AC8 4  ILE E 352 ? SER E 354 ? ILE E 332 SER E 334 
AC8 5  ALA E 329 ? VAL E 332 ? ALA E 309 VAL E 312 
AC8 6  SER F 345 ? VAL F 347 ? SER F 325 VAL F 327 
AC8 7  LEU F 362 ? LEU F 363 ? LEU F 342 LEU F 343 
AC8 8  ARG F 374 ? VAL F 380 ? ARG F 354 VAL F 360 
AC8 9  GLN F 391 ? ILE F 397 ? GLN F 371 ILE F 377 
AC8 10 ILE F 408 ? VAL F 409 ? ILE F 388 VAL F 389 
AC9 1  SER F 341 ? VAL F 343 ? SER F 321 VAL F 323 
AC9 2  ALA F 357 ? ASN F 359 ? ALA F 337 ASN F 339 
AC9 3  ARG F 374 ? VAL F 380 ? ARG F 354 VAL F 360 
AC9 4  GLN F 391 ? ILE F 397 ? GLN F 371 ILE F 377 
AC9 5  CYS F 428 ? ILE F 430 ? CYS F 408 ILE F 410 
AC9 6  ARG F 421 ? ARG F 422 ? ARG F 401 ARG F 402 
AD1 1  SER E 341 ? VAL E 343 ? SER E 321 VAL E 323 
AD1 2  ALA E 357 ? ASN E 359 ? ALA E 337 ASN E 339 
AD1 3  ARG E 374 ? VAL E 380 ? ARG E 354 VAL E 360 
AD1 4  GLN E 391 ? ILE E 397 ? GLN E 371 ILE E 377 
AD1 5  CYS E 428 ? ILE E 430 ? CYS E 408 ILE E 410 
AD1 6  ARG E 421 ? ARG E 422 ? ARG E 401 ARG E 402 
AD2 1  ILE E 408 ? VAL E 409 ? ILE E 388 VAL E 389 
AD2 2  GLN E 391 ? ILE E 397 ? GLN E 371 ILE E 377 
AD2 3  ARG E 374 ? VAL E 380 ? ARG E 354 VAL E 360 
AD2 4  LEU E 362 ? LEU E 363 ? LEU E 342 LEU E 343 
AD2 5  SER E 345 ? VAL E 347 ? SER E 325 VAL E 327 
AD2 6  ALA F 329 ? VAL F 332 ? ALA F 309 VAL F 312 
AD2 7  ILE F 352 ? SER F 354 ? ILE F 332 SER F 334 
AD2 8  ARG F 368 ? ALA F 369 ? ARG F 348 ALA F 349 
AD2 9  LYS F 385 ? ILE F 386 ? LYS F 365 ILE F 366 
AD2 10 VAL F 402 ? ILE F 403 ? VAL F 382 ILE F 383 
AD3 1  SER F 111 ? PRO F 116 ? SER F 91  PRO F 96  
AD3 2  ARG F 81  ? THR F 86  ? ARG F 61  THR F 66  
AD3 3  ALA F 33  ? LEU F 38  ? ALA F 13  LEU F 18  
AD3 4  TYR F 148 ? ALA F 153 ? TYR F 128 ALA F 133 
AD3 5  PHE F 221 ? HIS F 232 ? PHE F 201 HIS F 212 
AD3 6  GLY F 192 ? VAL F 196 ? GLY F 172 VAL F 176 
AD3 7  ILE F 202 ? GLU F 207 ? ILE F 182 GLU F 187 
AD4 1  SER F 111 ? PRO F 116 ? SER F 91  PRO F 96  
AD4 2  ARG F 81  ? THR F 86  ? ARG F 61  THR F 66  
AD4 3  ALA F 33  ? LEU F 38  ? ALA F 13  LEU F 18  
AD4 4  TYR F 148 ? ALA F 153 ? TYR F 128 ALA F 133 
AD4 5  PHE F 221 ? HIS F 232 ? PHE F 201 HIS F 212 
AD4 6  VAL F 176 ? PRO F 184 ? VAL F 156 PRO F 164 
AD4 7  ALA F 267 ? ARG F 271 ? ALA F 247 ARG F 251 
AD5 1  TYR F 59  ? PHE F 60  ? TYR F 39  PHE F 40  
AD5 2  ALA F 64  ? ARG F 65  ? ALA F 44  ARG F 45  
AD6 1  ILE F 157 ? TYR F 158 ? ILE F 137 TYR F 138 
AD6 2  TRP F 287 ? ARG F 288 ? TRP F 267 ARG F 268 
AD7 1  SER G 111 ? PRO G 116 ? SER G 91  PRO G 96  
AD7 2  ARG G 81  ? THR G 86  ? ARG G 61  THR G 66  
AD7 3  ALA G 33  ? LEU G 38  ? ALA G 13  LEU G 18  
AD7 4  TYR G 148 ? ALA G 153 ? TYR G 128 ALA G 133 
AD7 5  PHE G 221 ? HIS G 232 ? PHE G 201 HIS G 212 
AD7 6  GLY G 192 ? VAL G 196 ? GLY G 172 VAL G 176 
AD7 7  ILE G 202 ? GLU G 207 ? ILE G 182 GLU G 187 
AD8 1  SER G 111 ? PRO G 116 ? SER G 91  PRO G 96  
AD8 2  ARG G 81  ? THR G 86  ? ARG G 61  THR G 66  
AD8 3  ALA G 33  ? LEU G 38  ? ALA G 13  LEU G 18  
AD8 4  TYR G 148 ? ALA G 153 ? TYR G 128 ALA G 133 
AD8 5  PHE G 221 ? HIS G 232 ? PHE G 201 HIS G 212 
AD8 6  VAL G 176 ? PRO G 184 ? VAL G 156 PRO G 164 
AD8 7  ALA G 267 ? ARG G 271 ? ALA G 247 ARG G 251 
AD9 1  ILE G 157 ? TYR G 158 ? ILE G 137 TYR G 138 
AD9 2  TRP G 287 ? ARG G 288 ? TRP G 267 ARG G 268 
AE1 1  VAL G 402 ? ILE G 403 ? VAL G 382 ILE G 383 
AE1 2  LYS G 385 ? ILE G 386 ? LYS G 365 ILE G 366 
AE1 3  ARG G 368 ? ALA G 369 ? ARG G 348 ALA G 349 
AE1 4  ILE G 352 ? SER G 354 ? ILE G 332 SER G 334 
AE1 5  ALA G 329 ? VAL G 332 ? ALA G 309 VAL G 312 
AE1 6  SER H 345 ? VAL H 347 ? SER H 325 VAL H 327 
AE1 7  LEU H 362 ? LEU H 363 ? LEU H 342 LEU H 343 
AE1 8  ARG H 374 ? VAL H 380 ? ARG H 354 VAL H 360 
AE1 9  GLN H 391 ? ILE H 397 ? GLN H 371 ILE H 377 
AE1 10 ILE H 408 ? VAL H 409 ? ILE H 388 VAL H 389 
AE2 1  SER H 341 ? VAL H 343 ? SER H 321 VAL H 323 
AE2 2  ALA H 357 ? ASN H 359 ? ALA H 337 ASN H 339 
AE2 3  ARG H 374 ? VAL H 380 ? ARG H 354 VAL H 360 
AE2 4  GLN H 391 ? ILE H 397 ? GLN H 371 ILE H 377 
AE2 5  CYS H 428 ? ILE H 430 ? CYS H 408 ILE H 410 
AE2 6  ARG H 421 ? ARG H 422 ? ARG H 401 ARG H 402 
AE3 1  SER G 341 ? VAL G 343 ? SER G 321 VAL G 323 
AE3 2  ALA G 357 ? ASN G 359 ? ALA G 337 ASN G 339 
AE3 3  ARG G 374 ? VAL G 380 ? ARG G 354 VAL G 360 
AE3 4  GLN G 391 ? ILE G 397 ? GLN G 371 ILE G 377 
AE3 5  CYS G 428 ? ILE G 430 ? CYS G 408 ILE G 410 
AE3 6  ARG G 421 ? ARG G 422 ? ARG G 401 ARG G 402 
AE4 1  ILE G 408 ? VAL G 409 ? ILE G 388 VAL G 389 
AE4 2  GLN G 391 ? ILE G 397 ? GLN G 371 ILE G 377 
AE4 3  ARG G 374 ? VAL G 380 ? ARG G 354 VAL G 360 
AE4 4  LEU G 362 ? LEU G 363 ? LEU G 342 LEU G 343 
AE4 5  SER G 345 ? VAL G 347 ? SER G 325 VAL G 327 
AE4 6  ALA H 329 ? VAL H 332 ? ALA H 309 VAL H 312 
AE4 7  ILE H 352 ? SER H 354 ? ILE H 332 SER H 334 
AE4 8  ARG H 368 ? ALA H 369 ? ARG H 348 ALA H 349 
AE4 9  LYS H 385 ? ILE H 386 ? LYS H 365 ILE H 366 
AE4 10 VAL H 402 ? ILE H 403 ? VAL H 382 ILE H 383 
AE5 1  SER H 111 ? PRO H 116 ? SER H 91  PRO H 96  
AE5 2  ARG H 81  ? THR H 86  ? ARG H 61  THR H 66  
AE5 3  ALA H 33  ? LEU H 38  ? ALA H 13  LEU H 18  
AE5 4  TYR H 148 ? ALA H 153 ? TYR H 128 ALA H 133 
AE5 5  PHE H 221 ? HIS H 232 ? PHE H 201 HIS H 212 
AE5 6  GLY H 192 ? VAL H 196 ? GLY H 172 VAL H 176 
AE5 7  ILE H 202 ? GLU H 207 ? ILE H 182 GLU H 187 
AE6 1  SER H 111 ? PRO H 116 ? SER H 91  PRO H 96  
AE6 2  ARG H 81  ? THR H 86  ? ARG H 61  THR H 66  
AE6 3  ALA H 33  ? LEU H 38  ? ALA H 13  LEU H 18  
AE6 4  TYR H 148 ? ALA H 153 ? TYR H 128 ALA H 133 
AE6 5  PHE H 221 ? HIS H 232 ? PHE H 201 HIS H 212 
AE6 6  VAL H 176 ? PRO H 184 ? VAL H 156 PRO H 164 
AE6 7  ALA H 267 ? ARG H 271 ? ALA H 247 ARG H 251 
AE7 1  TYR H 59  ? PHE H 60  ? TYR H 39  PHE H 40  
AE7 2  ALA H 64  ? ARG H 65  ? ALA H 44  ARG H 45  
AE8 1  ILE H 157 ? TYR H 158 ? ILE H 137 TYR H 138 
AE8 2  TRP H 287 ? ARG H 288 ? TRP H 267 ARG H 268 
AE9 1  SER I 111 ? PRO I 116 ? SER I 91  PRO I 96  
AE9 2  ARG I 81  ? THR I 86  ? ARG I 61  THR I 66  
AE9 3  ALA I 33  ? LEU I 38  ? ALA I 13  LEU I 18  
AE9 4  TYR I 148 ? ALA I 153 ? TYR I 128 ALA I 133 
AE9 5  PHE I 221 ? HIS I 232 ? PHE I 201 HIS I 212 
AE9 6  GLY I 192 ? VAL I 196 ? GLY I 172 VAL I 176 
AE9 7  ILE I 202 ? GLU I 207 ? ILE I 182 GLU I 187 
AF1 1  SER I 111 ? PRO I 116 ? SER I 91  PRO I 96  
AF1 2  ARG I 81  ? THR I 86  ? ARG I 61  THR I 66  
AF1 3  ALA I 33  ? LEU I 38  ? ALA I 13  LEU I 18  
AF1 4  TYR I 148 ? ALA I 153 ? TYR I 128 ALA I 133 
AF1 5  PHE I 221 ? HIS I 232 ? PHE I 201 HIS I 212 
AF1 6  VAL I 176 ? PRO I 184 ? VAL I 156 PRO I 164 
AF1 7  ALA I 267 ? ARG I 271 ? ALA I 247 ARG I 251 
AF2 1  ILE I 157 ? TYR I 158 ? ILE I 137 TYR I 138 
AF2 2  TRP I 287 ? ARG I 288 ? TRP I 267 ARG I 268 
AF3 1  VAL I 402 ? ILE I 403 ? VAL I 382 ILE I 383 
AF3 2  LYS I 385 ? ILE I 386 ? LYS I 365 ILE I 366 
AF3 3  ARG I 368 ? ALA I 369 ? ARG I 348 ALA I 349 
AF3 4  ILE I 352 ? SER I 354 ? ILE I 332 SER I 334 
AF3 5  ALA I 329 ? VAL I 332 ? ALA I 309 VAL I 312 
AF3 6  SER J 345 ? VAL J 347 ? SER J 325 VAL J 327 
AF3 7  LEU J 362 ? LEU J 363 ? LEU J 342 LEU J 343 
AF3 8  ARG J 374 ? VAL J 380 ? ARG J 354 VAL J 360 
AF3 9  GLN J 391 ? ILE J 397 ? GLN J 371 ILE J 377 
AF3 10 ILE J 408 ? VAL J 409 ? ILE J 388 VAL J 389 
AF4 1  SER J 341 ? VAL J 343 ? SER J 321 VAL J 323 
AF4 2  ALA J 357 ? ASN J 359 ? ALA J 337 ASN J 339 
AF4 3  ARG J 374 ? VAL J 380 ? ARG J 354 VAL J 360 
AF4 4  GLN J 391 ? ILE J 397 ? GLN J 371 ILE J 377 
AF4 5  CYS J 428 ? ILE J 430 ? CYS J 408 ILE J 410 
AF4 6  ARG J 421 ? ARG J 422 ? ARG J 401 ARG J 402 
AF5 1  SER I 341 ? VAL I 343 ? SER I 321 VAL I 323 
AF5 2  ALA I 357 ? ASN I 359 ? ALA I 337 ASN I 339 
AF5 3  ARG I 374 ? VAL I 380 ? ARG I 354 VAL I 360 
AF5 4  GLN I 391 ? ILE I 397 ? GLN I 371 ILE I 377 
AF5 5  CYS I 428 ? ILE I 430 ? CYS I 408 ILE I 410 
AF5 6  ARG I 421 ? ARG I 422 ? ARG I 401 ARG I 402 
AF6 1  ILE I 408 ? VAL I 409 ? ILE I 388 VAL I 389 
AF6 2  GLN I 391 ? ILE I 397 ? GLN I 371 ILE I 377 
AF6 3  ARG I 374 ? VAL I 380 ? ARG I 354 VAL I 360 
AF6 4  LEU I 362 ? LEU I 363 ? LEU I 342 LEU I 343 
AF6 5  SER I 345 ? VAL I 347 ? SER I 325 VAL I 327 
AF6 6  ALA J 329 ? VAL J 332 ? ALA J 309 VAL J 312 
AF6 7  ILE J 352 ? SER J 354 ? ILE J 332 SER J 334 
AF6 8  ARG J 368 ? ALA J 369 ? ARG J 348 ALA J 349 
AF6 9  LYS J 385 ? ILE J 386 ? LYS J 365 ILE J 366 
AF6 10 VAL J 402 ? ILE J 403 ? VAL J 382 ILE J 383 
AF7 1  SER J 111 ? PRO J 116 ? SER J 91  PRO J 96  
AF7 2  ARG J 81  ? THR J 86  ? ARG J 61  THR J 66  
AF7 3  ALA J 33  ? LEU J 38  ? ALA J 13  LEU J 18  
AF7 4  TYR J 148 ? ALA J 153 ? TYR J 128 ALA J 133 
AF7 5  PHE J 221 ? HIS J 232 ? PHE J 201 HIS J 212 
AF7 6  GLY J 192 ? VAL J 196 ? GLY J 172 VAL J 176 
AF7 7  ILE J 202 ? GLU J 207 ? ILE J 182 GLU J 187 
AF8 1  SER J 111 ? PRO J 116 ? SER J 91  PRO J 96  
AF8 2  ARG J 81  ? THR J 86  ? ARG J 61  THR J 66  
AF8 3  ALA J 33  ? LEU J 38  ? ALA J 13  LEU J 18  
AF8 4  TYR J 148 ? ALA J 153 ? TYR J 128 ALA J 133 
AF8 5  PHE J 221 ? HIS J 232 ? PHE J 201 HIS J 212 
AF8 6  VAL J 176 ? PRO J 184 ? VAL J 156 PRO J 164 
AF8 7  ALA J 267 ? ARG J 271 ? ALA J 247 ARG J 251 
AF9 1  ILE J 157 ? TYR J 158 ? ILE J 137 TYR J 138 
AF9 2  TRP J 287 ? ARG J 288 ? TRP J 267 ARG J 268 
AG1 1  SER K 111 ? PRO K 116 ? SER K 91  PRO K 96  
AG1 2  ARG K 81  ? THR K 86  ? ARG K 61  THR K 66  
AG1 3  ALA K 33  ? LEU K 38  ? ALA K 13  LEU K 18  
AG1 4  TYR K 148 ? ALA K 153 ? TYR K 128 ALA K 133 
AG1 5  ALA K 222 ? HIS K 232 ? ALA K 202 HIS K 212 
AG1 6  VAL K 176 ? VAL K 183 ? VAL K 156 VAL K 163 
AG1 7  ALA K 267 ? ARG K 271 ? ALA K 247 ARG K 251 
AG2 1  TYR K 59  ? PHE K 60  ? TYR K 39  PHE K 40  
AG2 2  ALA K 64  ? ARG K 65  ? ALA K 44  ARG K 45  
AG3 1  ILE K 157 ? TYR K 158 ? ILE K 137 TYR K 138 
AG3 2  TRP K 287 ? ARG K 288 ? TRP K 267 ARG K 268 
AG4 1  GLY K 192 ? VAL K 196 ? GLY K 172 VAL K 176 
AG4 2  ILE K 202 ? GLU K 207 ? ILE K 182 GLU K 187 
AG5 1  VAL K 402 ? ILE K 403 ? VAL K 382 ILE K 383 
AG5 2  LYS K 385 ? ILE K 386 ? LYS K 365 ILE K 366 
AG5 3  ARG K 368 ? ALA K 369 ? ARG K 348 ALA K 349 
AG5 4  ILE K 352 ? SER K 354 ? ILE K 332 SER K 334 
AG5 5  ALA K 329 ? VAL K 332 ? ALA K 309 VAL K 312 
AG5 6  SER L 345 ? VAL L 347 ? SER L 325 VAL L 327 
AG5 7  LEU L 362 ? LEU L 363 ? LEU L 342 LEU L 343 
AG5 8  ARG L 374 ? VAL L 380 ? ARG L 354 VAL L 360 
AG5 9  GLN L 391 ? ILE L 397 ? GLN L 371 ILE L 377 
AG5 10 ILE L 408 ? VAL L 409 ? ILE L 388 VAL L 389 
AG6 1  SER L 341 ? VAL L 343 ? SER L 321 VAL L 323 
AG6 2  ALA L 357 ? ASN L 359 ? ALA L 337 ASN L 339 
AG6 3  ARG L 374 ? VAL L 380 ? ARG L 354 VAL L 360 
AG6 4  GLN L 391 ? ILE L 397 ? GLN L 371 ILE L 377 
AG6 5  CYS L 428 ? ILE L 430 ? CYS L 408 ILE L 410 
AG6 6  ARG L 421 ? ARG L 422 ? ARG L 401 ARG L 402 
AG7 1  SER K 341 ? VAL K 343 ? SER K 321 VAL K 323 
AG7 2  ALA K 357 ? ASN K 359 ? ALA K 337 ASN K 339 
AG7 3  ARG K 374 ? VAL K 380 ? ARG K 354 VAL K 360 
AG7 4  GLN K 391 ? ILE K 397 ? GLN K 371 ILE K 377 
AG7 5  CYS K 428 ? ILE K 430 ? CYS K 408 ILE K 410 
AG7 6  ARG K 421 ? ARG K 422 ? ARG K 401 ARG K 402 
AG8 1  ILE K 408 ? VAL K 409 ? ILE K 388 VAL K 389 
AG8 2  GLN K 391 ? ILE K 397 ? GLN K 371 ILE K 377 
AG8 3  ARG K 374 ? VAL K 380 ? ARG K 354 VAL K 360 
AG8 4  LEU K 362 ? LEU K 363 ? LEU K 342 LEU K 343 
AG8 5  SER K 345 ? VAL K 347 ? SER K 325 VAL K 327 
AG8 6  ALA L 329 ? VAL L 332 ? ALA L 309 VAL L 312 
AG8 7  ILE L 352 ? SER L 354 ? ILE L 332 SER L 334 
AG8 8  ARG L 368 ? ALA L 369 ? ARG L 348 ALA L 349 
AG8 9  LYS L 385 ? ILE L 386 ? LYS L 365 ILE L 366 
AG8 10 VAL L 402 ? ILE L 403 ? VAL L 382 ILE L 383 
AG9 1  SER L 111 ? PRO L 116 ? SER L 91  PRO L 96  
AG9 2  ARG L 81  ? THR L 86  ? ARG L 61  THR L 66  
AG9 3  ALA L 33  ? LEU L 38  ? ALA L 13  LEU L 18  
AG9 4  TYR L 148 ? ALA L 153 ? TYR L 128 ALA L 133 
AG9 5  PHE L 221 ? HIS L 232 ? PHE L 201 HIS L 212 
AG9 6  GLY L 192 ? VAL L 196 ? GLY L 172 VAL L 176 
AG9 7  ILE L 202 ? GLU L 207 ? ILE L 182 GLU L 187 
AH1 1  SER L 111 ? PRO L 116 ? SER L 91  PRO L 96  
AH1 2  ARG L 81  ? THR L 86  ? ARG L 61  THR L 66  
AH1 3  ALA L 33  ? LEU L 38  ? ALA L 13  LEU L 18  
AH1 4  TYR L 148 ? ALA L 153 ? TYR L 128 ALA L 133 
AH1 5  PHE L 221 ? HIS L 232 ? PHE L 201 HIS L 212 
AH1 6  VAL L 176 ? PRO L 184 ? VAL L 156 PRO L 164 
AH1 7  ALA L 267 ? ARG L 271 ? ALA L 247 ARG L 251 
AH2 1  TYR L 59  ? PHE L 60  ? TYR L 39  PHE L 40  
AH2 2  ALA L 64  ? ARG L 65  ? ALA L 44  ARG L 45  
AH3 1  ILE L 157 ? TYR L 158 ? ILE L 137 TYR L 138 
AH3 2  TRP L 287 ? ARG L 288 ? TRP L 267 ARG L 268 
AH4 1  SER M 111 ? PRO M 116 ? SER M 91  PRO M 96  
AH4 2  ARG M 81  ? THR M 86  ? ARG M 61  THR M 66  
AH4 3  ALA M 33  ? LEU M 38  ? ALA M 13  LEU M 18  
AH4 4  TYR M 148 ? ALA M 153 ? TYR M 128 ALA M 133 
AH4 5  PHE M 221 ? HIS M 232 ? PHE M 201 HIS M 212 
AH4 6  GLY M 192 ? VAL M 196 ? GLY M 172 VAL M 176 
AH4 7  ILE M 202 ? GLU M 207 ? ILE M 182 GLU M 187 
AH5 1  SER M 111 ? PRO M 116 ? SER M 91  PRO M 96  
AH5 2  ARG M 81  ? THR M 86  ? ARG M 61  THR M 66  
AH5 3  ALA M 33  ? LEU M 38  ? ALA M 13  LEU M 18  
AH5 4  TYR M 148 ? ALA M 153 ? TYR M 128 ALA M 133 
AH5 5  PHE M 221 ? HIS M 232 ? PHE M 201 HIS M 212 
AH5 6  VAL M 176 ? PRO M 184 ? VAL M 156 PRO M 164 
AH5 7  ALA M 267 ? ARG M 271 ? ALA M 247 ARG M 251 
AH6 1  TYR M 59  ? PHE M 60  ? TYR M 39  PHE M 40  
AH6 2  ALA M 64  ? ARG M 65  ? ALA M 44  ARG M 45  
AH7 1  ILE M 157 ? TYR M 158 ? ILE M 137 TYR M 138 
AH7 2  TRP M 287 ? ARG M 288 ? TRP M 267 ARG M 268 
AH8 1  VAL M 402 ? ILE M 403 ? VAL M 382 ILE M 383 
AH8 2  LYS M 385 ? ILE M 386 ? LYS M 365 ILE M 366 
AH8 3  ARG M 368 ? ALA M 369 ? ARG M 348 ALA M 349 
AH8 4  ILE M 352 ? SER M 354 ? ILE M 332 SER M 334 
AH8 5  ALA M 329 ? VAL M 332 ? ALA M 309 VAL M 312 
AH8 6  SER N 345 ? VAL N 347 ? SER N 325 VAL N 327 
AH8 7  LEU N 362 ? LEU N 363 ? LEU N 342 LEU N 343 
AH8 8  ARG N 374 ? VAL N 380 ? ARG N 354 VAL N 360 
AH8 9  GLN N 391 ? ILE N 397 ? GLN N 371 ILE N 377 
AH8 10 ILE N 408 ? VAL N 409 ? ILE N 388 VAL N 389 
AH9 1  SER N 341 ? VAL N 343 ? SER N 321 VAL N 323 
AH9 2  ALA N 357 ? ASN N 359 ? ALA N 337 ASN N 339 
AH9 3  ARG N 374 ? VAL N 380 ? ARG N 354 VAL N 360 
AH9 4  GLN N 391 ? ILE N 397 ? GLN N 371 ILE N 377 
AH9 5  CYS N 428 ? ILE N 430 ? CYS N 408 ILE N 410 
AH9 6  ARG N 421 ? ARG N 422 ? ARG N 401 ARG N 402 
AI1 1  SER M 341 ? VAL M 343 ? SER M 321 VAL M 323 
AI1 2  ALA M 357 ? ASN M 359 ? ALA M 337 ASN M 339 
AI1 3  ARG M 374 ? VAL M 380 ? ARG M 354 VAL M 360 
AI1 4  GLN M 391 ? ILE M 397 ? GLN M 371 ILE M 377 
AI1 5  CYS M 428 ? ILE M 430 ? CYS M 408 ILE M 410 
AI1 6  ARG M 421 ? ARG M 422 ? ARG M 401 ARG M 402 
AI2 1  ILE M 408 ? VAL M 409 ? ILE M 388 VAL M 389 
AI2 2  GLN M 391 ? ILE M 397 ? GLN M 371 ILE M 377 
AI2 3  ARG M 374 ? VAL M 380 ? ARG M 354 VAL M 360 
AI2 4  LEU M 362 ? LEU M 363 ? LEU M 342 LEU M 343 
AI2 5  VAL M 346 ? VAL M 347 ? VAL M 326 VAL M 327 
AI2 6  ALA N 329 ? VAL N 332 ? ALA N 309 VAL N 312 
AI2 7  ILE N 352 ? SER N 354 ? ILE N 332 SER N 334 
AI2 8  ARG N 368 ? ALA N 369 ? ARG N 348 ALA N 349 
AI2 9  LYS N 385 ? ILE N 386 ? LYS N 365 ILE N 366 
AI2 10 VAL N 402 ? ILE N 403 ? VAL N 382 ILE N 383 
AI3 1  SER N 111 ? PRO N 116 ? SER N 91  PRO N 96  
AI3 2  ARG N 81  ? THR N 86  ? ARG N 61  THR N 66  
AI3 3  ALA N 33  ? LEU N 38  ? ALA N 13  LEU N 18  
AI3 4  TYR N 148 ? ALA N 153 ? TYR N 128 ALA N 133 
AI3 5  PHE N 221 ? HIS N 232 ? PHE N 201 HIS N 212 
AI3 6  GLY N 192 ? VAL N 196 ? GLY N 172 VAL N 176 
AI3 7  ILE N 202 ? GLU N 207 ? ILE N 182 GLU N 187 
AI4 1  SER N 111 ? PRO N 116 ? SER N 91  PRO N 96  
AI4 2  ARG N 81  ? THR N 86  ? ARG N 61  THR N 66  
AI4 3  ALA N 33  ? LEU N 38  ? ALA N 13  LEU N 18  
AI4 4  TYR N 148 ? ALA N 153 ? TYR N 128 ALA N 133 
AI4 5  PHE N 221 ? HIS N 232 ? PHE N 201 HIS N 212 
AI4 6  VAL N 176 ? PRO N 184 ? VAL N 156 PRO N 164 
AI4 7  ALA N 267 ? ARG N 271 ? ALA N 247 ARG N 251 
AI5 1  ILE N 157 ? TYR N 158 ? ILE N 137 TYR N 138 
AI5 2  TRP N 287 ? ARG N 288 ? TRP N 267 ARG N 268 
AI6 1  SER O 111 ? PRO O 116 ? SER O 91  PRO O 96  
AI6 2  ARG O 81  ? THR O 86  ? ARG O 61  THR O 66  
AI6 3  ALA O 33  ? ALA O 39  ? ALA O 13  ALA O 19  
AI6 4  TYR O 148 ? ALA O 153 ? TYR O 128 ALA O 133 
AI6 5  PHE O 221 ? HIS O 232 ? PHE O 201 HIS O 212 
AI6 6  GLY O 192 ? VAL O 196 ? GLY O 172 VAL O 176 
AI6 7  ILE O 202 ? GLU O 207 ? ILE O 182 GLU O 187 
AI7 1  SER O 111 ? PRO O 116 ? SER O 91  PRO O 96  
AI7 2  ARG O 81  ? THR O 86  ? ARG O 61  THR O 66  
AI7 3  ALA O 33  ? ALA O 39  ? ALA O 13  ALA O 19  
AI7 4  TYR O 148 ? ALA O 153 ? TYR O 128 ALA O 133 
AI7 5  PHE O 221 ? HIS O 232 ? PHE O 201 HIS O 212 
AI7 6  VAL O 176 ? PRO O 184 ? VAL O 156 PRO O 164 
AI7 7  ALA O 267 ? ARG O 271 ? ALA O 247 ARG O 251 
AI8 1  TYR O 59  ? PHE O 60  ? TYR O 39  PHE O 40  
AI8 2  ALA O 64  ? ARG O 65  ? ALA O 44  ARG O 45  
AI9 1  ILE O 157 ? TYR O 158 ? ILE O 137 TYR O 138 
AI9 2  TRP O 287 ? ARG O 288 ? TRP O 267 ARG O 268 
AJ1 1  VAL O 402 ? ILE O 403 ? VAL O 382 ILE O 383 
AJ1 2  LYS O 385 ? ILE O 386 ? LYS O 365 ILE O 366 
AJ1 3  ARG O 368 ? ALA O 369 ? ARG O 348 ALA O 349 
AJ1 4  ILE O 352 ? SER O 354 ? ILE O 332 SER O 334 
AJ1 5  ALA O 329 ? VAL O 332 ? ALA O 309 VAL O 312 
AJ1 6  SER P 345 ? VAL P 347 ? SER P 325 VAL P 327 
AJ1 7  LEU P 362 ? LEU P 363 ? LEU P 342 LEU P 343 
AJ1 8  ARG P 374 ? VAL P 380 ? ARG P 354 VAL P 360 
AJ1 9  GLN P 391 ? ILE P 397 ? GLN P 371 ILE P 377 
AJ1 10 ILE P 408 ? VAL P 409 ? ILE P 388 VAL P 389 
AJ2 1  SER P 341 ? VAL P 343 ? SER P 321 VAL P 323 
AJ2 2  ALA P 357 ? ASN P 359 ? ALA P 337 ASN P 339 
AJ2 3  ARG P 374 ? VAL P 380 ? ARG P 354 VAL P 360 
AJ2 4  GLN P 391 ? ILE P 397 ? GLN P 371 ILE P 377 
AJ2 5  CYS P 428 ? ILE P 430 ? CYS P 408 ILE P 410 
AJ2 6  ARG P 421 ? ARG P 422 ? ARG P 401 ARG P 402 
AJ3 1  SER O 341 ? VAL O 343 ? SER O 321 VAL O 323 
AJ3 2  ALA O 357 ? LEU O 363 ? ALA O 337 LEU O 343 
AJ3 3  ARG O 374 ? VAL O 380 ? ARG O 354 VAL O 360 
AJ3 4  GLN O 391 ? ILE O 397 ? GLN O 371 ILE O 377 
AJ3 5  CYS O 428 ? ILE O 430 ? CYS O 408 ILE O 410 
AJ3 6  ARG O 421 ? ARG O 422 ? ARG O 401 ARG O 402 
AJ4 1  ILE O 408 ? VAL O 409 ? ILE O 388 VAL O 389 
AJ4 2  GLN O 391 ? ILE O 397 ? GLN O 371 ILE O 377 
AJ4 3  ARG O 374 ? VAL O 380 ? ARG O 354 VAL O 360 
AJ4 4  ALA O 357 ? LEU O 363 ? ALA O 337 LEU O 343 
AJ4 5  SER O 345 ? VAL O 347 ? SER O 325 VAL O 327 
AJ4 6  ALA P 329 ? VAL P 332 ? ALA P 309 VAL P 312 
AJ4 7  ILE P 352 ? SER P 354 ? ILE P 332 SER P 334 
AJ4 8  ARG P 368 ? ALA P 369 ? ARG P 348 ALA P 349 
AJ4 9  LYS P 385 ? ILE P 386 ? LYS P 365 ILE P 366 
AJ4 10 VAL P 402 ? ILE P 403 ? VAL P 382 ILE P 383 
AJ5 1  SER P 111 ? PRO P 116 ? SER P 91  PRO P 96  
AJ5 2  ARG P 81  ? THR P 86  ? ARG P 61  THR P 66  
AJ5 3  ALA P 33  ? LEU P 38  ? ALA P 13  LEU P 18  
AJ5 4  TYR P 148 ? ALA P 153 ? TYR P 128 ALA P 133 
AJ5 5  PHE P 221 ? HIS P 232 ? PHE P 201 HIS P 212 
AJ5 6  GLY P 192 ? VAL P 196 ? GLY P 172 VAL P 176 
AJ5 7  ILE P 202 ? GLU P 207 ? ILE P 182 GLU P 187 
AJ6 1  SER P 111 ? PRO P 116 ? SER P 91  PRO P 96  
AJ6 2  ARG P 81  ? THR P 86  ? ARG P 61  THR P 66  
AJ6 3  ALA P 33  ? LEU P 38  ? ALA P 13  LEU P 18  
AJ6 4  TYR P 148 ? ALA P 153 ? TYR P 128 ALA P 133 
AJ6 5  PHE P 221 ? HIS P 232 ? PHE P 201 HIS P 212 
AJ6 6  VAL P 176 ? PRO P 184 ? VAL P 156 PRO P 164 
AJ6 7  ALA P 267 ? ARG P 271 ? ALA P 247 ARG P 251 
AJ7 1  ILE P 157 ? TYR P 158 ? ILE P 137 TYR P 138 
AJ7 2  TRP P 287 ? ARG P 288 ? TRP P 267 ARG P 268 
AJ8 1  SER Q 111 ? PRO Q 116 ? SER Q 91  PRO Q 96  
AJ8 2  ARG Q 81  ? THR Q 86  ? ARG Q 61  THR Q 66  
AJ8 3  ALA Q 33  ? LEU Q 38  ? ALA Q 13  LEU Q 18  
AJ8 4  TYR Q 148 ? ALA Q 153 ? TYR Q 128 ALA Q 133 
AJ8 5  PHE Q 221 ? HIS Q 232 ? PHE Q 201 HIS Q 212 
AJ8 6  GLY Q 192 ? VAL Q 196 ? GLY Q 172 VAL Q 176 
AJ8 7  ILE Q 202 ? GLU Q 207 ? ILE Q 182 GLU Q 187 
AJ9 1  SER Q 111 ? PRO Q 116 ? SER Q 91  PRO Q 96  
AJ9 2  ARG Q 81  ? THR Q 86  ? ARG Q 61  THR Q 66  
AJ9 3  ALA Q 33  ? LEU Q 38  ? ALA Q 13  LEU Q 18  
AJ9 4  TYR Q 148 ? ALA Q 153 ? TYR Q 128 ALA Q 133 
AJ9 5  PHE Q 221 ? HIS Q 232 ? PHE Q 201 HIS Q 212 
AJ9 6  VAL Q 176 ? PRO Q 184 ? VAL Q 156 PRO Q 164 
AJ9 7  ALA Q 267 ? ARG Q 271 ? ALA Q 247 ARG Q 251 
AK1 1  TYR Q 59  ? PHE Q 60  ? TYR Q 39  PHE Q 40  
AK1 2  ALA Q 64  ? ARG Q 65  ? ALA Q 44  ARG Q 45  
AK2 1  ILE Q 157 ? TYR Q 158 ? ILE Q 137 TYR Q 138 
AK2 2  TRP Q 287 ? ARG Q 288 ? TRP Q 267 ARG Q 268 
AK3 1  VAL Q 402 ? ILE Q 403 ? VAL Q 382 ILE Q 383 
AK3 2  LYS Q 385 ? ILE Q 386 ? LYS Q 365 ILE Q 366 
AK3 3  ARG Q 368 ? ALA Q 369 ? ARG Q 348 ALA Q 349 
AK3 4  ILE Q 352 ? SER Q 354 ? ILE Q 332 SER Q 334 
AK3 5  ALA Q 329 ? VAL Q 332 ? ALA Q 309 VAL Q 312 
AK3 6  SER R 345 ? VAL R 347 ? SER R 325 VAL R 327 
AK3 7  LEU R 362 ? LEU R 363 ? LEU R 342 LEU R 343 
AK3 8  ARG R 374 ? VAL R 380 ? ARG R 354 VAL R 360 
AK3 9  GLN R 391 ? ILE R 397 ? GLN R 371 ILE R 377 
AK3 10 ILE R 408 ? VAL R 409 ? ILE R 388 VAL R 389 
AK4 1  SER R 341 ? VAL R 343 ? SER R 321 VAL R 323 
AK4 2  ALA R 357 ? ASN R 359 ? ALA R 337 ASN R 339 
AK4 3  ARG R 374 ? VAL R 380 ? ARG R 354 VAL R 360 
AK4 4  GLN R 391 ? ILE R 397 ? GLN R 371 ILE R 377 
AK4 5  CYS R 428 ? ILE R 430 ? CYS R 408 ILE R 410 
AK4 6  ARG R 421 ? ARG R 422 ? ARG R 401 ARG R 402 
AK5 1  SER Q 341 ? VAL Q 343 ? SER Q 321 VAL Q 323 
AK5 2  ALA Q 357 ? ASN Q 359 ? ALA Q 337 ASN Q 339 
AK5 3  ARG Q 374 ? VAL Q 380 ? ARG Q 354 VAL Q 360 
AK5 4  GLN Q 391 ? ILE Q 397 ? GLN Q 371 ILE Q 377 
AK5 5  CYS Q 428 ? ILE Q 430 ? CYS Q 408 ILE Q 410 
AK5 6  ARG Q 421 ? ARG Q 422 ? ARG Q 401 ARG Q 402 
AK6 1  ILE Q 408 ? VAL Q 409 ? ILE Q 388 VAL Q 389 
AK6 2  GLN Q 391 ? ILE Q 397 ? GLN Q 371 ILE Q 377 
AK6 3  ARG Q 374 ? VAL Q 380 ? ARG Q 354 VAL Q 360 
AK6 4  LEU Q 362 ? LEU Q 363 ? LEU Q 342 LEU Q 343 
AK6 5  SER Q 345 ? VAL Q 347 ? SER Q 325 VAL Q 327 
AK6 6  ALA R 329 ? VAL R 332 ? ALA R 309 VAL R 312 
AK6 7  ILE R 352 ? SER R 354 ? ILE R 332 SER R 334 
AK6 8  ARG R 368 ? ALA R 369 ? ARG R 348 ALA R 349 
AK6 9  LYS R 385 ? ILE R 386 ? LYS R 365 ILE R 366 
AK6 10 VAL R 402 ? ILE R 403 ? VAL R 382 ILE R 383 
AK7 1  SER R 111 ? PRO R 116 ? SER R 91  PRO R 96  
AK7 2  ARG R 81  ? THR R 86  ? ARG R 61  THR R 66  
AK7 3  ALA R 33  ? LEU R 38  ? ALA R 13  LEU R 18  
AK7 4  TYR R 148 ? ALA R 153 ? TYR R 128 ALA R 133 
AK7 5  PHE R 221 ? HIS R 232 ? PHE R 201 HIS R 212 
AK7 6  GLY R 192 ? VAL R 196 ? GLY R 172 VAL R 176 
AK7 7  ILE R 202 ? GLU R 207 ? ILE R 182 GLU R 187 
AK8 1  SER R 111 ? PRO R 116 ? SER R 91  PRO R 96  
AK8 2  ARG R 81  ? THR R 86  ? ARG R 61  THR R 66  
AK8 3  ALA R 33  ? LEU R 38  ? ALA R 13  LEU R 18  
AK8 4  TYR R 148 ? ALA R 153 ? TYR R 128 ALA R 133 
AK8 5  PHE R 221 ? HIS R 232 ? PHE R 201 HIS R 212 
AK8 6  VAL R 176 ? PRO R 184 ? VAL R 156 PRO R 164 
AK8 7  ALA R 267 ? ARG R 271 ? ALA R 247 ARG R 251 
AK9 1  ILE R 157 ? TYR R 158 ? ILE R 137 TYR R 138 
AK9 2  TRP R 287 ? ARG R 288 ? TRP R 267 ARG R 268 
AL1 1  SER S 111 ? PRO S 116 ? SER W 91  PRO W 96  
AL1 2  ARG S 81  ? THR S 86  ? ARG W 61  THR W 66  
AL1 3  ALA S 33  ? ALA S 39  ? ALA W 13  ALA W 19  
AL1 4  TYR S 148 ? ALA S 153 ? TYR W 128 ALA W 133 
AL1 5  PHE S 221 ? HIS S 232 ? PHE W 201 HIS W 212 
AL1 6  GLY S 192 ? VAL S 196 ? GLY W 172 VAL W 176 
AL1 7  ILE S 202 ? GLU S 207 ? ILE W 182 GLU W 187 
AL2 1  SER S 111 ? PRO S 116 ? SER W 91  PRO W 96  
AL2 2  ARG S 81  ? THR S 86  ? ARG W 61  THR W 66  
AL2 3  ALA S 33  ? ALA S 39  ? ALA W 13  ALA W 19  
AL2 4  TYR S 148 ? ALA S 153 ? TYR W 128 ALA W 133 
AL2 5  PHE S 221 ? HIS S 232 ? PHE W 201 HIS W 212 
AL2 6  VAL S 176 ? PRO S 184 ? VAL W 156 PRO W 164 
AL2 7  ALA S 267 ? ARG S 271 ? ALA W 247 ARG W 251 
AL3 1  TYR S 59  ? PHE S 60  ? TYR W 39  PHE W 40  
AL3 2  ALA S 64  ? ARG S 65  ? ALA W 44  ARG W 45  
AL4 1  ILE S 157 ? TYR S 158 ? ILE W 137 TYR W 138 
AL4 2  TRP S 287 ? ARG S 288 ? TRP W 267 ARG W 268 
AL5 1  VAL S 402 ? ILE S 403 ? VAL W 382 ILE W 383 
AL5 2  LYS S 385 ? ILE S 386 ? LYS W 365 ILE W 366 
AL5 3  ARG S 368 ? ALA S 369 ? ARG W 348 ALA W 349 
AL5 4  ILE S 352 ? SER S 354 ? ILE W 332 SER W 334 
AL5 5  ALA S 329 ? VAL S 332 ? ALA W 309 VAL W 312 
AL5 6  SER T 345 ? VAL T 347 ? SER T 325 VAL T 327 
AL5 7  LEU T 362 ? LEU T 363 ? LEU T 342 LEU T 343 
AL5 8  ARG T 374 ? VAL T 380 ? ARG T 354 VAL T 360 
AL5 9  GLN T 391 ? ILE T 397 ? GLN T 371 ILE T 377 
AL5 10 ILE T 408 ? VAL T 409 ? ILE T 388 VAL T 389 
AL6 1  SER T 341 ? VAL T 343 ? SER T 321 VAL T 323 
AL6 2  ALA T 357 ? ASN T 359 ? ALA T 337 ASN T 339 
AL6 3  ARG T 374 ? VAL T 380 ? ARG T 354 VAL T 360 
AL6 4  GLN T 391 ? ILE T 397 ? GLN T 371 ILE T 377 
AL6 5  CYS T 428 ? ILE T 430 ? CYS T 408 ILE T 410 
AL6 6  ARG T 421 ? ARG T 422 ? ARG T 401 ARG T 402 
AL7 1  SER S 341 ? VAL S 343 ? SER W 321 VAL W 323 
AL7 2  ALA S 357 ? LEU S 363 ? ALA W 337 LEU W 343 
AL7 3  ARG S 374 ? VAL S 380 ? ARG W 354 VAL W 360 
AL7 4  GLN S 391 ? ILE S 397 ? GLN W 371 ILE W 377 
AL7 5  CYS S 428 ? ILE S 430 ? CYS W 408 ILE W 410 
AL7 6  ARG S 421 ? ARG S 422 ? ARG W 401 ARG W 402 
AL8 1  ILE S 408 ? VAL S 409 ? ILE W 388 VAL W 389 
AL8 2  GLN S 391 ? ILE S 397 ? GLN W 371 ILE W 377 
AL8 3  ARG S 374 ? VAL S 380 ? ARG W 354 VAL W 360 
AL8 4  ALA S 357 ? LEU S 363 ? ALA W 337 LEU W 343 
AL8 5  SER S 345 ? VAL S 347 ? SER W 325 VAL W 327 
AL8 6  ALA T 329 ? VAL T 332 ? ALA T 309 VAL T 312 
AL8 7  ILE T 352 ? SER T 354 ? ILE T 332 SER T 334 
AL8 8  ARG T 368 ? ALA T 369 ? ARG T 348 ALA T 349 
AL8 9  LYS T 385 ? ILE T 386 ? LYS T 365 ILE T 366 
AL8 10 VAL T 402 ? ILE T 403 ? VAL T 382 ILE T 383 
AL9 1  SER T 111 ? PRO T 116 ? SER T 91  PRO T 96  
AL9 2  ARG T 81  ? THR T 86  ? ARG T 61  THR T 66  
AL9 3  ALA T 33  ? LEU T 38  ? ALA T 13  LEU T 18  
AL9 4  TYR T 148 ? ALA T 153 ? TYR T 128 ALA T 133 
AL9 5  PHE T 221 ? HIS T 232 ? PHE T 201 HIS T 212 
AL9 6  VAL T 176 ? PRO T 184 ? VAL T 156 PRO T 164 
AL9 7  ALA T 267 ? ARG T 271 ? ALA T 247 ARG T 251 
AM1 1  TYR T 59  ? PHE T 60  ? TYR T 39  PHE T 40  
AM1 2  ALA T 64  ? ARG T 65  ? ALA T 44  ARG T 45  
AM2 1  ILE T 157 ? TYR T 158 ? ILE T 137 TYR T 138 
AM2 2  TRP T 287 ? ARG T 288 ? TRP T 267 ARG T 268 
AM3 1  GLY T 192 ? VAL T 196 ? GLY T 172 VAL T 176 
AM3 2  ILE T 202 ? GLU T 207 ? ILE T 182 GLU T 187 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  O LEU A 115 ? O LEU A 95  N VAL A 84  ? N VAL A 64  
AA1 2 3  O GLY A 83  ? O GLY A 63  N VAL A 37  ? N VAL A 17  
AA1 3 4  N LEU A 38  ? N LEU A 18  O LEU A 152 ? O LEU A 132 
AA1 4 5  N ILE A 151 ? N ILE A 131 O TYR A 229 ? O TYR A 209 
AA1 5 6  O SER A 225 ? O SER A 205 N GLY A 192 ? N GLY A 172 
AA1 6 7  N HIS A 195 ? N HIS A 175 O ASP A 204 ? O ASP A 184 
AA2 1 2  O LEU A 115 ? O LEU A 95  N VAL A 84  ? N VAL A 64  
AA2 2 3  O GLY A 83  ? O GLY A 63  N VAL A 37  ? N VAL A 17  
AA2 3 4  N LEU A 38  ? N LEU A 18  O LEU A 152 ? O LEU A 132 
AA2 4 5  N ILE A 151 ? N ILE A 131 O TYR A 229 ? O TYR A 209 
AA2 5 6  O ALA A 222 ? O ALA A 202 N VAL A 183 ? N VAL A 163 
AA2 6 7  N ILE A 178 ? N ILE A 158 O HIS A 270 ? O HIS A 250 
AA3 1 2  N PHE A 60  ? N PHE A 40  O ALA A 64  ? O ALA A 44  
AA4 1 2  N ILE A 157 ? N ILE A 137 O ARG A 288 ? O ARG A 268 
AA5 1 2  O ILE A 403 ? O ILE A 383 N LYS A 385 ? N LYS A 365 
AA5 2 3  O ILE A 386 ? O ILE A 366 N ARG A 368 ? N ARG A 348 
AA5 3 4  O ALA A 369 ? O ALA A 349 N SER A 354 ? N SER A 334 
AA5 4 5  O ILE A 353 ? O ILE A 333 N LYS A 330 ? N LYS A 310 
AA5 5 6  N PHE A 331 ? N PHE A 311 O SER B 345 ? O SER B 325 
AA5 6 7  N VAL B 346 ? N VAL B 326 O LEU B 363 ? O LEU B 343 
AA5 7 8  N LEU B 362 ? N LEU B 342 O VAL B 380 ? O VAL B 360 
AA5 8 9  N VAL B 379 ? N VAL B 359 O ILE B 397 ? O ILE B 377 
AA5 9 10 N GLN B 391 ? N GLN B 371 O VAL B 409 ? O VAL B 389 
AA6 1 2  N SER B 341 ? N SER B 321 O LEU B 358 ? O LEU B 338 
AA6 2 3  N LEU B 362 ? N LEU B 342 O VAL B 380 ? O VAL B 360 
AA6 3 4  N VAL B 379 ? N VAL B 359 O ILE B 397 ? O ILE B 377 
AA6 4 5  N VAL B 396 ? N VAL B 376 O ILE B 430 ? O ILE B 410 
AA6 5 6  O LEU B 429 ? O LEU B 409 N ARG B 421 ? N ARG B 401 
AA7 1 2  N VAL A 343 ? N VAL A 323 O LEU A 358 ? O LEU A 338 
AA7 2 3  N ALA A 357 ? N ALA A 337 O LEU A 375 ? O LEU A 355 
AA7 3 4  N VAL A 379 ? N VAL A 359 O ILE A 397 ? O ILE A 377 
AA7 4 5  N VAL A 396 ? N VAL A 376 O CYS A 428 ? O CYS A 408 
AA7 5 6  O LEU A 429 ? O LEU A 409 N ARG A 421 ? N ARG A 401 
AA8 1 2  O VAL A 409 ? O VAL A 389 N GLN A 391 ? N GLN A 371 
AA8 2 3  O ILE A 397 ? O ILE A 377 N VAL A 379 ? N VAL A 359 
AA8 3 4  O VAL A 380 ? O VAL A 360 N LEU A 362 ? N LEU A 342 
AA8 4 5  O LEU A 363 ? O LEU A 343 N VAL A 346 ? N VAL A 326 
AA8 5 6  N SER A 345 ? N SER A 325 O PHE B 331 ? O PHE B 311 
AA8 6 7  N LYS B 330 ? N LYS B 310 O ILE B 353 ? O ILE B 333 
AA8 7 8  N SER B 354 ? N SER B 334 O ALA B 369 ? O ALA B 349 
AA8 8 9  N ARG B 368 ? N ARG B 348 O ILE B 386 ? O ILE B 366 
AA8 9 10 N LYS B 385 ? N LYS B 365 O ILE B 403 ? O ILE B 383 
AA9 1 2  O LEU B 115 ? O LEU B 95  N VAL B 84  ? N VAL B 64  
AA9 2 3  O GLY B 83  ? O GLY B 63  N VAL B 37  ? N VAL B 17  
AA9 3 4  N LEU B 38  ? N LEU B 18  O LEU B 152 ? O LEU B 132 
AA9 4 5  N ILE B 151 ? N ILE B 131 O TYR B 229 ? O TYR B 209 
AA9 5 6  O SER B 225 ? O SER B 205 N GLY B 192 ? N GLY B 172 
AA9 6 7  N VAL B 193 ? N VAL B 173 O ILE B 206 ? O ILE B 186 
AB1 1 2  O LEU B 115 ? O LEU B 95  N VAL B 84  ? N VAL B 64  
AB1 2 3  O GLY B 83  ? O GLY B 63  N VAL B 37  ? N VAL B 17  
AB1 3 4  N LEU B 38  ? N LEU B 18  O LEU B 152 ? O LEU B 132 
AB1 4 5  N ILE B 151 ? N ILE B 131 O TYR B 229 ? O TYR B 209 
AB1 5 6  O MET B 226 ? O MET B 206 N GLY B 179 ? N GLY B 159 
AB1 6 7  N ILE B 178 ? N ILE B 158 O HIS B 270 ? O HIS B 250 
AB2 1 2  N ILE B 157 ? N ILE B 137 O ARG B 288 ? O ARG B 268 
AB3 1 2  O LEU C 115 ? O LEU C 95  N VAL C 84  ? N VAL C 64  
AB3 2 3  O GLY C 83  ? O GLY C 63  N VAL C 37  ? N VAL C 17  
AB3 3 4  N LEU C 38  ? N LEU C 18  O LEU C 152 ? O LEU C 132 
AB3 4 5  N ILE C 151 ? N ILE C 131 O TYR C 229 ? O TYR C 209 
AB3 5 6  O SER C 225 ? O SER C 205 N GLY C 192 ? N GLY C 172 
AB3 6 7  N HIS C 195 ? N HIS C 175 O ILE C 203 ? O ILE C 183 
AB4 1 2  O LEU C 115 ? O LEU C 95  N VAL C 84  ? N VAL C 64  
AB4 2 3  O GLY C 83  ? O GLY C 63  N VAL C 37  ? N VAL C 17  
AB4 3 4  N LEU C 38  ? N LEU C 18  O LEU C 152 ? O LEU C 132 
AB4 4 5  N ILE C 151 ? N ILE C 131 O TYR C 229 ? O TYR C 209 
AB4 5 6  O MET C 226 ? O MET C 206 N GLY C 179 ? N GLY C 159 
AB4 6 7  N ILE C 178 ? N ILE C 158 O HIS C 270 ? O HIS C 250 
AB5 1 2  N PHE C 60  ? N PHE C 40  O ALA C 64  ? O ALA C 44  
AB6 1 2  N ILE C 157 ? N ILE C 137 O ARG C 288 ? O ARG C 268 
AB7 1 2  O ILE C 403 ? O ILE C 383 N LYS C 385 ? N LYS C 365 
AB7 2 3  O ILE C 386 ? O ILE C 366 N ARG C 368 ? N ARG C 348 
AB7 3 4  O ALA C 369 ? O ALA C 349 N SER C 354 ? N SER C 334 
AB7 4 5  O ILE C 353 ? O ILE C 333 N LYS C 330 ? N LYS C 310 
AB7 5 6  N PHE C 331 ? N PHE C 311 O SER D 345 ? O SER D 325 
AB7 6 7  N VAL D 346 ? N VAL D 326 O LEU D 363 ? O LEU D 343 
AB7 7 8  N LEU D 362 ? N LEU D 342 O VAL D 380 ? O VAL D 360 
AB7 8 9  N VAL D 379 ? N VAL D 359 O VAL D 395 ? O VAL D 375 
AB7 9 10 N GLN D 391 ? N GLN D 371 O VAL D 409 ? O VAL D 389 
AB8 1 2  N SER D 341 ? N SER D 321 O LEU D 358 ? O LEU D 338 
AB8 2 3  N LEU D 362 ? N LEU D 342 O VAL D 380 ? O VAL D 360 
AB8 3 4  N VAL D 379 ? N VAL D 359 O VAL D 395 ? O VAL D 375 
AB8 4 5  N VAL D 396 ? N VAL D 376 O ILE D 430 ? O ILE D 410 
AB8 5 6  O LEU D 429 ? O LEU D 409 N ARG D 421 ? N ARG D 401 
AB9 1 2  N SER C 341 ? N SER C 321 O LEU C 358 ? O LEU C 338 
AB9 2 3  N ALA C 357 ? N ALA C 337 O LEU C 375 ? O LEU C 355 
AB9 3 4  N VAL C 379 ? N VAL C 359 O ILE C 397 ? O ILE C 377 
AB9 4 5  N VAL C 396 ? N VAL C 376 O ILE C 430 ? O ILE C 410 
AB9 5 6  O LEU C 429 ? O LEU C 409 N ARG C 421 ? N ARG C 401 
AC1 1 2  O VAL C 409 ? O VAL C 389 N GLN C 391 ? N GLN C 371 
AC1 2 3  O ILE C 397 ? O ILE C 377 N VAL C 379 ? N VAL C 359 
AC1 3 4  O VAL C 380 ? O VAL C 360 N LEU C 362 ? N LEU C 342 
AC1 4 5  O LEU C 363 ? O LEU C 343 N VAL C 346 ? N VAL C 326 
AC1 5 6  N SER C 345 ? N SER C 325 O PHE D 331 ? O PHE D 311 
AC1 6 7  N LYS D 330 ? N LYS D 310 O ILE D 353 ? O ILE D 333 
AC1 7 8  N SER D 354 ? N SER D 334 O ALA D 369 ? O ALA D 349 
AC1 8 9  N ARG D 368 ? N ARG D 348 O ILE D 386 ? O ILE D 366 
AC1 9 10 N LYS D 385 ? N LYS D 365 O ILE D 403 ? O ILE D 383 
AC2 1 2  O LEU D 115 ? O LEU D 95  N VAL D 84  ? N VAL D 64  
AC2 2 3  O GLY D 83  ? O GLY D 63  N VAL D 37  ? N VAL D 17  
AC2 3 4  N TYR D 36  ? N TYR D 16  O VAL D 150 ? O VAL D 130 
AC2 4 5  N ILE D 151 ? N ILE D 131 O TYR D 229 ? O TYR D 209 
AC2 5 6  O SER D 225 ? O SER D 205 N GLY D 192 ? N GLY D 172 
AC2 6 7  N VAL D 193 ? N VAL D 173 O ILE D 206 ? O ILE D 186 
AC3 1 2  O LEU D 115 ? O LEU D 95  N VAL D 84  ? N VAL D 64  
AC3 2 3  O GLY D 83  ? O GLY D 63  N VAL D 37  ? N VAL D 17  
AC3 3 4  N TYR D 36  ? N TYR D 16  O VAL D 150 ? O VAL D 130 
AC3 4 5  N ILE D 151 ? N ILE D 131 O TYR D 229 ? O TYR D 209 
AC3 5 6  O MET D 226 ? O MET D 206 N GLY D 179 ? N GLY D 159 
AC3 6 7  N ILE D 178 ? N ILE D 158 O HIS D 270 ? O HIS D 250 
AC4 1 2  N ILE D 157 ? N ILE D 137 O ARG D 288 ? O ARG D 268 
AC5 1 2  O LEU E 115 ? O LEU E 95  N VAL E 84  ? N VAL E 64  
AC5 2 3  O GLY E 83  ? O GLY E 63  N VAL E 37  ? N VAL E 17  
AC5 3 4  N TYR E 36  ? N TYR E 16  O VAL E 150 ? O VAL E 130 
AC5 4 5  N ILE E 151 ? N ILE E 131 O TYR E 229 ? O TYR E 209 
AC5 5 6  O SER E 225 ? O SER E 205 N GLY E 192 ? N GLY E 172 
AC5 6 7  N HIS E 195 ? N HIS E 175 O ASP E 204 ? O ASP E 184 
AC6 1 2  O LEU E 115 ? O LEU E 95  N VAL E 84  ? N VAL E 64  
AC6 2 3  O GLY E 83  ? O GLY E 63  N VAL E 37  ? N VAL E 17  
AC6 3 4  N TYR E 36  ? N TYR E 16  O VAL E 150 ? O VAL E 130 
AC6 4 5  N ILE E 151 ? N ILE E 131 O TYR E 229 ? O TYR E 209 
AC6 5 6  O ALA E 224 ? O ALA E 204 N LEU E 181 ? N LEU E 161 
AC6 6 7  N ILE E 178 ? N ILE E 158 O HIS E 270 ? O HIS E 250 
AC7 1 2  N ILE E 157 ? N ILE E 137 O ARG E 288 ? O ARG E 268 
AC8 1 2  O ILE E 403 ? O ILE E 383 N LYS E 385 ? N LYS E 365 
AC8 2 3  O ILE E 386 ? O ILE E 366 N ARG E 368 ? N ARG E 348 
AC8 3 4  O ALA E 369 ? O ALA E 349 N SER E 354 ? N SER E 334 
AC8 4 5  O ILE E 353 ? O ILE E 333 N LYS E 330 ? N LYS E 310 
AC8 5 6  N PHE E 331 ? N PHE E 311 O SER F 345 ? O SER F 325 
AC8 6 7  N VAL F 346 ? N VAL F 326 O LEU F 363 ? O LEU F 343 
AC8 7 8  N LEU F 362 ? N LEU F 342 O VAL F 380 ? O VAL F 360 
AC8 8 9  N VAL F 379 ? N VAL F 359 O ILE F 397 ? O ILE F 377 
AC8 9 10 N GLN F 391 ? N GLN F 371 O VAL F 409 ? O VAL F 389 
AC9 1 2  N SER F 341 ? N SER F 321 O LEU F 358 ? O LEU F 338 
AC9 2 3  N ALA F 357 ? N ALA F 337 O LEU F 375 ? O LEU F 355 
AC9 3 4  N VAL F 379 ? N VAL F 359 O ILE F 397 ? O ILE F 377 
AC9 4 5  N VAL F 396 ? N VAL F 376 O ILE F 430 ? O ILE F 410 
AC9 5 6  O LEU F 429 ? O LEU F 409 N ARG F 421 ? N ARG F 401 
AD1 1 2  N VAL E 343 ? N VAL E 323 O LEU E 358 ? O LEU E 338 
AD1 2 3  N ALA E 357 ? N ALA E 337 O LEU E 375 ? O LEU E 355 
AD1 3 4  N VAL E 379 ? N VAL E 359 O VAL E 395 ? O VAL E 375 
AD1 4 5  N VAL E 396 ? N VAL E 376 O ILE E 430 ? O ILE E 410 
AD1 5 6  O LEU E 429 ? O LEU E 409 N ARG E 421 ? N ARG E 401 
AD2 1 2  O VAL E 409 ? O VAL E 389 N GLN E 391 ? N GLN E 371 
AD2 2 3  O VAL E 395 ? O VAL E 375 N VAL E 379 ? N VAL E 359 
AD2 3 4  O VAL E 380 ? O VAL E 360 N LEU E 362 ? N LEU E 342 
AD2 4 5  O LEU E 363 ? O LEU E 343 N VAL E 346 ? N VAL E 326 
AD2 5 6  N SER E 345 ? N SER E 325 O PHE F 331 ? O PHE F 311 
AD2 6 7  N LYS F 330 ? N LYS F 310 O ILE F 353 ? O ILE F 333 
AD2 7 8  N SER F 354 ? N SER F 334 O ALA F 369 ? O ALA F 349 
AD2 8 9  N ARG F 368 ? N ARG F 348 O ILE F 386 ? O ILE F 366 
AD2 9 10 N LYS F 385 ? N LYS F 365 O ILE F 403 ? O ILE F 383 
AD3 1 2  O LEU F 115 ? O LEU F 95  N VAL F 84  ? N VAL F 64  
AD3 2 3  O GLY F 83  ? O GLY F 63  N VAL F 37  ? N VAL F 17  
AD3 3 4  N LEU F 38  ? N LEU F 18  O LEU F 152 ? O LEU F 132 
AD3 4 5  N ILE F 151 ? N ILE F 131 O TYR F 229 ? O TYR F 209 
AD3 5 6  O SER F 225 ? O SER F 205 N GLY F 192 ? N GLY F 172 
AD3 6 7  N HIS F 195 ? N HIS F 175 O ASP F 204 ? O ASP F 184 
AD4 1 2  O LEU F 115 ? O LEU F 95  N VAL F 84  ? N VAL F 64  
AD4 2 3  O GLY F 83  ? O GLY F 63  N VAL F 37  ? N VAL F 17  
AD4 3 4  N LEU F 38  ? N LEU F 18  O LEU F 152 ? O LEU F 132 
AD4 4 5  N ILE F 151 ? N ILE F 131 O TYR F 229 ? O TYR F 209 
AD4 5 6  O ALA F 222 ? O ALA F 202 N VAL F 183 ? N VAL F 163 
AD4 6 7  N ILE F 178 ? N ILE F 158 O HIS F 270 ? O HIS F 250 
AD5 1 2  N PHE F 60  ? N PHE F 40  O ALA F 64  ? O ALA F 44  
AD6 1 2  N ILE F 157 ? N ILE F 137 O ARG F 288 ? O ARG F 268 
AD7 1 2  O LEU G 115 ? O LEU G 95  N VAL G 84  ? N VAL G 64  
AD7 2 3  O GLY G 83  ? O GLY G 63  N VAL G 37  ? N VAL G 17  
AD7 3 4  N TYR G 36  ? N TYR G 16  O VAL G 150 ? O VAL G 130 
AD7 4 5  N ILE G 151 ? N ILE G 131 O TYR G 229 ? O TYR G 209 
AD7 5 6  O SER G 225 ? O SER G 205 N GLY G 192 ? N GLY G 172 
AD7 6 7  N HIS G 195 ? N HIS G 175 O ASP G 204 ? O ASP G 184 
AD8 1 2  O LEU G 115 ? O LEU G 95  N VAL G 84  ? N VAL G 64  
AD8 2 3  O GLY G 83  ? O GLY G 63  N VAL G 37  ? N VAL G 17  
AD8 3 4  N TYR G 36  ? N TYR G 16  O VAL G 150 ? O VAL G 130 
AD8 4 5  N ILE G 151 ? N ILE G 131 O TYR G 229 ? O TYR G 209 
AD8 5 6  O ALA G 224 ? O ALA G 204 N LEU G 181 ? N LEU G 161 
AD8 6 7  N CYS G 180 ? N CYS G 160 O HIS G 270 ? O HIS G 250 
AD9 1 2  N ILE G 157 ? N ILE G 137 O ARG G 288 ? O ARG G 268 
AE1 1 2  O ILE G 403 ? O ILE G 383 N LYS G 385 ? N LYS G 365 
AE1 2 3  O ILE G 386 ? O ILE G 366 N ARG G 368 ? N ARG G 348 
AE1 3 4  O ALA G 369 ? O ALA G 349 N SER G 354 ? N SER G 334 
AE1 4 5  O ILE G 353 ? O ILE G 333 N LYS G 330 ? N LYS G 310 
AE1 5 6  N PHE G 331 ? N PHE G 311 O SER H 345 ? O SER H 325 
AE1 6 7  N VAL H 346 ? N VAL H 326 O LEU H 363 ? O LEU H 343 
AE1 7 8  N LEU H 362 ? N LEU H 342 O VAL H 380 ? O VAL H 360 
AE1 8 9  N VAL H 379 ? N VAL H 359 O ILE H 397 ? O ILE H 377 
AE1 9 10 N GLN H 391 ? N GLN H 371 O VAL H 409 ? O VAL H 389 
AE2 1 2  N SER H 341 ? N SER H 321 O LEU H 358 ? O LEU H 338 
AE2 2 3  N ALA H 357 ? N ALA H 337 O LEU H 375 ? O LEU H 355 
AE2 3 4  N VAL H 379 ? N VAL H 359 O ILE H 397 ? O ILE H 377 
AE2 4 5  N ASN H 394 ? N ASN H 374 O CYS H 428 ? O CYS H 408 
AE2 5 6  O LEU H 429 ? O LEU H 409 N ARG H 421 ? N ARG H 401 
AE3 1 2  N SER G 341 ? N SER G 321 O LEU G 358 ? O LEU G 338 
AE3 2 3  N ALA G 357 ? N ALA G 337 O LEU G 375 ? O LEU G 355 
AE3 3 4  N VAL G 379 ? N VAL G 359 O ILE G 397 ? O ILE G 377 
AE3 4 5  N VAL G 396 ? N VAL G 376 O ILE G 430 ? O ILE G 410 
AE3 5 6  O LEU G 429 ? O LEU G 409 N ARG G 421 ? N ARG G 401 
AE4 1 2  O VAL G 409 ? O VAL G 389 N GLN G 391 ? N GLN G 371 
AE4 2 3  O ILE G 397 ? O ILE G 377 N VAL G 379 ? N VAL G 359 
AE4 3 4  O VAL G 380 ? O VAL G 360 N LEU G 362 ? N LEU G 342 
AE4 4 5  O LEU G 363 ? O LEU G 343 N VAL G 346 ? N VAL G 326 
AE4 5 6  N SER G 345 ? N SER G 325 O PHE H 331 ? O PHE H 311 
AE4 6 7  N LYS H 330 ? N LYS H 310 O ILE H 353 ? O ILE H 333 
AE4 7 8  N SER H 354 ? N SER H 334 O ALA H 369 ? O ALA H 349 
AE4 8 9  N ARG H 368 ? N ARG H 348 O ILE H 386 ? O ILE H 366 
AE4 9 10 N LYS H 385 ? N LYS H 365 O ILE H 403 ? O ILE H 383 
AE5 1 2  O LEU H 115 ? O LEU H 95  N VAL H 84  ? N VAL H 64  
AE5 2 3  O GLY H 83  ? O GLY H 63  N VAL H 37  ? N VAL H 17  
AE5 3 4  N TYR H 36  ? N TYR H 16  O VAL H 150 ? O VAL H 130 
AE5 4 5  N ILE H 151 ? N ILE H 131 O TYR H 229 ? O TYR H 209 
AE5 5 6  O SER H 225 ? O SER H 205 N GLY H 192 ? N GLY H 172 
AE5 6 7  N HIS H 195 ? N HIS H 175 O ILE H 203 ? O ILE H 183 
AE6 1 2  O LEU H 115 ? O LEU H 95  N VAL H 84  ? N VAL H 64  
AE6 2 3  O GLY H 83  ? O GLY H 63  N VAL H 37  ? N VAL H 17  
AE6 3 4  N TYR H 36  ? N TYR H 16  O VAL H 150 ? O VAL H 130 
AE6 4 5  N ILE H 151 ? N ILE H 131 O TYR H 229 ? O TYR H 209 
AE6 5 6  O ALA H 222 ? O ALA H 202 N VAL H 183 ? N VAL H 163 
AE6 6 7  N ILE H 178 ? N ILE H 158 O HIS H 270 ? O HIS H 250 
AE7 1 2  N PHE H 60  ? N PHE H 40  O ALA H 64  ? O ALA H 44  
AE8 1 2  N ILE H 157 ? N ILE H 137 O ARG H 288 ? O ARG H 268 
AE9 1 2  O LEU I 115 ? O LEU I 95  N VAL I 84  ? N VAL I 64  
AE9 2 3  O GLY I 83  ? O GLY I 63  N VAL I 37  ? N VAL I 17  
AE9 3 4  N LEU I 38  ? N LEU I 18  O LEU I 152 ? O LEU I 132 
AE9 4 5  N ILE I 151 ? N ILE I 131 O TYR I 229 ? O TYR I 209 
AE9 5 6  O SER I 225 ? O SER I 205 N GLY I 192 ? N GLY I 172 
AE9 6 7  N HIS I 195 ? N HIS I 175 O ILE I 203 ? O ILE I 183 
AF1 1 2  O LEU I 115 ? O LEU I 95  N VAL I 84  ? N VAL I 64  
AF1 2 3  O GLY I 83  ? O GLY I 63  N VAL I 37  ? N VAL I 17  
AF1 3 4  N LEU I 38  ? N LEU I 18  O LEU I 152 ? O LEU I 132 
AF1 4 5  N ILE I 151 ? N ILE I 131 O TYR I 229 ? O TYR I 209 
AF1 5 6  O MET I 226 ? O MET I 206 N GLY I 179 ? N GLY I 159 
AF1 6 7  N ILE I 178 ? N ILE I 158 O HIS I 270 ? O HIS I 250 
AF2 1 2  N ILE I 157 ? N ILE I 137 O ARG I 288 ? O ARG I 268 
AF3 1 2  O ILE I 403 ? O ILE I 383 N LYS I 385 ? N LYS I 365 
AF3 2 3  O ILE I 386 ? O ILE I 366 N ARG I 368 ? N ARG I 348 
AF3 3 4  O ALA I 369 ? O ALA I 349 N SER I 354 ? N SER I 334 
AF3 4 5  O ILE I 353 ? O ILE I 333 N LYS I 330 ? N LYS I 310 
AF3 5 6  N PHE I 331 ? N PHE I 311 O SER J 345 ? O SER J 325 
AF3 6 7  N VAL J 346 ? N VAL J 326 O LEU J 363 ? O LEU J 343 
AF3 7 8  N LEU J 362 ? N LEU J 342 O VAL J 380 ? O VAL J 360 
AF3 8 9  N VAL J 379 ? N VAL J 359 O ILE J 397 ? O ILE J 377 
AF3 9 10 N GLN J 391 ? N GLN J 371 O VAL J 409 ? O VAL J 389 
AF4 1 2  N SER J 341 ? N SER J 321 O LEU J 358 ? O LEU J 338 
AF4 2 3  N ALA J 357 ? N ALA J 337 O LEU J 375 ? O LEU J 355 
AF4 3 4  N VAL J 379 ? N VAL J 359 O ILE J 397 ? O ILE J 377 
AF4 4 5  N VAL J 396 ? N VAL J 376 O ILE J 430 ? O ILE J 410 
AF4 5 6  O LEU J 429 ? O LEU J 409 N ARG J 421 ? N ARG J 401 
AF5 1 2  N SER I 341 ? N SER I 321 O LEU I 358 ? O LEU I 338 
AF5 2 3  N ALA I 357 ? N ALA I 337 O LEU I 375 ? O LEU I 355 
AF5 3 4  N VAL I 379 ? N VAL I 359 O VAL I 395 ? O VAL I 375 
AF5 4 5  N VAL I 396 ? N VAL I 376 O CYS I 428 ? O CYS I 408 
AF5 5 6  O LEU I 429 ? O LEU I 409 N ARG I 421 ? N ARG I 401 
AF6 1 2  O VAL I 409 ? O VAL I 389 N GLN I 391 ? N GLN I 371 
AF6 2 3  O VAL I 395 ? O VAL I 375 N VAL I 379 ? N VAL I 359 
AF6 3 4  O VAL I 380 ? O VAL I 360 N LEU I 362 ? N LEU I 342 
AF6 4 5  O LEU I 363 ? O LEU I 343 N VAL I 346 ? N VAL I 326 
AF6 5 6  N SER I 345 ? N SER I 325 O PHE J 331 ? O PHE J 311 
AF6 6 7  N LYS J 330 ? N LYS J 310 O ILE J 353 ? O ILE J 333 
AF6 7 8  N SER J 354 ? N SER J 334 O ALA J 369 ? O ALA J 349 
AF6 8 9  N ARG J 368 ? N ARG J 348 O ILE J 386 ? O ILE J 366 
AF6 9 10 N LYS J 385 ? N LYS J 365 O ILE J 403 ? O ILE J 383 
AF7 1 2  O LEU J 115 ? O LEU J 95  N VAL J 84  ? N VAL J 64  
AF7 2 3  O GLY J 83  ? O GLY J 63  N VAL J 37  ? N VAL J 17  
AF7 3 4  N LEU J 38  ? N LEU J 18  O LEU J 152 ? O LEU J 132 
AF7 4 5  N ILE J 151 ? N ILE J 131 O TYR J 229 ? O TYR J 209 
AF7 5 6  O SER J 225 ? O SER J 205 N GLY J 192 ? N GLY J 172 
AF7 6 7  N HIS J 195 ? N HIS J 175 O ASP J 204 ? O ASP J 184 
AF8 1 2  O LEU J 115 ? O LEU J 95  N VAL J 84  ? N VAL J 64  
AF8 2 3  O GLY J 83  ? O GLY J 63  N VAL J 37  ? N VAL J 17  
AF8 3 4  N LEU J 38  ? N LEU J 18  O LEU J 152 ? O LEU J 132 
AF8 4 5  N ILE J 151 ? N ILE J 131 O TYR J 229 ? O TYR J 209 
AF8 5 6  O ALA J 224 ? O ALA J 204 N LEU J 181 ? N LEU J 161 
AF8 6 7  N ILE J 178 ? N ILE J 158 O VAL J 268 ? O VAL J 248 
AF9 1 2  N ILE J 157 ? N ILE J 137 O ARG J 288 ? O ARG J 268 
AG1 1 2  O LEU K 115 ? O LEU K 95  N VAL K 84  ? N VAL K 64  
AG1 2 3  O GLY K 83  ? O GLY K 63  N VAL K 37  ? N VAL K 17  
AG1 3 4  N LEU K 38  ? N LEU K 18  O LEU K 152 ? O LEU K 132 
AG1 4 5  N ILE K 151 ? N ILE K 131 O TYR K 229 ? O TYR K 209 
AG1 5 6  O ALA K 222 ? O ALA K 202 N VAL K 183 ? N VAL K 163 
AG1 6 7  N ILE K 178 ? N ILE K 158 O HIS K 270 ? O HIS K 250 
AG2 1 2  N PHE K 60  ? N PHE K 40  O ALA K 64  ? O ALA K 44  
AG3 1 2  N ILE K 157 ? N ILE K 137 O ARG K 288 ? O ARG K 268 
AG4 1 2  N VAL K 193 ? N VAL K 173 O ILE K 206 ? O ILE K 186 
AG5 1 2  O ILE K 403 ? O ILE K 383 N LYS K 385 ? N LYS K 365 
AG5 2 3  O ILE K 386 ? O ILE K 366 N ARG K 368 ? N ARG K 348 
AG5 3 4  O ALA K 369 ? O ALA K 349 N SER K 354 ? N SER K 334 
AG5 4 5  O ILE K 353 ? O ILE K 333 N LYS K 330 ? N LYS K 310 
AG5 5 6  N PHE K 331 ? N PHE K 311 O SER L 345 ? O SER L 325 
AG5 6 7  N VAL L 346 ? N VAL L 326 O LEU L 363 ? O LEU L 343 
AG5 7 8  N LEU L 362 ? N LEU L 342 O VAL L 380 ? O VAL L 360 
AG5 8 9  N VAL L 379 ? N VAL L 359 O ILE L 397 ? O ILE L 377 
AG5 9 10 N GLN L 391 ? N GLN L 371 O VAL L 409 ? O VAL L 389 
AG6 1 2  N SER L 341 ? N SER L 321 O LEU L 358 ? O LEU L 338 
AG6 2 3  N ALA L 357 ? N ALA L 337 O LEU L 375 ? O LEU L 355 
AG6 3 4  N VAL L 379 ? N VAL L 359 O ILE L 397 ? O ILE L 377 
AG6 4 5  N VAL L 396 ? N VAL L 376 O ILE L 430 ? O ILE L 410 
AG6 5 6  O LEU L 429 ? O LEU L 409 N ARG L 421 ? N ARG L 401 
AG7 1 2  N VAL K 343 ? N VAL K 323 O LEU K 358 ? O LEU K 338 
AG7 2 3  N ALA K 357 ? N ALA K 337 O LEU K 375 ? O LEU K 355 
AG7 3 4  N VAL K 379 ? N VAL K 359 O ILE K 397 ? O ILE K 377 
AG7 4 5  N VAL K 396 ? N VAL K 376 O ILE K 430 ? O ILE K 410 
AG7 5 6  O LEU K 429 ? O LEU K 409 N ARG K 421 ? N ARG K 401 
AG8 1 2  O VAL K 409 ? O VAL K 389 N GLN K 391 ? N GLN K 371 
AG8 2 3  O ILE K 397 ? O ILE K 377 N VAL K 379 ? N VAL K 359 
AG8 3 4  O VAL K 380 ? O VAL K 360 N LEU K 362 ? N LEU K 342 
AG8 4 5  O LEU K 363 ? O LEU K 343 N VAL K 346 ? N VAL K 326 
AG8 5 6  N SER K 345 ? N SER K 325 O PHE L 331 ? O PHE L 311 
AG8 6 7  N LYS L 330 ? N LYS L 310 O ILE L 353 ? O ILE L 333 
AG8 7 8  N SER L 354 ? N SER L 334 O ALA L 369 ? O ALA L 349 
AG8 8 9  N ARG L 368 ? N ARG L 348 O ILE L 386 ? O ILE L 366 
AG8 9 10 N LYS L 385 ? N LYS L 365 O ILE L 403 ? O ILE L 383 
AG9 1 2  O LEU L 115 ? O LEU L 95  N VAL L 84  ? N VAL L 64  
AG9 2 3  O GLY L 83  ? O GLY L 63  N VAL L 37  ? N VAL L 17  
AG9 3 4  N TYR L 36  ? N TYR L 16  O VAL L 150 ? O VAL L 130 
AG9 4 5  N ILE L 151 ? N ILE L 131 O TYR L 229 ? O TYR L 209 
AG9 5 6  O SER L 225 ? O SER L 205 N GLY L 192 ? N GLY L 172 
AG9 6 7  N HIS L 195 ? N HIS L 175 O ASP L 204 ? O ASP L 184 
AH1 1 2  O LEU L 115 ? O LEU L 95  N VAL L 84  ? N VAL L 64  
AH1 2 3  O GLY L 83  ? O GLY L 63  N VAL L 37  ? N VAL L 17  
AH1 3 4  N TYR L 36  ? N TYR L 16  O VAL L 150 ? O VAL L 130 
AH1 4 5  N ILE L 151 ? N ILE L 131 O TYR L 229 ? O TYR L 209 
AH1 5 6  O ALA L 222 ? O ALA L 202 N VAL L 183 ? N VAL L 163 
AH1 6 7  N ILE L 178 ? N ILE L 158 O HIS L 270 ? O HIS L 250 
AH2 1 2  N PHE L 60  ? N PHE L 40  O ALA L 64  ? O ALA L 44  
AH3 1 2  N ILE L 157 ? N ILE L 137 O ARG L 288 ? O ARG L 268 
AH4 1 2  O LEU M 115 ? O LEU M 95  N VAL M 84  ? N VAL M 64  
AH4 2 3  O GLY M 83  ? O GLY M 63  N VAL M 37  ? N VAL M 17  
AH4 3 4  N LEU M 38  ? N LEU M 18  O LEU M 152 ? O LEU M 132 
AH4 4 5  N ILE M 151 ? N ILE M 131 O TYR M 229 ? O TYR M 209 
AH4 5 6  O SER M 225 ? O SER M 205 N GLY M 192 ? N GLY M 172 
AH4 6 7  N HIS M 195 ? N HIS M 175 O ASP M 204 ? O ASP M 184 
AH5 1 2  O LEU M 115 ? O LEU M 95  N VAL M 84  ? N VAL M 64  
AH5 2 3  O GLY M 83  ? O GLY M 63  N VAL M 37  ? N VAL M 17  
AH5 3 4  N LEU M 38  ? N LEU M 18  O LEU M 152 ? O LEU M 132 
AH5 4 5  N ILE M 151 ? N ILE M 131 O TYR M 229 ? O TYR M 209 
AH5 5 6  O ALA M 222 ? O ALA M 202 N VAL M 183 ? N VAL M 163 
AH5 6 7  N ILE M 178 ? N ILE M 158 O HIS M 270 ? O HIS M 250 
AH6 1 2  N PHE M 60  ? N PHE M 40  O ALA M 64  ? O ALA M 44  
AH7 1 2  N ILE M 157 ? N ILE M 137 O ARG M 288 ? O ARG M 268 
AH8 1 2  O ILE M 403 ? O ILE M 383 N LYS M 385 ? N LYS M 365 
AH8 2 3  O ILE M 386 ? O ILE M 366 N ARG M 368 ? N ARG M 348 
AH8 3 4  O ALA M 369 ? O ALA M 349 N SER M 354 ? N SER M 334 
AH8 4 5  O ILE M 353 ? O ILE M 333 N LYS M 330 ? N LYS M 310 
AH8 5 6  N PHE M 331 ? N PHE M 311 O SER N 345 ? O SER N 325 
AH8 6 7  N VAL N 346 ? N VAL N 326 O LEU N 363 ? O LEU N 343 
AH8 7 8  N LEU N 362 ? N LEU N 342 O VAL N 380 ? O VAL N 360 
AH8 8 9  N VAL N 379 ? N VAL N 359 O ILE N 397 ? O ILE N 377 
AH8 9 10 N GLN N 391 ? N GLN N 371 O VAL N 409 ? O VAL N 389 
AH9 1 2  N VAL N 343 ? N VAL N 323 O LEU N 358 ? O LEU N 338 
AH9 2 3  N ALA N 357 ? N ALA N 337 O LEU N 375 ? O LEU N 355 
AH9 3 4  N VAL N 379 ? N VAL N 359 O ILE N 397 ? O ILE N 377 
AH9 4 5  N VAL N 396 ? N VAL N 376 O ILE N 430 ? O ILE N 410 
AH9 5 6  O LEU N 429 ? O LEU N 409 N ARG N 421 ? N ARG N 401 
AI1 1 2  N SER M 341 ? N SER M 321 O LEU M 358 ? O LEU M 338 
AI1 2 3  N ALA M 357 ? N ALA M 337 O LEU M 375 ? O LEU M 355 
AI1 3 4  N VAL M 379 ? N VAL M 359 O ILE M 397 ? O ILE M 377 
AI1 4 5  N VAL M 396 ? N VAL M 376 O ILE M 430 ? O ILE M 410 
AI1 5 6  O LEU M 429 ? O LEU M 409 N ARG M 421 ? N ARG M 401 
AI2 1 2  O VAL M 409 ? O VAL M 389 N GLN M 391 ? N GLN M 371 
AI2 2 3  O ILE M 397 ? O ILE M 377 N VAL M 379 ? N VAL M 359 
AI2 3 4  O VAL M 380 ? O VAL M 360 N LEU M 362 ? N LEU M 342 
AI2 4 5  O LEU M 363 ? O LEU M 343 N VAL M 346 ? N VAL M 326 
AI2 5 6  N VAL M 347 ? N VAL M 327 O ALA N 329 ? O ALA N 309 
AI2 6 7  N LYS N 330 ? N LYS N 310 O ILE N 353 ? O ILE N 333 
AI2 7 8  N SER N 354 ? N SER N 334 O ALA N 369 ? O ALA N 349 
AI2 8 9  N ARG N 368 ? N ARG N 348 O ILE N 386 ? O ILE N 366 
AI2 9 10 N LYS N 385 ? N LYS N 365 O ILE N 403 ? O ILE N 383 
AI3 1 2  O LEU N 115 ? O LEU N 95  N VAL N 84  ? N VAL N 64  
AI3 2 3  O GLY N 83  ? O GLY N 63  N VAL N 37  ? N VAL N 17  
AI3 3 4  N LEU N 38  ? N LEU N 18  O LEU N 152 ? O LEU N 132 
AI3 4 5  N ILE N 151 ? N ILE N 131 O TYR N 229 ? O TYR N 209 
AI3 5 6  O SER N 225 ? O SER N 205 N GLY N 192 ? N GLY N 172 
AI3 6 7  N HIS N 195 ? N HIS N 175 O ASP N 204 ? O ASP N 184 
AI4 1 2  O LEU N 115 ? O LEU N 95  N VAL N 84  ? N VAL N 64  
AI4 2 3  O GLY N 83  ? O GLY N 63  N VAL N 37  ? N VAL N 17  
AI4 3 4  N LEU N 38  ? N LEU N 18  O LEU N 152 ? O LEU N 132 
AI4 4 5  N ILE N 151 ? N ILE N 131 O TYR N 229 ? O TYR N 209 
AI4 5 6  O ALA N 222 ? O ALA N 202 N VAL N 183 ? N VAL N 163 
AI4 6 7  N ILE N 178 ? N ILE N 158 O HIS N 270 ? O HIS N 250 
AI5 1 2  N ILE N 157 ? N ILE N 137 O ARG N 288 ? O ARG N 268 
AI6 1 2  O LEU O 115 ? O LEU O 95  N VAL O 84  ? N VAL O 64  
AI6 2 3  O GLY O 83  ? O GLY O 63  N VAL O 37  ? N VAL O 17  
AI6 3 4  N LEU O 38  ? N LEU O 18  O LEU O 152 ? O LEU O 132 
AI6 4 5  N ILE O 151 ? N ILE O 131 O TYR O 229 ? O TYR O 209 
AI6 5 6  O SER O 225 ? O SER O 205 N GLY O 192 ? N GLY O 172 
AI6 6 7  N HIS O 195 ? N HIS O 175 O ILE O 203 ? O ILE O 183 
AI7 1 2  O LEU O 115 ? O LEU O 95  N VAL O 84  ? N VAL O 64  
AI7 2 3  O GLY O 83  ? O GLY O 63  N VAL O 37  ? N VAL O 17  
AI7 3 4  N LEU O 38  ? N LEU O 18  O LEU O 152 ? O LEU O 132 
AI7 4 5  N ILE O 151 ? N ILE O 131 O TYR O 229 ? O TYR O 209 
AI7 5 6  O MET O 226 ? O MET O 206 N GLY O 179 ? N GLY O 159 
AI7 6 7  N ILE O 178 ? N ILE O 158 O HIS O 270 ? O HIS O 250 
AI8 1 2  N PHE O 60  ? N PHE O 40  O ALA O 64  ? O ALA O 44  
AI9 1 2  N ILE O 157 ? N ILE O 137 O ARG O 288 ? O ARG O 268 
AJ1 1 2  O ILE O 403 ? O ILE O 383 N LYS O 385 ? N LYS O 365 
AJ1 2 3  O ILE O 386 ? O ILE O 366 N ARG O 368 ? N ARG O 348 
AJ1 3 4  O ALA O 369 ? O ALA O 349 N SER O 354 ? N SER O 334 
AJ1 4 5  O ILE O 353 ? O ILE O 333 N LYS O 330 ? N LYS O 310 
AJ1 5 6  N PHE O 331 ? N PHE O 311 O SER P 345 ? O SER P 325 
AJ1 6 7  N VAL P 346 ? N VAL P 326 O LEU P 363 ? O LEU P 343 
AJ1 7 8  N LEU P 362 ? N LEU P 342 O VAL P 380 ? O VAL P 360 
AJ1 8 9  N VAL P 379 ? N VAL P 359 O ILE P 397 ? O ILE P 377 
AJ1 9 10 N GLN P 391 ? N GLN P 371 O VAL P 409 ? O VAL P 389 
AJ2 1 2  N SER P 341 ? N SER P 321 O LEU P 358 ? O LEU P 338 
AJ2 2 3  N ALA P 357 ? N ALA P 337 O LEU P 375 ? O LEU P 355 
AJ2 3 4  N VAL P 379 ? N VAL P 359 O ILE P 397 ? O ILE P 377 
AJ2 4 5  N VAL P 396 ? N VAL P 376 O CYS P 428 ? O CYS P 408 
AJ2 5 6  O LEU P 429 ? O LEU P 409 N ARG P 421 ? N ARG P 401 
AJ3 1 2  N SER O 341 ? N SER O 321 O LEU O 358 ? O LEU O 338 
AJ3 2 3  N LEU O 362 ? N LEU O 342 O VAL O 380 ? O VAL O 360 
AJ3 3 4  N VAL O 379 ? N VAL O 359 O ILE O 397 ? O ILE O 377 
AJ3 4 5  N VAL O 396 ? N VAL O 376 O ILE O 430 ? O ILE O 410 
AJ3 5 6  O LEU O 429 ? O LEU O 409 N ARG O 421 ? N ARG O 401 
AJ4 1 2  O VAL O 409 ? O VAL O 389 N GLN O 391 ? N GLN O 371 
AJ4 2 3  O ILE O 397 ? O ILE O 377 N VAL O 379 ? N VAL O 359 
AJ4 3 4  O VAL O 380 ? O VAL O 360 N LEU O 362 ? N LEU O 342 
AJ4 4 5  O LEU O 363 ? O LEU O 343 N VAL O 346 ? N VAL O 326 
AJ4 5 6  N SER O 345 ? N SER O 325 O PHE P 331 ? O PHE P 311 
AJ4 6 7  N LYS P 330 ? N LYS P 310 O ILE P 353 ? O ILE P 333 
AJ4 7 8  N SER P 354 ? N SER P 334 O ALA P 369 ? O ALA P 349 
AJ4 8 9  N ARG P 368 ? N ARG P 348 O ILE P 386 ? O ILE P 366 
AJ4 9 10 N LYS P 385 ? N LYS P 365 O ILE P 403 ? O ILE P 383 
AJ5 1 2  O LEU P 115 ? O LEU P 95  N VAL P 84  ? N VAL P 64  
AJ5 2 3  O GLY P 83  ? O GLY P 63  N VAL P 37  ? N VAL P 17  
AJ5 3 4  N LEU P 38  ? N LEU P 18  O LEU P 152 ? O LEU P 132 
AJ5 4 5  N ILE P 151 ? N ILE P 131 O TYR P 229 ? O TYR P 209 
AJ5 5 6  O SER P 225 ? O SER P 205 N GLY P 192 ? N GLY P 172 
AJ5 6 7  N HIS P 195 ? N HIS P 175 O ASP P 204 ? O ASP P 184 
AJ6 1 2  O LEU P 115 ? O LEU P 95  N VAL P 84  ? N VAL P 64  
AJ6 2 3  O GLY P 83  ? O GLY P 63  N VAL P 37  ? N VAL P 17  
AJ6 3 4  N LEU P 38  ? N LEU P 18  O LEU P 152 ? O LEU P 132 
AJ6 4 5  N ILE P 151 ? N ILE P 131 O TYR P 229 ? O TYR P 209 
AJ6 5 6  O MET P 226 ? O MET P 206 N GLY P 179 ? N GLY P 159 
AJ6 6 7  N ILE P 178 ? N ILE P 158 O HIS P 270 ? O HIS P 250 
AJ7 1 2  N ILE P 157 ? N ILE P 137 O ARG P 288 ? O ARG P 268 
AJ8 1 2  O LEU Q 115 ? O LEU Q 95  N VAL Q 84  ? N VAL Q 64  
AJ8 2 3  O GLY Q 83  ? O GLY Q 63  N VAL Q 37  ? N VAL Q 17  
AJ8 3 4  N LEU Q 38  ? N LEU Q 18  O LEU Q 152 ? O LEU Q 132 
AJ8 4 5  N ILE Q 151 ? N ILE Q 131 O TYR Q 229 ? O TYR Q 209 
AJ8 5 6  O SER Q 225 ? O SER Q 205 N GLY Q 192 ? N GLY Q 172 
AJ8 6 7  N VAL Q 193 ? N VAL Q 173 O ILE Q 206 ? O ILE Q 186 
AJ9 1 2  O LEU Q 115 ? O LEU Q 95  N VAL Q 84  ? N VAL Q 64  
AJ9 2 3  O GLY Q 83  ? O GLY Q 63  N VAL Q 37  ? N VAL Q 17  
AJ9 3 4  N LEU Q 38  ? N LEU Q 18  O LEU Q 152 ? O LEU Q 132 
AJ9 4 5  N ILE Q 151 ? N ILE Q 131 O TYR Q 229 ? O TYR Q 209 
AJ9 5 6  O ALA Q 224 ? O ALA Q 204 N LEU Q 181 ? N LEU Q 161 
AJ9 6 7  N CYS Q 180 ? N CYS Q 160 O HIS Q 270 ? O HIS Q 250 
AK1 1 2  N PHE Q 60  ? N PHE Q 40  O ALA Q 64  ? O ALA Q 44  
AK2 1 2  N ILE Q 157 ? N ILE Q 137 O ARG Q 288 ? O ARG Q 268 
AK3 1 2  O ILE Q 403 ? O ILE Q 383 N LYS Q 385 ? N LYS Q 365 
AK3 2 3  O ILE Q 386 ? O ILE Q 366 N ARG Q 368 ? N ARG Q 348 
AK3 3 4  O ALA Q 369 ? O ALA Q 349 N SER Q 354 ? N SER Q 334 
AK3 4 5  O ILE Q 353 ? O ILE Q 333 N LYS Q 330 ? N LYS Q 310 
AK3 5 6  N PHE Q 331 ? N PHE Q 311 O SER R 345 ? O SER R 325 
AK3 6 7  N VAL R 346 ? N VAL R 326 O LEU R 363 ? O LEU R 343 
AK3 7 8  N LEU R 362 ? N LEU R 342 O ALA R 378 ? O ALA R 358 
AK3 8 9  N VAL R 379 ? N VAL R 359 O ILE R 397 ? O ILE R 377 
AK3 9 10 N GLN R 391 ? N GLN R 371 O VAL R 409 ? O VAL R 389 
AK4 1 2  N SER R 341 ? N SER R 321 O LEU R 358 ? O LEU R 338 
AK4 2 3  N ALA R 357 ? N ALA R 337 O LEU R 375 ? O LEU R 355 
AK4 3 4  N VAL R 379 ? N VAL R 359 O ILE R 397 ? O ILE R 377 
AK4 4 5  N VAL R 396 ? N VAL R 376 O CYS R 428 ? O CYS R 408 
AK4 5 6  O LEU R 429 ? O LEU R 409 N ARG R 421 ? N ARG R 401 
AK5 1 2  N SER Q 341 ? N SER Q 321 O LEU Q 358 ? O LEU Q 338 
AK5 2 3  N ALA Q 357 ? N ALA Q 337 O LEU Q 375 ? O LEU Q 355 
AK5 3 4  N VAL Q 379 ? N VAL Q 359 O ILE Q 397 ? O ILE Q 377 
AK5 4 5  N VAL Q 396 ? N VAL Q 376 O ILE Q 430 ? O ILE Q 410 
AK5 5 6  O LEU Q 429 ? O LEU Q 409 N ARG Q 421 ? N ARG Q 401 
AK6 1 2  O VAL Q 409 ? O VAL Q 389 N GLN Q 391 ? N GLN Q 371 
AK6 2 3  O ILE Q 397 ? O ILE Q 377 N VAL Q 379 ? N VAL Q 359 
AK6 3 4  O VAL Q 380 ? O VAL Q 360 N LEU Q 362 ? N LEU Q 342 
AK6 4 5  O LEU Q 363 ? O LEU Q 343 N VAL Q 346 ? N VAL Q 326 
AK6 5 6  N SER Q 345 ? N SER Q 325 O PHE R 331 ? O PHE R 311 
AK6 6 7  N LYS R 330 ? N LYS R 310 O ILE R 353 ? O ILE R 333 
AK6 7 8  N SER R 354 ? N SER R 334 O ALA R 369 ? O ALA R 349 
AK6 8 9  N ARG R 368 ? N ARG R 348 O ILE R 386 ? O ILE R 366 
AK6 9 10 N LYS R 385 ? N LYS R 365 O ILE R 403 ? O ILE R 383 
AK7 1 2  O LEU R 115 ? O LEU R 95  N VAL R 84  ? N VAL R 64  
AK7 2 3  O GLY R 83  ? O GLY R 63  N VAL R 37  ? N VAL R 17  
AK7 3 4  N LEU R 38  ? N LEU R 18  O LEU R 152 ? O LEU R 132 
AK7 4 5  N ILE R 151 ? N ILE R 131 O TYR R 229 ? O TYR R 209 
AK7 5 6  O SER R 225 ? O SER R 205 N GLY R 192 ? N GLY R 172 
AK7 6 7  N VAL R 193 ? N VAL R 173 O ILE R 206 ? O ILE R 186 
AK8 1 2  O LEU R 115 ? O LEU R 95  N VAL R 84  ? N VAL R 64  
AK8 2 3  O GLY R 83  ? O GLY R 63  N VAL R 37  ? N VAL R 17  
AK8 3 4  N LEU R 38  ? N LEU R 18  O LEU R 152 ? O LEU R 132 
AK8 4 5  N ILE R 151 ? N ILE R 131 O TYR R 229 ? O TYR R 209 
AK8 5 6  O ALA R 224 ? O ALA R 204 N LEU R 181 ? N LEU R 161 
AK8 6 7  N ILE R 178 ? N ILE R 158 O HIS R 270 ? O HIS R 250 
AK9 1 2  N ILE R 157 ? N ILE R 137 O ARG R 288 ? O ARG R 268 
AL1 1 2  O LEU S 115 ? O LEU W 95  N VAL S 84  ? N VAL W 64  
AL1 2 3  O GLY S 83  ? O GLY W 63  N VAL S 37  ? N VAL W 17  
AL1 3 4  N LEU S 38  ? N LEU W 18  O LEU S 152 ? O LEU W 132 
AL1 4 5  N ILE S 151 ? N ILE W 131 O TYR S 229 ? O TYR W 209 
AL1 5 6  O SER S 225 ? O SER W 205 N GLY S 192 ? N GLY W 172 
AL1 6 7  N HIS S 195 ? N HIS W 175 O ILE S 203 ? O ILE W 183 
AL2 1 2  O LEU S 115 ? O LEU W 95  N VAL S 84  ? N VAL W 64  
AL2 2 3  O GLY S 83  ? O GLY W 63  N VAL S 37  ? N VAL W 17  
AL2 3 4  N LEU S 38  ? N LEU W 18  O LEU S 152 ? O LEU W 132 
AL2 4 5  N ILE S 151 ? N ILE W 131 O TYR S 229 ? O TYR W 209 
AL2 5 6  O MET S 226 ? O MET W 206 N GLY S 179 ? N GLY W 159 
AL2 6 7  N ILE S 178 ? N ILE W 158 O HIS S 270 ? O HIS W 250 
AL3 1 2  N PHE S 60  ? N PHE W 40  O ALA S 64  ? O ALA W 44  
AL4 1 2  N ILE S 157 ? N ILE W 137 O ARG S 288 ? O ARG W 268 
AL5 1 2  O ILE S 403 ? O ILE W 383 N LYS S 385 ? N LYS W 365 
AL5 2 3  O ILE S 386 ? O ILE W 366 N ARG S 368 ? N ARG W 348 
AL5 3 4  O ALA S 369 ? O ALA W 349 N SER S 354 ? N SER W 334 
AL5 4 5  O ILE S 353 ? O ILE W 333 N LYS S 330 ? N LYS W 310 
AL5 5 6  N PHE S 331 ? N PHE W 311 O SER T 345 ? O SER T 325 
AL5 6 7  N VAL T 346 ? N VAL T 326 O LEU T 363 ? O LEU T 343 
AL5 7 8  N LEU T 362 ? N LEU T 342 O VAL T 380 ? O VAL T 360 
AL5 8 9  N VAL T 379 ? N VAL T 359 O ILE T 397 ? O ILE T 377 
AL5 9 10 N GLN T 391 ? N GLN T 371 O VAL T 409 ? O VAL T 389 
AL6 1 2  N SER T 341 ? N SER T 321 O LEU T 358 ? O LEU T 338 
AL6 2 3  N ALA T 357 ? N ALA T 337 O LEU T 375 ? O LEU T 355 
AL6 3 4  N VAL T 379 ? N VAL T 359 O ILE T 397 ? O ILE T 377 
AL6 4 5  N VAL T 396 ? N VAL T 376 O CYS T 428 ? O CYS T 408 
AL6 5 6  O LEU T 429 ? O LEU T 409 N ARG T 421 ? N ARG T 401 
AL7 1 2  N SER S 341 ? N SER W 321 O LEU S 358 ? O LEU W 338 
AL7 2 3  N LEU S 362 ? N LEU W 342 O VAL S 380 ? O VAL W 360 
AL7 3 4  N VAL S 379 ? N VAL W 359 O ILE S 397 ? O ILE W 377 
AL7 4 5  N VAL S 396 ? N VAL W 376 O ILE S 430 ? O ILE W 410 
AL7 5 6  O LEU S 429 ? O LEU W 409 N ARG S 421 ? N ARG W 401 
AL8 1 2  O VAL S 409 ? O VAL W 389 N GLN S 391 ? N GLN W 371 
AL8 2 3  O ILE S 397 ? O ILE W 377 N VAL S 379 ? N VAL W 359 
AL8 3 4  O VAL S 380 ? O VAL W 360 N LEU S 362 ? N LEU W 342 
AL8 4 5  O LEU S 363 ? O LEU W 343 N VAL S 346 ? N VAL W 326 
AL8 5 6  N SER S 345 ? N SER W 325 O PHE T 331 ? O PHE T 311 
AL8 6 7  N LYS T 330 ? N LYS T 310 O ILE T 353 ? O ILE T 333 
AL8 7 8  N SER T 354 ? N SER T 334 O ALA T 369 ? O ALA T 349 
AL8 8 9  N ARG T 368 ? N ARG T 348 O ILE T 386 ? O ILE T 366 
AL8 9 10 N LYS T 385 ? N LYS T 365 O ILE T 403 ? O ILE T 383 
AL9 1 2  O LEU T 115 ? O LEU T 95  N VAL T 84  ? N VAL T 64  
AL9 2 3  O GLY T 83  ? O GLY T 63  N VAL T 37  ? N VAL T 17  
AL9 3 4  N LEU T 38  ? N LEU T 18  O LEU T 152 ? O LEU T 132 
AL9 4 5  N ILE T 151 ? N ILE T 131 O TYR T 229 ? O TYR T 209 
AL9 5 6  O ALA T 224 ? O ALA T 204 N LEU T 181 ? N LEU T 161 
AL9 6 7  N ILE T 178 ? N ILE T 158 O HIS T 270 ? O HIS T 250 
AM1 1 2  N PHE T 60  ? N PHE T 40  O ALA T 64  ? O ALA T 44  
AM2 1 2  N ILE T 157 ? N ILE T 137 O ARG T 288 ? O ARG T 268 
AM3 1 2  N VAL T 193 ? N VAL T 173 O ILE T 206 ? O ILE T 186 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 501  ? 6  'binding site for residue SO4 A 501'                   
AC2 Software A SO4 502  ? 5  'binding site for residue SO4 A 502'                   
AC3 Software A SO4 503  ? 2  'binding site for residue SO4 A 503'                   
AC4 Software A SO4 504  ? 6  'binding site for residue SO4 A 504'                   
AC5 Software A SO4 505  ? 5  'binding site for residue SO4 A 505'                   
AC6 Software A SO4 506  ? 1  'binding site for residue SO4 A 506'                   
AC7 Software B SO4 1201 ? 7  'binding site for residue SO4 B 1201'                  
AC8 Software B SO4 1202 ? 5  'binding site for residue SO4 B 1202'                  
AC9 Software B SO4 1203 ? 6  'binding site for residue SO4 B 1203'                  
AD1 Software B SO4 1204 ? 6  'binding site for residue SO4 B 1204'                  
AD2 Software B SO4 1205 ? 2  'binding site for residue SO4 B 1205'                  
AD3 Software B SO4 1206 ? 5  'binding site for residue SO4 B 1206'                  
AD4 Software B SO4 1207 ? 3  'binding site for residue SO4 B 1207'                  
AD5 Software C SO4 501  ? 6  'binding site for residue SO4 C 501'                   
AD6 Software C SO4 502  ? 6  'binding site for residue SO4 C 502'                   
AD7 Software C SO4 503  ? 1  'binding site for residue SO4 C 503'                   
AD8 Software C SO4 504  ? 3  'binding site for residue SO4 C 504'                   
AD9 Software C SO4 505  ? 5  'binding site for residue SO4 C 505'                   
AE1 Software C SO4 506  ? 3  'binding site for residue SO4 C 506'                   
AE2 Software C SO4 507  ? 6  'binding site for residue SO4 C 507'                   
AE3 Software C SO4 508  ? 4  'binding site for residue SO4 C 508'                   
AE4 Software D SO4 501  ? 6  'binding site for residue SO4 D 501'                   
AE5 Software D SO4 502  ? 3  'binding site for residue SO4 D 502'                   
AE6 Software D SO4 503  ? 3  'binding site for residue SO4 D 503'                   
AE7 Software D SO4 504  ? 5  'binding site for residue SO4 D 504'                   
AE8 Software D SO4 505  ? 3  'binding site for residue SO4 D 505'                   
AE9 Software D SO4 506  ? 2  'binding site for residue SO4 D 506'                   
AF1 Software E SO4 501  ? 4  'binding site for residue SO4 E 501'                   
AF2 Software E SO4 502  ? 5  'binding site for residue SO4 E 502'                   
AF3 Software E SO4 503  ? 4  'binding site for residue SO4 E 503'                   
AF4 Software E SO4 504  ? 6  'binding site for residue SO4 E 504'                   
AF5 Software E SO4 505  ? 10 'binding site for residue SO4 E 505'                   
AF6 Software E SO4 506  ? 3  'binding site for residue SO4 E 506'                   
AF7 Software E SO4 507  ? 2  'binding site for residue SO4 E 507'                   
AF8 Software F SO4 501  ? 4  'binding site for residue SO4 F 501'                   
AF9 Software F SO4 503  ? 5  'binding site for residue SO4 F 503'                   
AG1 Software F SO4 504  ? 5  'binding site for residue SO4 F 504'                   
AG2 Software F SO4 505  ? 5  'binding site for residue SO4 F 505'                   
AG3 Software F SO4 506  ? 4  'binding site for residue SO4 F 506'                   
AG4 Software F SO4 507  ? 4  'binding site for residue SO4 F 507'                   
AG5 Software G SO4 501  ? 4  'binding site for residue SO4 G 501'                   
AG6 Software G SO4 503  ? 4  'binding site for residue SO4 G 503'                   
AG7 Software G SO4 504  ? 3  'binding site for residue SO4 G 504'                   
AG8 Software G SO4 505  ? 5  'binding site for residue SO4 G 505'                   
AG9 Software G SO4 506  ? 3  'binding site for residue SO4 G 506'                   
AH1 Software H SO4 501  ? 5  'binding site for residue SO4 H 501'                   
AH2 Software H SO4 502  ? 3  'binding site for residue SO4 H 502'                   
AH3 Software H SO4 503  ? 2  'binding site for residue SO4 H 503'                   
AH4 Software H SO4 504  ? 4  'binding site for residue SO4 H 504'                   
AH5 Software H SO4 505  ? 6  'binding site for residue SO4 H 505'                   
AH6 Software I SO4 501  ? 6  'binding site for residue SO4 I 501'                   
AH7 Software I SO4 502  ? 2  'binding site for residue SO4 I 502'                   
AH8 Software I SO4 503  ? 4  'binding site for residue SO4 I 503'                   
AH9 Software I SO4 504  ? 4  'binding site for residue SO4 I 504'                   
AI1 Software I SO4 505  ? 5  'binding site for residue SO4 I 505'                   
AI2 Software I SO4 506  ? 1  'binding site for residue SO4 I 506'                   
AI3 Software I SO4 507  ? 2  'binding site for residue SO4 I 507'                   
AI4 Software J SO4 501  ? 7  'binding site for residue SO4 J 501'                   
AI5 Software J SO4 502  ? 5  'binding site for residue SO4 J 502'                   
AI6 Software J SO4 503  ? 3  'binding site for residue SO4 J 503'                   
AI7 Software J SO4 504  ? 2  'binding site for residue SO4 J 504'                   
AI8 Software J SO4 505  ? 5  'binding site for residue SO4 J 505'                   
AI9 Software J SO4 506  ? 4  'binding site for residue SO4 J 506'                   
AJ1 Software J SO4 507  ? 5  'binding site for residue SO4 J 507'                   
AJ2 Software K SO4 501  ? 5  'binding site for residue SO4 K 501'                   
AJ3 Software K SO4 502  ? 5  'binding site for residue SO4 K 502'                   
AJ4 Software K SO4 503  ? 2  'binding site for residue SO4 K 503'                   
AJ5 Software L SO4 501  ? 5  'binding site for residue SO4 L 501'                   
AJ6 Software L SO4 502  ? 3  'binding site for residue SO4 L 502'                   
AJ7 Software L SO4 503  ? 4  'binding site for residue SO4 L 503'                   
AJ8 Software L SO4 504  ? 4  'binding site for residue SO4 L 504'                   
AJ9 Software L SO4 505  ? 1  'binding site for residue SO4 L 505'                   
AK1 Software L SO4 506  ? 4  'binding site for residue SO4 L 506'                   
AK2 Software M SO4 501  ? 5  'binding site for residue SO4 M 501'                   
AK3 Software M SO4 502  ? 6  'binding site for residue SO4 M 502'                   
AK4 Software M SO4 503  ? 3  'binding site for residue SO4 M 503'                   
AK5 Software M SO4 504  ? 2  'binding site for residue SO4 M 504'                   
AK6 Software N SO4 501  ? 4  'binding site for residue SO4 N 501'                   
AK7 Software N SO4 503  ? 4  'binding site for residue SO4 N 503'                   
AK8 Software N SO4 504  ? 5  'binding site for residue SO4 N 504'                   
AK9 Software N SO4 505  ? 5  'binding site for residue SO4 N 505'                   
AL1 Software N SO4 506  ? 2  'binding site for residue SO4 N 506'                   
AL2 Software O SO4 501  ? 5  'binding site for residue SO4 O 501'                   
AL3 Software O SO4 502  ? 5  'binding site for residue SO4 O 502'                   
AL4 Software O SO4 503  ? 3  'binding site for residue SO4 O 503'                   
AL5 Software O SO4 504  ? 5  'binding site for residue SO4 O 504'                   
AL6 Software O SO4 505  ? 5  'binding site for residue SO4 O 505'                   
AL7 Software O SO4 507  ? 2  'binding site for residue SO4 O 507'                   
AL8 Software P SO4 1101 ? 9  'binding site for residue SO4 P 1101'                  
AL9 Software P SO4 1102 ? 6  'binding site for residue SO4 P 1102'                  
AM1 Software P SO4 1103 ? 2  'binding site for residue SO4 P 1103'                  
AM2 Software P SO4 1104 ? 4  'binding site for residue SO4 P 1104'                  
AM3 Software P SO4 1105 ? 6  'binding site for residue SO4 P 1105'                  
AM4 Software P SO4 1106 ? 7  'binding site for residue SO4 P 1106'                  
AM5 Software P SO4 1107 ? 5  'binding site for residue SO4 P 1107'                  
AM6 Software P SO4 1108 ? 4  'binding site for residue SO4 P 1108'                  
AM7 Software P SO4 1110 ? 6  'binding site for residue SO4 P 1110'                  
AM8 Software Q SO4 501  ? 5  'binding site for residue SO4 Q 501'                   
AM9 Software Q SO4 502  ? 6  'binding site for residue SO4 Q 502'                   
AN1 Software Q SO4 503  ? 3  'binding site for residue SO4 Q 503'                   
AN2 Software Q SO4 504  ? 2  'binding site for residue SO4 Q 504'                   
AN3 Software Q SO4 505  ? 4  'binding site for residue SO4 Q 505'                   
AN4 Software Q SO4 506  ? 4  'binding site for residue SO4 Q 506'                   
AN5 Software Q SO4 507  ? 1  'binding site for residue SO4 Q 507'                   
AN6 Software R SO4 501  ? 6  'binding site for residue SO4 R 501'                   
AN7 Software R SO4 502  ? 7  'binding site for residue SO4 R 502'                   
AN8 Software R SO4 503  ? 2  'binding site for residue SO4 R 503'                   
AN9 Software R SO4 504  ? 3  'binding site for residue SO4 R 504'                   
AO1 Software R SO4 505  ? 3  'binding site for residue SO4 R 505'                   
AO2 Software R SO4 507  ? 1  'binding site for residue SO4 R 507'                   
AO3 Software W SO4 501  ? 5  'binding site for residue SO4 W 501'                   
AO4 Software W SO4 502  ? 3  'binding site for residue SO4 W 502'                   
AO5 Software W SO4 503  ? 4  'binding site for residue SO4 W 503'                   
AO6 Software W SO4 504  ? 7  'binding site for residue SO4 W 504'                   
AO7 Software W SO4 505  ? 5  'binding site for residue SO4 W 505'                   
AO8 Software T SO4 501  ? 7  'binding site for residue SO4 T 501'                   
AO9 Software T SO4 502  ? 2  'binding site for residue SO4 T 502'                   
AP1 Software T SO4 503  ? 5  'binding site for residue SO4 T 503'                   
AP2 Software T SO4 504  ? 3  'binding site for residue SO4 T 504'                   
AP3 Software T SO4 505  ? 5  'binding site for residue SO4 T 505'                   
AP4 Software T SO4 506  ? 4  'binding site for residue SO4 T 506'                   
AP5 Software T SO4 507  ? 2  'binding site for residue SO4 T 507'                   
AP6 Software C SO4 509  ? 10 'binding site for Di-peptide SO4 C 509 and ARG C 79'   
AP7 Software C SO4 509  ? 10 'binding site for Di-peptide SO4 C 509 and ARG C 79'   
AP8 Software C SO4 509  ? 10 'binding site for Di-peptide SO4 C 509 and ARG C 79'   
AP9 Software F SO4 502  ? 7  'binding site for Di-peptide SO4 F 502 and ARG F 401'  
AQ1 Software F SO4 502  ? 7  'binding site for Di-peptide SO4 F 502 and ARG F 401'  
AQ2 Software F SO4 502  ? 7  'binding site for Di-peptide SO4 F 502 and ARG F 401'  
AQ3 Software G SO4 502  ? 10 'binding site for Di-peptide SO4 G 502 and LYS G 27'   
AQ4 Software G SO4 507  ? 11 'binding site for Di-peptide SO4 G 507 and LYS G 43'   
AQ5 Software J SO4 508  ? 9  'binding site for Di-peptide SO4 J 508 and THR J 411'  
AQ6 Software K SO4 504  ? 6  'binding site for Di-peptide SO4 K 504 and VAL K 286'  
AQ7 Software K SO4 505  ? 10 'binding site for Di-peptide SO4 K 505 and ARG K 251'  
AQ8 Software K SO4 506  ? 10 'binding site for Di-peptide SO4 K 506 and ARG K 368'  
AQ9 Software N SO4 502  ? 7  'binding site for Di-peptide SO4 N 502 and ARG N 401'  
AR1 Software O SO4 506  ? 18 'binding site for Di-peptide SO4 O 506 and ARG G 60'   
AR2 Software O SO4 506  ? 18 'binding site for Di-peptide SO4 O 506 and ARG G 60'   
AR3 Software O SO4 506  ? 18 'binding site for Di-peptide SO4 O 506 and ARG G 60'   
AR4 Software O SO4 506  ? 8  'binding site for Di-peptide SO4 O 506 and ARG O 60'   
AR5 Software P SO4 1109 ? 12 'binding site for Di-peptide SO4 P 1109 and GLN P 412' 
AR6 Software Q SO4 508  ? 7  'binding site for Di-peptide SO4 Q 508 and SER Q 413'  
AR7 Software R SO4 506  ? 11 'binding site for Di-peptide SO4 R 506 and ARG R 251'  
AR8 Software T SO4 508  ? 13 'binding site for Di-peptide SO4 T 508 and ARG T 79'   
AR9 Software T SO4 508  ? 13 'binding site for Di-peptide SO4 T 508 and ARG T 79'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  SER A  354 ? SER A 334  . ? 1_555 ? 
2   AC1 6  ASN A  370 ? ASN A 350  . ? 1_555 ? 
3   AC1 6  SER A  371 ? SER A 351  . ? 1_555 ? 
4   AC1 6  ARG A  388 ? ARG A 368  . ? 1_555 ? 
5   AC1 6  HOH AF .   ? HOH A 616  . ? 1_555 ? 
6   AC1 6  HOH AF .   ? HOH A 626  . ? 1_555 ? 
7   AC2 5  THR A  130 ? THR A 110  . ? 1_555 ? 
8   AC2 5  TYR A  229 ? TYR A 209  . ? 1_555 ? 
9   AC2 5  GLY A  254 ? GLY A 234  . ? 1_555 ? 
10  AC2 5  HOH AF .   ? HOH A 673  . ? 1_555 ? 
11  AC2 5  HOH AF .   ? HOH A 684  . ? 1_555 ? 
12  AC3 2  ARG A  338 ? ARG A 318  . ? 1_555 ? 
13  AC3 2  ARG A  388 ? ARG A 368  . ? 1_555 ? 
14  AC4 6  ARG A  288 ? ARG A 268  . ? 1_555 ? 
15  AC4 6  ASP A  289 ? ASP A 269  . ? 1_555 ? 
16  AC4 6  VAL A  290 ? VAL A 270  . ? 1_555 ? 
17  AC4 6  ALA A  295 ? ALA A 275  . ? 1_555 ? 
18  AC4 6  HOH AF .   ? HOH A 613  . ? 1_555 ? 
19  AC4 6  HOH AF .   ? HOH A 646  . ? 1_555 ? 
20  AC5 5  ASP A  305 ? ASP A 285  . ? 1_555 ? 
21  AC5 5  VAL A  306 ? VAL A 286  . ? 1_555 ? 
22  AC5 5  ARG A  360 ? ARG A 340  . ? 1_555 ? 
23  AC5 5  HOH AF .   ? HOH A 602  . ? 1_555 ? 
24  AC5 5  HOH AF .   ? HOH A 634  . ? 1_555 ? 
25  AC6 1  ARG A  421 ? ARG A 401  . ? 1_555 ? 
26  AC7 7  VAL A  332 ? VAL A 312  . ? 1_555 ? 
27  AC7 7  HIS A  333 ? HIS A 313  . ? 1_555 ? 
28  AC7 7  THR B  304 ? THR B 284  . ? 1_555 ? 
29  AC7 7  VAL B  306 ? VAL B 286  . ? 1_555 ? 
30  AC7 7  SER B  344 ? SER B 324  . ? 1_555 ? 
31  AC7 7  ARG B  360 ? ARG B 340  . ? 1_555 ? 
32  AC7 7  SO4 FA .   ? SO4 B 1206 . ? 1_555 ? 
33  AC8 5  SER B  354 ? SER B 334  . ? 1_555 ? 
34  AC8 5  ASN B  370 ? ASN B 350  . ? 1_555 ? 
35  AC8 5  SER B  371 ? SER B 351  . ? 1_555 ? 
36  AC8 5  ARG B  388 ? ARG B 368  . ? 1_555 ? 
37  AC8 5  HOH BF .   ? HOH B 1334 . ? 1_555 ? 
38  AC9 6  THR B  130 ? THR B 110  . ? 1_555 ? 
39  AC9 6  TYR B  229 ? TYR B 209  . ? 1_555 ? 
40  AC9 6  ASP B  252 ? ASP B 232  . ? 1_555 ? 
41  AC9 6  PHE B  253 ? PHE B 233  . ? 1_555 ? 
42  AC9 6  GLY B  254 ? GLY B 234  . ? 1_555 ? 
43  AC9 6  HOH BF .   ? HOH B 1313 . ? 1_555 ? 
44  AD1 6  ARG B  288 ? ARG B 268  . ? 1_555 ? 
45  AD1 6  ASP B  289 ? ASP B 269  . ? 1_555 ? 
46  AD1 6  VAL B  290 ? VAL B 270  . ? 1_555 ? 
47  AD1 6  ALA B  295 ? ALA B 275  . ? 1_555 ? 
48  AD1 6  HOH BF .   ? HOH B 1311 . ? 1_555 ? 
49  AD1 6  HOH BF .   ? HOH B 1327 . ? 1_555 ? 
50  AD2 2  LYS B  47  ? LYS B 27   . ? 1_555 ? 
51  AD2 2  ARG B  421 ? ARG B 401  . ? 1_555 ? 
52  AD3 5  ASP B  305 ? ASP B 285  . ? 1_555 ? 
53  AD3 5  VAL B  306 ? VAL B 286  . ? 1_555 ? 
54  AD3 5  ARG B  360 ? ARG B 340  . ? 1_555 ? 
55  AD3 5  SO4 AA .   ? SO4 B 1201 . ? 1_555 ? 
56  AD3 5  HOH BF .   ? HOH B 1309 . ? 1_555 ? 
57  AD4 3  ARG B  338 ? ARG B 318  . ? 1_555 ? 
58  AD4 3  ARG B  388 ? ARG B 368  . ? 1_555 ? 
59  AD4 3  HOH BF .   ? HOH B 1326 . ? 1_555 ? 
60  AD5 6  SER C  354 ? SER C 334  . ? 1_555 ? 
61  AD5 6  ASN C  370 ? ASN C 350  . ? 1_555 ? 
62  AD5 6  SER C  371 ? SER C 351  . ? 1_555 ? 
63  AD5 6  ARG C  388 ? ARG C 368  . ? 1_555 ? 
64  AD5 6  HOH CF .   ? HOH C 647  . ? 1_555 ? 
65  AD5 6  HOH CF .   ? HOH C 701  . ? 1_555 ? 
66  AD6 6  ARG C  288 ? ARG C 268  . ? 1_555 ? 
67  AD6 6  ASP C  289 ? ASP C 269  . ? 1_555 ? 
68  AD6 6  VAL C  290 ? VAL C 270  . ? 1_555 ? 
69  AD6 6  GLY C  291 ? GLY C 271  . ? 1_555 ? 
70  AD6 6  ALA C  295 ? ALA C 275  . ? 1_555 ? 
71  AD6 6  HOH CF .   ? HOH C 702  . ? 1_555 ? 
72  AD7 1  ARG C  421 ? ARG C 401  . ? 1_555 ? 
73  AD8 3  ARG C  338 ? ARG C 318  . ? 1_555 ? 
74  AD8 3  ARG C  388 ? ARG C 368  . ? 1_555 ? 
75  AD8 3  HOH CF .   ? HOH C 632  . ? 1_555 ? 
76  AD9 5  ILE C  215 ? ILE C 195  . ? 1_555 ? 
77  AD9 5  ASN C  218 ? ASN C 198  . ? 1_555 ? 
78  AD9 5  ARG C  271 ? ARG C 251  . ? 1_555 ? 
79  AD9 5  HOH CF .   ? HOH C 633  . ? 1_555 ? 
80  AD9 5  HOH CF .   ? HOH C 707  . ? 1_555 ? 
81  AE1 3  ASP C  305 ? ASP C 285  . ? 1_555 ? 
82  AE1 3  VAL C  306 ? VAL C 286  . ? 1_555 ? 
83  AE1 3  HOH CF .   ? HOH C 656  . ? 1_555 ? 
84  AE2 6  THR C  130 ? THR C 110  . ? 1_555 ? 
85  AE2 6  TYR C  229 ? TYR C 209  . ? 1_555 ? 
86  AE2 6  ASP C  252 ? ASP C 232  . ? 1_555 ? 
87  AE2 6  PHE C  253 ? PHE C 233  . ? 1_555 ? 
88  AE2 6  GLY C  254 ? GLY C 234  . ? 1_555 ? 
89  AE2 6  HOH CF .   ? HOH C 601  . ? 1_555 ? 
90  AE3 4  ASP C  294 ? ASP C 274  . ? 1_555 ? 
91  AE3 4  THR C  423 ? THR C 403  . ? 1_555 ? 
92  AE3 4  GLU C  424 ? GLU C 404  . ? 1_555 ? 
93  AE3 4  HOH CF .   ? HOH C 609  . ? 1_555 ? 
94  AE4 6  SER D  354 ? SER D 334  . ? 1_555 ? 
95  AE4 6  ASN D  370 ? ASN D 350  . ? 1_555 ? 
96  AE4 6  SER D  371 ? SER D 351  . ? 1_555 ? 
97  AE4 6  ARG D  388 ? ARG D 368  . ? 1_555 ? 
98  AE4 6  HOH DF .   ? HOH D 602  . ? 1_555 ? 
99  AE4 6  HOH DF .   ? HOH D 675  . ? 1_555 ? 
100 AE5 3  ILE D  215 ? ILE D 195  . ? 1_555 ? 
101 AE5 3  ASN D  218 ? ASN D 198  . ? 1_555 ? 
102 AE5 3  ARG D  271 ? ARG D 251  . ? 1_555 ? 
103 AE6 3  ASP D  305 ? ASP D 285  . ? 1_555 ? 
104 AE6 3  VAL D  306 ? VAL D 286  . ? 1_555 ? 
105 AE6 3  HOH DF .   ? HOH D 632  . ? 1_555 ? 
106 AE7 5  ARG D  288 ? ARG D 268  . ? 1_555 ? 
107 AE7 5  ASP D  289 ? ASP D 269  . ? 1_555 ? 
108 AE7 5  VAL D  290 ? VAL D 270  . ? 1_555 ? 
109 AE7 5  ALA D  295 ? ALA D 275  . ? 1_555 ? 
110 AE7 5  HOH DF .   ? HOH D 670  . ? 1_555 ? 
111 AE8 3  ARG D  338 ? ARG D 318  . ? 1_555 ? 
112 AE8 3  ARG D  388 ? ARG D 368  . ? 1_555 ? 
113 AE8 3  HOH DF .   ? HOH D 647  . ? 1_555 ? 
114 AE9 2  LYS D  47  ? LYS D 27   . ? 1_555 ? 
115 AE9 2  ARG D  421 ? ARG D 401  . ? 1_555 ? 
116 AF1 4  SER E  354 ? SER E 334  . ? 1_555 ? 
117 AF1 4  ASN E  370 ? ASN E 350  . ? 1_555 ? 
118 AF1 4  SER E  371 ? SER E 351  . ? 1_555 ? 
119 AF1 4  ARG E  388 ? ARG E 368  . ? 1_555 ? 
120 AF2 5  THR E  130 ? THR E 110  . ? 1_555 ? 
121 AF2 5  TYR E  229 ? TYR E 209  . ? 1_555 ? 
122 AF2 5  ASP E  252 ? ASP E 232  . ? 1_555 ? 
123 AF2 5  PHE E  253 ? PHE E 233  . ? 1_555 ? 
124 AF2 5  GLY E  254 ? GLY E 234  . ? 1_555 ? 
125 AF3 4  ILE E  215 ? ILE E 195  . ? 1_555 ? 
126 AF3 4  PRO E  216 ? PRO E 196  . ? 1_555 ? 
127 AF3 4  ASN E  218 ? ASN E 198  . ? 1_555 ? 
128 AF3 4  ARG E  271 ? ARG E 251  . ? 1_555 ? 
129 AF4 6  ARG E  288 ? ARG E 268  . ? 1_555 ? 
130 AF4 6  ASP E  289 ? ASP E 269  . ? 1_555 ? 
131 AF4 6  VAL E  290 ? VAL E 270  . ? 1_555 ? 
132 AF4 6  GLY E  291 ? GLY E 271  . ? 1_555 ? 
133 AF4 6  ALA E  295 ? ALA E 275  . ? 1_555 ? 
134 AF4 6  HOH EF .   ? HOH E 612  . ? 1_555 ? 
135 AF5 10 ARG E  52  ? ARG E 32   . ? 1_555 ? 
136 AF5 10 ARG E  53  ? ARG E 33   . ? 1_555 ? 
137 AF5 10 ALA E  54  ? ALA E 34   . ? 1_555 ? 
138 AF5 10 ALA E  57  ? ALA E 37   . ? 1_555 ? 
139 AF5 10 TYR E  88  ? TYR E 68   . ? 1_555 ? 
140 AF5 10 LYS E  89  ? LYS E 69   . ? 1_555 ? 
141 AF5 10 ALA E  90  ? ALA E 70   . ? 1_555 ? 
142 AF5 10 HIS E  91  ? HIS E 71   . ? 1_555 ? 
143 AF5 10 ASP E  92  ? ASP E 72   . ? 1_555 ? 
144 AF5 10 LEU E  93  ? LEU E 73   . ? 1_555 ? 
145 AF6 3  ASP E  305 ? ASP E 285  . ? 1_555 ? 
146 AF6 3  VAL E  306 ? VAL E 286  . ? 1_555 ? 
147 AF6 3  HOH EF .   ? HOH E 641  . ? 1_555 ? 
148 AF7 2  ARG E  338 ? ARG E 318  . ? 1_555 ? 
149 AF7 2  ARG E  388 ? ARG E 368  . ? 1_555 ? 
150 AF8 4  SER F  354 ? SER F 334  . ? 1_555 ? 
151 AF8 4  ASN F  370 ? ASN F 350  . ? 1_555 ? 
152 AF8 4  SER F  371 ? SER F 351  . ? 1_555 ? 
153 AF8 4  ARG F  388 ? ARG F 368  . ? 1_555 ? 
154 AF9 5  THR F  130 ? THR F 110  . ? 1_555 ? 
155 AF9 5  TYR F  229 ? TYR F 209  . ? 1_555 ? 
156 AF9 5  PHE F  253 ? PHE F 233  . ? 1_555 ? 
157 AF9 5  GLY F  254 ? GLY F 234  . ? 1_555 ? 
158 AF9 5  HOH FF .   ? HOH F 629  . ? 1_555 ? 
159 AG1 5  ILE F  215 ? ILE F 195  . ? 1_555 ? 
160 AG1 5  PRO F  216 ? PRO F 196  . ? 1_555 ? 
161 AG1 5  ASN F  218 ? ASN F 198  . ? 1_555 ? 
162 AG1 5  ARG F  271 ? ARG F 251  . ? 1_555 ? 
163 AG1 5  HOH FF .   ? HOH F 668  . ? 1_555 ? 
164 AG2 5  ARG F  288 ? ARG F 268  . ? 1_555 ? 
165 AG2 5  ASP F  289 ? ASP F 269  . ? 1_555 ? 
166 AG2 5  VAL F  290 ? VAL F 270  . ? 1_555 ? 
167 AG2 5  ALA F  295 ? ALA F 275  . ? 1_555 ? 
168 AG2 5  HOH FF .   ? HOH F 628  . ? 1_555 ? 
169 AG3 4  ASP F  305 ? ASP F 285  . ? 1_555 ? 
170 AG3 4  VAL F  306 ? VAL F 286  . ? 1_555 ? 
171 AG3 4  ARG F  360 ? ARG F 340  . ? 1_555 ? 
172 AG3 4  HOH FF .   ? HOH F 618  . ? 1_555 ? 
173 AG4 4  ARG F  338 ? ARG F 318  . ? 1_555 ? 
174 AG4 4  ARG F  388 ? ARG F 368  . ? 1_555 ? 
175 AG4 4  HOH FF .   ? HOH F 603  . ? 1_555 ? 
176 AG4 4  HOH FF .   ? HOH F 663  . ? 1_555 ? 
177 AG5 4  SER G  354 ? SER G 334  . ? 1_555 ? 
178 AG5 4  ASN G  370 ? ASN G 350  . ? 1_555 ? 
179 AG5 4  SER G  371 ? SER G 351  . ? 1_555 ? 
180 AG5 4  ARG G  388 ? ARG G 368  . ? 1_555 ? 
181 AG6 4  THR G  130 ? THR G 110  . ? 1_555 ? 
182 AG6 4  TYR G  229 ? TYR G 209  . ? 1_555 ? 
183 AG6 4  PHE G  253 ? PHE G 233  . ? 1_555 ? 
184 AG6 4  GLY G  254 ? GLY G 234  . ? 1_555 ? 
185 AG7 3  ASP G  305 ? ASP G 285  . ? 1_555 ? 
186 AG7 3  VAL G  306 ? VAL G 286  . ? 1_555 ? 
187 AG7 3  HOH GF .   ? HOH G 628  . ? 1_555 ? 
188 AG8 5  ARG G  288 ? ARG G 268  . ? 1_555 ? 
189 AG8 5  ASP G  289 ? ASP G 269  . ? 1_555 ? 
190 AG8 5  VAL G  290 ? VAL G 270  . ? 1_555 ? 
191 AG8 5  ALA G  295 ? ALA G 275  . ? 1_555 ? 
192 AG8 5  HOH GF .   ? HOH G 660  . ? 1_555 ? 
193 AG9 3  ARG G  338 ? ARG G 318  . ? 1_555 ? 
194 AG9 3  ARG G  388 ? ARG G 368  . ? 1_555 ? 
195 AG9 3  HOH GF .   ? HOH G 619  . ? 1_555 ? 
196 AH1 5  SER H  354 ? SER H 334  . ? 1_555 ? 
197 AH1 5  ASN H  370 ? ASN H 350  . ? 1_555 ? 
198 AH1 5  SER H  371 ? SER H 351  . ? 1_555 ? 
199 AH1 5  ARG H  388 ? ARG H 368  . ? 1_555 ? 
200 AH1 5  HOH HF .   ? HOH H 621  . ? 1_555 ? 
201 AH2 3  LYS H  47  ? LYS H 27   . ? 1_555 ? 
202 AH2 3  ARG H  421 ? ARG H 401  . ? 1_555 ? 
203 AH2 3  HOH HF .   ? HOH H 614  . ? 1_555 ? 
204 AH3 2  ARG H  338 ? ARG H 318  . ? 1_555 ? 
205 AH3 2  ARG H  388 ? ARG H 368  . ? 1_555 ? 
206 AH4 4  ASP H  305 ? ASP H 285  . ? 1_555 ? 
207 AH4 4  VAL H  306 ? VAL H 286  . ? 1_555 ? 
208 AH4 4  ARG H  360 ? ARG H 340  . ? 1_555 ? 
209 AH4 4  HOH HF .   ? HOH H 634  . ? 1_555 ? 
210 AH5 6  ARG H  288 ? ARG H 268  . ? 1_555 ? 
211 AH5 6  ASP H  289 ? ASP H 269  . ? 1_555 ? 
212 AH5 6  VAL H  290 ? VAL H 270  . ? 1_555 ? 
213 AH5 6  GLY H  291 ? GLY H 271  . ? 1_555 ? 
214 AH5 6  ALA H  295 ? ALA H 275  . ? 1_555 ? 
215 AH5 6  HOH HF .   ? HOH H 632  . ? 1_555 ? 
216 AH6 6  SER I  354 ? SER I 334  . ? 1_555 ? 
217 AH6 6  ASN I  370 ? ASN I 350  . ? 1_555 ? 
218 AH6 6  SER I  371 ? SER I 351  . ? 1_555 ? 
219 AH6 6  ARG I  388 ? ARG I 368  . ? 1_555 ? 
220 AH6 6  HOH IF .   ? HOH I 616  . ? 1_555 ? 
221 AH6 6  HOH IF .   ? HOH I 634  . ? 1_555 ? 
222 AH7 2  THR I  423 ? THR I 403  . ? 1_555 ? 
223 AH7 2  GLU I  424 ? GLU I 404  . ? 1_555 ? 
224 AH8 4  ILE I  215 ? ILE I 195  . ? 1_555 ? 
225 AH8 4  ASN I  218 ? ASN I 198  . ? 1_555 ? 
226 AH8 4  ARG I  271 ? ARG I 251  . ? 1_555 ? 
227 AH8 4  HOH IF .   ? HOH I 701  . ? 1_555 ? 
228 AH9 4  ASP I  305 ? ASP I 285  . ? 1_555 ? 
229 AH9 4  VAL I  306 ? VAL I 286  . ? 1_555 ? 
230 AH9 4  HOH IF .   ? HOH I 605  . ? 1_555 ? 
231 AH9 4  HOH IF .   ? HOH I 630  . ? 1_555 ? 
232 AI1 5  ARG I  288 ? ARG I 268  . ? 1_555 ? 
233 AI1 5  ASP I  289 ? ASP I 269  . ? 1_555 ? 
234 AI1 5  VAL I  290 ? VAL I 270  . ? 1_555 ? 
235 AI1 5  ALA I  295 ? ALA I 275  . ? 1_555 ? 
236 AI1 5  HOH IF .   ? HOH I 686  . ? 1_555 ? 
237 AI2 1  ARG I  421 ? ARG I 401  . ? 1_555 ? 
238 AI3 2  ARG I  338 ? ARG I 318  . ? 1_555 ? 
239 AI3 2  ARG I  388 ? ARG I 368  . ? 1_555 ? 
240 AI4 7  SER J  354 ? SER J 334  . ? 1_555 ? 
241 AI4 7  ASN J  370 ? ASN J 350  . ? 1_555 ? 
242 AI4 7  SER J  371 ? SER J 351  . ? 1_555 ? 
243 AI4 7  ARG J  388 ? ARG J 368  . ? 1_555 ? 
244 AI4 7  HOH JF .   ? HOH J 630  . ? 1_555 ? 
245 AI4 7  HOH JF .   ? HOH J 683  . ? 1_555 ? 
246 AI4 7  HOH JF .   ? HOH J 717  . ? 1_555 ? 
247 AI5 5  ARG J  288 ? ARG J 268  . ? 1_555 ? 
248 AI5 5  ASP J  289 ? ASP J 269  . ? 1_555 ? 
249 AI5 5  VAL J  290 ? VAL J 270  . ? 1_555 ? 
250 AI5 5  GLY J  291 ? GLY J 271  . ? 1_555 ? 
251 AI5 5  ALA J  295 ? ALA J 275  . ? 1_555 ? 
252 AI6 3  ARG J  338 ? ARG J 318  . ? 1_555 ? 
253 AI6 3  ARG J  388 ? ARG J 368  . ? 1_555 ? 
254 AI6 3  HOH JF .   ? HOH J 628  . ? 1_555 ? 
255 AI7 2  LYS J  47  ? LYS J 27   . ? 1_555 ? 
256 AI7 2  ARG J  421 ? ARG J 401  . ? 1_555 ? 
257 AI8 5  ILE J  215 ? ILE J 195  . ? 1_555 ? 
258 AI8 5  ASN J  218 ? ASN J 198  . ? 1_555 ? 
259 AI8 5  ARG J  271 ? ARG J 251  . ? 1_555 ? 
260 AI8 5  HOH JF .   ? HOH J 637  . ? 1_555 ? 
261 AI8 5  HOH JF .   ? HOH J 729  . ? 1_555 ? 
262 AI9 4  ASP J  305 ? ASP J 285  . ? 1_555 ? 
263 AI9 4  VAL J  306 ? VAL J 286  . ? 1_555 ? 
264 AI9 4  HOH JF .   ? HOH J 608  . ? 1_555 ? 
265 AI9 4  HOH JF .   ? HOH J 645  . ? 1_555 ? 
266 AJ1 5  THR J  130 ? THR J 110  . ? 1_555 ? 
267 AJ1 5  TYR J  229 ? TYR J 209  . ? 1_555 ? 
268 AJ1 5  PHE J  253 ? PHE J 233  . ? 1_555 ? 
269 AJ1 5  GLY J  254 ? GLY J 234  . ? 1_555 ? 
270 AJ1 5  HOH JF .   ? HOH J 602  . ? 1_555 ? 
271 AJ2 5  SER K  354 ? SER K 334  . ? 1_555 ? 
272 AJ2 5  ASN K  370 ? ASN K 350  . ? 1_555 ? 
273 AJ2 5  SER K  371 ? SER K 351  . ? 1_555 ? 
274 AJ2 5  ARG K  388 ? ARG K 368  . ? 1_555 ? 
275 AJ2 5  HOH KF .   ? HOH K 618  . ? 1_555 ? 
276 AJ3 5  ARG K  288 ? ARG K 268  . ? 1_555 ? 
277 AJ3 5  ASP K  289 ? ASP K 269  . ? 1_555 ? 
278 AJ3 5  VAL K  290 ? VAL K 270  . ? 1_555 ? 
279 AJ3 5  ALA K  295 ? ALA K 275  . ? 1_555 ? 
280 AJ3 5  HOH KF .   ? HOH K 661  . ? 1_555 ? 
281 AJ4 2  LYS K  47  ? LYS K 27   . ? 1_555 ? 
282 AJ4 2  ARG K  421 ? ARG K 401  . ? 1_555 ? 
283 AJ5 5  SER L  354 ? SER L 334  . ? 1_555 ? 
284 AJ5 5  ASN L  370 ? ASN L 350  . ? 1_555 ? 
285 AJ5 5  SER L  371 ? SER L 351  . ? 1_555 ? 
286 AJ5 5  ARG L  388 ? ARG L 368  . ? 1_555 ? 
287 AJ5 5  HOH LF .   ? HOH L 651  . ? 1_555 ? 
288 AJ6 3  ARG L  338 ? ARG L 318  . ? 1_555 ? 
289 AJ6 3  ARG L  388 ? ARG L 368  . ? 1_555 ? 
290 AJ6 3  HOH LF .   ? HOH L 624  . ? 1_555 ? 
291 AJ7 4  ARG L  288 ? ARG L 268  . ? 1_555 ? 
292 AJ7 4  ASP L  289 ? ASP L 269  . ? 1_555 ? 
293 AJ7 4  VAL L  290 ? VAL L 270  . ? 1_555 ? 
294 AJ7 4  ALA L  295 ? ALA L 275  . ? 1_555 ? 
295 AJ8 4  ASP L  305 ? ASP L 285  . ? 1_555 ? 
296 AJ8 4  VAL L  306 ? VAL L 286  . ? 1_555 ? 
297 AJ8 4  HOH LF .   ? HOH L 607  . ? 1_555 ? 
298 AJ8 4  HOH LF .   ? HOH L 637  . ? 1_555 ? 
299 AJ9 1  ARG L  421 ? ARG L 401  . ? 1_555 ? 
300 AK1 4  THR L  130 ? THR L 110  . ? 1_555 ? 
301 AK1 4  TYR L  229 ? TYR L 209  . ? 1_555 ? 
302 AK1 4  PHE L  253 ? PHE L 233  . ? 1_555 ? 
303 AK1 4  GLY L  254 ? GLY L 234  . ? 1_555 ? 
304 AK2 5  SER M  354 ? SER M 334  . ? 1_555 ? 
305 AK2 5  ASN M  370 ? ASN M 350  . ? 1_555 ? 
306 AK2 5  SER M  371 ? SER M 351  . ? 1_555 ? 
307 AK2 5  ARG M  388 ? ARG M 368  . ? 1_555 ? 
308 AK2 5  HOH MF .   ? HOH M 605  . ? 1_555 ? 
309 AK3 6  ARG M  288 ? ARG M 268  . ? 1_555 ? 
310 AK3 6  ASP M  289 ? ASP M 269  . ? 1_555 ? 
311 AK3 6  VAL M  290 ? VAL M 270  . ? 1_555 ? 
312 AK3 6  GLY M  291 ? GLY M 271  . ? 1_555 ? 
313 AK3 6  ALA M  295 ? ALA M 275  . ? 1_555 ? 
314 AK3 6  HOH MF .   ? HOH M 644  . ? 1_555 ? 
315 AK4 3  ASP M  305 ? ASP M 285  . ? 1_555 ? 
316 AK4 3  VAL M  306 ? VAL M 286  . ? 1_555 ? 
317 AK4 3  HOH MF .   ? HOH M 619  . ? 1_555 ? 
318 AK5 2  ARG M  338 ? ARG M 318  . ? 1_555 ? 
319 AK5 2  ARG M  388 ? ARG M 368  . ? 1_555 ? 
320 AK6 4  SER N  354 ? SER N 334  . ? 1_555 ? 
321 AK6 4  ASN N  370 ? ASN N 350  . ? 1_555 ? 
322 AK6 4  SER N  371 ? SER N 351  . ? 1_555 ? 
323 AK6 4  ARG N  388 ? ARG N 368  . ? 1_555 ? 
324 AK7 4  ASP N  305 ? ASP N 285  . ? 1_555 ? 
325 AK7 4  VAL N  306 ? VAL N 286  . ? 1_555 ? 
326 AK7 4  ARG N  360 ? ARG N 340  . ? 1_555 ? 
327 AK7 4  HOH NF .   ? HOH N 624  . ? 1_555 ? 
328 AK8 5  THR N  130 ? THR N 110  . ? 1_555 ? 
329 AK8 5  TYR N  229 ? TYR N 209  . ? 1_555 ? 
330 AK8 5  PHE N  253 ? PHE N 233  . ? 1_555 ? 
331 AK8 5  GLY N  254 ? GLY N 234  . ? 1_555 ? 
332 AK8 5  HOH NF .   ? HOH N 641  . ? 1_555 ? 
333 AK9 5  ARG N  288 ? ARG N 268  . ? 1_555 ? 
334 AK9 5  ASP N  289 ? ASP N 269  . ? 1_555 ? 
335 AK9 5  VAL N  290 ? VAL N 270  . ? 1_555 ? 
336 AK9 5  ALA N  295 ? ALA N 275  . ? 1_555 ? 
337 AK9 5  HOH NF .   ? HOH N 674  . ? 1_555 ? 
338 AL1 2  ARG N  338 ? ARG N 318  . ? 1_555 ? 
339 AL1 2  ARG N  388 ? ARG N 368  . ? 1_555 ? 
340 AL2 5  SER O  354 ? SER O 334  . ? 1_555 ? 
341 AL2 5  ASN O  370 ? ASN O 350  . ? 1_555 ? 
342 AL2 5  SER O  371 ? SER O 351  . ? 1_555 ? 
343 AL2 5  ARG O  388 ? ARG O 368  . ? 1_555 ? 
344 AL2 5  HOH OF .   ? HOH O 643  . ? 1_555 ? 
345 AL3 5  ASP O  305 ? ASP O 285  . ? 1_555 ? 
346 AL3 5  VAL O  306 ? VAL O 286  . ? 1_555 ? 
347 AL3 5  ARG O  360 ? ARG O 340  . ? 1_555 ? 
348 AL3 5  HOH OF .   ? HOH O 641  . ? 1_555 ? 
349 AL3 5  HOH OF .   ? HOH O 694  . ? 1_555 ? 
350 AL4 3  LYS O  47  ? LYS O 27   . ? 1_555 ? 
351 AL4 3  ARG O  421 ? ARG O 401  . ? 1_555 ? 
352 AL4 3  HOH OF .   ? HOH O 609  . ? 1_555 ? 
353 AL5 5  THR O  130 ? THR O 110  . ? 1_555 ? 
354 AL5 5  TYR O  229 ? TYR O 209  . ? 1_555 ? 
355 AL5 5  PHE O  253 ? PHE O 233  . ? 1_555 ? 
356 AL5 5  GLY O  254 ? GLY O 234  . ? 1_555 ? 
357 AL5 5  LYS O  255 ? LYS O 235  . ? 1_555 ? 
358 AL6 5  ARG O  288 ? ARG O 268  . ? 1_555 ? 
359 AL6 5  ASP O  289 ? ASP O 269  . ? 1_555 ? 
360 AL6 5  VAL O  290 ? VAL O 270  . ? 1_555 ? 
361 AL6 5  ALA O  295 ? ALA O 275  . ? 1_555 ? 
362 AL6 5  HOH OF .   ? HOH O 632  . ? 1_555 ? 
363 AL7 2  ARG O  338 ? ARG O 318  . ? 1_555 ? 
364 AL7 2  ARG O  388 ? ARG O 368  . ? 1_555 ? 
365 AL8 9  LYS O  63  ? LYS O 43   . ? 1_555 ? 
366 AL8 9  ALA O  323 ? ALA O 303  . ? 1_555 ? 
367 AL8 9  GLU O  324 ? GLU O 304  . ? 1_555 ? 
368 AL8 9  THR O  326 ? THR O 306  . ? 1_555 ? 
369 AL8 9  GLU P  324 ? GLU P 304  . ? 1_555 ? 
370 AL8 9  ILE P  325 ? ILE P 305  . ? 1_555 ? 
371 AL8 9  THR P  326 ? THR P 306  . ? 1_555 ? 
372 AL8 9  HOH PF .   ? HOH P 1227 . ? 1_555 ? 
373 AL8 9  HOH PF .   ? HOH P 1289 . ? 1_555 ? 
374 AL9 6  SER P  354 ? SER P 334  . ? 1_555 ? 
375 AL9 6  ASN P  370 ? ASN P 350  . ? 1_555 ? 
376 AL9 6  SER P  371 ? SER P 351  . ? 1_555 ? 
377 AL9 6  ARG P  388 ? ARG P 368  . ? 1_555 ? 
378 AL9 6  HOH PF .   ? HOH P 1223 . ? 1_555 ? 
379 AL9 6  HOH PF .   ? HOH P 1269 . ? 1_555 ? 
380 AM1 2  LYS P  47  ? LYS P 27   . ? 1_555 ? 
381 AM1 2  ARG P  421 ? ARG P 401  . ? 1_555 ? 
382 AM2 4  ARG P  338 ? ARG P 318  . ? 1_555 ? 
383 AM2 4  ARG P  388 ? ARG P 368  . ? 1_555 ? 
384 AM2 4  HOH PF .   ? HOH P 1203 . ? 1_555 ? 
385 AM2 4  HOH PF .   ? HOH P 1210 . ? 1_555 ? 
386 AM3 6  LEU P  38  ? LEU P 18   . ? 1_555 ? 
387 AM3 6  THR P  130 ? THR P 110  . ? 1_555 ? 
388 AM3 6  TYR P  229 ? TYR P 209  . ? 1_555 ? 
389 AM3 6  GLY P  254 ? GLY P 234  . ? 1_555 ? 
390 AM3 6  HOH PF .   ? HOH P 1201 . ? 1_555 ? 
391 AM3 6  HOH PF .   ? HOH P 1213 . ? 1_555 ? 
392 AM4 7  ARG P  288 ? ARG P 268  . ? 1_555 ? 
393 AM4 7  ASP P  289 ? ASP P 269  . ? 1_555 ? 
394 AM4 7  VAL P  290 ? VAL P 270  . ? 1_555 ? 
395 AM4 7  GLY P  291 ? GLY P 271  . ? 1_555 ? 
396 AM4 7  ALA P  295 ? ALA P 275  . ? 1_555 ? 
397 AM4 7  HOH PF .   ? HOH P 1242 . ? 1_555 ? 
398 AM4 7  HOH PF .   ? HOH P 1300 . ? 1_555 ? 
399 AM5 5  ASP P  305 ? ASP P 285  . ? 1_555 ? 
400 AM5 5  VAL P  306 ? VAL P 286  . ? 1_555 ? 
401 AM5 5  ARG P  360 ? ARG P 340  . ? 1_555 ? 
402 AM5 5  HOH PF .   ? HOH P 1229 . ? 1_555 ? 
403 AM5 5  HOH PF .   ? HOH P 1304 . ? 1_555 ? 
404 AM6 4  ARG O  339 ? ARG O 319  . ? 1_555 ? 
405 AM6 4  ARG P  339 ? ARG P 319  . ? 1_555 ? 
406 AM6 4  SER P  341 ? SER P 321  . ? 1_555 ? 
407 AM6 4  VAL P  343 ? VAL P 323  . ? 1_555 ? 
408 AM7 6  GLY P  40  ? GLY P 20   . ? 1_555 ? 
409 AM7 6  GLY P  41  ? GLY P 21   . ? 1_555 ? 
410 AM7 6  GLN P  87  ? GLN P 67   . ? 1_555 ? 
411 AM7 6  GLY P  129 ? GLY P 109  . ? 1_555 ? 
412 AM7 6  THR P  130 ? THR P 110  . ? 1_555 ? 
413 AM7 6  ALA P  133 ? ALA P 113  . ? 1_555 ? 
414 AM8 5  SER Q  354 ? SER Q 334  . ? 1_555 ? 
415 AM8 5  ASN Q  370 ? ASN Q 350  . ? 1_555 ? 
416 AM8 5  SER Q  371 ? SER Q 351  . ? 1_555 ? 
417 AM8 5  ARG Q  388 ? ARG Q 368  . ? 1_555 ? 
418 AM8 5  HOH QF .   ? HOH Q 605  . ? 1_555 ? 
419 AM9 6  ARG Q  288 ? ARG Q 268  . ? 1_555 ? 
420 AM9 6  ASP Q  289 ? ASP Q 269  . ? 1_555 ? 
421 AM9 6  VAL Q  290 ? VAL Q 270  . ? 1_555 ? 
422 AM9 6  ALA Q  295 ? ALA Q 275  . ? 1_555 ? 
423 AM9 6  HOH QF .   ? HOH Q 676  . ? 1_555 ? 
424 AM9 6  HOH QF .   ? HOH Q 714  . ? 1_555 ? 
425 AN1 3  ARG Q  338 ? ARG Q 318  . ? 1_555 ? 
426 AN1 3  ARG Q  388 ? ARG Q 368  . ? 1_555 ? 
427 AN1 3  HOH QF .   ? HOH Q 642  . ? 1_555 ? 
428 AN2 2  LYS Q  47  ? LYS Q 27   . ? 1_555 ? 
429 AN2 2  ARG Q  421 ? ARG Q 401  . ? 1_555 ? 
430 AN3 4  ASN Q  218 ? ASN Q 198  . ? 1_555 ? 
431 AN3 4  ARG Q  271 ? ARG Q 251  . ? 1_555 ? 
432 AN3 4  HOH QF .   ? HOH Q 657  . ? 1_555 ? 
433 AN3 4  HOH QF .   ? HOH Q 671  . ? 1_555 ? 
434 AN4 4  ASP Q  305 ? ASP Q 285  . ? 1_555 ? 
435 AN4 4  VAL Q  306 ? VAL Q 286  . ? 1_555 ? 
436 AN4 4  ARG Q  360 ? ARG Q 340  . ? 1_555 ? 
437 AN4 4  HOH QF .   ? HOH Q 656  . ? 1_555 ? 
438 AN5 1  ARG Q  422 ? ARG Q 402  . ? 1_555 ? 
439 AN6 6  SER R  354 ? SER R 334  . ? 1_555 ? 
440 AN6 6  ASN R  370 ? ASN R 350  . ? 1_555 ? 
441 AN6 6  SER R  371 ? SER R 351  . ? 1_555 ? 
442 AN6 6  ARG R  388 ? ARG R 368  . ? 1_555 ? 
443 AN6 6  HOH RF .   ? HOH R 622  . ? 1_555 ? 
444 AN6 6  HOH RF .   ? HOH R 719  . ? 1_555 ? 
445 AN7 7  ARG R  288 ? ARG R 268  . ? 1_555 ? 
446 AN7 7  ASP R  289 ? ASP R 269  . ? 1_555 ? 
447 AN7 7  VAL R  290 ? VAL R 270  . ? 1_555 ? 
448 AN7 7  GLY R  291 ? GLY R 271  . ? 1_555 ? 
449 AN7 7  ALA R  295 ? ALA R 275  . ? 1_555 ? 
450 AN7 7  HOH RF .   ? HOH R 680  . ? 1_555 ? 
451 AN7 7  HOH RF .   ? HOH R 740  . ? 1_555 ? 
452 AN8 2  LYS R  47  ? LYS R 27   . ? 1_555 ? 
453 AN8 2  ARG R  421 ? ARG R 401  . ? 1_555 ? 
454 AN9 3  ARG R  338 ? ARG R 318  . ? 1_555 ? 
455 AN9 3  ARG R  388 ? ARG R 368  . ? 1_555 ? 
456 AN9 3  HOH RF .   ? HOH R 672  . ? 1_555 ? 
457 AO1 3  ASP R  305 ? ASP R 285  . ? 1_555 ? 
458 AO1 3  VAL R  306 ? VAL R 286  . ? 1_555 ? 
459 AO1 3  HOH RF .   ? HOH R 602  . ? 1_555 ? 
460 AO2 1  ARG R  422 ? ARG R 402  . ? 1_555 ? 
461 AO3 5  SER S  354 ? SER W 334  . ? 1_555 ? 
462 AO3 5  ASN S  370 ? ASN W 350  . ? 1_555 ? 
463 AO3 5  SER S  371 ? SER W 351  . ? 1_555 ? 
464 AO3 5  ARG S  388 ? ARG W 368  . ? 1_555 ? 
465 AO3 5  HOH SF .   ? HOH W 627  . ? 1_555 ? 
466 AO4 3  ARG S  338 ? ARG W 318  . ? 1_555 ? 
467 AO4 3  ARG S  388 ? ARG W 368  . ? 1_555 ? 
468 AO4 3  HOH SF .   ? HOH W 638  . ? 1_555 ? 
469 AO5 4  ASP S  305 ? ASP W 285  . ? 1_555 ? 
470 AO5 4  VAL S  306 ? VAL W 286  . ? 1_555 ? 
471 AO5 4  ARG S  360 ? ARG W 340  . ? 1_555 ? 
472 AO5 4  HOH SF .   ? HOH W 614  . ? 1_555 ? 
473 AO6 7  ARG S  288 ? ARG W 268  . ? 1_555 ? 
474 AO6 7  ASP S  289 ? ASP W 269  . ? 1_555 ? 
475 AO6 7  VAL S  290 ? VAL W 270  . ? 1_555 ? 
476 AO6 7  GLY S  291 ? GLY W 271  . ? 1_555 ? 
477 AO6 7  ALA S  295 ? ALA W 275  . ? 1_555 ? 
478 AO6 7  HOH SF .   ? HOH W 626  . ? 1_555 ? 
479 AO6 7  HOH SF .   ? HOH W 663  . ? 1_555 ? 
480 AO7 5  THR S  130 ? THR W 110  . ? 1_555 ? 
481 AO7 5  TYR S  229 ? TYR W 209  . ? 1_555 ? 
482 AO7 5  PHE S  253 ? PHE W 233  . ? 1_555 ? 
483 AO7 5  GLY S  254 ? GLY W 234  . ? 1_555 ? 
484 AO7 5  LYS S  255 ? LYS W 235  . ? 1_555 ? 
485 AO8 7  SER T  354 ? SER T 334  . ? 1_555 ? 
486 AO8 7  ASN T  370 ? ASN T 350  . ? 1_555 ? 
487 AO8 7  SER T  371 ? SER T 351  . ? 1_555 ? 
488 AO8 7  ARG T  388 ? ARG T 368  . ? 1_555 ? 
489 AO8 7  HOH TF .   ? HOH T 615  . ? 1_555 ? 
490 AO8 7  HOH TF .   ? HOH T 683  . ? 1_555 ? 
491 AO8 7  HOH TF .   ? HOH T 708  . ? 1_555 ? 
492 AO9 2  ARG T  338 ? ARG T 318  . ? 1_555 ? 
493 AO9 2  ARG T  388 ? ARG T 368  . ? 1_555 ? 
494 AP1 5  LEU T  38  ? LEU T 18   . ? 1_555 ? 
495 AP1 5  THR T  130 ? THR T 110  . ? 1_555 ? 
496 AP1 5  TYR T  229 ? TYR T 209  . ? 1_555 ? 
497 AP1 5  GLY T  254 ? GLY T 234  . ? 1_555 ? 
498 AP1 5  HOH TF .   ? HOH T 603  . ? 1_555 ? 
499 AP2 3  ILE T  215 ? ILE T 195  . ? 1_555 ? 
500 AP2 3  ASN T  218 ? ASN T 198  . ? 1_555 ? 
501 AP2 3  ARG T  271 ? ARG T 251  . ? 1_555 ? 
502 AP3 5  ARG T  288 ? ARG T 268  . ? 1_555 ? 
503 AP3 5  ASP T  289 ? ASP T 269  . ? 1_555 ? 
504 AP3 5  VAL T  290 ? VAL T 270  . ? 1_555 ? 
505 AP3 5  ALA T  295 ? ALA T 275  . ? 1_555 ? 
506 AP3 5  HOH TF .   ? HOH T 692  . ? 1_555 ? 
507 AP4 4  ASP T  305 ? ASP T 285  . ? 1_555 ? 
508 AP4 4  VAL T  306 ? VAL T 286  . ? 1_555 ? 
509 AP4 4  ARG T  360 ? ARG T 340  . ? 1_555 ? 
510 AP4 4  HOH TF .   ? HOH T 605  . ? 1_555 ? 
511 AP5 2  LYS T  47  ? LYS T 27   . ? 1_555 ? 
512 AP5 2  ARG T  421 ? ARG T 401  . ? 1_555 ? 
513 AP6 10 PRO B  106 ? PRO B 86   . ? 1_555 ? 
514 AP6 10 ARG C  95  ? ARG C 75   . ? 1_555 ? 
515 AP6 10 HIS C  96  ? HIS C 76   . ? 1_555 ? 
516 AP6 10 LEU C  97  ? LEU C 77   . ? 1_555 ? 
517 AP6 10 GLN C  98  ? GLN C 78   . ? 1_555 ? 
518 AP6 10 GLY C  100 ? GLY C 80   . ? 1_555 ? 
519 AP6 10 TRP C  101 ? TRP C 81   . ? 1_555 ? 
520 AP6 10 ASP C  102 ? ASP C 82   . ? 1_555 ? 
521 AP6 10 TYR C  322 ? TYR C 302  . ? 1_555 ? 
522 AP6 10 HOH CF .   ? HOH C 698  . ? 1_555 ? 
523 AP7 10 PRO B  106 ? PRO B 86   . ? 1_555 ? 
524 AP7 10 ARG C  95  ? ARG C 75   . ? 1_555 ? 
525 AP7 10 HIS C  96  ? HIS C 76   . ? 1_555 ? 
526 AP7 10 LEU C  97  ? LEU C 77   . ? 1_555 ? 
527 AP7 10 GLN C  98  ? GLN C 78   . ? 1_555 ? 
528 AP7 10 GLY C  100 ? GLY C 80   . ? 1_555 ? 
529 AP7 10 TRP C  101 ? TRP C 81   . ? 1_555 ? 
530 AP7 10 ASP C  102 ? ASP C 82   . ? 1_555 ? 
531 AP7 10 TYR C  322 ? TYR C 302  . ? 1_555 ? 
532 AP7 10 HOH CF .   ? HOH C 698  . ? 1_555 ? 
533 AP8 10 PRO B  106 ? PRO B 86   . ? 1_555 ? 
534 AP8 10 ARG C  95  ? ARG C 75   . ? 1_555 ? 
535 AP8 10 HIS C  96  ? HIS C 76   . ? 1_555 ? 
536 AP8 10 LEU C  97  ? LEU C 77   . ? 1_555 ? 
537 AP8 10 GLN C  98  ? GLN C 78   . ? 1_555 ? 
538 AP8 10 GLY C  100 ? GLY C 80   . ? 1_555 ? 
539 AP8 10 TRP C  101 ? TRP C 81   . ? 1_555 ? 
540 AP8 10 ASP C  102 ? ASP C 82   . ? 1_555 ? 
541 AP8 10 TYR C  322 ? TYR C 302  . ? 1_555 ? 
542 AP8 10 HOH CF .   ? HOH C 698  . ? 1_555 ? 
543 AP9 7  LYS F  47  ? LYS F 27   . ? 1_555 ? 
544 AP9 7  GLU F  48  ? GLU F 28   . ? 1_555 ? 
545 AP9 7  PHE F  420 ? PHE F 400  . ? 1_555 ? 
546 AP9 7  ARG F  422 ? ARG F 402  . ? 1_555 ? 
547 AP9 7  CYS F  428 ? CYS F 408  . ? 1_555 ? 
548 AP9 7  LEU F  429 ? LEU F 409  . ? 1_555 ? 
549 AP9 7  HOH FF .   ? HOH F 675  . ? 1_555 ? 
550 AQ1 7  LYS F  47  ? LYS F 27   . ? 1_555 ? 
551 AQ1 7  GLU F  48  ? GLU F 28   . ? 1_555 ? 
552 AQ1 7  PHE F  420 ? PHE F 400  . ? 1_555 ? 
553 AQ1 7  ARG F  422 ? ARG F 402  . ? 1_555 ? 
554 AQ1 7  CYS F  428 ? CYS F 408  . ? 1_555 ? 
555 AQ1 7  LEU F  429 ? LEU F 409  . ? 1_555 ? 
556 AQ1 7  HOH FF .   ? HOH F 675  . ? 1_555 ? 
557 AQ2 7  LYS F  47  ? LYS F 27   . ? 1_555 ? 
558 AQ2 7  GLU F  48  ? GLU F 28   . ? 1_555 ? 
559 AQ2 7  PHE F  420 ? PHE F 400  . ? 1_555 ? 
560 AQ2 7  ARG F  422 ? ARG F 402  . ? 1_555 ? 
561 AQ2 7  CYS F  428 ? CYS F 408  . ? 1_555 ? 
562 AQ2 7  LEU F  429 ? LEU F 409  . ? 1_555 ? 
563 AQ2 7  HOH FF .   ? HOH F 675  . ? 1_555 ? 
564 AQ3 10 SER G  44  ? SER G 24   . ? 1_555 ? 
565 AQ3 10 ARG G  45  ? ARG G 25   . ? 1_555 ? 
566 AQ3 10 LEU G  46  ? LEU G 26   . ? 1_555 ? 
567 AQ3 10 GLU G  48  ? GLU G 28   . ? 1_555 ? 
568 AQ3 10 LEU G  49  ? LEU G 29   . ? 1_555 ? 
569 AQ3 10 THR G  50  ? THR G 30   . ? 1_555 ? 
570 AQ3 10 ASP G  51  ? ASP G 31   . ? 1_555 ? 
571 AQ3 10 ARG G  421 ? ARG G 401  . ? 1_555 ? 
572 AQ3 10 HOH GF .   ? HOH G 608  . ? 1_555 ? 
573 AQ3 10 HOH GF .   ? HOH G 663  . ? 1_555 ? 
574 AQ4 11 PHE G  60  ? PHE G 40   . ? 1_555 ? 
575 AQ4 11 GLY G  61  ? GLY G 41   . ? 1_555 ? 
576 AQ4 11 GLY G  62  ? GLY G 42   . ? 1_555 ? 
577 AQ4 11 ALA G  64  ? ALA G 44   . ? 1_555 ? 
578 AQ4 11 THR G  321 ? THR G 301  . ? 1_555 ? 
579 AQ4 11 TYR G  322 ? TYR G 302  . ? 1_555 ? 
580 AQ4 11 ALA G  323 ? ALA G 303  . ? 1_555 ? 
581 AQ4 11 PHE G  364 ? PHE G 344  . ? 1_555 ? 
582 AQ4 11 HOH GF .   ? HOH G 636  . ? 1_555 ? 
583 AQ4 11 HOH GF .   ? HOH G 670  . ? 1_555 ? 
584 AQ4 11 THR H  326 ? THR H 306  . ? 1_555 ? 
585 AQ5 9  GLU J  48  ? GLU J 28   . ? 1_555 ? 
586 AQ5 9  ASP J  398 ? ASP J 378  . ? 1_555 ? 
587 AQ5 9  ILE J  430 ? ILE J 410  . ? 1_555 ? 
588 AQ5 9  GLN J  432 ? GLN J 412  . ? 1_555 ? 
589 AQ5 9  SER J  433 ? SER J 413  . ? 1_555 ? 
590 AQ5 9  MET J  434 ? MET J 414  . ? 1_555 ? 
591 AQ5 9  ILE J  435 ? ILE J 415  . ? 1_555 ? 
592 AQ5 9  HOH JF .   ? HOH J 658  . ? 1_555 ? 
593 AQ5 9  HOH JF .   ? HOH J 707  . ? 1_555 ? 
594 AQ6 6  ASP K  305 ? ASP K 285  . ? 1_555 ? 
595 AQ6 6  VAL K  307 ? VAL K 287  . ? 1_555 ? 
596 AQ6 6  PRO K  308 ? PRO K 288  . ? 1_555 ? 
597 AQ6 6  HOH KF .   ? HOH K 612  . ? 1_555 ? 
598 AQ6 6  HOH KF .   ? HOH K 643  . ? 1_555 ? 
599 AQ6 6  VAL L  332 ? VAL L 312  . ? 1_555 ? 
600 AQ7 10 CYS K  180 ? CYS K 160  . ? 1_555 ? 
601 AQ7 10 GLU K  182 ? GLU K 162  . ? 1_555 ? 
602 AQ7 10 ASP K  200 ? ASP K 180  . ? 1_555 ? 
603 AQ7 10 ILE K  215 ? ILE K 195  . ? 1_555 ? 
604 AQ7 10 LEU K  223 ? LEU K 203  . ? 1_555 ? 
605 AQ7 10 HIS K  270 ? HIS K 250  . ? 1_555 ? 
606 AQ7 10 PHE K  272 ? PHE K 252  . ? 1_555 ? 
607 AQ7 10 ALA K  273 ? ALA K 253  . ? 1_555 ? 
608 AQ7 10 ASP K  274 ? ASP K 254  . ? 1_555 ? 
609 AQ7 10 HOH KF .   ? HOH K 607  . ? 1_555 ? 
610 AQ8 10 ARG K  338 ? ARG K 318  . ? 1_555 ? 
611 AQ8 10 SER K  371 ? SER K 351  . ? 1_555 ? 
612 AQ8 10 TYR K  372 ? TYR K 352  . ? 1_555 ? 
613 AQ8 10 GLY K  387 ? GLY K 367  . ? 1_555 ? 
614 AQ8 10 HIS K  389 ? HIS K 369  . ? 1_555 ? 
615 AQ8 10 ALA K  390 ? ALA K 370  . ? 1_555 ? 
616 AQ8 10 GLU K  405 ? GLU K 385  . ? 1_555 ? 
617 AQ8 10 GLY K  406 ? GLY K 386  . ? 1_555 ? 
618 AQ8 10 SO4 LC .   ? SO4 K 501  . ? 1_555 ? 
619 AQ8 10 HOH KF .   ? HOH K 609  . ? 1_555 ? 
620 AQ9 7  LYS N  47  ? LYS N 27   . ? 1_555 ? 
621 AQ9 7  GLU N  48  ? GLU N 28   . ? 1_555 ? 
622 AQ9 7  PHE N  420 ? PHE N 400  . ? 1_555 ? 
623 AQ9 7  ARG N  422 ? ARG N 402  . ? 1_555 ? 
624 AQ9 7  ILE N  427 ? ILE N 407  . ? 1_555 ? 
625 AQ9 7  CYS N  428 ? CYS N 408  . ? 1_555 ? 
626 AQ9 7  LEU N  429 ? LEU N 409  . ? 1_555 ? 
627 AR1 18 GLY G  78  ? GLY G 58   . ? 1_555 ? 
628 AR1 18 ILE G  79  ? ILE G 59   . ? 1_555 ? 
629 AR1 18 ARG G  81  ? ARG G 61   . ? 1_555 ? 
630 AR1 18 PHE G  104 ? PHE G 84   . ? 1_555 ? 
631 AR1 18 ASN G  109 ? ASN G 89   . ? 1_555 ? 
632 AR1 18 GLU G  110 ? GLU G 90   . ? 1_555 ? 
633 AR1 18 SER G  111 ? SER G 91   . ? 1_555 ? 
634 AR1 18 ARG G  338 ? ARG G 318  . ? 1_555 ? 
635 AR1 18 ARG G  388 ? ARG G 368  . ? 1_555 ? 
636 AR1 18 HOH GF .   ? HOH G 619  . ? 1_555 ? 
637 AR1 18 HOH GF .   ? HOH G 644  . ? 1_555 ? 
638 AR1 18 GLY O  78  ? GLY O 58   . ? 1_555 ? 
639 AR1 18 ILE O  79  ? ILE O 59   . ? 1_555 ? 
640 AR1 18 ARG O  81  ? ARG O 61   . ? 1_555 ? 
641 AR1 18 PHE O  104 ? PHE O 84   . ? 1_555 ? 
642 AR1 18 GLU O  110 ? GLU O 90   . ? 1_555 ? 
643 AR1 18 SER O  111 ? SER O 91   . ? 1_555 ? 
644 AR1 18 HOH OF .   ? HOH O 635  . ? 1_555 ? 
645 AR2 18 GLY G  78  ? GLY G 58   . ? 1_555 ? 
646 AR2 18 ILE G  79  ? ILE G 59   . ? 1_555 ? 
647 AR2 18 ARG G  81  ? ARG G 61   . ? 1_555 ? 
648 AR2 18 PHE G  104 ? PHE G 84   . ? 1_555 ? 
649 AR2 18 ASN G  109 ? ASN G 89   . ? 1_555 ? 
650 AR2 18 GLU G  110 ? GLU G 90   . ? 1_555 ? 
651 AR2 18 SER G  111 ? SER G 91   . ? 1_555 ? 
652 AR2 18 ARG G  338 ? ARG G 318  . ? 1_555 ? 
653 AR2 18 ARG G  388 ? ARG G 368  . ? 1_555 ? 
654 AR2 18 HOH GF .   ? HOH G 619  . ? 1_555 ? 
655 AR2 18 HOH GF .   ? HOH G 644  . ? 1_555 ? 
656 AR2 18 GLY O  78  ? GLY O 58   . ? 1_555 ? 
657 AR2 18 ILE O  79  ? ILE O 59   . ? 1_555 ? 
658 AR2 18 ARG O  81  ? ARG O 61   . ? 1_555 ? 
659 AR2 18 PHE O  104 ? PHE O 84   . ? 1_555 ? 
660 AR2 18 GLU O  110 ? GLU O 90   . ? 1_555 ? 
661 AR2 18 SER O  111 ? SER O 91   . ? 1_555 ? 
662 AR2 18 HOH OF .   ? HOH O 635  . ? 1_555 ? 
663 AR3 18 GLY G  78  ? GLY G 58   . ? 1_555 ? 
664 AR3 18 ILE G  79  ? ILE G 59   . ? 1_555 ? 
665 AR3 18 ARG G  81  ? ARG G 61   . ? 1_555 ? 
666 AR3 18 PHE G  104 ? PHE G 84   . ? 1_555 ? 
667 AR3 18 ASN G  109 ? ASN G 89   . ? 1_555 ? 
668 AR3 18 GLU G  110 ? GLU G 90   . ? 1_555 ? 
669 AR3 18 SER G  111 ? SER G 91   . ? 1_555 ? 
670 AR3 18 ARG G  338 ? ARG G 318  . ? 1_555 ? 
671 AR3 18 ARG G  388 ? ARG G 368  . ? 1_555 ? 
672 AR3 18 HOH GF .   ? HOH G 619  . ? 1_555 ? 
673 AR3 18 HOH GF .   ? HOH G 644  . ? 1_555 ? 
674 AR3 18 GLY O  78  ? GLY O 58   . ? 1_555 ? 
675 AR3 18 ILE O  79  ? ILE O 59   . ? 1_555 ? 
676 AR3 18 ARG O  81  ? ARG O 61   . ? 1_555 ? 
677 AR3 18 PHE O  104 ? PHE O 84   . ? 1_555 ? 
678 AR3 18 GLU O  110 ? GLU O 90   . ? 1_555 ? 
679 AR3 18 SER O  111 ? SER O 91   . ? 1_555 ? 
680 AR3 18 HOH OF .   ? HOH O 635  . ? 1_555 ? 
681 AR4 8  ARG G  80  ? ARG G 60   . ? 1_545 ? 
682 AR4 8  GLY O  78  ? GLY O 58   . ? 1_555 ? 
683 AR4 8  ILE O  79  ? ILE O 59   . ? 1_555 ? 
684 AR4 8  ARG O  81  ? ARG O 61   . ? 1_555 ? 
685 AR4 8  PHE O  104 ? PHE O 84   . ? 1_555 ? 
686 AR4 8  GLU O  110 ? GLU O 90   . ? 1_555 ? 
687 AR4 8  SER O  111 ? SER O 91   . ? 1_555 ? 
688 AR4 8  HOH OF .   ? HOH O 635  . ? 1_555 ? 
689 AR5 12 ARG P  52  ? ARG P 32   . ? 1_555 ? 
690 AR5 12 ASP P  398 ? ASP P 378  . ? 1_555 ? 
691 AR5 12 HIS P  399 ? HIS P 379  . ? 1_555 ? 
692 AR5 12 VAL P  401 ? VAL P 381  . ? 1_555 ? 
693 AR5 12 VAL P  402 ? VAL P 382  . ? 1_555 ? 
694 AR5 12 THR P  431 ? THR P 411  . ? 1_555 ? 
695 AR5 12 SER P  433 ? SER P 413  . ? 1_555 ? 
696 AR5 12 MET P  434 ? MET P 414  . ? 1_555 ? 
697 AR5 12 ILE P  435 ? ILE P 415  . ? 1_555 ? 
698 AR5 12 ASP P  436 ? ASP P 416  . ? 1_555 ? 
699 AR5 12 HOH PF .   ? HOH P 1218 . ? 1_555 ? 
700 AR5 12 HOH PF .   ? HOH P 1294 . ? 1_555 ? 
701 AR6 7  ARG Q  52  ? ARG Q 32   . ? 1_555 ? 
702 AR6 7  THR Q  431 ? THR Q 411  . ? 1_555 ? 
703 AR6 7  GLN Q  432 ? GLN Q 412  . ? 1_555 ? 
704 AR6 7  MET Q  434 ? MET Q 414  . ? 1_555 ? 
705 AR6 7  ILE Q  435 ? ILE Q 415  . ? 1_555 ? 
706 AR6 7  ASP Q  436 ? ASP Q 416  . ? 1_555 ? 
707 AR6 7  LYS Q  437 ? LYS Q 417  . ? 1_555 ? 
708 AR7 11 CYS R  180 ? CYS R 160  . ? 1_555 ? 
709 AR7 11 GLU R  182 ? GLU R 162  . ? 1_555 ? 
710 AR7 11 ASP R  200 ? ASP R 180  . ? 1_555 ? 
711 AR7 11 ILE R  215 ? ILE R 195  . ? 1_555 ? 
712 AR7 11 ASN R  218 ? ASN R 198  . ? 1_555 ? 
713 AR7 11 HIS R  270 ? HIS R 250  . ? 1_555 ? 
714 AR7 11 PHE R  272 ? PHE R 252  . ? 1_555 ? 
715 AR7 11 ALA R  273 ? ALA R 253  . ? 1_555 ? 
716 AR7 11 ASP R  274 ? ASP R 254  . ? 1_555 ? 
717 AR7 11 HOH RF .   ? HOH R 612  . ? 1_555 ? 
718 AR7 11 HOH RF .   ? HOH R 662  . ? 1_555 ? 
719 AR8 13 PRO L  106 ? PRO L 86   . ? 1_555 ? 
720 AR8 13 PHE L  112 ? PHE L 92   . ? 1_555 ? 
721 AR8 13 ARG T  95  ? ARG T 75   . ? 1_555 ? 
722 AR8 13 HIS T  96  ? HIS T 76   . ? 1_555 ? 
723 AR8 13 LEU T  97  ? LEU T 77   . ? 1_555 ? 
724 AR8 13 GLN T  98  ? GLN T 78   . ? 1_555 ? 
725 AR8 13 GLY T  100 ? GLY T 80   . ? 1_555 ? 
726 AR8 13 TRP T  101 ? TRP T 81   . ? 1_555 ? 
727 AR8 13 ASP T  102 ? ASP T 82   . ? 1_555 ? 
728 AR8 13 TYR T  322 ? TYR T 302  . ? 1_555 ? 
729 AR8 13 HOH TF .   ? HOH T 652  . ? 1_555 ? 
730 AR8 13 HOH TF .   ? HOH T 695  . ? 1_555 ? 
731 AR8 13 HOH TF .   ? HOH T 698  . ? 1_555 ? 
732 AR9 13 PRO L  106 ? PRO L 86   . ? 1_555 ? 
733 AR9 13 PHE L  112 ? PHE L 92   . ? 1_555 ? 
734 AR9 13 ARG T  95  ? ARG T 75   . ? 1_555 ? 
735 AR9 13 HIS T  96  ? HIS T 76   . ? 1_555 ? 
736 AR9 13 LEU T  97  ? LEU T 77   . ? 1_555 ? 
737 AR9 13 GLN T  98  ? GLN T 78   . ? 1_555 ? 
738 AR9 13 GLY T  100 ? GLY T 80   . ? 1_555 ? 
739 AR9 13 TRP T  101 ? TRP T 81   . ? 1_555 ? 
740 AR9 13 ASP T  102 ? ASP T 82   . ? 1_555 ? 
741 AR9 13 TYR T  322 ? TYR T 302  . ? 1_555 ? 
742 AR9 13 HOH TF .   ? HOH T 652  . ? 1_555 ? 
743 AR9 13 HOH TF .   ? HOH T 695  . ? 1_555 ? 
744 AR9 13 HOH TF .   ? HOH T 698  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6V99 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.010705 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002367 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007063 
_atom_sites.fract_transf_matrix[2][3]   0.002360 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004718 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C ? ? 3.54356 2.42580 25.62398 1.50364  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N ? ? 4.01032 2.96436 19.97189 1.75589  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O ? ? 4.49882 3.47563 15.80542 1.70748  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S ? ? 9.55732 6.39887 1.23737  29.19336 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . VAL A  1 26  ? -64.36341 -42.38325  75.07651  1.000 77.24685  ? 6    VAL A N   1 
ATOM   2     C CA  . VAL A  1 26  ? -63.42276 -42.37079  76.19914  1.000 76.73151  ? 6    VAL A CA  1 
ATOM   3     C C   . VAL A  1 26  ? -61.99948 -42.07559  75.73246  1.000 73.67860  ? 6    VAL A C   1 
ATOM   4     O O   . VAL A  1 26  ? -61.37256 -41.12072  76.19233  1.000 70.21665  ? 6    VAL A O   1 
ATOM   5     C CB  . VAL A  1 26  ? -63.42955 -43.70082  76.97504  1.000 75.89395  ? 6    VAL A CB  1 
ATOM   6     C CG1 . VAL A  1 26  ? -62.30367 -43.70652  77.99768  1.000 72.52093  ? 6    VAL A CG1 1 
ATOM   7     C CG2 . VAL A  1 26  ? -64.76501 -43.93030  77.66424  1.000 81.94251  ? 6    VAL A CG2 1 
ATOM   8     N N   . GLN A  1 27  ? -61.49250 -42.91479  74.83152  1.000 71.30096  ? 7    GLN A N   1 
ATOM   9     C CA  . GLN A  1 27  ? -60.09987 -42.81046  74.42307  1.000 64.89301  ? 7    GLN A CA  1 
ATOM   10    C C   . GLN A  1 27  ? -59.90138 -41.61507  73.49869  1.000 63.60254  ? 7    GLN A C   1 
ATOM   11    O O   . GLN A  1 27  ? -60.78123 -41.29281  72.69051  1.000 65.13151  ? 7    GLN A O   1 
ATOM   12    C CB  . GLN A  1 27  ? -59.63631 -44.08203  73.71857  1.000 65.49312  ? 7    GLN A CB  1 
ATOM   13    C CG  . GLN A  1 27  ? -58.74353 -44.94914  74.58109  1.000 70.85067  ? 7    GLN A CG  1 
ATOM   14    C CD  . GLN A  1 27  ? -58.55114 -46.34639  74.02111  1.000 73.09643  ? 7    GLN A CD  1 
ATOM   15    O OE1 . GLN A  1 27  ? -58.98627 -47.33784  74.62148  1.000 75.71942  ? 7    GLN A OE1 1 
ATOM   16    N NE2 . GLN A  1 27  ? -57.88243 -46.43583  72.87297  1.000 69.21179  ? 7    GLN A NE2 1 
ATOM   17    N N   . PRO A  1 28  ? -58.76923 -40.93259  73.59929  1.000 54.76635  ? 8    PRO A N   1 
ATOM   18    C CA  . PRO A  1 28  ? -58.51118 -39.82362  72.68012  1.000 48.07632  ? 8    PRO A CA  1 
ATOM   19    C C   . PRO A  1 28  ? -58.37788 -40.34804  71.26541  1.000 47.75005  ? 8    PRO A C   1 
ATOM   20    O O   . PRO A  1 28  ? -57.72406 -41.36497  71.02128  1.000 51.41394  ? 8    PRO A O   1 
ATOM   21    C CB  . PRO A  1 28  ? -57.18952 -39.22639  73.18457  1.000 46.81311  ? 8    PRO A CB  1 
ATOM   22    C CG  . PRO A  1 28  ? -56.94923 -39.84450  74.54175  1.000 52.14812  ? 8    PRO A CG  1 
ATOM   23    C CD  . PRO A  1 28  ? -57.65659 -41.17220  74.53130  1.000 51.14216  ? 8    PRO A CD  1 
ATOM   24    N N   . LEU A  1 29  ? -59.00096 -39.63600  70.32771  1.000 46.70534  ? 9    LEU A N   1 
ATOM   25    C CA  . LEU A  1 29  ? -58.90294 -40.02720  68.92985  1.000 47.48864  ? 9    LEU A CA  1 
ATOM   26    C C   . LEU A  1 29  ? -57.48315 -39.88286  68.38732  1.000 48.22576  ? 9    LEU A C   1 
ATOM   27    O O   . LEU A  1 29  ? -57.09581 -40.62691  67.47356  1.000 48.35834  ? 9    LEU A O   1 
ATOM   28    C CB  . LEU A  1 29  ? -59.88066 -39.20429  68.09944  1.000 44.23039  ? 9    LEU A CB  1 
ATOM   29    C CG  . LEU A  1 29  ? -61.30938 -39.71805  68.24081  1.000 47.43274  ? 9    LEU A CG  1 
ATOM   30    C CD1 . LEU A  1 29  ? -62.25775 -38.94166  67.36941  1.000 48.33954  ? 9    LEU A CD1 1 
ATOM   31    C CD2 . LEU A  1 29  ? -61.36190 -41.18036  67.89034  1.000 47.58493  ? 9    LEU A CD2 1 
ATOM   32    N N   . ALA A  1 30  ? -56.69647 -38.94284  68.92629  1.000 42.83180  ? 10   ALA A N   1 
ATOM   33    C CA  . ALA A  1 30  ? -55.35848 -38.70563  68.39609  1.000 41.52224  ? 10   ALA A CA  1 
ATOM   34    C C   . ALA A  1 30  ? -54.43541 -39.89570  68.61262  1.000 46.80947  ? 10   ALA A C   1 
ATOM   35    O O   . ALA A  1 30  ? -53.44426 -40.03182  67.88631  1.000 50.48729  ? 10   ALA A O   1 
ATOM   36    C CB  . ALA A  1 30  ? -54.75158 -37.43697  69.01854  1.000 36.08179  ? 10   ALA A CB  1 
ATOM   37    N N   . ARG A  1 31  ? -54.74897 -40.76127  69.58699  1.000 49.64192  ? 11   ARG A N   1 
ATOM   38    C CA  . ARG A  1 31  ? -54.00239 -42.00523  69.78194  1.000 47.14814  ? 11   ARG A CA  1 
ATOM   39    C C   . ARG A  1 31  ? -53.91853 -42.83176  68.50944  1.000 48.84465  ? 11   ARG A C   1 
ATOM   40    O O   . ARG A  1 31  ? -52.97147 -43.60912  68.32554  1.000 49.53278  ? 11   ARG A O   1 
ATOM   41    C CB  . ARG A  1 31  ? -54.65859 -42.85619  70.87680  1.000 48.03807  ? 11   ARG A CB  1 
ATOM   42    C CG  . ARG A  1 31  ? -54.27494 -42.47519  72.27991  1.000 48.12339  ? 11   ARG A CG  1 
ATOM   43    C CD  . ARG A  1 31  ? -54.70172 -43.54661  73.27642  1.000 49.84198  ? 11   ARG A CD  1 
ATOM   44    N NE  . ARG A  1 31  ? -54.66365 -43.03448  74.64052  1.000 49.57615  ? 11   ARG A NE  1 
ATOM   45    C CZ  . ARG A  1 31  ? -55.11472 -43.67822  75.70688  1.000 50.43698  ? 11   ARG A CZ  1 
ATOM   46    N NH1 . ARG A  1 31  ? -55.64249 -44.88779  75.58555  1.000 54.92893  ? 11   ARG A NH1 1 
ATOM   47    N NH2 . ARG A  1 31  ? -55.03928 -43.10505  76.89963  1.000 50.15922  ? 11   ARG A NH2 1 
ATOM   48    N N   . ASP A  1 32  ? -54.90560 -42.70280  67.63325  1.000 49.38532  ? 12   ASP A N   1 
ATOM   49    C CA  . ASP A  1 32  ? -55.02946 -43.57440  66.47669  1.000 55.39972  ? 12   ASP A CA  1 
ATOM   50    C C   . ASP A  1 32  ? -54.85165 -42.82565  65.17254  1.000 52.18343  ? 12   ASP A C   1 
ATOM   51    O O   . ASP A  1 32  ? -55.34661 -43.27564  64.13249  1.000 57.00598  ? 12   ASP A O   1 
ATOM   52    C CB  . ASP A  1 32  ? -56.38227 -44.28550  66.49910  1.000 63.49238  ? 12   ASP A CB  1 
ATOM   53    C CG  . ASP A  1 32  ? -56.54187 -45.15798  67.71344  1.000 68.83332  ? 12   ASP A CG  1 
ATOM   54    O OD1 . ASP A  1 32  ? -55.86620 -46.20724  67.75344  1.000 69.80953  ? 12   ASP A OD1 1 
ATOM   55    O OD2 . ASP A  1 32  ? -57.30878 -44.78247  68.63125  1.000 71.79109  ? 12   ASP A OD2 1 
ATOM   56    N N   . ALA A  1 33  ? -54.16772 -41.69227  65.20684  1.000 41.65933  ? 13   ALA A N   1 
ATOM   57    C CA  . ALA A  1 33  ? -54.04797 -40.85159  64.03458  1.000 40.36330  ? 13   ALA A CA  1 
ATOM   58    C C   . ALA A  1 33  ? -52.59483 -40.73800  63.60721  1.000 43.80980  ? 13   ALA A C   1 
ATOM   59    O O   . ALA A  1 33  ? -51.67477 -40.80573  64.42756  1.000 41.66047  ? 13   ALA A O   1 
ATOM   60    C CB  . ALA A  1 33  ? -54.62054 -39.44927  64.29497  1.000 40.01564  ? 13   ALA A CB  1 
ATOM   61    N N   . MET A  1 34  ? -52.39905 -40.54274  62.30741  1.000 46.89682  ? 14   MET A N   1 
ATOM   62    C CA  . MET A  1 34  ? -51.09930 -40.18907  61.76005  1.000 43.67716  ? 14   MET A CA  1 
ATOM   63    C C   . MET A  1 34  ? -51.22472 -38.83188  61.08094  1.000 47.09276  ? 14   MET A C   1 
ATOM   64    O O   . MET A  1 34  ? -52.06491 -38.65373  60.18913  1.000 48.56102  ? 14   MET A O   1 
ATOM   65    C CB  . MET A  1 34  ? -50.60720 -41.25668  60.78456  1.000 40.47773  ? 14   MET A CB  1 
ATOM   66    C CG  . MET A  1 34  ? -49.25527 -40.95296  60.18789  1.000 42.79502  ? 14   MET A CG  1 
ATOM   67    S SD  . MET A  1 34  ? -48.80049 -42.14277  58.90680  1.000 52.11410  ? 14   MET A SD  1 
ATOM   68    C CE  . MET A  1 34  ? -47.20216 -41.48448  58.40763  1.000 51.62519  ? 14   MET A CE  1 
ATOM   69    N N   . ALA A  1 35  ? -50.40850 -37.87548  61.51916  1.000 44.06646  ? 15   ALA A N   1 
ATOM   70    C CA  . ALA A  1 35  ? -50.33226 -36.57951  60.85928  1.000 40.24218  ? 15   ALA A CA  1 
ATOM   71    C C   . ALA A  1 35  ? -49.41550 -36.70609  59.66264  1.000 39.82406  ? 15   ALA A C   1 
ATOM   72    O O   . ALA A  1 35  ? -48.29488 -37.21036  59.78760  1.000 42.70059  ? 15   ALA A O   1 
ATOM   73    C CB  . ALA A  1 35  ? -49.80468 -35.50027  61.81253  1.000 35.86269  ? 15   ALA A CB  1 
ATOM   74    N N   . TYR A  1 36  ? -49.89273 -36.27513  58.49973  1.000 40.30748  ? 16   TYR A N   1 
ATOM   75    C CA  . TYR A  1 36  ? -49.10615 -36.34128  57.27339  1.000 43.48775  ? 16   TYR A CA  1 
ATOM   76    C C   . TYR A  1 36  ? -48.91826 -34.92496  56.72287  1.000 46.33450  ? 16   TYR A C   1 
ATOM   77    O O   . TYR A  1 36  ? -49.86298 -34.31501  56.20417  1.000 44.31209  ? 16   TYR A O   1 
ATOM   78    C CB  . TYR A  1 36  ? -49.77450 -37.26736  56.26069  1.000 45.27219  ? 16   TYR A CB  1 
ATOM   79    C CG  . TYR A  1 36  ? -48.81752 -37.84673  55.24138  1.000 47.03332  ? 16   TYR A CG  1 
ATOM   80    C CD1 . TYR A  1 36  ? -48.41732 -37.09518  54.14105  1.000 47.89724  ? 16   TYR A CD1 1 
ATOM   81    C CD2 . TYR A  1 36  ? -48.32443 -39.14497  55.36811  1.000 46.10343  ? 16   TYR A CD2 1 
ATOM   82    C CE1 . TYR A  1 36  ? -47.54490 -37.60239  53.20357  1.000 48.38899  ? 16   TYR A CE1 1 
ATOM   83    C CE2 . TYR A  1 36  ? -47.44797 -39.67073  54.41876  1.000 47.55082  ? 16   TYR A CE2 1 
ATOM   84    C CZ  . TYR A  1 36  ? -47.06010 -38.88581  53.34161  1.000 48.01526  ? 16   TYR A CZ  1 
ATOM   85    O OH  . TYR A  1 36  ? -46.19310 -39.36553  52.38801  1.000 49.74511  ? 16   TYR A OH  1 
ATOM   86    N N   . VAL A  1 37  ? -47.69424 -34.41557  56.80689  1.000 45.19052  ? 17   VAL A N   1 
ATOM   87    C CA  . VAL A  1 37  ? -47.41538 -33.00996  56.53739  1.000 44.81346  ? 17   VAL A CA  1 
ATOM   88    C C   . VAL A  1 37  ? -46.94536 -32.85445  55.09846  1.000 44.11676  ? 17   VAL A C   1 
ATOM   89    O O   . VAL A  1 37  ? -45.91259 -33.40772  54.70522  1.000 41.46032  ? 17   VAL A O   1 
ATOM   90    C CB  . VAL A  1 37  ? -46.38313 -32.43789  57.52361  1.000 42.23946  ? 17   VAL A CB  1 
ATOM   91    C CG1 . VAL A  1 37  ? -46.16753 -30.95351  57.24855  1.000 37.37712  ? 17   VAL A CG1 1 
ATOM   92    C CG2 . VAL A  1 37  ? -46.84371 -32.65855  58.97845  1.000 37.33022  ? 17   VAL A CG2 1 
ATOM   93    N N   . LEU A  1 38  ? -47.70079 -32.08483  54.31795  1.000 45.07165  ? 18   LEU A N   1 
ATOM   94    C CA  . LEU A  1 38  ? -47.29874 -31.72891  52.96311  1.000 47.93451  ? 18   LEU A CA  1 
ATOM   95    C C   . LEU A  1 38  ? -46.33166 -30.55291  53.03241  1.000 49.46181  ? 18   LEU A C   1 
ATOM   96    O O   . LEU A  1 38  ? -46.71257 -29.43640  53.40101  1.000 48.51324  ? 18   LEU A O   1 
ATOM   97    C CB  . LEU A  1 38  ? -48.51680 -31.38583  52.12386  1.000 49.79491  ? 18   LEU A CB  1 
ATOM   98    C CG  . LEU A  1 38  ? -49.55773 -32.48856  51.95208  1.000 52.80026  ? 18   LEU A CG  1 
ATOM   99    C CD1 . LEU A  1 38  ? -50.83241 -31.90233  51.35138  1.000 53.82487  ? 18   LEU A CD1 1 
ATOM   100   C CD2 . LEU A  1 38  ? -49.01426 -33.59563  51.06190  1.000 54.81562  ? 18   LEU A CD2 1 
ATOM   101   N N   . ALA A  1 39  ? -45.07634 -30.80769  52.70228  1.000 47.46724  ? 19   ALA A N   1 
ATOM   102   C CA  . ALA A  1 39  ? -44.02332 -29.82357  52.85660  1.000 47.49393  ? 19   ALA A CA  1 
ATOM   103   C C   . ALA A  1 39  ? -43.25879 -29.67914  51.56142  1.000 51.14544  ? 19   ALA A C   1 
ATOM   104   O O   . ALA A  1 39  ? -42.07296 -29.34180  51.57232  1.000 52.83225  ? 19   ALA A O   1 
ATOM   105   C CB  . ALA A  1 39  ? -43.07958 -30.20182  53.99242  1.000 49.63843  ? 19   ALA A CB  1 
ATOM   106   N N   . GLY A  1 40  ? -43.93021 -29.94919  50.43811  1.000 54.94410  ? 20   GLY A N   1 
ATOM   107   C CA  . GLY A  1 40  ? -43.28350 -29.81324  49.14955  1.000 61.15747  ? 20   GLY A CA  1 
ATOM   108   C C   . GLY A  1 40  ? -43.29537 -28.40005  48.60892  1.000 67.97290  ? 20   GLY A C   1 
ATOM   109   O O   . GLY A  1 40  ? -42.40842 -28.03010  47.83300  1.000 71.31472  ? 20   GLY A O   1 
ATOM   110   N N   . GLY A  1 41  ? -44.28077 -27.59408  49.00936  1.000 70.86430  ? 21   GLY A N   1 
ATOM   111   C CA  . GLY A  1 41  ? -44.49124 -26.25169  48.48060  1.000 70.91057  ? 21   GLY A CA  1 
ATOM   112   C C   . GLY A  1 41  ? -43.26933 -25.36357  48.32445  1.000 69.24543  ? 21   GLY A C   1 
ATOM   113   O O   . GLY A  1 41  ? -42.50464 -25.15522  49.27237  1.000 64.49236  ? 21   GLY A O   1 
ATOM   114   N N   . ARG A  1 42  ? -43.09602 -24.81649  47.11862  1.000 76.49848  ? 22   ARG A N   1 
ATOM   115   C CA  . ARG A  1 42  ? -41.93087 -23.99209  46.81101  1.000 75.02033  ? 22   ARG A CA  1 
ATOM   116   C C   . ARG A  1 42  ? -42.07405 -22.56269  47.33253  1.000 71.11094  ? 22   ARG A C   1 
ATOM   117   O O   . ARG A  1 42  ? -41.06497 -21.91899  47.64329  1.000 69.47701  ? 22   ARG A O   1 
ATOM   118   C CB  . ARG A  1 42  ? -41.68421 -23.98635  45.29315  1.000 73.13725  ? 22   ARG A CB  1 
ATOM   119   N N   . GLY A  1 43  ? -43.30100 -22.05347  47.43736  1.000 70.48209  ? 23   GLY A N   1 
ATOM   120   C CA  . GLY A  1 43  ? -43.52673 -20.66625  47.80790  1.000 66.51392  ? 23   GLY A CA  1 
ATOM   121   C C   . GLY A  1 43  ? -42.83894 -19.69634  46.86750  1.000 68.90849  ? 23   GLY A C   1 
ATOM   122   O O   . GLY A  1 43  ? -42.02746 -18.86613  47.29686  1.000 69.66250  ? 23   GLY A O   1 
ATOM   123   N N   . SER A  1 44  ? -43.16528 -19.78858  45.57468  1.000 68.65037  ? 24   SER A N   1 
ATOM   124   C CA  . SER A  1 44  ? -42.39273 -19.07072  44.56604  1.000 73.83339  ? 24   SER A CA  1 
ATOM   125   C C   . SER A  1 44  ? -42.49746 -17.55794  44.73379  1.000 77.08421  ? 24   SER A C   1 
ATOM   126   O O   . SER A  1 44  ? -41.55399 -16.83129  44.40145  1.000 77.22953  ? 24   SER A O   1 
ATOM   127   C CB  . SER A  1 44  ? -42.83805 -19.49181  43.16129  1.000 78.19719  ? 24   SER A CB  1 
ATOM   128   O OG  . SER A  1 44  ? -44.24378 -19.63368  43.09073  1.000 78.13517  ? 24   SER A OG  1 
ATOM   129   N N   . ARG A  1 45  ? -43.61382 -17.06178  45.26988  1.000 77.24305  ? 25   ARG A N   1 
ATOM   130   C CA  . ARG A  1 45  ? -43.76729 -15.62043  45.42985  1.000 71.06058  ? 25   ARG A CA  1 
ATOM   131   C C   . ARG A  1 45  ? -42.92454 -15.04926  46.55905  1.000 63.53477  ? 25   ARG A C   1 
ATOM   132   O O   . ARG A  1 45  ? -42.87335 -13.82644  46.69726  1.000 64.89323  ? 25   ARG A O   1 
ATOM   133   C CB  . ARG A  1 45  ? -45.23458 -15.27143  45.65188  1.000 73.52026  ? 25   ARG A CB  1 
ATOM   134   C CG  . ARG A  1 45  ? -46.13458 -15.76581  44.53997  1.000 81.14380  ? 25   ARG A CG  1 
ATOM   135   C CD  . ARG A  1 45  ? -47.49299 -15.13327  44.64019  1.000 84.91143  ? 25   ARG A CD  1 
ATOM   136   N NE  . ARG A  1 45  ? -47.37736 -13.68107  44.71169  1.000 90.47859  ? 25   ARG A NE  1 
ATOM   137   C CZ  . ARG A  1 45  ? -48.36735 -12.86945  45.07048  1.000 92.29422  ? 25   ARG A CZ  1 
ATOM   138   N NH1 . ARG A  1 45  ? -49.54743 -13.38197  45.39880  1.000 95.54585  ? 25   ARG A NH1 1 
ATOM   139   N NH2 . ARG A  1 45  ? -48.17828 -11.55085  45.10462  1.000 86.58365  ? 25   ARG A NH2 1 
ATOM   140   N N   . LEU A  1 46  ? -42.28241 -15.88704  47.37505  1.000 56.91267  ? 26   LEU A N   1 
ATOM   141   C CA  . LEU A  1 46  ? -41.24277 -15.40188  48.27358  1.000 51.40946  ? 26   LEU A CA  1 
ATOM   142   C C   . LEU A  1 46  ? -39.94601 -15.09148  47.53935  1.000 55.27525  ? 26   LEU A C   1 
ATOM   143   O O   . LEU A  1 46  ? -38.99634 -14.60650  48.16674  1.000 55.52203  ? 26   LEU A O   1 
ATOM   144   C CB  . LEU A  1 46  ? -40.97984 -16.42637  49.37793  1.000 47.48990  ? 26   LEU A CB  1 
ATOM   145   C CG  . LEU A  1 46  ? -42.15798 -16.66518  50.31635  1.000 44.65952  ? 26   LEU A CG  1 
ATOM   146   C CD1 . LEU A  1 46  ? -41.83983 -17.74434  51.31565  1.000 42.23068  ? 26   LEU A CD1 1 
ATOM   147   C CD2 . LEU A  1 46  ? -42.52586 -15.34406  51.02124  1.000 50.15375  ? 26   LEU A CD2 1 
ATOM   148   N N   . LYS A  1 47  ? -39.90645 -15.36683  46.23068  1.000 55.78682  ? 27   LYS A N   1 
ATOM   149   C CA  . LYS A  1 47  ? -38.75554 -15.21452  45.35164  1.000 56.26728  ? 27   LYS A CA  1 
ATOM   150   C C   . LYS A  1 47  ? -37.44347 -15.64668  46.00758  1.000 55.08915  ? 27   LYS A C   1 
ATOM   151   O O   . LYS A  1 47  ? -37.34715 -16.78506  46.48224  1.000 54.29772  ? 27   LYS A O   1 
ATOM   152   C CB  . LYS A  1 47  ? -38.74879 -13.77712  44.81092  1.000 62.80577  ? 27   LYS A CB  1 
ATOM   153   C CG  . LYS A  1 47  ? -40.19512 -13.20110  44.71196  1.000 68.04839  ? 27   LYS A CG  1 
ATOM   154   C CD  . LYS A  1 47  ? -40.80326 -13.19406  43.26979  1.000 76.70062  ? 27   LYS A CD  1 
ATOM   155   C CE  . LYS A  1 47  ? -42.32601 -12.85161  43.26423  1.000 77.96177  ? 27   LYS A CE  1 
ATOM   156   N NZ  . LYS A  1 47  ? -42.96669 -12.89043  41.89041  1.000 80.63112  ? 27   LYS A NZ  1 
ATOM   157   N N   . GLU A  1 48  ? -36.42541 -14.77995  46.03546  1.000 57.39534  ? 28   GLU A N   1 
ATOM   158   C CA  . GLU A  1 48  ? -35.08356 -15.22723  46.41173  1.000 57.35465  ? 28   GLU A CA  1 
ATOM   159   C C   . GLU A  1 48  ? -35.00989 -15.82160  47.81376  1.000 58.72025  ? 28   GLU A C   1 
ATOM   160   O O   . GLU A  1 48  ? -34.00354 -16.46377  48.14519  1.000 56.82938  ? 28   GLU A O   1 
ATOM   161   C CB  . GLU A  1 48  ? -34.08174 -14.08551  46.31310  1.000 58.41177  ? 28   GLU A CB  1 
ATOM   162   C CG  . GLU A  1 48  ? -33.67149 -13.72925  44.90932  1.000 65.73491  ? 28   GLU A CG  1 
ATOM   163   C CD  . GLU A  1 48  ? -34.59560 -12.70390  44.28259  1.000 71.64241  ? 28   GLU A CD  1 
ATOM   164   O OE1 . GLU A  1 48  ? -34.54931 -12.51849  43.04421  1.000 76.87247  ? 28   GLU A OE1 1 
ATOM   165   O OE2 . GLU A  1 48  ? -35.37471 -12.08244  45.03031  1.000 71.33719  ? 28   GLU A OE2 1 
ATOM   166   N N   . LEU A  1 49  ? -36.04123 -15.63000  48.63786  1.000 60.15307  ? 29   LEU A N   1 
ATOM   167   C CA  . LEU A  1 49  ? -36.07411 -16.25532  49.95465  1.000 59.38653  ? 29   LEU A CA  1 
ATOM   168   C C   . LEU A  1 49  ? -36.18541 -17.77326  49.86321  1.000 61.00958  ? 29   LEU A C   1 
ATOM   169   O O   . LEU A  1 49  ? -35.72536 -18.48495  50.76761  1.000 59.10009  ? 29   LEU A O   1 
ATOM   170   C CB  . LEU A  1 49  ? -37.24001 -15.68381  50.75295  1.000 57.94724  ? 29   LEU A CB  1 
ATOM   171   C CG  . LEU A  1 49  ? -37.05663 -15.42493  52.24503  1.000 58.19567  ? 29   LEU A CG  1 
ATOM   172   C CD1 . LEU A  1 49  ? -35.66078 -14.89863  52.55646  1.000 57.36290  ? 29   LEU A CD1 1 
ATOM   173   C CD2 . LEU A  1 49  ? -38.12160 -14.44259  52.70146  1.000 57.73976  ? 29   LEU A CD2 1 
ATOM   174   N N   . THR A  1 50  ? -36.79732 -18.28956  48.79369  1.000 59.61981  ? 30   THR A N   1 
ATOM   175   C CA  . THR A  1 50  ? -36.95702 -19.72714  48.62848  1.000 55.91498  ? 30   THR A CA  1 
ATOM   176   C C   . THR A  1 50  ? -36.11282 -20.27220  47.48249  1.000 57.86212  ? 30   THR A C   1 
ATOM   177   O O   . THR A  1 50  ? -36.40446 -21.35421  46.96794  1.000 50.51337  ? 30   THR A O   1 
ATOM   178   C CB  . THR A  1 50  ? -38.43015 -20.10062  48.42663  1.000 49.25808  ? 30   THR A CB  1 
ATOM   179   O OG1 . THR A  1 50  ? -39.05604 -19.15980  47.55420  1.000 53.73941  ? 30   THR A OG1 1 
ATOM   180   C CG2 . THR A  1 50  ? -39.17137 -20.11586  49.77321  1.000 44.00818  ? 30   THR A CG2 1 
ATOM   181   N N   . ASP A  1 51  ? -35.06671 -19.54530  47.07902  1.000 63.26375  ? 31   ASP A N   1 
ATOM   182   C CA  . ASP A  1 51  ? -34.20381 -20.01728  45.99757  1.000 67.82664  ? 31   ASP A CA  1 
ATOM   183   C C   . ASP A  1 51  ? -33.37033 -21.21987  46.43366  1.000 72.50674  ? 31   ASP A C   1 
ATOM   184   O O   . ASP A  1 51  ? -33.13030 -22.13783  45.63686  1.000 70.43243  ? 31   ASP A O   1 
ATOM   185   C CB  . ASP A  1 51  ? -33.28554 -18.88945  45.52162  1.000 69.12901  ? 31   ASP A CB  1 
ATOM   186   C CG  . ASP A  1 51  ? -33.91579 -18.03612  44.43769  1.000 72.54625  ? 31   ASP A CG  1 
ATOM   187   O OD1 . ASP A  1 51  ? -35.08739 -18.29247  44.08989  1.000 72.93381  ? 31   ASP A OD1 1 
ATOM   188   O OD2 . ASP A  1 51  ? -33.23874 -17.11057  43.93170  1.000 74.98291  ? 31   ASP A OD2 1 
ATOM   189   N N   . ARG A  1 52  ? -32.90860 -21.22923  47.69191  1.000 74.67770  ? 32   ARG A N   1 
ATOM   190   C CA  . ARG A  1 52  ? -32.05620 -22.29974  48.20571  1.000 76.68983  ? 32   ARG A CA  1 
ATOM   191   C C   . ARG A  1 52  ? -32.70692 -23.06169  49.36057  1.000 74.51904  ? 32   ARG A C   1 
ATOM   192   O O   . ARG A  1 52  ? -32.00302 -23.70082  50.15381  1.000 76.46805  ? 32   ARG A O   1 
ATOM   193   C CB  . ARG A  1 52  ? -30.69421 -21.74241  48.63425  1.000 77.87851  ? 32   ARG A CB  1 
ATOM   194   C CG  . ARG A  1 52  ? -30.05929 -20.78724  47.61721  1.000 81.60558  ? 32   ARG A CG  1 
ATOM   195   C CD  . ARG A  1 52  ? -28.55454 -21.01820  47.47168  1.000 83.87324  ? 32   ARG A CD  1 
ATOM   196   N NE  . ARG A  1 52  ? -28.20686 -21.80537  46.28601  1.000 86.40995  ? 32   ARG A NE  1 
ATOM   197   C CZ  . ARG A  1 52  ? -27.81523 -21.28252  45.12559  1.000 91.02099  ? 32   ARG A CZ  1 
ATOM   198   N NH1 . ARG A  1 52  ? -27.73162 -19.96287  44.98423  1.000 91.94363  ? 32   ARG A NH1 1 
ATOM   199   N NH2 . ARG A  1 52  ? -27.51261 -22.07641  44.10255  1.000 93.21506  ? 32   ARG A NH2 1 
ATOM   200   N N   . ARG A  1 53  ? -34.03297 -23.01103  49.47236  1.000 68.91450  ? 33   ARG A N   1 
ATOM   201   C CA  . ARG A  1 53  ? -34.74635 -23.74942  50.50490  1.000 61.80471  ? 33   ARG A CA  1 
ATOM   202   C C   . ARG A  1 53  ? -36.23432 -23.68254  50.20373  1.000 58.27669  ? 33   ARG A C   1 
ATOM   203   O O   . ARG A  1 53  ? -36.72060 -22.67391  49.67182  1.000 60.42921  ? 33   ARG A O   1 
ATOM   204   C CB  . ARG A  1 53  ? -34.45902 -23.19193  51.90631  1.000 57.46419  ? 33   ARG A CB  1 
ATOM   205   C CG  . ARG A  1 53  ? -34.85978 -21.75768  52.09593  1.000 60.47133  ? 33   ARG A CG  1 
ATOM   206   C CD  . ARG A  1 53  ? -34.59663 -21.31085  53.52179  1.000 65.51483  ? 33   ARG A CD  1 
ATOM   207   N NE  . ARG A  1 53  ? -33.19635 -20.95790  53.75067  1.000 72.93196  ? 33   ARG A NE  1 
ATOM   208   C CZ  . ARG A  1 53  ? -32.69182 -19.72821  53.63312  1.000 75.63265  ? 33   ARG A CZ  1 
ATOM   209   N NH1 . ARG A  1 53  ? -33.46227 -18.70020  53.27996  1.000 72.13443  ? 33   ARG A NH1 1 
ATOM   210   N NH2 . ARG A  1 53  ? -31.40372 -19.52331  53.87088  1.000 79.09432  ? 33   ARG A NH2 1 
ATOM   211   N N   . ALA A  1 54  ? -36.94225 -24.76815  50.54319  1.000 45.71046  ? 34   ALA A N   1 
ATOM   212   C CA  . ALA A  1 54  ? -38.39823 -24.81315  50.45992  1.000 47.52605  ? 34   ALA A CA  1 
ATOM   213   C C   . ALA A  1 54  ? -39.05210 -23.89733  51.49682  1.000 49.74605  ? 34   ALA A C   1 
ATOM   214   O O   . ALA A  1 54  ? -38.49957 -23.63924  52.57260  1.000 51.36219  ? 34   ALA A O   1 
ATOM   215   C CB  . ALA A  1 54  ? -38.90143 -26.23937  50.66892  1.000 52.14861  ? 34   ALA A CB  1 
ATOM   216   N N   . LYS A  1 55  ? -40.24407 -23.40213  51.15873  1.000 50.37563  ? 35   LYS A N   1 
ATOM   217   C CA  . LYS A  1 55  ? -40.95823 -22.49555  52.05569  1.000 49.50295  ? 35   LYS A CA  1 
ATOM   218   C C   . LYS A  1 55  ? -41.12522 -23.04447  53.46762  1.000 48.48152  ? 35   LYS A C   1 
ATOM   219   O O   . LYS A  1 55  ? -40.97374 -22.25941  54.42256  1.000 43.88049  ? 35   LYS A O   1 
ATOM   220   C CB  . LYS A  1 55  ? -42.33061 -22.13614  51.46806  1.000 46.90863  ? 35   LYS A CB  1 
ATOM   221   C CG  . LYS A  1 55  ? -43.12252 -21.15802  52.32789  1.000 42.73296  ? 35   LYS A CG  1 
ATOM   222   C CD  . LYS A  1 55  ? -44.49406 -20.87557  51.73454  1.000 44.00065  ? 35   LYS A CD  1 
ATOM   223   C CE  . LYS A  1 55  ? -45.29894 -19.95787  52.63868  1.000 45.44708  ? 35   LYS A CE  1 
ATOM   224   N NZ  . LYS A  1 55  ? -46.76700 -20.03359  52.38913  1.000 48.55625  ? 35   LYS A NZ  1 
ATOM   225   N N   . PRO A  1 56  ? -41.43552 -24.33352  53.67582  1.000 45.43168  ? 36   PRO A N   1 
ATOM   226   C CA  . PRO A  1 56  ? -41.53424 -24.84702  55.05345  1.000 43.51236  ? 36   PRO A CA  1 
ATOM   227   C C   . PRO A  1 56  ? -40.24477 -24.73222  55.84349  1.000 43.39956  ? 36   PRO A C   1 
ATOM   228   O O   . PRO A  1 56  ? -40.29720 -24.75857  57.08300  1.000 40.65250  ? 36   PRO A O   1 
ATOM   229   C CB  . PRO A  1 56  ? -41.94209 -26.31413  54.85477  1.000 40.12881  ? 36   PRO A CB  1 
ATOM   230   C CG  . PRO A  1 56  ? -42.66210 -26.31673  53.54611  1.000 43.68834  ? 36   PRO A CG  1 
ATOM   231   C CD  . PRO A  1 56  ? -41.91874 -25.32528  52.69365  1.000 45.08006  ? 36   PRO A CD  1 
ATOM   232   N N   . ALA A  1 57  ? -39.09452 -24.58623  55.18105  1.000 44.49437  ? 37   ALA A N   1 
ATOM   233   C CA  . ALA A  1 57  ? -37.82438 -24.40705  55.87810  1.000 44.98892  ? 37   ALA A CA  1 
ATOM   234   C C   . ALA A  1 57  ? -37.50892 -22.93828  56.16079  1.000 45.62745  ? 37   ALA A C   1 
ATOM   235   O O   . ALA A  1 57  ? -36.47821 -22.64138  56.78333  1.000 44.21302  ? 37   ALA A O   1 
ATOM   236   C CB  . ALA A  1 57  ? -36.68417 -25.06889  55.08427  1.000 37.05042  ? 37   ALA A CB  1 
ATOM   237   N N   . VAL A  1 58  ? -38.38833 -22.01925  55.75474  1.000 45.90490  ? 38   VAL A N   1 
ATOM   238   C CA  . VAL A  1 58  ? -38.15889 -20.60064  55.99213  1.000 42.53825  ? 38   VAL A CA  1 
ATOM   239   C C   . VAL A  1 58  ? -38.26764 -20.30739  57.47967  1.000 39.70585  ? 38   VAL A C   1 
ATOM   240   O O   . VAL A  1 58  ? -39.21397 -20.74227  58.14693  1.000 37.28518  ? 38   VAL A O   1 
ATOM   241   C CB  . VAL A  1 58  ? -39.14995 -19.74922  55.18477  1.000 43.74338  ? 38   VAL A CB  1 
ATOM   242   C CG1 . VAL A  1 58  ? -39.12481 -18.31381  55.66744  1.000 40.13827  ? 38   VAL A CG1 1 
ATOM   243   C CG2 . VAL A  1 58  ? -38.83832 -19.83312  53.67552  1.000 45.20583  ? 38   VAL A CG2 1 
ATOM   244   N N   . TYR A  1 59  ? -37.29346 -19.56477  58.00037  1.000 40.79408  ? 39   TYR A N   1 
ATOM   245   C CA  . TYR A  1 59  ? -37.30667 -19.13302  59.39169  1.000 43.86373  ? 39   TYR A CA  1 
ATOM   246   C C   . TYR A  1 59  ? -38.49736 -18.22155  59.67886  1.000 47.04374  ? 39   TYR A C   1 
ATOM   247   O O   . TYR A  1 59  ? -38.93841 -17.44842  58.82295  1.000 50.26278  ? 39   TYR A O   1 
ATOM   248   C CB  . TYR A  1 59  ? -36.01933 -18.38730  59.71669  1.000 44.00034  ? 39   TYR A CB  1 
ATOM   249   C CG  . TYR A  1 59  ? -34.78575 -19.23912  59.65633  1.000 55.69624  ? 39   TYR A CG  1 
ATOM   250   C CD1 . TYR A  1 59  ? -34.34391 -19.94082  60.77593  1.000 60.33363  ? 39   TYR A CD1 1 
ATOM   251   C CD2 . TYR A  1 59  ? -34.04178 -19.33018  58.48652  1.000 64.46968  ? 39   TYR A CD2 1 
ATOM   252   C CE1 . TYR A  1 59  ? -33.19724 -20.71602  60.72757  1.000 62.76672  ? 39   TYR A CE1 1 
ATOM   253   C CE2 . TYR A  1 59  ? -32.89084 -20.10994  58.42592  1.000 68.95584  ? 39   TYR A CE2 1 
ATOM   254   C CZ  . TYR A  1 59  ? -32.47600 -20.79751  59.54840  1.000 68.52133  ? 39   TYR A CZ  1 
ATOM   255   O OH  . TYR A  1 59  ? -31.33326 -21.57081  59.48977  1.000 74.83148  ? 39   TYR A OH  1 
ATOM   256   N N   . PHE A  1 60  ? -39.00604 -18.30357  60.90930  1.000 43.86164  ? 40   PHE A N   1 
ATOM   257   C CA  . PHE A  1 60  ? -40.05503 -17.39760  61.35804  1.000 42.41636  ? 40   PHE A CA  1 
ATOM   258   C C   . PHE A  1 60  ? -39.91316 -17.10290  62.84625  1.000 38.21831  ? 40   PHE A C   1 
ATOM   259   O O   . PHE A  1 60  ? -39.51491 -17.96160  63.63189  1.000 37.38503  ? 40   PHE A O   1 
ATOM   260   C CB  . PHE A  1 60  ? -41.45888 -17.95412  61.10295  1.000 40.83454  ? 40   PHE A CB  1 
ATOM   261   C CG  . PHE A  1 60  ? -42.54616 -17.02050  61.54319  1.000 44.92815  ? 40   PHE A CG  1 
ATOM   262   C CD1 . PHE A  1 60  ? -42.80401 -15.84911  60.82699  1.000 46.90538  ? 40   PHE A CD1 1 
ATOM   263   C CD2 . PHE A  1 60  ? -43.27326 -17.27576  62.69411  1.000 40.47989  ? 40   PHE A CD2 1 
ATOM   264   C CE1 . PHE A  1 60  ? -43.79024 -14.95492  61.24795  1.000 47.75178  ? 40   PHE A CE1 1 
ATOM   265   C CE2 . PHE A  1 60  ? -44.26093 -16.40676  63.11576  1.000 39.43057  ? 40   PHE A CE2 1 
ATOM   266   C CZ  . PHE A  1 60  ? -44.52729 -15.23796  62.39581  1.000 43.78707  ? 40   PHE A CZ  1 
ATOM   267   N N   . GLY A  1 61  ? -40.26713 -15.87631  63.22739  1.000 37.10430  ? 41   GLY A N   1 
ATOM   268   C CA  . GLY A  1 61  ? -40.46149 -15.52403  64.62032  1.000 38.49739  ? 41   GLY A CA  1 
ATOM   269   C C   . GLY A  1 61  ? -39.21992 -15.30439  65.45399  1.000 40.02784  ? 41   GLY A C   1 
ATOM   270   O O   . GLY A  1 61  ? -39.34601 -14.87218  66.59792  1.000 47.04328  ? 41   GLY A O   1 
ATOM   271   N N   . GLY A  1 62  ? -38.02026 -15.59659  64.95208  1.000 38.86407  ? 42   GLY A N   1 
ATOM   272   C CA  . GLY A  1 62  ? -36.79587 -15.42741  65.71551  1.000 48.55826  ? 42   GLY A CA  1 
ATOM   273   C C   . GLY A  1 62  ? -36.02810 -16.71260  65.97281  1.000 61.35597  ? 42   GLY A C   1 
ATOM   274   O O   . GLY A  1 62  ? -34.80448 -16.66738  66.14058  1.000 75.87802  ? 42   GLY A O   1 
ATOM   275   N N   . LYS A  1 63  ? -36.71968 -17.85890  66.01691  1.000 60.37378  ? 43   LYS A N   1 
ATOM   276   C CA  . LYS A  1 63  ? -36.02419 -19.13110  66.22249  1.000 60.95229  ? 43   LYS A CA  1 
ATOM   277   C C   . LYS A  1 63  ? -36.50261 -20.25164  65.32076  1.000 56.88999  ? 43   LYS A C   1 
ATOM   278   O O   . LYS A  1 63  ? -35.69291 -20.97025  64.72380  1.000 58.07590  ? 43   LYS A O   1 
ATOM   279   C CB  . LYS A  1 63  ? -36.19099 -19.62067  67.64390  1.000 64.79405  ? 43   LYS A CB  1 
ATOM   280   C CG  . LYS A  1 63  ? -35.10023 -19.20749  68.51805  1.000 72.98843  ? 43   LYS A CG  1 
ATOM   281   C CD  . LYS A  1 63  ? -35.68357 -19.11634  69.87261  1.000 76.05928  ? 43   LYS A CD  1 
ATOM   282   C CE  . LYS A  1 63  ? -35.03056 -17.99013  70.63692  1.000 80.52903  ? 43   LYS A CE  1 
ATOM   283   N NZ  . LYS A  1 63  ? -34.52496 -18.65141  71.80716  1.000 84.25246  ? 43   LYS A NZ  1 
ATOM   284   N N   . ALA A  1 64  ? -37.81539 -20.43502  65.26021  1.000 48.67425  ? 44   ALA A N   1 
ATOM   285   C CA  . ALA A  1 64  ? -38.37891 -21.60676  64.63049  1.000 42.96799  ? 44   ALA A CA  1 
ATOM   286   C C   . ALA A  1 64  ? -38.39411 -21.46246  63.11616  1.000 43.61867  ? 44   ALA A C   1 
ATOM   287   O O   . ALA A  1 64  ? -38.06415 -20.41464  62.55200  1.000 46.22641  ? 44   ALA A O   1 
ATOM   288   C CB  . ALA A  1 64  ? -39.79316 -21.85509  65.13726  1.000 42.86585  ? 44   ALA A CB  1 
ATOM   289   N N   . ARG A  1 65  ? -38.76754 -22.55344  62.45462  1.000 35.47435  ? 45   ARG A N   1 
ATOM   290   C CA  . ARG A  1 65  ? -39.09016 -22.51812  61.04639  1.000 32.54197  ? 45   ARG A CA  1 
ATOM   291   C C   . ARG A  1 65  ? -40.59240 -22.70308  60.88550  1.000 35.99395  ? 45   ARG A C   1 
ATOM   292   O O   . ARG A  1 65  ? -41.30243 -23.08795  61.81633  1.000 39.09872  ? 45   ARG A O   1 
ATOM   293   C CB  . ARG A  1 65  ? -38.30775 -23.59428  60.28518  1.000 34.20817  ? 45   ARG A CB  1 
ATOM   294   C CG  . ARG A  1 65  ? -36.82021 -23.36455  60.27699  1.000 33.72000  ? 45   ARG A CG  1 
ATOM   295   C CD  . ARG A  1 65  ? -36.09594 -24.42733  59.48119  1.000 40.98454  ? 45   ARG A CD  1 
ATOM   296   N NE  . ARG A  1 65  ? -34.66444 -24.43775  59.77965  1.000 42.64915  ? 45   ARG A NE  1 
ATOM   297   C CZ  . ARG A  1 65  ? -33.71403 -24.20634  58.88141  1.000 43.58826  ? 45   ARG A CZ  1 
ATOM   298   N NH1 . ARG A  1 65  ? -34.04335 -23.95113  57.62124  1.000 45.93973  ? 45   ARG A NH1 1 
ATOM   299   N NH2 . ARG A  1 65  ? -32.43636 -24.23648  59.23646  1.000 42.13083  ? 45   ARG A NH2 1 
ATOM   300   N N   . ILE A  1 66  ? -41.07123 -22.44352  59.67378  1.000 34.09252  ? 46   ILE A N   1 
ATOM   301   C CA  . ILE A  1 66  ? -42.50701 -22.44361  59.43701  1.000 34.19168  ? 46   ILE A CA  1 
ATOM   302   C C   . ILE A  1 66  ? -43.10263 -23.83241  59.66839  1.000 37.26511  ? 46   ILE A C   1 
ATOM   303   O O   . ILE A  1 66  ? -44.19278 -23.96859  60.23326  1.000 40.89041  ? 46   ILE A O   1 
ATOM   304   C CB  . ILE A  1 66  ? -42.79622 -21.91923  58.01836  1.000 37.55197  ? 46   ILE A CB  1 
ATOM   305   C CG1 . ILE A  1 66  ? -42.45714 -20.41981  57.91482  1.000 35.89106  ? 46   ILE A CG1 1 
ATOM   306   C CG2 . ILE A  1 66  ? -44.24504 -22.21944  57.60814  1.000 36.46253  ? 46   ILE A CG2 1 
ATOM   307   C CD1 . ILE A  1 66  ? -42.57384 -19.88258  56.48313  1.000 37.95050  ? 46   ILE A CD1 1 
ATOM   308   N N   . ILE A  1 67  ? -42.40186 -24.88555  59.24667  1.000 36.89140  ? 47   ILE A N   1 
ATOM   309   C CA  . ILE A  1 67  ? -42.95569 -26.22564  59.40153  1.000 39.83514  ? 47   ILE A CA  1 
ATOM   310   C C   . ILE A  1 67  ? -43.15536 -26.57479  60.87947  1.000 38.14104  ? 47   ILE A C   1 
ATOM   311   O O   . ILE A  1 67  ? -44.03226 -27.39003  61.21980  1.000 34.31942  ? 47   ILE A O   1 
ATOM   312   C CB  . ILE A  1 67  ? -42.04769 -27.25589  58.69154  1.000 43.63099  ? 47   ILE A CB  1 
ATOM   313   C CG1 . ILE A  1 67  ? -42.81716 -28.55779  58.40897  1.000 45.89961  ? 47   ILE A CG1 1 
ATOM   314   C CG2 . ILE A  1 67  ? -40.77184 -27.50695  59.51614  1.000 37.62125  ? 47   ILE A CG2 1 
ATOM   315   C CD1 . ILE A  1 67  ? -42.04564 -29.57821  57.61785  1.000 47.47392  ? 47   ILE A CD1 1 
ATOM   316   N N   . ASP A  1 68  ? -42.36250 -25.96051  61.77790  1.000 32.94882  ? 48   ASP A N   1 
ATOM   317   C CA  . ASP A  1 68  ? -42.42826 -26.29453  63.20038  1.000 32.94398  ? 48   ASP A CA  1 
ATOM   318   C C   . ASP A  1 68  ? -43.82358 -26.07897  63.79427  1.000 38.06673  ? 48   ASP A C   1 
ATOM   319   O O   . ASP A  1 68  ? -44.16252 -26.71029  64.80437  1.000 34.40640  ? 48   ASP A O   1 
ATOM   320   C CB  . ASP A  1 68  ? -41.39323 -25.48696  63.99473  1.000 31.44679  ? 48   ASP A CB  1 
ATOM   321   C CG  . ASP A  1 68  ? -39.95940 -25.87407  63.66703  1.000 32.24899  ? 48   ASP A CG  1 
ATOM   322   O OD1 . ASP A  1 68  ? -39.73478 -27.04870  63.32191  1.000 33.49361  ? 48   ASP A OD1 1 
ATOM   323   O OD2 . ASP A  1 68  ? -39.04979 -25.02036  63.78154  1.000 35.97069  ? 48   ASP A OD2 1 
ATOM   324   N N   . PHE A  1 69  ? -44.65899 -25.23439  63.18328  1.000 39.28889  ? 49   PHE A N   1 
ATOM   325   C CA  . PHE A  1 69  ? -45.98650 -25.02429  63.75200  1.000 35.30103  ? 49   PHE A CA  1 
ATOM   326   C C   . PHE A  1 69  ? -46.88650 -26.23215  63.51123  1.000 34.38047  ? 49   PHE A C   1 
ATOM   327   O O   . PHE A  1 69  ? -47.47330 -26.77819  64.45039  1.000 34.42160  ? 49   PHE A O   1 
ATOM   328   C CB  . PHE A  1 69  ? -46.58397 -23.72344  63.19994  1.000 35.10620  ? 49   PHE A CB  1 
ATOM   329   C CG  . PHE A  1 69  ? -45.88384 -22.51989  63.72600  1.000 33.88658  ? 49   PHE A CG  1 
ATOM   330   C CD1 . PHE A  1 69  ? -44.64840 -22.15133  63.22086  1.000 31.25447  ? 49   PHE A CD1 1 
ATOM   331   C CD2 . PHE A  1 69  ? -46.39709 -21.82836  64.80150  1.000 36.83167  ? 49   PHE A CD2 1 
ATOM   332   C CE1 . PHE A  1 69  ? -43.97801 -21.08669  63.74419  1.000 31.74955  ? 49   PHE A CE1 1 
ATOM   333   C CE2 . PHE A  1 69  ? -45.73221 -20.75356  65.32970  1.000 35.29049  ? 49   PHE A CE2 1 
ATOM   334   C CZ  . PHE A  1 69  ? -44.52565 -20.38120  64.80391  1.000 34.33885  ? 49   PHE A CZ  1 
ATOM   335   N N   . ALA A  1 70  ? -46.98738 -26.67816  62.26435  1.000 33.69767  ? 50   ALA A N   1 
ATOM   336   C CA  . ALA A  1 70  ? -47.79973 -27.84805  61.97290  1.000 29.96993  ? 50   ALA A CA  1 
ATOM   337   C C   . ALA A  1 70  ? -47.32499 -29.05266  62.77539  1.000 36.27981  ? 50   ALA A C   1 
ATOM   338   O O   . ALA A  1 70  ? -48.14073 -29.80847  63.31887  1.000 38.91302  ? 50   ALA A O   1 
ATOM   339   C CB  . ALA A  1 70  ? -47.74808 -28.14844  60.48107  1.000 29.38541  ? 50   ALA A CB  1 
ATOM   340   N N   . LEU A  1 71  ? -46.00336 -29.23417  62.87015  1.000 28.21353  ? 51   LEU A N   1 
ATOM   341   C CA  . LEU A  1 71  ? -45.45329 -30.36136  63.60852  1.000 28.24481  ? 51   LEU A CA  1 
ATOM   342   C C   . LEU A  1 71  ? -45.75526 -30.24308  65.09787  1.000 31.59426  ? 51   LEU A C   1 
ATOM   343   O O   . LEU A  1 71  ? -46.13469 -31.23081  65.73559  1.000 33.09373  ? 51   LEU A O   1 
ATOM   344   C CB  . LEU A  1 71  ? -43.94570 -30.47020  63.36492  1.000 28.49281  ? 51   LEU A CB  1 
ATOM   345   C CG  . LEU A  1 71  ? -43.50314 -30.72280  61.90636  1.000 38.32163  ? 51   LEU A CG  1 
ATOM   346   C CD1 . LEU A  1 71  ? -41.99823 -30.57131  61.77518  1.000 38.66478  ? 51   LEU A CD1 1 
ATOM   347   C CD2 . LEU A  1 71  ? -43.94250 -32.10100  61.36496  1.000 36.58003  ? 51   LEU A CD2 1 
ATOM   348   N N   . SER A  1 72  ? -45.61902 -29.03321  65.66001  1.000 35.73288  ? 52   SER A N   1 
ATOM   349   C CA  . SER A  1 72  ? -45.91538 -28.82227  67.07266  1.000 34.70474  ? 52   SER A CA  1 
ATOM   350   C C   . SER A  1 72  ? -47.40249 -29.00157  67.36372  1.000 37.04888  ? 52   SER A C   1 
ATOM   351   O O   . SER A  1 72  ? -47.77224 -29.53802  68.41504  1.000 35.58610  ? 52   SER A O   1 
ATOM   352   C CB  . SER A  1 72  ? -45.46095 -27.42597  67.50847  1.000 30.69888  ? 52   SER A CB  1 
ATOM   353   O OG  . SER A  1 72  ? -44.06081 -27.28751  67.42133  1.000 31.83482  ? 52   SER A OG  1 
ATOM   354   N N   . ASN A  1 73  ? -48.26745 -28.51640  66.46626  1.000 36.23547  ? 53   ASN A N   1 
ATOM   355   C CA  . ASN A  1 73  ? -49.69702 -28.77384  66.59720  1.000 35.78712  ? 53   ASN A CA  1 
ATOM   356   C C   . ASN A  1 73  ? -49.98721 -30.27677  66.71475  1.000 37.29188  ? 53   ASN A C   1 
ATOM   357   O O   . ASN A  1 73  ? -50.78207 -30.70679  67.55596  1.000 39.02449  ? 53   ASN A O   1 
ATOM   358   C CB  . ASN A  1 73  ? -50.44092 -28.17479  65.40198  1.000 35.03062  ? 53   ASN A CB  1 
ATOM   359   C CG  . ASN A  1 73  ? -50.54317 -26.66511  65.46355  1.000 38.92203  ? 53   ASN A CG  1 
ATOM   360   O OD1 . ASN A  1 73  ? -50.42904 -26.05809  66.54498  1.000 35.92047  ? 53   ASN A OD1 1 
ATOM   361   N ND2 . ASN A  1 73  ? -50.78104 -26.04269  64.29977  1.000 33.85507  ? 53   ASN A ND2 1 
ATOM   362   N N   . ALA A  1 74  ? -49.35791 -31.09031  65.86567  1.000 36.72642  ? 54   ALA A N   1 
ATOM   363   C CA  . ALA A  1 74  ? -49.63037 -32.52505  65.89294  1.000 41.80502  ? 54   ALA A CA  1 
ATOM   364   C C   . ALA A  1 74  ? -49.11350 -33.13794  67.18523  1.000 40.08462  ? 54   ALA A C   1 
ATOM   365   O O   . ALA A  1 74  ? -49.83170 -33.88185  67.86913  1.000 39.83395  ? 54   ALA A O   1 
ATOM   366   C CB  . ALA A  1 74  ? -49.00028 -33.20827  64.67746  1.000 29.51811  ? 54   ALA A CB  1 
ATOM   367   N N   . LEU A  1 75  ? -47.87137 -32.80191  67.54396  1.000 38.81152  ? 55   LEU A N   1 
ATOM   368   C CA  . LEU A  1 75  ? -47.29880 -33.20426  68.82624  1.000 38.69543  ? 55   LEU A CA  1 
ATOM   369   C C   . LEU A  1 75  ? -48.19806 -32.81064  70.00149  1.000 39.74545  ? 55   LEU A C   1 
ATOM   370   O O   . LEU A  1 75  ? -48.60813 -33.66240  70.80108  1.000 34.69006  ? 55   LEU A O   1 
ATOM   371   C CB  . LEU A  1 75  ? -45.91223 -32.58014  68.96127  1.000 39.64585  ? 55   LEU A CB  1 
ATOM   372   C CG  . LEU A  1 75  ? -45.13750 -32.86991  70.22618  1.000 43.59619  ? 55   LEU A CG  1 
ATOM   373   C CD1 . LEU A  1 75  ? -44.48220 -34.24641  70.11630  1.000 46.74813  ? 55   LEU A CD1 1 
ATOM   374   C CD2 . LEU A  1 75  ? -44.10404 -31.78838  70.43291  1.000 43.32145  ? 55   LEU A CD2 1 
ATOM   375   N N   . ASN A  1 76  ? -48.53052 -31.51226  70.10840  1.000 39.02850  ? 56   ASN A N   1 
ATOM   376   C CA  . ASN A  1 76  ? -49.32352 -31.02886  71.23963  1.000 40.50745  ? 56   ASN A CA  1 
ATOM   377   C C   . ASN A  1 76  ? -50.71793 -31.65648  71.26352  1.000 39.68723  ? 56   ASN A C   1 
ATOM   378   O O   . ASN A  1 76  ? -51.31880 -31.79478  72.34113  1.000 36.78133  ? 56   ASN A O   1 
ATOM   379   C CB  . ASN A  1 76  ? -49.45638 -29.48909  71.20514  1.000 40.81581  ? 56   ASN A CB  1 
ATOM   380   C CG  . ASN A  1 76  ? -48.11063 -28.74251  71.42588  1.000 41.85281  ? 56   ASN A CG  1 
ATOM   381   O OD1 . ASN A  1 76  ? -47.17175 -29.27354  72.01647  1.000 40.61255  ? 56   ASN A OD1 1 
ATOM   382   N ND2 . ASN A  1 76  ? -48.04141 -27.49422  70.95255  1.000 40.90640  ? 56   ASN A ND2 1 
ATOM   383   N N   . SER A  1 77  ? -51.26236 -31.99908  70.09240  1.000 36.06183  ? 57   SER A N   1 
ATOM   384   C CA  . SER A  1 77  ? -52.56994 -32.64210  70.00383  1.000 43.08369  ? 57   SER A CA  1 
ATOM   385   C C   . SER A  1 77  ? -52.52432 -34.12398  70.34314  1.000 44.74354  ? 57   SER A C   1 
ATOM   386   O O   . SER A  1 77  ? -53.57311 -34.77030  70.35116  1.000 48.40164  ? 57   SER A O   1 
ATOM   387   C CB  . SER A  1 77  ? -53.16496 -32.47839  68.59616  1.000 41.63662  ? 57   SER A CB  1 
ATOM   388   O OG  . SER A  1 77  ? -53.36639 -31.11441  68.27181  1.000 43.99455  ? 57   SER A OG  1 
ATOM   389   N N   . GLY A  1 78  ? -51.34413 -34.68264  70.58995  1.000 43.56798  ? 58   GLY A N   1 
ATOM   390   C CA  . GLY A  1 78  ? -51.22521 -36.06416  70.99332  1.000 38.95679  ? 58   GLY A CA  1 
ATOM   391   C C   . GLY A  1 78  ? -51.04483 -37.04838  69.86762  1.000 41.04007  ? 58   GLY A C   1 
ATOM   392   O O   . GLY A  1 78  ? -51.07816 -38.25700  70.11864  1.000 44.12837  ? 58   GLY A O   1 
ATOM   393   N N   . ILE A  1 79  ? -50.87224 -36.58210  68.63107  1.000 45.88808  ? 59   ILE A N   1 
ATOM   394   C CA  . ILE A  1 79  ? -50.59038 -37.49857  67.53289  1.000 43.26477  ? 59   ILE A CA  1 
ATOM   395   C C   . ILE A  1 79  ? -49.15901 -37.99260  67.65847  1.000 46.55515  ? 59   ILE A C   1 
ATOM   396   O O   . ILE A  1 79  ? -48.22141 -37.19185  67.75348  1.000 46.26294  ? 59   ILE A O   1 
ATOM   397   C CB  . ILE A  1 79  ? -50.81590 -36.81044  66.18491  1.000 37.96427  ? 59   ILE A CB  1 
ATOM   398   C CG1 . ILE A  1 79  ? -52.23108 -36.25662  66.11758  1.000 34.73133  ? 59   ILE A CG1 1 
ATOM   399   C CG2 . ILE A  1 79  ? -50.54588 -37.78750  65.04393  1.000 41.52059  ? 59   ILE A CG2 1 
ATOM   400   C CD1 . ILE A  1 79  ? -52.56786 -35.60823  64.77436  1.000 34.14606  ? 59   ILE A CD1 1 
ATOM   401   N N   . ARG A  1 80  ? -48.97925 -39.31545  67.65039  1.000 48.25452  ? 60   ARG A N   1 
ATOM   402   C CA  . ARG A  1 80  ? -47.66340 -39.90296  67.86889  1.000 48.60268  ? 60   ARG A CA  1 
ATOM   403   C C   . ARG A  1 80  ? -46.97250 -40.35465  66.58784  1.000 43.78749  ? 60   ARG A C   1 
ATOM   404   O O   . ARG A  1 80  ? -45.79884 -40.73288  66.64254  1.000 43.68050  ? 60   ARG A O   1 
ATOM   405   C CB  . ARG A  1 80  ? -47.77561 -41.07812  68.84288  1.000 55.72044  ? 60   ARG A CB  1 
ATOM   406   C CG  . ARG A  1 80  ? -48.30748 -40.65087  70.20105  1.000 62.60856  ? 60   ARG A CG  1 
ATOM   407   C CD  . ARG A  1 80  ? -48.21011 -41.76527  71.22208  1.000 72.27838  ? 60   ARG A CD  1 
ATOM   408   N NE  . ARG A  1 80  ? -49.43682 -42.55384  71.28207  1.000 80.01925  ? 60   ARG A NE  1 
ATOM   409   C CZ  . ARG A  1 80  ? -50.04027 -42.91909  72.41093  1.000 86.25006  ? 60   ARG A CZ  1 
ATOM   410   N NH1 . ARG A  1 80  ? -49.53237 -42.57249  73.59073  1.000 86.69304  ? 60   ARG A NH1 1 
ATOM   411   N NH2 . ARG A  1 80  ? -51.15185 -43.64257  72.35860  1.000 90.01248  ? 60   ARG A NH2 1 
ATOM   412   N N   . ARG A  1 81  ? -47.64729 -40.29899  65.44026  1.000 43.79987  ? 61   ARG A N   1 
ATOM   413   C CA  . ARG A  1 81  ? -47.06826 -40.72790  64.17255  1.000 43.80169  ? 61   ARG A CA  1 
ATOM   414   C C   . ARG A  1 81  ? -47.13155 -39.58007  63.17511  1.000 41.65208  ? 61   ARG A C   1 
ATOM   415   O O   . ARG A  1 81  ? -48.22193 -39.11491  62.82836  1.000 42.12070  ? 61   ARG A O   1 
ATOM   416   C CB  . ARG A  1 81  ? -47.78794 -41.96121  63.62370  1.000 38.35063  ? 61   ARG A CB  1 
ATOM   417   C CG  . ARG A  1 81  ? -47.45379 -43.21632  64.40789  1.000 38.14103  ? 61   ARG A CG  1 
ATOM   418   C CD  . ARG A  1 81  ? -47.97808 -44.45274  63.69497  1.000 42.41088  ? 61   ARG A CD  1 
ATOM   419   N NE  . ARG A  1 81  ? -47.87269 -45.65691  64.51816  1.000 46.37535  ? 61   ARG A NE  1 
ATOM   420   C CZ  . ARG A  1 81  ? -46.73293 -46.18887  64.95406  1.000 42.63276  ? 61   ARG A CZ  1 
ATOM   421   N NH1 . ARG A  1 81  ? -45.56409 -45.66965  64.61644  1.000 42.11201  ? 61   ARG A NH1 1 
ATOM   422   N NH2 . ARG A  1 81  ? -46.76388 -47.26990  65.70583  1.000 43.83055  ? 61   ARG A NH2 1 
ATOM   423   N N   . ILE A  1 82  ? -45.96600 -39.14801  62.69598  1.000 39.21355  ? 62   ILE A N   1 
ATOM   424   C CA  . ILE A  1 82  ? -45.86240 -38.02070  61.77911  1.000 42.31602  ? 62   ILE A CA  1 
ATOM   425   C C   . ILE A  1 82  ? -45.09397 -38.46982  60.54126  1.000 45.57949  ? 62   ILE A C   1 
ATOM   426   O O   . ILE A  1 82  ? -44.03098 -39.09414  60.65451  1.000 48.87302  ? 62   ILE A O   1 
ATOM   427   C CB  . ILE A  1 82  ? -45.18227 -36.80580  62.44523  1.000 40.37461  ? 62   ILE A CB  1 
ATOM   428   C CG1 . ILE A  1 82  ? -45.87865 -36.45298  63.76920  1.000 37.76713  ? 62   ILE A CG1 1 
ATOM   429   C CG2 . ILE A  1 82  ? -45.17373 -35.61640  61.48178  1.000 38.66518  ? 62   ILE A CG2 1 
ATOM   430   C CD1 . ILE A  1 82  ? -45.32947 -35.21739  64.46183  1.000 36.99033  ? 62   ILE A CD1 1 
ATOM   431   N N   . GLY A  1 83  ? -45.64891 -38.18257  59.37190  1.000 43.55975  ? 63   GLY A N   1 
ATOM   432   C CA  . GLY A  1 83  ? -44.92145 -38.28621  58.11619  1.000 42.47373  ? 63   GLY A CA  1 
ATOM   433   C C   . GLY A  1 83  ? -44.84068 -36.92196  57.45772  1.000 46.03797  ? 63   GLY A C   1 
ATOM   434   O O   . GLY A  1 83  ? -45.80076 -36.14723  57.50036  1.000 41.41073  ? 63   GLY A O   1 
ATOM   435   N N   . VAL A  1 84  ? -43.68723 -36.62808  56.85919  1.000 49.62370  ? 64   VAL A N   1 
ATOM   436   C CA  . VAL A  1 84  ? -43.44293 -35.34861  56.20421  1.000 43.69572  ? 64   VAL A CA  1 
ATOM   437   C C   . VAL A  1 84  ? -43.02589 -35.60861  54.75990  1.000 45.02059  ? 64   VAL A C   1 
ATOM   438   O O   . VAL A  1 84  ? -41.97355 -36.20980  54.50815  1.000 45.81852  ? 64   VAL A O   1 
ATOM   439   C CB  . VAL A  1 84  ? -42.37223 -34.52212  56.93066  1.000 38.58926  ? 64   VAL A CB  1 
ATOM   440   C CG1 . VAL A  1 84  ? -42.14137 -33.17802  56.18451  1.000 38.63571  ? 64   VAL A CG1 1 
ATOM   441   C CG2 . VAL A  1 84  ? -42.76100 -34.29018  58.39084  1.000 33.42228  ? 64   VAL A CG2 1 
ATOM   442   N N   . ALA A  1 85  ? -43.82253 -35.12566  53.81519  1.000 42.90182  ? 65   ALA A N   1 
ATOM   443   C CA  . ALA A  1 85  ? -43.48632 -35.26402  52.40456  1.000 50.04389  ? 65   ALA A CA  1 
ATOM   444   C C   . ALA A  1 85  ? -42.68468 -34.04771  51.95500  1.000 53.06931  ? 65   ALA A C   1 
ATOM   445   O O   . ALA A  1 85  ? -43.16563 -32.91428  52.04258  1.000 50.92063  ? 65   ALA A O   1 
ATOM   446   C CB  . ALA A  1 85  ? -44.74424 -35.43370  51.55778  1.000 49.68155  ? 65   ALA A CB  1 
ATOM   447   N N   . THR A  1 86  ? -41.45980 -34.27920  51.49110  1.000 56.61531  ? 66   THR A N   1 
ATOM   448   C CA  . THR A  1 86  ? -40.62511 -33.21647  50.95071  1.000 58.65523  ? 66   THR A CA  1 
ATOM   449   C C   . THR A  1 86  ? -40.35346 -33.48744  49.47635  1.000 61.16765  ? 66   THR A C   1 
ATOM   450   O O   . THR A  1 86  ? -40.66409 -34.55587  48.94517  1.000 56.17793  ? 66   THR A O   1 
ATOM   451   C CB  . THR A  1 86  ? -39.29961 -33.08924  51.71692  1.000 60.28396  ? 66   THR A CB  1 
ATOM   452   O OG1 . THR A  1 86  ? -38.39959 -34.12511  51.29970  1.000 65.12380  ? 66   THR A OG1 1 
ATOM   453   C CG2 . THR A  1 86  ? -39.53666 -33.21801  53.19632  1.000 60.52009  ? 66   THR A CG2 1 
ATOM   454   N N   . GLN A  1 87  ? -39.78338 -32.49466  48.81087  1.000 82.54725  ? 67   GLN A N   1 
ATOM   455   C CA  . GLN A  1 87  ? -39.26142 -32.70342  47.47468  1.000 90.54533  ? 67   GLN A CA  1 
ATOM   456   C C   . GLN A  1 87  ? -37.79745 -33.13825  47.60005  1.000 92.15902  ? 67   GLN A C   1 
ATOM   457   O O   . GLN A  1 87  ? -37.34415 -33.55701  48.67174  1.000 85.11936  ? 67   GLN A O   1 
ATOM   458   C CB  . GLN A  1 87  ? -39.47430 -31.44405  46.63394  1.000 98.75315  ? 67   GLN A CB  1 
ATOM   459   C CG  . GLN A  1 87  ? -40.93312 -30.96030  46.61617  1.000 108.54315 ? 67   GLN A CG  1 
ATOM   460   C CD  . GLN A  1 87  ? -41.86495 -31.84907  45.78621  1.000 121.11655 ? 67   GLN A CD  1 
ATOM   461   O OE1 . GLN A  1 87  ? -41.49282 -32.33186  44.71140  1.000 139.57131 ? 67   GLN A OE1 1 
ATOM   462   N NE2 . GLN A  1 87  ? -43.08275 -32.06815  46.29008  1.000 118.20151 ? 67   GLN A NE2 1 
ATOM   463   N N   . TYR A  1 88  ? -37.05132 -33.08032  46.49170  1.000 98.84361  ? 68   TYR A N   1 
ATOM   464   C CA  . TYR A  1 88  ? -35.60987 -33.29766  46.49521  1.000 96.12916  ? 68   TYR A CA  1 
ATOM   465   C C   . TYR A  1 88  ? -34.82263 -31.99095  46.53323  1.000 96.82531  ? 68   TYR A C   1 
ATOM   466   O O   . TYR A  1 88  ? -33.59956 -32.02484  46.70981  1.000 95.89970  ? 68   TYR A O   1 
ATOM   467   C CB  . TYR A  1 88  ? -35.19391 -34.12677  45.27354  1.000 100.49528 ? 68   TYR A CB  1 
ATOM   468   N N   . LYS A  1 89  ? -35.49420 -30.85180  46.34491  1.000 100.59693 ? 69   LYS A N   1 
ATOM   469   C CA  . LYS A  1 89  ? -34.97332 -29.53568  46.72978  1.000 100.82183 ? 69   LYS A CA  1 
ATOM   470   C C   . LYS A  1 89  ? -35.37364 -29.27987  48.18565  1.000 95.79514  ? 69   LYS A C   1 
ATOM   471   O O   . LYS A  1 89  ? -36.26702 -28.48517  48.50105  1.000 98.54129  ? 69   LYS A O   1 
ATOM   472   C CB  . LYS A  1 89  ? -35.50506 -28.45869  45.78837  1.000 102.86320 ? 69   LYS A CB  1 
ATOM   473   C CG  . LYS A  1 89  ? -35.17891 -26.99417  46.13365  1.000 103.07994 ? 69   LYS A CG  1 
ATOM   474   C CD  . LYS A  1 89  ? -33.80425 -26.79368  46.74899  1.000 97.74772  ? 69   LYS A CD  1 
ATOM   475   C CE  . LYS A  1 89  ? -33.42194 -25.32302  46.71349  1.000 98.73066  ? 69   LYS A CE  1 
ATOM   476   N NZ  . LYS A  1 89  ? -32.49771 -25.01583  45.58321  1.000 103.91883 ? 69   LYS A NZ  1 
ATOM   477   N N   . ALA A  1 90  ? -34.69706 -30.00039  49.08482  1.000 81.79294  ? 70   ALA A N   1 
ATOM   478   C CA  . ALA A  1 90  ? -35.08189 -29.96770  50.48671  1.000 69.64805  ? 70   ALA A CA  1 
ATOM   479   C C   . ALA A  1 90  ? -33.95874 -30.39466  51.42110  1.000 63.80678  ? 70   ALA A C   1 
ATOM   480   O O   . ALA A  1 90  ? -34.23444 -30.87521  52.52314  1.000 62.16870  ? 70   ALA A O   1 
ATOM   481   C CB  . ALA A  1 90  ? -36.30193 -30.86095  50.71398  1.000 65.71951  ? 70   ALA A CB  1 
ATOM   482   N N   . HIS A  1 91  ? -32.69729 -30.23364  51.00610  1.000 66.49081  ? 71   HIS A N   1 
ATOM   483   C CA  . HIS A  1 91  ? -31.59227 -30.58120  51.89818  1.000 68.69756  ? 71   HIS A CA  1 
ATOM   484   C C   . HIS A  1 91  ? -31.67624 -29.78599  53.19617  1.000 60.98023  ? 71   HIS A C   1 
ATOM   485   O O   . HIS A  1 91  ? -31.46030 -30.32670  54.28575  1.000 53.71711  ? 71   HIS A O   1 
ATOM   486   C CB  . HIS A  1 91  ? -30.23776 -30.35570  51.20714  1.000 80.07574  ? 71   HIS A CB  1 
ATOM   487   C CG  . HIS A  1 91  ? -29.05202 -30.69172  52.07032  1.000 86.91484  ? 71   HIS A CG  1 
ATOM   488   N ND1 . HIS A  1 91  ? -28.68838 -31.98941  52.37306  1.000 87.14341  ? 71   HIS A ND1 1 
ATOM   489   C CD2 . HIS A  1 91  ? -28.15963 -29.89593  52.70999  1.000 88.68611  ? 71   HIS A CD2 1 
ATOM   490   C CE1 . HIS A  1 91  ? -27.62377 -31.97816  53.15695  1.000 86.09459  ? 71   HIS A CE1 1 
ATOM   491   N NE2 . HIS A  1 91  ? -27.28320 -30.72040  53.37642  1.000 87.79631  ? 71   HIS A NE2 1 
ATOM   492   N N   . ASP A  1 92  ? -32.02169 -28.50725  53.09643  1.000 62.20072  ? 72   ASP A N   1 
ATOM   493   C CA  . ASP A  1 92  ? -32.17389 -27.68264  54.28397  1.000 56.87040  ? 72   ASP A CA  1 
ATOM   494   C C   . ASP A  1 92  ? -33.30440 -28.19366  55.15705  1.000 52.48224  ? 72   ASP A C   1 
ATOM   495   O O   . ASP A  1 92  ? -33.15640 -28.32962  56.37863  1.000 49.63921  ? 72   ASP A O   1 
ATOM   496   C CB  . ASP A  1 92  ? -32.42505 -26.24041  53.86264  1.000 67.08831  ? 72   ASP A CB  1 
ATOM   497   C CG  . ASP A  1 92  ? -31.55461 -25.27951  54.59707  1.000 75.67122  ? 72   ASP A CG  1 
ATOM   498   O OD1 . ASP A  1 92  ? -31.40514 -25.44380  55.83057  1.000 77.66467  ? 72   ASP A OD1 1 
ATOM   499   O OD2 . ASP A  1 92  ? -31.00154 -24.37492  53.93854  1.000 82.88371  ? 72   ASP A OD2 1 
ATOM   500   N N   . LEU A  1 93  ? -34.44413 -28.50382  54.54276  1.000 52.68919  ? 73   LEU A N   1 
ATOM   501   C CA  . LEU A  1 93  ? -35.59277 -28.92390  55.33323  1.000 53.47209  ? 73   LEU A CA  1 
ATOM   502   C C   . LEU A  1 93  ? -35.33814 -30.26771  56.00740  1.000 46.38618  ? 73   LEU A C   1 
ATOM   503   O O   . LEU A  1 93  ? -35.64469 -30.43971  57.19183  1.000 47.15846  ? 73   LEU A O   1 
ATOM   504   C CB  . LEU A  1 93  ? -36.84106 -28.97092  54.45271  1.000 51.13613  ? 73   LEU A CB  1 
ATOM   505   C CG  . LEU A  1 93  ? -38.08564 -29.57162  55.10443  1.000 49.69483  ? 73   LEU A CG  1 
ATOM   506   C CD1 . LEU A  1 93  ? -38.64407 -28.65930  56.19397  1.000 47.21355  ? 73   LEU A CD1 1 
ATOM   507   C CD2 . LEU A  1 93  ? -39.12635 -29.79046  54.03001  1.000 52.36125  ? 73   LEU A CD2 1 
ATOM   508   N N   . ILE A  1 94  ? -34.75398 -31.22013  55.28118  1.000 47.39114  ? 74   ILE A N   1 
ATOM   509   C CA  . ILE A  1 94  ? -34.51863 -32.54744  55.84736  1.000 45.27635  ? 74   ILE A CA  1 
ATOM   510   C C   . ILE A  1 94  ? -33.51969 -32.46425  56.99919  1.000 43.50146  ? 74   ILE A C   1 
ATOM   511   O O   . ILE A  1 94  ? -33.70939 -33.07408  58.06104  1.000 40.83858  ? 74   ILE A O   1 
ATOM   512   C CB  . ILE A  1 94  ? -34.05280 -33.51035  54.73298  1.000 52.21545  ? 74   ILE A CB  1 
ATOM   513   C CG1 . ILE A  1 94  ? -35.20158 -33.76675  53.73370  1.000 52.68545  ? 74   ILE A CG1 1 
ATOM   514   C CG2 . ILE A  1 94  ? -33.47494 -34.81863  55.32292  1.000 46.00207  ? 74   ILE A CG2 1 
ATOM   515   C CD1 . ILE A  1 94  ? -34.77880 -34.41214  52.39543  1.000 52.79806  ? 74   ILE A CD1 1 
ATOM   516   N N   . ARG A  1 95  ? -32.45328 -31.68404  56.81520  1.000 46.41160  ? 75   ARG A N   1 
ATOM   517   C CA  . ARG A  1 95  ? -31.47623 -31.49530  57.88196  1.000 49.45689  ? 75   ARG A CA  1 
ATOM   518   C C   . ARG A  1 95  ? -32.13096 -30.94689  59.14589  1.000 45.96953  ? 75   ARG A C   1 
ATOM   519   O O   . ARG A  1 95  ? -31.78690 -31.36082  60.25976  1.000 45.74737  ? 75   ARG A O   1 
ATOM   520   C CB  . ARG A  1 95  ? -30.36665 -30.56285  57.39587  1.000 56.94693  ? 75   ARG A CB  1 
ATOM   521   C CG  . ARG A  1 95  ? -29.18602 -30.39628  58.33082  1.000 61.84517  ? 75   ARG A CG  1 
ATOM   522   C CD  . ARG A  1 95  ? -27.95258 -30.02310  57.51785  1.000 74.12612  ? 75   ARG A CD  1 
ATOM   523   N NE  . ARG A  1 95  ? -27.10148 -29.06428  58.21714  1.000 81.63597  ? 75   ARG A NE  1 
ATOM   524   C CZ  . ARG A  1 95  ? -27.15510 -27.74005  58.05649  1.000 85.51513  ? 75   ARG A CZ  1 
ATOM   525   N NH1 . ARG A  1 95  ? -28.02627 -27.19424  57.21143  1.000 86.64482  ? 75   ARG A NH1 1 
ATOM   526   N NH2 . ARG A  1 95  ? -26.33100 -26.95500  58.74578  1.000 85.03145  ? 75   ARG A NH2 1 
ATOM   527   N N   . HIS A  1 96  ? -33.08968 -30.02704  58.99238  1.000 44.97773  ? 76   HIS A N   1 
ATOM   528   C CA  . HIS A  1 96  ? -33.78675 -29.46479  60.14941  1.000 43.66021  ? 76   HIS A CA  1 
ATOM   529   C C   . HIS A  1 96  ? -34.64337 -30.51458  60.84902  1.000 37.78892  ? 76   HIS A C   1 
ATOM   530   O O   . HIS A  1 96  ? -34.66339 -30.58624  62.07914  1.000 43.91630  ? 76   HIS A O   1 
ATOM   531   C CB  . HIS A  1 96  ? -34.65173 -28.27289  59.72368  1.000 43.38324  ? 76   HIS A CB  1 
ATOM   532   C CG  . HIS A  1 96  ? -35.60977 -27.80967  60.77874  1.000 40.98134  ? 76   HIS A CG  1 
ATOM   533   N ND1 . HIS A  1 96  ? -35.29261 -26.83675  61.70404  1.000 44.93996  ? 76   HIS A ND1 1 
ATOM   534   C CD2 . HIS A  1 96  ? -36.88526 -28.17854  61.04674  1.000 42.13362  ? 76   HIS A CD2 1 
ATOM   535   C CE1 . HIS A  1 96  ? -36.33373 -26.61935  62.48878  1.000 43.09793  ? 76   HIS A CE1 1 
ATOM   536   N NE2 . HIS A  1 96  ? -37.31026 -27.42971  62.11898  1.000 39.29700  ? 76   HIS A NE2 1 
ATOM   537   N N   . LEU A  1 97  ? -35.37635 -31.32167  60.08071  1.000 37.58599  ? 77   LEU A N   1 
ATOM   538   C CA  . LEU A  1 97  ? -36.18460 -32.39325  60.67537  1.000 45.47259  ? 77   LEU A CA  1 
ATOM   539   C C   . LEU A  1 97  ? -35.32479 -33.45712  61.35682  1.000 43.57455  ? 77   LEU A C   1 
ATOM   540   O O   . LEU A  1 97  ? -35.68250 -33.95439  62.43080  1.000 40.28483  ? 77   LEU A O   1 
ATOM   541   C CB  . LEU A  1 97  ? -37.08446 -33.03442  59.61702  1.000 40.35762  ? 77   LEU A CB  1 
ATOM   542   C CG  . LEU A  1 97  ? -37.93479 -32.01364  58.86354  1.000 41.44951  ? 77   LEU A CG  1 
ATOM   543   C CD1 . LEU A  1 97  ? -38.49751 -32.61951  57.61669  1.000 42.29243  ? 77   LEU A CD1 1 
ATOM   544   C CD2 . LEU A  1 97  ? -39.04689 -31.51241  59.77433  1.000 36.71345  ? 77   LEU A CD2 1 
ATOM   545   N N   . GLN A  1 98  ? -34.19689 -33.82153  60.74076  1.000 48.24818  ? 78   GLN A N   1 
ATOM   546   C CA  . GLN A  1 98  ? -33.27675 -34.78755  61.34368  1.000 44.75068  ? 78   GLN A CA  1 
ATOM   547   C C   . GLN A  1 98  ? -32.78366 -34.30633  62.70198  1.000 44.70257  ? 78   GLN A C   1 
ATOM   548   O O   . GLN A  1 98  ? -32.78889 -35.06678  63.67525  1.000 42.62139  ? 78   GLN A O   1 
ATOM   549   C CB  . GLN A  1 98  ? -32.08194 -35.04971  60.41009  1.000 41.32871  ? 78   GLN A CB  1 
ATOM   550   C CG  . GLN A  1 98  ? -32.45838 -35.71326  59.09694  1.000 43.95397  ? 78   GLN A CG  1 
ATOM   551   C CD  . GLN A  1 98  ? -31.28054 -35.88077  58.13397  1.000 49.65922  ? 78   GLN A CD  1 
ATOM   552   O OE1 . GLN A  1 98  ? -31.34908 -36.67951  57.21088  1.000 52.59864  ? 78   GLN A OE1 1 
ATOM   553   N NE2 . GLN A  1 98  ? -30.19306 -35.15604  58.36835  1.000 48.65454  ? 78   GLN A NE2 1 
ATOM   554   N N   . ARG A  1 99  ? -32.35571 -33.03808  62.78596  1.000 45.19906  ? 79   ARG A N   1 
ATOM   555   C CA  . ARG A  1 99  ? -31.70220 -32.53978  63.99356  1.000 41.17529  ? 79   ARG A CA  1 
ATOM   556   C C   . ARG A  1 99  ? -32.73134 -32.14097  65.04555  1.000 40.32179  ? 79   ARG A C   1 
ATOM   557   O O   . ARG A  1 99  ? -32.47337 -32.29749  66.24262  1.000 46.21181  ? 79   ARG A O   1 
ATOM   558   C CB  . ARG A  1 99  ? -30.74723 -31.36123  63.64443  1.000 45.79494  ? 79   ARG A CB  1 
ATOM   559   C CG  . ARG A  1 99  ? -29.60110 -31.60045  62.51631  1.000 59.30912  ? 79   ARG A CG  1 
ATOM   560   C CD  . ARG A  1 99  ? -28.35297 -32.37273  63.02333  1.000 76.00658  ? 79   ARG A CD  1 
ATOM   561   N NE  . ARG A  1 99  ? -28.39499 -33.82206  62.63459  1.000 85.68347  ? 79   ARG A NE  1 
ATOM   562   C CZ  . ARG A  1 99  ? -27.55093 -34.75506  63.12522  1.000 87.60048  ? 79   ARG A CZ  1 
ATOM   563   N NH1 . ARG A  1 99  ? -26.64489 -34.47976  64.02395  1.000 91.75145  ? 79   ARG A NH1 1 
ATOM   564   N NH2 . ARG A  1 99  ? -27.74971 -36.03496  62.61695  1.000 84.08502  ? 79   ARG A NH2 1 
ATOM   565   N N   . GLY A  1 100 ? -33.90023 -31.64408  64.62809  1.000 38.70895  ? 80   GLY A N   1 
ATOM   566   C CA  . GLY A  1 100 ? -34.86826 -31.08637  65.56020  1.000 33.61356  ? 80   GLY A CA  1 
ATOM   567   C C   . GLY A  1 100 ? -35.96929 -32.04122  65.99449  1.000 34.85518  ? 80   GLY A C   1 
ATOM   568   O O   . GLY A  1 100 ? -36.42427 -31.99442  67.13635  1.000 41.15486  ? 80   GLY A O   1 
ATOM   569   N N   . TRP A  1 101 ? -36.41078 -32.91211  65.09537  1.000 34.85147  ? 81   TRP A N   1 
ATOM   570   C CA  . TRP A  1 101 ? -37.52080 -33.82049  65.36449  1.000 33.69985  ? 81   TRP A CA  1 
ATOM   571   C C   . TRP A  1 101 ? -37.00174 -35.25520  65.43170  1.000 32.69801  ? 81   TRP A C   1 
ATOM   572   O O   . TRP A  1 101 ? -37.38283 -36.12303  64.63388  1.000 37.59691  ? 81   TRP A O   1 
ATOM   573   C CB  . TRP A  1 101 ? -38.60636 -33.62613  64.29664  1.000 36.45055  ? 81   TRP A CB  1 
ATOM   574   C CG  . TRP A  1 101 ? -39.23479 -32.24870  64.44664  1.000 33.28959  ? 81   TRP A CG  1 
ATOM   575   C CD1 . TRP A  1 101 ? -38.79030 -31.07343  63.89755  1.000 32.97533  ? 81   TRP A CD1 1 
ATOM   576   C CD2 . TRP A  1 101 ? -40.36285 -31.90722  65.26415  1.000 32.55262  ? 81   TRP A CD2 1 
ATOM   577   N NE1 . TRP A  1 101 ? -39.58708 -30.03408  64.30163  1.000 35.77094  ? 81   TRP A NE1 1 
ATOM   578   C CE2 . TRP A  1 101 ? -40.56143 -30.51546  65.13906  1.000 34.56773  ? 81   TRP A CE2 1 
ATOM   579   C CE3 . TRP A  1 101 ? -41.23113 -32.64509  66.07835  1.000 29.25007  ? 81   TRP A CE3 1 
ATOM   580   C CZ2 . TRP A  1 101 ? -41.59784 -29.84328  65.79276  1.000 36.84080  ? 81   TRP A CZ2 1 
ATOM   581   C CZ3 . TRP A  1 101 ? -42.26492 -31.97628  66.72216  1.000 32.31495  ? 81   TRP A CZ3 1 
ATOM   582   C CH2 . TRP A  1 101 ? -42.43296 -30.58664  66.58387  1.000 33.59999  ? 81   TRP A CH2 1 
ATOM   583   N N   . ASP A  1 102 ? -36.11958 -35.49864  66.40067  1.000 30.64982  ? 82   ASP A N   1 
ATOM   584   C CA  . ASP A  1 102 ? -35.32397 -36.71700  66.47631  1.000 33.38561  ? 82   ASP A CA  1 
ATOM   585   C C   . ASP A  1 102 ? -35.63974 -37.53293  67.71615  1.000 35.87499  ? 82   ASP A C   1 
ATOM   586   O O   . ASP A  1 102 ? -34.90794 -38.48508  68.00972  1.000 40.02723  ? 82   ASP A O   1 
ATOM   587   C CB  . ASP A  1 102 ? -33.82980 -36.37369  66.48850  1.000 35.03737  ? 82   ASP A CB  1 
ATOM   588   C CG  . ASP A  1 102 ? -33.46748 -35.44967  67.66398  1.000 36.82223  ? 82   ASP A CG  1 
ATOM   589   O OD1 . ASP A  1 102 ? -34.40300 -34.97187  68.34004  1.000 36.45778  ? 82   ASP A OD1 1 
ATOM   590   O OD2 . ASP A  1 102 ? -32.27297 -35.21971  67.92489  1.000 36.71098  ? 82   ASP A OD2 1 
ATOM   591   N N   . PHE A  1 103 ? -36.67839 -37.16852  68.47207  1.000 34.97614  ? 83   PHE A N   1 
ATOM   592   C CA  . PHE A  1 103 ? -36.91510 -37.74874  69.79125  1.000 32.08798  ? 83   PHE A CA  1 
ATOM   593   C C   . PHE A  1 103 ? -38.05519 -38.77229  69.79857  1.000 35.78612  ? 83   PHE A C   1 
ATOM   594   O O   . PHE A  1 103 ? -38.50529 -39.17632  70.88068  1.000 35.60322  ? 83   PHE A O   1 
ATOM   595   C CB  . PHE A  1 103 ? -37.17614 -36.63323  70.82150  1.000 27.52928  ? 83   PHE A CB  1 
ATOM   596   C CG  . PHE A  1 103 ? -38.30090 -35.71555  70.45589  1.000 29.87935  ? 83   PHE A CG  1 
ATOM   597   C CD1 . PHE A  1 103 ? -38.06173 -34.56133  69.68477  1.000 30.78264  ? 83   PHE A CD1 1 
ATOM   598   C CD2 . PHE A  1 103 ? -39.60586 -35.99143  70.86820  1.000 28.58372  ? 83   PHE A CD2 1 
ATOM   599   C CE1 . PHE A  1 103 ? -39.10649 -33.70002  69.33322  1.000 31.34934  ? 83   PHE A CE1 1 
ATOM   600   C CE2 . PHE A  1 103 ? -40.66272 -35.13655  70.52206  1.000 29.35986  ? 83   PHE A CE2 1 
ATOM   601   C CZ  . PHE A  1 103 ? -40.40501 -33.97501  69.75101  1.000 31.52065  ? 83   PHE A CZ  1 
ATOM   602   N N   . PHE A  1 104 ? -38.52489 -39.20897  68.62417  1.000 33.24237  ? 84   PHE A N   1 
ATOM   603   C CA  . PHE A  1 104 ? -39.55683 -40.24115  68.55502  1.000 32.69044  ? 84   PHE A CA  1 
ATOM   604   C C   . PHE A  1 104 ? -38.90561 -41.62135  68.61001  1.000 35.54510  ? 84   PHE A C   1 
ATOM   605   O O   . PHE A  1 104 ? -37.83870 -41.83781  68.03966  1.000 40.53949  ? 84   PHE A O   1 
ATOM   606   C CB  . PHE A  1 104 ? -40.39124 -40.08844  67.27590  1.000 35.80247  ? 84   PHE A CB  1 
ATOM   607   C CG  . PHE A  1 104 ? -41.32348 -38.88695  67.27975  1.000 40.72856  ? 84   PHE A CG  1 
ATOM   608   C CD1 . PHE A  1 104 ? -40.82410 -37.58916  67.38591  1.000 43.32414  ? 84   PHE A CD1 1 
ATOM   609   C CD2 . PHE A  1 104 ? -42.69625 -39.05118  67.16196  1.000 42.45066  ? 84   PHE A CD2 1 
ATOM   610   C CE1 . PHE A  1 104 ? -41.67545 -36.49282  67.38932  1.000 41.60377  ? 84   PHE A CE1 1 
ATOM   611   C CE2 . PHE A  1 104 ? -43.55931 -37.94700  67.15534  1.000 38.89107  ? 84   PHE A CE2 1 
ATOM   612   C CZ  . PHE A  1 104 ? -43.04906 -36.67391  67.27140  1.000 38.35970  ? 84   PHE A CZ  1 
ATOM   613   N N   . ARG A  1 105 ? -39.52330 -42.54806  69.33529  1.000 36.51634  ? 85   ARG A N   1 
ATOM   614   C CA  . ARG A  1 105 ? -38.97537 -43.89662  69.47896  1.000 35.65823  ? 85   ARG A CA  1 
ATOM   615   C C   . ARG A  1 105 ? -40.01999 -44.90775  69.02356  1.000 36.05248  ? 85   ARG A C   1 
ATOM   616   O O   . ARG A  1 105 ? -41.13142 -44.93468  69.57782  1.000 35.53319  ? 85   ARG A O   1 
ATOM   617   C CB  . ARG A  1 105 ? -38.54515 -44.17779  70.92614  1.000 40.23853  ? 85   ARG A CB  1 
ATOM   618   C CG  . ARG A  1 105 ? -37.33393 -43.38799  71.39332  1.000 41.37488  ? 85   ARG A CG  1 
ATOM   619   C CD  . ARG A  1 105 ? -36.10059 -43.70484  70.53880  1.000 47.99125  ? 85   ARG A CD  1 
ATOM   620   N NE  . ARG A  1 105 ? -35.72842 -45.11901  70.64244  1.000 60.88530  ? 85   ARG A NE  1 
ATOM   621   C CZ  . ARG A  1 105 ? -34.56150 -45.64963  70.25312  1.000 64.71709  ? 85   ARG A CZ  1 
ATOM   622   N NH1 . ARG A  1 105 ? -33.60265 -44.90244  69.70315  1.000 64.34432  ? 85   ARG A NH1 1 
ATOM   623   N NH2 . ARG A  1 105 ? -34.34280 -46.94615  70.43433  1.000 64.28473  ? 85   ARG A NH2 1 
ATOM   624   N N   . PRO A  1 106 ? -39.74063 -45.72815  68.01339  1.000 36.52235  ? 86   PRO A N   1 
ATOM   625   C CA  . PRO A  1 106 ? -40.74794 -46.71445  67.58062  1.000 39.93339  ? 86   PRO A CA  1 
ATOM   626   C C   . PRO A  1 106 ? -41.22399 -47.65075  68.68482  1.000 41.17536  ? 86   PRO A C   1 
ATOM   627   O O   . PRO A  1 106 ? -42.40475 -48.02685  68.67325  1.000 42.74738  ? 86   PRO A O   1 
ATOM   628   C CB  . PRO A  1 106 ? -40.02784 -47.46644  66.45273  1.000 38.05047  ? 86   PRO A CB  1 
ATOM   629   C CG  . PRO A  1 106 ? -39.12173 -46.39828  65.85478  1.000 35.52670  ? 86   PRO A CG  1 
ATOM   630   C CD  . PRO A  1 106 ? -38.62258 -45.61649  67.06074  1.000 35.04076  ? 86   PRO A CD  1 
ATOM   631   N N   . GLU A  1 107 ? -40.36663 -48.01754  69.64932  1.000 38.86066  ? 87   GLU A N   1 
ATOM   632   C CA  . GLU A  1 107 ? -40.80282 -48.90608  70.73194  1.000 38.91691  ? 87   GLU A CA  1 
ATOM   633   C C   . GLU A  1 107 ? -41.92483 -48.32166  71.56105  1.000 37.15592  ? 87   GLU A C   1 
ATOM   634   O O   . GLU A  1 107 ? -42.64719 -49.08597  72.20518  1.000 40.54611  ? 87   GLU A O   1 
ATOM   635   C CB  . GLU A  1 107 ? -39.68791 -49.24315  71.71700  1.000 39.34023  ? 87   GLU A CB  1 
ATOM   636   C CG  . GLU A  1 107 ? -38.43088 -49.57449  71.10179  1.000 50.55819  ? 87   GLU A CG  1 
ATOM   637   C CD  . GLU A  1 107 ? -37.52570 -48.38316  71.06442  1.000 38.57612  ? 87   GLU A CD  1 
ATOM   638   O OE1 . GLU A  1 107 ? -37.92183 -47.35016  70.48673  1.000 36.14512  ? 87   GLU A OE1 1 
ATOM   639   O OE2 . GLU A  1 107 ? -36.42961 -48.49891  71.61747  1.000 39.97376  ? 87   GLU A OE2 1 
ATOM   640   N N   . ARG A  1 108 ? -42.04923 -46.99657  71.61185  1.000 35.32698  ? 88   ARG A N   1 
ATOM   641   C CA  . ARG A  1 108 ? -43.15069 -46.33103  72.29699  1.000 33.99025  ? 88   ARG A CA  1 
ATOM   642   C C   . ARG A  1 108 ? -44.29688 -45.99195  71.35062  1.000 34.89583  ? 88   ARG A C   1 
ATOM   643   O O   . ARG A  1 108 ? -45.11658 -45.12251  71.67019  1.000 34.55380  ? 88   ARG A O   1 
ATOM   644   C CB  . ARG A  1 108 ? -42.65894 -45.06071  72.99039  1.000 32.61113  ? 88   ARG A CB  1 
ATOM   645   C CG  . ARG A  1 108 ? -41.56190 -45.31159  74.00363  1.000 39.63124  ? 88   ARG A CG  1 
ATOM   646   C CD  . ARG A  1 108 ? -41.39483 -44.13528  74.93446  1.000 37.47602  ? 88   ARG A CD  1 
ATOM   647   N NE  . ARG A  1 108 ? -41.00508 -42.92434  74.21538  1.000 38.19352  ? 88   ARG A NE  1 
ATOM   648   C CZ  . ARG A  1 108 ? -39.77365 -42.41423  74.20727  1.000 40.95759  ? 88   ARG A CZ  1 
ATOM   649   N NH1 . ARG A  1 108 ? -38.79155 -43.01834  74.87908  1.000 41.28069  ? 88   ARG A NH1 1 
ATOM   650   N NH2 . ARG A  1 108 ? -39.52190 -41.30875  73.50875  1.000 37.10027  ? 88   ARG A NH2 1 
ATOM   651   N N   . ASN A  1 109 ? -44.34894 -46.64054  70.18345  1.000 38.64723  ? 89   ASN A N   1 
ATOM   652   C CA  . ASN A  1 109 ? -45.40084 -46.41764  69.19105  1.000 43.77683  ? 89   ASN A CA  1 
ATOM   653   C C   . ASN A  1 109 ? -45.38903 -44.98614  68.66636  1.000 45.20138  ? 89   ASN A C   1 
ATOM   654   O O   . ASN A  1 109 ? -46.42519 -44.42073  68.33732  1.000 45.44236  ? 89   ASN A O   1 
ATOM   655   C CB  . ASN A  1 109 ? -46.77844 -46.78183  69.75132  1.000 47.61112  ? 89   ASN A CB  1 
ATOM   656   C CG  . ASN A  1 109 ? -46.96955 -48.27862  69.86898  1.000 48.53243  ? 89   ASN A CG  1 
ATOM   657   O OD1 . ASN A  1 109 ? -46.53995 -49.02088  68.99919  1.000 52.70412  ? 89   ASN A OD1 1 
ATOM   658   N ND2 . ASN A  1 109 ? -47.60637 -48.72766  70.94428  1.000 49.02640  ? 89   ASN A ND2 1 
ATOM   659   N N   . GLU A  1 110 ? -44.21061 -44.39350  68.60459  1.000 46.99488  ? 90   GLU A N   1 
ATOM   660   C CA  . GLU A  1 110 ? -43.99428 -43.10934  67.97638  1.000 47.61047  ? 90   GLU A CA  1 
ATOM   661   C C   . GLU A  1 110 ? -43.18931 -43.33974  66.70565  1.000 48.47203  ? 90   GLU A C   1 
ATOM   662   O O   . GLU A  1 110 ? -42.38516 -44.27435  66.63350  1.000 47.88304  ? 90   GLU A O   1 
ATOM   663   C CB  . GLU A  1 110 ? -43.24363 -42.16614  68.91778  1.000 46.39778  ? 90   GLU A CB  1 
ATOM   664   C CG  . GLU A  1 110 ? -43.85954 -42.01443  70.29595  1.000 40.68180  ? 90   GLU A CG  1 
ATOM   665   C CD  . GLU A  1 110 ? -42.85224 -41.56531  71.32074  1.000 43.73539  ? 90   GLU A CD  1 
ATOM   666   O OE1 . GLU A  1 110 ? -41.67391 -41.34203  70.95449  1.000 43.68919  ? 90   GLU A OE1 1 
ATOM   667   O OE2 . GLU A  1 110 ? -43.23014 -41.44699  72.50608  1.000 51.99323  ? 90   GLU A OE2 1 
ATOM   668   N N   . SER A  1 111 ? -43.41901 -42.49966  65.69614  1.000 44.07500  ? 91   SER A N   1 
ATOM   669   C CA  . SER A  1 111 ? -42.61917 -42.56054  64.48009  1.000 43.24736  ? 91   SER A CA  1 
ATOM   670   C C   . SER A  1 111 ? -42.57233 -41.17746  63.85939  1.000 43.43612  ? 91   SER A C   1 
ATOM   671   O O   . SER A  1 111 ? -43.57532 -40.46571  63.85976  1.000 49.34272  ? 91   SER A O   1 
ATOM   672   C CB  . SER A  1 111 ? -43.16936 -43.57841  63.46047  1.000 43.33489  ? 91   SER A CB  1 
ATOM   673   O OG  . SER A  1 111 ? -44.58809 -43.57210  63.38987  1.000 40.40788  ? 91   SER A OG  1 
ATOM   674   N N   . PHE A  1 112 ? -41.40381 -40.80657  63.33680  1.000 41.35481  ? 92   PHE A N   1 
ATOM   675   C CA  . PHE A  1 112 ? -41.23847 -39.59444  62.53921  1.000 38.35093  ? 92   PHE A CA  1 
ATOM   676   C C   . PHE A  1 112 ? -40.58566 -39.99410  61.22342  1.000 38.15322  ? 92   PHE A C   1 
ATOM   677   O O   . PHE A  1 112 ? -39.43497 -40.43727  61.20305  1.000 39.92558  ? 92   PHE A O   1 
ATOM   678   C CB  . PHE A  1 112 ? -40.40777 -38.53923  63.27936  1.000 39.07366  ? 92   PHE A CB  1 
ATOM   679   C CG  . PHE A  1 112 ? -40.58963 -37.13871  62.73929  1.000 40.38370  ? 92   PHE A CG  1 
ATOM   680   C CD1 . PHE A  1 112 ? -39.92996 -36.72627  61.58905  1.000 43.20260  ? 92   PHE A CD1 1 
ATOM   681   C CD2 . PHE A  1 112 ? -41.42959 -36.25289  63.36517  1.000 40.78824  ? 92   PHE A CD2 1 
ATOM   682   C CE1 . PHE A  1 112 ? -40.10251 -35.44010  61.08913  1.000 42.20814  ? 92   PHE A CE1 1 
ATOM   683   C CE2 . PHE A  1 112 ? -41.60079 -34.96273  62.87923  1.000 46.74961  ? 92   PHE A CE2 1 
ATOM   684   C CZ  . PHE A  1 112 ? -40.93706 -34.56369  61.73313  1.000 44.16124  ? 92   PHE A CZ  1 
ATOM   685   N N   . ASP A  1 113 ? -41.31615 -39.86355  60.12402  1.000 42.71845  ? 93   ASP A N   1 
ATOM   686   C CA  . ASP A  1 113 ? -40.84780 -40.34716  58.83382  1.000 39.86897  ? 93   ASP A CA  1 
ATOM   687   C C   . ASP A  1 113 ? -40.65604 -39.16991  57.88487  1.000 45.25919  ? 93   ASP A C   1 
ATOM   688   O O   . ASP A  1 113 ? -41.60557 -38.42479  57.60701  1.000 47.20697  ? 93   ASP A O   1 
ATOM   689   C CB  . ASP A  1 113 ? -41.81945 -41.38559  58.27774  1.000 44.29887  ? 93   ASP A CB  1 
ATOM   690   C CG  . ASP A  1 113 ? -41.70432 -42.72690  59.00786  1.000 49.00062  ? 93   ASP A CG  1 
ATOM   691   O OD1 . ASP A  1 113 ? -40.58187 -43.28096  59.02164  1.000 48.77180  ? 93   ASP A OD1 1 
ATOM   692   O OD2 . ASP A  1 113 ? -42.71320 -43.22224  59.56634  1.000 48.81340  ? 93   ASP A OD2 1 
ATOM   693   N N   . ILE A  1 114 ? -39.41701 -38.98491  57.42736  1.000 49.57292  ? 94   ILE A N   1 
ATOM   694   C CA  . ILE A  1 114 ? -39.08103 -38.02278  56.37720  1.000 51.46781  ? 94   ILE A CA  1 
ATOM   695   C C   . ILE A  1 114 ? -39.19293 -38.73620  55.03419  1.000 55.79666  ? 94   ILE A C   1 
ATOM   696   O O   . ILE A  1 114 ? -38.45563 -39.69306  54.76960  1.000 58.89726  ? 94   ILE A O   1 
ATOM   697   C CB  . ILE A  1 114 ? -37.66856 -37.45117  56.58042  1.000 48.43629  ? 94   ILE A CB  1 
ATOM   698   C CG1 . ILE A  1 114 ? -37.57717 -36.71009  57.91710  1.000 44.70185  ? 94   ILE A CG1 1 
ATOM   699   C CG2 . ILE A  1 114 ? -37.27493 -36.55962  55.41415  1.000 52.01467  ? 94   ILE A CG2 1 
ATOM   700   C CD1 . ILE A  1 114 ? -36.16811 -36.39079  58.35090  1.000 45.19310  ? 94   ILE A CD1 1 
ATOM   701   N N   . LEU A  1 115 ? -40.11933 -38.27983  54.18471  1.000 54.08899  ? 95   LEU A N   1 
ATOM   702   C CA  . LEU A  1 115 ? -40.47420 -38.97048  52.94327  1.000 53.01182  ? 95   LEU A CA  1 
ATOM   703   C C   . LEU A  1 115 ? -40.21441 -38.06483  51.74523  1.000 53.13924  ? 95   LEU A C   1 
ATOM   704   O O   . LEU A  1 115 ? -41.14576 -37.44709  51.20512  1.000 55.01992  ? 95   LEU A O   1 
ATOM   705   C CB  . LEU A  1 115 ? -41.93064 -39.42846  52.98069  1.000 53.61933  ? 95   LEU A CB  1 
ATOM   706   C CG  . LEU A  1 115 ? -42.27124 -40.06892  54.32533  1.000 50.78155  ? 95   LEU A CG  1 
ATOM   707   C CD1 . LEU A  1 115 ? -43.75393 -40.26942  54.47801  1.000 46.67637  ? 95   LEU A CD1 1 
ATOM   708   C CD2 . LEU A  1 115 ? -41.54062 -41.39947  54.41753  1.000 58.34753  ? 95   LEU A CD2 1 
ATOM   709   N N   . PRO A  1 116 ? -38.96899 -37.97291  51.29395  1.000 56.53337  ? 96   PRO A N   1 
ATOM   710   C CA  . PRO A  1 116 ? -38.67799 -37.22965  50.06777  1.000 67.33046  ? 96   PRO A CA  1 
ATOM   711   C C   . PRO A  1 116 ? -39.08388 -38.01917  48.83354  1.000 76.05221  ? 96   PRO A C   1 
ATOM   712   O O   . PRO A  1 116 ? -39.19923 -39.24677  48.84961  1.000 75.10691  ? 96   PRO A O   1 
ATOM   713   C CB  . PRO A  1 116 ? -37.15533 -37.03647  50.11012  1.000 68.03782  ? 96   PRO A CB  1 
ATOM   714   C CG  . PRO A  1 116 ? -36.67023 -37.79236  51.34061  1.000 63.32969  ? 96   PRO A CG  1 
ATOM   715   C CD  . PRO A  1 116 ? -37.78031 -38.66755  51.80796  1.000 56.64859  ? 96   PRO A CD  1 
ATOM   716   N N   . ALA A  1 117 ? -39.30530 -37.28429  47.74952  1.000 97.07228  ? 97   ALA A N   1 
ATOM   717   C CA  . ALA A  1 117 ? -39.49276 -37.91942  46.45324  1.000 102.73606 ? 97   ALA A CA  1 
ATOM   718   C C   . ALA A  1 117 ? -38.15677 -38.48828  45.98960  1.000 113.96596 ? 97   ALA A C   1 
ATOM   719   O O   . ALA A  1 117 ? -37.16803 -37.75424  45.88297  1.000 116.05192 ? 97   ALA A O   1 
ATOM   720   C CB  . ALA A  1 117 ? -40.04523 -36.91578  45.44791  1.000 101.52731 ? 97   ALA A CB  1 
ATOM   721   N N   . SER A  1 118 ? -38.11465 -39.79529  45.74008  1.000 123.22066 ? 98   SER A N   1 
ATOM   722   C CA  . SER A  1 118 ? -36.85127 -40.46621  45.45722  1.000 134.97648 ? 98   SER A CA  1 
ATOM   723   C C   . SER A  1 118 ? -37.12061 -41.78468  44.73643  1.000 142.02666 ? 98   SER A C   1 
ATOM   724   O O   . SER A  1 118 ? -38.26955 -42.19262  44.53940  1.000 138.37908 ? 98   SER A O   1 
ATOM   725   C CB  . SER A  1 118 ? -36.05138 -40.68989  46.74499  1.000 132.97812 ? 98   SER A CB  1 
ATOM   726   O OG  . SER A  1 118 ? -36.82906 -41.36186  47.71876  1.000 126.63092 ? 98   SER A OG  1 
ATOM   727   N N   . GLN A  1 119 ? -36.03102 -42.45350  44.35111  1.000 152.33264 ? 99   GLN A N   1 
ATOM   728   C CA  . GLN A  1 119 ? -36.08812 -43.71387  43.60729  1.000 159.17703 ? 99   GLN A CA  1 
ATOM   729   C C   . GLN A  1 119 ? -36.00776 -44.89320  44.58099  1.000 158.49785 ? 99   GLN A C   1 
ATOM   730   O O   . GLN A  1 119 ? -35.03599 -45.65109  44.62972  1.000 162.68508 ? 99   GLN A O   1 
ATOM   731   C CB  . GLN A  1 119 ? -34.97431 -43.76356  42.56776  1.000 167.46725 ? 99   GLN A CB  1 
ATOM   732   N N   . ARG A  1 120 ? -37.07353 -45.03753  45.37063  1.000 151.81497 ? 100  ARG A N   1 
ATOM   733   C CA  . ARG A  1 120 ? -37.16572 -46.11367  46.35255  1.000 147.78192 ? 100  ARG A CA  1 
ATOM   734   C C   . ARG A  1 120 ? -37.54204 -47.42242  45.66148  1.000 149.35803 ? 100  ARG A C   1 
ATOM   735   O O   . ARG A  1 120 ? -36.68027 -48.27624  45.42424  1.000 154.10804 ? 100  ARG A O   1 
ATOM   736   C CB  . ARG A  1 120 ? -38.17644 -45.74520  47.44607  1.000 139.96848 ? 100  ARG A CB  1 
ATOM   737   C CG  . ARG A  1 120 ? -37.76910 -44.53466  48.29798  1.000 134.70121 ? 100  ARG A CG  1 
ATOM   738   C CD  . ARG A  1 120 ? -38.93379 -43.57015  48.50710  1.000 128.47549 ? 100  ARG A CD  1 
ATOM   739   N NE  . ARG A  1 120 ? -40.14039 -44.25768  48.96083  1.000 124.20176 ? 100  ARG A NE  1 
ATOM   740   C CZ  . ARG A  1 120 ? -40.40001 -44.56493  50.22827  1.000 117.88054 ? 100  ARG A CZ  1 
ATOM   741   N NH1 . ARG A  1 120 ? -41.52477 -45.19702  50.54062  1.000 112.55923 ? 100  ARG A NH1 1 
ATOM   742   N NH2 . ARG A  1 120 ? -39.53673 -44.24095  51.18186  1.000 117.29163 ? 100  ARG A NH2 1 
ATOM   743   N N   . VAL A  1 121 ? -38.82452 -47.59403  45.34239  1.000 145.68956 ? 101  VAL A N   1 
ATOM   744   C CA  . VAL A  1 121 ? -39.26667 -48.65723  44.44522  1.000 147.65154 ? 101  VAL A CA  1 
ATOM   745   C C   . VAL A  1 121 ? -40.05528 -47.98698  43.32810  1.000 147.89577 ? 101  VAL A C   1 
ATOM   746   O O   . VAL A  1 121 ? -40.99861 -48.56826  42.77769  1.000 149.07766 ? 101  VAL A O   1 
ATOM   747   C CB  . VAL A  1 121 ? -40.10598 -49.72326  45.17508  1.000 143.61523 ? 101  VAL A CB  1 
ATOM   748   N N   . SER A  1 122 ? -39.65460 -46.75678  42.98259  1.000 146.62935 ? 102  SER A N   1 
ATOM   749   C CA  . SER A  1 122 ? -40.41908 -45.87123  42.11351  1.000 144.52571 ? 102  SER A CA  1 
ATOM   750   C C   . SER A  1 122 ? -39.67164 -45.39766  40.86903  1.000 152.10800 ? 102  SER A C   1 
ATOM   751   O O   . SER A  1 122 ? -40.32693 -45.01957  39.89530  1.000 154.18953 ? 102  SER A O   1 
ATOM   752   C CB  . SER A  1 122 ? -40.88725 -44.63679  42.90745  1.000 135.16597 ? 102  SER A CB  1 
ATOM   753   O OG  . SER A  1 122 ? -41.55526 -43.70610  42.07580  1.000 134.00666 ? 102  SER A OG  1 
ATOM   754   N N   . GLU A  1 123 ? -38.33181 -45.39790  40.87928  1.000 156.40912 ? 103  GLU A N   1 
ATOM   755   C CA  . GLU A  1 123 ? -37.47544 -44.93981  39.77957  1.000 162.61356 ? 103  GLU A CA  1 
ATOM   756   C C   . GLU A  1 123 ? -37.53092 -43.42325  39.59590  1.000 162.50433 ? 103  GLU A C   1 
ATOM   757   O O   . GLU A  1 123 ? -36.49614 -42.75094  39.67798  1.000 164.58076 ? 103  GLU A O   1 
ATOM   758   C CB  . GLU A  1 123 ? -37.82494 -45.64963  38.46423  1.000 166.80884 ? 103  GLU A CB  1 
ATOM   759   N N   . THR A  1 124 ? -38.71814 -42.87114  39.34638  1.000 160.57214 ? 104  THR A N   1 
ATOM   760   C CA  . THR A  1 124 ? -38.84444 -41.42486  39.22328  1.000 159.85282 ? 104  THR A CA  1 
ATOM   761   C C   . THR A  1 124 ? -38.50921 -40.74683  40.55091  1.000 157.29735 ? 104  THR A C   1 
ATOM   762   O O   . THR A  1 124 ? -38.57177 -41.35067  41.62788  1.000 153.73905 ? 104  THR A O   1 
ATOM   763   C CB  . THR A  1 124 ? -40.25308 -41.03132  38.77095  1.000 154.93940 ? 104  THR A CB  1 
ATOM   764   O OG1 . THR A  1 124 ? -40.32893 -39.60596  38.63363  1.000 153.02796 ? 104  THR A OG1 1 
ATOM   765   C CG2 . THR A  1 124 ? -41.29962 -41.49590  39.77870  1.000 147.87943 ? 104  THR A CG2 1 
ATOM   766   N N   . GLN A  1 125 ? -38.14099 -39.46998  40.46398  1.000 158.95374 ? 105  GLN A N   1 
ATOM   767   C CA  . GLN A  1 125 ? -37.65762 -38.72948  41.62177  1.000 156.10153 ? 105  GLN A CA  1 
ATOM   768   C C   . GLN A  1 125 ? -38.48454 -37.47339  41.88959  1.000 152.91830 ? 105  GLN A C   1 
ATOM   769   O O   . GLN A  1 125 ? -37.95751 -36.48031  42.39559  1.000 154.64555 ? 105  GLN A O   1 
ATOM   770   C CB  . GLN A  1 125 ? -36.18113 -38.37348  41.44431  1.000 161.29307 ? 105  GLN A CB  1 
ATOM   771   N N   . TRP A  1 126 ? -39.78016 -37.49617  41.56607  1.000 148.29587 ? 106  TRP A N   1 
ATOM   772   C CA  . TRP A  1 126 ? -40.63183 -36.33319  41.79182  1.000 142.97750 ? 106  TRP A CA  1 
ATOM   773   C C   . TRP A  1 126 ? -42.06400 -36.76283  42.09422  1.000 130.61405 ? 106  TRP A C   1 
ATOM   774   O O   . TRP A  1 126 ? -42.55611 -37.75068  41.53857  1.000 130.69272 ? 106  TRP A O   1 
ATOM   775   C CB  . TRP A  1 126 ? -40.61281 -35.38051  40.58540  1.000 152.22317 ? 106  TRP A CB  1 
ATOM   776   C CG  . TRP A  1 126 ? -39.29957 -34.66383  40.40392  1.000 159.78196 ? 106  TRP A CG  1 
ATOM   777   C CD1 . TRP A  1 126 ? -38.93338 -33.46323  40.94794  1.000 160.47056 ? 106  TRP A CD1 1 
ATOM   778   C CD2 . TRP A  1 126 ? -38.17986 -35.10992  39.62574  1.000 166.67654 ? 106  TRP A CD2 1 
ATOM   779   N NE1 . TRP A  1 126 ? -37.65540 -33.13738  40.55604  1.000 167.12116 ? 106  TRP A NE1 1 
ATOM   780   C CE2 . TRP A  1 126 ? -37.17159 -34.13127  39.74425  1.000 170.93425 ? 106  TRP A CE2 1 
ATOM   781   C CE3 . TRP A  1 126 ? -37.93230 -36.24374  38.84266  1.000 168.77431 ? 106  TRP A CE3 1 
ATOM   782   C CZ2 . TRP A  1 126 ? -35.93771 -34.25223  39.10615  1.000 177.29472 ? 106  TRP A CZ2 1 
ATOM   783   C CZ3 . TRP A  1 126 ? -36.71005 -36.36194  38.21378  1.000 175.15460 ? 106  TRP A CZ3 1 
ATOM   784   C CH2 . TRP A  1 126 ? -35.72795 -35.37270  38.34735  1.000 179.43065 ? 106  TRP A CH2 1 
ATOM   785   N N   . TYR A  1 127 ? -42.71956 -36.00876  42.98619  1.000 119.41314 ? 107  TYR A N   1 
ATOM   786   C CA  . TYR A  1 127 ? -44.13291 -36.19394  43.30769  1.000 107.63643 ? 107  TYR A CA  1 
ATOM   787   C C   . TYR A  1 127 ? -44.99263 -35.38913  42.34245  1.000 103.59221 ? 107  TYR A C   1 
ATOM   788   O O   . TYR A  1 127 ? -44.72577 -34.20950  42.09616  1.000 103.26435 ? 107  TYR A O   1 
ATOM   789   C CB  . TYR A  1 127 ? -44.45809 -35.73943  44.73529  1.000 99.94672  ? 107  TYR A CB  1 
ATOM   790   C CG  . TYR A  1 127 ? -43.92856 -36.59772  45.86571  1.000 94.81622  ? 107  TYR A CG  1 
ATOM   791   C CD1 . TYR A  1 127 ? -44.12898 -37.97182  45.88889  1.000 90.51884  ? 107  TYR A CD1 1 
ATOM   792   C CD2 . TYR A  1 127 ? -43.25102 -36.01684  46.93398  1.000 91.85947  ? 107  TYR A CD2 1 
ATOM   793   C CE1 . TYR A  1 127 ? -43.64151 -38.74372  46.93458  1.000 86.13096  ? 107  TYR A CE1 1 
ATOM   794   C CE2 . TYR A  1 127 ? -42.76650 -36.77628  47.97844  1.000 86.40111  ? 107  TYR A CE2 1 
ATOM   795   C CZ  . TYR A  1 127 ? -42.96260 -38.13494  47.97635  1.000 82.51193  ? 107  TYR A CZ  1 
ATOM   796   O OH  . TYR A  1 127 ? -42.47435 -38.87254  49.02483  1.000 75.13494  ? 107  TYR A OH  1 
ATOM   797   N N   . GLU A  1 128 ? -46.05390 -36.02178  41.83224  1.000 99.27415  ? 108  GLU A N   1 
ATOM   798   C CA  . GLU A  1 128 ? -46.92430 -35.35058  40.87014  1.000 100.20359 ? 108  GLU A CA  1 
ATOM   799   C C   . GLU A  1 128 ? -47.75109 -34.24710  41.52207  1.000 96.05097  ? 108  GLU A C   1 
ATOM   800   O O   . GLU A  1 128 ? -48.09775 -33.26154  40.85870  1.000 97.95485  ? 108  GLU A O   1 
ATOM   801   C CB  . GLU A  1 128 ? -47.84628 -36.36630  40.19174  1.000 98.61160  ? 108  GLU A CB  1 
ATOM   802   C CG  . GLU A  1 128 ? -47.12433 -37.39812  39.34338  1.000 102.46937 ? 108  GLU A CG  1 
ATOM   803   C CD  . GLU A  1 128 ? -46.21046 -36.76606  38.30785  1.000 109.95216 ? 108  GLU A CD  1 
ATOM   804   O OE1 . GLU A  1 128 ? -44.97605 -36.88967  38.45447  1.000 111.12516 ? 108  GLU A OE1 1 
ATOM   805   O OE2 . GLU A  1 128 ? -46.72181 -36.14863  37.34632  1.000 114.79490 ? 108  GLU A OE2 1 
ATOM   806   N N   . GLY A  1 129 ? -48.07851 -34.39305  42.79993  1.000 84.91960  ? 109  GLY A N   1 
ATOM   807   C CA  . GLY A  1 129 ? -48.91790 -33.41681  43.46367  1.000 81.77798  ? 109  GLY A CA  1 
ATOM   808   C C   . GLY A  1 129 ? -49.16373 -33.81915  44.90003  1.000 77.74245  ? 109  GLY A C   1 
ATOM   809   O O   . GLY A  1 129 ? -48.54184 -34.75092  45.41212  1.000 76.36752  ? 109  GLY A O   1 
ATOM   810   N N   . THR A  1 130 ? -50.09874 -33.10571  45.54422  1.000 78.80795  ? 110  THR A N   1 
ATOM   811   C CA  . THR A  1 130 ? -50.34272 -33.30232  46.97604  1.000 75.50822  ? 110  THR A CA  1 
ATOM   812   C C   . THR A  1 130 ? -50.91477 -34.68649  47.27176  1.000 76.27642  ? 110  THR A C   1 
ATOM   813   O O   . THR A  1 130 ? -50.57794 -35.29801  48.29344  1.000 78.76665  ? 110  THR A O   1 
ATOM   814   C CB  . THR A  1 130 ? -51.28040 -32.21923  47.51606  1.000 70.78083  ? 110  THR A CB  1 
ATOM   815   O OG1 . THR A  1 130 ? -52.57530 -32.33241  46.90521  1.000 73.04725  ? 110  THR A OG1 1 
ATOM   816   C CG2 . THR A  1 130 ? -50.71426 -30.85551  47.23982  1.000 72.25930  ? 110  THR A CG2 1 
ATOM   817   N N   . ALA A  1 131 ? -51.79384 -35.19065  46.40071  1.000 73.83576  ? 111  ALA A N   1 
ATOM   818   C CA  . ALA A  1 131 ? -52.35396 -36.52080  46.60653  1.000 69.49545  ? 111  ALA A CA  1 
ATOM   819   C C   . ALA A  1 131 ? -51.31150 -37.59861  46.34619  1.000 67.00535  ? 111  ALA A C   1 
ATOM   820   O O   . ALA A  1 131 ? -51.22523 -38.58669  47.08910  1.000 63.37395  ? 111  ALA A O   1 
ATOM   821   C CB  . ALA A  1 131 ? -53.56987 -36.71586  45.70498  1.000 71.99310  ? 111  ALA A CB  1 
ATOM   822   N N   . ASP A  1 132 ? -50.50713 -37.42450  45.29490  1.000 71.89813  ? 112  ASP A N   1 
ATOM   823   C CA  . ASP A  1 132 ? -49.47340 -38.40732  44.99156  1.000 74.53711  ? 112  ASP A CA  1 
ATOM   824   C C   . ASP A  1 132 ? -48.41874 -38.46855  46.09169  1.000 71.30434  ? 112  ASP A C   1 
ATOM   825   O O   . ASP A  1 132 ? -47.87754 -39.54579  46.36737  1.000 65.73034  ? 112  ASP A O   1 
ATOM   826   C CB  . ASP A  1 132 ? -48.82855 -38.09278  43.64182  1.000 74.63599  ? 112  ASP A CB  1 
ATOM   827   C CG  . ASP A  1 132 ? -47.88600 -39.18212  43.18455  1.000 76.76629  ? 112  ASP A CG  1 
ATOM   828   O OD1 . ASP A  1 132 ? -48.31289 -40.35951  43.12508  1.000 77.49156  ? 112  ASP A OD1 1 
ATOM   829   O OD2 . ASP A  1 132 ? -46.72008 -38.85578  42.88606  1.000 77.89679  ? 112  ASP A OD2 1 
ATOM   830   N N   . ALA A  1 133 ? -48.13325 -37.33536  46.74052  1.000 69.00114  ? 113  ALA A N   1 
ATOM   831   C CA  . ALA A  1 133 ? -47.15286 -37.30781  47.82217  1.000 67.42606  ? 113  ALA A CA  1 
ATOM   832   C C   . ALA A  1 133 ? -47.53343 -38.23092  48.97983  1.000 65.44989  ? 113  ALA A C   1 
ATOM   833   O O   . ALA A  1 133 ? -46.65188 -38.66930  49.72396  1.000 59.76870  ? 113  ALA A O   1 
ATOM   834   C CB  . ALA A  1 133 ? -46.96902 -35.87287  48.31252  1.000 63.72425  ? 113  ALA A CB  1 
ATOM   835   N N   . VAL A  1 134 ? -48.81777 -38.54518  49.13516  1.000 66.38556  ? 114  VAL A N   1 
ATOM   836   C CA  . VAL A  1 134 ? -49.26735 -39.56050  50.08397  1.000 62.71274  ? 114  VAL A CA  1 
ATOM   837   C C   . VAL A  1 134 ? -49.32989 -40.93965  49.43343  1.000 66.76961  ? 114  VAL A C   1 
ATOM   838   O O   . VAL A  1 134 ? -48.91407 -41.93416  50.03529  1.000 66.54500  ? 114  VAL A O   1 
ATOM   839   C CB  . VAL A  1 134 ? -50.63834 -39.15505  50.65295  1.000 61.33436  ? 114  VAL A CB  1 
ATOM   840   C CG1 . VAL A  1 134 ? -50.96781 -39.97006  51.89019  1.000 54.97209  ? 114  VAL A CG1 1 
ATOM   841   C CG2 . VAL A  1 134 ? -50.67726 -37.63865  50.93353  1.000 64.26374  ? 114  VAL A CG2 1 
ATOM   842   N N   . TYR A  1 135 ? -49.85242 -41.01037  48.20150  1.000 67.86401  ? 115  TYR A N   1 
ATOM   843   C CA  . TYR A  1 135 ? -50.02250 -42.29299  47.52460  1.000 66.25709  ? 115  TYR A CA  1 
ATOM   844   C C   . TYR A  1 135 ? -48.70887 -43.05862  47.44353  1.000 66.15255  ? 115  TYR A C   1 
ATOM   845   O O   . TYR A  1 135 ? -48.66790 -44.25920  47.72498  1.000 65.72119  ? 115  TYR A O   1 
ATOM   846   C CB  . TYR A  1 135 ? -50.60087 -42.07154  46.12121  1.000 70.58780  ? 115  TYR A CB  1 
ATOM   847   C CG  . TYR A  1 135 ? -50.61210 -43.30635  45.23184  1.000 74.20129  ? 115  TYR A CG  1 
ATOM   848   C CD1 . TYR A  1 135 ? -51.66892 -44.21318  45.27821  1.000 74.04100  ? 115  TYR A CD1 1 
ATOM   849   C CD2 . TYR A  1 135 ? -49.58117 -43.55436  44.33090  1.000 75.61688  ? 115  TYR A CD2 1 
ATOM   850   C CE1 . TYR A  1 135 ? -51.68774 -45.33931  44.47344  1.000 74.27458  ? 115  TYR A CE1 1 
ATOM   851   C CE2 . TYR A  1 135 ? -49.59676 -44.68071  43.51566  1.000 76.29999  ? 115  TYR A CE2 1 
ATOM   852   C CZ  . TYR A  1 135 ? -50.65135 -45.57250  43.59093  1.000 78.43648  ? 115  TYR A CZ  1 
ATOM   853   O OH  . TYR A  1 135 ? -50.67633 -46.69440  42.77511  1.000 81.65626  ? 115  TYR A OH  1 
ATOM   854   N N   . GLN A  1 136 ? -47.61868 -42.37516  47.08574  1.000 65.11800  ? 116  GLN A N   1 
ATOM   855   C CA  . GLN A  1 136 ? -46.35554 -43.06624  46.85622  1.000 67.23948  ? 116  GLN A CA  1 
ATOM   856   C C   . GLN A  1 136 ? -45.84576 -43.75226  48.11729  1.000 68.94332  ? 116  GLN A C   1 
ATOM   857   O O   . GLN A  1 136 ? -45.11702 -44.74809  48.02677  1.000 69.48876  ? 116  GLN A O   1 
ATOM   858   C CB  . GLN A  1 136 ? -45.31002 -42.08735  46.31569  1.000 69.10468  ? 116  GLN A CB  1 
ATOM   859   C CG  . GLN A  1 136 ? -45.59801 -41.58193  44.90673  1.000 72.83084  ? 116  GLN A CG  1 
ATOM   860   C CD  . GLN A  1 136 ? -45.55534 -42.69590  43.86979  1.000 79.92066  ? 116  GLN A CD  1 
ATOM   861   O OE1 . GLN A  1 136 ? -44.82667 -43.67810  44.03170  1.000 80.12317  ? 116  GLN A OE1 1 
ATOM   862   N NE2 . GLN A  1 136 ? -46.34168 -42.55165  42.80350  1.000 78.63768  ? 116  GLN A NE2 1 
ATOM   863   N N   . ASN A  1 137 ? -46.23544 -43.25435  49.29445  1.000 65.81161  ? 117  ASN A N   1 
ATOM   864   C CA  . ASN A  1 137 ? -45.74205 -43.75775  50.56853  1.000 60.88239  ? 117  ASN A CA  1 
ATOM   865   C C   . ASN A  1 137 ? -46.78974 -44.55581  51.34047  1.000 59.62398  ? 117  ASN A C   1 
ATOM   866   O O   . ASN A  1 137 ? -46.66727 -44.71946  52.55758  1.000 60.91485  ? 117  ASN A O   1 
ATOM   867   C CB  . ASN A  1 137 ? -45.22067 -42.60279  51.41920  1.000 59.14789  ? 117  ASN A CB  1 
ATOM   868   C CG  . ASN A  1 137 ? -44.11098 -41.84623  50.74277  1.000 61.27276  ? 117  ASN A CG  1 
ATOM   869   O OD1 . ASN A  1 137 ? -42.97692 -42.31811  50.67733  1.000 63.40728  ? 117  ASN A OD1 1 
ATOM   870   N ND2 . ASN A  1 137 ? -44.41546 -40.64222  50.27232  1.000 61.27913  ? 117  ASN A ND2 1 
ATOM   871   N N   . ILE A  1 138 ? -47.81115 -45.06803  50.65278  1.000 60.34596  ? 118  ILE A N   1 
ATOM   872   C CA  . ILE A  1 138 ? -48.80225 -45.94213  51.28248  1.000 60.09614  ? 118  ILE A CA  1 
ATOM   873   C C   . ILE A  1 138 ? -48.13569 -47.12564  51.99077  1.000 66.43226  ? 118  ILE A C   1 
ATOM   874   O O   . ILE A  1 138 ? -48.59203 -47.57544  53.05312  1.000 60.37584  ? 118  ILE A O   1 
ATOM   875   C CB  . ILE A  1 138 ? -49.80582 -46.40844  50.21423  1.000 72.67945  ? 118  ILE A CB  1 
ATOM   876   C CG1 . ILE A  1 138 ? -50.70382 -45.23306  49.78827  1.000 71.45296  ? 118  ILE A CG1 1 
ATOM   877   C CG2 . ILE A  1 138 ? -50.55369 -47.67260  50.66312  1.000 68.92675  ? 118  ILE A CG2 1 
ATOM   878   C CD1 . ILE A  1 138 ? -51.65485 -45.56124  48.65346  1.000 76.29491  ? 118  ILE A CD1 1 
ATOM   879   N N   . ASP A  1 139 ? -47.04243 -47.64534  51.41269  1.000 67.22677  ? 119  ASP A N   1 
ATOM   880   C CA  . ASP A  1 139 ? -46.30385 -48.75591  52.00907  1.000 71.42036  ? 119  ASP A CA  1 
ATOM   881   C C   . ASP A  1 139 ? -45.69427 -48.39746  53.35528  1.000 68.24541  ? 119  ASP A C   1 
ATOM   882   O O   . ASP A  1 139 ? -45.32260 -49.30207  54.11036  1.000 69.38177  ? 119  ASP A O   1 
ATOM   883   C CB  . ASP A  1 139 ? -45.19688 -49.23239  51.06190  1.000 77.81184  ? 119  ASP A CB  1 
ATOM   884   C CG  . ASP A  1 139 ? -44.22324 -48.11565  50.67468  1.000 80.34497  ? 119  ASP A CG  1 
ATOM   885   O OD1 . ASP A  1 139 ? -44.46204 -46.93195  51.02662  1.000 75.53448  ? 119  ASP A OD1 1 
ATOM   886   O OD2 . ASP A  1 139 ? -43.20865 -48.43261  50.01156  1.000 83.33248  ? 119  ASP A OD2 1 
ATOM   887   N N   . ILE A  1 140 ? -45.56096 -47.10449  53.65413  1.000 63.56128  ? 120  ILE A N   1 
ATOM   888   C CA  . ILE A  1 140 ? -45.12128 -46.65338  54.96997  1.000 62.61045  ? 120  ILE A CA  1 
ATOM   889   C C   . ILE A  1 140 ? -46.29749 -46.60482  55.93708  1.000 63.30265  ? 120  ILE A C   1 
ATOM   890   O O   . ILE A  1 140 ? -46.19994 -47.07017  57.07985  1.000 65.21800  ? 120  ILE A O   1 
ATOM   891   C CB  . ILE A  1 140 ? -44.43454 -45.27625  54.84938  1.000 65.40399  ? 120  ILE A CB  1 
ATOM   892   C CG1 . ILE A  1 140 ? -43.19547 -45.35642  53.95599  1.000 68.84060  ? 120  ILE A CG1 1 
ATOM   893   C CG2 . ILE A  1 140 ? -44.07669 -44.70831  56.21869  1.000 64.49548  ? 120  ILE A CG2 1 
ATOM   894   C CD1 . ILE A  1 140 ? -41.89611 -45.59013  54.70204  1.000 65.99006  ? 120  ILE A CD1 1 
ATOM   895   N N   . ILE A  1 141 ? -47.42443 -46.04525  55.49014  1.000 61.75782  ? 121  ILE A N   1 
ATOM   896   C CA  . ILE A  1 141 ? -48.58036 -45.84938  56.36040  1.000 59.53155  ? 121  ILE A CA  1 
ATOM   897   C C   . ILE A  1 141 ? -49.23470 -47.18081  56.73102  1.000 64.43534  ? 121  ILE A C   1 
ATOM   898   O O   . ILE A  1 141 ? -49.66180 -47.37793  57.87446  1.000 63.10227  ? 121  ILE A O   1 
ATOM   899   C CB  . ILE A  1 141 ? -49.58512 -44.91569  55.67256  1.000 55.80263  ? 121  ILE A CB  1 
ATOM   900   C CG1 . ILE A  1 141 ? -48.94091 -43.55986  55.39133  1.000 56.71934  ? 121  ILE A CG1 1 
ATOM   901   C CG2 . ILE A  1 141 ? -50.84961 -44.79265  56.50255  1.000 57.45986  ? 121  ILE A CG2 1 
ATOM   902   C CD1 . ILE A  1 141 ? -49.37685 -42.93405  54.06943  1.000 53.83899  ? 121  ILE A CD1 1 
ATOM   903   N N   . GLU A  1 142 ? -49.36805 -48.09374  55.76825  1.000 67.86327  ? 122  GLU A N   1 
ATOM   904   C CA  . GLU A  1 142 ? -50.17785 -49.28749  56.00616  1.000 71.49836  ? 122  GLU A CA  1 
ATOM   905   C C   . GLU A  1 142 ? -49.67361 -50.16557  57.14208  1.000 68.99177  ? 122  GLU A C   1 
ATOM   906   O O   . GLU A  1 142 ? -50.51841 -50.68083  57.89378  1.000 72.47023  ? 122  GLU A O   1 
ATOM   907   C CB  . GLU A  1 142 ? -50.31428 -50.10297  54.71500  1.000 77.10764  ? 122  GLU A CB  1 
ATOM   908   C CG  . GLU A  1 142 ? -51.45808 -49.61707  53.84032  1.000 81.69161  ? 122  GLU A CG  1 
ATOM   909   C CD  . GLU A  1 142 ? -51.56533 -50.37038  52.52625  1.000 87.95184  ? 122  GLU A CD  1 
ATOM   910   O OE1 . GLU A  1 142 ? -50.77007 -51.32095  52.29872  1.000 85.33230  ? 122  GLU A OE1 1 
ATOM   911   O OE2 . GLU A  1 142 ? -52.44854 -49.99536  51.71742  1.000 91.00721  ? 122  GLU A OE2 1 
ATOM   912   N N   . PRO A  1 143 ? -48.36738 -50.38822  57.33330  1.000 67.61020  ? 123  PRO A N   1 
ATOM   913   C CA  . PRO A  1 143 ? -47.95318 -51.18474  58.50719  1.000 69.08730  ? 123  PRO A CA  1 
ATOM   914   C C   . PRO A  1 143 ? -48.29582 -50.51768  59.82761  1.000 69.67926  ? 123  PRO A C   1 
ATOM   915   O O   . PRO A  1 143 ? -48.62435 -51.21529  60.79776  1.000 72.63910  ? 123  PRO A O   1 
ATOM   916   C CB  . PRO A  1 143 ? -46.43422 -51.34313  58.31959  1.000 65.96298  ? 123  PRO A CB  1 
ATOM   917   C CG  . PRO A  1 143 ? -46.22901 -51.21099  56.85371  1.000 71.57799  ? 123  PRO A CG  1 
ATOM   918   C CD  . PRO A  1 143 ? -47.24825 -50.17928  56.39713  1.000 63.33955  ? 123  PRO A CD  1 
ATOM   919   N N   . TYR A  1 144 ? -48.21535 -49.18360  59.89885  1.000 60.61041  ? 124  TYR A N   1 
ATOM   920   C CA  . TYR A  1 144 ? -48.65324 -48.48879  61.10504  1.000 60.72702  ? 124  TYR A CA  1 
ATOM   921   C C   . TYR A  1 144 ? -50.13310 -48.71483  61.35730  1.000 60.58054  ? 124  TYR A C   1 
ATOM   922   O O   . TYR A  1 144 ? -50.56816 -48.76006  62.51322  1.000 63.94678  ? 124  TYR A O   1 
ATOM   923   C CB  . TYR A  1 144 ? -48.38174 -46.99592  60.98542  1.000 57.39471  ? 124  TYR A CB  1 
ATOM   924   C CG  . TYR A  1 144 ? -46.92309 -46.63857  60.89458  1.000 62.32577  ? 124  TYR A CG  1 
ATOM   925   C CD1 . TYR A  1 144 ? -46.50414 -45.54443  60.13444  1.000 61.23863  ? 124  TYR A CD1 1 
ATOM   926   C CD2 . TYR A  1 144 ? -45.96265 -47.37742  61.57055  1.000 59.35892  ? 124  TYR A CD2 1 
ATOM   927   C CE1 . TYR A  1 144 ? -45.17149 -45.19722  60.04992  1.000 56.51626  ? 124  TYR A CE1 1 
ATOM   928   C CE2 . TYR A  1 144 ? -44.61998 -47.03722  61.49310  1.000 59.99474  ? 124  TYR A CE2 1 
ATOM   929   C CZ  . TYR A  1 144 ? -44.23344 -45.94278  60.73274  1.000 62.48117  ? 124  TYR A CZ  1 
ATOM   930   O OH  . TYR A  1 144 ? -42.90762 -45.58908  60.64500  1.000 59.92731  ? 124  TYR A OH  1 
ATOM   931   N N   . ALA A  1 145 ? -50.90838 -48.86072  60.28584  1.000 51.25903  ? 125  ALA A N   1 
ATOM   932   C CA  . ALA A  1 145 ? -52.34936 -49.06663  60.34590  1.000 59.63088  ? 125  ALA A CA  1 
ATOM   933   C C   . ALA A  1 145 ? -53.08989 -48.04513  61.21999  1.000 56.10069  ? 125  ALA A C   1 
ATOM   934   O O   . ALA A  1 145 ? -53.92482 -48.41834  62.04335  1.000 59.36567  ? 125  ALA A O   1 
ATOM   935   C CB  . ALA A  1 145 ? -52.65844 -50.48481  60.81311  1.000 57.96112  ? 125  ALA A CB  1 
ATOM   936   N N   . PRO A  1 146 ? -52.82823 -46.74721  61.04235  1.000 51.38780  ? 126  PRO A N   1 
ATOM   937   C CA  . PRO A  1 146 ? -53.56198 -45.75744  61.83971  1.000 50.25244  ? 126  PRO A CA  1 
ATOM   938   C C   . PRO A  1 146 ? -55.02929 -45.77115  61.46299  1.000 52.66342  ? 126  PRO A C   1 
ATOM   939   O O   . PRO A  1 146 ? -55.39449 -46.07219  60.32800  1.000 57.81451  ? 126  PRO A O   1 
ATOM   940   C CB  . PRO A  1 146 ? -52.90358 -44.42780  61.46214  1.000 46.77875  ? 126  PRO A CB  1 
ATOM   941   C CG  . PRO A  1 146 ? -52.48293 -44.63251  60.05599  1.000 52.25016  ? 126  PRO A CG  1 
ATOM   942   C CD  . PRO A  1 146 ? -52.07265 -46.10432  59.94908  1.000 51.39535  ? 126  PRO A CD  1 
ATOM   943   N N   . GLU A  1 147 ? -55.88234 -45.48206  62.44295  1.000 53.95591  ? 127  GLU A N   1 
ATOM   944   C CA  . GLU A  1 147 ? -57.30965 -45.43021  62.15334  1.000 54.95320  ? 127  GLU A CA  1 
ATOM   945   C C   . GLU A  1 147 ? -57.66412 -44.18567  61.33956  1.000 55.24001  ? 127  GLU A C   1 
ATOM   946   O O   . GLU A  1 147 ? -58.61245 -44.21022  60.55000  1.000 58.70679  ? 127  GLU A O   1 
ATOM   947   C CB  . GLU A  1 147 ? -58.10414 -45.48886  63.45969  1.000 56.47533  ? 127  GLU A CB  1 
ATOM   948   C CG  . GLU A  1 147 ? -59.60500 -45.55694  63.26905  1.000 69.48038  ? 127  GLU A CG  1 
ATOM   949   C CD  . GLU A  1 147 ? -60.13023 -46.98926  63.10332  1.000 83.27175  ? 127  GLU A CD  1 
ATOM   950   O OE1 . GLU A  1 147 ? -61.30416 -47.24017  63.47228  1.000 88.30105  ? 127  GLU A OE1 1 
ATOM   951   O OE2 . GLU A  1 147 ? -59.36655 -47.86479  62.62331  1.000 83.04962  ? 127  GLU A OE2 1 
ATOM   952   N N   . TYR A  1 148 ? -56.89281 -43.11126  61.48127  1.000 54.89065  ? 128  TYR A N   1 
ATOM   953   C CA  . TYR A  1 148 ? -57.21680 -41.83047  60.87269  1.000 56.05670  ? 128  TYR A CA  1 
ATOM   954   C C   . TYR A  1 148 ? -55.96351 -41.18997  60.30319  1.000 55.14923  ? 128  TYR A C   1 
ATOM   955   O O   . TYR A  1 148 ? -54.86580 -41.34478  60.84408  1.000 54.80011  ? 128  TYR A O   1 
ATOM   956   C CB  . TYR A  1 148 ? -57.84768 -40.85523  61.87293  1.000 52.20667  ? 128  TYR A CB  1 
ATOM   957   C CG  . TYR A  1 148 ? -58.86325 -41.48230  62.79372  1.000 55.07229  ? 128  TYR A CG  1 
ATOM   958   C CD1 . TYR A  1 148 ? -60.13538 -41.81881  62.33046  1.000 56.56553  ? 128  TYR A CD1 1 
ATOM   959   C CD2 . TYR A  1 148 ? -58.55748 -41.73561  64.12999  1.000 53.44324  ? 128  TYR A CD2 1 
ATOM   960   C CE1 . TYR A  1 148 ? -61.08615 -42.38824  63.17198  1.000 58.43656  ? 128  TYR A CE1 1 
ATOM   961   C CE2 . TYR A  1 148 ? -59.49759 -42.31477  64.98419  1.000 57.16335  ? 128  TYR A CE2 1 
ATOM   962   C CZ  . TYR A  1 148 ? -60.76175 -42.63970  64.49764  1.000 59.30660  ? 128  TYR A CZ  1 
ATOM   963   O OH  . TYR A  1 148 ? -61.69457 -43.21050  65.33388  1.000 60.18077  ? 128  TYR A OH  1 
ATOM   964   N N   . MET A  1 149 ? -56.15201 -40.45733  59.20882  1.000 54.14951  ? 129  MET A N   1 
ATOM   965   C CA  . MET A  1 149 ? -55.12330 -39.62994  58.60608  1.000 52.41762  ? 129  MET A CA  1 
ATOM   966   C C   . MET A  1 149 ? -55.48840 -38.16668  58.82032  1.000 55.04821  ? 129  MET A C   1 
ATOM   967   O O   . MET A  1 149 ? -56.64996 -37.77956  58.63891  1.000 57.07411  ? 129  MET A O   1 
ATOM   968   C CB  . MET A  1 149 ? -54.98382 -39.92927  57.11633  1.000 52.39904  ? 129  MET A CB  1 
ATOM   969   C CG  . MET A  1 149 ? -54.50559 -41.33975  56.81379  1.000 59.07117  ? 129  MET A CG  1 
ATOM   970   S SD  . MET A  1 149 ? -52.88418 -41.68871  57.50779  1.000 63.60881  ? 129  MET A SD  1 
ATOM   971   C CE  . MET A  1 149 ? -51.84116 -40.58956  56.55643  1.000 63.04812  ? 129  MET A CE  1 
ATOM   972   N N   . VAL A  1 150 ? -54.50312 -37.36840  59.22931  1.000 50.01002  ? 130  VAL A N   1 
ATOM   973   C CA  . VAL A  1 150 ? -54.65316 -35.93225  59.41745  1.000 46.91634  ? 130  VAL A CA  1 
ATOM   974   C C   . VAL A  1 150 ? -53.67916 -35.27687  58.44643  1.000 47.87688  ? 130  VAL A C   1 
ATOM   975   O O   . VAL A  1 150 ? -52.47933 -35.17711  58.73517  1.000 49.20178  ? 130  VAL A O   1 
ATOM   976   C CB  . VAL A  1 150 ? -54.39044 -35.50088  60.86397  1.000 38.94564  ? 130  VAL A CB  1 
ATOM   977   C CG1 . VAL A  1 150 ? -54.46664 -33.97842  60.99678  1.000 37.83395  ? 130  VAL A CG1 1 
ATOM   978   C CG2 . VAL A  1 150 ? -55.40765 -36.14069  61.78025  1.000 44.34559  ? 130  VAL A CG2 1 
ATOM   979   N N   . ILE A  1 151 ? -54.18182 -34.85301  57.28113  1.000 51.00750  ? 131  ILE A N   1 
ATOM   980   C CA  . ILE A  1 151 ? -53.33477 -34.23982  56.26111  1.000 48.13901  ? 131  ILE A CA  1 
ATOM   981   C C   . ILE A  1 151 ? -53.19340 -32.75302  56.56206  1.000 46.18459  ? 131  ILE A C   1 
ATOM   982   O O   . ILE A  1 151 ? -54.19289 -32.04700  56.75123  1.000 50.76773  ? 131  ILE A O   1 
ATOM   983   C CB  . ILE A  1 151 ? -53.90829 -34.46839  54.85389  1.000 47.52009  ? 131  ILE A CB  1 
ATOM   984   C CG1 . ILE A  1 151 ? -54.20313 -35.95297  54.62602  1.000 51.52650  ? 131  ILE A CG1 1 
ATOM   985   C CG2 . ILE A  1 151 ? -52.94322 -33.93911  53.79714  1.000 43.30437  ? 131  ILE A CG2 1 
ATOM   986   C CD1 . ILE A  1 151 ? -52.98214 -36.88249  54.75100  1.000 46.92861  ? 131  ILE A CD1 1 
ATOM   987   N N   . LEU A  1 152 ? -51.95199 -32.26802  56.57816  1.000 42.16136  ? 132  LEU A N   1 
ATOM   988   C CA  . LEU A  1 152 ? -51.64534 -30.90635  56.99144  1.000 40.49920  ? 132  LEU A CA  1 
ATOM   989   C C   . LEU A  1 152 ? -50.77745 -30.20576  55.95710  1.000 44.22219  ? 132  LEU A C   1 
ATOM   990   O O   . LEU A  1 152 ? -49.89694 -30.82141  55.34669  1.000 43.32469  ? 132  LEU A O   1 
ATOM   991   C CB  . LEU A  1 152 ? -50.93354 -30.89902  58.33936  1.000 38.41853  ? 132  LEU A CB  1 
ATOM   992   C CG  . LEU A  1 152 ? -51.72596 -31.52477  59.49483  1.000 39.74838  ? 132  LEU A CG  1 
ATOM   993   C CD1 . LEU A  1 152 ? -50.86330 -31.65671  60.74739  1.000 34.80929  ? 132  LEU A CD1 1 
ATOM   994   C CD2 . LEU A  1 152 ? -52.96921 -30.69236  59.77711  1.000 39.04847  ? 132  LEU A CD2 1 
ATOM   995   N N   . ALA A  1 153 ? -51.02902 -28.91648  55.76191  1.000 45.60601  ? 133  ALA A N   1 
ATOM   996   C CA  . ALA A  1 153 ? -50.11542 -28.09132  54.98075  1.000 48.19804  ? 133  ALA A CA  1 
ATOM   997   C C   . ALA A  1 153 ? -48.99705 -27.60768  55.90035  1.000 45.56069  ? 133  ALA A C   1 
ATOM   998   O O   . ALA A  1 153 ? -49.26407 -27.01900  56.95020  1.000 40.72065  ? 133  ALA A O   1 
ATOM   999   C CB  . ALA A  1 153 ? -50.85386 -26.91661  54.33910  1.000 37.17889  ? 133  ALA A CB  1 
ATOM   1000  N N   . GLY A  1 154 ? -47.75319 -27.86751  55.51857  1.000 45.31517  ? 134  GLY A N   1 
ATOM   1001  C CA  . GLY A  1 154 ? -46.63316 -27.48997  56.35546  1.000 46.61561  ? 134  GLY A CA  1 
ATOM   1002  C C   . GLY A  1 154 ? -46.01908 -26.13502  56.05144  1.000 47.97816  ? 134  GLY A C   1 
ATOM   1003  O O   . GLY A  1 154 ? -44.82732 -25.92370  56.29517  1.000 48.25497  ? 134  GLY A O   1 
ATOM   1004  N N   . ASP A  1 155 ? -46.80312 -25.19567  55.52518  1.000 48.70812  ? 135  ASP A N   1 
ATOM   1005  C CA  . ASP A  1 155 ? -46.23952 -23.89602  55.17810  1.000 44.60073  ? 135  ASP A CA  1 
ATOM   1006  C C   . ASP A  1 155 ? -47.09041 -22.74891  55.71909  1.000 40.80450  ? 135  ASP A C   1 
ATOM   1007  O O   . ASP A  1 155 ? -47.05426 -21.63285  55.18418  1.000 43.46537  ? 135  ASP A O   1 
ATOM   1008  C CB  . ASP A  1 155 ? -46.03124 -23.77581  53.66612  1.000 45.70602  ? 135  ASP A CB  1 
ATOM   1009  C CG  . ASP A  1 155 ? -47.32982 -23.60375  52.90996  1.000 52.60786  ? 135  ASP A CG  1 
ATOM   1010  O OD1 . ASP A  1 155 ? -48.21417 -24.48430  53.04197  1.000 54.89474  ? 135  ASP A OD1 1 
ATOM   1011  O OD2 . ASP A  1 155 ? -47.47039 -22.57663  52.20038  1.000 51.34249  ? 135  ASP A OD2 1 
ATOM   1012  N N   . HIS A  1 156 ? -47.82732 -22.99409  56.80284  1.000 38.69430  ? 136  HIS A N   1 
ATOM   1013  C CA  . HIS A  1 156 ? -48.64291 -21.97601  57.45999  1.000 39.46872  ? 136  HIS A CA  1 
ATOM   1014  C C   . HIS A  1 156 ? -48.27632 -21.86439  58.93698  1.000 42.80480  ? 136  HIS A C   1 
ATOM   1015  O O   . HIS A  1 156 ? -47.85758 -22.84323  59.57620  1.000 39.77014  ? 136  HIS A O   1 
ATOM   1016  C CB  . HIS A  1 156 ? -50.13699 -22.28385  57.35128  1.000 37.87705  ? 136  HIS A CB  1 
ATOM   1017  C CG  . HIS A  1 156 ? -50.60535 -22.54242  55.95240  1.000 44.02139  ? 136  HIS A CG  1 
ATOM   1018  N ND1 . HIS A  1 156 ? -51.60867 -23.44157  55.66117  1.000 47.26842  ? 136  HIS A ND1 1 
ATOM   1019  C CD2 . HIS A  1 156 ? -50.22189 -22.01009  54.76752  1.000 46.21816  ? 136  HIS A CD2 1 
ATOM   1020  C CE1 . HIS A  1 156 ? -51.82372 -23.45355  54.35775  1.000 49.34194  ? 136  HIS A CE1 1 
ATOM   1021  N NE2 . HIS A  1 156 ? -50.99394 -22.59508  53.79138  1.000 48.47157  ? 136  HIS A NE2 1 
ATOM   1022  N N   . ILE A  1 157 ? -48.45957 -20.66160  59.47652  1.000 41.54335  ? 137  ILE A N   1 
ATOM   1023  C CA  . ILE A  1 157 ? -48.20293 -20.36394  60.88170  1.000 37.40272  ? 137  ILE A CA  1 
ATOM   1024  C C   . ILE A  1 157 ? -49.54791 -20.24583  61.58686  1.000 39.49636  ? 137  ILE A C   1 
ATOM   1025  O O   . ILE A  1 157 ? -50.33105 -19.33437  61.29879  1.000 42.71797  ? 137  ILE A O   1 
ATOM   1026  C CB  . ILE A  1 157 ? -47.37367 -19.08583  61.03956  1.000 36.85154  ? 137  ILE A CB  1 
ATOM   1027  C CG1 . ILE A  1 157 ? -46.00612 -19.27071  60.38184  1.000 37.21569  ? 137  ILE A CG1 1 
ATOM   1028  C CG2 . ILE A  1 157 ? -47.21869 -18.72645  62.51739  1.000 38.09970  ? 137  ILE A CG2 1 
ATOM   1029  C CD1 . ILE A  1 157 ? -45.63470 -18.15839  59.46954  1.000 35.74448  ? 137  ILE A CD1 1 
ATOM   1030  N N   . TYR A  1 158 ? -49.81809 -21.16115  62.51538  1.000 40.67152  ? 138  TYR A N   1 
ATOM   1031  C CA  . TYR A  1 158 ? -51.09112 -21.22598  63.22726  1.000 34.47459  ? 138  TYR A CA  1 
ATOM   1032  C C   . TYR A  1 158 ? -50.97022 -22.28251  64.31471  1.000 34.36889  ? 138  TYR A C   1 
ATOM   1033  O O   . TYR A  1 158 ? -50.07238 -23.13271  64.28283  1.000 38.63007  ? 138  TYR A O   1 
ATOM   1034  C CB  . TYR A  1 158 ? -52.25936 -21.55286  62.28534  1.000 30.52665  ? 138  TYR A CB  1 
ATOM   1035  C CG  . TYR A  1 158 ? -52.21853 -22.97375  61.80410  1.000 30.88753  ? 138  TYR A CG  1 
ATOM   1036  C CD1 . TYR A  1 158 ? -53.10099 -23.92440  62.30812  1.000 34.18430  ? 138  TYR A CD1 1 
ATOM   1037  C CD2 . TYR A  1 158 ? -51.26679 -23.37754  60.88262  1.000 33.23982  ? 138  TYR A CD2 1 
ATOM   1038  C CE1 . TYR A  1 158 ? -53.04529 -25.23595  61.89590  1.000 35.76417  ? 138  TYR A CE1 1 
ATOM   1039  C CE2 . TYR A  1 158 ? -51.19272 -24.68593  60.46202  1.000 36.92553  ? 138  TYR A CE2 1 
ATOM   1040  C CZ  . TYR A  1 158 ? -52.09179 -25.60796  60.96271  1.000 40.76227  ? 138  TYR A CZ  1 
ATOM   1041  O OH  . TYR A  1 158 ? -52.02185 -26.90464  60.52920  1.000 46.90328  ? 138  TYR A OH  1 
ATOM   1042  N N   . LYS A  1 159 ? -51.88029 -22.21430  65.28360  1.000 35.74376  ? 139  LYS A N   1 
ATOM   1043  C CA  . LYS A  1 159 ? -51.90798 -23.14597  66.40068  1.000 36.96645  ? 139  LYS A CA  1 
ATOM   1044  C C   . LYS A  1 159 ? -53.30881 -23.73745  66.50621  1.000 44.08341  ? 139  LYS A C   1 
ATOM   1045  O O   . LYS A  1 159 ? -54.30040 -22.99293  66.51835  1.000 42.52844  ? 139  LYS A O   1 
ATOM   1046  C CB  . LYS A  1 159 ? -51.50929 -22.44691  67.70501  1.000 37.17627  ? 139  LYS A CB  1 
ATOM   1047  C CG  . LYS A  1 159 ? -50.06388 -22.00881  67.73786  1.000 43.32958  ? 139  LYS A CG  1 
ATOM   1048  C CD  . LYS A  1 159 ? -49.65151 -21.41073  69.08158  1.000 47.06742  ? 139  LYS A CD  1 
ATOM   1049  C CE  . LYS A  1 159 ? -50.11284 -19.96990  69.22975  1.000 52.18661  ? 139  LYS A CE  1 
ATOM   1050  N NZ  . LYS A  1 159 ? -49.52618 -19.31191  70.44947  1.000 53.54980  ? 139  LYS A NZ  1 
ATOM   1051  N N   . MET A  1 160 ? -53.39208 -25.06816  66.59338  1.000 44.76000  ? 140  MET A N   1 
ATOM   1052  C CA  . MET A  1 160 ? -54.66968 -25.76097  66.42583  1.000 44.69887  ? 140  MET A CA  1 
ATOM   1053  C C   . MET A  1 160 ? -54.63481 -27.11984  67.11734  1.000 43.77548  ? 140  MET A C   1 
ATOM   1054  O O   . MET A  1 160 ? -53.66008 -27.86698  66.98178  1.000 43.93952  ? 140  MET A O   1 
ATOM   1055  C CB  . MET A  1 160 ? -54.99326 -25.92733  64.92503  1.000 43.32452  ? 140  MET A CB  1 
ATOM   1056  C CG  . MET A  1 160 ? -56.28932 -26.67185  64.60122  1.000 44.72546  ? 140  MET A CG  1 
ATOM   1057  S SD  . MET A  1 160 ? -56.67719 -26.55581  62.83521  1.000 46.13159  ? 140  MET A SD  1 
ATOM   1058  C CE  . MET A  1 160 ? -58.37344 -27.13391  62.76276  1.000 46.97911  ? 140  MET A CE  1 
ATOM   1059  N N   . ASP A  1 161 ? -55.70780 -27.44147  67.83449  1.000 39.35424  ? 141  ASP A N   1 
ATOM   1060  C CA  . ASP A  1 161 ? -55.85046 -28.71237  68.53921  1.000 34.35349  ? 141  ASP A CA  1 
ATOM   1061  C C   . ASP A  1 161 ? -56.63112 -29.68642  67.65787  1.000 39.21585  ? 141  ASP A C   1 
ATOM   1062  O O   . ASP A  1 161 ? -57.86605 -29.62764  67.58560  1.000 41.00443  ? 141  ASP A O   1 
ATOM   1063  C CB  . ASP A  1 161 ? -56.55839 -28.49523  69.86890  1.000 32.99840  ? 141  ASP A CB  1 
ATOM   1064  C CG  . ASP A  1 161 ? -56.56524 -29.74884  70.75330  1.000 41.71857  ? 141  ASP A CG  1 
ATOM   1065  O OD1 . ASP A  1 161 ? -56.87844 -29.59636  71.95186  1.000 39.92189  ? 141  ASP A OD1 1 
ATOM   1066  O OD2 . ASP A  1 161 ? -56.26056 -30.87277  70.26379  1.000 42.44676  ? 141  ASP A OD2 1 
ATOM   1067  N N   . TYR A  1 162 ? -55.91507 -30.61916  67.02500  1.000 38.25287  ? 142  TYR A N   1 
ATOM   1068  C CA  . TYR A  1 162 ? -56.52245 -31.50852  66.04177  1.000 38.27429  ? 142  TYR A CA  1 
ATOM   1069  C C   . TYR A  1 162 ? -57.50532 -32.50050  66.64850  1.000 43.10415  ? 142  TYR A C   1 
ATOM   1070  O O   . TYR A  1 162 ? -58.28112 -33.09927  65.89805  1.000 46.10323  ? 142  TYR A O   1 
ATOM   1071  C CB  . TYR A  1 162 ? -55.44501 -32.26674  65.27097  1.000 35.78658  ? 142  TYR A CB  1 
ATOM   1072  C CG  . TYR A  1 162 ? -54.50557 -31.34855  64.53383  1.000 34.01794  ? 142  TYR A CG  1 
ATOM   1073  C CD1 . TYR A  1 162 ? -54.99484 -30.32861  63.74230  1.000 34.46243  ? 142  TYR A CD1 1 
ATOM   1074  C CD2 . TYR A  1 162 ? -53.11968 -31.48762  64.64624  1.000 34.62673  ? 142  TYR A CD2 1 
ATOM   1075  C CE1 . TYR A  1 162 ? -54.14507 -29.45856  63.07421  1.000 35.43950  ? 142  TYR A CE1 1 
ATOM   1076  C CE2 . TYR A  1 162 ? -52.25261 -30.62618  63.96783  1.000 34.11362  ? 142  TYR A CE2 1 
ATOM   1077  C CZ  . TYR A  1 162 ? -52.77580 -29.60776  63.18753  1.000 35.67171  ? 142  TYR A CZ  1 
ATOM   1078  O OH  . TYR A  1 162 ? -51.93583 -28.74373  62.50458  1.000 39.47595  ? 142  TYR A OH  1 
ATOM   1079  N N   . GLU A  1 163 ? -57.50818 -32.68804  67.97006  1.000 41.99174  ? 143  GLU A N   1 
ATOM   1080  C CA  . GLU A  1 163 ? -58.47690 -33.60963  68.55823  1.000 44.55050  ? 143  GLU A CA  1 
ATOM   1081  C C   . GLU A  1 163 ? -59.91297 -33.15380  68.28855  1.000 49.67517  ? 143  GLU A C   1 
ATOM   1082  O O   . GLU A  1 163 ? -60.80039 -33.99251  68.07796  1.000 41.25853  ? 143  GLU A O   1 
ATOM   1083  C CB  . GLU A  1 163 ? -58.20890 -33.77037  70.06400  1.000 46.64724  ? 143  GLU A CB  1 
ATOM   1084  C CG  . GLU A  1 163 ? -59.16687 -34.72274  70.80802  1.000 47.91920  ? 143  GLU A CG  1 
ATOM   1085  C CD  . GLU A  1 163 ? -58.90849 -36.19715  70.50270  1.000 50.11943  ? 143  GLU A CD  1 
ATOM   1086  O OE1 . GLU A  1 163 ? -57.76961 -36.54685  70.13805  1.000 50.50348  ? 143  GLU A OE1 1 
ATOM   1087  O OE2 . GLU A  1 163 ? -59.83973 -37.01556  70.63567  1.000 51.61691  ? 143  GLU A OE2 1 
ATOM   1088  N N   . TYR A  1 164 ? -60.15842 -31.83868  68.25075  1.000 46.76295  ? 144  TYR A N   1 
ATOM   1089  C CA  . TYR A  1 164 ? -61.50361 -31.35795  67.94619  1.000 50.79221  ? 144  TYR A CA  1 
ATOM   1090  C C   . TYR A  1 164 ? -61.93948 -31.80271  66.55684  1.000 53.23381  ? 144  TYR A C   1 
ATOM   1091  O O   . TYR A  1 164 ? -63.04885 -32.31629  66.36983  1.000 52.60752  ? 144  TYR A O   1 
ATOM   1092  C CB  . TYR A  1 164 ? -61.56083 -29.84067  68.04945  1.000 53.70738  ? 144  TYR A CB  1 
ATOM   1093  C CG  . TYR A  1 164 ? -61.43500 -29.31726  69.45172  1.000 56.58424  ? 144  TYR A CG  1 
ATOM   1094  C CD1 . TYR A  1 164 ? -60.19457 -28.98531  69.97089  1.000 53.90103  ? 144  TYR A CD1 1 
ATOM   1095  C CD2 . TYR A  1 164 ? -62.55753 -29.14638  70.25625  1.000 59.87733  ? 144  TYR A CD2 1 
ATOM   1096  C CE1 . TYR A  1 164 ? -60.06796 -28.50400  71.25231  1.000 58.44043  ? 144  TYR A CE1 1 
ATOM   1097  C CE2 . TYR A  1 164 ? -62.44391 -28.65935  71.54576  1.000 60.19615  ? 144  TYR A CE2 1 
ATOM   1098  C CZ  . TYR A  1 164 ? -61.19367 -28.33538  72.03817  1.000 61.94639  ? 144  TYR A CZ  1 
ATOM   1099  O OH  . TYR A  1 164 ? -61.05305 -27.84842  73.32066  1.000 63.76401  ? 144  TYR A OH  1 
ATOM   1100  N N   . MET A  1 165 ? -61.06874 -31.61105  65.56754  1.000 54.47328  ? 145  MET A N   1 
ATOM   1101  C CA  . MET A  1 165 ? -61.38791 -32.01649  64.20521  1.000 53.06930  ? 145  MET A CA  1 
ATOM   1102  C C   . MET A  1 165 ? -61.60792 -33.51732  64.10408  1.000 49.13340  ? 145  MET A C   1 
ATOM   1103  O O   . MET A  1 165 ? -62.50748 -33.97090  63.38964  1.000 47.48635  ? 145  MET A O   1 
ATOM   1104  C CB  . MET A  1 165 ? -60.26764 -31.58419  63.27297  1.000 57.86391  ? 145  MET A CB  1 
ATOM   1105  C CG  . MET A  1 165 ? -60.75515 -31.19533  61.92235  1.000 62.43142  ? 145  MET A CG  1 
ATOM   1106  S SD  . MET A  1 165 ? -59.41965 -30.42520  61.02926  1.000 63.49896  ? 145  MET A SD  1 
ATOM   1107  C CE  . MET A  1 165 ? -59.96049 -30.81837  59.35580  1.000 60.14222  ? 145  MET A CE  1 
ATOM   1108  N N   . LEU A  1 166 ? -60.78531 -34.30710  64.80107  1.000 47.05615  ? 146  LEU A N   1 
ATOM   1109  C CA  . LEU A  1 166 ? -60.97667 -35.75148  64.79029  1.000 48.94346  ? 146  LEU A CA  1 
ATOM   1110  C C   . LEU A  1 166 ? -62.34259 -36.12809  65.36204  1.000 52.05406  ? 146  LEU A C   1 
ATOM   1111  O O   . LEU A  1 166 ? -63.04404 -36.99061  64.81156  1.000 51.41188  ? 146  LEU A O   1 
ATOM   1112  C CB  . LEU A  1 166 ? -59.84933 -36.43067  65.57479  1.000 49.12449  ? 146  LEU A CB  1 
ATOM   1113  C CG  . LEU A  1 166 ? -58.46834 -36.47125  64.91742  1.000 46.93695  ? 146  LEU A CG  1 
ATOM   1114  C CD1 . LEU A  1 166 ? -57.37688 -36.81067  65.93564  1.000 46.02891  ? 146  LEU A CD1 1 
ATOM   1115  C CD2 . LEU A  1 166 ? -58.44290 -37.45513  63.74840  1.000 44.13081  ? 146  LEU A CD2 1 
ATOM   1116  N N   . GLN A  1 167 ? -62.74771 -35.48478  66.46198  1.000 54.68578  ? 147  GLN A N   1 
ATOM   1117  C CA  . GLN A  1 167 ? -64.01503 -35.85605  67.07519  1.000 60.07127  ? 147  GLN A CA  1 
ATOM   1118  C C   . GLN A  1 167 ? -65.19057 -35.43959  66.20525  1.000 57.94987  ? 147  GLN A C   1 
ATOM   1119  O O   . GLN A  1 167 ? -66.19379 -36.15615  66.12699  1.000 57.09562  ? 147  GLN A O   1 
ATOM   1120  C CB  . GLN A  1 167 ? -64.12795 -35.27313  68.48086  1.000 66.90816  ? 147  GLN A CB  1 
ATOM   1121  C CG  . GLN A  1 167 ? -64.78365 -36.28321  69.43196  1.000 79.45859  ? 147  GLN A CG  1 
ATOM   1122  C CD  . GLN A  1 167 ? -64.16558 -36.31662  70.82538  1.000 81.51517  ? 147  GLN A CD  1 
ATOM   1123  O OE1 . GLN A  1 167 ? -62.94824 -36.18131  70.98929  1.000 75.86979  ? 147  GLN A OE1 1 
ATOM   1124  N NE2 . GLN A  1 167 ? -65.00849 -36.53013  71.83729  1.000 85.35270  ? 147  GLN A NE2 1 
ATOM   1125  N N   . GLN A  1 168 ? -65.07837 -34.29847  65.52514  1.000 55.74450  ? 148  GLN A N   1 
ATOM   1126  C CA  . GLN A  1 168 ? -66.13328 -33.90962  64.60143  1.000 56.82336  ? 148  GLN A CA  1 
ATOM   1127  C C   . GLN A  1 168 ? -66.21177 -34.87892  63.43047  1.000 61.76295  ? 148  GLN A C   1 
ATOM   1128  O O   . GLN A  1 168 ? -67.30922 -35.24999  62.99631  1.000 62.58843  ? 148  GLN A O   1 
ATOM   1129  C CB  . GLN A  1 168 ? -65.91344 -32.47877  64.09912  1.000 53.38870  ? 148  GLN A CB  1 
ATOM   1130  C CG  . GLN A  1 168 ? -66.99038 -31.99878  63.10999  1.000 55.92646  ? 148  GLN A CG  1 
ATOM   1131  C CD  . GLN A  1 168 ? -66.78650 -30.55340  62.66927  1.000 60.08205  ? 148  GLN A CD  1 
ATOM   1132  O OE1 . GLN A  1 168 ? -66.51363 -29.67477  63.48740  1.000 59.58165  ? 148  GLN A OE1 1 
ATOM   1133  N NE2 . GLN A  1 168 ? -66.92364 -30.30384  61.37171  1.000 61.63049  ? 148  GLN A NE2 1 
ATOM   1134  N N   . HIS A  1 169 ? -65.05834 -35.29891  62.90488  1.000 62.00650  ? 149  HIS A N   1 
ATOM   1135  C CA  . HIS A  1 169 ? -65.06196 -36.19485  61.75289  1.000 64.67696  ? 149  HIS A CA  1 
ATOM   1136  C C   . HIS A  1 169 ? -65.74122 -37.51764  62.08323  1.000 66.41056  ? 149  HIS A C   1 
ATOM   1137  O O   . HIS A  1 169 ? -66.45819 -38.07407  61.24671  1.000 73.22638  ? 149  HIS A O   1 
ATOM   1138  C CB  . HIS A  1 169 ? -63.63301 -36.43048  61.25376  1.000 60.86686  ? 149  HIS A CB  1 
ATOM   1139  C CG  . HIS A  1 169 ? -63.53831 -37.40074  60.11392  1.000 63.83340  ? 149  HIS A CG  1 
ATOM   1140  N ND1 . HIS A  1 169 ? -63.90703 -37.07799  58.82542  1.000 65.93377  ? 149  HIS A ND1 1 
ATOM   1141  C CD2 . HIS A  1 169 ? -63.10935 -38.68599  60.07020  1.000 64.91156  ? 149  HIS A CD2 1 
ATOM   1142  C CE1 . HIS A  1 169 ? -63.70936 -38.12126  58.03892  1.000 65.97632  ? 149  HIS A CE1 1 
ATOM   1143  N NE2 . HIS A  1 169 ? -63.22135 -39.10737  58.76891  1.000 66.12365  ? 149  HIS A NE2 1 
ATOM   1144  N N   . VAL A  1 170 ? -65.54135 -38.03309  63.29718  1.000 65.24197  ? 150  VAL A N   1 
ATOM   1145  C CA  . VAL A  1 170 ? -66.13280 -39.32492  63.64096  1.000 69.63632  ? 150  VAL A CA  1 
ATOM   1146  C C   . VAL A  1 170 ? -67.62690 -39.18374  63.92267  1.000 76.45177  ? 150  VAL A C   1 
ATOM   1147  O O   . VAL A  1 170 ? -68.42654 -40.04911  63.54146  1.000 80.40303  ? 150  VAL A O   1 
ATOM   1148  C CB  . VAL A  1 170 ? -65.38468 -39.96200  64.82591  1.000 62.78436  ? 150  VAL A CB  1 
ATOM   1149  C CG1 . VAL A  1 170 ? -66.09211 -41.22897  65.27655  1.000 64.18465  ? 150  VAL A CG1 1 
ATOM   1150  C CG2 . VAL A  1 170 ? -63.96476 -40.28830  64.42737  1.000 57.39376  ? 150  VAL A CG2 1 
ATOM   1151  N N   . ASP A  1 171 ? -68.03051 -38.08785  64.57154  1.000 74.04768  ? 151  ASP A N   1 
ATOM   1152  C CA  . ASP A  1 171 ? -69.43139 -37.90523  64.93293  1.000 75.41436  ? 151  ASP A CA  1 
ATOM   1153  C C   . ASP A  1 171 ? -70.28226 -37.45113  63.75038  1.000 78.62985  ? 151  ASP A C   1 
ATOM   1154  O O   . ASP A  1 171 ? -71.48995 -37.71625  63.72142  1.000 80.19606  ? 151  ASP A O   1 
ATOM   1155  C CB  . ASP A  1 171 ? -69.54871 -36.89967  66.08022  1.000 74.83339  ? 151  ASP A CB  1 
ATOM   1156  C CG  . ASP A  1 171 ? -68.79891 -37.34445  67.33530  1.000 76.99341  ? 151  ASP A CG  1 
ATOM   1157  O OD1 . ASP A  1 171 ? -68.62325 -38.56980  67.53371  1.000 73.89885  ? 151  ASP A OD1 1 
ATOM   1158  O OD2 . ASP A  1 171 ? -68.37969 -36.46067  68.12472  1.000 78.65019  ? 151  ASP A OD2 1 
ATOM   1159  N N   . SER A  1 172 ? -69.68455 -36.77003  62.77410  1.000 75.97844  ? 152  SER A N   1 
ATOM   1160  C CA  . SER A  1 172 ? -70.43327 -36.32857  61.60687  1.000 72.77470  ? 152  SER A CA  1 
ATOM   1161  C C   . SER A  1 172 ? -70.57308 -37.41748  60.55444  1.000 74.93416  ? 152  SER A C   1 
ATOM   1162  O O   . SER A  1 172 ? -71.41298 -37.28665  59.65817  1.000 80.04550  ? 152  SER A O   1 
ATOM   1163  C CB  . SER A  1 172 ? -69.76357 -35.10222  60.98166  1.000 71.99803  ? 152  SER A CB  1 
ATOM   1164  O OG  . SER A  1 172 ? -68.52810 -35.44631  60.36975  1.000 70.56242  ? 152  SER A OG  1 
ATOM   1165  N N   . GLY A  1 173 ? -69.77979 -38.48359  60.63796  1.000 74.11462  ? 153  GLY A N   1 
ATOM   1166  C CA  . GLY A  1 173 ? -69.78503 -39.52011  59.62388  1.000 73.65492  ? 153  GLY A CA  1 
ATOM   1167  C C   . GLY A  1 173 ? -69.14841 -39.13453  58.30741  1.000 68.69234  ? 153  GLY A C   1 
ATOM   1168  O O   . GLY A  1 173 ? -69.18916 -39.93305  57.36202  1.000 65.44729  ? 153  GLY A O   1 
ATOM   1169  N N   . ALA A  1 174 ? -68.54381 -37.94994  58.22770  1.000 66.11332  ? 154  ALA A N   1 
ATOM   1170  C CA  . ALA A  1 174 ? -68.03636 -37.41714  56.97242  1.000 68.89443  ? 154  ALA A CA  1 
ATOM   1171  C C   . ALA A  1 174 ? -67.04709 -38.37562  56.32055  1.000 68.58194  ? 154  ALA A C   1 
ATOM   1172  O O   . ALA A  1 174 ? -66.35750 -39.14678  56.99042  1.000 64.12343  ? 154  ALA A O   1 
ATOM   1173  C CB  . ALA A  1 174 ? -67.35836 -36.06059  57.21230  1.000 68.14245  ? 154  ALA A CB  1 
ATOM   1174  N N   . ASP A  1 175 ? -66.98057 -38.31403  54.98929  1.000 71.79487  ? 155  ASP A N   1 
ATOM   1175  C CA  . ASP A  1 175 ? -65.88513 -38.95377  54.27298  1.000 74.46382  ? 155  ASP A CA  1 
ATOM   1176  C C   . ASP A  1 175 ? -64.60046 -38.13276  54.36289  1.000 75.98945  ? 155  ASP A C   1 
ATOM   1177  O O   . ASP A  1 175 ? -63.50044 -38.69806  54.33687  1.000 80.60169  ? 155  ASP A O   1 
ATOM   1178  C CB  . ASP A  1 175 ? -66.28155 -39.17701  52.81608  1.000 78.94655  ? 155  ASP A CB  1 
ATOM   1179  C CG  . ASP A  1 175 ? -67.60104 -39.92596  52.67965  1.000 85.46514  ? 155  ASP A CG  1 
ATOM   1180  O OD1 . ASP A  1 175 ? -68.12205 -40.42274  53.70763  1.000 84.90125  ? 155  ASP A OD1 1 
ATOM   1181  O OD2 . ASP A  1 175 ? -68.11637 -40.01391  51.54299  1.000 89.18615  ? 155  ASP A OD2 1 
ATOM   1182  N N   . VAL A  1 176 ? -64.71436 -36.81326  54.47838  1.000 71.30917  ? 156  VAL A N   1 
ATOM   1183  C CA  . VAL A  1 176 ? -63.56014 -35.94961  54.71124  1.000 67.33715  ? 156  VAL A CA  1 
ATOM   1184  C C   . VAL A  1 176 ? -64.03578 -34.71157  55.45034  1.000 64.00704  ? 156  VAL A C   1 
ATOM   1185  O O   . VAL A  1 176 ? -65.05621 -34.11415  55.09170  1.000 66.29900  ? 156  VAL A O   1 
ATOM   1186  C CB  . VAL A  1 176 ? -62.83978 -35.55963  53.40344  1.000 64.55202  ? 156  VAL A CB  1 
ATOM   1187  C CG1 . VAL A  1 176 ? -63.82908 -34.98922  52.38619  1.000 65.32477  ? 156  VAL A CG1 1 
ATOM   1188  C CG2 . VAL A  1 176 ? -61.69957 -34.58301  53.68959  1.000 58.26844  ? 156  VAL A CG2 1 
ATOM   1189  N N   . THR A  1 177 ? -63.30920 -34.34579  56.49720  1.000 59.82146  ? 157  THR A N   1 
ATOM   1190  C CA  . THR A  1 177 ? -63.53116 -33.10925  57.23007  1.000 57.55741  ? 157  THR A CA  1 
ATOM   1191  C C   . THR A  1 177 ? -62.41516 -32.13256  56.87792  1.000 55.37292  ? 157  THR A C   1 
ATOM   1192  O O   . THR A  1 177 ? -61.24757 -32.52051  56.80481  1.000 56.60596  ? 157  THR A O   1 
ATOM   1193  C CB  . THR A  1 177 ? -63.58223 -33.39056  58.73788  1.000 56.20667  ? 157  THR A CB  1 
ATOM   1194  O OG1 . THR A  1 177 ? -64.70492 -34.23789  59.01880  1.000 58.24785  ? 157  THR A OG1 1 
ATOM   1195  C CG2 . THR A  1 177 ? -63.71059 -32.11342  59.54112  1.000 54.16504  ? 157  THR A CG2 1 
ATOM   1196  N N   . ILE A  1 178 ? -62.76985 -30.87185  56.63477  1.000 56.26051  ? 158  ILE A N   1 
ATOM   1197  C CA  . ILE A  1 178 ? -61.82985 -29.88084  56.11698  1.000 57.92272  ? 158  ILE A CA  1 
ATOM   1198  C C   . ILE A  1 178 ? -61.77598 -28.68125  57.06156  1.000 57.53416  ? 158  ILE A C   1 
ATOM   1199  O O   . ILE A  1 178 ? -62.82032 -28.14395  57.45751  1.000 60.17270  ? 158  ILE A O   1 
ATOM   1200  C CB  . ILE A  1 178 ? -62.21431 -29.44233  54.68852  1.000 62.29946  ? 158  ILE A CB  1 
ATOM   1201  C CG1 . ILE A  1 178 ? -62.28801 -30.66111  53.76552  1.000 65.94681  ? 158  ILE A CG1 1 
ATOM   1202  C CG2 . ILE A  1 178 ? -61.22450 -28.41093  54.14831  1.000 60.56948  ? 158  ILE A CG2 1 
ATOM   1203  C CD1 . ILE A  1 178 ? -62.67029 -30.32781  52.34012  1.000 66.23824  ? 158  ILE A CD1 1 
ATOM   1204  N N   . GLY A  1 179 ? -60.55809 -28.25588  57.40302  1.000 50.78648  ? 159  GLY A N   1 
ATOM   1205  C CA  . GLY A  1 179 ? -60.37370 -27.08173  58.25138  1.000 45.27178  ? 159  GLY A CA  1 
ATOM   1206  C C   . GLY A  1 179 ? -60.54066 -25.79692  57.45012  1.000 46.83929  ? 159  GLY A C   1 
ATOM   1207  O O   . GLY A  1 179 ? -59.97056 -25.64744  56.36435  1.000 47.87684  ? 159  GLY A O   1 
ATOM   1208  N N   . CYS A  1 180 ? -61.30788 -24.85701  57.99915  1.000 47.96543  ? 160  CYS A N   1 
ATOM   1209  C CA  . CYS A  1 180 ? -61.76413 -23.68603  57.26141  1.000 49.90060  ? 160  CYS A CA  1 
ATOM   1210  C C   . CYS A  1 180 ? -61.57364 -22.41833  58.08035  1.000 51.86721  ? 160  CYS A C   1 
ATOM   1211  O O   . CYS A  1 180 ? -61.99835 -22.34804  59.24046  1.000 50.77667  ? 160  CYS A O   1 
ATOM   1212  C CB  . CYS A  1 180 ? -63.23451 -23.83733  56.87662  1.000 48.80524  ? 160  CYS A CB  1 
ATOM   1213  S SG  . CYS A  1 180 ? -63.49791 -24.92504  55.47369  1.000 60.57312  ? 160  CYS A SG  1 
ATOM   1214  N N   . LEU A  1 181 ? -60.93539 -21.41971  57.47788  1.000 53.62382  ? 161  LEU A N   1 
ATOM   1215  C CA  . LEU A  1 181 ? -60.91715 -20.09223  58.07296  1.000 54.79678  ? 161  LEU A CA  1 
ATOM   1216  C C   . LEU A  1 181 ? -62.20343 -19.36578  57.71181  1.000 57.34155  ? 161  LEU A C   1 
ATOM   1217  O O   . LEU A  1 181 ? -62.71323 -19.49128  56.59485  1.000 58.99158  ? 161  LEU A O   1 
ATOM   1218  C CB  . LEU A  1 181 ? -59.72502 -19.27266  57.58823  1.000 53.72573  ? 161  LEU A CB  1 
ATOM   1219  C CG  . LEU A  1 181 ? -58.29635 -19.79821  57.67776  1.000 51.44640  ? 161  LEU A CG  1 
ATOM   1220  C CD1 . LEU A  1 181 ? -57.40399 -18.80095  56.94459  1.000 51.80069  ? 161  LEU A CD1 1 
ATOM   1221  C CD2 . LEU A  1 181 ? -57.83626 -19.98535  59.11397  1.000 48.79734  ? 161  LEU A CD2 1 
ATOM   1222  N N   . GLU A  1 182 ? -62.74090 -18.63420  58.67306  1.000 57.60968  ? 162  GLU A N   1 
ATOM   1223  C CA  . GLU A  1 182 ? -63.89681 -17.77890  58.46304  1.000 57.65604  ? 162  GLU A CA  1 
ATOM   1224  C C   . GLU A  1 182 ? -63.34919 -16.38685  58.19046  1.000 54.81902  ? 162  GLU A C   1 
ATOM   1225  O O   . GLU A  1 182 ? -62.72905 -15.78156  59.06809  1.000 54.40646  ? 162  GLU A O   1 
ATOM   1226  C CB  . GLU A  1 182 ? -64.81155 -17.79934  59.68268  1.000 61.93441  ? 162  GLU A CB  1 
ATOM   1227  C CG  . GLU A  1 182 ? -66.10770 -17.02948  59.49811  1.000 73.96745  ? 162  GLU A CG  1 
ATOM   1228  C CD  . GLU A  1 182 ? -67.13355 -17.36984  60.56421  1.000 81.36683  ? 162  GLU A CD  1 
ATOM   1229  O OE1 . GLU A  1 182 ? -67.06191 -18.49025  61.12674  1.000 82.05849  ? 162  GLU A OE1 1 
ATOM   1230  O OE2 . GLU A  1 182 ? -68.00112 -16.51186  60.84072  1.000 83.91836  ? 162  GLU A OE2 1 
ATOM   1231  N N   . VAL A  1 183 ? -63.52044 -15.90399  56.96384  1.000 51.04171  ? 163  VAL A N   1 
ATOM   1232  C CA  . VAL A  1 183 ? -62.90091 -14.64568  56.55270  1.000 49.86442  ? 163  VAL A CA  1 
ATOM   1233  C C   . VAL A  1 183 ? -63.92938 -13.82738  55.78351  1.000 55.52310  ? 163  VAL A C   1 
ATOM   1234  O O   . VAL A  1 183 ? -64.91414 -14.36894  55.25622  1.000 59.21232  ? 163  VAL A O   1 
ATOM   1235  C CB  . VAL A  1 183 ? -61.63246 -14.88382  55.69835  1.000 49.30583  ? 163  VAL A CB  1 
ATOM   1236  C CG1 . VAL A  1 183 ? -60.76003 -15.97796  56.30499  1.000 50.84797  ? 163  VAL A CG1 1 
ATOM   1237  C CG2 . VAL A  1 183 ? -61.99380 -15.24158  54.28899  1.000 51.37670  ? 163  VAL A CG2 1 
ATOM   1238  N N   . PRO A  1 184 ? -63.74408 -12.51081  55.71825  1.000 54.86832  ? 164  PRO A N   1 
ATOM   1239  C CA  . PRO A  1 184 ? -64.60296 -11.69926  54.84532  1.000 57.57115  ? 164  PRO A CA  1 
ATOM   1240  C C   . PRO A  1 184 ? -64.42896 -12.14103  53.40086  1.000 58.59630  ? 164  PRO A C   1 
ATOM   1241  O O   . PRO A  1 184 ? -63.32576 -12.49674  52.97632  1.000 57.63924  ? 164  PRO A O   1 
ATOM   1242  C CB  . PRO A  1 184 ? -64.10252 -10.26638  55.07365  1.000 52.98638  ? 164  PRO A CB  1 
ATOM   1243  C CG  . PRO A  1 184 ? -63.42250 -10.30440  56.40541  1.000 53.46088  ? 164  PRO A CG  1 
ATOM   1244  C CD  . PRO A  1 184 ? -62.81722 -11.69040  56.51471  1.000 52.97361  ? 164  PRO A CD  1 
ATOM   1245  N N   . ARG A  1 185 ? -65.53680 -12.12789  52.64716  1.000 61.20453  ? 165  ARG A N   1 
ATOM   1246  C CA  . ARG A  1 185 ? -65.53755 -12.77380  51.33674  1.000 64.03180  ? 165  ARG A CA  1 
ATOM   1247  C C   . ARG A  1 185 ? -64.63189 -12.06343  50.33926  1.000 68.02908  ? 165  ARG A C   1 
ATOM   1248  O O   . ARG A  1 185 ? -64.12403 -12.70395  49.40885  1.000 69.19557  ? 165  ARG A O   1 
ATOM   1249  C CB  . ARG A  1 185 ? -66.95726 -12.86604  50.78503  1.000 63.51371  ? 165  ARG A CB  1 
ATOM   1250  C CG  . ARG A  1 185 ? -67.99617 -13.16369  51.82467  1.000 66.11178  ? 165  ARG A CG  1 
ATOM   1251  C CD  . ARG A  1 185 ? -69.33649 -12.57754  51.40407  1.000 73.54170  ? 165  ARG A CD  1 
ATOM   1252  N NE  . ARG A  1 185 ? -69.60612 -12.77553  49.98313  1.000 73.05251  ? 165  ARG A NE  1 
ATOM   1253  C CZ  . ARG A  1 185 ? -70.03971 -11.83639  49.14503  1.000 73.55236  ? 165  ARG A CZ  1 
ATOM   1254  N NH1 . ARG A  1 185 ? -70.28890 -10.59612  49.56444  1.000 74.78190  ? 165  ARG A NH1 1 
ATOM   1255  N NH2 . ARG A  1 185 ? -70.24303 -12.15499  47.87632  1.000 73.78750  ? 165  ARG A NH2 1 
ATOM   1256  N N   . MET A  1 186 ? -64.41286 -10.75529  50.50492  1.000 71.28005  ? 166  MET A N   1 
ATOM   1257  C CA  . MET A  1 186 ? -63.51046 -10.05503  49.59530  1.000 72.97726  ? 166  MET A CA  1 
ATOM   1258  C C   . MET A  1 186 ? -62.07794 -10.55730  49.73308  1.000 73.44272  ? 166  MET A C   1 
ATOM   1259  O O   . MET A  1 186 ? -61.34484 -10.63205  48.74004  1.000 75.00153  ? 166  MET A O   1 
ATOM   1260  C CB  . MET A  1 186 ? -63.57971 -8.55610   49.84112  1.000 74.08617  ? 166  MET A CB  1 
ATOM   1261  C CG  . MET A  1 186 ? -63.89248 -8.18558   51.26858  1.000 80.68336  ? 166  MET A CG  1 
ATOM   1262  S SD  . MET A  1 186 ? -64.29295 -6.43000   51.35237  1.000 91.26916  ? 166  MET A SD  1 
ATOM   1263  C CE  . MET A  1 186 ? -62.70295 -5.73907   51.84149  1.000 87.71504  ? 166  MET A CE  1 
ATOM   1264  N N   . GLU A  1 187 ? -61.66828 -10.92661  50.94273  1.000 71.99050  ? 167  GLU A N   1 
ATOM   1265  C CA  . GLU A  1 187 ? -60.34658 -11.49452  51.15633  1.000 71.87778  ? 167  GLU A CA  1 
ATOM   1266  C C   . GLU A  1 187 ? -60.31170 -12.99809  50.95918  1.000 71.33873  ? 167  GLU A C   1 
ATOM   1267  O O   . GLU A  1 187 ? -59.22552 -13.58322  50.99544  1.000 75.16426  ? 167  GLU A O   1 
ATOM   1268  C CB  . GLU A  1 187 ? -59.84082 -11.15337  52.55932  1.000 70.59601  ? 167  GLU A CB  1 
ATOM   1269  C CG  . GLU A  1 187 ? -59.95666 -9.67188   52.87521  1.000 73.16321  ? 167  GLU A CG  1 
ATOM   1270  C CD  . GLU A  1 187 ? -60.26596 -9.41124   54.33129  1.000 74.41346  ? 167  GLU A CD  1 
ATOM   1271  O OE1 . GLU A  1 187 ? -59.97601 -10.29564  55.17110  1.000 68.90127  ? 167  GLU A OE1 1 
ATOM   1272  O OE2 . GLU A  1 187 ? -60.81819 -8.32677   54.62514  1.000 77.56233  ? 167  GLU A OE2 1 
ATOM   1273  N N   . ALA A  1 188 ? -61.46251 -13.63262  50.75907  1.000 65.97211  ? 168  ALA A N   1 
ATOM   1274  C CA  . ALA A  1 188 ? -61.52435 -15.05382  50.46232  1.000 61.80798  ? 168  ALA A CA  1 
ATOM   1275  C C   . ALA A  1 188 ? -61.21495 -15.34480  49.00135  1.000 66.12970  ? 168  ALA A C   1 
ATOM   1276  O O   . ALA A  1 188 ? -61.26664 -16.50495  48.57771  1.000 67.03884  ? 168  ALA A O   1 
ATOM   1277  C CB  . ALA A  1 188 ? -62.90534 -15.59444  50.83789  1.000 60.09313  ? 168  ALA A CB  1 
ATOM   1278  N N   . THR A  1 189 ? -60.87275 -14.30333  48.24126  1.000 67.78385  ? 169  THR A N   1 
ATOM   1279  C CA  . THR A  1 189 ? -60.73702 -14.36901  46.79339  1.000 67.16853  ? 169  THR A CA  1 
ATOM   1280  C C   . THR A  1 189 ? -59.45719 -15.06391  46.34118  1.000 66.76654  ? 169  THR A C   1 
ATOM   1281  O O   . THR A  1 189 ? -59.37669 -15.49460  45.18446  1.000 70.65009  ? 169  THR A O   1 
ATOM   1282  C CB  . THR A  1 189 ? -60.80023 -12.94668  46.23021  1.000 67.48113  ? 169  THR A CB  1 
ATOM   1283  O OG1 . THR A  1 189 ? -60.93922 -12.99409  44.80979  1.000 71.16727  ? 169  THR A OG1 1 
ATOM   1284  C CG2 . THR A  1 189 ? -59.54442 -12.15994  46.60703  1.000 63.80521  ? 169  THR A CG2 1 
ATOM   1285  N N   . GLY A  1 190 ? -58.46344 -15.19219  47.21603  1.000 62.34787  ? 170  GLY A N   1 
ATOM   1286  C CA  . GLY A  1 190 ? -57.24899 -15.90515  46.89371  1.000 61.68218  ? 170  GLY A CA  1 
ATOM   1287  C C   . GLY A  1 190 ? -57.19281 -17.34254  47.36221  1.000 62.88217  ? 170  GLY A C   1 
ATOM   1288  O O   . GLY A  1 190 ? -56.18296 -18.01146  47.13191  1.000 66.43058  ? 170  GLY A O   1 
ATOM   1289  N N   . PHE A  1 191 ? -58.24863 -17.84759  47.99103  1.000 61.79910  ? 171  PHE A N   1 
ATOM   1290  C CA  . PHE A  1 191 ? -58.27400 -19.17147  48.59672  1.000 58.14059  ? 171  PHE A CA  1 
ATOM   1291  C C   . PHE A  1 191 ? -59.16153 -20.12220  47.79949  1.000 60.31715  ? 171  PHE A C   1 
ATOM   1292  O O   . PHE A  1 191 ? -59.95059 -19.72240  46.93353  1.000 59.00578  ? 171  PHE A O   1 
ATOM   1293  C CB  . PHE A  1 191 ? -58.80429 -19.10503  50.03886  1.000 57.25050  ? 171  PHE A CB  1 
ATOM   1294  C CG  . PHE A  1 191 ? -57.96613 -18.28284  50.98300  1.000 56.21954  ? 171  PHE A CG  1 
ATOM   1295  C CD1 . PHE A  1 191 ? -57.89358 -16.90240  50.86040  1.000 56.75611  ? 171  PHE A CD1 1 
ATOM   1296  C CD2 . PHE A  1 191 ? -57.28309 -18.89667  52.02942  1.000 53.18199  ? 171  PHE A CD2 1 
ATOM   1297  C CE1 . PHE A  1 191 ? -57.13667 -16.14999  51.73880  1.000 55.25107  ? 171  PHE A CE1 1 
ATOM   1298  C CE2 . PHE A  1 191 ? -56.52898 -18.15035  52.91154  1.000 50.84093  ? 171  PHE A CE2 1 
ATOM   1299  C CZ  . PHE A  1 191 ? -56.45332 -16.77460  52.77700  1.000 51.83616  ? 171  PHE A CZ  1 
ATOM   1300  N N   . GLY A  1 192 ? -59.04028 -21.40736  48.12862  1.000 60.18772  ? 172  GLY A N   1 
ATOM   1301  C CA  . GLY A  1 192 ? -60.10119 -22.35125  47.82328  1.000 62.95017  ? 172  GLY A CA  1 
ATOM   1302  C C   . GLY A  1 192 ? -61.21161 -22.16066  48.83958  1.000 65.75281  ? 172  GLY A C   1 
ATOM   1303  O O   . GLY A  1 192 ? -60.95236 -22.03875  50.04179  1.000 67.38638  ? 172  GLY A O   1 
ATOM   1304  N N   . VAL A  1 193 ? -62.44933 -22.10144  48.36187  1.000 64.44321  ? 173  VAL A N   1 
ATOM   1305  C CA  . VAL A  1 193 ? -63.57653 -21.70123  49.19287  1.000 64.83053  ? 173  VAL A CA  1 
ATOM   1306  C C   . VAL A  1 193 ? -64.63540 -22.79119  49.17212  1.000 70.76382  ? 173  VAL A C   1 
ATOM   1307  O O   . VAL A  1 193 ? -64.90688 -23.38655  48.12225  1.000 76.29470  ? 173  VAL A O   1 
ATOM   1308  C CB  . VAL A  1 193 ? -64.16136 -20.35763  48.71879  1.000 59.77179  ? 173  VAL A CB  1 
ATOM   1309  C CG1 . VAL A  1 193 ? -65.34384 -19.95292  49.58904  1.000 57.69363  ? 173  VAL A CG1 1 
ATOM   1310  C CG2 . VAL A  1 193 ? -63.06871 -19.30926  48.73277  1.000 56.48674  ? 173  VAL A CG2 1 
ATOM   1311  N N   . MET A  1 194 ? -65.25034 -23.03118  50.32984  1.000 69.28212  ? 174  MET A N   1 
ATOM   1312  C CA  . MET A  1 194 ? -66.29780 -24.03374  50.48164  1.000 71.57927  ? 174  MET A CA  1 
ATOM   1313  C C   . MET A  1 194 ? -67.65026 -23.33234  50.56619  1.000 73.46337  ? 174  MET A C   1 
ATOM   1314  O O   . MET A  1 194 ? -67.87889 -22.52980  51.47882  1.000 75.20448  ? 174  MET A O   1 
ATOM   1315  C CB  . MET A  1 194 ? -66.05243 -24.88954  51.72971  1.000 70.70741  ? 174  MET A CB  1 
ATOM   1316  C CG  . MET A  1 194 ? -64.63968 -25.46244  51.84472  1.000 70.02847  ? 174  MET A CG  1 
ATOM   1317  S SD  . MET A  1 194 ? -64.24171 -26.65195  50.53728  1.000 79.02910  ? 174  MET A SD  1 
ATOM   1318  C CE  . MET A  1 194 ? -62.47866 -26.85296  50.76846  1.000 79.07577  ? 174  MET A CE  1 
ATOM   1319  N N   . HIS A  1 195 ? -68.53356 -23.61058  49.60768  1.000 70.31794  ? 175  HIS A N   1 
ATOM   1320  C CA  . HIS A  1 195 ? -69.93812 -23.27529  49.78749  1.000 72.81711  ? 175  HIS A CA  1 
ATOM   1321  C C   . HIS A  1 195 ? -70.55113 -24.36968  50.64974  1.000 72.57143  ? 175  HIS A C   1 
ATOM   1322  O O   . HIS A  1 195 ? -70.31232 -25.55960  50.42275  1.000 70.15090  ? 175  HIS A O   1 
ATOM   1323  C CB  . HIS A  1 195 ? -70.66770 -23.15168  48.43865  1.000 76.58655  ? 175  HIS A CB  1 
ATOM   1324  C CG  . HIS A  1 195 ? -72.09943 -22.68679  48.54033  1.000 78.31324  ? 175  HIS A CG  1 
ATOM   1325  N ND1 . HIS A  1 195 ? -72.77892 -22.12828  47.47543  1.000 81.77723  ? 175  HIS A ND1 1 
ATOM   1326  C CD2 . HIS A  1 195 ? -72.97333 -22.68667  49.57691  1.000 79.14444  ? 175  HIS A CD2 1 
ATOM   1327  C CE1 . HIS A  1 195 ? -74.01057 -21.81921  47.84786  1.000 82.95597  ? 175  HIS A CE1 1 
ATOM   1328  N NE2 . HIS A  1 195 ? -74.15264 -22.14368  49.12014  1.000 82.86616  ? 175  HIS A NE2 1 
ATOM   1329  N N   . VAL A  1 196 ? -71.35115 -23.96521  51.62765  1.000 75.24209  ? 176  VAL A N   1 
ATOM   1330  C CA  . VAL A  1 196 ? -71.79657 -24.84502  52.69214  1.000 77.09187  ? 176  VAL A CA  1 
ATOM   1331  C C   . VAL A  1 196 ? -73.24462 -24.51799  53.05925  1.000 81.72914  ? 176  VAL A C   1 
ATOM   1332  O O   . VAL A  1 196 ? -73.72155 -23.39704  52.84777  1.000 84.84814  ? 176  VAL A O   1 
ATOM   1333  C CB  . VAL A  1 196 ? -70.81183 -24.69949  53.86210  1.000 78.79390  ? 176  VAL A CB  1 
ATOM   1334  C CG1 . VAL A  1 196 ? -71.38793 -25.18433  55.11398  1.000 82.41349  ? 176  VAL A CG1 1 
ATOM   1335  C CG2 . VAL A  1 196 ? -69.53705 -25.45551  53.55217  1.000 78.51163  ? 176  VAL A CG2 1 
ATOM   1336  N N   . ASN A  1 197 ? -73.95321 -25.51465  53.59249  1.000 81.77233  ? 177  ASN A N   1 
ATOM   1337  C CA  . ASN A  1 197 ? -75.39040 -25.46642  53.82440  1.000 83.41585  ? 177  ASN A CA  1 
ATOM   1338  C C   . ASN A  1 197 ? -75.71935 -25.18487  55.29594  1.000 85.47012  ? 177  ASN A C   1 
ATOM   1339  O O   . ASN A  1 197 ? -74.86183 -24.75151  56.07591  1.000 81.60256  ? 177  ASN A O   1 
ATOM   1340  C CB  . ASN A  1 197 ? -76.01465 -26.79061  53.35827  1.000 83.04523  ? 177  ASN A CB  1 
ATOM   1341  C CG  . ASN A  1 197 ? -75.83333 -27.91941  54.37955  1.000 79.04519  ? 177  ASN A CG  1 
ATOM   1342  O OD1 . ASN A  1 197 ? -74.91097 -27.90049  55.19339  1.000 71.46244  ? 177  ASN A OD1 1 
ATOM   1343  N ND2 . ASN A  1 197 ? -76.71387 -28.90621  54.32975  1.000 81.49388  ? 177  ASN A ND2 1 
ATOM   1344  N N   . GLU A  1 198 ? -76.96644 -25.47773  55.67898  1.000 93.16527  ? 178  GLU A N   1 
ATOM   1345  C CA  . GLU A  1 198 ? -77.47079 -25.23356  57.02771  1.000 96.01210  ? 178  GLU A CA  1 
ATOM   1346  C C   . GLU A  1 198 ? -76.57992 -25.84891  58.10494  1.000 90.59780  ? 178  GLU A C   1 
ATOM   1347  O O   . GLU A  1 198 ? -76.30448 -25.21137  59.12915  1.000 87.86825  ? 178  GLU A O   1 
ATOM   1348  C CB  . GLU A  1 198 ? -78.90575 -25.77471  57.10948  1.000 103.63070 ? 178  GLU A CB  1 
ATOM   1349  C CG  . GLU A  1 198 ? -79.38219 -26.23943  58.47522  1.000 107.51784 ? 178  GLU A CG  1 
ATOM   1350  C CD  . GLU A  1 198 ? -80.44446 -27.33760  58.37954  1.000 113.34976 ? 178  GLU A CD  1 
ATOM   1351  O OE1 . GLU A  1 198 ? -80.67960 -27.85544  57.26334  1.000 115.34683 ? 178  GLU A OE1 1 
ATOM   1352  O OE2 . GLU A  1 198 ? -81.04564 -27.68327  59.42158  1.000 115.57114 ? 178  GLU A OE2 1 
ATOM   1353  N N   . LYS A  1 199 ? -76.10313 -27.07610  57.88670  1.000 89.12332  ? 179  LYS A N   1 
ATOM   1354  C CA  . LYS A  1 199 ? -75.38085 -27.83904  58.90209  1.000 85.20051  ? 179  LYS A CA  1 
ATOM   1355  C C   . LYS A  1 199 ? -73.91715 -28.04637  58.52876  1.000 87.26505  ? 179  LYS A C   1 
ATOM   1356  O O   . LYS A  1 199 ? -73.34464 -29.11778  58.74900  1.000 90.94172  ? 179  LYS A O   1 
ATOM   1357  C CB  . LYS A  1 199 ? -76.05923 -29.18144  59.15792  1.000 86.62207  ? 179  LYS A CB  1 
ATOM   1358  C CG  . LYS A  1 199 ? -77.57623 -29.09264  59.25194  1.000 93.61746  ? 179  LYS A CG  1 
ATOM   1359  C CD  . LYS A  1 199 ? -78.23920 -30.44182  59.51375  1.000 98.48588  ? 179  LYS A CD  1 
ATOM   1360  C CE  . LYS A  1 199 ? -77.82406 -31.48388  58.48882  1.000 100.86361 ? 179  LYS A CE  1 
ATOM   1361  N NZ  . LYS A  1 199 ? -77.79644 -30.93526  57.09615  1.000 103.44871 ? 179  LYS A NZ  1 
ATOM   1362  N N   . ASP A  1 200 ? -73.30485 -27.00883  57.96140  1.000 85.09929  ? 180  ASP A N   1 
ATOM   1363  C CA  . ASP A  1 200 ? -71.87152 -26.93208  57.68116  1.000 81.02769  ? 180  ASP A CA  1 
ATOM   1364  C C   . ASP A  1 200 ? -71.35159 -28.08835  56.82409  1.000 78.32233  ? 180  ASP A C   1 
ATOM   1365  O O   . ASP A  1 200 ? -70.14907 -28.37731  56.83164  1.000 75.69616  ? 180  ASP A O   1 
ATOM   1366  C CB  . ASP A  1 200 ? -71.04938 -26.80335  58.96929  1.000 78.43140  ? 180  ASP A CB  1 
ATOM   1367  C CG  . ASP A  1 200 ? -70.63447 -25.36489  59.24252  1.000 78.67292  ? 180  ASP A CG  1 
ATOM   1368  O OD1 . ASP A  1 200 ? -70.97180 -24.49902  58.40424  1.000 83.75544  ? 180  ASP A OD1 1 
ATOM   1369  O OD2 . ASP A  1 200 ? -69.97826 -25.09353  60.27516  1.000 73.40812  ? 180  ASP A OD2 1 
ATOM   1370  N N   . GLU A  1 201 ? -72.21756 -28.74266  56.05719  1.000 77.66988  ? 181  GLU A N   1 
ATOM   1371  C CA  . GLU A  1 201 ? -71.76921 -29.70001  55.05588  1.000 76.09167  ? 181  GLU A CA  1 
ATOM   1372  C C   . GLU A  1 201 ? -71.41830 -28.96424  53.76848  1.000 74.54944  ? 181  GLU A C   1 
ATOM   1373  O O   . GLU A  1 201 ? -72.10212 -28.01247  53.37930  1.000 77.98483  ? 181  GLU A O   1 
ATOM   1374  C CB  . GLU A  1 201 ? -72.84643 -30.74771  54.78786  1.000 79.73184  ? 181  GLU A CB  1 
ATOM   1375  C CG  . GLU A  1 201 ? -73.70355 -31.07451  55.99470  1.000 88.12594  ? 181  GLU A CG  1 
ATOM   1376  C CD  . GLU A  1 201 ? -74.64296 -32.25114  55.74120  1.000 96.56377  ? 181  GLU A CD  1 
ATOM   1377  O OE1 . GLU A  1 201 ? -75.73641 -32.29350  56.34527  1.000 98.37725  ? 181  GLU A OE1 1 
ATOM   1378  O OE2 . GLU A  1 201 ? -74.28067 -33.14306  54.94269  1.000 100.11765 ? 181  GLU A OE2 1 
ATOM   1379  N N   . ILE A  1 202 ? -70.34806 -29.39948  53.11161  1.000 70.72384  ? 182  ILE A N   1 
ATOM   1380  C CA  . ILE A  1 202 ? -69.83521 -28.70322  51.93558  1.000 71.64890  ? 182  ILE A CA  1 
ATOM   1381  C C   . ILE A  1 202 ? -70.58980 -29.17836  50.70617  1.000 80.81852  ? 182  ILE A C   1 
ATOM   1382  O O   . ILE A  1 202 ? -70.55941 -30.36600  50.36144  1.000 86.78951  ? 182  ILE A O   1 
ATOM   1383  C CB  . ILE A  1 202 ? -68.32370 -28.90783  51.76516  1.000 69.42216  ? 182  ILE A CB  1 
ATOM   1384  C CG1 . ILE A  1 202 ? -67.57492 -28.37842  52.98964  1.000 65.25170  ? 182  ILE A CG1 1 
ATOM   1385  C CG2 . ILE A  1 202 ? -67.83818 -28.19851  50.50489  1.000 68.24337  ? 182  ILE A CG2 1 
ATOM   1386  C CD1 . ILE A  1 202 ? -66.19033 -28.94232  53.12490  1.000 68.27532  ? 182  ILE A CD1 1 
ATOM   1387  N N   . ILE A  1 203 ? -71.26430 -28.24007  50.03876  1.000 79.54525  ? 183  ILE A N   1 
ATOM   1388  C CA  . ILE A  1 203 ? -72.00842 -28.54357  48.82861  1.000 75.93302  ? 183  ILE A CA  1 
ATOM   1389  C C   . ILE A  1 203 ? -71.24703 -28.17683  47.56521  1.000 75.71602  ? 183  ILE A C   1 
ATOM   1390  O O   . ILE A  1 203 ? -71.64062 -28.61819  46.47325  1.000 79.37375  ? 183  ILE A O   1 
ATOM   1391  C CB  . ILE A  1 203 ? -73.37595 -27.83684  48.84466  1.000 78.33024  ? 183  ILE A CB  1 
ATOM   1392  C CG1 . ILE A  1 203 ? -73.20702 -26.33534  48.61365  1.000 77.99040  ? 183  ILE A CG1 1 
ATOM   1393  C CG2 . ILE A  1 203 ? -74.05271 -28.06925  50.18165  1.000 76.58627  ? 183  ILE A CG2 1 
ATOM   1394  C CD1 . ILE A  1 203 ? -74.48573 -25.58143  48.82289  1.000 78.99961  ? 183  ILE A CD1 1 
ATOM   1395  N N   . ASP A  1 204 ? -70.17587 -27.39536  47.67017  1.000 72.49174  ? 184  ASP A N   1 
ATOM   1396  C CA  . ASP A  1 204 ? -69.41191 -26.99932  46.49672  1.000 78.25618  ? 184  ASP A CA  1 
ATOM   1397  C C   . ASP A  1 204 ? -68.07873 -26.43157  46.94484  1.000 77.58703  ? 184  ASP A C   1 
ATOM   1398  O O   . ASP A  1 204 ? -67.98315 -25.79054  47.99656  1.000 74.81364  ? 184  ASP A O   1 
ATOM   1399  C CB  . ASP A  1 204 ? -70.16109 -25.96006  45.64807  1.000 83.90079  ? 184  ASP A CB  1 
ATOM   1400  C CG  . ASP A  1 204 ? -69.57770 -25.81791  44.24594  1.000 89.72385  ? 184  ASP A CG  1 
ATOM   1401  O OD1 . ASP A  1 204 ? -68.52388 -26.43462  43.95460  1.000 90.83022  ? 184  ASP A OD1 1 
ATOM   1402  O OD2 . ASP A  1 204 ? -70.17823 -25.09519  43.42397  1.000 92.61608  ? 184  ASP A OD2 1 
ATOM   1403  N N   . PHE A  1 205 ? -67.05924 -26.65966  46.12196  1.000 78.49392  ? 185  PHE A N   1 
ATOM   1404  C CA  . PHE A  1 205 ? -65.72964 -26.11105  46.34466  1.000 77.29258  ? 185  PHE A CA  1 
ATOM   1405  C C   . PHE A  1 205 ? -65.29717 -25.37789  45.08691  1.000 76.29837  ? 185  PHE A C   1 
ATOM   1406  O O   . PHE A  1 205 ? -65.27723 -25.96867  44.00182  1.000 81.56498  ? 185  PHE A O   1 
ATOM   1407  C CB  . PHE A  1 205 ? -64.72436 -27.21015  46.69347  1.000 75.74678  ? 185  PHE A CB  1 
ATOM   1408  C CG  . PHE A  1 205 ? -63.30375 -26.82108  46.43206  1.000 75.54843  ? 185  PHE A CG  1 
ATOM   1409  C CD1 . PHE A  1 205 ? -62.57787 -26.13695  47.39109  1.000 74.94461  ? 185  PHE A CD1 1 
ATOM   1410  C CD2 . PHE A  1 205 ? -62.69853 -27.12107  45.21959  1.000 75.15960  ? 185  PHE A CD2 1 
ATOM   1411  C CE1 . PHE A  1 205 ? -61.27628 -25.77183  47.15255  1.000 74.13391  ? 185  PHE A CE1 1 
ATOM   1412  C CE2 . PHE A  1 205 ? -61.40549 -26.75425  44.97602  1.000 74.46201  ? 185  PHE A CE2 1 
ATOM   1413  C CZ  . PHE A  1 205 ? -60.69224 -26.09365  45.94696  1.000 74.31483  ? 185  PHE A CZ  1 
ATOM   1414  N N   . ILE A  1 206 ? -64.93478 -24.10652  45.23474  1.000 70.61725  ? 186  ILE A N   1 
ATOM   1415  C CA  . ILE A  1 206 ? -64.51737 -23.26667  44.12048  1.000 71.99313  ? 186  ILE A CA  1 
ATOM   1416  C C   . ILE A  1 206 ? -63.09276 -22.80676  44.38167  1.000 68.97462  ? 186  ILE A C   1 
ATOM   1417  O O   . ILE A  1 206 ? -62.78045 -22.34509  45.48320  1.000 59.78715  ? 186  ILE A O   1 
ATOM   1418  C CB  . ILE A  1 206 ? -65.45309 -22.05374  43.93047  1.000 74.82475  ? 186  ILE A CB  1 
ATOM   1419  C CG1 . ILE A  1 206 ? -66.92527 -22.48838  43.91527  1.000 80.39552  ? 186  ILE A CG1 1 
ATOM   1420  C CG2 . ILE A  1 206 ? -65.12575 -21.33950  42.63526  1.000 71.71208  ? 186  ILE A CG2 1 
ATOM   1421  C CD1 . ILE A  1 206 ? -67.65130 -22.35369  45.24439  1.000 78.71517  ? 186  ILE A CD1 1 
ATOM   1422  N N   . GLU A  1 207 ? -62.23913 -22.91628  43.36890  1.000 70.29605  ? 187  GLU A N   1 
ATOM   1423  C CA  . GLU A  1 207 ? -60.86444 -22.44430  43.47698  1.000 71.56730  ? 187  GLU A CA  1 
ATOM   1424  C C   . GLU A  1 207 ? -60.79440 -20.96294  43.13584  1.000 69.21019  ? 187  GLU A C   1 
ATOM   1425  O O   . GLU A  1 207 ? -61.14564 -20.56478  42.02039  1.000 73.06530  ? 187  GLU A O   1 
ATOM   1426  C CB  . GLU A  1 207 ? -59.95150 -23.25308  42.55685  1.000 83.24969  ? 187  GLU A CB  1 
ATOM   1427  C CG  . GLU A  1 207 ? -58.46121 -23.16219  42.88975  1.000 92.23982  ? 187  GLU A CG  1 
ATOM   1428  C CD  . GLU A  1 207 ? -58.10019 -23.74068  44.25616  1.000 99.59831  ? 187  GLU A CD  1 
ATOM   1429  O OE1 . GLU A  1 207 ? -56.89902 -23.77080  44.59719  1.000 102.04959 ? 187  GLU A OE1 1 
ATOM   1430  O OE2 . GLU A  1 207 ? -59.00159 -24.15676  45.00327  1.000 102.95576 ? 187  GLU A OE2 1 
ATOM   1431  N N   . LYS A  1 208 ? -60.32393 -20.15823  44.08819  1.000 66.36508  ? 188  LYS A N   1 
ATOM   1432  C CA  . LYS A  1 208 ? -60.21197 -18.70486  43.97930  1.000 68.55444  ? 188  LYS A CA  1 
ATOM   1433  C C   . LYS A  1 208 ? -61.41535 -18.08769  43.25136  1.000 68.97491  ? 188  LYS A C   1 
ATOM   1434  O O   . LYS A  1 208 ? -61.25754 -17.51216  42.16968  1.000 66.29519  ? 188  LYS A O   1 
ATOM   1435  C CB  . LYS A  1 208 ? -58.90490 -18.30293  43.30337  1.000 70.48596  ? 188  LYS A CB  1 
ATOM   1436  C CG  . LYS A  1 208 ? -57.74758 -19.24585  43.54289  1.000 70.67884  ? 188  LYS A CG  1 
ATOM   1437  C CD  . LYS A  1 208 ? -56.43682 -18.68582  42.99293  1.000 73.26534  ? 188  LYS A CD  1 
ATOM   1438  C CE  . LYS A  1 208 ? -55.45413 -18.39067  44.13474  1.000 75.22599  ? 188  LYS A CE  1 
ATOM   1439  N NZ  . LYS A  1 208 ? -54.00543 -18.39774  43.75131  1.000 75.18044  ? 188  LYS A NZ  1 
ATOM   1440  N N   . PRO A  1 209 ? -62.62051 -18.20155  43.80863  1.000 68.71301  ? 189  PRO A N   1 
ATOM   1441  C CA  . PRO A  1 209 ? -63.77249 -17.55780  43.16323  1.000 68.04218  ? 189  PRO A CA  1 
ATOM   1442  C C   . PRO A  1 209 ? -63.59902 -16.05162  43.16842  1.000 66.55696  ? 189  PRO A C   1 
ATOM   1443  O O   . PRO A  1 209 ? -63.25635 -15.45090  44.19123  1.000 62.55959  ? 189  PRO A O   1 
ATOM   1444  C CB  . PRO A  1 209 ? -64.96523 -17.99775  44.02073  1.000 67.57067  ? 189  PRO A CB  1 
ATOM   1445  C CG  . PRO A  1 209 ? -64.37930 -18.34038  45.33527  1.000 66.44784  ? 189  PRO A CG  1 
ATOM   1446  C CD  . PRO A  1 209 ? -62.99471 -18.86468  45.07115  1.000 64.58231  ? 189  PRO A CD  1 
ATOM   1447  N N   . ALA A  1 210 ? -63.82069 -15.44541  42.00270  1.000 70.25981  ? 190  ALA A N   1 
ATOM   1448  C CA  . ALA A  1 210 ? -63.73917 -13.99367  41.91398  1.000 70.07680  ? 190  ALA A CA  1 
ATOM   1449  C C   . ALA A  1 210 ? -64.79146 -13.31534  42.78085  1.000 70.01881  ? 190  ALA A C   1 
ATOM   1450  O O   . ALA A  1 210 ? -64.56589 -12.19407  43.24883  1.000 71.69869  ? 190  ALA A O   1 
ATOM   1451  C CB  . ALA A  1 210 ? -63.86119 -13.54169  40.46063  1.000 69.74507  ? 190  ALA A CB  1 
ATOM   1452  N N   . ASP A  1 211 ? -65.94370 -13.96102  43.00644  1.000 70.92655  ? 191  ASP A N   1 
ATOM   1453  C CA  . ASP A  1 211 ? -66.94145 -13.49349  43.97778  1.000 74.01809  ? 191  ASP A CA  1 
ATOM   1454  C C   . ASP A  1 211 ? -67.39714 -14.69723  44.79383  1.000 75.28600  ? 191  ASP A C   1 
ATOM   1455  O O   . ASP A  1 211 ? -68.23702 -15.49380  44.35330  1.000 76.63440  ? 191  ASP A O   1 
ATOM   1456  C CB  . ASP A  1 211 ? -68.10280 -12.75857  43.29647  1.000 76.57174  ? 191  ASP A CB  1 
ATOM   1457  C CG  . ASP A  1 211 ? -69.06027 -12.13111  44.29873  1.000 79.75718  ? 191  ASP A CG  1 
ATOM   1458  O OD1 . ASP A  1 211 ? -70.29358 -12.31250  44.16412  1.000 75.23697  ? 191  ASP A OD1 1 
ATOM   1459  O OD2 . ASP A  1 211 ? -68.55858 -11.50074  45.25944  1.000 85.16984  ? 191  ASP A OD2 1 
ATOM   1460  N N   . PRO A  1 212 ? -66.85522 -14.86053  45.99526  1.000 72.47682  ? 192  PRO A N   1 
ATOM   1461  C CA  . PRO A  1 212 ? -66.96310 -16.14626  46.69922  1.000 69.12737  ? 192  PRO A CA  1 
ATOM   1462  C C   . PRO A  1 212 ? -68.30418 -16.29866  47.39377  1.000 72.71882  ? 192  PRO A C   1 
ATOM   1463  O O   . PRO A  1 212 ? -68.93633 -15.30357  47.77708  1.000 74.74843  ? 192  PRO A O   1 
ATOM   1464  C CB  . PRO A  1 212 ? -65.81277 -16.08749  47.71696  1.000 68.63627  ? 192  PRO A CB  1 
ATOM   1465  C CG  . PRO A  1 212 ? -64.95218 -14.89274  47.30819  1.000 69.69474  ? 192  PRO A CG  1 
ATOM   1466  C CD  . PRO A  1 212 ? -65.91667 -13.94085  46.66658  1.000 71.71805  ? 192  PRO A CD  1 
ATOM   1467  N N   . PRO A  1 213 ? -68.77097 -17.53214  47.58871  1.000 73.75277  ? 193  PRO A N   1 
ATOM   1468  C CA  . PRO A  1 213 ? -70.04884 -17.73613  48.28524  1.000 76.11282  ? 193  PRO A CA  1 
ATOM   1469  C C   . PRO A  1 213 ? -69.92601 -17.46540  49.77825  1.000 73.45131  ? 193  PRO A C   1 
ATOM   1470  O O   . PRO A  1 213 ? -68.85141 -17.56699  50.37512  1.000 66.54363  ? 193  PRO A O   1 
ATOM   1471  C CB  . PRO A  1 213 ? -70.37573 -19.21323  48.02150  1.000 75.12797  ? 193  PRO A CB  1 
ATOM   1472  C CG  . PRO A  1 213 ? -69.42240 -19.64779  46.93074  1.000 73.22714  ? 193  PRO A CG  1 
ATOM   1473  C CD  . PRO A  1 213 ? -68.20921 -18.79620  47.08316  1.000 70.15701  ? 193  PRO A CD  1 
ATOM   1474  N N   . GLY A  1 214 ? -71.06414 -17.12390  50.38282  1.000 75.92907  ? 194  GLY A N   1 
ATOM   1475  C CA  . GLY A  1 214 ? -71.10935 -16.80547  51.79763  1.000 74.52117  ? 194  GLY A CA  1 
ATOM   1476  C C   . GLY A  1 214 ? -71.86266 -17.79886  52.66180  1.000 76.11805  ? 194  GLY A C   1 
ATOM   1477  O O   . GLY A  1 214 ? -72.69886 -18.56227  52.16847  1.000 77.51190  ? 194  GLY A O   1 
ATOM   1478  N N   . ILE A  1 215 ? -71.58279 -17.77023  53.96119  1.000 76.47707  ? 195  ILE A N   1 
ATOM   1479  C CA  . ILE A  1 215 ? -72.17575 -18.70640  54.92645  1.000 77.18162  ? 195  ILE A CA  1 
ATOM   1480  C C   . ILE A  1 215 ? -73.65033 -18.37268  55.12662  1.000 87.94357  ? 195  ILE A C   1 
ATOM   1481  O O   . ILE A  1 215 ? -74.00680 -17.17985  55.19451  1.000 91.58963  ? 195  ILE A O   1 
ATOM   1482  C CB  . ILE A  1 215 ? -71.41675 -18.63605  56.25025  1.000 69.36681  ? 195  ILE A CB  1 
ATOM   1483  C CG1 . ILE A  1 215 ? -69.93082 -18.87091  56.01039  1.000 65.03428  ? 195  ILE A CG1 1 
ATOM   1484  C CG2 . ILE A  1 215 ? -71.97676 -19.63630  57.25282  1.000 70.20201  ? 195  ILE A CG2 1 
ATOM   1485  C CD1 . ILE A  1 215 ? -69.06928 -18.55920  57.21316  1.000 64.30737  ? 195  ILE A CD1 1 
ATOM   1486  N N   . PRO A  1 216 ? -74.53914 -19.36927  55.22045  1.000 89.85837  ? 196  PRO A N   1 
ATOM   1487  C CA  . PRO A  1 216 ? -75.93049 -19.08307  55.60594  1.000 88.57569  ? 196  PRO A CA  1 
ATOM   1488  C C   . PRO A  1 216 ? -75.98856 -18.37745  56.95767  1.000 86.88353  ? 196  PRO A C   1 
ATOM   1489  O O   . PRO A  1 216 ? -75.23636 -18.70083  57.88244  1.000 80.05434  ? 196  PRO A O   1 
ATOM   1490  C CB  . PRO A  1 216 ? -76.59185 -20.46570  55.66589  1.000 91.12316  ? 196  PRO A CB  1 
ATOM   1491  C CG  . PRO A  1 216 ? -75.61292 -21.44705  55.08590  1.000 91.46505  ? 196  PRO A CG  1 
ATOM   1492  C CD  . PRO A  1 216 ? -74.33410 -20.75210  54.74886  1.000 89.97527  ? 196  PRO A CD  1 
ATOM   1493  N N   . GLY A  1 217 ? -76.87924 -17.38508  57.05522  1.000 91.23600  ? 197  GLY A N   1 
ATOM   1494  C CA  . GLY A  1 217 ? -77.03419 -16.58841  58.26203  1.000 90.56640  ? 197  GLY A CA  1 
ATOM   1495  C C   . GLY A  1 217 ? -75.85073 -15.68006  58.52885  1.000 89.78638  ? 197  GLY A C   1 
ATOM   1496  O O   . GLY A  1 217 ? -75.74086 -15.07946  59.60400  1.000 87.05376  ? 197  GLY A O   1 
ATOM   1497  N N   . ASN A  1 218 ? -74.95653 -15.57564  57.54539  1.000 90.31197  ? 198  ASN A N   1 
ATOM   1498  C CA  . ASN A  1 218 ? -73.74552 -14.77560  57.66003  1.000 86.59076  ? 198  ASN A CA  1 
ATOM   1499  C C   . ASN A  1 218 ? -73.10973 -14.63025  56.28988  1.000 84.33559  ? 198  ASN A C   1 
ATOM   1500  O O   . ASN A  1 218 ? -71.94022 -14.98092  56.09894  1.000 83.77816  ? 198  ASN A O   1 
ATOM   1501  C CB  . ASN A  1 218 ? -72.75994 -15.42073  58.63336  1.000 86.57748  ? 198  ASN A CB  1 
ATOM   1502  C CG  . ASN A  1 218 ? -71.60901 -14.49187  59.01110  1.000 89.79381  ? 198  ASN A CG  1 
ATOM   1503  O OD1 . ASN A  1 218 ? -71.20283 -13.63117  58.22640  1.000 95.21075  ? 198  ASN A OD1 1 
ATOM   1504  N ND2 . ASN A  1 218 ? -71.06328 -14.68122  60.21082  1.000 85.21587  ? 198  ASN A ND2 1 
ATOM   1505  N N   . GLU A  1 219 ? -73.87028 -14.12857  55.33566  1.000 85.33378  ? 199  GLU A N   1 
ATOM   1506  C CA  . GLU A  1 219 ? -73.35932 -14.10958  53.98719  1.000 84.41556  ? 199  GLU A CA  1 
ATOM   1507  C C   . GLU A  1 219 ? -72.33703 -12.98783  53.76481  1.000 76.12246  ? 199  GLU A C   1 
ATOM   1508  O O   . GLU A  1 219 ? -72.02458 -12.68744  52.60383  1.000 76.23514  ? 199  GLU A O   1 
ATOM   1509  C CB  . GLU A  1 219 ? -74.53666 -14.02514  52.99343  1.000 89.53840  ? 199  GLU A CB  1 
ATOM   1510  C CG  . GLU A  1 219 ? -75.69913 -15.11219  53.13765  1.000 94.35847  ? 199  GLU A CG  1 
ATOM   1511  C CD  . GLU A  1 219 ? -76.49665 -15.17952  54.47336  1.000 97.71166  ? 199  GLU A CD  1 
ATOM   1512  O OE1 . GLU A  1 219 ? -76.75673 -14.09214  55.10142  1.000 98.21117  ? 199  GLU A OE1 1 
ATOM   1513  O OE2 . GLU A  1 219 ? -76.82809 -16.34404  54.85720  1.000 96.91760  ? 199  GLU A OE2 1 
ATOM   1514  N N   . GLY A  1 220 ? -71.86475 -12.39043  54.86541  1.000 67.61200  ? 200  GLY A N   1 
ATOM   1515  C CA  . GLY A  1 220 ? -70.75251 -11.46568  54.85145  1.000 63.37974  ? 200  GLY A CA  1 
ATOM   1516  C C   . GLY A  1 220 ? -69.40373 -12.12642  54.94667  1.000 62.06926  ? 200  GLY A C   1 
ATOM   1517  O O   . GLY A  1 220 ? -68.37658 -11.46966  54.76205  1.000 60.06218  ? 200  GLY A O   1 
ATOM   1518  N N   . PHE A  1 221 ? -69.38036 -13.42585  55.22368  1.000 61.67837  ? 201  PHE A N   1 
ATOM   1519  C CA  . PHE A  1 221 ? -68.14339 -14.16221  55.42337  1.000 63.05775  ? 201  PHE A CA  1 
ATOM   1520  C C   . PHE A  1 221 ? -68.16046 -15.44660  54.60876  1.000 66.63327  ? 201  PHE A C   1 
ATOM   1521  O O   . PHE A  1 221 ? -69.22399 -16.00027  54.30783  1.000 68.72206  ? 201  PHE A O   1 
ATOM   1522  C CB  . PHE A  1 221 ? -67.92946 -14.48983  56.90378  1.000 60.41334  ? 201  PHE A CB  1 
ATOM   1523  C CG  . PHE A  1 221 ? -67.53379 -13.30769  57.72508  1.000 60.17485  ? 201  PHE A CG  1 
ATOM   1524  C CD1 . PHE A  1 221 ? -68.47399 -12.36288  58.09406  1.000 65.05560  ? 201  PHE A CD1 1 
ATOM   1525  C CD2 . PHE A  1 221 ? -66.22382 -13.13214  58.12462  1.000 58.94725  ? 201  PHE A CD2 1 
ATOM   1526  C CE1 . PHE A  1 221 ? -68.11985 -11.26680  58.84883  1.000 62.83670  ? 201  PHE A CE1 1 
ATOM   1527  C CE2 . PHE A  1 221 ? -65.86228 -12.03302  58.88385  1.000 60.22183  ? 201  PHE A CE2 1 
ATOM   1528  C CZ  . PHE A  1 221 ? -66.81286 -11.10000  59.23955  1.000 60.11546  ? 201  PHE A CZ  1 
ATOM   1529  N N   . ALA A  1 222 ? -66.96472 -15.91418  54.25941  1.000 64.16735  ? 202  ALA A N   1 
ATOM   1530  C CA  . ALA A  1 222 ? -66.77690 -17.15465  53.52940  1.000 59.10311  ? 202  ALA A CA  1 
ATOM   1531  C C   . ALA A  1 222 ? -65.85813 -18.07207  54.32160  1.000 58.96012  ? 202  ALA A C   1 
ATOM   1532  O O   . ALA A  1 222 ? -65.09263 -17.63194  55.18672  1.000 57.33033  ? 202  ALA A O   1 
ATOM   1533  C CB  . ALA A  1 222 ? -66.19725 -16.90218  52.12954  1.000 56.43835  ? 202  ALA A CB  1 
ATOM   1534  N N   . LEU A  1 223 ? -65.96154 -19.36442  54.03313  1.000 59.75838  ? 203  LEU A N   1 
ATOM   1535  C CA  . LEU A  1 223 ? -65.09892 -20.36480  54.63783  1.000 57.26241  ? 203  LEU A CA  1 
ATOM   1536  C C   . LEU A  1 223 ? -64.01928 -20.72442  53.63319  1.000 60.53496  ? 203  LEU A C   1 
ATOM   1537  O O   . LEU A  1 223 ? -64.32193 -21.24009  52.55137  1.000 62.99954  ? 203  LEU A O   1 
ATOM   1538  C CB  . LEU A  1 223 ? -65.87990 -21.60519  55.07917  1.000 54.57874  ? 203  LEU A CB  1 
ATOM   1539  C CG  . LEU A  1 223 ? -66.88378 -21.34397  56.20263  1.000 55.22215  ? 203  LEU A CG  1 
ATOM   1540  C CD1 . LEU A  1 223 ? -67.61120 -22.60695  56.64092  1.000 55.23423  ? 203  LEU A CD1 1 
ATOM   1541  C CD2 . LEU A  1 223 ? -66.16414 -20.73767  57.38276  1.000 55.20823  ? 203  LEU A CD2 1 
ATOM   1542  N N   . ALA A  1 224 ? -62.76870 -20.43439  53.98630  1.000 57.72094  ? 204  ALA A N   1 
ATOM   1543  C CA  . ALA A  1 224 ? -61.63942 -20.64107  53.09772  1.000 54.39270  ? 204  ALA A CA  1 
ATOM   1544  C C   . ALA A  1 224 ? -60.81891 -21.82864  53.58347  1.000 50.09716  ? 204  ALA A C   1 
ATOM   1545  O O   . ALA A  1 224 ? -60.60785 -22.00062  54.79108  1.000 46.91940  ? 204  ALA A O   1 
ATOM   1546  C CB  . ALA A  1 224 ? -60.77919 -19.37787  53.00167  1.000 53.52457  ? 204  ALA A CB  1 
ATOM   1547  N N   . SER A  1 225 ? -60.36403 -22.65245  52.63596  1.000 51.19671  ? 205  SER A N   1 
ATOM   1548  C CA  . SER A  1 225 ? -59.74431 -23.92724  52.97647  1.000 53.92224  ? 205  SER A CA  1 
ATOM   1549  C C   . SER A  1 225 ? -58.33577 -23.74505  53.53408  1.000 51.03493  ? 205  SER A C   1 
ATOM   1550  O O   . SER A  1 225 ? -57.48118 -23.10325  52.91231  1.000 47.96316  ? 205  SER A O   1 
ATOM   1551  C CB  . SER A  1 225 ? -59.69203 -24.84540  51.76026  1.000 56.44511  ? 205  SER A CB  1 
ATOM   1552  O OG  . SER A  1 225 ? -59.09463 -26.08627  52.13377  1.000 56.03125  ? 205  SER A OG  1 
ATOM   1553  N N   . MET A  1 226 ? -58.08550 -24.35948  54.68776  1.000 50.60470  ? 206  MET A N   1 
ATOM   1554  C CA  . MET A  1 226 ? -56.76313 -24.33265  55.29971  1.000 48.77254  ? 206  MET A CA  1 
ATOM   1555  C C   . MET A  1 226 ? -55.78999 -25.32934  54.69173  1.000 46.43546  ? 206  MET A C   1 
ATOM   1556  O O   . MET A  1 226 ? -54.60139 -25.27334  55.01971  1.000 44.75382  ? 206  MET A O   1 
ATOM   1557  C CB  . MET A  1 226 ? -56.86892 -24.60904  56.80045  1.000 47.84033  ? 206  MET A CB  1 
ATOM   1558  C CG  . MET A  1 226 ? -57.53154 -23.48373  57.56830  1.000 42.16467  ? 206  MET A CG  1 
ATOM   1559  S SD  . MET A  1 226 ? -57.95810 -23.98045  59.24487  1.000 46.85668  ? 206  MET A SD  1 
ATOM   1560  C CE  . MET A  1 226 ? -56.46847 -23.48408  60.10320  1.000 37.26946  ? 206  MET A CE  1 
ATOM   1561  N N   . GLY A  1 227 ? -56.24513 -26.22441  53.81624  1.000 49.03856  ? 207  GLY A N   1 
ATOM   1562  C CA  . GLY A  1 227 ? -55.38499 -27.29790  53.36375  1.000 42.39886  ? 207  GLY A CA  1 
ATOM   1563  C C   . GLY A  1 227 ? -55.22196 -28.37703  54.40160  1.000 52.92805  ? 207  GLY A C   1 
ATOM   1564  O O   . GLY A  1 227 ? -54.27306 -29.17274  54.33207  1.000 48.95927  ? 207  GLY A O   1 
ATOM   1565  N N   . ILE A  1 228 ? -56.12685 -28.41485  55.37505  1.000 51.49759  ? 208  ILE A N   1 
ATOM   1566  C CA  . ILE A  1 228 ? -56.12741 -29.39687  56.44653  1.000 50.81308  ? 208  ILE A CA  1 
ATOM   1567  C C   . ILE A  1 228 ? -57.29185 -30.34731  56.19729  1.000 52.64406  ? 208  ILE A C   1 
ATOM   1568  O O   . ILE A  1 228 ? -58.44674 -29.90914  56.10144  1.000 52.51724  ? 208  ILE A O   1 
ATOM   1569  C CB  . ILE A  1 228 ? -56.23279 -28.71736  57.81954  1.000 49.04180  ? 208  ILE A CB  1 
ATOM   1570  C CG1 . ILE A  1 228 ? -55.05773 -27.75103  58.00628  1.000 47.40185  ? 208  ILE A CG1 1 
ATOM   1571  C CG2 . ILE A  1 228 ? -56.25018 -29.75824  58.93587  1.000 50.39742  ? 208  ILE A CG2 1 
ATOM   1572  C CD1 . ILE A  1 228 ? -55.15963 -26.85217  59.22035  1.000 38.96864  ? 208  ILE A CD1 1 
ATOM   1573  N N   . TYR A  1 229 ? -56.99177 -31.64664  56.09282  1.000 52.04655  ? 209  TYR A N   1 
ATOM   1574  C CA  . TYR A  1 229 ? -57.99188 -32.66426  55.79297  1.000 50.99420  ? 209  TYR A CA  1 
ATOM   1575  C C   . TYR A  1 229 ? -57.86653 -33.84162  56.75650  1.000 55.16178  ? 209  TYR A C   1 
ATOM   1576  O O   . TYR A  1 229 ? -56.75377 -34.28804  57.06622  1.000 55.72363  ? 209  TYR A O   1 
ATOM   1577  C CB  . TYR A  1 229 ? -57.85744 -33.17977  54.34692  1.000 49.78731  ? 209  TYR A CB  1 
ATOM   1578  C CG  . TYR A  1 229 ? -57.54904 -32.12260  53.31782  1.000 52.90663  ? 209  TYR A CG  1 
ATOM   1579  C CD1 . TYR A  1 229 ? -58.48406 -31.14139  52.99568  1.000 56.99344  ? 209  TYR A CD1 1 
ATOM   1580  C CD2 . TYR A  1 229 ? -56.32527 -32.10320  52.65862  1.000 54.00666  ? 209  TYR A CD2 1 
ATOM   1581  C CE1 . TYR A  1 229 ? -58.20375 -30.15609  52.04645  1.000 57.78633  ? 209  TYR A CE1 1 
ATOM   1582  C CE2 . TYR A  1 229 ? -56.03283 -31.12116  51.70862  1.000 54.21818  ? 209  TYR A CE2 1 
ATOM   1583  C CZ  . TYR A  1 229 ? -56.98178 -30.15598  51.40504  1.000 56.40294  ? 209  TYR A CZ  1 
ATOM   1584  O OH  . TYR A  1 229 ? -56.70671 -29.19312  50.46233  1.000 55.99183  ? 209  TYR A OH  1 
ATOM   1585  N N   . VAL A  1 230 ? -59.02032 -34.36126  57.19087  1.000 53.72138  ? 210  VAL A N   1 
ATOM   1586  C CA  . VAL A  1 230 ? -59.11971 -35.53791  58.04807  1.000 53.47847  ? 210  VAL A CA  1 
ATOM   1587  C C   . VAL A  1 230 ? -59.91403 -36.60664  57.31365  1.000 57.67618  ? 210  VAL A C   1 
ATOM   1588  O O   . VAL A  1 230 ? -60.98581 -36.31868  56.76401  1.000 57.37645  ? 210  VAL A O   1 
ATOM   1589  C CB  . VAL A  1 230 ? -59.79269 -35.20573  59.39230  1.000 51.60050  ? 210  VAL A CB  1 
ATOM   1590  C CG1 . VAL A  1 230 ? -59.99931 -36.46244  60.23263  1.000 46.28283  ? 210  VAL A CG1 1 
ATOM   1591  C CG2 . VAL A  1 230 ? -58.97985 -34.18551  60.14334  1.000 47.00135  ? 210  VAL A CG2 1 
ATOM   1592  N N   . PHE A  1 231 ? -59.38840 -37.83767  57.31627  1.000 58.83040  ? 211  PHE A N   1 
ATOM   1593  C CA  . PHE A  1 231 ? -60.02710 -39.01003  56.72648  1.000 55.76376  ? 211  PHE A CA  1 
ATOM   1594  C C   . PHE A  1 231 ? -59.96117 -40.19060  57.68666  1.000 54.41961  ? 211  PHE A C   1 
ATOM   1595  O O   . PHE A  1 231 ? -59.06212 -40.28894  58.52434  1.000 54.30010  ? 211  PHE A O   1 
ATOM   1596  C CB  . PHE A  1 231 ? -59.34507 -39.47739  55.42927  1.000 58.06989  ? 211  PHE A CB  1 
ATOM   1597  C CG  . PHE A  1 231 ? -59.23232 -38.43261  54.36492  1.000 57.79703  ? 211  PHE A CG  1 
ATOM   1598  C CD1 . PHE A  1 231 ? -60.13255 -38.40136  53.30961  1.000 57.32986  ? 211  PHE A CD1 1 
ATOM   1599  C CD2 . PHE A  1 231 ? -58.18980 -37.51747  54.39073  1.000 54.88193  ? 211  PHE A CD2 1 
ATOM   1600  C CE1 . PHE A  1 231 ? -60.01058 -37.45309  52.31172  1.000 61.19613  ? 211  PHE A CE1 1 
ATOM   1601  C CE2 . PHE A  1 231 ? -58.05862 -36.57064  53.40947  1.000 56.56830  ? 211  PHE A CE2 1 
ATOM   1602  C CZ  . PHE A  1 231 ? -58.96767 -36.52959  52.36442  1.000 62.13093  ? 211  PHE A CZ  1 
ATOM   1603  N N   . HIS A  1 232 ? -60.90508 -41.11708  57.53240  1.000 58.07431  ? 212  HIS A N   1 
ATOM   1604  C CA  . HIS A  1 232 ? -60.63722 -42.49739  57.91174  1.000 57.88566  ? 212  HIS A CA  1 
ATOM   1605  C C   . HIS A  1 232 ? -59.56434 -43.05415  56.98126  1.000 55.03558  ? 212  HIS A C   1 
ATOM   1606  O O   . HIS A  1 232 ? -59.64766 -42.90189  55.75852  1.000 56.21880  ? 212  HIS A O   1 
ATOM   1607  C CB  . HIS A  1 232 ? -61.90798 -43.34676  57.84237  1.000 62.99485  ? 212  HIS A CB  1 
ATOM   1608  C CG  . HIS A  1 232 ? -62.75140 -43.25626  59.07444  1.000 64.70890  ? 212  HIS A CG  1 
ATOM   1609  N ND1 . HIS A  1 232 ? -63.85585 -42.43315  59.16149  1.000 65.33294  ? 212  HIS A ND1 1 
ATOM   1610  C CD2 . HIS A  1 232 ? -62.63562 -43.86198  60.27969  1.000 63.01845  ? 212  HIS A CD2 1 
ATOM   1611  C CE1 . HIS A  1 232 ? -64.39331 -42.54905  60.36234  1.000 63.74200  ? 212  HIS A CE1 1 
ATOM   1612  N NE2 . HIS A  1 232 ? -63.67138 -43.40874  61.06044  1.000 64.47033  ? 212  HIS A NE2 1 
ATOM   1613  N N   . THR A  1 233 ? -58.54292 -43.67953  57.56965  1.000 54.03013  ? 213  THR A N   1 
ATOM   1614  C CA  . THR A  1 233 ? -57.37299 -44.09702  56.80387  1.000 58.11953  ? 213  THR A CA  1 
ATOM   1615  C C   . THR A  1 233 ? -57.74601 -44.98783  55.61641  1.000 60.92228  ? 213  THR A C   1 
ATOM   1616  O O   . THR A  1 233 ? -57.23438 -44.79918  54.50775  1.000 58.49610  ? 213  THR A O   1 
ATOM   1617  C CB  . THR A  1 233 ? -56.39233 -44.80846  57.73330  1.000 59.95079  ? 213  THR A CB  1 
ATOM   1618  O OG1 . THR A  1 233 ? -55.96631 -43.89648  58.75911  1.000 63.12971  ? 213  THR A OG1 1 
ATOM   1619  C CG2 . THR A  1 233 ? -55.17272 -45.32309  56.96351  1.000 56.40784  ? 213  THR A CG2 1 
ATOM   1620  N N   . LYS A  1 234 ? -58.64318 -45.95247  55.81098  1.000 63.89480  ? 214  LYS A N   1 
ATOM   1621  C CA  . LYS A  1 234 ? -58.89628 -46.88326  54.71841  1.000 68.19379  ? 214  LYS A CA  1 
ATOM   1622  C C   . LYS A  1 234 ? -59.64272 -46.20174  53.57850  1.000 68.01059  ? 214  LYS A C   1 
ATOM   1623  O O   . LYS A  1 234 ? -59.35311 -46.45608  52.40357  1.000 71.41358  ? 214  LYS A O   1 
ATOM   1624  C CB  . LYS A  1 234 ? -59.64642 -48.11766  55.22315  1.000 74.01175  ? 214  LYS A CB  1 
ATOM   1625  C CG  . LYS A  1 234 ? -59.81207 -49.20310  54.16054  1.000 80.31633  ? 214  LYS A CG  1 
ATOM   1626  C CD  . LYS A  1 234 ? -58.48680 -49.50119  53.44660  1.000 80.67319  ? 214  LYS A CD  1 
ATOM   1627  C CE  . LYS A  1 234 ? -58.66495 -49.52611  51.92043  1.000 79.43834  ? 214  LYS A CE  1 
ATOM   1628  N NZ  . LYS A  1 234 ? -59.74127 -50.45250  51.48689  1.000 82.70138  ? 214  LYS A NZ  1 
ATOM   1629  N N   . PHE A  1 235 ? -60.58980 -45.31877  53.89904  1.000 67.85832  ? 215  PHE A N   1 
ATOM   1630  C CA  . PHE A  1 235 ? -61.23137 -44.52318  52.85655  1.000 68.37108  ? 215  PHE A CA  1 
ATOM   1631  C C   . PHE A  1 235 ? -60.19058 -43.76504  52.03902  1.000 67.80058  ? 215  PHE A C   1 
ATOM   1632  O O   . PHE A  1 235 ? -60.22337 -43.78883  50.80169  1.000 71.38805  ? 215  PHE A O   1 
ATOM   1633  C CB  . PHE A  1 235 ? -62.25352 -43.56615  53.48275  1.000 71.18560  ? 215  PHE A CB  1 
ATOM   1634  C CG  . PHE A  1 235 ? -63.05995 -42.78061  52.47579  1.000 74.46156  ? 215  PHE A CG  1 
ATOM   1635  C CD1 . PHE A  1 235 ? -62.67852 -41.49618  52.10771  1.000 71.35778  ? 215  PHE A CD1 1 
ATOM   1636  C CD2 . PHE A  1 235 ? -64.19540 -43.33031  51.88770  1.000 79.13109  ? 215  PHE A CD2 1 
ATOM   1637  C CE1 . PHE A  1 235 ? -63.41662 -40.77626  51.17827  1.000 71.53953  ? 215  PHE A CE1 1 
ATOM   1638  C CE2 . PHE A  1 235 ? -64.94182 -42.61011  50.95016  1.000 78.07914  ? 215  PHE A CE2 1 
ATOM   1639  C CZ  . PHE A  1 235 ? -64.55052 -41.33992  50.59583  1.000 74.82303  ? 215  PHE A CZ  1 
ATOM   1640  N N   . LEU A  1 236 ? -59.23302 -43.11396  52.71782  1.000 60.76478  ? 216  LEU A N   1 
ATOM   1641  C CA  . LEU A  1 236 ? -58.23568 -42.31288  52.01389  1.000 58.52716  ? 216  LEU A CA  1 
ATOM   1642  C C   . LEU A  1 236 ? -57.37347 -43.16677  51.08175  1.000 64.96824  ? 216  LEU A C   1 
ATOM   1643  O O   . LEU A  1 236 ? -57.12314 -42.78156  49.93382  1.000 69.28675  ? 216  LEU A O   1 
ATOM   1644  C CB  . LEU A  1 236 ? -57.36315 -41.55249  53.00569  1.000 55.35828  ? 216  LEU A CB  1 
ATOM   1645  C CG  . LEU A  1 236 ? -56.21100 -40.80061  52.32706  1.000 54.22967  ? 216  LEU A CG  1 
ATOM   1646  C CD1 . LEU A  1 236 ? -56.73792 -39.76295  51.34315  1.000 54.91615  ? 216  LEU A CD1 1 
ATOM   1647  C CD2 . LEU A  1 236 ? -55.32675 -40.11865  53.36093  1.000 51.39030  ? 216  LEU A CD2 1 
ATOM   1648  N N   . MET A  1 237 ? -56.89822 -44.32434  51.55358  1.000 65.40855  ? 217  MET A N   1 
ATOM   1649  C CA  . MET A  1 237 ? -56.08738 -45.17908  50.68669  1.000 70.56263  ? 217  MET A CA  1 
ATOM   1650  C C   . MET A  1 237 ? -56.85034 -45.53295  49.41973  1.000 77.04902  ? 217  MET A C   1 
ATOM   1651  O O   . MET A  1 237 ? -56.32803 -45.39290  48.30626  1.000 76.04415  ? 217  MET A O   1 
ATOM   1652  C CB  . MET A  1 237 ? -55.64906 -46.46256  51.40702  1.000 72.34466  ? 217  MET A CB  1 
ATOM   1653  C CG  . MET A  1 237 ? -55.27301 -46.32117  52.87028  1.000 73.12947  ? 217  MET A CG  1 
ATOM   1654  S SD  . MET A  1 237 ? -54.14388 -44.95084  53.18192  1.000 78.25226  ? 217  MET A SD  1 
ATOM   1655  C CE  . MET A  1 237 ? -52.70311 -45.60434  52.39567  1.000 76.87295  ? 217  MET A CE  1 
ATOM   1656  N N   . GLU A  1 238 ? -58.10124 -45.98097  49.57471  1.000 82.09492  ? 218  GLU A N   1 
ATOM   1657  C CA  . GLU A  1 238 ? -58.92062 -46.32676  48.41774  1.000 81.23133  ? 218  GLU A CA  1 
ATOM   1658  C C   . GLU A  1 238 ? -59.08663 -45.12532  47.49439  1.000 79.12769  ? 218  GLU A C   1 
ATOM   1659  O O   . GLU A  1 238 ? -58.92470 -45.23999  46.27330  1.000 84.57957  ? 218  GLU A O   1 
ATOM   1660  C CB  . GLU A  1 238 ? -60.27908 -46.85989  48.88001  1.000 81.76270  ? 218  GLU A CB  1 
ATOM   1661  N N   . ALA A  1 239 ? -59.38613 -43.95429  48.06535  1.000 72.04452  ? 219  ALA A N   1 
ATOM   1662  C CA  . ALA A  1 239 ? -59.55031 -42.75430  47.24715  1.000 71.09801  ? 219  ALA A CA  1 
ATOM   1663  C C   . ALA A  1 239 ? -58.24272 -42.34768  46.58221  1.000 71.61429  ? 219  ALA A C   1 
ATOM   1664  O O   . ALA A  1 239 ? -58.25284 -41.85199  45.44844  1.000 68.92843  ? 219  ALA A O   1 
ATOM   1665  C CB  . ALA A  1 239 ? -60.09044 -41.60325  48.09775  1.000 67.04930  ? 219  ALA A CB  1 
ATOM   1666  N N   . LEU A  1 240 ? -57.11325 -42.55314  47.27203  1.000 74.72647  ? 220  LEU A N   1 
ATOM   1667  C CA  . LEU A  1 240 ? -55.80441 -42.26583  46.68957  1.000 74.35958  ? 220  LEU A CA  1 
ATOM   1668  C C   . LEU A  1 240 ? -55.46339 -43.24741  45.58074  1.000 77.06580  ? 220  LEU A C   1 
ATOM   1669  O O   . LEU A  1 240 ? -54.71014 -42.90427  44.66130  1.000 79.34903  ? 220  LEU A O   1 
ATOM   1670  C CB  . LEU A  1 240 ? -54.71650 -42.30295  47.76845  1.000 70.43758  ? 220  LEU A CB  1 
ATOM   1671  C CG  . LEU A  1 240 ? -54.63117 -41.12555  48.74244  1.000 65.88548  ? 220  LEU A CG  1 
ATOM   1672  C CD1 . LEU A  1 240 ? -53.71459 -41.49272  49.90459  1.000 68.25565  ? 220  LEU A CD1 1 
ATOM   1673  C CD2 . LEU A  1 240 ? -54.14455 -39.86843  48.04359  1.000 57.27283  ? 220  LEU A CD2 1 
ATOM   1674  N N   . ARG A  1 241 ? -55.99852 -44.46807  45.65369  1.000 76.28303  ? 221  ARG A N   1 
ATOM   1675  C CA  . ARG A  1 241 ? -55.80881 -45.42048  44.56545  1.000 79.66730  ? 221  ARG A CA  1 
ATOM   1676  C C   . ARG A  1 241 ? -56.66233 -45.04407  43.35733  1.000 84.12368  ? 221  ARG A C   1 
ATOM   1677  O O   . ARG A  1 241 ? -56.17375 -45.03059  42.22131  1.000 82.30861  ? 221  ARG A O   1 
ATOM   1678  C CB  . ARG A  1 241 ? -56.11656 -46.83926  45.05015  1.000 78.29491  ? 221  ARG A CB  1 
ATOM   1679  C CG  . ARG A  1 241 ? -55.08031 -47.37908  46.03728  1.000 76.68273  ? 221  ARG A CG  1 
ATOM   1680  C CD  . ARG A  1 241 ? -55.30257 -48.84075  46.37458  1.000 82.33303  ? 221  ARG A CD  1 
ATOM   1681  N NE  . ARG A  1 241 ? -54.84635 -49.16490  47.72732  1.000 85.00058  ? 221  ARG A NE  1 
ATOM   1682  C CZ  . ARG A  1 241 ? -53.60148 -49.52972  48.04332  1.000 84.30498  ? 221  ARG A CZ  1 
ATOM   1683  N NH1 . ARG A  1 241 ? -52.66706 -49.62706  47.10233  1.000 85.15640  ? 221  ARG A NH1 1 
ATOM   1684  N NH2 . ARG A  1 241 ? -53.28785 -49.80414  49.30504  1.000 79.37665  ? 221  ARG A NH2 1 
ATOM   1685  N N   . ARG A  1 242 ? -57.93778 -44.71488  43.58529  1.000 87.62949  ? 222  ARG A N   1 
ATOM   1686  C CA  . ARG A  1 242 ? -58.79370 -44.26612  42.49062  1.000 88.58057  ? 222  ARG A CA  1 
ATOM   1687  C C   . ARG A  1 242 ? -58.16632 -43.09191  41.75576  1.000 86.93538  ? 222  ARG A C   1 
ATOM   1688  O O   . ARG A  1 242 ? -58.21777 -43.01701  40.52270  1.000 88.88800  ? 222  ARG A O   1 
ATOM   1689  C CB  . ARG A  1 242 ? -60.17091 -43.86657  43.02419  1.000 91.15548  ? 222  ARG A CB  1 
ATOM   1690  C CG  . ARG A  1 242 ? -61.05429 -45.01722  43.50153  1.000 97.23591  ? 222  ARG A CG  1 
ATOM   1691  C CD  . ARG A  1 242 ? -62.49883 -44.53904  43.76063  1.000 102.36041 ? 222  ARG A CD  1 
ATOM   1692  N NE  . ARG A  1 242 ? -62.64370 -43.80654  45.02528  1.000 101.37935 ? 222  ARG A NE  1 
ATOM   1693  C CZ  . ARG A  1 242 ? -63.74074 -43.14398  45.39346  1.000 98.84319  ? 222  ARG A CZ  1 
ATOM   1694  N NH1 . ARG A  1 242 ? -64.80216 -43.11670  44.59212  1.000 98.38958  ? 222  ARG A NH1 1 
ATOM   1695  N NH2 . ARG A  1 242 ? -63.77494 -42.50517  46.56255  1.000 94.84540  ? 222  ARG A NH2 1 
ATOM   1696  N N   . ASP A  1 243 ? -57.55200 -42.16988  42.50248  1.000 83.37808  ? 223  ASP A N   1 
ATOM   1697  C CA  . ASP A  1 243 ? -57.01902 -40.95566  41.89316  1.000 84.07337  ? 223  ASP A CA  1 
ATOM   1698  C C   . ASP A  1 243 ? -55.76983 -41.24625  41.06626  1.000 82.52548  ? 223  ASP A C   1 
ATOM   1699  O O   . ASP A  1 243 ? -55.56709 -40.63983  40.00695  1.000 81.44665  ? 223  ASP A O   1 
ATOM   1700  C CB  . ASP A  1 243 ? -56.73295 -39.91159  42.97861  1.000 82.07694  ? 223  ASP A CB  1 
ATOM   1701  C CG  . ASP A  1 243 ? -56.08512 -38.66039  42.42687  1.000 80.50135  ? 223  ASP A CG  1 
ATOM   1702  O OD1 . ASP A  1 243 ? -56.81259 -37.83013  41.84003  1.000 77.14035  ? 223  ASP A OD1 1 
ATOM   1703  O OD2 . ASP A  1 243 ? -54.85501 -38.50386  42.59474  1.000 80.47867  ? 223  ASP A OD2 1 
ATOM   1704  N N   . ALA A  1 244 ? -54.92430 -42.17345  41.52724  1.000 82.42075  ? 224  ALA A N   1 
ATOM   1705  C CA  . ALA A  1 244 ? -53.71427 -42.50101  40.77758  1.000 83.37596  ? 224  ALA A CA  1 
ATOM   1706  C C   . ALA A  1 244 ? -54.03649 -43.12841  39.42560  1.000 87.88437  ? 224  ALA A C   1 
ATOM   1707  O O   . ALA A  1 244 ? -53.23684 -43.01718  38.48747  1.000 90.62527  ? 224  ALA A O   1 
ATOM   1708  C CB  . ALA A  1 244 ? -52.82136 -43.43557  41.59168  1.000 79.16903  ? 224  ALA A CB  1 
ATOM   1709  N N   . ALA A  1 245 ? -55.19349 -43.79157  39.30571  1.000 86.83146  ? 225  ALA A N   1 
ATOM   1710  C CA  . ALA A  1 245 ? -55.57416 -44.42140  38.04508  1.000 87.88297  ? 225  ALA A CA  1 
ATOM   1711  C C   . ALA A  1 245 ? -56.08849 -43.39265  37.05006  1.000 91.74520  ? 225  ALA A C   1 
ATOM   1712  O O   . ALA A  1 245 ? -55.70979 -43.41023  35.87447  1.000 95.34292  ? 225  ALA A O   1 
ATOM   1713  C CB  . ALA A  1 245 ? -56.63238 -45.49773  38.28954  1.000 86.94177  ? 225  ALA A CB  1 
ATOM   1714  N N   . ASP A  1 246 ? -56.94780 -42.48779  37.51196  1.000 92.88391  ? 226  ASP A N   1 
ATOM   1715  C CA  . ASP A  1 246 ? -57.58145 -41.46353  36.69261  1.000 92.93737  ? 226  ASP A CA  1 
ATOM   1716  C C   . ASP A  1 246 ? -56.52368 -40.55208  36.08195  1.000 89.93331  ? 226  ASP A C   1 
ATOM   1717  O O   . ASP A  1 246 ? -55.87051 -39.78675  36.80295  1.000 89.48259  ? 226  ASP A O   1 
ATOM   1718  C CB  . ASP A  1 246 ? -58.58690 -40.67751  37.54216  1.000 91.66707  ? 226  ASP A CB  1 
ATOM   1719  C CG  . ASP A  1 246 ? -59.14384 -39.46069  36.83035  1.000 94.43344  ? 226  ASP A CG  1 
ATOM   1720  O OD1 . ASP A  1 246 ? -58.42968 -38.44180  36.74727  1.000 94.14874  ? 226  ASP A OD1 1 
ATOM   1721  O OD2 . ASP A  1 246 ? -60.30048 -39.51722  36.36399  1.000 96.50759  ? 226  ASP A OD2 1 
ATOM   1722  N N   . PRO A  1 247 ? -56.31611 -40.61329  34.76207  1.000 88.48240  ? 227  PRO A N   1 
ATOM   1723  C CA  . PRO A  1 247 ? -55.32994 -39.72773  34.12638  1.000 86.54203  ? 227  PRO A CA  1 
ATOM   1724  C C   . PRO A  1 247 ? -55.80913 -38.29755  33.94883  1.000 85.99199  ? 227  PRO A C   1 
ATOM   1725  O O   . PRO A  1 247 ? -55.00271 -37.43800  33.56155  1.000 82.73074  ? 227  PRO A O   1 
ATOM   1726  C CB  . PRO A  1 247 ? -55.07689 -40.39616  32.76584  1.000 89.74153  ? 227  PRO A CB  1 
ATOM   1727  C CG  . PRO A  1 247 ? -56.19514 -41.36133  32.55767  1.000 92.53352  ? 227  PRO A CG  1 
ATOM   1728  C CD  . PRO A  1 247 ? -57.04649 -41.43619  33.78694  1.000 91.34667  ? 227  PRO A CD  1 
ATOM   1729  N N   . THR A  1 248 ? -57.09367 -38.02360  34.20352  1.000 87.02064  ? 228  THR A N   1 
ATOM   1730  C CA  . THR A  1 248 ? -57.58464 -36.64888  34.22242  1.000 84.51081  ? 228  THR A CA  1 
ATOM   1731  C C   . THR A  1 248 ? -57.00946 -35.87840  35.39740  1.000 85.50888  ? 228  THR A C   1 
ATOM   1732  O O   . THR A  1 248 ? -56.88604 -34.64696  35.33782  1.000 84.27542  ? 228  THR A O   1 
ATOM   1733  C CB  . THR A  1 248 ? -59.11268 -36.63482  34.30854  1.000 88.75118  ? 228  THR A CB  1 
ATOM   1734  O OG1 . THR A  1 248 ? -59.65352 -37.73486  33.55981  1.000 98.97403  ? 228  THR A OG1 1 
ATOM   1735  C CG2 . THR A  1 248 ? -59.66928 -35.32801  33.76733  1.000 91.23913  ? 228  THR A CG2 1 
ATOM   1736  N N   . SER A  1 249 ? -56.64627 -36.59356  36.46192  1.000 86.55515  ? 229  SER A N   1 
ATOM   1737  C CA  . SER A  1 249 ? -56.33119 -35.98852  37.74346  1.000 81.99479  ? 229  SER A CA  1 
ATOM   1738  C C   . SER A  1 249 ? -54.91417 -35.43533  37.74911  1.000 82.48631  ? 229  SER A C   1 
ATOM   1739  O O   . SER A  1 249 ? -53.96118 -36.13806  37.39562  1.000 82.29674  ? 229  SER A O   1 
ATOM   1740  C CB  . SER A  1 249 ? -56.50204 -37.02368  38.85212  1.000 83.20023  ? 229  SER A CB  1 
ATOM   1741  O OG  . SER A  1 249 ? -55.94741 -36.56558  40.07438  1.000 81.53574  ? 229  SER A OG  1 
ATOM   1742  N N   . SER A  1 250 ? -54.78184 -34.17125  38.15911  1.000 86.02676  ? 230  SER A N   1 
ATOM   1743  C CA  . SER A  1 250 ? -53.48994 -33.53780  38.40383  1.000 87.40807  ? 230  SER A CA  1 
ATOM   1744  C C   . SER A  1 250 ? -52.88787 -33.91789  39.76133  1.000 82.62841  ? 230  SER A C   1 
ATOM   1745  O O   . SER A  1 250 ? -51.92474 -33.27125  40.19718  1.000 81.02615  ? 230  SER A O   1 
ATOM   1746  C CB  . SER A  1 250 ? -53.62283 -32.01595  38.29515  1.000 90.58994  ? 230  SER A CB  1 
ATOM   1747  O OG  . SER A  1 250 ? -54.56460 -31.52359  39.23176  1.000 93.75458  ? 230  SER A OG  1 
ATOM   1748  N N   . ARG A  1 251 ? -53.45481 -34.93058  40.43251  1.000 78.79258  ? 231  ARG A N   1 
ATOM   1749  C CA  . ARG A  1 251 ? -52.84200 -35.58860  41.59161  1.000 78.49693  ? 231  ARG A CA  1 
ATOM   1750  C C   . ARG A  1 251 ? -52.79728 -34.67242  42.82007  1.000 76.97908  ? 231  ARG A C   1 
ATOM   1751  O O   . ARG A  1 251 ? -51.78544 -34.59629  43.51695  1.000 76.21609  ? 231  ARG A O   1 
ATOM   1752  C CB  . ARG A  1 251 ? -51.43884 -36.11344  41.25389  1.000 78.24644  ? 231  ARG A CB  1 
ATOM   1753  C CG  . ARG A  1 251 ? -51.35518 -37.00132  40.00696  1.000 78.44073  ? 231  ARG A CG  1 
ATOM   1754  C CD  . ARG A  1 251 ? -52.35262 -38.14267  40.05936  1.000 79.84593  ? 231  ARG A CD  1 
ATOM   1755  N NE  . ARG A  1 251 ? -52.25040 -38.92367  41.29196  1.000 81.38777  ? 231  ARG A NE  1 
ATOM   1756  C CZ  . ARG A  1 251 ? -51.35848 -39.89009  41.50352  1.000 82.77539  ? 231  ARG A CZ  1 
ATOM   1757  N NH1 . ARG A  1 251 ? -50.47874 -40.20140  40.56153  1.000 84.33504  ? 231  ARG A NH1 1 
ATOM   1758  N NH2 . ARG A  1 251 ? -51.34584 -40.54675  42.66001  1.000 82.07205  ? 231  ARG A NH2 1 
ATOM   1759  N N   . ASP A  1 252 ? -53.92217 -34.01197  43.10850  1.000 73.86735  ? 232  ASP A N   1 
ATOM   1760  C CA  . ASP A  1 252 ? -53.99262 -33.01771  44.16773  1.000 72.39045  ? 232  ASP A CA  1 
ATOM   1761  C C   . ASP A  1 252 ? -55.23336 -33.21557  45.03140  1.000 71.52434  ? 232  ASP A C   1 
ATOM   1762  O O   . ASP A  1 252 ? -56.30129 -33.59288  44.54473  1.000 71.44188  ? 232  ASP A O   1 
ATOM   1763  C CB  . ASP A  1 252 ? -53.98837 -31.59101  43.58649  1.000 77.23358  ? 232  ASP A CB  1 
ATOM   1764  C CG  . ASP A  1 252 ? -52.58341 -31.02978  43.42578  1.000 80.43947  ? 232  ASP A CG  1 
ATOM   1765  O OD1 . ASP A  1 252 ? -51.60527 -31.79801  43.55176  1.000 79.66626  ? 232  ASP A OD1 1 
ATOM   1766  O OD2 . ASP A  1 252 ? -52.45856 -29.81563  43.17067  1.000 82.45432  ? 232  ASP A OD2 1 
ATOM   1767  N N   . PHE A  1 253 ? -55.07814 -32.92832  46.32864  1.000 69.81782  ? 233  PHE A N   1 
ATOM   1768  C CA  . PHE A  1 253 ? -56.20331 -32.98859  47.25906  1.000 66.94671  ? 233  PHE A CA  1 
ATOM   1769  C C   . PHE A  1 253 ? -57.24309 -31.91094  46.95875  1.000 67.21503  ? 233  PHE A C   1 
ATOM   1770  O O   . PHE A  1 253 ? -58.43557 -32.20429  46.80723  1.000 68.39335  ? 233  PHE A O   1 
ATOM   1771  C CB  . PHE A  1 253 ? -55.69892 -32.82716  48.68816  1.000 61.49645  ? 233  PHE A CB  1 
ATOM   1772  C CG  . PHE A  1 253 ? -55.26791 -34.10632  49.34241  1.000 61.10045  ? 233  PHE A CG  1 
ATOM   1773  C CD1 . PHE A  1 253 ? -53.91604 -34.39680  49.50670  1.000 60.36889  ? 233  PHE A CD1 1 
ATOM   1774  C CD2 . PHE A  1 253 ? -56.20792 -35.00123  49.83092  1.000 61.62689  ? 233  PHE A CD2 1 
ATOM   1775  C CE1 . PHE A  1 253 ? -53.50794 -35.57249  50.13013  1.000 58.89162  ? 233  PHE A CE1 1 
ATOM   1776  C CE2 . PHE A  1 253 ? -55.80586 -36.18134  50.45962  1.000 64.71775  ? 233  PHE A CE2 1 
ATOM   1777  C CZ  . PHE A  1 253 ? -54.45390 -36.46615  50.60866  1.000 60.89817  ? 233  PHE A CZ  1 
ATOM   1778  N N   . GLY A  1 254 ? -56.81263 -30.64853  46.90248  1.000 65.62951  ? 234  GLY A N   1 
ATOM   1779  C CA  . GLY A  1 254 ? -57.75692 -29.55865  46.71854  1.000 66.70183  ? 234  GLY A CA  1 
ATOM   1780  C C   . GLY A  1 254 ? -58.39904 -29.53263  45.34847  1.000 71.21123  ? 234  GLY A C   1 
ATOM   1781  O O   . GLY A  1 254 ? -59.57851 -29.19056  45.21950  1.000 77.28002  ? 234  GLY A O   1 
ATOM   1782  N N   . LYS A  1 255 ? -57.64837 -29.89920  44.31152  1.000 71.14400  ? 235  LYS A N   1 
ATOM   1783  C CA  . LYS A  1 255 ? -58.19293 -29.85821  42.96008  1.000 73.90637  ? 235  LYS A CA  1 
ATOM   1784  C C   . LYS A  1 255 ? -58.99006 -31.11498  42.62714  1.000 74.60434  ? 235  LYS A C   1 
ATOM   1785  O O   . LYS A  1 255 ? -60.00949 -31.03537  41.93595  1.000 82.21399  ? 235  LYS A O   1 
ATOM   1786  C CB  . LYS A  1 255 ? -57.05680 -29.65926  41.95440  1.000 77.12147  ? 235  LYS A CB  1 
ATOM   1787  C CG  . LYS A  1 255 ? -57.46130 -29.73071  40.48712  1.000 83.18722  ? 235  LYS A CG  1 
ATOM   1788  C CD  . LYS A  1 255 ? -58.42265 -28.61320  40.08047  1.000 83.78522  ? 235  LYS A CD  1 
ATOM   1789  C CE  . LYS A  1 255 ? -58.25061 -28.24786  38.60761  1.000 82.58450  ? 235  LYS A CE  1 
ATOM   1790  N NZ  . LYS A  1 255 ? -59.17515 -29.02704  37.74002  1.000 86.59447  ? 235  LYS A NZ  1 
ATOM   1791  N N   . ASP A  1 256 ? -58.55527 -32.28196  43.10140  1.000 74.61098  ? 236  ASP A N   1 
ATOM   1792  C CA  . ASP A  1 256 ? -59.08918 -33.55121  42.60330  1.000 77.56752  ? 236  ASP A CA  1 
ATOM   1793  C C   . ASP A  1 256 ? -59.77524 -34.37820  43.68194  1.000 74.57657  ? 236  ASP A C   1 
ATOM   1794  O O   . ASP A  1 256 ? -60.96757 -34.67667  43.55073  1.000 77.23356  ? 236  ASP A O   1 
ATOM   1795  C CB  . ASP A  1 256 ? -57.97960 -34.38342  41.94063  1.000 76.77429  ? 236  ASP A CB  1 
ATOM   1796  C CG  . ASP A  1 256 ? -57.17924 -33.59476  40.91845  1.000 77.26337  ? 236  ASP A CG  1 
ATOM   1797  O OD1 . ASP A  1 256 ? -56.06643 -33.14162  41.26322  1.000 75.62387  ? 236  ASP A OD1 1 
ATOM   1798  O OD2 . ASP A  1 256 ? -57.66357 -33.42590  39.77312  1.000 79.28067  ? 236  ASP A OD2 1 
ATOM   1799  N N   . ILE A  1 257 ? -59.05299 -34.79366  44.72393  1.000 68.36070  ? 237  ILE A N   1 
ATOM   1800  C CA  . ILE A  1 257 ? -59.64905 -35.65926  45.73754  1.000 70.05963  ? 237  ILE A CA  1 
ATOM   1801  C C   . ILE A  1 257 ? -60.88440 -35.00492  46.33847  1.000 76.44370  ? 237  ILE A C   1 
ATOM   1802  O O   . ILE A  1 257 ? -61.97938 -35.58121  46.33199  1.000 83.37788  ? 237  ILE A O   1 
ATOM   1803  C CB  . ILE A  1 257 ? -58.62682 -35.99335  46.83327  1.000 68.21082  ? 237  ILE A CB  1 
ATOM   1804  C CG1 . ILE A  1 257 ? -57.35875 -36.58678  46.22249  1.000 70.09906  ? 237  ILE A CG1 1 
ATOM   1805  C CG2 . ILE A  1 257 ? -59.27830 -36.90035  47.86545  1.000 59.62495  ? 237  ILE A CG2 1 
ATOM   1806  C CD1 . ILE A  1 257 ? -57.38814 -38.10896  46.09059  1.000 74.66798  ? 237  ILE A CD1 1 
ATOM   1807  N N   . ILE A  1 258 ? -60.72920 -33.78814  46.85483  1.000 70.80149  ? 238  ILE A N   1 
ATOM   1808  C CA  . ILE A  1 258 ? -61.78449 -33.14256  47.62990  1.000 68.38918  ? 238  ILE A CA  1 
ATOM   1809  C C   . ILE A  1 258 ? -63.00488 -32.84996  46.76384  1.000 73.65405  ? 238  ILE A C   1 
ATOM   1810  O O   . ILE A  1 258 ? -64.11227 -33.26694  47.13255  1.000 77.72865  ? 238  ILE A O   1 
ATOM   1811  C CB  . ILE A  1 258 ? -61.27765 -31.86895  48.32014  1.000 63.49499  ? 238  ILE A CB  1 
ATOM   1812  C CG1 . ILE A  1 258 ? -60.29366 -32.22665  49.43744  1.000 62.62033  ? 238  ILE A CG1 1 
ATOM   1813  C CG2 . ILE A  1 258 ? -62.44742 -31.09822  48.86141  1.000 65.33360  ? 238  ILE A CG2 1 
ATOM   1814  C CD1 . ILE A  1 258 ? -60.86672 -33.14197  50.47946  1.000 62.70641  ? 238  ILE A CD1 1 
ATOM   1815  N N   . PRO A  1 259 ? -62.87999 -32.15882  45.62189  1.000 73.70608  ? 239  PRO A N   1 
ATOM   1816  C CA  . PRO A  1 259 ? -64.08394 -31.91180  44.81333  1.000 71.08804  ? 239  PRO A CA  1 
ATOM   1817  C C   . PRO A  1 259 ? -64.83602 -33.17864  44.45932  1.000 71.99279  ? 239  PRO A C   1 
ATOM   1818  O O   . PRO A  1 259 ? -66.07103 -33.17667  44.47051  1.000 75.10188  ? 239  PRO A O   1 
ATOM   1819  C CB  . PRO A  1 259 ? -63.52132 -31.20118  43.57888  1.000 74.07187  ? 239  PRO A CB  1 
ATOM   1820  C CG  . PRO A  1 259 ? -62.28916 -30.51800  44.08645  1.000 73.85030  ? 239  PRO A CG  1 
ATOM   1821  C CD  . PRO A  1 259 ? -61.69441 -31.51472  45.02108  1.000 74.38501  ? 239  PRO A CD  1 
ATOM   1822  N N   . TYR A  1 260 ? -64.12152 -34.26781  44.16695  1.000 75.04029  ? 240  TYR A N   1 
ATOM   1823  C CA  . TYR A  1 260 ? -64.76533 -35.55897  43.94175  1.000 80.41479  ? 240  TYR A CA  1 
ATOM   1824  C C   . TYR A  1 260 ? -65.74799 -35.89054  45.06151  1.000 79.45895  ? 240  TYR A C   1 
ATOM   1825  O O   . TYR A  1 260 ? -66.92344 -36.18093  44.80791  1.000 77.56298  ? 240  TYR A O   1 
ATOM   1826  C CB  . TYR A  1 260 ? -63.69497 -36.64981  43.81629  1.000 84.57463  ? 240  TYR A CB  1 
ATOM   1827  C CG  . TYR A  1 260 ? -64.17991 -37.98755  43.27146  1.000 94.40540  ? 240  TYR A CG  1 
ATOM   1828  C CD1 . TYR A  1 260 ? -64.99199 -38.82980  44.03205  1.000 97.53486  ? 240  TYR A CD1 1 
ATOM   1829  C CD2 . TYR A  1 260 ? -63.81942 -38.41195  41.99312  1.000 98.76409  ? 240  TYR A CD2 1 
ATOM   1830  C CE1 . TYR A  1 260 ? -65.43288 -40.05385  43.53256  1.000 99.94415  ? 240  TYR A CE1 1 
ATOM   1831  C CE2 . TYR A  1 260 ? -64.25475 -39.63636  41.48668  1.000 101.73766 ? 240  TYR A CE2 1 
ATOM   1832  C CZ  . TYR A  1 260 ? -65.05945 -40.45208  42.26022  1.000 103.05875 ? 240  TYR A CZ  1 
ATOM   1833  O OH  . TYR A  1 260 ? -65.49069 -41.66877  41.76075  1.000 107.16351 ? 240  TYR A OH  1 
ATOM   1834  N N   . ILE A  1 261 ? -65.28612 -35.82785  46.31407  1.000 76.81783  ? 241  ILE A N   1 
ATOM   1835  C CA  . ILE A  1 261 ? -66.12367 -36.26151  47.42791  1.000 76.41601  ? 241  ILE A CA  1 
ATOM   1836  C C   . ILE A  1 261 ? -67.22739 -35.25207  47.74370  1.000 77.57577  ? 241  ILE A C   1 
ATOM   1837  O O   . ILE A  1 261 ? -68.32810 -35.64891  48.14275  1.000 80.94018  ? 241  ILE A O   1 
ATOM   1838  C CB  . ILE A  1 261 ? -65.26273 -36.55374  48.66881  1.000 75.20812  ? 241  ILE A CB  1 
ATOM   1839  C CG1 . ILE A  1 261 ? -63.90945 -37.13564  48.26106  1.000 72.20354  ? 241  ILE A CG1 1 
ATOM   1840  C CG2 . ILE A  1 261 ? -65.97871 -37.51731  49.58378  1.000 79.50979  ? 241  ILE A CG2 1 
ATOM   1841  C CD1 . ILE A  1 261 ? -62.98361 -37.38355  49.42510  1.000 68.32775  ? 241  ILE A CD1 1 
ATOM   1842  N N   . VAL A  1 262 ? -66.96889 -33.94908  47.59156  1.000 76.14371  ? 242  VAL A N   1 
ATOM   1843  C CA  . VAL A  1 262 ? -68.04130 -32.96320  47.75100  1.000 81.16447  ? 242  VAL A CA  1 
ATOM   1844  C C   . VAL A  1 262 ? -69.26854 -33.38059  46.94803  1.000 90.47741  ? 242  VAL A C   1 
ATOM   1845  O O   . VAL A  1 262 ? -70.40020 -33.35828  47.44783  1.000 93.37415  ? 242  VAL A O   1 
ATOM   1846  C CB  . VAL A  1 262 ? -67.56360 -31.56165  47.33290  1.000 77.99445  ? 242  VAL A CB  1 
ATOM   1847  C CG1 . VAL A  1 262 ? -68.62455 -30.53474  47.68361  1.000 77.80840  ? 242  VAL A CG1 1 
ATOM   1848  C CG2 . VAL A  1 262 ? -66.24454 -31.21567  47.99916  1.000 73.19169  ? 242  VAL A CG2 1 
ATOM   1849  N N   . GLU A  1 263 ? -69.05118 -33.79894  45.69647  1.000 93.59300  ? 243  GLU A N   1 
ATOM   1850  C CA  . GLU A  1 263 ? -70.15316 -34.19985  44.82480  1.000 96.38630  ? 243  GLU A CA  1 
ATOM   1851  C C   . GLU A  1 263 ? -70.71991 -35.55405  45.23192  1.000 95.24622  ? 243  GLU A C   1 
ATOM   1852  O O   . GLU A  1 263 ? -71.91180 -35.67935  45.53333  1.000 95.10375  ? 243  GLU A O   1 
ATOM   1853  C CB  . GLU A  1 263 ? -69.68018 -34.24007  43.36809  1.000 99.31544  ? 243  GLU A CB  1 
ATOM   1854  C CG  . GLU A  1 263 ? -70.62783 -33.57650  42.37769  1.000 105.24196 ? 243  GLU A CG  1 
ATOM   1855  C CD  . GLU A  1 263 ? -69.93717 -33.17452  41.08364  1.000 108.13365 ? 243  GLU A CD  1 
ATOM   1856  O OE1 . GLU A  1 263 ? -70.05484 -33.92573  40.08680  1.000 111.28482 ? 243  GLU A OE1 1 
ATOM   1857  O OE2 . GLU A  1 263 ? -69.27614 -32.10921  41.06744  1.000 105.68784 ? 243  GLU A OE2 1 
ATOM   1858  N N   . HIS A  1 264 ? -69.87381 -36.58213  45.25022  1.000 95.39283  ? 244  HIS A N   1 
ATOM   1859  C CA  . HIS A  1 264 ? -70.34773 -37.95665  45.36040  1.000 98.46975  ? 244  HIS A CA  1 
ATOM   1860  C C   . HIS A  1 264 ? -70.45103 -38.45264  46.79523  1.000 93.22501  ? 244  HIS A C   1 
ATOM   1861  O O   . HIS A  1 264 ? -71.26581 -39.34330  47.07345  1.000 92.79770  ? 244  HIS A O   1 
ATOM   1862  C CB  . HIS A  1 264 ? -69.43111 -38.88885  44.56111  1.000 101.50882 ? 244  HIS A CB  1 
ATOM   1863  C CG  . HIS A  1 264 ? -69.39017 -38.57991  43.09530  1.000 104.78709 ? 244  HIS A CG  1 
ATOM   1864  N ND1 . HIS A  1 264 ? -70.21459 -37.64383  42.50690  1.000 105.93602 ? 244  HIS A ND1 1 
ATOM   1865  C CD2 . HIS A  1 264 ? -68.62368 -39.08318  42.09916  1.000 106.04257 ? 244  HIS A CD2 1 
ATOM   1866  C CE1 . HIS A  1 264 ? -69.95666 -37.58253  41.21279  1.000 107.33698 ? 244  HIS A CE1 1 
ATOM   1867  N NE2 . HIS A  1 264 ? -68.99675 -38.44765  40.93902  1.000 107.78287 ? 244  HIS A NE2 1 
ATOM   1868  N N   . GLY A  1 265 ? -69.64552 -37.90725  47.70917  1.000 87.32291  ? 245  GLY A N   1 
ATOM   1869  C CA  . GLY A  1 265 ? -69.66108 -38.30049  49.09213  1.000 83.43022  ? 245  GLY A CA  1 
ATOM   1870  C C   . GLY A  1 265 ? -70.14593 -37.19629  50.00920  1.000 80.68113  ? 245  GLY A C   1 
ATOM   1871  O O   . GLY A  1 265 ? -70.85033 -36.26328  49.59622  1.000 75.80989  ? 245  GLY A O   1 
ATOM   1872  N N   . LYS A  1 266 ? -69.75867 -37.30225  51.27958  1.000 81.80760  ? 246  LYS A N   1 
ATOM   1873  C CA  . LYS A  1 266 ? -70.10035 -36.31038  52.28990  1.000 84.64783  ? 246  LYS A CA  1 
ATOM   1874  C C   . LYS A  1 266 ? -68.83828 -35.59484  52.76252  1.000 80.29918  ? 246  LYS A C   1 
ATOM   1875  O O   . LYS A  1 266 ? -67.92191 -36.22115  53.30632  1.000 79.48272  ? 246  LYS A O   1 
ATOM   1876  C CB  . LYS A  1 266 ? -70.83175 -36.94512  53.47383  1.000 87.99374  ? 246  LYS A CB  1 
ATOM   1877  C CG  . LYS A  1 266 ? -71.45030 -35.89063  54.39494  1.000 91.11515  ? 246  LYS A CG  1 
ATOM   1878  C CD  . LYS A  1 266 ? -71.74935 -36.41080  55.79582  1.000 91.02947  ? 246  LYS A CD  1 
ATOM   1879  C CE  . LYS A  1 266 ? -72.94421 -35.66940  56.40176  1.000 94.03101  ? 246  LYS A CE  1 
ATOM   1880  N NZ  . LYS A  1 266 ? -72.68538 -35.07805  57.75005  1.000 92.88788  ? 246  LYS A NZ  1 
ATOM   1881  N N   . ALA A  1 267 ? -68.80176 -34.28542  52.55786  1.000 78.26185  ? 247  ALA A N   1 
ATOM   1882  C CA  . ALA A  1 267 ? -67.73576 -33.43023  53.04819  1.000 73.86771  ? 247  ALA A CA  1 
ATOM   1883  C C   . ALA A  1 267 ? -68.32103 -32.45216  54.05774  1.000 75.38298  ? 247  ALA A C   1 
ATOM   1884  O O   . ALA A  1 267 ? -69.39572 -31.87993  53.83514  1.000 75.00331  ? 247  ALA A O   1 
ATOM   1885  C CB  . ALA A  1 267 ? -67.05475 -32.67711  51.89934  1.000 68.25315  ? 247  ALA A CB  1 
ATOM   1886  N N   . VAL A  1 268 ? -67.62261 -32.27704  55.17569  1.000 71.54180  ? 248  VAL A N   1 
ATOM   1887  C CA  . VAL A  1 268 ? -68.06631 -31.39713  56.24839  1.000 70.28734  ? 248  VAL A CA  1 
ATOM   1888  C C   . VAL A  1 268 ? -66.92778 -30.44086  56.57343  1.000 67.67962  ? 248  VAL A C   1 
ATOM   1889  O O   . VAL A  1 268 ? -65.75286 -30.82448  56.54690  1.000 67.19487  ? 248  VAL A O   1 
ATOM   1890  C CB  . VAL A  1 268 ? -68.51447 -32.20470  57.48962  1.000 71.73904  ? 248  VAL A CB  1 
ATOM   1891  C CG1 . VAL A  1 268 ? -68.85377 -31.29606  58.65188  1.000 70.97392  ? 248  VAL A CG1 1 
ATOM   1892  C CG2 . VAL A  1 268 ? -69.72493 -33.08283  57.14238  1.000 74.99628  ? 248  VAL A CG2 1 
ATOM   1893  N N   . ALA A  1 269 ? -67.27431 -29.18913  56.85023  1.000 68.08962  ? 249  ALA A N   1 
ATOM   1894  C CA  . ALA A  1 269 ? -66.30037 -28.15697  57.17245  1.000 60.13556  ? 249  ALA A CA  1 
ATOM   1895  C C   . ALA A  1 269 ? -66.11499 -28.05986  58.67774  1.000 56.88029  ? 249  ALA A C   1 
ATOM   1896  O O   . ALA A  1 269 ? -67.08382 -28.07711  59.44208  1.000 55.48171  ? 249  ALA A O   1 
ATOM   1897  C CB  . ALA A  1 269 ? -66.73181 -26.79491  56.61835  1.000 53.40202  ? 249  ALA A CB  1 
ATOM   1898  N N   . HIS A  1 270 ? -64.86447 -27.96181  59.09834  1.000 54.02727  ? 250  HIS A N   1 
ATOM   1899  C CA  . HIS A  1 270 ? -64.53329 -27.68264  60.48115  1.000 52.19699  ? 250  HIS A CA  1 
ATOM   1900  C C   . HIS A  1 270 ? -63.95197 -26.28526  60.52800  1.000 50.38694  ? 250  HIS A C   1 
ATOM   1901  O O   . HIS A  1 270 ? -63.10071 -25.94377  59.70169  1.000 50.78801  ? 250  HIS A O   1 
ATOM   1902  C CB  . HIS A  1 270 ? -63.53694 -28.70402  61.03977  1.000 54.27857  ? 250  HIS A CB  1 
ATOM   1903  C CG  . HIS A  1 270 ? -63.04527 -28.36764  62.41103  1.000 50.93602  ? 250  HIS A CG  1 
ATOM   1904  N ND1 . HIS A  1 270 ? -63.79463 -28.59531  63.54513  1.000 51.83634  ? 250  HIS A ND1 1 
ATOM   1905  C CD2 . HIS A  1 270 ? -61.89054 -27.79732  62.82986  1.000 50.32156  ? 250  HIS A CD2 1 
ATOM   1906  C CE1 . HIS A  1 270 ? -63.11745 -28.18723  64.60476  1.000 52.06645  ? 250  HIS A CE1 1 
ATOM   1907  N NE2 . HIS A  1 270 ? -61.95791 -27.70073  64.19905  1.000 48.43642  ? 250  HIS A NE2 1 
ATOM   1908  N N   . ARG A  1 271 ? -64.41814 -25.47823  61.47710  1.000 51.29829  ? 251  ARG A N   1 
ATOM   1909  C CA  . ARG A  1 271 ? -64.03936 -24.07164  61.53739  1.000 50.19368  ? 251  ARG A CA  1 
ATOM   1910  C C   . ARG A  1 271 ? -62.88407 -23.86824  62.50398  1.000 47.82010  ? 251  ARG A C   1 
ATOM   1911  O O   . ARG A  1 271 ? -62.96221 -24.27150  63.66944  1.000 42.51730  ? 251  ARG A O   1 
ATOM   1912  C CB  . ARG A  1 271 ? -65.23353 -23.20750  61.93304  1.000 49.34389  ? 251  ARG A CB  1 
ATOM   1913  C CG  . ARG A  1 271 ? -66.33902 -23.24434  60.88669  1.000 52.59789  ? 251  ARG A CG  1 
ATOM   1914  C CD  . ARG A  1 271 ? -67.42187 -22.24311  61.17537  1.000 59.60550  ? 251  ARG A CD  1 
ATOM   1915  N NE  . ARG A  1 271 ? -68.58348 -22.47624  60.33064  1.000 66.61398  ? 251  ARG A NE  1 
ATOM   1916  C CZ  . ARG A  1 271 ? -69.54843 -21.58437  60.13373  1.000 72.08947  ? 251  ARG A CZ  1 
ATOM   1917  N NH1 . ARG A  1 271 ? -69.47645 -20.39447  60.72285  1.000 75.32597  ? 251  ARG A NH1 1 
ATOM   1918  N NH2 . ARG A  1 271 ? -70.57638 -21.87511  59.33823  1.000 72.72650  ? 251  ARG A NH2 1 
ATOM   1919  N N   . PHE A  1 272 ? -61.82033 -23.22726  61.99883  1.000 45.50448  ? 252  PHE A N   1 
ATOM   1920  C CA  . PHE A  1 272 ? -60.61786 -22.95008  62.77829  1.000 46.11180  ? 252  PHE A CA  1 
ATOM   1921  C C   . PHE A  1 272 ? -60.92732 -22.30631  64.12643  1.000 45.71140  ? 252  PHE A C   1 
ATOM   1922  O O   . PHE A  1 272 ? -60.22403 -22.56034  65.11200  1.000 44.26970  ? 252  PHE A O   1 
ATOM   1923  C CB  . PHE A  1 272 ? -59.69182 -22.05168  61.95711  1.000 46.55189  ? 252  PHE A CB  1 
ATOM   1924  C CG  . PHE A  1 272 ? -58.38147 -21.72098  62.63340  1.000 45.67492  ? 252  PHE A CG  1 
ATOM   1925  C CD1 . PHE A  1 272 ? -57.61876 -22.70414  63.24069  1.000 44.11722  ? 252  PHE A CD1 1 
ATOM   1926  C CD2 . PHE A  1 272 ? -57.90332 -20.41826  62.63502  1.000 45.66750  ? 252  PHE A CD2 1 
ATOM   1927  C CE1 . PHE A  1 272 ? -56.40853 -22.38694  63.83608  1.000 40.98987  ? 252  PHE A CE1 1 
ATOM   1928  C CE2 . PHE A  1 272 ? -56.69427 -20.09853  63.22842  1.000 42.45852  ? 252  PHE A CE2 1 
ATOM   1929  C CZ  . PHE A  1 272 ? -55.95005 -21.07851  63.82448  1.000 40.28375  ? 252  PHE A CZ  1 
ATOM   1930  N N   . ALA A  1 273 ? -61.97271 -21.47876  64.19960  1.000 45.94750  ? 253  ALA A N   1 
ATOM   1931  C CA  . ALA A  1 273 ? -62.29569 -20.83676  65.47148  1.000 49.50976  ? 253  ALA A CA  1 
ATOM   1932  C C   . ALA A  1 273 ? -62.71343 -21.83192  66.55102  1.000 51.17810  ? 253  ALA A C   1 
ATOM   1933  O O   . ALA A  1 273 ? -62.66268 -21.49506  67.73302  1.000 51.75856  ? 253  ALA A O   1 
ATOM   1934  C CB  . ALA A  1 273 ? -63.39476 -19.79292  65.27201  1.000 48.46919  ? 253  ALA A CB  1 
ATOM   1935  N N   . ASP A  1 274 ? -63.12328 -23.04551  66.18714  1.000 51.63294  ? 254  ASP A N   1 
ATOM   1936  C CA  . ASP A  1 274 ? -63.52442 -24.01153  67.19743  1.000 52.25313  ? 254  ASP A CA  1 
ATOM   1937  C C   . ASP A  1 274 ? -62.36291 -24.79440  67.78020  1.000 49.70475  ? 254  ASP A C   1 
ATOM   1938  O O   . ASP A  1 274 ? -62.51863 -25.37290  68.85862  1.000 56.18039  ? 254  ASP A O   1 
ATOM   1939  C CB  . ASP A  1 274 ? -64.53365 -25.00251  66.62609  1.000 58.50930  ? 254  ASP A CB  1 
ATOM   1940  C CG  . ASP A  1 274 ? -65.84791 -24.35193  66.29041  1.000 67.83165  ? 254  ASP A CG  1 
ATOM   1941  O OD1 . ASP A  1 274 ? -66.25712 -23.41225  67.00965  1.000 67.28600  ? 254  ASP A OD1 1 
ATOM   1942  O OD2 . ASP A  1 274 ? -66.47105 -24.78411  65.30237  1.000 74.55665  ? 254  ASP A OD2 1 
ATOM   1943  N N   . SER A  1 275 ? -61.20933 -24.82797  67.10694  1.000 47.86926  ? 255  SER A N   1 
ATOM   1944  C CA  . SER A  1 275 ? -60.08072 -25.62490  67.56638  1.000 46.05325  ? 255  SER A CA  1 
ATOM   1945  C C   . SER A  1 275 ? -58.75526 -24.87503  67.61047  1.000 43.24313  ? 255  SER A C   1 
ATOM   1946  O O   . SER A  1 275 ? -57.73998 -25.47310  67.99282  1.000 39.30786  ? 255  SER A O   1 
ATOM   1947  C CB  . SER A  1 275 ? -59.91520 -26.85847  66.67726  1.000 49.32657  ? 255  SER A CB  1 
ATOM   1948  O OG  . SER A  1 275 ? -59.89239 -26.46108  65.32548  1.000 53.11186  ? 255  SER A OG  1 
ATOM   1949  N N   . CYS A  1 276 ? -58.72715 -23.60314  67.21182  1.000 43.63585  ? 256  CYS A N   1 
ATOM   1950  C CA  . CYS A  1 276 ? -57.53714 -22.78563  67.39201  1.000 40.75389  ? 256  CYS A CA  1 
ATOM   1951  C C   . CYS A  1 276 ? -57.15993 -22.72786  68.86584  1.000 40.64157  ? 256  CYS A C   1 
ATOM   1952  O O   . CYS A  1 276 ? -58.02037 -22.61206  69.74224  1.000 41.72032  ? 256  CYS A O   1 
ATOM   1953  C CB  . CYS A  1 276 ? -57.78408 -21.36910  66.86687  1.000 46.74835  ? 256  CYS A CB  1 
ATOM   1954  S SG  . CYS A  1 276 ? -56.47603 -20.18433  67.24839  1.000 50.47718  ? 256  CYS A SG  1 
ATOM   1955  N N   . VAL A  1 277 ? -55.86755 -22.81206  69.14454  1.000 39.50450  ? 257  VAL A N   1 
ATOM   1956  C CA  . VAL A  1 277 ? -55.37045 -22.66473  70.50529  1.000 44.93853  ? 257  VAL A CA  1 
ATOM   1957  C C   . VAL A  1 277 ? -54.91860 -21.21462  70.66066  1.000 48.21724  ? 257  VAL A C   1 
ATOM   1958  O O   . VAL A  1 277 ? -53.90506 -20.80107  70.08532  1.000 46.92371  ? 257  VAL A O   1 
ATOM   1959  C CB  . VAL A  1 277 ? -54.24298 -23.65683  70.81626  1.000 41.32650  ? 257  VAL A CB  1 
ATOM   1960  C CG1 . VAL A  1 277 ? -53.96011 -23.67588  72.32021  1.000 38.39951  ? 257  VAL A CG1 1 
ATOM   1961  C CG2 . VAL A  1 277 ? -54.61826 -25.05252  70.33011  1.000 39.68184  ? 257  VAL A CG2 1 
ATOM   1962  N N   . ARG A  1 278 ? -55.69177 -20.43825  71.41249  1.000 41.71305  ? 258  ARG A N   1 
ATOM   1963  C CA  . ARG A  1 278 ? -55.43758 -19.01942  71.62315  1.000 48.15016  ? 258  ARG A CA  1 
ATOM   1964  C C   . ARG A  1 278 ? -54.86460 -18.82883  73.01364  1.000 51.63553  ? 258  ARG A C   1 
ATOM   1965  O O   . ARG A  1 278 ? -55.49196 -19.22462  74.00198  1.000 56.55312  ? 258  ARG A O   1 
ATOM   1966  C CB  . ARG A  1 278 ? -56.71622 -18.19124  71.49441  1.000 47.00309  ? 258  ARG A CB  1 
ATOM   1967  C CG  . ARG A  1 278 ? -56.98845 -17.63400  70.11710  1.000 54.03098  ? 258  ARG A CG  1 
ATOM   1968  C CD  . ARG A  1 278 ? -58.32478 -16.90842  70.09528  1.000 61.69681  ? 258  ARG A CD  1 
ATOM   1969  N NE  . ARG A  1 278 ? -58.38518 -15.88104  71.13311  1.000 71.27042  ? 258  ARG A NE  1 
ATOM   1970  C CZ  . ARG A  1 278 ? -59.48372 -15.55592  71.81014  1.000 78.89738  ? 258  ARG A CZ  1 
ATOM   1971  N NH1 . ARG A  1 278 ? -60.62413 -16.18374  71.55854  1.000 84.54374  ? 258  ARG A NH1 1 
ATOM   1972  N NH2 . ARG A  1 278 ? -59.44412 -14.60724  72.74163  1.000 78.59639  ? 258  ARG A NH2 1 
ATOM   1973  N N   . SER A  1 279 ? -53.69642 -18.20435  73.09503  1.000 51.97097  ? 259  SER A N   1 
ATOM   1974  C CA  . SER A  1 279 ? -53.22794 -17.78485  74.40218  1.000 58.05963  ? 259  SER A CA  1 
ATOM   1975  C C   . SER A  1 279 ? -54.12230 -16.65597  74.92165  1.000 61.01272  ? 259  SER A C   1 
ATOM   1976  O O   . SER A  1 279 ? -54.89396 -16.04101  74.17172  1.000 58.57848  ? 259  SER A O   1 
ATOM   1977  C CB  . SER A  1 279 ? -51.76177 -17.34437  74.34111  1.000 55.92150  ? 259  SER A CB  1 
ATOM   1978  O OG  . SER A  1 279 ? -51.65290 -15.94111  74.25609  1.000 57.61660  ? 259  SER A OG  1 
ATOM   1979  N N   . ASP A  1 280 ? -54.02948 -16.40014  76.23089  1.000 62.73687  ? 260  ASP A N   1 
ATOM   1980  C CA  . ASP A  1 280 ? -54.81126 -15.31307  76.82016  1.000 64.84060  ? 260  ASP A CA  1 
ATOM   1981  C C   . ASP A  1 280 ? -54.46728 -13.96940  76.19900  1.000 62.23639  ? 260  ASP A C   1 
ATOM   1982  O O   . ASP A  1 280 ? -55.29874 -13.05382  76.19732  1.000 59.18241  ? 260  ASP A O   1 
ATOM   1983  C CB  . ASP A  1 280 ? -54.58968 -15.25710  78.32743  1.000 67.87766  ? 260  ASP A CB  1 
ATOM   1984  C CG  . ASP A  1 280 ? -55.41026 -16.29261  79.07234  1.000 70.39281  ? 260  ASP A CG  1 
ATOM   1985  O OD1 . ASP A  1 280 ? -56.61219 -16.42258  78.75510  1.000 69.24183  ? 260  ASP A OD1 1 
ATOM   1986  O OD2 . ASP A  1 280 ? -54.85545 -16.97471  79.96560  1.000 70.28788  ? 260  ASP A OD2 1 
ATOM   1987  N N   . PHE A  1 281 ? -53.25706 -13.83714  75.65818  1.000 60.99970  ? 261  PHE A N   1 
ATOM   1988  C CA  . PHE A  1 281 ? -52.77596 -12.58321  75.10334  1.000 62.46298  ? 261  PHE A CA  1 
ATOM   1989  C C   . PHE A  1 281 ? -52.91819 -12.51006  73.58578  1.000 63.03288  ? 261  PHE A C   1 
ATOM   1990  O O   . PHE A  1 281 ? -52.21060 -11.72487  72.94637  1.000 64.33360  ? 261  PHE A O   1 
ATOM   1991  C CB  . PHE A  1 281 ? -51.32096 -12.35859  75.51416  1.000 61.49311  ? 261  PHE A CB  1 
ATOM   1992  C CG  . PHE A  1 281 ? -51.08423 -12.48899  76.99146  1.000 62.41528  ? 261  PHE A CG  1 
ATOM   1993  C CD1 . PHE A  1 281 ? -51.54215 -11.51797  77.87380  1.000 65.07511  ? 261  PHE A CD1 1 
ATOM   1994  C CD2 . PHE A  1 281 ? -50.39575 -13.57944  77.49982  1.000 62.85286  ? 261  PHE A CD2 1 
ATOM   1995  C CE1 . PHE A  1 281 ? -51.32063 -11.63309  79.24191  1.000 65.73897  ? 261  PHE A CE1 1 
ATOM   1996  C CE2 . PHE A  1 281 ? -50.17455 -13.70667  78.86172  1.000 64.39836  ? 261  PHE A CE2 1 
ATOM   1997  C CZ  . PHE A  1 281 ? -50.63943 -12.73167  79.73560  1.000 67.24363  ? 261  PHE A CZ  1 
ATOM   1998  N N   . GLU A  1 282 ? -53.82153 -13.29701  72.99794  1.000 64.29729  ? 262  GLU A N   1 
ATOM   1999  C CA  . GLU A  1 282 ? -54.11544 -13.24828  71.56597  1.000 64.95763  ? 262  GLU A CA  1 
ATOM   2000  C C   . GLU A  1 282 ? -55.58108 -12.87358  71.38645  1.000 66.31822  ? 262  GLU A C   1 
ATOM   2001  O O   . GLU A  1 282 ? -56.46223 -13.54693  71.92929  1.000 65.21253  ? 262  GLU A O   1 
ATOM   2002  C CB  . GLU A  1 282 ? -53.80246 -14.59153  70.89581  1.000 59.87466  ? 262  GLU A CB  1 
ATOM   2003  C CG  . GLU A  1 282 ? -52.31878 -14.92888  70.92631  1.000 59.34588  ? 262  GLU A CG  1 
ATOM   2004  C CD  . GLU A  1 282 ? -51.98797 -16.34085  70.43181  1.000 59.44730  ? 262  GLU A CD  1 
ATOM   2005  O OE1 . GLU A  1 282 ? -52.86296 -17.23452  70.48994  1.000 60.48747  ? 262  GLU A OE1 1 
ATOM   2006  O OE2 . GLU A  1 282 ? -50.84071 -16.54636  69.97466  1.000 57.97158  ? 262  GLU A OE2 1 
ATOM   2007  N N   . HIS A  1 283 ? -55.84428 -11.80359  70.62649  1.000 69.57356  ? 263  HIS A N   1 
ATOM   2008  C CA  . HIS A  1 283 ? -57.18369 -11.21271  70.58358  1.000 72.04617  ? 263  HIS A CA  1 
ATOM   2009  C C   . HIS A  1 283 ? -58.12156 -11.87883  69.58001  1.000 68.57211  ? 263  HIS A C   1 
ATOM   2010  O O   . HIS A  1 283 ? -59.31491 -11.55924  69.56286  1.000 69.02351  ? 263  HIS A O   1 
ATOM   2011  C CB  . HIS A  1 283 ? -57.09523 -9.70296   70.29054  1.000 73.71102  ? 263  HIS A CB  1 
ATOM   2012  C CG  . HIS A  1 283 ? -56.78501 -9.36414   68.86152  1.000 77.38314  ? 263  HIS A CG  1 
ATOM   2013  N ND1 . HIS A  1 283 ? -57.71736 -8.81505   68.00455  1.000 79.66808  ? 263  HIS A ND1 1 
ATOM   2014  C CD2 . HIS A  1 283 ? -55.63902 -9.47273   68.14637  1.000 76.78480  ? 263  HIS A CD2 1 
ATOM   2015  C CE1 . HIS A  1 283 ? -57.16173 -8.60681   66.82296  1.000 78.57179  ? 263  HIS A CE1 1 
ATOM   2016  N NE2 . HIS A  1 283 ? -55.90040 -8.99548   66.88249  1.000 77.32888  ? 263  HIS A NE2 1 
ATOM   2017  N N   . GLU A  1 284 ? -57.62638 -12.80069  68.76843  1.000 64.78826  ? 264  GLU A N   1 
ATOM   2018  C CA  . GLU A  1 284 ? -58.43160 -13.48651  67.76909  1.000 65.16707  ? 264  GLU A CA  1 
ATOM   2019  C C   . GLU A  1 284 ? -57.63027 -14.68532  67.26562  1.000 60.07634  ? 264  GLU A C   1 
ATOM   2020  O O   . GLU A  1 284 ? -56.42325 -14.76933  67.52385  1.000 54.78728  ? 264  GLU A O   1 
ATOM   2021  C CB  . GLU A  1 284 ? -58.80514 -12.54460  66.60945  1.000 69.39245  ? 264  GLU A CB  1 
ATOM   2022  C CG  . GLU A  1 284 ? -57.60942 -12.04781  65.81651  1.000 71.61208  ? 264  GLU A CG  1 
ATOM   2023  C CD  . GLU A  1 284 ? -58.00649 -11.27990  64.57249  1.000 73.32923  ? 264  GLU A CD  1 
ATOM   2024  O OE1 . GLU A  1 284 ? -57.21547 -11.27675  63.60602  1.000 72.68260  ? 264  GLU A OE1 1 
ATOM   2025  O OE2 . GLU A  1 284 ? -59.10350 -10.68234  64.56272  1.000 76.19969  ? 264  GLU A OE2 1 
ATOM   2026  N N   . PRO A  1 285 ? -58.28179 -15.63620  66.58110  1.000 59.01895  ? 265  PRO A N   1 
ATOM   2027  C CA  . PRO A  1 285 ? -57.54074 -16.80188  66.06252  1.000 54.90949  ? 265  PRO A CA  1 
ATOM   2028  C C   . PRO A  1 285 ? -56.53372 -16.37848  65.00285  1.000 51.02356  ? 265  PRO A C   1 
ATOM   2029  O O   . PRO A  1 285 ? -56.83897 -15.59860  64.10184  1.000 60.27003  ? 265  PRO A O   1 
ATOM   2030  C CB  . PRO A  1 285 ? -58.64031 -17.69438  65.47349  1.000 55.95051  ? 265  PRO A CB  1 
ATOM   2031  C CG  . PRO A  1 285 ? -59.90300 -17.25897  66.16160  1.000 56.47979  ? 265  PRO A CG  1 
ATOM   2032  C CD  . PRO A  1 285 ? -59.73805 -15.78315  66.39307  1.000 54.19162  ? 265  PRO A CD  1 
ATOM   2033  N N   . TYR A  1 286 ? -55.32512 -16.89708  65.11367  1.000 46.18477  ? 266  TYR A N   1 
ATOM   2034  C CA  . TYR A  1 286 ? -54.20413 -16.44227  64.30207  1.000 43.16723  ? 266  TYR A CA  1 
ATOM   2035  C C   . TYR A  1 286 ? -53.84317 -17.52359  63.29361  1.000 41.59593  ? 266  TYR A C   1 
ATOM   2036  O O   . TYR A  1 286 ? -53.54291 -18.66083  63.67557  1.000 42.30561  ? 266  TYR A O   1 
ATOM   2037  C CB  . TYR A  1 286 ? -53.01428 -16.10462  65.19918  1.000 41.94156  ? 266  TYR A CB  1 
ATOM   2038  C CG  . TYR A  1 286 ? -51.74633 -15.64783  64.50458  1.000 45.63746  ? 266  TYR A CG  1 
ATOM   2039  C CD1 . TYR A  1 286 ? -50.88497 -16.57028  63.90425  1.000 44.57521  ? 266  TYR A CD1 1 
ATOM   2040  C CD2 . TYR A  1 286 ? -51.37461 -14.29479  64.49986  1.000 44.96759  ? 266  TYR A CD2 1 
ATOM   2041  C CE1 . TYR A  1 286 ? -49.71167 -16.15963  63.29573  1.000 47.18808  ? 266  TYR A CE1 1 
ATOM   2042  C CE2 . TYR A  1 286 ? -50.20024 -13.87091  63.89336  1.000 42.04230  ? 266  TYR A CE2 1 
ATOM   2043  C CZ  . TYR A  1 286 ? -49.36915 -14.80719  63.30137  1.000 46.55031  ? 266  TYR A CZ  1 
ATOM   2044  O OH  . TYR A  1 286 ? -48.20234 -14.41366  62.69581  1.000 44.29775  ? 266  TYR A OH  1 
ATOM   2045  N N   . TRP A  1 287 ? -53.85836 -17.15890  62.01684  1.000 42.15369  ? 267  TRP A N   1 
ATOM   2046  C CA  . TRP A  1 287 ? -53.39087 -18.00980  60.93452  1.000 41.60241  ? 267  TRP A CA  1 
ATOM   2047  C C   . TRP A  1 287 ? -52.75250 -17.10472  59.89452  1.000 47.83969  ? 267  TRP A C   1 
ATOM   2048  O O   . TRP A  1 287 ? -53.35318 -16.09957  59.50543  1.000 54.45370  ? 267  TRP A O   1 
ATOM   2049  C CB  . TRP A  1 287 ? -54.54632 -18.81738  60.32778  1.000 41.97716  ? 267  TRP A CB  1 
ATOM   2050  C CG  . TRP A  1 287 ? -54.14794 -19.71524  59.18484  1.000 44.95019  ? 267  TRP A CG  1 
ATOM   2051  C CD1 . TRP A  1 287 ? -53.89059 -21.05429  59.25319  1.000 43.38091  ? 267  TRP A CD1 1 
ATOM   2052  C CD2 . TRP A  1 287 ? -53.97880 -19.34330  57.80319  1.000 48.02766  ? 267  TRP A CD2 1 
ATOM   2053  N NE1 . TRP A  1 287 ? -53.55425 -21.53757  58.00916  1.000 48.44824  ? 267  TRP A NE1 1 
ATOM   2054  C CE2 . TRP A  1 287 ? -53.60659 -20.51135  57.10080  1.000 49.28781  ? 267  TRP A CE2 1 
ATOM   2055  C CE3 . TRP A  1 287 ? -54.10625 -18.13837  57.09541  1.000 48.73387  ? 267  TRP A CE3 1 
ATOM   2056  C CZ2 . TRP A  1 287 ? -53.35782 -20.51386  55.72399  1.000 48.19592  ? 267  TRP A CZ2 1 
ATOM   2057  C CZ3 . TRP A  1 287 ? -53.87333 -18.14115  55.72483  1.000 50.36444  ? 267  TRP A CZ3 1 
ATOM   2058  C CH2 . TRP A  1 287 ? -53.50158 -19.32476  55.05368  1.000 51.00667  ? 267  TRP A CH2 1 
ATOM   2059  N N   . ARG A  1 288 ? -51.53755 -17.43582  59.45537  1.000 44.29511  ? 268  ARG A N   1 
ATOM   2060  C CA  . ARG A  1 288 ? -50.87787 -16.61940  58.44563  1.000 43.84372  ? 268  ARG A CA  1 
ATOM   2061  C C   . ARG A  1 288 ? -50.21804 -17.49509  57.38640  1.000 46.82729  ? 268  ARG A C   1 
ATOM   2062  O O   . ARG A  1 288 ? -49.64128 -18.55023  57.68818  1.000 43.59102  ? 268  ARG A O   1 
ATOM   2063  C CB  . ARG A  1 288 ? -49.83872 -15.67569  59.06280  1.000 41.68478  ? 268  ARG A CB  1 
ATOM   2064  C CG  . ARG A  1 288 ? -50.38772 -14.74629  60.15760  1.000 42.81723  ? 268  ARG A CG  1 
ATOM   2065  C CD  . ARG A  1 288 ? -50.84094 -13.40319  59.62113  1.000 46.93748  ? 268  ARG A CD  1 
ATOM   2066  N NE  . ARG A  1 288 ? -51.13241 -12.45211  60.70153  1.000 54.13697  ? 268  ARG A NE  1 
ATOM   2067  C CZ  . ARG A  1 288 ? -52.27475 -12.41457  61.38773  1.000 53.00550  ? 268  ARG A CZ  1 
ATOM   2068  N NH1 . ARG A  1 288 ? -53.25134 -13.27880  61.10445  1.000 47.60822  ? 268  ARG A NH1 1 
ATOM   2069  N NH2 . ARG A  1 288 ? -52.43910 -11.51587  62.36071  1.000 51.54178  ? 268  ARG A NH2 1 
ATOM   2070  N N   . ASP A  1 289 ? -50.30331 -17.02619  56.14146  1.000 46.28390  ? 269  ASP A N   1 
ATOM   2071  C CA  . ASP A  1 289 ? -49.76094 -17.71606  54.98626  1.000 47.31331  ? 269  ASP A CA  1 
ATOM   2072  C C   . ASP A  1 289 ? -48.31034 -17.35739  54.70550  1.000 46.49374  ? 269  ASP A C   1 
ATOM   2073  O O   . ASP A  1 289 ? -47.56189 -18.19867  54.20190  1.000 49.03576  ? 269  ASP A O   1 
ATOM   2074  C CB  . ASP A  1 289 ? -50.60919 -17.38524  53.75414  1.000 51.42335  ? 269  ASP A CB  1 
ATOM   2075  C CG  . ASP A  1 289 ? -50.25453 -18.23956  52.57581  1.000 58.62429  ? 269  ASP A CG  1 
ATOM   2076  O OD1 . ASP A  1 289 ? -49.60758 -19.28628  52.79393  1.000 61.19605  ? 269  ASP A OD1 1 
ATOM   2077  O OD2 . ASP A  1 289 ? -50.60645 -17.88071  51.43341  1.000 63.17992  ? 269  ASP A OD2 1 
ATOM   2078  N N   . VAL A  1 290 ? -47.90155 -16.13878  55.04904  1.000 42.79034  ? 270  VAL A N   1 
ATOM   2079  C CA  . VAL A  1 290 ? -46.65989 -15.48560  54.62887  1.000 43.53326  ? 270  VAL A CA  1 
ATOM   2080  C C   . VAL A  1 290 ? -46.25233 -15.87611  53.20737  1.000 47.00673  ? 270  VAL A C   1 
ATOM   2081  O O   . VAL A  1 290 ? -45.09990 -16.23642  52.95038  1.000 48.67261  ? 270  VAL A O   1 
ATOM   2082  C CB  . VAL A  1 290 ? -45.52783 -15.72640  55.65208  1.000 45.13555  ? 270  VAL A CB  1 
ATOM   2083  C CG1 . VAL A  1 290 ? -45.86045 -15.00633  56.96835  1.000 46.84761  ? 270  VAL A CG1 1 
ATOM   2084  C CG2 . VAL A  1 290 ? -45.25482 -17.20926  55.92088  1.000 41.48449  ? 270  VAL A CG2 1 
ATOM   2085  N N   . GLY A  1 291 ? -47.18790 -15.75380  52.25891  1.000 51.57701  ? 271  GLY A N   1 
ATOM   2086  C CA  . GLY A  1 291 ? -46.91355 -16.12853  50.88047  1.000 53.70022  ? 271  GLY A CA  1 
ATOM   2087  C C   . GLY A  1 291 ? -46.23651 -15.06061  50.03153  1.000 57.83364  ? 271  GLY A C   1 
ATOM   2088  O O   . GLY A  1 291 ? -45.67926 -15.39263  48.97822  1.000 60.55666  ? 271  GLY A O   1 
ATOM   2089  N N   . THR A  1 292 ? -46.27078 -13.79223  50.44971  1.000 52.03635  ? 272  THR A N   1 
ATOM   2090  C CA  . THR A  1 292 ? -45.54443 -12.73295  49.75896  1.000 54.09228  ? 272  THR A CA  1 
ATOM   2091  C C   . THR A  1 292 ? -44.49968 -12.13407  50.69143  1.000 53.68967  ? 272  THR A C   1 
ATOM   2092  O O   . THR A  1 292 ? -44.56885 -12.29271  51.91337  1.000 50.38737  ? 272  THR A O   1 
ATOM   2093  C CB  . THR A  1 292 ? -46.48108 -11.62127  49.24748  1.000 54.86571  ? 272  THR A CB  1 
ATOM   2094  O OG1 . THR A  1 292 ? -46.82472 -10.74332  50.32587  1.000 50.55794  ? 272  THR A OG1 1 
ATOM   2095  C CG2 . THR A  1 292 ? -47.74774 -12.21112  48.67341  1.000 62.56927  ? 272  THR A CG2 1 
ATOM   2096  N N   . ILE A  1 293 ? -43.52241 -11.43997  50.09476  1.000 53.72908  ? 273  ILE A N   1 
ATOM   2097  C CA  . ILE A  1 293 ? -42.43956 -10.85011  50.88068  1.000 52.54586  ? 273  ILE A CA  1 
ATOM   2098  C C   . ILE A  1 293 ? -42.99152 -9.86261   51.90158  1.000 55.32980  ? 273  ILE A C   1 
ATOM   2099  O O   . ILE A  1 293 ? -42.57051 -9.85263   53.06572  1.000 56.18961  ? 273  ILE A O   1 
ATOM   2100  C CB  . ILE A  1 293 ? -41.40706 -10.18699  49.95511  1.000 54.15024  ? 273  ILE A CB  1 
ATOM   2101  C CG1 . ILE A  1 293 ? -40.66637 -11.25593  49.15449  1.000 57.78407  ? 273  ILE A CG1 1 
ATOM   2102  C CG2 . ILE A  1 293 ? -40.43244 -9.33524   50.76618  1.000 52.71746  ? 273  ILE A CG2 1 
ATOM   2103  C CD1 . ILE A  1 293 ? -39.76416 -10.68807  48.07411  1.000 58.88185  ? 273  ILE A CD1 1 
ATOM   2104  N N   . ASP A  1 294 ? -43.94963 -9.02937   51.48504  1.000 55.86744  ? 274  ASP A N   1 
ATOM   2105  C CA  . ASP A  1 294 ? -44.61431 -8.11073   52.40725  1.000 57.44409  ? 274  ASP A CA  1 
ATOM   2106  C C   . ASP A  1 294 ? -45.25838 -8.85423   53.57188  1.000 58.31771  ? 274  ASP A C   1 
ATOM   2107  O O   . ASP A  1 294 ? -45.13325 -8.43772   54.73385  1.000 48.16500  ? 274  ASP A O   1 
ATOM   2108  C CB  . ASP A  1 294 ? -45.66981 -7.29751   51.66281  1.000 60.48434  ? 274  ASP A CB  1 
ATOM   2109  C CG  . ASP A  1 294 ? -45.09227 -6.09017   50.99918  1.000 73.73141  ? 274  ASP A CG  1 
ATOM   2110  O OD1 . ASP A  1 294 ? -44.13507 -5.51670   51.56462  1.000 78.61013  ? 274  ASP A OD1 1 
ATOM   2111  O OD2 . ASP A  1 294 ? -45.59200 -5.71027   49.91776  1.000 82.53873  ? 274  ASP A OD2 1 
ATOM   2112  N N   . ALA A  1 295 ? -45.98462 -9.94217   53.27377  1.000 50.99889  ? 275  ALA A N   1 
ATOM   2113  C CA  . ALA A  1 295 ? -46.66455 -10.67488  54.33681  1.000 47.51614  ? 275  ALA A CA  1 
ATOM   2114  C C   . ALA A  1 295 ? -45.65787 -11.29160  55.28658  1.000 46.81735  ? 275  ALA A C   1 
ATOM   2115  O O   . ALA A  1 295 ? -45.81626 -11.21948  56.51134  1.000 49.60990  ? 275  ALA A O   1 
ATOM   2116  C CB  . ALA A  1 295 ? -47.58596 -11.73895  53.74530  1.000 46.97822  ? 275  ALA A CB  1 
ATOM   2117  N N   . TYR A  1 296 ? -44.59778 -11.87451  54.73837  1.000 48.26508  ? 276  TYR A N   1 
ATOM   2118  C CA  . TYR A  1 296 ? -43.55287 -12.44351  55.57829  1.000 45.02991  ? 276  TYR A CA  1 
ATOM   2119  C C   . TYR A  1 296 ? -42.93929 -11.37676  56.46931  1.000 45.94188  ? 276  TYR A C   1 
ATOM   2120  O O   . TYR A  1 296 ? -42.77434 -11.58286  57.67566  1.000 47.07362  ? 276  TYR A O   1 
ATOM   2121  C CB  . TYR A  1 296 ? -42.48915 -13.09009  54.69814  1.000 46.67175  ? 276  TYR A CB  1 
ATOM   2122  C CG  . TYR A  1 296 ? -41.31419 -13.64731  55.45579  1.000 45.61810  ? 276  TYR A CG  1 
ATOM   2123  C CD1 . TYR A  1 296 ? -41.39600 -14.88474  56.07874  1.000 41.34247  ? 276  TYR A CD1 1 
ATOM   2124  C CD2 . TYR A  1 296 ? -40.11598 -12.94786  55.53544  1.000 45.70139  ? 276  TYR A CD2 1 
ATOM   2125  C CE1 . TYR A  1 296 ? -40.32750 -15.40290  56.76734  1.000 40.51869  ? 276  TYR A CE1 1 
ATOM   2126  C CE2 . TYR A  1 296 ? -39.03020 -13.46907  56.22008  1.000 46.66388  ? 276  TYR A CE2 1 
ATOM   2127  C CZ  . TYR A  1 296 ? -39.14283 -14.70355  56.83147  1.000 45.23166  ? 276  TYR A CZ  1 
ATOM   2128  O OH  . TYR A  1 296 ? -38.07472 -15.23564  57.51953  1.000 45.12445  ? 276  TYR A OH  1 
ATOM   2129  N N   . TRP A  1 297 ? -42.59198 -10.22344  55.88230  1.000 45.15041  ? 277  TRP A N   1 
ATOM   2130  C CA  . TRP A  1 297 ? -42.00852 -9.13477   56.65702  1.000 45.51838  ? 277  TRP A CA  1 
ATOM   2131  C C   . TRP A  1 297 ? -42.98601 -8.63933   57.72084  1.000 45.58444  ? 277  TRP A C   1 
ATOM   2132  O O   . TRP A  1 297 ? -42.62377 -8.49898   58.89379  1.000 45.09975  ? 277  TRP A O   1 
ATOM   2133  C CB  . TRP A  1 297 ? -41.59429 -7.99091   55.72299  1.000 49.12152  ? 277  TRP A CB  1 
ATOM   2134  C CG  . TRP A  1 297 ? -41.13581 -6.74732   56.44959  1.000 48.64629  ? 277  TRP A CG  1 
ATOM   2135  C CD1 . TRP A  1 297 ? -39.85829 -6.44286   56.82990  1.000 47.64382  ? 277  TRP A CD1 1 
ATOM   2136  C CD2 . TRP A  1 297 ? -41.95320 -5.65875   56.88680  1.000 48.66263  ? 277  TRP A CD2 1 
ATOM   2137  N NE1 . TRP A  1 297 ? -39.83296 -5.22902   57.46885  1.000 53.18151  ? 277  TRP A NE1 1 
ATOM   2138  C CE2 . TRP A  1 297 ? -41.10542 -4.72580   57.51751  1.000 49.14246  ? 277  TRP A CE2 1 
ATOM   2139  C CE3 . TRP A  1 297 ? -43.31652 -5.37216   56.79158  1.000 51.88879  ? 277  TRP A CE3 1 
ATOM   2140  C CZ2 . TRP A  1 297 ? -41.57810 -3.52785   58.05680  1.000 54.06266  ? 277  TRP A CZ2 1 
ATOM   2141  C CZ3 . TRP A  1 297 ? -43.78895 -4.17606   57.33301  1.000 52.70024  ? 277  TRP A CZ3 1 
ATOM   2142  C CH2 . TRP A  1 297 ? -42.92035 -3.27109   57.95951  1.000 52.71057  ? 277  TRP A CH2 1 
ATOM   2143  N N   . GLN A  1 298 ? -44.24160 -8.40064   57.32444  1.000 46.33893  ? 278  GLN A N   1 
ATOM   2144  C CA  . GLN A  1 298 ? -45.26610 -7.93100   58.25411  1.000 52.63631  ? 278  GLN A CA  1 
ATOM   2145  C C   . GLN A  1 298 ? -45.44683 -8.89050   59.42863  1.000 51.87854  ? 278  GLN A C   1 
ATOM   2146  O O   . GLN A  1 298 ? -45.47689 -8.46269   60.58738  1.000 53.03620  ? 278  GLN A O   1 
ATOM   2147  C CB  . GLN A  1 298 ? -46.59067 -7.73075   57.51395  1.000 54.00353  ? 278  GLN A CB  1 
ATOM   2148  C CG  . GLN A  1 298 ? -47.58973 -6.83909   58.24651  1.000 56.73299  ? 278  GLN A CG  1 
ATOM   2149  C CD  . GLN A  1 298 ? -47.10789 -5.40063   58.37874  1.000 57.01611  ? 278  GLN A CD  1 
ATOM   2150  O OE1 . GLN A  1 298 ? -46.94121 -4.70084   57.38332  1.000 57.25702  ? 278  GLN A OE1 1 
ATOM   2151  N NE2 . GLN A  1 298 ? -46.87706 -4.95749   59.61214  1.000 49.94491  ? 278  GLN A NE2 1 
ATOM   2152  N N   . ALA A  1 299 ? -45.56858 -10.19217  59.15071  1.000 49.95850  ? 279  ALA A N   1 
ATOM   2153  C CA  . ALA A  1 299 ? -45.81032 -11.15928  60.22235  1.000 45.53973  ? 279  ALA A CA  1 
ATOM   2154  C C   . ALA A  1 299 ? -44.67575 -11.16730  61.23965  1.000 45.40958  ? 279  ALA A C   1 
ATOM   2155  O O   . ALA A  1 299 ? -44.91451 -11.29334  62.44799  1.000 42.08843  ? 279  ALA A O   1 
ATOM   2156  C CB  . ALA A  1 299 ? -46.00296 -12.55782  59.64185  1.000 42.18490  ? 279  ALA A CB  1 
ATOM   2157  N N   . ASN A  1 300 ? -43.43097 -11.05154  60.76769  1.000 45.29729  ? 280  ASN A N   1 
ATOM   2158  C CA  . ASN A  1 300 ? -42.29734 -11.02369  61.68424  1.000 43.72443  ? 280  ASN A CA  1 
ATOM   2159  C C   . ASN A  1 300 ? -42.23440 -9.70553   62.44526  1.000 44.70750  ? 280  ASN A C   1 
ATOM   2160  O O   . ASN A  1 300 ? -42.06833 -9.69238   63.66924  1.000 43.74017  ? 280  ASN A O   1 
ATOM   2161  C CB  . ASN A  1 300 ? -40.99758 -11.27123  60.92307  1.000 45.51039  ? 280  ASN A CB  1 
ATOM   2162  C CG  . ASN A  1 300 ? -40.79165 -12.74895  60.58653  1.000 52.88762  ? 280  ASN A CG  1 
ATOM   2163  O OD1 . ASN A  1 300 ? -41.06966 -13.19285  59.44981  1.000 46.92482  ? 280  ASN A OD1 1 
ATOM   2164  N ND2 . ASN A  1 300 ? -40.32610 -13.52554  61.58233  1.000 39.64197  ? 280  ASN A ND2 1 
ATOM   2165  N N   . ILE A  1 301 ? -42.38419 -8.58198   61.73799  1.000 49.42111  ? 281  ILE A N   1 
ATOM   2166  C CA  . ILE A  1 301 ? -42.21787 -7.28931   62.38939  1.000 48.60372  ? 281  ILE A CA  1 
ATOM   2167  C C   . ILE A  1 301 ? -43.31559 -7.04239   63.42318  1.000 47.41317  ? 281  ILE A C   1 
ATOM   2168  O O   . ILE A  1 301 ? -43.06712 -6.40414   64.45459  1.000 49.44310  ? 281  ILE A O   1 
ATOM   2169  C CB  . ILE A  1 301 ? -42.14386 -6.17925   61.32417  1.000 56.53705  ? 281  ILE A CB  1 
ATOM   2170  C CG1 . ILE A  1 301 ? -41.13795 -5.11256   61.75215  1.000 55.66090  ? 281  ILE A CG1 1 
ATOM   2171  C CG2 . ILE A  1 301 ? -43.50762 -5.57058   61.04063  1.000 62.93276  ? 281  ILE A CG2 1 
ATOM   2172  C CD1 . ILE A  1 301 ? -39.71015 -5.51897   61.46586  1.000 54.45468  ? 281  ILE A CD1 1 
ATOM   2173  N N   . ASP A  1 302 ? -44.52508 -7.56716   63.19308  1.000 45.78581  ? 282  ASP A N   1 
ATOM   2174  C CA  . ASP A  1 302 ? -45.62103 -7.40609   64.14597  1.000 47.73680  ? 282  ASP A CA  1 
ATOM   2175  C C   . ASP A  1 302 ? -45.32828 -8.06023   65.48826  1.000 45.13763  ? 282  ASP A C   1 
ATOM   2176  O O   . ASP A  1 302 ? -45.97895 -7.72569   66.48377  1.000 45.84193  ? 282  ASP A O   1 
ATOM   2177  C CB  . ASP A  1 302 ? -46.91029 -8.00597   63.58866  1.000 55.64550  ? 282  ASP A CB  1 
ATOM   2178  C CG  . ASP A  1 302 ? -47.46904 -7.22687   62.40887  1.000 61.85020  ? 282  ASP A CG  1 
ATOM   2179  O OD1 . ASP A  1 302 ? -46.99296 -6.10560   62.12503  1.000 64.41699  ? 282  ASP A OD1 1 
ATOM   2180  O OD2 . ASP A  1 302 ? -48.39066 -7.75678   61.75132  1.000 62.90699  ? 282  ASP A OD2 1 
ATOM   2181  N N   . LEU A  1 303 ? -44.38443 -9.00228   65.53557  1.000 43.84899  ? 283  LEU A N   1 
ATOM   2182  C CA  . LEU A  1 303 ? -43.97668 -9.57000   66.81496  1.000 43.26999  ? 283  LEU A CA  1 
ATOM   2183  C C   . LEU A  1 303 ? -43.24949 -8.58057   67.71270  1.000 44.19349  ? 283  LEU A C   1 
ATOM   2184  O O   . LEU A  1 303 ? -43.06300 -8.87513   68.89393  1.000 44.12127  ? 283  LEU A O   1 
ATOM   2185  C CB  . LEU A  1 303 ? -43.09420 -10.79942  66.60783  1.000 41.84128  ? 283  LEU A CB  1 
ATOM   2186  C CG  . LEU A  1 303 ? -43.82348 -11.92412  65.88956  1.000 40.95266  ? 283  LEU A CG  1 
ATOM   2187  C CD1 . LEU A  1 303 ? -42.86429 -13.02719  65.42914  1.000 43.05101  ? 283  LEU A CD1 1 
ATOM   2188  C CD2 . LEU A  1 303 ? -44.91635 -12.49586  66.79276  1.000 41.49194  ? 283  LEU A CD2 1 
ATOM   2189  N N   . THR A  1 304 ? -42.83329 -7.42779   67.20244  1.000 45.17881  ? 284  THR A N   1 
ATOM   2190  C CA  . THR A  1 304 ? -42.21384 -6.42321   68.05765  1.000 51.12867  ? 284  THR A CA  1 
ATOM   2191  C C   . THR A  1 304 ? -43.23171 -5.48643   68.69628  1.000 47.74453  ? 284  THR A C   1 
ATOM   2192  O O   . THR A  1 304 ? -42.82527 -4.59846   69.44306  1.000 51.45519  ? 284  THR A O   1 
ATOM   2193  C CB  . THR A  1 304 ? -41.16837 -5.59497   67.28547  1.000 51.87627  ? 284  THR A CB  1 
ATOM   2194  O OG1 . THR A  1 304 ? -41.81283 -4.78013   66.29016  1.000 51.49251  ? 284  THR A OG1 1 
ATOM   2195  C CG2 . THR A  1 304 ? -40.10457 -6.50557   66.63038  1.000 50.03363  ? 284  THR A CG2 1 
ATOM   2196  N N   . ASP A  1 305 ? -44.52930 -5.66263   68.42218  1.000 47.90915  ? 285  ASP A N   1 
ATOM   2197  C CA  . ASP A  1 305 ? -45.58091 -4.87143   69.06168  1.000 50.35889  ? 285  ASP A CA  1 
ATOM   2198  C C   . ASP A  1 305 ? -45.56506 -5.06150   70.57808  1.000 50.98443  ? 285  ASP A C   1 
ATOM   2199  O O   . ASP A  1 305 ? -45.07888 -6.07160   71.10479  1.000 50.03415  ? 285  ASP A O   1 
ATOM   2200  C CB  . ASP A  1 305 ? -46.96737 -5.27595   68.54732  1.000 52.98357  ? 285  ASP A CB  1 
ATOM   2201  C CG  . ASP A  1 305 ? -47.20511 -4.88663   67.09557  1.000 59.75919  ? 285  ASP A CG  1 
ATOM   2202  O OD1 . ASP A  1 305 ? -46.47120 -4.02524   66.56604  1.000 62.07780  ? 285  ASP A OD1 1 
ATOM   2203  O OD2 . ASP A  1 305 ? -48.13309 -5.45662   66.47887  1.000 60.49022  ? 285  ASP A OD2 1 
ATOM   2204  N N   . VAL A  1 306 ? -46.13413 -4.08387   71.28727  1.000 51.94481  ? 286  VAL A N   1 
ATOM   2205  C CA  . VAL A  1 306 ? -46.37324 -4.26797   72.71842  1.000 52.93250  ? 286  VAL A CA  1 
ATOM   2206  C C   . VAL A  1 306 ? -47.32107 -5.43832   72.94366  1.000 51.42365  ? 286  VAL A C   1 
ATOM   2207  O O   . VAL A  1 306 ? -47.05965 -6.31838   73.76974  1.000 51.84404  ? 286  VAL A O   1 
ATOM   2208  C CB  . VAL A  1 306 ? -46.90335 -2.97244   73.36026  1.000 58.55885  ? 286  VAL A CB  1 
ATOM   2209  C CG1 . VAL A  1 306 ? -46.74747 -3.03640   74.89095  1.000 63.83664  ? 286  VAL A CG1 1 
ATOM   2210  C CG2 . VAL A  1 306 ? -46.17408 -1.76047   72.81124  1.000 55.40496  ? 286  VAL A CG2 1 
ATOM   2211  N N   . VAL A  1 307 ? -48.41453 -5.48281   72.18503  1.000 51.57171  ? 287  VAL A N   1 
ATOM   2212  C CA  . VAL A  1 307 ? -49.36003 -6.59956   72.21209  1.000 52.34225  ? 287  VAL A CA  1 
ATOM   2213  C C   . VAL A  1 307 ? -49.41012 -7.25874   70.83591  1.000 49.65597  ? 287  VAL A C   1 
ATOM   2214  O O   . VAL A  1 307 ? -50.20644 -6.84340   69.97756  1.000 50.49734  ? 287  VAL A O   1 
ATOM   2215  C CB  . VAL A  1 307 ? -50.76222 -6.13108   72.64232  1.000 55.47196  ? 287  VAL A CB  1 
ATOM   2216  C CG1 . VAL A  1 307 ? -51.73772 -7.29753   72.62350  1.000 54.31558  ? 287  VAL A CG1 1 
ATOM   2217  C CG2 . VAL A  1 307 ? -50.71841 -5.48879   74.02279  1.000 54.24814  ? 287  VAL A CG2 1 
ATOM   2218  N N   . PRO A  1 308 ? -48.59012 -8.27473   70.57254  1.000 47.66163  ? 288  PRO A N   1 
ATOM   2219  C CA  . PRO A  1 308 ? -48.61393 -8.91496   69.25030  1.000 46.50097  ? 288  PRO A CA  1 
ATOM   2220  C C   . PRO A  1 308 ? -49.85537 -9.77231   69.06678  1.000 48.73608  ? 288  PRO A C   1 
ATOM   2221  O O   . PRO A  1 308 ? -50.44322 -10.26493  70.03128  1.000 49.35484  ? 288  PRO A O   1 
ATOM   2222  C CB  . PRO A  1 308 ? -47.34433 -9.78162   69.24500  1.000 44.90771  ? 288  PRO A CB  1 
ATOM   2223  C CG  . PRO A  1 308 ? -46.52676 -9.30659   70.40293  1.000 45.40783  ? 288  PRO A CG  1 
ATOM   2224  C CD  . PRO A  1 308 ? -47.50927 -8.80329   71.41811  1.000 48.63473  ? 288  PRO A CD  1 
ATOM   2225  N N   . ASP A  1 309 ? -50.23954 -9.95710   67.79984  1.000 46.61847  ? 289  ASP A N   1 
ATOM   2226  C CA  . ASP A  1 309 ? -51.32047 -10.88407  67.46574  1.000 49.18929  ? 289  ASP A CA  1 
ATOM   2227  C C   . ASP A  1 309 ? -50.96917 -12.32259  67.80576  1.000 48.50144  ? 289  ASP A C   1 
ATOM   2228  O O   . ASP A  1 309 ? -51.85863 -13.10898  68.13508  1.000 54.15179  ? 289  ASP A O   1 
ATOM   2229  C CB  . ASP A  1 309 ? -51.66002 -10.79087  65.97996  1.000 48.07768  ? 289  ASP A CB  1 
ATOM   2230  C CG  . ASP A  1 309 ? -51.97755 -9.39454   65.56948  1.000 52.10512  ? 289  ASP A CG  1 
ATOM   2231  O OD1 . ASP A  1 309 ? -52.65934 -8.71235   66.36417  1.000 53.76367  ? 289  ASP A OD1 1 
ATOM   2232  O OD2 . ASP A  1 309 ? -51.52681 -8.97056   64.48257  1.000 53.56104  ? 289  ASP A OD2 1 
ATOM   2233  N N   . LEU A  1 310 ? -49.70241 -12.69925  67.68382  1.000 42.94656  ? 290  LEU A N   1 
ATOM   2234  C CA  . LEU A  1 310 ? -49.24399 -14.04752  67.98538  1.000 41.50211  ? 290  LEU A CA  1 
ATOM   2235  C C   . LEU A  1 310 ? -48.35940 -13.98312  69.22044  1.000 41.80061  ? 290  LEU A C   1 
ATOM   2236  O O   . LEU A  1 310 ? -47.37581 -13.23648  69.24431  1.000 43.20848  ? 290  LEU A O   1 
ATOM   2237  C CB  . LEU A  1 310 ? -48.48838 -14.65870  66.80385  1.000 43.84924  ? 290  LEU A CB  1 
ATOM   2238  C CG  . LEU A  1 310 ? -47.78898 -15.99071  67.12142  1.000 40.15909  ? 290  LEU A CG  1 
ATOM   2239  C CD1 . LEU A  1 310 ? -48.80728 -17.09548  67.33328  1.000 38.64158  ? 290  LEU A CD1 1 
ATOM   2240  C CD2 . LEU A  1 310 ? -46.85314 -16.34952  65.98841  1.000 38.27450  ? 290  LEU A CD2 1 
ATOM   2241  N N   . ASP A  1 311 ? -48.71908 -14.74732  70.24517  1.000 44.02518  ? 291  ASP A N   1 
ATOM   2242  C CA  . ASP A  1 311 ? -48.04564 -14.70703  71.54164  1.000 44.68987  ? 291  ASP A CA  1 
ATOM   2243  C C   . ASP A  1 311 ? -46.98454 -15.80206  71.56145  1.000 47.39878  ? 291  ASP A C   1 
ATOM   2244  O O   . ASP A  1 311 ? -47.28128 -16.96020  71.85569  1.000 46.05267  ? 291  ASP A O   1 
ATOM   2245  C CB  . ASP A  1 311 ? -49.05884 -14.87975  72.66803  1.000 42.40841  ? 291  ASP A CB  1 
ATOM   2246  C CG  . ASP A  1 311 ? -48.41000 -15.06359  74.02407  1.000 45.17082  ? 291  ASP A CG  1 
ATOM   2247  O OD1 . ASP A  1 311 ? -47.22808 -14.70491  74.19622  1.000 48.12034  ? 291  ASP A OD1 1 
ATOM   2248  O OD2 . ASP A  1 311 ? -49.10442 -15.54415  74.94382  1.000 52.45330  ? 291  ASP A OD2 1 
ATOM   2249  N N   . ILE A  1 312 ? -45.73595 -15.42788  71.26325  1.000 48.51492  ? 292  ILE A N   1 
ATOM   2250  C CA  . ILE A  1 312 ? -44.64296 -16.40054  71.24224  1.000 48.98561  ? 292  ILE A CA  1 
ATOM   2251  C C   . ILE A  1 312 ? -44.11004 -16.72154  72.63073  1.000 48.64608  ? 292  ILE A C   1 
ATOM   2252  O O   . ILE A  1 312 ? -43.18634 -17.53722  72.75764  1.000 45.80651  ? 292  ILE A O   1 
ATOM   2253  C CB  . ILE A  1 312 ? -43.51187 -15.89235  70.32455  1.000 45.67845  ? 292  ILE A CB  1 
ATOM   2254  C CG1 . ILE A  1 312 ? -42.74916 -14.73822  70.97780  1.000 43.81319  ? 292  ILE A CG1 1 
ATOM   2255  C CG2 . ILE A  1 312 ? -44.07824 -15.43088  68.97996  1.000 46.98459  ? 292  ILE A CG2 1 
ATOM   2256  C CD1 . ILE A  1 312 ? -41.64929 -14.16780  70.08653  1.000 41.61921  ? 292  ILE A CD1 1 
ATOM   2257  N N   . TYR A  1 313 ? -44.65963 -16.11053  73.67850  1.000 48.15687  ? 293  TYR A N   1 
ATOM   2258  C CA  . TYR A  1 313 ? -44.29100 -16.43189  75.05102  1.000 50.39262  ? 293  TYR A CA  1 
ATOM   2259  C C   . TYR A  1 313 ? -45.30033 -17.36603  75.70394  1.000 54.71917  ? 293  TYR A C   1 
ATOM   2260  O O   . TYR A  1 313 ? -45.26019 -17.55707  76.92442  1.000 56.04049  ? 293  TYR A O   1 
ATOM   2261  C CB  . TYR A  1 313 ? -44.11197 -15.14240  75.87921  1.000 49.57588  ? 293  TYR A CB  1 
ATOM   2262  C CG  . TYR A  1 313 ? -42.95440 -14.33215  75.35298  1.000 51.47560  ? 293  TYR A CG  1 
ATOM   2263  C CD1 . TYR A  1 313 ? -41.66569 -14.50521  75.84987  1.000 50.17595  ? 293  TYR A CD1 1 
ATOM   2264  C CD2 . TYR A  1 313 ? -43.13744 -13.44052  74.29296  1.000 55.22279  ? 293  TYR A CD2 1 
ATOM   2265  C CE1 . TYR A  1 313 ? -40.58978 -13.78356  75.30984  1.000 54.38704  ? 293  TYR A CE1 1 
ATOM   2266  C CE2 . TYR A  1 313 ? -42.07810 -12.72826  73.75380  1.000 53.17811  ? 293  TYR A CE2 1 
ATOM   2267  C CZ  . TYR A  1 313 ? -40.81764 -12.90238  74.26061  1.000 54.11927  ? 293  TYR A CZ  1 
ATOM   2268  O OH  . TYR A  1 313 ? -39.79888 -12.18158  73.70546  1.000 58.70007  ? 293  TYR A OH  1 
ATOM   2269  N N   . ASP A  1 314 ? -46.20006 -17.95481  74.91845  1.000 54.53917  ? 294  ASP A N   1 
ATOM   2270  C CA  . ASP A  1 314 ? -47.19447 -18.85955  75.47084  1.000 55.77438  ? 294  ASP A CA  1 
ATOM   2271  C C   . ASP A  1 314 ? -46.55298 -20.20726  75.75257  1.000 52.25179  ? 294  ASP A C   1 
ATOM   2272  O O   . ASP A  1 314 ? -45.87102 -20.76283  74.89157  1.000 58.53224  ? 294  ASP A O   1 
ATOM   2273  C CB  . ASP A  1 314 ? -48.37188 -19.02741  74.51372  1.000 56.78150  ? 294  ASP A CB  1 
ATOM   2274  C CG  . ASP A  1 314 ? -49.21309 -20.24619  74.83949  1.000 58.24864  ? 294  ASP A CG  1 
ATOM   2275  O OD1 . ASP A  1 314 ? -50.18850 -20.11811  75.60253  1.000 58.31350  ? 294  ASP A OD1 1 
ATOM   2276  O OD2 . ASP A  1 314 ? -48.88382 -21.34336  74.33940  1.000 59.85625  ? 294  ASP A OD2 1 
ATOM   2277  N N   . LYS A  1 315 ? -46.77443 -20.72684  76.95974  1.000 47.97155  ? 295  LYS A N   1 
ATOM   2278  C CA  . LYS A  1 315 ? -46.25816 -22.02720  77.36493  1.000 48.41518  ? 295  LYS A CA  1 
ATOM   2279  C C   . LYS A  1 315 ? -47.28487 -23.13779  77.24299  1.000 45.82827  ? 295  LYS A C   1 
ATOM   2280  O O   . LYS A  1 315 ? -46.90929 -24.31414  77.22624  1.000 49.21941  ? 295  LYS A O   1 
ATOM   2281  C CB  . LYS A  1 315 ? -45.77317 -21.99479  78.81890  1.000 52.28401  ? 295  LYS A CB  1 
ATOM   2282  C CG  . LYS A  1 315 ? -44.56878 -21.11800  79.08977  1.000 53.78784  ? 295  LYS A CG  1 
ATOM   2283  C CD  . LYS A  1 315 ? -44.37211 -20.93842  80.59681  1.000 56.39620  ? 295  LYS A CD  1 
ATOM   2284  C CE  . LYS A  1 315 ? -42.96070 -20.46268  80.93147  1.000 62.99706  ? 295  LYS A CE  1 
ATOM   2285  N NZ  . LYS A  1 315 ? -42.07613 -20.48097  79.71628  1.000 66.05399  ? 295  LYS A NZ  1 
ATOM   2286  N N   . SER A  1 316 ? -48.56535 -22.80011  77.16449  1.000 42.66450  ? 296  SER A N   1 
ATOM   2287  C CA  . SER A  1 316 ? -49.58294 -23.83686  77.14883  1.000 45.39966  ? 296  SER A CA  1 
ATOM   2288  C C   . SER A  1 316 ? -49.61735 -24.61679  75.83030  1.000 44.20619  ? 296  SER A C   1 
ATOM   2289  O O   . SER A  1 316 ? -50.15264 -25.72725  75.80655  1.000 42.51315  ? 296  SER A O   1 
ATOM   2290  C CB  . SER A  1 316 ? -50.94798 -23.20854  77.42755  1.000 50.59759  ? 296  SER A CB  1 
ATOM   2291  O OG  . SER A  1 316 ? -51.27029 -22.28214  76.39753  1.000 52.68911  ? 296  SER A OG  1 
ATOM   2292  N N   . TRP A  1 317 ? -49.08331 -24.06406  74.73564  1.000 36.43125  ? 297  TRP A N   1 
ATOM   2293  C CA  . TRP A  1 317 ? -49.07220 -24.73795  73.43545  1.000 35.37252  ? 297  TRP A CA  1 
ATOM   2294  C C   . TRP A  1 317 ? -47.75081 -24.45077  72.74167  1.000 34.69544  ? 297  TRP A C   1 
ATOM   2295  O O   . TRP A  1 317 ? -47.70006 -23.78763  71.70251  1.000 38.22398  ? 297  TRP A O   1 
ATOM   2296  C CB  . TRP A  1 317 ? -50.26286 -24.30369  72.57577  1.000 35.81844  ? 297  TRP A CB  1 
ATOM   2297  C CG  . TRP A  1 317 ? -50.58894 -25.24229  71.41874  1.000 38.19037  ? 297  TRP A CG  1 
ATOM   2298  C CD1 . TRP A  1 317 ? -50.14153 -25.13192  70.14015  1.000 36.97871  ? 297  TRP A CD1 1 
ATOM   2299  C CD2 . TRP A  1 317 ? -51.43833 -26.40919  71.44574  1.000 36.91541  ? 297  TRP A CD2 1 
ATOM   2300  N NE1 . TRP A  1 317 ? -50.65522 -26.15012  69.36608  1.000 38.69246  ? 297  TRP A NE1 1 
ATOM   2301  C CE2 . TRP A  1 317 ? -51.45990 -26.93920  70.13842  1.000 34.27614  ? 297  TRP A CE2 1 
ATOM   2302  C CE3 . TRP A  1 317 ? -52.17974 -27.05321  72.44696  1.000 38.96489  ? 297  TRP A CE3 1 
ATOM   2303  C CZ2 . TRP A  1 317 ? -52.19705 -28.07886  69.79616  1.000 37.17720  ? 297  TRP A CZ2 1 
ATOM   2304  C CZ3 . TRP A  1 317 ? -52.91376 -28.19112  72.10713  1.000 35.08154  ? 297  TRP A CZ3 1 
ATOM   2305  C CH2 . TRP A  1 317 ? -52.91135 -28.69077  70.79011  1.000 37.83373  ? 297  TRP A CH2 1 
ATOM   2306  N N   . PRO A  1 318 ? -46.66179 -24.99499  73.26348  1.000 35.00239  ? 298  PRO A N   1 
ATOM   2307  C CA  . PRO A  1 318 ? -45.33140 -24.55750  72.83228  1.000 33.95200  ? 298  PRO A CA  1 
ATOM   2308  C C   . PRO A  1 318 ? -44.95415 -25.07139  71.45388  1.000 33.11360  ? 298  PRO A C   1 
ATOM   2309  O O   . PRO A  1 318 ? -45.41751 -26.12069  70.98902  1.000 32.57669  ? 298  PRO A O   1 
ATOM   2310  C CB  . PRO A  1 318 ? -44.40760 -25.14796  73.90582  1.000 33.93765  ? 298  PRO A CB  1 
ATOM   2311  C CG  . PRO A  1 318 ? -45.16106 -26.40134  74.36896  1.000 34.66351  ? 298  PRO A CG  1 
ATOM   2312  C CD  . PRO A  1 318 ? -46.61658 -26.02228  74.32432  1.000 34.21429  ? 298  PRO A CD  1 
ATOM   2313  N N   . ILE A  1 319 ? -44.07679 -24.31138  70.80883  1.000 33.15010  ? 299  ILE A N   1 
ATOM   2314  C CA  . ILE A  1 319 ? -43.57019 -24.64135  69.48681  1.000 36.71080  ? 299  ILE A CA  1 
ATOM   2315  C C   . ILE A  1 319 ? -42.20994 -25.28928  69.66915  1.000 34.56770  ? 299  ILE A C   1 
ATOM   2316  O O   . ILE A  1 319 ? -41.25306 -24.65045  70.12210  1.000 36.78869  ? 299  ILE A O   1 
ATOM   2317  C CB  . ILE A  1 319 ? -43.47611 -23.40921  68.57747  1.000 39.37039  ? 299  ILE A CB  1 
ATOM   2318  C CG1 . ILE A  1 319 ? -44.75823 -22.57715  68.65633  1.000 40.23744  ? 299  ILE A CG1 1 
ATOM   2319  C CG2 . ILE A  1 319 ? -43.23336 -23.84999  67.14145  1.000 32.74068  ? 299  ILE A CG2 1 
ATOM   2320  C CD1 . ILE A  1 319 ? -45.94970 -23.26729  68.05487  1.000 37.83128  ? 299  ILE A CD1 1 
ATOM   2321  N N   . TRP A  1 320 ? -42.11217 -26.55599  69.31293  1.000 31.67362  ? 300  TRP A N   1 
ATOM   2322  C CA  . TRP A  1 320 ? -40.81938 -27.21674  69.36264  1.000 35.01433  ? 300  TRP A CA  1 
ATOM   2323  C C   . TRP A  1 320 ? -40.04485 -26.90678  68.08806  1.000 31.52842  ? 300  TRP A C   1 
ATOM   2324  O O   . TRP A  1 320 ? -40.62396 -26.78188  67.01011  1.000 33.88634  ? 300  TRP A O   1 
ATOM   2325  C CB  . TRP A  1 320 ? -40.99134 -28.73186  69.52753  1.000 30.97922  ? 300  TRP A CB  1 
ATOM   2326  C CG  . TRP A  1 320 ? -39.68871 -29.41805  69.62213  1.000 33.36197  ? 300  TRP A CG  1 
ATOM   2327  C CD1 . TRP A  1 320 ? -39.00327 -30.04432  68.60832  1.000 32.42846  ? 300  TRP A CD1 1 
ATOM   2328  C CD2 . TRP A  1 320 ? -38.87085 -29.52349  70.78962  1.000 33.45865  ? 300  TRP A CD2 1 
ATOM   2329  N NE1 . TRP A  1 320 ? -37.81516 -30.55056  69.09182  1.000 37.01858  ? 300  TRP A NE1 1 
ATOM   2330  C CE2 . TRP A  1 320 ? -37.70331 -30.23521  70.42049  1.000 31.28783  ? 300  TRP A CE2 1 
ATOM   2331  C CE3 . TRP A  1 320 ? -39.01303 -29.09244  72.11266  1.000 31.68795  ? 300  TRP A CE3 1 
ATOM   2332  C CZ2 . TRP A  1 320 ? -36.69496 -30.52934  71.32741  1.000 33.25009  ? 300  TRP A CZ2 1 
ATOM   2333  C CZ3 . TRP A  1 320 ? -38.01022 -29.37634  73.01136  1.000 35.41805  ? 300  TRP A CZ3 1 
ATOM   2334  C CH2 . TRP A  1 320 ? -36.86258 -30.09266  72.61646  1.000 37.32914  ? 300  TRP A CH2 1 
ATOM   2335  N N   . THR A  1 321 ? -38.72933 -26.76917  68.21463  1.000 31.77554  ? 301  THR A N   1 
ATOM   2336  C CA  . THR A  1 321 ? -37.89028 -26.56226  67.04112  1.000 33.28569  ? 301  THR A CA  1 
ATOM   2337  C C   . THR A  1 321 ? -36.48526 -27.08768  67.32285  1.000 35.41188  ? 301  THR A C   1 
ATOM   2338  O O   . THR A  1 321 ? -36.20207 -27.64656  68.39099  1.000 36.86659  ? 301  THR A O   1 
ATOM   2339  C CB  . THR A  1 321 ? -37.83901 -25.07896  66.65078  1.000 36.91408  ? 301  THR A CB  1 
ATOM   2340  O OG1 . THR A  1 321 ? -37.30602 -24.95382  65.32970  1.000 37.30820  ? 301  THR A OG1 1 
ATOM   2341  C CG2 . THR A  1 321 ? -36.94975 -24.28459  67.64559  1.000 34.42021  ? 301  THR A CG2 1 
ATOM   2342  N N   . TYR A  1 322 ? -35.59544 -26.90555  66.34744  1.000 34.88871  ? 302  TYR A N   1 
ATOM   2343  C CA  . TYR A  1 322 ? -34.19638 -27.21536  66.56972  1.000 33.10163  ? 302  TYR A CA  1 
ATOM   2344  C C   . TYR A  1 322 ? -33.52528 -26.01745  67.22967  1.000 40.92353  ? 302  TYR A C   1 
ATOM   2345  O O   . TYR A  1 322 ? -33.63775 -24.88806  66.74576  1.000 43.90488  ? 302  TYR A O   1 
ATOM   2346  C CB  . TYR A  1 322 ? -33.49260 -27.55916  65.25909  1.000 38.51774  ? 302  TYR A CB  1 
ATOM   2347  C CG  . TYR A  1 322 ? -32.02649 -27.78664  65.48749  1.000 38.80602  ? 302  TYR A CG  1 
ATOM   2348  C CD1 . TYR A  1 322 ? -31.59895 -28.86501  66.25404  1.000 40.45847  ? 302  TYR A CD1 1 
ATOM   2349  C CD2 . TYR A  1 322 ? -31.07833 -26.90166  65.00279  1.000 35.83325  ? 302  TYR A CD2 1 
ATOM   2350  C CE1 . TYR A  1 322 ? -30.27797 -29.07721  66.49882  1.000 39.32414  ? 302  TYR A CE1 1 
ATOM   2351  C CE2 . TYR A  1 322 ? -29.73482 -27.10904  65.24366  1.000 39.13484  ? 302  TYR A CE2 1 
ATOM   2352  C CZ  . TYR A  1 322 ? -29.34759 -28.20260  65.99416  1.000 39.18152  ? 302  TYR A CZ  1 
ATOM   2353  O OH  . TYR A  1 322 ? -28.02589 -28.42919  66.25845  1.000 39.59813  ? 302  TYR A OH  1 
ATOM   2354  N N   . ALA A  1 323 ? -32.84775 -26.25536  68.34434  1.000 37.11778  ? 303  ALA A N   1 
ATOM   2355  C CA  . ALA A  1 323 ? -32.18328 -25.18415  69.06239  1.000 39.21048  ? 303  ALA A CA  1 
ATOM   2356  C C   . ALA A  1 323 ? -30.90140 -25.72717  69.65848  1.000 45.96255  ? 303  ALA A C   1 
ATOM   2357  O O   . ALA A  1 323 ? -30.81197 -26.90765  70.01575  1.000 41.84316  ? 303  ALA A O   1 
ATOM   2358  C CB  . ALA A  1 323 ? -33.04949 -24.58425  70.18060  1.000 39.35849  ? 303  ALA A CB  1 
ATOM   2359  N N   . GLU A  1 324 ? -29.91028 -24.84874  69.74028  1.000 36.30063  ? 304  GLU A N   1 
ATOM   2360  C CA  . GLU A  1 324 ? -28.63144 -25.13452  70.34928  1.000 41.02869  ? 304  GLU A CA  1 
ATOM   2361  C C   . GLU A  1 324 ? -28.44940 -24.23673  71.56955  1.000 43.24640  ? 304  GLU A C   1 
ATOM   2362  O O   . GLU A  1 324 ? -29.05979 -23.17406  71.68019  1.000 45.57641  ? 304  GLU A O   1 
ATOM   2363  C CB  . GLU A  1 324 ? -27.49329 -24.92269  69.33551  1.000 41.78862  ? 304  GLU A CB  1 
ATOM   2364  C CG  . GLU A  1 324 ? -27.60814 -25.82805  68.09917  1.000 45.61193  ? 304  GLU A CG  1 
ATOM   2365  C CD  . GLU A  1 324 ? -26.39644 -25.76208  67.15489  1.000 47.95487  ? 304  GLU A CD  1 
ATOM   2366  O OE1 . GLU A  1 324 ? -25.57300 -24.83618  67.28024  1.000 50.07798  ? 304  GLU A OE1 1 
ATOM   2367  O OE2 . GLU A  1 324 ? -26.27063 -26.63957  66.27075  1.000 49.15838  ? 304  GLU A OE2 1 
ATOM   2368  N N   . ILE A  1 325 ? -27.61881 -24.69626  72.49989  1.000 41.94107  ? 305  ILE A N   1 
ATOM   2369  C CA  . ILE A  1 325 ? -27.13122 -23.83570  73.56179  1.000 40.13985  ? 305  ILE A CA  1 
ATOM   2370  C C   . ILE A  1 325 ? -26.37559 -22.66119  72.94977  1.000 38.77818  ? 305  ILE A C   1 
ATOM   2371  O O   . ILE A  1 325 ? -25.33950 -22.83963  72.30130  1.000 40.39161  ? 305  ILE A O   1 
ATOM   2372  C CB  . ILE A  1 325 ? -26.23818 -24.62593  74.52007  1.000 40.24644  ? 305  ILE A CB  1 
ATOM   2373  C CG1 . ILE A  1 325 ? -26.94276 -25.88651  74.99997  1.000 39.73221  ? 305  ILE A CG1 1 
ATOM   2374  C CG2 . ILE A  1 325 ? -25.85878 -23.75671  75.69599  1.000 40.75489  ? 305  ILE A CG2 1 
ATOM   2375  C CD1 . ILE A  1 325 ? -26.15458 -26.63860  76.03938  1.000 40.48358  ? 305  ILE A CD1 1 
ATOM   2376  N N   . THR A  1 326 ? -26.87945 -21.45568  73.16443  1.000 42.58767  ? 306  THR A N   1 
ATOM   2377  C CA  . THR A  1 326 ? -26.24590 -20.26591  72.62990  1.000 48.18010  ? 306  THR A CA  1 
ATOM   2378  C C   . THR A  1 326 ? -25.85113 -19.32552  73.75943  1.000 47.74178  ? 306  THR A C   1 
ATOM   2379  O O   . THR A  1 326 ? -26.51037 -19.28047  74.80629  1.000 45.75580  ? 306  THR A O   1 
ATOM   2380  C CB  . THR A  1 326 ? -27.17250 -19.50002  71.67206  1.000 52.22278  ? 306  THR A CB  1 
ATOM   2381  O OG1 . THR A  1 326 ? -28.37461 -19.14507  72.36727  1.000 55.01367  ? 306  THR A OG1 1 
ATOM   2382  C CG2 . THR A  1 326 ? -27.52297 -20.33873  70.44863  1.000 48.19416  ? 306  THR A CG2 1 
ATOM   2383  N N   . PRO A  1 327 ? -24.79885 -18.54229  73.56587  1.000 45.81504  ? 307  PRO A N   1 
ATOM   2384  C CA  . PRO A  1 327 ? -24.50632 -17.45090  74.50538  1.000 47.27501  ? 307  PRO A CA  1 
ATOM   2385  C C   . PRO A  1 327 ? -25.61621 -16.41138  74.48414  1.000 50.02164  ? 307  PRO A C   1 
ATOM   2386  O O   . PRO A  1 327 ? -26.39123 -16.33256  73.51786  1.000 38.25653  ? 307  PRO A O   1 
ATOM   2387  C CB  . PRO A  1 327 ? -23.17399 -16.87936  73.99000  1.000 45.87933  ? 307  PRO A CB  1 
ATOM   2388  C CG  . PRO A  1 327 ? -23.05287 -17.37902  72.57567  1.000 46.24327  ? 307  PRO A CG  1 
ATOM   2389  C CD  . PRO A  1 327 ? -23.77947 -18.68527  72.51520  1.000 42.96362  ? 307  PRO A CD  1 
ATOM   2390  N N   . PRO A  1 328 ? -25.75761 -15.62512  75.54904  1.000 47.88066  ? 308  PRO A N   1 
ATOM   2391  C CA  . PRO A  1 328 ? -26.79175 -14.58031  75.57434  1.000 47.32731  ? 308  PRO A CA  1 
ATOM   2392  C C   . PRO A  1 328 ? -26.51235 -13.47546  74.56506  1.000 48.53805  ? 308  PRO A C   1 
ATOM   2393  O O   . PRO A  1 328 ? -25.45239 -13.39805  73.94815  1.000 39.82534  ? 308  PRO A O   1 
ATOM   2394  C CB  . PRO A  1 328 ? -26.73397 -14.05330  77.01134  1.000 45.24907  ? 308  PRO A CB  1 
ATOM   2395  C CG  . PRO A  1 328 ? -25.37943 -14.45945  77.51392  1.000 48.19686  ? 308  PRO A CG  1 
ATOM   2396  C CD  . PRO A  1 328 ? -25.06207 -15.74898  76.83940  1.000 51.57874  ? 308  PRO A CD  1 
ATOM   2397  N N   . ALA A  1 329 ? -27.51061 -12.61180  74.39391  1.000 50.53008  ? 309  ALA A N   1 
ATOM   2398  C CA  . ALA A  1 329 ? -27.34890 -11.40101  73.59403  1.000 44.32547  ? 309  ALA A CA  1 
ATOM   2399  C C   . ALA A  1 329 ? -26.59372 -10.33115  74.37765  1.000 43.44334  ? 309  ALA A C   1 
ATOM   2400  O O   . ALA A  1 329 ? -26.75958 -10.19904  75.59173  1.000 47.24505  ? 309  ALA A O   1 
ATOM   2401  C CB  . ALA A  1 329 ? -28.71337 -10.86835  73.15402  1.000 39.45853  ? 309  ALA A CB  1 
ATOM   2402  N N   . LYS A  1 330 ? -25.77395 -9.55281   73.67059  1.000 44.22371  ? 310  LYS A N   1 
ATOM   2403  C CA  . LYS A  1 330 ? -24.88787 -8.56342   74.27650  1.000 44.98106  ? 310  LYS A CA  1 
ATOM   2404  C C   . LYS A  1 330 ? -25.01848 -7.21910   73.55666  1.000 44.01422  ? 310  LYS A C   1 
ATOM   2405  O O   . LYS A  1 330 ? -24.94150 -7.15857   72.32363  1.000 46.65737  ? 310  LYS A O   1 
ATOM   2406  C CB  . LYS A  1 330 ? -23.43728 -9.06318   74.23135  1.000 49.99080  ? 310  LYS A CB  1 
ATOM   2407  C CG  . LYS A  1 330 ? -22.42289 -8.22315   74.98815  1.000 54.86097  ? 310  LYS A CG  1 
ATOM   2408  C CD  . LYS A  1 330 ? -21.00889 -8.79445   74.82740  1.000 57.99609  ? 310  LYS A CD  1 
ATOM   2409  C CE  . LYS A  1 330 ? -19.93276 -7.84305   75.36339  1.000 58.43237  ? 310  LYS A CE  1 
ATOM   2410  N NZ  . LYS A  1 330 ? -19.92597 -7.74426   76.84870  1.000 58.18667  ? 310  LYS A NZ  1 
ATOM   2411  N N   . PHE A  1 331 ? -25.21641 -6.14668   74.32402  1.000 45.10257  ? 311  PHE A N   1 
ATOM   2412  C CA  . PHE A  1 331 ? -25.25467 -4.77887   73.80838  1.000 53.23291  ? 311  PHE A CA  1 
ATOM   2413  C C   . PHE A  1 331 ? -24.04926 -4.02977   74.35154  1.000 51.01658  ? 311  PHE A C   1 
ATOM   2414  O O   . PHE A  1 331 ? -23.79665 -4.05478   75.55886  1.000 52.86349  ? 311  PHE A O   1 
ATOM   2415  C CB  . PHE A  1 331 ? -26.55870 -4.05684   74.19875  1.000 54.89422  ? 311  PHE A CB  1 
ATOM   2416  C CG  . PHE A  1 331 ? -27.81099 -4.87940   73.94415  1.000 45.02095  ? 311  PHE A CG  1 
ATOM   2417  C CD1 . PHE A  1 331 ? -28.56746 -4.69282   72.78743  1.000 44.57269  ? 311  PHE A CD1 1 
ATOM   2418  C CD2 . PHE A  1 331 ? -28.21373 -5.84173   74.85870  1.000 45.24503  ? 311  PHE A CD2 1 
ATOM   2419  C CE1 . PHE A  1 331 ? -29.69907 -5.45759   72.54073  1.000 43.35292  ? 311  PHE A CE1 1 
ATOM   2420  C CE2 . PHE A  1 331 ? -29.34354 -6.61727   74.63072  1.000 45.17135  ? 311  PHE A CE2 1 
ATOM   2421  C CZ  . PHE A  1 331 ? -30.08923 -6.42921   73.46529  1.000 45.18021  ? 311  PHE A CZ  1 
ATOM   2422  N N   . VAL A  1 332 ? -23.30194 -3.36970   73.47218  1.000 51.85692  ? 312  VAL A N   1 
ATOM   2423  C CA  . VAL A  1 332 ? -22.04405 -2.75567   73.87866  1.000 56.68940  ? 312  VAL A CA  1 
ATOM   2424  C C   . VAL A  1 332 ? -21.88738 -1.38068   73.22710  1.000 55.23235  ? 312  VAL A C   1 
ATOM   2425  O O   . VAL A  1 332 ? -22.45273 -1.10787   72.16369  1.000 51.91461  ? 312  VAL A O   1 
ATOM   2426  C CB  . VAL A  1 332 ? -20.85825 -3.70778   73.56067  1.000 61.26990  ? 312  VAL A CB  1 
ATOM   2427  C CG1 . VAL A  1 332 ? -20.58516 -3.76002   72.09982  1.000 57.89569  ? 312  VAL A CG1 1 
ATOM   2428  C CG2 . VAL A  1 332 ? -19.60346 -3.29855   74.28105  1.000 65.64952  ? 312  VAL A CG2 1 
ATOM   2429  N N   . HIS A  1 333 ? -21.15159 -0.49842   73.92484  1.000 56.74102  ? 313  HIS A N   1 
ATOM   2430  C CA  . HIS A  1 333 ? -20.80443 0.88618    73.56804  1.000 58.33543  ? 313  HIS A CA  1 
ATOM   2431  C C   . HIS A  1 333 ? -21.88448 1.89104    73.95962  1.000 57.76885  ? 313  HIS A C   1 
ATOM   2432  O O   . HIS A  1 333 ? -23.08577 1.64411    73.79605  1.000 58.58063  ? 313  HIS A O   1 
ATOM   2433  C CB  . HIS A  1 333 ? -20.46500 1.02047    72.08433  1.000 60.40234  ? 313  HIS A CB  1 
ATOM   2434  C CG  . HIS A  1 333 ? -19.14397 0.42091    71.72718  1.000 61.07165  ? 313  HIS A CG  1 
ATOM   2435  N ND1 . HIS A  1 333 ? -19.02420 -0.66699   70.88889  1.000 59.14853  ? 313  HIS A ND1 1 
ATOM   2436  C CD2 . HIS A  1 333 ? -17.88713 0.73970    72.11639  1.000 60.13452  ? 313  HIS A CD2 1 
ATOM   2437  C CE1 . HIS A  1 333 ? -17.74831 -0.98486   70.76821  1.000 59.09412  ? 313  HIS A CE1 1 
ATOM   2438  N NE2 . HIS A  1 333 ? -17.03851 -0.14918   71.50665  1.000 61.55353  ? 313  HIS A NE2 1 
ATOM   2439  N N   . ASP A  1 334 ? -21.44754 3.02594    74.49967  1.000 60.56037  ? 314  ASP A N   1 
ATOM   2440  C CA  . ASP A  1 334 ? -22.34563 4.03408    75.04721  1.000 64.09894  ? 314  ASP A CA  1 
ATOM   2441  C C   . ASP A  1 334 ? -21.61814 5.36321    75.20334  1.000 64.47441  ? 314  ASP A C   1 
ATOM   2442  O O   . ASP A  1 334 ? -21.37547 5.81764    76.32568  1.000 66.27512  ? 314  ASP A O   1 
ATOM   2443  C CB  . ASP A  1 334 ? -22.90338 3.57175    76.39773  1.000 64.76506  ? 314  ASP A CB  1 
ATOM   2444  C CG  . ASP A  1 334 ? -23.92090 4.54421    76.98744  1.000 64.51703  ? 314  ASP A CG  1 
ATOM   2445  O OD1 . ASP A  1 334 ? -24.61259 5.25102    76.21924  1.000 63.99237  ? 314  ASP A OD1 1 
ATOM   2446  O OD2 . ASP A  1 334 ? -24.02190 4.59894    78.23096  1.000 64.80117  ? 314  ASP A OD2 1 
ATOM   2447  N N   . ASP A  1 335 ? -21.24955 5.98295    74.09342  1.000 66.98263  ? 315  ASP A N   1 
ATOM   2448  C CA  . ASP A  1 335 ? -20.59643 7.28202    74.11595  1.000 71.85199  ? 315  ASP A CA  1 
ATOM   2449  C C   . ASP A  1 335 ? -21.41572 8.26344    73.27672  1.000 75.31536  ? 315  ASP A C   1 
ATOM   2450  O O   . ASP A  1 335 ? -22.53156 7.95649    72.83816  1.000 71.81879  ? 315  ASP A O   1 
ATOM   2451  C CB  . ASP A  1 335 ? -19.14248 7.17213    73.63699  1.000 74.58170  ? 315  ASP A CB  1 
ATOM   2452  C CG  . ASP A  1 335 ? -19.01297 6.51709    72.26958  1.000 79.36796  ? 315  ASP A CG  1 
ATOM   2453  O OD1 . ASP A  1 335 ? -19.83166 6.81943    71.38184  1.000 80.72508  ? 315  ASP A OD1 1 
ATOM   2454  O OD2 . ASP A  1 335 ? -18.07144 5.71711    72.06861  1.000 82.40831  ? 315  ASP A OD2 1 
ATOM   2455  N N   . GLU A  1 336 ? -20.84030 9.45249    73.04932  1.000 81.42048  ? 316  GLU A N   1 
ATOM   2456  C CA  . GLU A  1 336 ? -21.54312 10.50584   72.32022  1.000 83.19759  ? 316  GLU A CA  1 
ATOM   2457  C C   . GLU A  1 336 ? -21.87871 10.08635   70.89475  1.000 77.80710  ? 316  GLU A C   1 
ATOM   2458  O O   . GLU A  1 336 ? -22.88011 10.54428   70.33323  1.000 75.72786  ? 316  GLU A O   1 
ATOM   2459  C CB  . GLU A  1 336 ? -20.70042 11.78137   72.30480  1.000 89.94814  ? 316  GLU A CB  1 
ATOM   2460  C CG  . GLU A  1 336 ? -21.50832 13.06436   72.38682  1.000 97.94616  ? 316  GLU A CG  1 
ATOM   2461  C CD  . GLU A  1 336 ? -22.44732 13.09908   73.58734  1.000 102.73979 ? 316  GLU A CD  1 
ATOM   2462  O OE1 . GLU A  1 336 ? -23.64994 12.80472   73.41149  1.000 102.42140 ? 316  GLU A OE1 1 
ATOM   2463  O OE2 . GLU A  1 336 ? -21.98743 13.43626   74.70374  1.000 104.80991 ? 316  GLU A OE2 1 
ATOM   2464  N N   . ASP A  1 337 ? -21.06975 9.20429    70.30804  1.000 77.90906  ? 317  ASP A N   1 
ATOM   2465  C CA  . ASP A  1 337 ? -21.14631 8.84075    68.89787  1.000 79.16659  ? 317  ASP A CA  1 
ATOM   2466  C C   . ASP A  1 337 ? -21.99291 7.59754    68.64460  1.000 77.40869  ? 317  ASP A C   1 
ATOM   2467  O O   . ASP A  1 337 ? -22.67940 7.51258    67.62055  1.000 76.41855  ? 317  ASP A O   1 
ATOM   2468  C CB  . ASP A  1 337 ? -19.73138 8.60956    68.35344  1.000 85.47353  ? 317  ASP A CB  1 
ATOM   2469  C CG  . ASP A  1 337 ? -18.70749 9.61876    68.90296  1.000 95.06107  ? 317  ASP A CG  1 
ATOM   2470  O OD1 . ASP A  1 337 ? -18.94326 10.84570   68.78649  1.000 90.85206  ? 317  ASP A OD1 1 
ATOM   2471  O OD2 . ASP A  1 337 ? -17.66383 9.17855    69.44454  1.000 102.66889 ? 317  ASP A OD2 1 
ATOM   2472  N N   . ARG A  1 338 ? -21.94419 6.62223    69.54804  1.000 74.07257  ? 318  ARG A N   1 
ATOM   2473  C CA  . ARG A  1 338 ? -22.51066 5.31186    69.27879  1.000 69.96821  ? 318  ARG A CA  1 
ATOM   2474  C C   . ARG A  1 338 ? -23.08845 4.73322    70.55753  1.000 67.75790  ? 318  ARG A C   1 
ATOM   2475  O O   . ARG A  1 338 ? -22.53948 4.92243    71.64627  1.000 70.16240  ? 318  ARG A O   1 
ATOM   2476  C CB  . ARG A  1 338 ? -21.46011 4.35236    68.70780  1.000 67.33178  ? 318  ARG A CB  1 
ATOM   2477  C CG  . ARG A  1 338 ? -20.24560 4.20026    69.59337  1.000 64.62788  ? 318  ARG A CG  1 
ATOM   2478  C CD  . ARG A  1 338 ? -19.25119 3.22053    69.02714  1.000 60.18171  ? 318  ARG A CD  1 
ATOM   2479  N NE  . ARG A  1 338 ? -17.98903 3.31709    69.74429  1.000 65.45311  ? 318  ARG A NE  1 
ATOM   2480  C CZ  . ARG A  1 338 ? -16.90804 2.61244    69.44531  1.000 71.24052  ? 318  ARG A CZ  1 
ATOM   2481  N NH1 . ARG A  1 338 ? -16.93266 1.75838    68.43316  1.000 71.69209  ? 318  ARG A NH1 1 
ATOM   2482  N NH2 . ARG A  1 338 ? -15.80160 2.76566    70.15517  1.000 75.82491  ? 318  ARG A NH2 1 
ATOM   2483  N N   . ARG A  1 339 ? -24.20034 4.02804    70.41127  1.000 64.09463  ? 319  ARG A N   1 
ATOM   2484  C CA  . ARG A  1 339 ? -24.78735 3.29510    71.51474  1.000 64.38206  ? 319  ARG A CA  1 
ATOM   2485  C C   . ARG A  1 339 ? -25.34755 1.99272    70.97471  1.000 59.33446  ? 319  ARG A C   1 
ATOM   2486  O O   . ARG A  1 339 ? -26.09811 1.99521    69.99324  1.000 58.56707  ? 319  ARG A O   1 
ATOM   2487  C CB  . ARG A  1 339 ? -25.88899 4.09385    72.21092  1.000 67.55392  ? 319  ARG A CB  1 
ATOM   2488  C CG  . ARG A  1 339 ? -26.51146 3.32875    73.35483  1.000 67.83624  ? 319  ARG A CG  1 
ATOM   2489  C CD  . ARG A  1 339 ? -26.95268 4.26374    74.44213  1.000 73.06500  ? 319  ARG A CD  1 
ATOM   2490  N NE  . ARG A  1 339 ? -28.11227 5.03603    74.02557  1.000 76.95341  ? 319  ARG A NE  1 
ATOM   2491  C CZ  . ARG A  1 339 ? -28.55799 6.10801    74.66541  1.000 79.49361  ? 319  ARG A CZ  1 
ATOM   2492  N NH1 . ARG A  1 339 ? -27.93761 6.53455    75.75678  1.000 77.34787  ? 319  ARG A NH1 1 
ATOM   2493  N NH2 . ARG A  1 339 ? -29.62527 6.74804    74.21173  1.000 84.22873  ? 319  ARG A NH2 1 
ATOM   2494  N N   . GLY A  1 340 ? -24.96237 0.88955    71.60047  1.000 52.83668  ? 320  GLY A N   1 
ATOM   2495  C CA  . GLY A  1 340 ? -25.50502 -0.39489   71.21715  1.000 54.09453  ? 320  GLY A CA  1 
ATOM   2496  C C   . GLY A  1 340 ? -26.72589 -0.68175   72.05941  1.000 54.71434  ? 320  GLY A C   1 
ATOM   2497  O O   . GLY A  1 340 ? -26.60959 -0.86307   73.28015  1.000 50.07540  ? 320  GLY A O   1 
ATOM   2498  N N   . SER A  1 341 ? -27.89830 -0.67605   71.43077  1.000 49.21793  ? 321  SER A N   1 
ATOM   2499  C CA  . SER A  1 341 ? -29.13055 -0.99660   72.13436  1.000 56.32405  ? 321  SER A CA  1 
ATOM   2500  C C   . SER A  1 341 ? -30.22285 -1.29340   71.12189  1.000 47.57349  ? 321  SER A C   1 
ATOM   2501  O O   . SER A  1 341 ? -30.12067 -0.94412   69.94398  1.000 47.77355  ? 321  SER A O   1 
ATOM   2502  C CB  . SER A  1 341 ? -29.57866 0.14463    73.05467  1.000 60.89449  ? 321  SER A CB  1 
ATOM   2503  O OG  . SER A  1 341 ? -30.08032 1.19901    72.25975  1.000 65.90534  ? 321  SER A OG  1 
ATOM   2504  N N   . ALA A  1 342 ? -31.28418 -1.91950   71.61665  1.000 50.31567  ? 322  ALA A N   1 
ATOM   2505  C CA  . ALA A  1 342 ? -32.43796 -2.29812   70.82188  1.000 49.20653  ? 322  ALA A CA  1 
ATOM   2506  C C   . ALA A  1 342 ? -33.67849 -1.70083   71.46351  1.000 50.95596  ? 322  ALA A C   1 
ATOM   2507  O O   . ALA A  1 342 ? -33.87797 -1.82468   72.67658  1.000 53.46870  ? 322  ALA A O   1 
ATOM   2508  C CB  . ALA A  1 342 ? -32.56368 -3.82659   70.72669  1.000 46.39969  ? 322  ALA A CB  1 
ATOM   2509  N N   . VAL A  1 343 ? -34.50358 -1.05352   70.65554  1.000 49.50248  ? 323  VAL A N   1 
ATOM   2510  C CA  . VAL A  1 343 ? -35.73649 -0.43857   71.12403  1.000 50.66845  ? 323  VAL A CA  1 
ATOM   2511  C C   . VAL A  1 343 ? -36.88116 -1.00555   70.30138  1.000 49.66968  ? 323  VAL A C   1 
ATOM   2512  O O   . VAL A  1 343 ? -36.74237 -1.20742   69.08689  1.000 49.76643  ? 323  VAL A O   1 
ATOM   2513  C CB  . VAL A  1 343 ? -35.68090 1.10295    71.02709  1.000 50.84321  ? 323  VAL A CB  1 
ATOM   2514  C CG1 . VAL A  1 343 ? -37.06930 1.71103    71.20619  1.000 51.54988  ? 323  VAL A CG1 1 
ATOM   2515  C CG2 . VAL A  1 343 ? -34.72864 1.65351    72.07771  1.000 51.52561  ? 323  VAL A CG2 1 
ATOM   2516  N N   . SER A  1 344 ? -37.99463 -1.28684   70.97825  1.000 47.42603  ? 324  SER A N   1 
ATOM   2517  C CA  . SER A  1 344 ? -39.18291 -1.87184   70.36991  1.000 46.79063  ? 324  SER A CA  1 
ATOM   2518  C C   . SER A  1 344 ? -38.80131 -3.00767   69.42110  1.000 46.35733  ? 324  SER A C   1 
ATOM   2519  O O   . SER A  1 344 ? -39.25947 -3.08685   68.28287  1.000 44.82301  ? 324  SER A O   1 
ATOM   2520  C CB  . SER A  1 344 ? -40.00646 -0.79707   69.66434  1.000 48.23523  ? 324  SER A CB  1 
ATOM   2521  O OG  . SER A  1 344 ? -40.40960 0.19696    70.59559  1.000 50.04795  ? 324  SER A OG  1 
ATOM   2522  N N   . SER A  1 345 ? -37.93232 -3.89042   69.91619  1.000 43.95909  ? 325  SER A N   1 
ATOM   2523  C CA  . SER A  1 345 ? -37.29694 -4.91371   69.10560  1.000 42.57295  ? 325  SER A CA  1 
ATOM   2524  C C   . SER A  1 345 ? -37.28762 -6.24233   69.85729  1.000 44.79398  ? 325  SER A C   1 
ATOM   2525  O O   . SER A  1 345 ? -37.43648 -6.29820   71.08457  1.000 46.08132  ? 325  SER A O   1 
ATOM   2526  C CB  . SER A  1 345 ? -35.85399 -4.51173   68.71834  1.000 42.76478  ? 325  SER A CB  1 
ATOM   2527  O OG  . SER A  1 345 ? -35.82086 -3.40131   67.82964  1.000 46.51079  ? 325  SER A OG  1 
ATOM   2528  N N   . VAL A  1 346 ? -37.09846 -7.31389   69.08915  1.000 40.49820  ? 326  VAL A N   1 
ATOM   2529  C CA  . VAL A  1 346 ? -36.88460 -8.65940   69.60125  1.000 42.54312  ? 326  VAL A CA  1 
ATOM   2530  C C   . VAL A  1 346 ? -35.50966 -9.12709   69.13231  1.000 46.08139  ? 326  VAL A C   1 
ATOM   2531  O O   . VAL A  1 346 ? -35.20217 -9.06226   67.93164  1.000 44.63255  ? 326  VAL A O   1 
ATOM   2532  C CB  . VAL A  1 346 ? -37.99331 -9.62280   69.13848  1.000 39.57002  ? 326  VAL A CB  1 
ATOM   2533  C CG1 . VAL A  1 346 ? -37.61675 -11.04657  69.48122  1.000 40.85799  ? 326  VAL A CG1 1 
ATOM   2534  C CG2 . VAL A  1 346 ? -39.32595 -9.26551   69.79715  1.000 39.32134  ? 326  VAL A CG2 1 
ATOM   2535  N N   . VAL A  1 347 ? -34.68017 -9.57560   70.08330  1.000 38.55544  ? 327  VAL A N   1 
ATOM   2536  C CA  . VAL A  1 347 ? -33.28113 -9.92911   69.84525  1.000 40.57646  ? 327  VAL A CA  1 
ATOM   2537  C C   . VAL A  1 347 ? -33.06391 -11.34363  70.36516  1.000 42.71686  ? 327  VAL A C   1 
ATOM   2538  O O   . VAL A  1 347 ? -33.48336 -11.66041  71.48577  1.000 37.56024  ? 327  VAL A O   1 
ATOM   2539  C CB  . VAL A  1 347 ? -32.30764 -8.94139   70.52755  1.000 41.51668  ? 327  VAL A CB  1 
ATOM   2540  C CG1 . VAL A  1 347 ? -30.83914 -9.35863   70.29191  1.000 42.30321  ? 327  VAL A CG1 1 
ATOM   2541  C CG2 . VAL A  1 347 ? -32.55136 -7.50461   70.04646  1.000 40.30438  ? 327  VAL A CG2 1 
ATOM   2542  N N   . SER A  1 348 ? -32.44310 -12.20188  69.53667  1.000 38.01104  ? 328  SER A N   1 
ATOM   2543  C CA  . SER A  1 348 ? -32.25520 -13.60244  69.87665  1.000 38.02107  ? 328  SER A CA  1 
ATOM   2544  C C   . SER A  1 348 ? -30.90496 -13.81349  70.54852  1.000 42.48306  ? 328  SER A C   1 
ATOM   2545  O O   . SER A  1 348 ? -30.10059 -12.89175  70.70145  1.000 37.47795  ? 328  SER A O   1 
ATOM   2546  C CB  . SER A  1 348 ? -32.35456 -14.50405  68.64233  1.000 41.40116  ? 328  SER A CB  1 
ATOM   2547  O OG  . SER A  1 348 ? -33.65910 -14.53135  68.09897  1.000 40.55813  ? 328  SER A OG  1 
ATOM   2548  N N   . GLY A  1 349 ? -30.65193 -15.06076  70.94696  1.000 39.12150  ? 329  GLY A N   1 
ATOM   2549  C CA  . GLY A  1 349 ? -29.37463 -15.41307  71.52291  1.000 37.18385  ? 329  GLY A CA  1 
ATOM   2550  C C   . GLY A  1 349 ? -28.25034 -15.29052  70.51530  1.000 38.51173  ? 329  GLY A C   1 
ATOM   2551  O O   . GLY A  1 349 ? -28.45384 -15.14513  69.30409  1.000 42.12113  ? 329  GLY A O   1 
ATOM   2552  N N   . ASP A  1 350 ? -27.02826 -15.32451  71.04406  1.000 38.72042  ? 330  ASP A N   1 
ATOM   2553  C CA  . ASP A  1 350 ? -25.82322 -15.23971  70.22422  1.000 43.77264  ? 330  ASP A CA  1 
ATOM   2554  C C   . ASP A  1 350 ? -25.81380 -13.97669  69.36392  1.000 49.28689  ? 330  ASP A C   1 
ATOM   2555  O O   . ASP A  1 350 ? -25.33741 -13.98573  68.22964  1.000 49.24768  ? 330  ASP A O   1 
ATOM   2556  C CB  . ASP A  1 350 ? -25.67048 -16.48489  69.34949  1.000 41.16009  ? 330  ASP A CB  1 
ATOM   2557  C CG  . ASP A  1 350 ? -24.29293 -16.60696  68.74518  1.000 49.89297  ? 330  ASP A CG  1 
ATOM   2558  O OD1 . ASP A  1 350 ? -23.30174 -16.24887  69.41888  1.000 49.36974  ? 330  ASP A OD1 1 
ATOM   2559  O OD2 . ASP A  1 350 ? -24.20506 -17.07671  67.58853  1.000 58.10024  ? 330  ASP A OD2 1 
ATOM   2560  N N   . CYS A  1 351 ? -26.36016 -12.88356  69.88380  1.000 52.15494  ? 331  CYS A N   1 
ATOM   2561  C CA  . CYS A  1 351 ? -26.40196 -11.61441  69.16924  1.000 51.68137  ? 331  CYS A CA  1 
ATOM   2562  C C   . CYS A  1 351 ? -25.49872 -10.60867  69.86656  1.000 46.07937  ? 331  CYS A C   1 
ATOM   2563  O O   . CYS A  1 351 ? -25.59986 -10.41123  71.07766  1.000 47.22490  ? 331  CYS A O   1 
ATOM   2564  C CB  . CYS A  1 351 ? -27.83207 -11.07609  69.08706  1.000 48.83578  ? 331  CYS A CB  1 
ATOM   2565  S SG  . CYS A  1 351 ? -28.77881 -11.77544  67.72751  1.000 47.75263  ? 331  CYS A SG  1 
ATOM   2566  N N   . ILE A  1 352 ? -24.61890 -9.97831   69.10964  1.000 47.15369  ? 332  ILE A N   1 
ATOM   2567  C CA  . ILE A  1 352 ? -23.75758 -8.92402   69.63389  1.000 48.52744  ? 332  ILE A CA  1 
ATOM   2568  C C   . ILE A  1 352 ? -24.12851 -7.62771   68.92025  1.000 47.60766  ? 332  ILE A C   1 
ATOM   2569  O O   . ILE A  1 352 ? -23.85114 -7.46521   67.72161  1.000 46.74175  ? 332  ILE A O   1 
ATOM   2570  C CB  . ILE A  1 352 ? -22.27055 -9.25577   69.45806  1.000 48.35855  ? 332  ILE A CB  1 
ATOM   2571  C CG1 . ILE A  1 352 ? -21.95503 -10.61532  70.08663  1.000 44.75323  ? 332  ILE A CG1 1 
ATOM   2572  C CG2 . ILE A  1 352 ? -21.41192 -8.17892   70.09879  1.000 50.52439  ? 332  ILE A CG2 1 
ATOM   2573  C CD1 . ILE A  1 352 ? -20.48019 -10.96506  70.09404  1.000 44.25695  ? 332  ILE A CD1 1 
ATOM   2574  N N   . ILE A  1 353 ? -24.76548 -6.71498   69.64698  1.000 45.15386  ? 333  ILE A N   1 
ATOM   2575  C CA  . ILE A  1 353 ? -25.18493 -5.42704   69.10071  1.000 48.16882  ? 333  ILE A CA  1 
ATOM   2576  C C   . ILE A  1 353 ? -24.13368 -4.41864   69.54483  1.000 49.86489  ? 333  ILE A C   1 
ATOM   2577  O O   . ILE A  1 353 ? -24.22712 -3.81075   70.61433  1.000 47.20623  ? 333  ILE A O   1 
ATOM   2578  C CB  . ILE A  1 353 ? -26.58884 -5.04351   69.55605  1.000 53.42232  ? 333  ILE A CB  1 
ATOM   2579  C CG1 . ILE A  1 353 ? -27.48854 -6.28793   69.55359  1.000 47.28650  ? 333  ILE A CG1 1 
ATOM   2580  C CG2 . ILE A  1 353 ? -27.13403 -3.87337   68.72379  1.000 54.21544  ? 333  ILE A CG2 1 
ATOM   2581  C CD1 . ILE A  1 353 ? -27.65749 -6.86435   68.18687  1.000 45.23372  ? 333  ILE A CD1 1 
ATOM   2582  N N   . SER A  1 354 ? -23.11926 -4.24621   68.70026  1.000 50.29187  ? 334  SER A N   1 
ATOM   2583  C CA  . SER A  1 354 ? -21.90539 -3.52303   69.04899  1.000 52.08096  ? 334  SER A CA  1 
ATOM   2584  C C   . SER A  1 354 ? -22.04818 -2.08490   68.55097  1.000 57.55605  ? 334  SER A C   1 
ATOM   2585  O O   . SER A  1 354 ? -21.75001 -1.77584   67.39641  1.000 51.09328  ? 334  SER A O   1 
ATOM   2586  C CB  . SER A  1 354 ? -20.68617 -4.23492   68.46264  1.000 49.56765  ? 334  SER A CB  1 
ATOM   2587  O OG  . SER A  1 354 ? -19.47918 -3.79903   69.06848  1.000 51.94322  ? 334  SER A OG  1 
ATOM   2588  N N   . GLY A  1 355 ? -22.52096 -1.20059   69.43576  1.000 54.50327  ? 335  GLY A N   1 
ATOM   2589  C CA  . GLY A  1 355 ? -22.72849 0.19146    69.07293  1.000 53.32702  ? 335  GLY A CA  1 
ATOM   2590  C C   . GLY A  1 355 ? -23.71536 0.40928    67.94561  1.000 53.79754  ? 335  GLY A C   1 
ATOM   2591  O O   . GLY A  1 355 ? -23.65364 1.43615    67.26867  1.000 54.29376  ? 335  GLY A O   1 
ATOM   2592  N N   . ALA A  1 356 ? -24.62089 -0.53696   67.71273  1.000 53.78722  ? 336  ALA A N   1 
ATOM   2593  C CA  . ALA A  1 356 ? -25.62448 -0.41739   66.66652  1.000 50.02772  ? 336  ALA A CA  1 
ATOM   2594  C C   . ALA A  1 356 ? -26.97056 -0.01764   67.26058  1.000 54.90361  ? 336  ALA A C   1 
ATOM   2595  O O   . ALA A  1 356 ? -27.33821 -0.45373   68.36024  1.000 49.18293  ? 336  ALA A O   1 
ATOM   2596  C CB  . ALA A  1 356 ? -25.76607 -1.73166   65.90182  1.000 48.61961  ? 336  ALA A CB  1 
ATOM   2597  N N   . ALA A  1 357 ? -27.70859 0.80953    66.52510  1.000 50.56851  ? 337  ALA A N   1 
ATOM   2598  C CA  . ALA A  1 357 ? -29.03068 1.25128    66.94708  1.000 55.40187  ? 337  ALA A CA  1 
ATOM   2599  C C   . ALA A  1 357 ? -30.09070 0.40118    66.26118  1.000 49.59758  ? 337  ALA A C   1 
ATOM   2600  O O   . ALA A  1 357 ? -30.17821 0.39113    65.03059  1.000 52.24987  ? 337  ALA A O   1 
ATOM   2601  C CB  . ALA A  1 357 ? -29.23892 2.73465    66.64038  1.000 52.73989  ? 337  ALA A CB  1 
ATOM   2602  N N   . LEU A  1 358 ? -30.88860 -0.30392   67.05867  1.000 48.74651  ? 338  LEU A N   1 
ATOM   2603  C CA  . LEU A  1 358 ? -31.95489 -1.17621   66.56968  1.000 49.64391  ? 338  LEU A CA  1 
ATOM   2604  C C   . LEU A  1 358 ? -33.31036 -0.62004   66.97594  1.000 52.45509  ? 338  LEU A C   1 
ATOM   2605  O O   . LEU A  1 358 ? -33.55006 -0.37910   68.16400  1.000 55.78332  ? 338  LEU A O   1 
ATOM   2606  C CB  . LEU A  1 358 ? -31.82361 -2.59882   67.12284  1.000 48.83740  ? 338  LEU A CB  1 
ATOM   2607  C CG  . LEU A  1 358 ? -30.47827 -3.32012   67.08038  1.000 53.00279  ? 338  LEU A CG  1 
ATOM   2608  C CD1 . LEU A  1 358 ? -30.63828 -4.77874   67.52502  1.000 48.80014  ? 338  LEU A CD1 1 
ATOM   2609  C CD2 . LEU A  1 358 ? -29.87330 -3.22789   65.68441  1.000 44.75323  ? 338  LEU A CD2 1 
ATOM   2610  N N   . ASN A  1 359 ? -34.20527 -0.44955   66.00241  1.000 50.77868  ? 339  ASN A N   1 
ATOM   2611  C CA  . ASN A  1 359 ? -35.56111 -0.00873   66.30307  1.000 52.30677  ? 339  ASN A CA  1 
ATOM   2612  C C   . ASN A  1 359 ? -36.57956 -0.79696   65.48956  1.000 48.60766  ? 339  ASN A C   1 
ATOM   2613  O O   . ASN A  1 359 ? -36.43305 -0.93624   64.27247  1.000 48.05173  ? 339  ASN A O   1 
ATOM   2614  C CB  . ASN A  1 359 ? -35.72264 1.49414    66.04503  1.000 56.64792  ? 339  ASN A CB  1 
ATOM   2615  C CG  . ASN A  1 359 ? -37.03989 2.01313    66.55916  1.000 63.61652  ? 339  ASN A CG  1 
ATOM   2616  O OD1 . ASN A  1 359 ? -37.37226 1.82993    67.72808  1.000 65.98363  ? 339  ASN A OD1 1 
ATOM   2617  N ND2 . ASN A  1 359 ? -37.80985 2.64478    65.68828  1.000 67.56872  ? 339  ASN A ND2 1 
ATOM   2618  N N   . ARG A  1 360 ? -37.60897 -1.29228   66.16743  1.000 46.32100  ? 340  ARG A N   1 
ATOM   2619  C CA  . ARG A  1 360 ? -38.67441 -2.11172   65.58013  1.000 50.84070  ? 340  ARG A CA  1 
ATOM   2620  C C   . ARG A  1 360 ? -38.11834 -3.12391   64.57931  1.000 50.87849  ? 340  ARG A C   1 
ATOM   2621  O O   . ARG A  1 360 ? -38.53741 -3.21659   63.42380  1.000 47.99936  ? 340  ARG A O   1 
ATOM   2622  C CB  . ARG A  1 360 ? -39.77144 -1.24559   64.96895  1.000 50.64194  ? 340  ARG A CB  1 
ATOM   2623  C CG  . ARG A  1 360 ? -40.25424 -0.20614   65.96142  1.000 63.95604  ? 340  ARG A CG  1 
ATOM   2624  C CD  . ARG A  1 360 ? -41.78489 -0.16472   66.18113  1.000 71.19618  ? 340  ARG A CD  1 
ATOM   2625  N NE  . ARG A  1 360 ? -42.44607 -1.46666   66.25615  1.000 69.02062  ? 340  ARG A NE  1 
ATOM   2626  C CZ  . ARG A  1 360 ? -43.70830 -1.62116   66.65593  1.000 63.12587  ? 340  ARG A CZ  1 
ATOM   2627  N NH1 . ARG A  1 360 ? -44.41849 -0.55231   67.02431  1.000 56.07390  ? 340  ARG A NH1 1 
ATOM   2628  N NH2 . ARG A  1 360 ? -44.25345 -2.83565   66.69467  1.000 55.23139  ? 340  ARG A NH2 1 
ATOM   2629  N N   . SER A  1 361 ? -37.16139 -3.90572   65.07031  1.000 50.89116  ? 341  SER A N   1 
ATOM   2630  C CA  . SER A  1 361 ? -36.50144 -4.93346   64.28132  1.000 47.33631  ? 341  SER A CA  1 
ATOM   2631  C C   . SER A  1 361 ? -36.55480 -6.25901   65.03027  1.000 48.60994  ? 341  SER A C   1 
ATOM   2632  O O   . SER A  1 361 ? -36.64596 -6.30272   66.26216  1.000 44.86659  ? 341  SER A O   1 
ATOM   2633  C CB  . SER A  1 361 ? -35.04361 -4.54752   63.96060  1.000 45.00735  ? 341  SER A CB  1 
ATOM   2634  O OG  . SER A  1 361 ? -34.97464 -3.26350   63.34804  1.000 49.65618  ? 341  SER A OG  1 
ATOM   2635  N N   . LEU A  1 362 ? -36.50612 -7.34846   64.26238  1.000 47.64064  ? 342  LEU A N   1 
ATOM   2636  C CA  . LEU A  1 362 ? -36.46801 -8.69726   64.80649  1.000 38.93811  ? 342  LEU A CA  1 
ATOM   2637  C C   . LEU A  1 362 ? -35.18464 -9.37274   64.32599  1.000 44.41284  ? 342  LEU A C   1 
ATOM   2638  O O   . LEU A  1 362 ? -34.98531 -9.54649   63.11784  1.000 42.11929  ? 342  LEU A O   1 
ATOM   2639  C CB  . LEU A  1 362 ? -37.71508 -9.48546   64.38713  1.000 38.53731  ? 342  LEU A CB  1 
ATOM   2640  C CG  . LEU A  1 362 ? -37.87166 -10.90121  64.97470  1.000 40.89385  ? 342  LEU A CG  1 
ATOM   2641  C CD1 . LEU A  1 362 ? -39.32974 -11.27573  65.12775  1.000 48.02764  ? 342  LEU A CD1 1 
ATOM   2642  C CD2 . LEU A  1 362 ? -37.19414 -11.92367  64.10888  1.000 39.36873  ? 342  LEU A CD2 1 
ATOM   2643  N N   . LEU A  1 363 ? -34.31702 -9.74669   65.26681  1.000 40.54193  ? 343  LEU A N   1 
ATOM   2644  C CA  . LEU A  1 363 ? -33.04132 -10.38842  64.96355  1.000 38.28272  ? 343  LEU A CA  1 
ATOM   2645  C C   . LEU A  1 363 ? -33.11685 -11.85252  65.36692  1.000 40.65741  ? 343  LEU A C   1 
ATOM   2646  O O   . LEU A  1 363 ? -33.31556 -12.16049  66.54910  1.000 40.72780  ? 343  LEU A O   1 
ATOM   2647  C CB  . LEU A  1 363 ? -31.89438 -9.72220   65.70946  1.000 38.61782  ? 343  LEU A CB  1 
ATOM   2648  C CG  . LEU A  1 363 ? -31.22902 -8.54471   65.01317  1.000 42.94840  ? 343  LEU A CG  1 
ATOM   2649  C CD1 . LEU A  1 363 ? -32.21359 -7.39466   64.85943  1.000 40.87120  ? 343  LEU A CD1 1 
ATOM   2650  C CD2 . LEU A  1 363 ? -30.05842 -8.13050   65.84915  1.000 43.08866  ? 343  LEU A CD2 1 
ATOM   2651  N N   . PHE A  1 364 ? -32.94476 -12.74324  64.39165  1.000 43.31379  ? 344  PHE A N   1 
ATOM   2652  C CA  . PHE A  1 364 ? -32.77797 -14.16054  64.66447  1.000 43.66998  ? 344  PHE A CA  1 
ATOM   2653  C C   . PHE A  1 364 ? -31.41825 -14.40034  65.32184  1.000 45.02627  ? 344  PHE A C   1 
ATOM   2654  O O   . PHE A  1 364 ? -30.65098 -13.47324  65.58745  1.000 49.06819  ? 344  PHE A O   1 
ATOM   2655  C CB  . PHE A  1 364 ? -32.90661 -14.96657  63.37207  1.000 42.55868  ? 344  PHE A CB  1 
ATOM   2656  C CG  . PHE A  1 364 ? -34.31359 -15.05426  62.83030  1.000 44.01398  ? 344  PHE A CG  1 
ATOM   2657  C CD1 . PHE A  1 364 ? -34.90909 -13.96753  62.20620  1.000 43.87889  ? 344  PHE A CD1 1 
ATOM   2658  C CD2 . PHE A  1 364 ? -35.03177 -16.24789  62.91137  1.000 44.71188  ? 344  PHE A CD2 1 
ATOM   2659  C CE1 . PHE A  1 364 ? -36.20100 -14.05354  61.68703  1.000 44.75220  ? 344  PHE A CE1 1 
ATOM   2660  C CE2 . PHE A  1 364 ? -36.32397 -16.34121  62.40347  1.000 43.79307  ? 344  PHE A CE2 1 
ATOM   2661  C CZ  . PHE A  1 364 ? -36.90895 -15.23614  61.78902  1.000 46.08812  ? 344  PHE A CZ  1 
ATOM   2662  N N   . THR A  1 365 ? -31.09726 -15.67003  65.54796  1.000 43.56071  ? 345  THR A N   1 
ATOM   2663  C CA  . THR A  1 365 ? -29.89596 -16.03561  66.29155  1.000 45.23735  ? 345  THR A CA  1 
ATOM   2664  C C   . THR A  1 365 ? -28.61978 -15.67473  65.53106  1.000 42.21810  ? 345  THR A C   1 
ATOM   2665  O O   . THR A  1 365 ? -28.52535 -15.84278  64.31031  1.000 37.61410  ? 345  THR A O   1 
ATOM   2666  C CB  . THR A  1 365 ? -29.91328 -17.54788  66.59745  1.000 51.70759  ? 345  THR A CB  1 
ATOM   2667  O OG1 . THR A  1 365 ? -30.98975 -17.84230  67.49053  1.000 60.03166  ? 345  THR A OG1 1 
ATOM   2668  C CG2 . THR A  1 365 ? -28.64605 -17.98681  67.27679  1.000 48.93072  ? 345  THR A CG2 1 
ATOM   2669  N N   . GLY A  1 366 ? -27.61751 -15.20082  66.26471  1.000 44.10368  ? 346  GLY A N   1 
ATOM   2670  C CA  . GLY A  1 366 ? -26.28130 -15.12749  65.70988  1.000 42.70409  ? 346  GLY A CA  1 
ATOM   2671  C C   . GLY A  1 366 ? -25.93164 -13.85411  64.96659  1.000 44.46525  ? 346  GLY A C   1 
ATOM   2672  O O   . GLY A  1 366 ? -24.90966 -13.82757  64.27449  1.000 47.19665  ? 346  GLY A O   1 
ATOM   2673  N N   . VAL A  1 367 ? -26.73677 -12.80810  65.07434  1.000 40.58772  ? 347  VAL A N   1 
ATOM   2674  C CA  . VAL A  1 367 ? -26.47481 -11.57516  64.34093  1.000 41.09914  ? 347  VAL A CA  1 
ATOM   2675  C C   . VAL A  1 367 ? -25.34619 -10.79529  65.01053  1.000 48.15085  ? 347  VAL A C   1 
ATOM   2676  O O   . VAL A  1 367 ? -25.23510 -10.75969  66.24631  1.000 53.59650  ? 347  VAL A O   1 
ATOM   2677  C CB  . VAL A  1 367 ? -27.75983 -10.73540  64.25554  1.000 41.19253  ? 347  VAL A CB  1 
ATOM   2678  C CG1 . VAL A  1 367 ? -27.46246 -9.32436   63.71856  1.000 41.07448  ? 347  VAL A CG1 1 
ATOM   2679  C CG2 . VAL A  1 367 ? -28.80218 -11.44533  63.40415  1.000 39.10435  ? 347  VAL A CG2 1 
ATOM   2680  N N   . ARG A  1 368 ? -24.51079 -10.15111  64.19164  1.000 47.62339  ? 348  ARG A N   1 
ATOM   2681  C CA  . ARG A  1 368 ? -23.50069 -9.19747   64.64943  1.000 50.55797  ? 348  ARG A CA  1 
ATOM   2682  C C   . ARG A  1 368 ? -23.73194 -7.86325   63.95098  1.000 51.37690  ? 348  ARG A C   1 
ATOM   2683  O O   . ARG A  1 368 ? -23.59731 -7.77319   62.72524  1.000 53.87121  ? 348  ARG A O   1 
ATOM   2684  C CB  . ARG A  1 368 ? -22.07922 -9.70469   64.36854  1.000 51.02034  ? 348  ARG A CB  1 
ATOM   2685  C CG  . ARG A  1 368 ? -21.75870 -11.08048  64.98930  1.000 57.74491  ? 348  ARG A CG  1 
ATOM   2686  C CD  . ARG A  1 368 ? -21.14110 -10.98815  66.39422  1.000 58.67470  ? 348  ARG A CD  1 
ATOM   2687  N NE  . ARG A  1 368 ? -20.72702 -12.29695  66.91584  1.000 61.48121  ? 348  ARG A NE  1 
ATOM   2688  C CZ  . ARG A  1 368 ? -21.55602 -13.17132  67.48650  1.000 59.07496  ? 348  ARG A CZ  1 
ATOM   2689  N NH1 . ARG A  1 368 ? -21.10556 -14.33905  67.93864  1.000 57.06196  ? 348  ARG A NH1 1 
ATOM   2690  N NH2 . ARG A  1 368 ? -22.84460 -12.87920  67.59083  1.000 56.58060  ? 348  ARG A NH2 1 
ATOM   2691  N N   . ALA A  1 369 ? -24.07460 -6.83283   64.72250  1.000 47.11768  ? 349  ALA A N   1 
ATOM   2692  C CA  . ALA A  1 369 ? -24.23207 -5.47761   64.20037  1.000 48.06637  ? 349  ALA A CA  1 
ATOM   2693  C C   . ALA A  1 369 ? -23.18392 -4.57484   64.84320  1.000 49.89234  ? 349  ALA A C   1 
ATOM   2694  O O   . ALA A  1 369 ? -23.11172 -4.48288   66.07367  1.000 47.16261  ? 349  ALA A O   1 
ATOM   2695  C CB  . ALA A  1 369 ? -25.64601 -4.95220   64.45046  1.000 45.15422  ? 349  ALA A CB  1 
ATOM   2696  N N   . ASN A  1 370 ? -22.38174 -3.89986   64.01070  1.000 55.64971  ? 350  ASN A N   1 
ATOM   2697  C CA  . ASN A  1 370 ? -21.18727 -3.19211   64.46310  1.000 58.14722  ? 350  ASN A CA  1 
ATOM   2698  C C   . ASN A  1 370 ? -21.41618 -1.68219   64.56636  1.000 56.23513  ? 350  ASN A C   1 
ATOM   2699  O O   . ASN A  1 370 ? -22.47207 -1.15439   64.21084  1.000 55.65897  ? 350  ASN A O   1 
ATOM   2700  C CB  . ASN A  1 370 ? -20.00485 -3.50275   63.54427  1.000 59.19524  ? 350  ASN A CB  1 
ATOM   2701  C CG  . ASN A  1 370 ? -19.69740 -4.98289   63.48594  1.000 57.50847  ? 350  ASN A CG  1 
ATOM   2702  O OD1 . ASN A  1 370 ? -19.67163 -5.57520   62.40808  1.000 61.56074  ? 350  ASN A OD1 1 
ATOM   2703  N ND2 . ASN A  1 370 ? -19.47855 -5.59556   64.65117  1.000 52.27936  ? 350  ASN A ND2 1 
ATOM   2704  N N   . SER A  1 371 ? -20.38917 -0.98493   65.06181  1.000 55.01613  ? 351  SER A N   1 
ATOM   2705  C CA  . SER A  1 371 ? -20.54989 0.38574    65.53630  1.000 57.48628  ? 351  SER A CA  1 
ATOM   2706  C C   . SER A  1 371 ? -21.04466 1.31452    64.43565  1.000 58.75034  ? 351  SER A C   1 
ATOM   2707  O O   . SER A  1 371 ? -20.62819 1.21086    63.28029  1.000 58.45879  ? 351  SER A O   1 
ATOM   2708  C CB  . SER A  1 371 ? -19.22772 0.90613    66.10751  1.000 60.33124  ? 351  SER A CB  1 
ATOM   2709  O OG  . SER A  1 371 ? -18.89701 0.24446    67.32472  1.000 58.35253  ? 351  SER A OG  1 
ATOM   2710  N N   . TYR A  1 372 ? -21.95838 2.21512    64.81102  1.000 59.56735  ? 352  TYR A N   1 
ATOM   2711  C CA  . TYR A  1 372 ? -22.57866 3.23296    63.96161  1.000 62.24996  ? 352  TYR A CA  1 
ATOM   2712  C C   . TYR A  1 372 ? -23.54779 2.66329    62.93263  1.000 61.11068  ? 352  TYR A C   1 
ATOM   2713  O O   . TYR A  1 372 ? -24.06018 3.42245    62.08645  1.000 62.41508  ? 352  TYR A O   1 
ATOM   2714  C CB  . TYR A  1 372 ? -21.52933 4.10599    63.25715  1.000 65.92814  ? 352  TYR A CB  1 
ATOM   2715  C CG  . TYR A  1 372 ? -20.41144 4.51723    64.19057  1.000 69.10037  ? 352  TYR A CG  1 
ATOM   2716  C CD1 . TYR A  1 372 ? -20.65566 5.38762    65.24781  1.000 62.25128  ? 352  TYR A CD1 1 
ATOM   2717  C CD2 . TYR A  1 372 ? -19.11745 4.01624    64.03014  1.000 67.40326  ? 352  TYR A CD2 1 
ATOM   2718  C CE1 . TYR A  1 372 ? -19.64212 5.75675    66.12253  1.000 68.90104  ? 352  TYR A CE1 1 
ATOM   2719  C CE2 . TYR A  1 372 ? -18.09308 4.38116    64.90354  1.000 66.80786  ? 352  TYR A CE2 1 
ATOM   2720  C CZ  . TYR A  1 372 ? -18.36167 5.25543    65.94610  1.000 66.96356  ? 352  TYR A CZ  1 
ATOM   2721  O OH  . TYR A  1 372 ? -17.36093 5.63176    66.81634  1.000 66.50849  ? 352  TYR A OH  1 
ATOM   2722  N N   . SER A  1 373 ? -23.82158 1.35968    62.96296  1.000 53.85226  ? 353  SER A N   1 
ATOM   2723  C CA  . SER A  1 373 ? -24.86190 0.84785    62.09290  1.000 54.88863  ? 353  SER A CA  1 
ATOM   2724  C C   . SER A  1 373 ? -26.22721 1.06802    62.74218  1.000 60.48690  ? 353  SER A C   1 
ATOM   2725  O O   . SER A  1 373 ? -26.35589 1.17025    63.97132  1.000 51.82492  ? 353  SER A O   1 
ATOM   2726  C CB  . SER A  1 373 ? -24.64472 -0.63489   61.75638  1.000 57.56678  ? 353  SER A CB  1 
ATOM   2727  O OG  . SER A  1 373 ? -24.72188 -1.47982   62.89541  1.000 57.74663  ? 353  SER A OG  1 
ATOM   2728  N N   . ARG A  1 374 ? -27.24915 1.17715    61.89319  1.000 58.83413  ? 354  ARG A N   1 
ATOM   2729  C CA  . ARG A  1 374 ? -28.61576 1.40883    62.33144  1.000 56.30666  ? 354  ARG A CA  1 
ATOM   2730  C C   . ARG A  1 374 ? -29.53923 0.49427    61.54513  1.000 55.59846  ? 354  ARG A C   1 
ATOM   2731  O O   . ARG A  1 374 ? -29.35829 0.29831    60.33908  1.000 57.05579  ? 354  ARG A O   1 
ATOM   2732  C CB  . ARG A  1 374 ? -29.02411 2.88019    62.14975  1.000 61.01591  ? 354  ARG A CB  1 
ATOM   2733  C CG  . ARG A  1 374 ? -28.15440 3.85909    62.92389  1.000 64.79565  ? 354  ARG A CG  1 
ATOM   2734  C CD  . ARG A  1 374 ? -28.44916 5.29858    62.54200  1.000 72.54365  ? 354  ARG A CD  1 
ATOM   2735  N NE  . ARG A  1 374 ? -29.79476 5.69146    62.95401  1.000 80.75685  ? 354  ARG A NE  1 
ATOM   2736  C CZ  . ARG A  1 374 ? -30.13018 6.07134    64.18643  1.000 88.70134  ? 354  ARG A CZ  1 
ATOM   2737  N NH1 . ARG A  1 374 ? -29.21796 6.10819    65.15254  1.000 92.55999  ? 354  ARG A NH1 1 
ATOM   2738  N NH2 . ARG A  1 374 ? -31.38515 6.41256    64.45754  1.000 89.79782  ? 354  ARG A NH2 1 
ATOM   2739  N N   . LEU A  1 375 ? -30.49561 -0.10406   62.24815  1.000 54.74895  ? 355  LEU A N   1 
ATOM   2740  C CA  . LEU A  1 375 ? -31.51293 -0.94719   61.64527  1.000 50.26774  ? 355  LEU A CA  1 
ATOM   2741  C C   . LEU A  1 375 ? -32.87261 -0.46625   62.10734  1.000 52.14363  ? 355  LEU A C   1 
ATOM   2742  O O   . LEU A  1 375 ? -33.06689 -0.17210   63.28935  1.000 50.15426  ? 355  LEU A O   1 
ATOM   2743  C CB  . LEU A  1 375 ? -31.34760 -2.41069   62.02119  1.000 48.71085  ? 355  LEU A CB  1 
ATOM   2744  C CG  . LEU A  1 375 ? -30.13517 -3.12777   61.43480  1.000 58.91163  ? 355  LEU A CG  1 
ATOM   2745  C CD1 . LEU A  1 375 ? -29.92484 -4.45040   62.16331  1.000 60.40032  ? 355  LEU A CD1 1 
ATOM   2746  C CD2 . LEU A  1 375 ? -30.27214 -3.35710   59.92933  1.000 62.63171  ? 355  LEU A CD2 1 
ATOM   2747  N N   . GLU A  1 376 ? -33.81215 -0.38750   61.17729  1.000 53.97795  ? 356  GLU A N   1 
ATOM   2748  C CA  . GLU A  1 376 ? -35.17158 -0.03201   61.53569  1.000 56.56004  ? 356  GLU A CA  1 
ATOM   2749  C C   . GLU A  1 376 ? -36.12265 -0.80727   60.64189  1.000 50.56983  ? 356  GLU A C   1 
ATOM   2750  O O   . GLU A  1 376 ? -35.87961 -0.93670   59.44047  1.000 49.07166  ? 356  GLU A O   1 
ATOM   2751  C CB  . GLU A  1 376 ? -35.40752 1.48084    61.41541  1.000 65.10224  ? 356  GLU A CB  1 
ATOM   2752  C CG  . GLU A  1 376 ? -36.70960 1.93358    62.06578  1.000 71.07400  ? 356  GLU A CG  1 
ATOM   2753  C CD  . GLU A  1 376 ? -36.98925 3.39504    61.83781  1.000 79.26630  ? 356  GLU A CD  1 
ATOM   2754  O OE1 . GLU A  1 376 ? -38.15797 3.73991    61.56106  1.000 83.68206  ? 356  GLU A OE1 1 
ATOM   2755  O OE2 . GLU A  1 376 ? -36.04169 4.20045    61.94405  1.000 81.06832  ? 356  GLU A OE2 1 
ATOM   2756  N N   . ASN A  1 377 ? -37.18554 -1.34523   61.23900  1.000 46.34663  ? 357  ASN A N   1 
ATOM   2757  C CA  . ASN A  1 377 ? -38.14373 -2.17037   60.50196  1.000 52.20725  ? 357  ASN A CA  1 
ATOM   2758  C C   . ASN A  1 377 ? -37.44033 -3.30520   59.75331  1.000 48.09925  ? 357  ASN A C   1 
ATOM   2759  O O   . ASN A  1 377 ? -37.73631 -3.58444   58.59005  1.000 47.41078  ? 357  ASN A O   1 
ATOM   2760  C CB  . ASN A  1 377 ? -38.95933 -1.30507   59.53853  1.000 46.93296  ? 357  ASN A CB  1 
ATOM   2761  C CG  . ASN A  1 377 ? -39.95048 -0.41692   60.25677  1.000 53.94245  ? 357  ASN A CG  1 
ATOM   2762  O OD1 . ASN A  1 377 ? -40.08808 -0.48159   61.47797  1.000 56.08840  ? 357  ASN A OD1 1 
ATOM   2763  N ND2 . ASN A  1 377 ? -40.65205 0.41162    59.50407  1.000 52.90859  ? 357  ASN A ND2 1 
ATOM   2764  N N   . ALA A  1 378 ? -36.48671 -3.95385   60.42057  1.000 45.56497  ? 358  ALA A N   1 
ATOM   2765  C CA  . ALA A  1 378 ? -35.61365 -4.94212   59.79276  1.000 45.78339  ? 358  ALA A CA  1 
ATOM   2766  C C   . ALA A  1 378 ? -35.89838 -6.33299   60.35952  1.000 45.69704  ? 358  ALA A C   1 
ATOM   2767  O O   . ALA A  1 378 ? -35.83882 -6.53551   61.57563  1.000 42.50040  ? 358  ALA A O   1 
ATOM   2768  C CB  . ALA A  1 378 ? -34.14254 -4.57349   59.99284  1.000 43.25359  ? 358  ALA A CB  1 
ATOM   2769  N N   . VAL A  1 379 ? -36.21079 -7.27815   59.47515  1.000 46.37609  ? 359  VAL A N   1 
ATOM   2770  C CA  . VAL A  1 379 ? -36.31593 -8.69755   59.80722  1.000 43.31178  ? 359  VAL A CA  1 
ATOM   2771  C C   . VAL A  1 379 ? -35.01119 -9.35013   59.37200  1.000 45.26514  ? 359  VAL A C   1 
ATOM   2772  O O   . VAL A  1 379 ? -34.72248 -9.43693   58.17261  1.000 44.47522  ? 359  VAL A O   1 
ATOM   2773  C CB  . VAL A  1 379 ? -37.52681 -9.33958   59.12522  1.000 42.15580  ? 359  VAL A CB  1 
ATOM   2774  C CG1 . VAL A  1 379 ? -37.49997 -10.87460  59.28651  1.000 38.82169  ? 359  VAL A CG1 1 
ATOM   2775  C CG2 . VAL A  1 379 ? -38.81216 -8.71410   59.68529  1.000 40.06297  ? 359  VAL A CG2 1 
ATOM   2776  N N   . VAL A  1 380 ? -34.19957 -9.76536   60.34193  1.000 39.21706  ? 360  VAL A N   1 
ATOM   2777  C CA  . VAL A  1 380 ? -32.79727 -10.12028  60.11289  1.000 44.16571  ? 360  VAL A CA  1 
ATOM   2778  C C   . VAL A  1 380 ? -32.60172 -11.57976  60.47636  1.000 47.25369  ? 360  VAL A C   1 
ATOM   2779  O O   . VAL A  1 380 ? -32.63206 -11.93795  61.66587  1.000 42.72205  ? 360  VAL A O   1 
ATOM   2780  C CB  . VAL A  1 380 ? -31.84037 -9.24587   60.92600  1.000 48.00183  ? 360  VAL A CB  1 
ATOM   2781  C CG1 . VAL A  1 380 ? -30.42568 -9.44776   60.42785  1.000 51.44988  ? 360  VAL A CG1 1 
ATOM   2782  C CG2 . VAL A  1 380 ? -32.24997 -7.79816   60.83315  1.000 40.71886  ? 360  VAL A CG2 1 
ATOM   2783  N N   . LEU A  1 381 ? -32.34714 -12.40591  59.46039  1.000 38.67878  ? 361  LEU A N   1 
ATOM   2784  C CA  . LEU A  1 381 ? -32.29646 -13.84627  59.60516  1.000 40.60047  ? 361  LEU A CA  1 
ATOM   2785  C C   . LEU A  1 381 ? -30.97228 -14.27196  60.23932  1.000 45.94389  ? 361  LEU A C   1 
ATOM   2786  O O   . LEU A  1 381 ? -30.05568 -13.46074  60.39991  1.000 38.74013  ? 361  LEU A O   1 
ATOM   2787  C CB  . LEU A  1 381 ? -32.54149 -14.48576  58.23870  1.000 41.70475  ? 361  LEU A CB  1 
ATOM   2788  C CG  . LEU A  1 381 ? -34.01654 -14.82269  57.98904  1.000 39.93349  ? 361  LEU A CG  1 
ATOM   2789  C CD1 . LEU A  1 381 ? -34.94410 -13.66515  58.31208  1.000 42.75459  ? 361  LEU A CD1 1 
ATOM   2790  C CD2 . LEU A  1 381 ? -34.19987 -15.21436  56.55651  1.000 38.92286  ? 361  LEU A CD2 1 
ATOM   2791  N N   . PRO A  1 382 ? -30.85109 -15.54313  60.65886  1.000 44.82037  ? 362  PRO A N   1 
ATOM   2792  C CA  . PRO A  1 382 ? -29.69611 -15.92958  61.48754  1.000 42.74176  ? 362  PRO A CA  1 
ATOM   2793  C C   . PRO A  1 382 ? -28.35255 -15.68040  60.81432  1.000 43.21949  ? 362  PRO A C   1 
ATOM   2794  O O   . PRO A  1 382 ? -28.20086 -15.81062  59.59853  1.000 43.17905  ? 362  PRO A O   1 
ATOM   2795  C CB  . PRO A  1 382 ? -29.91516 -17.43169  61.73569  1.000 40.76078  ? 362  PRO A CB  1 
ATOM   2796  C CG  . PRO A  1 382 ? -31.38333 -17.61495  61.61772  1.000 42.15802  ? 362  PRO A CG  1 
ATOM   2797  C CD  . PRO A  1 382 ? -31.83848 -16.63887  60.55841  1.000 42.67844  ? 362  PRO A CD  1 
ATOM   2798  N N   . SER A  1 383 ? -27.37291 -15.31059  61.64065  1.000 45.07592  ? 363  SER A N   1 
ATOM   2799  C CA  . SER A  1 383 ? -25.96001 -15.25473  61.27645  1.000 46.75476  ? 363  SER A CA  1 
ATOM   2800  C C   . SER A  1 383 ? -25.61298 -14.07991  60.37817  1.000 47.66303  ? 363  SER A C   1 
ATOM   2801  O O   . SER A  1 383 ? -24.58006 -14.11002  59.69701  1.000 51.24393  ? 363  SER A O   1 
ATOM   2802  C CB  . SER A  1 383 ? -25.50056 -16.55923  60.61283  1.000 46.07666  ? 363  SER A CB  1 
ATOM   2803  O OG  . SER A  1 383 ? -25.57907 -17.61059  61.54903  1.000 47.46256  ? 363  SER A OG  1 
ATOM   2804  N N   . VAL A  1 384 ? -26.43818 -13.05132  60.36092  1.000 42.76682  ? 364  VAL A N   1 
ATOM   2805  C CA  . VAL A  1 384 ? -26.18350 -11.88317  59.52913  1.000 46.85829  ? 364  VAL A CA  1 
ATOM   2806  C C   . VAL A  1 384 ? -25.10315 -11.02281  60.18117  1.000 49.92385  ? 364  VAL A C   1 
ATOM   2807  O O   . VAL A  1 384 ? -24.97497 -10.97663  61.40862  1.000 51.52779  ? 364  VAL A O   1 
ATOM   2808  C CB  . VAL A  1 384 ? -27.50524 -11.11607  59.30369  1.000 45.01244  ? 364  VAL A CB  1 
ATOM   2809  C CG1 . VAL A  1 384 ? -27.26849 -9.66890   58.89236  1.000 42.37160  ? 364  VAL A CG1 1 
ATOM   2810  C CG2 . VAL A  1 384 ? -28.33796 -11.83163  58.25006  1.000 44.59889  ? 364  VAL A CG2 1 
ATOM   2811  N N   . LYS A  1 385 ? -24.28194 -10.36512  59.36399  1.000 47.51323  ? 365  LYS A N   1 
ATOM   2812  C CA  . LYS A  1 385 ? -23.29955 -9.42379   59.87295  1.000 50.17794  ? 365  LYS A CA  1 
ATOM   2813  C C   . LYS A  1 385 ? -23.59560 -8.06114   59.26156  1.000 51.71262  ? 365  LYS A C   1 
ATOM   2814  O O   . LYS A  1 385 ? -23.80165 -7.95948   58.05008  1.000 55.01199  ? 365  LYS A O   1 
ATOM   2815  C CB  . LYS A  1 385 ? -21.87006 -9.88704   59.57505  1.000 57.57262  ? 365  LYS A CB  1 
ATOM   2816  C CG  . LYS A  1 385 ? -20.84800 -8.74987   59.64421  1.000 68.58851  ? 365  LYS A CG  1 
ATOM   2817  C CD  . LYS A  1 385 ? -19.54598 -9.06140   58.90992  1.000 74.36430  ? 365  LYS A CD  1 
ATOM   2818  C CE  . LYS A  1 385 ? -18.54414 -9.71486   59.85494  1.000 75.22006  ? 365  LYS A CE  1 
ATOM   2819  N NZ  . LYS A  1 385 ? -17.14302 -9.57606   59.37265  1.000 75.46873  ? 365  LYS A NZ  1 
ATOM   2820  N N   . ILE A  1 386 ? -23.67762 -7.03028   60.10887  1.000 51.13598  ? 366  ILE A N   1 
ATOM   2821  C CA  . ILE A  1 386 ? -23.98148 -5.66138   59.69698  1.000 52.25174  ? 366  ILE A CA  1 
ATOM   2822  C C   . ILE A  1 386 ? -22.71439 -4.84929   59.90050  1.000 55.97650  ? 366  ILE A C   1 
ATOM   2823  O O   . ILE A  1 386 ? -22.33852 -4.56034   61.04431  1.000 52.52157  ? 366  ILE A O   1 
ATOM   2824  C CB  . ILE A  1 386 ? -25.14486 -5.04726   60.49097  1.000 47.14768  ? 366  ILE A CB  1 
ATOM   2825  C CG1 . ILE A  1 386 ? -26.28749 -6.05371   60.66584  1.000 44.71392  ? 366  ILE A CG1 1 
ATOM   2826  C CG2 . ILE A  1 386 ? -25.61349 -3.73520   59.83496  1.000 47.50401  ? 366  ILE A CG2 1 
ATOM   2827  C CD1 . ILE A  1 386 ? -27.25460 -6.10900   59.50737  1.000 44.51047  ? 366  ILE A CD1 1 
ATOM   2828  N N   . GLY A  1 387 ? -22.05254 -4.48626   58.80060  1.000 54.11487  ? 367  GLY A N   1 
ATOM   2829  C CA  . GLY A  1 387 ? -20.83470 -3.70940   58.90285  1.000 55.92651  ? 367  GLY A CA  1 
ATOM   2830  C C   . GLY A  1 387 ? -21.06991 -2.32972   59.48522  1.000 56.17238  ? 367  GLY A C   1 
ATOM   2831  O O   . GLY A  1 387 ? -22.18713 -1.81920   59.54004  1.000 57.12024  ? 367  GLY A O   1 
ATOM   2832  N N   . ARG A  1 388 ? -19.97833 -1.71383   59.92197  1.000 58.45192  ? 368  ARG A N   1 
ATOM   2833  C CA  . ARG A  1 388 ? -20.05817 -0.39042   60.51975  1.000 59.42419  ? 368  ARG A CA  1 
ATOM   2834  C C   . ARG A  1 388 ? -20.73909 0.59492    59.57639  1.000 59.61950  ? 368  ARG A C   1 
ATOM   2835  O O   . ARG A  1 388 ? -20.70286 0.44573    58.35223  1.000 60.60437  ? 368  ARG A O   1 
ATOM   2836  C CB  . ARG A  1 388 ? -18.66289 0.11273    60.86839  1.000 60.60168  ? 368  ARG A CB  1 
ATOM   2837  C CG  . ARG A  1 388 ? -17.98748 -0.61314   62.00828  1.000 58.98350  ? 368  ARG A CG  1 
ATOM   2838  C CD  . ARG A  1 388 ? -16.68338 0.08861    62.32935  1.000 64.99687  ? 368  ARG A CD  1 
ATOM   2839  N NE  . ARG A  1 388 ? -16.23394 -0.12677   63.69894  1.000 63.90574  ? 368  ARG A NE  1 
ATOM   2840  C CZ  . ARG A  1 388 ? -15.61796 0.79449    64.42934  1.000 66.56050  ? 368  ARG A CZ  1 
ATOM   2841  N NH1 . ARG A  1 388 ? -15.38815 2.00639    63.92935  1.000 66.77849  ? 368  ARG A NH1 1 
ATOM   2842  N NH2 . ARG A  1 388 ? -15.23636 0.50384    65.66369  1.000 68.70493  ? 368  ARG A NH2 1 
ATOM   2843  N N   . HIS A  1 389 ? -21.38844 1.59722    60.16494  1.000 58.50565  ? 369  HIS A N   1 
ATOM   2844  C CA  . HIS A  1 389 ? -21.95793 2.74490    59.46115  1.000 61.52309  ? 369  HIS A CA  1 
ATOM   2845  C C   . HIS A  1 389 ? -23.03559 2.36517    58.44876  1.000 60.33568  ? 369  HIS A C   1 
ATOM   2846  O O   . HIS A  1 389 ? -23.52117 3.23530    57.71681  1.000 67.10359  ? 369  HIS A O   1 
ATOM   2847  C CB  . HIS A  1 389 ? -20.86397 3.57386    58.75929  1.000 61.30232  ? 369  HIS A CB  1 
ATOM   2848  C CG  . HIS A  1 389 ? -19.83546 4.13413    59.69266  1.000 63.66740  ? 369  HIS A CG  1 
ATOM   2849  N ND1 . HIS A  1 389 ? -19.99225 5.34308    60.33625  1.000 67.37774  ? 369  HIS A ND1 1 
ATOM   2850  C CD2 . HIS A  1 389 ? -18.63356 3.65195    60.09028  1.000 65.57665  ? 369  HIS A CD2 1 
ATOM   2851  C CE1 . HIS A  1 389 ? -18.93088 5.58421    61.08665  1.000 68.67332  ? 369  HIS A CE1 1 
ATOM   2852  N NE2 . HIS A  1 389 ? -18.09157 4.57266    60.95654  1.000 67.59462  ? 369  HIS A NE2 1 
ATOM   2853  N N   . ALA A  1 390 ? -23.42187 1.09863    58.36786  1.000 55.72627  ? 370  ALA A N   1 
ATOM   2854  C CA  . ALA A  1 390 ? -24.50558 0.73830    57.47107  1.000 54.19937  ? 370  ALA A CA  1 
ATOM   2855  C C   . ALA A  1 390 ? -25.84271 1.14031    58.08297  1.000 54.77430  ? 370  ALA A C   1 
ATOM   2856  O O   . ALA A  1 390 ? -26.02745 1.11525    59.30533  1.000 52.93840  ? 370  ALA A O   1 
ATOM   2857  C CB  . ALA A  1 390 ? -24.48629 -0.75922   57.16891  1.000 52.55172  ? 370  ALA A CB  1 
ATOM   2858  N N   . GLN A  1 391 ? -26.77895 1.53558    57.22136  1.000 54.62174  ? 371  GLN A N   1 
ATOM   2859  C CA  . GLN A  1 391 ? -28.10383 1.96975    57.65357  1.000 55.51160  ? 371  GLN A CA  1 
ATOM   2860  C C   . GLN A  1 391 ? -29.15112 1.32571    56.75696  1.000 58.62156  ? 371  GLN A C   1 
ATOM   2861  O O   . GLN A  1 391 ? -29.13005 1.51090    55.53488  1.000 64.98606  ? 371  GLN A O   1 
ATOM   2862  C CB  . GLN A  1 391 ? -28.21244 3.50296    57.65475  1.000 55.58737  ? 371  GLN A CB  1 
ATOM   2863  C CG  . GLN A  1 391 ? -27.03201 4.15395    58.38010  1.000 59.12200  ? 371  GLN A CG  1 
ATOM   2864  C CD  . GLN A  1 391 ? -27.29943 5.57256    58.81517  1.000 69.16687  ? 371  GLN A CD  1 
ATOM   2865  O OE1 . GLN A  1 391 ? -28.18788 6.23779    58.28100  1.000 71.67834  ? 371  GLN A OE1 1 
ATOM   2866  N NE2 . GLN A  1 391 ? -26.54448 6.04091    59.81469  1.000 73.10537  ? 371  GLN A NE2 1 
ATOM   2867  N N   . LEU A  1 392 ? -30.05310 0.55292    57.35770  1.000 53.92751  ? 372  LEU A N   1 
ATOM   2868  C CA  . LEU A  1 392 ? -30.99551 -0.25352   56.59724  1.000 57.19816  ? 372  LEU A CA  1 
ATOM   2869  C C   . LEU A  1 392 ? -32.38714 -0.09513   57.18067  1.000 56.17050  ? 372  LEU A C   1 
ATOM   2870  O O   . LEU A  1 392 ? -32.56786 -0.18740   58.39709  1.000 61.51315  ? 372  LEU A O   1 
ATOM   2871  C CB  . LEU A  1 392 ? -30.57972 -1.72593   56.58945  1.000 60.93164  ? 372  LEU A CB  1 
ATOM   2872  C CG  . LEU A  1 392 ? -29.20426 -2.06162   56.00193  1.000 66.61867  ? 372  LEU A CG  1 
ATOM   2873  C CD1 . LEU A  1 392 ? -28.10863 -1.97986   57.05920  1.000 67.96537  ? 372  LEU A CD1 1 
ATOM   2874  C CD2 . LEU A  1 392 ? -29.24320 -3.45286   55.39260  1.000 66.06399  ? 372  LEU A CD2 1 
ATOM   2875  N N   . SER A  1 393 ? -33.36762 0.12363    56.31186  1.000 52.59847  ? 373  SER A N   1 
ATOM   2876  C CA  . SER A  1 393 ? -34.72361 0.41892    56.74658  1.000 53.40448  ? 373  SER A CA  1 
ATOM   2877  C C   . SER A  1 393 ? -35.73190 -0.33950   55.89120  1.000 51.95932  ? 373  SER A C   1 
ATOM   2878  O O   . SER A  1 393 ? -35.61730 -0.35887   54.66187  1.000 54.54235  ? 373  SER A O   1 
ATOM   2879  C CB  . SER A  1 393 ? -34.98414 1.92705    56.67647  1.000 57.15435  ? 373  SER A CB  1 
ATOM   2880  O OG  . SER A  1 393 ? -36.36479 2.19473    56.79743  1.000 59.99619  ? 373  SER A OG  1 
ATOM   2881  N N   . ASN A  1 394 ? -36.72782 -0.93071   56.55028  1.000 50.51299  ? 374  ASN A N   1 
ATOM   2882  C CA  . ASN A  1 394 ? -37.73377 -1.81063   55.94195  1.000 55.11498  ? 374  ASN A CA  1 
ATOM   2883  C C   . ASN A  1 394 ? -37.09396 -2.85509   55.01293  1.000 57.87218  ? 374  ASN A C   1 
ATOM   2884  O O   . ASN A  1 394 ? -37.26779 -2.87054   53.78488  1.000 54.62105  ? 374  ASN A O   1 
ATOM   2885  C CB  . ASN A  1 394 ? -38.81038 -0.98574   55.23714  1.000 54.34695  ? 374  ASN A CB  1 
ATOM   2886  C CG  . ASN A  1 394 ? -39.50650 -0.00222   56.18721  1.000 57.48370  ? 374  ASN A CG  1 
ATOM   2887  O OD1 . ASN A  1 394 ? -40.42806 -0.36140   56.92478  1.000 58.45304  ? 374  ASN A OD1 1 
ATOM   2888  N ND2 . ASN A  1 394 ? -39.07289 1.24522    56.15314  1.000 60.51861  ? 374  ASN A ND2 1 
ATOM   2889  N N   . VAL A  1 395 ? -36.36201 -3.77204   55.64862  1.000 52.99255  ? 375  VAL A N   1 
ATOM   2890  C CA  . VAL A  1 395 ? -35.66461 -4.81383   54.91281  1.000 50.07691  ? 375  VAL A CA  1 
ATOM   2891  C C   . VAL A  1 395 ? -35.96453 -6.16023   55.54023  1.000 50.26992  ? 375  VAL A C   1 
ATOM   2892  O O   . VAL A  1 395 ? -36.30848 -6.26453   56.72295  1.000 49.45297  ? 375  VAL A O   1 
ATOM   2893  C CB  . VAL A  1 395 ? -34.13559 -4.58202   54.85623  1.000 51.64535  ? 375  VAL A CB  1 
ATOM   2894  C CG1 . VAL A  1 395 ? -33.80782 -3.23448   54.18623  1.000 51.25683  ? 375  VAL A CG1 1 
ATOM   2895  C CG2 . VAL A  1 395 ? -33.53735 -4.65079   56.24338  1.000 50.67580  ? 375  VAL A CG2 1 
ATOM   2896  N N   . VAL A  1 396 ? -35.86058 -7.19278   54.71147  1.000 52.36884  ? 376  VAL A N   1 
ATOM   2897  C CA  . VAL A  1 396 ? -35.70169 -8.56943   55.14000  1.000 41.97698  ? 376  VAL A CA  1 
ATOM   2898  C C   . VAL A  1 396 ? -34.32847 -9.00835   54.65929  1.000 50.22404  ? 376  VAL A C   1 
ATOM   2899  O O   . VAL A  1 396 ? -34.05624 -8.98864   53.44871  1.000 42.99630  ? 376  VAL A O   1 
ATOM   2900  C CB  . VAL A  1 396 ? -36.80200 -9.47365   54.56903  1.000 47.73703  ? 376  VAL A CB  1 
ATOM   2901  C CG1 . VAL A  1 396 ? -36.51344 -10.94084  54.91865  1.000 47.71339  ? 376  VAL A CG1 1 
ATOM   2902  C CG2 . VAL A  1 396 ? -38.16042 -9.04937   55.08241  1.000 41.67291  ? 376  VAL A CG2 1 
ATOM   2903  N N   . ILE A  1 397 ? -33.45709 -9.38455   55.59950  1.000 48.41671  ? 377  ILE A N   1 
ATOM   2904  C CA  . ILE A  1 397 ? -32.08834 -9.79605   55.29551  1.000 46.91185  ? 377  ILE A CA  1 
ATOM   2905  C C   . ILE A  1 397 ? -31.99000 -11.30860  55.45405  1.000 47.95001  ? 377  ILE A C   1 
ATOM   2906  O O   . ILE A  1 397 ? -32.26301 -11.84389  56.53340  1.000 50.64462  ? 377  ILE A O   1 
ATOM   2907  C CB  . ILE A  1 397 ? -31.05824 -9.09557   56.19455  1.000 46.68403  ? 377  ILE A CB  1 
ATOM   2908  C CG1 . ILE A  1 397 ? -31.28665 -7.57661   56.25786  1.000 43.02195  ? 377  ILE A CG1 1 
ATOM   2909  C CG2 . ILE A  1 397 ? -29.62824 -9.42049   55.72199  1.000 42.89507  ? 377  ILE A CG2 1 
ATOM   2910  C CD1 . ILE A  1 397 ? -30.22569 -6.86617   57.07345  1.000 43.52130  ? 377  ILE A CD1 1 
ATOM   2911  N N   . ASP A  1 398 ? -31.55372 -11.98826  54.39262  1.000 52.01671  ? 378  ASP A N   1 
ATOM   2912  C CA  . ASP A  1 398 ? -31.52704 -13.44589  54.33599  1.000 53.89525  ? 378  ASP A CA  1 
ATOM   2913  C C   . ASP A  1 398 ? -30.41279 -14.00130  55.22165  1.000 48.06669  ? 378  ASP A C   1 
ATOM   2914  O O   . ASP A  1 398 ? -29.51554 -13.28639  55.67756  1.000 46.11665  ? 378  ASP A O   1 
ATOM   2915  C CB  . ASP A  1 398 ? -31.35953 -13.91906  52.88186  1.000 64.04238  ? 378  ASP A CB  1 
ATOM   2916  C CG  . ASP A  1 398 ? -31.43497 -15.45078  52.72434  1.000 73.95006  ? 378  ASP A CG  1 
ATOM   2917  O OD1 . ASP A  1 398 ? -32.50483 -16.03581  53.01444  1.000 76.11962  ? 378  ASP A OD1 1 
ATOM   2918  O OD2 . ASP A  1 398 ? -30.43673 -16.05780  52.27086  1.000 84.58088  ? 378  ASP A OD2 1 
ATOM   2919  N N   . HIS A  1 399 ? -30.48694 -15.30883  55.45193  1.000 48.33449  ? 379  HIS A N   1 
ATOM   2920  C CA  . HIS A  1 399 ? -29.56340 -16.00578  56.33559  1.000 45.96004  ? 379  HIS A CA  1 
ATOM   2921  C C   . HIS A  1 399 ? -28.10971 -15.80757  55.90714  1.000 44.97334  ? 379  HIS A C   1 
ATOM   2922  O O   . HIS A  1 399 ? -27.75603 -16.02426  54.74727  1.000 42.65018  ? 379  HIS A O   1 
ATOM   2923  C CB  . HIS A  1 399 ? -29.93592 -17.49164  56.34161  1.000 48.73304  ? 379  HIS A CB  1 
ATOM   2924  C CG  . HIS A  1 399 ? -29.06134 -18.34490  57.20400  1.000 52.99749  ? 379  HIS A CG  1 
ATOM   2925  N ND1 . HIS A  1 399 ? -27.78616 -18.71951  56.83689  1.000 55.82776  ? 379  HIS A ND1 1 
ATOM   2926  C CD2 . HIS A  1 399 ? -29.28885 -18.91909  58.40655  1.000 53.50614  ? 379  HIS A CD2 1 
ATOM   2927  C CE1 . HIS A  1 399 ? -27.26093 -19.47866  57.78167  1.000 54.61443  ? 379  HIS A CE1 1 
ATOM   2928  N NE2 . HIS A  1 399 ? -28.15202 -19.61440  58.74553  1.000 55.27837  ? 379  HIS A NE2 1 
ATOM   2929  N N   . GLY A  1 400 ? -27.26324 -15.38886  56.85161  1.000 46.49774  ? 380  GLY A N   1 
ATOM   2930  C CA  . GLY A  1 400 ? -25.82765 -15.35769  56.64217  1.000 48.48356  ? 380  GLY A CA  1 
ATOM   2931  C C   . GLY A  1 400 ? -25.29110 -14.19952  55.82188  1.000 50.72132  ? 380  GLY A C   1 
ATOM   2932  O O   . GLY A  1 400 ? -24.06466 -14.05193  55.72499  1.000 44.87958  ? 380  GLY A O   1 
ATOM   2933  N N   . VAL A  1 401 ? -26.16015 -13.38031  55.22149  1.000 48.76956  ? 381  VAL A N   1 
ATOM   2934  C CA  . VAL A  1 401 ? -25.71848 -12.22196  54.45458  1.000 44.91557  ? 381  VAL A CA  1 
ATOM   2935  C C   . VAL A  1 401 ? -24.74077 -11.37540  55.26155  1.000 48.06235  ? 381  VAL A C   1 
ATOM   2936  O O   . VAL A  1 401 ? -24.94808 -11.11582  56.45233  1.000 44.56214  ? 381  VAL A O   1 
ATOM   2937  C CB  . VAL A  1 401 ? -26.93899 -11.38826  54.03182  1.000 46.49351  ? 381  VAL A CB  1 
ATOM   2938  C CG1 . VAL A  1 401 ? -26.49882 -10.05422  53.46510  1.000 45.89204  ? 381  VAL A CG1 1 
ATOM   2939  C CG2 . VAL A  1 401 ? -27.79170 -12.16177  53.04181  1.000 48.35217  ? 381  VAL A CG2 1 
ATOM   2940  N N   . VAL A  1 402 ? -23.65883 -10.95085  54.61254  1.000 53.26248  ? 382  VAL A N   1 
ATOM   2941  C CA  . VAL A  1 402 ? -22.72997 -9.98770   55.19580  1.000 57.95693  ? 382  VAL A CA  1 
ATOM   2942  C C   . VAL A  1 402 ? -22.98462 -8.63275   54.53110  1.000 59.20080  ? 382  VAL A C   1 
ATOM   2943  O O   . VAL A  1 402 ? -22.76104 -8.46204   53.32423  1.000 53.64529  ? 382  VAL A O   1 
ATOM   2944  C CB  . VAL A  1 402 ? -21.26695 -10.43210  55.04446  1.000 54.85574  ? 382  VAL A CB  1 
ATOM   2945  C CG1 . VAL A  1 402 ? -20.35390 -9.23465   55.06593  1.000 50.92474  ? 382  VAL A CG1 1 
ATOM   2946  C CG2 . VAL A  1 402 ? -20.87894 -11.35279  56.17565  1.000 57.38728  ? 382  VAL A CG2 1 
ATOM   2947  N N   . ILE A  1 403 ? -23.47811 -7.67832   55.31450  1.000 56.80704  ? 383  ILE A N   1 
ATOM   2948  C CA  . ILE A  1 403 ? -23.71309 -6.32376   54.81055  1.000 54.73591  ? 383  ILE A CA  1 
ATOM   2949  C C   . ILE A  1 403 ? -22.40212 -5.54527   54.86512  1.000 53.97056  ? 383  ILE A C   1 
ATOM   2950  O O   . ILE A  1 403 ? -21.74118 -5.53293   55.91477  1.000 54.39694  ? 383  ILE A O   1 
ATOM   2951  C CB  . ILE A  1 403 ? -24.79564 -5.62683   55.62133  1.000 55.45204  ? 383  ILE A CB  1 
ATOM   2952  C CG1 . ILE A  1 403 ? -26.04959 -6.50792   55.69042  1.000 52.94445  ? 383  ILE A CG1 1 
ATOM   2953  C CG2 . ILE A  1 403 ? -25.06876 -4.22582   55.05665  1.000 58.87009  ? 383  ILE A CG2 1 
ATOM   2954  C CD1 . ILE A  1 403 ? -26.98091 -6.38425   54.50387  1.000 47.02042  ? 383  ILE A CD1 1 
ATOM   2955  N N   . PRO A  1 404 ? -21.98817 -4.91089   53.77439  1.000 54.01574  ? 384  PRO A N   1 
ATOM   2956  C CA  . PRO A  1 404 ? -20.74007 -4.14404   53.79972  1.000 56.65229  ? 384  PRO A CA  1 
ATOM   2957  C C   . PRO A  1 404 ? -20.89525 -2.82843   54.54968  1.000 59.00090  ? 384  PRO A C   1 
ATOM   2958  O O   . PRO A  1 404 ? -21.98375 -2.26633   54.68956  1.000 54.40727  ? 384  PRO A O   1 
ATOM   2959  C CB  . PRO A  1 404 ? -20.43318 -3.91017   52.31817  1.000 56.63039  ? 384  PRO A CB  1 
ATOM   2960  C CG  . PRO A  1 404 ? -21.74852 -4.02666   51.64223  1.000 55.18671  ? 384  PRO A CG  1 
ATOM   2961  C CD  . PRO A  1 404 ? -22.54424 -5.02919   52.41691  1.000 54.88248  ? 384  PRO A CD  1 
ATOM   2962  N N   . GLU A  1 405 ? -19.76298 -2.33818   55.03279  1.000 61.97031  ? 385  GLU A N   1 
ATOM   2963  C CA  . GLU A  1 405 ? -19.76000 -1.14529   55.86105  1.000 62.42918  ? 385  GLU A CA  1 
ATOM   2964  C C   . GLU A  1 405 ? -20.27729 0.05631    55.08007  1.000 63.28200  ? 385  GLU A C   1 
ATOM   2965  O O   . GLU A  1 405 ? -19.87216 0.29610    53.94248  1.000 59.79246  ? 385  GLU A O   1 
ATOM   2966  C CB  . GLU A  1 405 ? -18.34702 -0.89539   56.38393  1.000 63.60001  ? 385  GLU A CB  1 
ATOM   2967  C CG  . GLU A  1 405 ? -17.74737 -2.13042   57.05973  1.000 66.33565  ? 385  GLU A CG  1 
ATOM   2968  C CD  . GLU A  1 405 ? -16.33312 -1.90461   57.56892  1.000 71.70377  ? 385  GLU A CD  1 
ATOM   2969  O OE1 . GLU A  1 405 ? -15.73971 -0.87962   57.21758  1.000 75.02347  ? 385  GLU A OE1 1 
ATOM   2970  O OE2 . GLU A  1 405 ? -15.80640 -2.74844   58.32128  1.000 74.36903  ? 385  GLU A OE2 1 
ATOM   2971  N N   . GLY A  1 406 ? -21.20764 0.79014    55.68195  1.000 63.25331  ? 386  GLY A N   1 
ATOM   2972  C CA  . GLY A  1 406 ? -21.70941 1.99705    55.06727  1.000 59.36920  ? 386  GLY A CA  1 
ATOM   2973  C C   . GLY A  1 406 ? -22.76875 1.81043    54.00728  1.000 59.41046  ? 386  GLY A C   1 
ATOM   2974  O O   . GLY A  1 406 ? -23.13605 2.78707    53.35268  1.000 66.22297  ? 386  GLY A O   1 
ATOM   2975  N N   . LEU A  1 407 ? -23.28507 0.60229    53.81371  1.000 58.79992  ? 387  LEU A N   1 
ATOM   2976  C CA  . LEU A  1 407 ? -24.38188 0.43089    52.87558  1.000 59.07739  ? 387  LEU A CA  1 
ATOM   2977  C C   . LEU A  1 407 ? -25.63267 1.12162    53.41895  1.000 61.17874  ? 387  LEU A C   1 
ATOM   2978  O O   . LEU A  1 407 ? -25.90908 1.08798    54.62201  1.000 60.88335  ? 387  LEU A O   1 
ATOM   2979  C CB  . LEU A  1 407 ? -24.63464 -1.05453   52.62126  1.000 58.85989  ? 387  LEU A CB  1 
ATOM   2980  C CG  . LEU A  1 407 ? -25.95001 -1.46850   51.95041  1.000 59.59975  ? 387  LEU A CG  1 
ATOM   2981  C CD1 . LEU A  1 407 ? -26.21036 -0.72715   50.62066  1.000 60.32252  ? 387  LEU A CD1 1 
ATOM   2982  C CD2 . LEU A  1 407 ? -25.97358 -2.96994   51.72830  1.000 52.45037  ? 387  LEU A CD2 1 
ATOM   2983  N N   . ILE A  1 408 ? -26.36526 1.79222    52.52993  1.000 59.18427  ? 388  ILE A N   1 
ATOM   2984  C CA  . ILE A  1 408 ? -27.61236 2.47324    52.86213  1.000 58.90757  ? 388  ILE A CA  1 
ATOM   2985  C C   . ILE A  1 408 ? -28.72837 1.81852    52.05765  1.000 57.24305  ? 388  ILE A C   1 
ATOM   2986  O O   . ILE A  1 408 ? -28.61146 1.66835    50.83614  1.000 57.69911  ? 388  ILE A O   1 
ATOM   2987  C CB  . ILE A  1 408 ? -27.53882 3.99152    52.57799  1.000 65.78856  ? 388  ILE A CB  1 
ATOM   2988  C CG1 . ILE A  1 408 ? -27.08105 4.77842    53.81602  1.000 63.27997  ? 388  ILE A CG1 1 
ATOM   2989  C CG2 . ILE A  1 408 ? -28.89065 4.51872    52.13379  1.000 67.07087  ? 388  ILE A CG2 1 
ATOM   2990  C CD1 . ILE A  1 408 ? -25.63642 4.56661    54.20652  1.000 64.12478  ? 388  ILE A CD1 1 
ATOM   2991  N N   . VAL A  1 409 ? -29.78555 1.39212    52.75201  1.000 56.53064  ? 389  VAL A N   1 
ATOM   2992  C CA  . VAL A  1 409 ? -30.97312 0.79454    52.14935  1.000 55.71394  ? 389  VAL A CA  1 
ATOM   2993  C C   . VAL A  1 409 ? -32.19076 1.41464    52.81684  1.000 58.93832  ? 389  VAL A C   1 
ATOM   2994  O O   . VAL A  1 409 ? -32.29684 1.40718    54.05007  1.000 59.86687  ? 389  VAL A O   1 
ATOM   2995  C CB  . VAL A  1 409 ? -31.00850 -0.74027   52.31649  1.000 53.34903  ? 389  VAL A CB  1 
ATOM   2996  C CG1 . VAL A  1 409 ? -32.23126 -1.31719   51.62455  1.000 50.91448  ? 389  VAL A CG1 1 
ATOM   2997  C CG2 . VAL A  1 409 ? -29.73562 -1.38137   51.77647  1.000 52.18041  ? 389  VAL A CG2 1 
ATOM   2998  N N   . GLY A  1 410 ? -33.11164 1.93925    52.00990  1.000 58.81704  ? 390  GLY A N   1 
ATOM   2999  C CA  . GLY A  1 410 ? -34.30111 2.58791    52.52742  1.000 59.61255  ? 390  GLY A CA  1 
ATOM   3000  C C   . GLY A  1 410 ? -34.36078 4.09010    52.33341  1.000 63.49384  ? 390  GLY A C   1 
ATOM   3001  O O   . GLY A  1 410 ? -35.34916 4.70545    52.74501  1.000 63.94829  ? 390  GLY A O   1 
ATOM   3002  N N   . GLU A  1 411 ? -33.35385 4.70518    51.71472  1.000 67.64040  ? 391  GLU A N   1 
ATOM   3003  C CA  . GLU A  1 411 ? -33.37948 6.14218    51.46999  1.000 70.43884  ? 391  GLU A CA  1 
ATOM   3004  C C   . GLU A  1 411 ? -33.65926 6.50618    50.01657  1.000 70.62481  ? 391  GLU A C   1 
ATOM   3005  O O   . GLU A  1 411 ? -34.25320 7.55716    49.76511  1.000 75.18037  ? 391  GLU A O   1 
ATOM   3006  C CB  . GLU A  1 411 ? -32.05464 6.78441    51.90261  1.000 74.71684  ? 391  GLU A CB  1 
ATOM   3007  C CG  . GLU A  1 411 ? -31.74968 6.65632    53.39343  1.000 78.80167  ? 391  GLU A CG  1 
ATOM   3008  C CD  . GLU A  1 411 ? -32.48678 7.67922    54.25568  1.000 83.84390  ? 391  GLU A CD  1 
ATOM   3009  O OE1 . GLU A  1 411 ? -33.37744 7.26767    55.04149  1.000 87.21574  ? 391  GLU A OE1 1 
ATOM   3010  O OE2 . GLU A  1 411 ? -32.16677 8.88782    54.15499  1.000 85.61045  ? 391  GLU A OE2 1 
ATOM   3011  N N   . ASP A  1 412 ? -33.26593 5.66880    49.05818  1.000 66.71696  ? 392  ASP A N   1 
ATOM   3012  C CA  . ASP A  1 412 ? -33.44574 5.94881    47.63168  1.000 65.37261  ? 392  ASP A CA  1 
ATOM   3013  C C   . ASP A  1 412 ? -34.27497 4.85703    46.97001  1.000 66.28281  ? 392  ASP A C   1 
ATOM   3014  O O   . ASP A  1 412 ? -33.71858 3.82445    46.55322  1.000 64.05019  ? 392  ASP A O   1 
ATOM   3015  C CB  . ASP A  1 412 ? -32.09071 6.06803    46.94076  1.000 68.76505  ? 392  ASP A CB  1 
ATOM   3016  C CG  . ASP A  1 412 ? -32.19689 6.58763    45.50977  1.000 73.21354  ? 392  ASP A CG  1 
ATOM   3017  O OD1 . ASP A  1 412 ? -33.30563 6.60510    44.93140  1.000 75.14804  ? 392  ASP A OD1 1 
ATOM   3018  O OD2 . ASP A  1 412 ? -31.15370 6.99362    44.96152  1.000 75.82265  ? 392  ASP A OD2 1 
ATOM   3019  N N   . PRO A  1 413 ? -35.59274 5.05365    46.81339  1.000 69.71720  ? 393  PRO A N   1 
ATOM   3020  C CA  . PRO A  1 413 ? -36.43872 3.98126    46.25344  1.000 68.15975  ? 393  PRO A CA  1 
ATOM   3021  C C   . PRO A  1 413 ? -35.97413 3.46196    44.90752  1.000 71.08121  ? 393  PRO A C   1 
ATOM   3022  O O   . PRO A  1 413 ? -35.96198 2.24361    44.69249  1.000 71.62211  ? 393  PRO A O   1 
ATOM   3023  C CB  . PRO A  1 413 ? -37.81831 4.64766    46.14820  1.000 66.87612  ? 393  PRO A CB  1 
ATOM   3024  C CG  . PRO A  1 413 ? -37.80056 5.70775    47.18687  1.000 66.68031  ? 393  PRO A CG  1 
ATOM   3025  C CD  . PRO A  1 413 ? -36.38557 6.22193    47.23279  1.000 67.50532  ? 393  PRO A CD  1 
ATOM   3026  N N   . GLU A  1 414 ? -35.58689 4.35278    43.99456  1.000 74.25392  ? 394  GLU A N   1 
ATOM   3027  C CA  . GLU A  1 414 ? -35.20918 3.91735    42.65272  1.000 78.95705  ? 394  GLU A CA  1 
ATOM   3028  C C   . GLU A  1 414 ? -33.94318 3.08192    42.67224  1.000 79.31956  ? 394  GLU A C   1 
ATOM   3029  O O   . GLU A  1 414 ? -33.80442 2.13428    41.88855  1.000 81.28669  ? 394  GLU A O   1 
ATOM   3030  C CB  . GLU A  1 414 ? -35.01261 5.11654    41.73179  1.000 83.04706  ? 394  GLU A CB  1 
ATOM   3031  C CG  . GLU A  1 414 ? -36.26562 5.60731    41.07315  1.000 88.10582  ? 394  GLU A CG  1 
ATOM   3032  C CD  . GLU A  1 414 ? -36.00347 6.85596    40.27512  1.000 102.01341 ? 394  GLU A CD  1 
ATOM   3033  O OE1 . GLU A  1 414 ? -36.30914 6.87722    39.05794  1.000 109.66118 ? 394  GLU A OE1 1 
ATOM   3034  O OE2 . GLU A  1 414 ? -35.45848 7.81452    40.86624  1.000 105.32671 ? 394  GLU A OE2 1 
ATOM   3035  N N   . LEU A  1 415 ? -32.99980 3.43320    43.54194  1.000 76.11479  ? 395  LEU A N   1 
ATOM   3036  C CA  . LEU A  1 415 ? -31.72388 2.73634    43.54574  1.000 76.55258  ? 395  LEU A CA  1 
ATOM   3037  C C   . LEU A  1 415 ? -31.83300 1.41408    44.29438  1.000 76.51772  ? 395  LEU A C   1 
ATOM   3038  O O   . LEU A  1 415 ? -31.27533 0.39482    43.86233  1.000 82.15461  ? 395  LEU A O   1 
ATOM   3039  C CB  . LEU A  1 415 ? -30.65370 3.62579    44.14385  1.000 69.24901  ? 395  LEU A CB  1 
ATOM   3040  C CG  . LEU A  1 415 ? -29.34056 2.96572    44.48935  1.000 70.39132  ? 395  LEU A CG  1 
ATOM   3041  C CD1 . LEU A  1 415 ? -28.47063 2.73744    43.22592  1.000 72.45285  ? 395  LEU A CD1 1 
ATOM   3042  C CD2 . LEU A  1 415 ? -28.70942 3.99335    45.37135  1.000 74.35069  ? 395  LEU A CD2 1 
ATOM   3043  N N   . ASP A  1 416 ? -32.54870 1.42097    45.42642  1.000 67.67155  ? 396  ASP A N   1 
ATOM   3044  C CA  . ASP A  1 416 ? -32.84022 0.17618    46.13103  1.000 64.00750  ? 396  ASP A CA  1 
ATOM   3045  C C   . ASP A  1 416 ? -33.50343 -0.82344   45.20143  1.000 65.43182  ? 396  ASP A C   1 
ATOM   3046  O O   . ASP A  1 416 ? -33.13532 -2.00202   45.17938  1.000 67.53060  ? 396  ASP A O   1 
ATOM   3047  C CB  . ASP A  1 416 ? -33.74420 0.43466    47.34321  1.000 61.92312  ? 396  ASP A CB  1 
ATOM   3048  C CG  . ASP A  1 416 ? -33.02554 1.12842    48.48261  1.000 62.22135  ? 396  ASP A CG  1 
ATOM   3049  O OD1 . ASP A  1 416 ? -31.77803 1.23169    48.42097  1.000 65.66897  ? 396  ASP A OD1 1 
ATOM   3050  O OD2 . ASP A  1 416 ? -33.70896 1.54829    49.45122  1.000 57.35508  ? 396  ASP A OD2 1 
ATOM   3051  N N   . ALA A  1 417 ? -34.46899 -0.35724   44.40700  1.000 68.34705  ? 397  ALA A N   1 
ATOM   3052  C CA  . ALA A  1 417 ? -35.16278 -1.23259   43.46543  1.000 73.24573  ? 397  ALA A CA  1 
ATOM   3053  C C   . ALA A  1 417 ? -34.19913 -1.87541   42.47202  1.000 74.58317  ? 397  ALA A C   1 
ATOM   3054  O O   . ALA A  1 417 ? -34.26793 -3.08541   42.22826  1.000 76.07050  ? 397  ALA A O   1 
ATOM   3055  C CB  . ALA A  1 417 ? -36.24581 -0.45099   42.71913  1.000 75.58557  ? 397  ALA A CB  1 
ATOM   3056  N N   . LYS A  1 418 ? -33.30123 -1.08701   41.87905  1.000 72.27695  ? 398  LYS A N   1 
ATOM   3057  C CA  . LYS A  1 418 ? -32.36785 -1.65899   40.91553  1.000 76.53317  ? 398  LYS A CA  1 
ATOM   3058  C C   . LYS A  1 418 ? -31.46210 -2.68712   41.57278  1.000 79.76881  ? 398  LYS A C   1 
ATOM   3059  O O   . LYS A  1 418 ? -31.11094 -3.69935   40.95490  1.000 85.84712  ? 398  LYS A O   1 
ATOM   3060  C CB  . LYS A  1 418 ? -31.52998 -0.55688   40.26712  1.000 80.88058  ? 398  LYS A CB  1 
ATOM   3061  N N   . ARG A  1 419 ? -31.08661 -2.45512   42.82856  1.000 76.34254  ? 399  ARG A N   1 
ATOM   3062  C CA  . ARG A  1 419 ? -30.02152 -3.22812   43.43978  1.000 73.34225  ? 399  ARG A CA  1 
ATOM   3063  C C   . ARG A  1 419 ? -30.51691 -4.39899   44.27091  1.000 67.55908  ? 399  ARG A C   1 
ATOM   3064  O O   . ARG A  1 419 ? -29.74152 -5.31729   44.55815  1.000 67.04426  ? 399  ARG A O   1 
ATOM   3065  C CB  . ARG A  1 419 ? -29.15032 -2.32039   44.30392  1.000 75.57183  ? 399  ARG A CB  1 
ATOM   3066  C CG  . ARG A  1 419 ? -27.75694 -2.52889   43.89453  1.000 81.45135  ? 399  ARG A CG  1 
ATOM   3067  C CD  . ARG A  1 419 ? -26.71591 -1.68825   44.54165  1.000 87.01677  ? 399  ARG A CD  1 
ATOM   3068  N NE  . ARG A  1 419 ? -26.94148 -0.26079   44.65561  1.000 89.97933  ? 399  ARG A NE  1 
ATOM   3069  C CZ  . ARG A  1 419 ? -26.59392 0.42198    45.73406  1.000 87.66755  ? 399  ARG A CZ  1 
ATOM   3070  N NH1 . ARG A  1 419 ? -26.07634 -0.22873   46.76671  1.000 86.09612  ? 399  ARG A NH1 1 
ATOM   3071  N NH2 . ARG A  1 419 ? -26.74891 1.73110    45.78270  1.000 88.04439  ? 399  ARG A NH2 1 
ATOM   3072  N N   . PHE A  1 420 ? -31.78001 -4.39251   44.65203  1.000 65.13579  ? 400  PHE A N   1 
ATOM   3073  C CA  . PHE A  1 420 ? -32.32852 -5.45459   45.46638  1.000 64.63134  ? 400  PHE A CA  1 
ATOM   3074  C C   . PHE A  1 420 ? -33.68867 -5.83031   44.91294  1.000 65.37076  ? 400  PHE A C   1 
ATOM   3075  O O   . PHE A  1 420 ? -34.24091 -5.15678   44.03779  1.000 67.73537  ? 400  PHE A O   1 
ATOM   3076  C CB  . PHE A  1 420 ? -32.44610 -5.02612   46.93635  1.000 60.80307  ? 400  PHE A CB  1 
ATOM   3077  C CG  . PHE A  1 420 ? -31.14992 -4.54379   47.53064  1.000 60.02501  ? 400  PHE A CG  1 
ATOM   3078  C CD1 . PHE A  1 420 ? -30.06671 -5.41275   47.66246  1.000 60.07922  ? 400  PHE A CD1 1 
ATOM   3079  C CD2 . PHE A  1 420 ? -31.00753 -3.22219   47.94717  1.000 55.63626  ? 400  PHE A CD2 1 
ATOM   3080  C CE1 . PHE A  1 420 ? -28.86968 -4.97070   48.21526  1.000 59.28048  ? 400  PHE A CE1 1 
ATOM   3081  C CE2 . PHE A  1 420 ? -29.81859 -2.77142   48.49827  1.000 54.16568  ? 400  PHE A CE2 1 
ATOM   3082  C CZ  . PHE A  1 420 ? -28.74465 -3.63842   48.63121  1.000 57.68156  ? 400  PHE A CZ  1 
ATOM   3083  N N   . ARG A  1 421 ? -34.20484 -6.94213   45.41532  1.000 62.70260  ? 401  ARG A N   1 
ATOM   3084  C CA  . ARG A  1 421 ? -35.63096 -7.20922   45.35774  1.000 61.06234  ? 401  ARG A CA  1 
ATOM   3085  C C   . ARG A  1 421 ? -36.34245 -6.17894   46.23147  1.000 64.77838  ? 401  ARG A C   1 
ATOM   3086  O O   . ARG A  1 421 ? -36.06745 -6.08065   47.43192  1.000 66.49648  ? 401  ARG A O   1 
ATOM   3087  C CB  . ARG A  1 421 ? -35.90062 -8.63537   45.83792  1.000 55.62443  ? 401  ARG A CB  1 
ATOM   3088  C CG  . ARG A  1 421 ? -37.34150 -8.96721   46.10413  1.000 53.32255  ? 401  ARG A CG  1 
ATOM   3089  C CD  . ARG A  1 421 ? -38.04871 -9.30007   44.82989  1.000 57.17238  ? 401  ARG A CD  1 
ATOM   3090  N NE  . ARG A  1 421 ? -37.32283 -10.31541  44.06592  1.000 58.62784  ? 401  ARG A NE  1 
ATOM   3091  C CZ  . ARG A  1 421 ? -37.63200 -10.67266  42.82246  1.000 62.32239  ? 401  ARG A CZ  1 
ATOM   3092  N NH1 . ARG A  1 421 ? -38.65295 -10.08783  42.20725  1.000 62.88163  ? 401  ARG A NH1 1 
ATOM   3093  N NH2 . ARG A  1 421 ? -36.92181 -11.60598  42.18870  1.000 63.71658  ? 401  ARG A NH2 1 
ATOM   3094  N N   . ARG A  1 422 ? -37.21827 -5.37667   45.62953  1.000 66.49467  ? 402  ARG A N   1 
ATOM   3095  C CA  . ARG A  1 422 ? -37.95221 -4.33646   46.34335  1.000 61.30248  ? 402  ARG A CA  1 
ATOM   3096  C C   . ARG A  1 422 ? -39.43417 -4.50307   46.05347  1.000 63.79867  ? 402  ARG A C   1 
ATOM   3097  O O   . ARG A  1 422 ? -39.82352 -4.68854   44.89673  1.000 71.24580  ? 402  ARG A O   1 
ATOM   3098  C CB  . ARG A  1 422 ? -37.47831 -2.93468   45.93284  1.000 59.55104  ? 402  ARG A CB  1 
ATOM   3099  C CG  . ARG A  1 422 ? -38.04579 -1.81278   46.79485  1.000 61.29445  ? 402  ARG A CG  1 
ATOM   3100  C CD  . ARG A  1 422 ? -37.49769 -0.44682   46.38842  1.000 65.95334  ? 402  ARG A CD  1 
ATOM   3101  N NE  . ARG A  1 422 ? -37.74320 0.55059    47.42571  1.000 64.25868  ? 402  ARG A NE  1 
ATOM   3102  C CZ  . ARG A  1 422 ? -38.87884 1.22744    47.55284  1.000 67.08123  ? 402  ARG A CZ  1 
ATOM   3103  N NH1 . ARG A  1 422 ? -39.87052 1.01804    46.70218  1.000 67.27534  ? 402  ARG A NH1 1 
ATOM   3104  N NH2 . ARG A  1 422 ? -39.02444 2.11467    48.53010  1.000 69.58398  ? 402  ARG A NH2 1 
ATOM   3105  N N   . THR A  1 423 ? -40.25915 -4.44796   47.08924  1.000 63.07576  ? 403  THR A N   1 
ATOM   3106  C CA  . THR A  1 423 ? -41.67966 -4.65228   46.86469  1.000 68.27854  ? 403  THR A CA  1 
ATOM   3107  C C   . THR A  1 423 ? -42.38030 -3.33606   46.53891  1.000 72.14698  ? 403  THR A C   1 
ATOM   3108  O O   . THR A  1 423 ? -41.84702 -2.24032   46.74396  1.000 70.86856  ? 403  THR A O   1 
ATOM   3109  C CB  . THR A  1 423 ? -42.34769 -5.30566   48.07233  1.000 65.71329  ? 403  THR A CB  1 
ATOM   3110  O OG1 . THR A  1 423 ? -43.69026 -5.67060   47.71878  1.000 73.16356  ? 403  THR A OG1 1 
ATOM   3111  C CG2 . THR A  1 423 ? -42.40218 -4.34619   49.22590  1.000 56.53808  ? 403  THR A CG2 1 
ATOM   3112  N N   . GLU A  1 424 ? -43.60633 -3.47108   46.02101  1.000 74.30073  ? 404  GLU A N   1 
ATOM   3113  C CA  . GLU A  1 424 ? -44.46758 -2.32059   45.77341  1.000 77.69108  ? 404  GLU A CA  1 
ATOM   3114  C C   . GLU A  1 424 ? -44.62569 -1.45787   47.02210  1.000 74.52688  ? 404  GLU A C   1 
ATOM   3115  O O   . GLU A  1 424 ? -44.80838 -0.23817   46.92320  1.000 76.96416  ? 404  GLU A O   1 
ATOM   3116  C CB  . GLU A  1 424 ? -45.82758 -2.81799   45.27500  1.000 81.92785  ? 404  GLU A CB  1 
ATOM   3117  C CG  . GLU A  1 424 ? -46.89559 -1.75862   45.15647  1.000 85.80993  ? 404  GLU A CG  1 
ATOM   3118  C CD  . GLU A  1 424 ? -46.46125 -0.60153   44.28389  1.000 92.45329  ? 404  GLU A CD  1 
ATOM   3119  O OE1 . GLU A  1 424 ? -46.57600 0.56213    44.73272  1.000 93.71365  ? 404  GLU A OE1 1 
ATOM   3120  O OE2 . GLU A  1 424 ? -46.00766 -0.85512   43.14515  1.000 97.30348  ? 404  GLU A OE2 1 
ATOM   3121  N N   . SER A  1 425 ? -44.52900 -2.06656   48.19971  1.000 68.35517  ? 405  SER A N   1 
ATOM   3122  C CA  . SER A  1 425 ? -44.68053 -1.37576   49.47209  1.000 67.86064  ? 405  SER A CA  1 
ATOM   3123  C C   . SER A  1 425 ? -43.38621 -0.76485   50.00278  1.000 62.76877  ? 405  SER A C   1 
ATOM   3124  O O   . SER A  1 425 ? -43.44434 0.01490    50.95790  1.000 63.20341  ? 405  SER A O   1 
ATOM   3125  C CB  . SER A  1 425 ? -45.24373 -2.33745   50.52284  1.000 69.79372  ? 405  SER A CB  1 
ATOM   3126  O OG  . SER A  1 425 ? -46.44928 -2.92156   50.06736  1.000 77.56952  ? 405  SER A OG  1 
ATOM   3127  N N   . GLY A  1 426 ? -42.23018 -1.09104   49.43211  1.000 57.70214  ? 406  GLY A N   1 
ATOM   3128  C CA  . GLY A  1 426 ? -40.97926 -0.50940   49.87923  1.000 59.99026  ? 406  GLY A CA  1 
ATOM   3129  C C   . GLY A  1 426 ? -40.08282 -1.40539   50.70486  1.000 63.84488  ? 406  GLY A C   1 
ATOM   3130  O O   . GLY A  1 426 ? -39.05575 -0.92776   51.20602  1.000 79.49460  ? 406  GLY A O   1 
ATOM   3131  N N   . ILE A  1 427 ? -40.44019 -2.67772   50.87057  1.000 59.20538  ? 407  ILE A N   1 
ATOM   3132  C CA  . ILE A  1 427 ? -39.60636 -3.63841   51.58884  1.000 52.24512  ? 407  ILE A CA  1 
ATOM   3133  C C   . ILE A  1 427 ? -38.55314 -4.18235   50.63592  1.000 52.82607  ? 407  ILE A C   1 
ATOM   3134  O O   . ILE A  1 427 ? -38.87204 -4.64359   49.53612  1.000 55.08774  ? 407  ILE A O   1 
ATOM   3135  C CB  . ILE A  1 427 ? -40.45697 -4.77956   52.16921  1.000 49.41194  ? 407  ILE A CB  1 
ATOM   3136  C CG1 . ILE A  1 427 ? -41.57333 -4.24273   53.05703  1.000 51.19481  ? 407  ILE A CG1 1 
ATOM   3137  C CG2 . ILE A  1 427 ? -39.58810 -5.76078   52.93410  1.000 46.24495  ? 407  ILE A CG2 1 
ATOM   3138  C CD1 . ILE A  1 427 ? -41.07472 -3.53871   54.28533  1.000 58.71558  ? 407  ILE A CD1 1 
ATOM   3139  N N   . CYS A  1 428 ? -37.29735 -4.14696   51.05676  1.000 54.79118  ? 408  CYS A N   1 
ATOM   3140  C CA  . CYS A  1 428 ? -36.20731 -4.71389   50.27281  1.000 54.85883  ? 408  CYS A CA  1 
ATOM   3141  C C   . CYS A  1 428 ? -35.79508 -6.06918   50.83421  1.000 49.97275  ? 408  CYS A C   1 
ATOM   3142  O O   . CYS A  1 428 ? -35.48142 -6.18530   52.02222  1.000 46.40449  ? 408  CYS A O   1 
ATOM   3143  C CB  . CYS A  1 428 ? -34.99740 -3.77835   50.25707  1.000 59.95120  ? 408  CYS A CB  1 
ATOM   3144  S SG  . CYS A  1 428 ? -35.11614 -2.38995   49.11948  1.000 62.63361  ? 408  CYS A SG  1 
ATOM   3145  N N   . LEU A  1 429 ? -35.78753 -7.08509   49.97851  1.000 53.27754  ? 409  LEU A N   1 
ATOM   3146  C CA  . LEU A  1 429 ? -35.20246 -8.37593   50.31813  1.000 53.05646  ? 409  LEU A CA  1 
ATOM   3147  C C   . LEU A  1 429 ? -33.75786 -8.38190   49.84927  1.000 60.58972  ? 409  LEU A C   1 
ATOM   3148  O O   . LEU A  1 429 ? -33.47034 -7.99288   48.71269  1.000 64.42905  ? 409  LEU A O   1 
ATOM   3149  C CB  . LEU A  1 429 ? -35.97597 -9.52236   49.67579  1.000 51.64034  ? 409  LEU A CB  1 
ATOM   3150  C CG  . LEU A  1 429 ? -35.27554 -10.87042  49.82417  1.000 52.05317  ? 409  LEU A CG  1 
ATOM   3151  C CD1 . LEU A  1 429 ? -35.59278 -11.47719  51.17736  1.000 51.31924  ? 409  LEU A CD1 1 
ATOM   3152  C CD2 . LEU A  1 429 ? -35.66790 -11.80159  48.70348  1.000 51.19643  ? 409  LEU A CD2 1 
ATOM   3153  N N   . ILE A  1 430 ? -32.84950 -8.80450   50.72648  1.000 63.18574  ? 410  ILE A N   1 
ATOM   3154  C CA  . ILE A  1 430 ? -31.41521 -8.71272   50.46996  1.000 58.03354  ? 410  ILE A CA  1 
ATOM   3155  C C   . ILE A  1 430 ? -30.78251 -10.08718  50.64164  1.000 55.39208  ? 410  ILE A C   1 
ATOM   3156  O O   . ILE A  1 430 ? -30.77398 -10.63203  51.75192  1.000 56.19311  ? 410  ILE A O   1 
ATOM   3157  C CB  . ILE A  1 430 ? -30.73118 -7.70133   51.39596  1.000 54.49613  ? 410  ILE A CB  1 
ATOM   3158  C CG1 . ILE A  1 430 ? -31.15645 -6.27417   51.03909  1.000 57.49444  ? 410  ILE A CG1 1 
ATOM   3159  C CG2 . ILE A  1 430 ? -29.23139 -7.87591   51.32249  1.000 55.88449  ? 410  ILE A CG2 1 
ATOM   3160  C CD1 . ILE A  1 430 ? -31.10341 -5.32956   52.20063  1.000 56.30628  ? 410  ILE A CD1 1 
ATOM   3161  N N   . THR A  1 431 ? -30.23610 -10.62701  49.55275  1.000 52.85511  ? 411  THR A N   1 
ATOM   3162  C CA  A THR A  1 431 ? -29.52379 -11.89474  49.52063  0.041 56.24921  ? 411  THR A CA  1 
ATOM   3163  C CA  B THR A  1 431 ? -29.51139 -11.88729  49.56664  0.959 55.98804  ? 411  THR A CA  1 
ATOM   3164  C C   . THR A  1 431 ? -28.03674 -11.63963  49.29457  1.000 59.75093  ? 411  THR A C   1 
ATOM   3165  O O   . THR A  1 431 ? -27.63987 -10.58836  48.78139  1.000 63.72857  ? 411  THR A O   1 
ATOM   3166  C CB  A THR A  1 431 ? -30.08073 -12.79827  48.40890  0.041 58.82301  ? 411  THR A CB  1 
ATOM   3167  C CB  B THR A  1 431 ? -30.05016 -12.87236  48.52396  0.959 58.76186  ? 411  THR A CB  1 
ATOM   3168  O OG1 A THR A  1 431 ? -31.50777 -12.67388  48.35892  0.041 58.47556  ? 411  THR A OG1 1 
ATOM   3169  O OG1 B THR A  1 431 ? -29.78801 -12.36492  47.20864  0.959 61.73049  ? 411  THR A OG1 1 
ATOM   3170  C CG2 A THR A  1 431 ? -29.71975 -14.25821  48.64498  0.041 59.48182  ? 411  THR A CG2 1 
ATOM   3171  C CG2 B THR A  1 431 ? -31.53905 -13.08383  48.69718  0.959 58.03495  ? 411  THR A CG2 1 
ATOM   3172  N N   . GLN A  1 432 ? -27.21495 -12.62446  49.67409  1.000 61.13683  ? 412  GLN A N   1 
ATOM   3173  C CA  . GLN A  1 432 ? -25.78409 -12.52031  49.41110  1.000 63.14072  ? 412  GLN A CA  1 
ATOM   3174  C C   . GLN A  1 432 ? -25.52444 -12.35822  47.92119  1.000 63.96655  ? 412  GLN A C   1 
ATOM   3175  O O   . GLN A  1 432 ? -24.62183 -11.61491  47.51537  1.000 61.58703  ? 412  GLN A O   1 
ATOM   3176  C CB  . GLN A  1 432 ? -25.04124 -13.74404  49.94735  1.000 60.73635  ? 412  GLN A CB  1 
ATOM   3177  C CG  . GLN A  1 432 ? -23.53740 -13.52992  49.99676  1.000 59.89219  ? 412  GLN A CG  1 
ATOM   3178  C CD  . GLN A  1 432 ? -23.18622 -12.19778  50.64933  1.000 63.12256  ? 412  GLN A CD  1 
ATOM   3179  O OE1 . GLN A  1 432 ? -23.58696 -11.92605  51.78615  1.000 65.48068  ? 412  GLN A OE1 1 
ATOM   3180  N NE2 . GLN A  1 432 ? -22.45948 -11.34940  49.92324  1.000 59.98233  ? 412  GLN A NE2 1 
ATOM   3181  N N   . SER A  1 433 ? -26.33177 -13.02874  47.09590  1.000 63.69499  ? 413  SER A N   1 
ATOM   3182  C CA  . SER A  1 433 ? -26.20036 -12.91078  45.65112  1.000 66.40262  ? 413  SER A CA  1 
ATOM   3183  C C   . SER A  1 433 ? -26.27193 -11.45600  45.20323  1.000 67.60739  ? 413  SER A C   1 
ATOM   3184  O O   . SER A  1 433 ? -25.48309 -11.02318  44.35249  1.000 72.76270  ? 413  SER A O   1 
ATOM   3185  C CB  . SER A  1 433 ? -27.28542 -13.74184  44.97180  1.000 70.40990  ? 413  SER A CB  1 
ATOM   3186  O OG  . SER A  1 433 ? -27.15903 -13.69416  43.56247  1.000 79.92008  ? 413  SER A OG  1 
ATOM   3187  N N   . MET A  1 434 ? -27.20082 -10.67984  45.77414  1.000 62.87192  ? 414  MET A N   1 
ATOM   3188  C CA  . MET A  1 434 ? -27.33102 -9.27882   45.38048  1.000 61.13391  ? 414  MET A CA  1 
ATOM   3189  C C   . MET A  1 434 ? -26.16405 -8.45138   45.88768  1.000 62.60633  ? 414  MET A C   1 
ATOM   3190  O O   . MET A  1 434 ? -25.63438 -7.61164   45.15339  1.000 66.71131  ? 414  MET A O   1 
ATOM   3191  C CB  . MET A  1 434 ? -28.63955 -8.68538   45.88748  1.000 58.83845  ? 414  MET A CB  1 
ATOM   3192  C CG  . MET A  1 434 ? -29.80031 -9.62053   45.82878  1.000 62.09065  ? 414  MET A CG  1 
ATOM   3193  S SD  . MET A  1 434 ? -31.21557 -8.91357   46.65418  1.000 64.04477  ? 414  MET A SD  1 
ATOM   3194  C CE  . MET A  1 434 ? -32.56337 -9.87433   45.96740  1.000 60.66320  ? 414  MET A CE  1 
ATOM   3195  N N   . ILE A  1 435 ? -25.75041 -8.67777   47.13559  1.000 59.19703  ? 415  ILE A N   1 
ATOM   3196  C CA  . ILE A  1 435 ? -24.66514 -7.89620   47.72405  1.000 61.40406  ? 415  ILE A CA  1 
ATOM   3197  C C   . ILE A  1 435 ? -23.40254 -8.01080   46.88080  1.000 65.29440  ? 415  ILE A C   1 
ATOM   3198  O O   . ILE A  1 435 ? -22.71812 -7.01372   46.62254  1.000 68.31175  ? 415  ILE A O   1 
ATOM   3199  C CB  . ILE A  1 435 ? -24.40695 -8.34956   49.17433  1.000 60.62400  ? 415  ILE A CB  1 
ATOM   3200  C CG1 . ILE A  1 435 ? -25.53208 -7.88848   50.12119  1.000 56.62035  ? 415  ILE A CG1 1 
ATOM   3201  C CG2 . ILE A  1 435 ? -23.01823 -7.91221   49.63307  1.000 60.02967  ? 415  ILE A CG2 1 
ATOM   3202  C CD1 . ILE A  1 435 ? -25.77891 -6.36927   50.14642  1.000 54.43850  ? 415  ILE A CD1 1 
ATOM   3203  N N   . ASP A  1 436 ? -23.07456 -9.22912   46.44226  1.000 67.80920  ? 416  ASP A N   1 
ATOM   3204  C CA  . ASP A  1 436 ? -21.83672 -9.45548   45.70592  1.000 69.32570  ? 416  ASP A CA  1 
ATOM   3205  C C   . ASP A  1 436 ? -21.81917 -8.67688   44.39888  1.000 72.32167  ? 416  ASP A C   1 
ATOM   3206  O O   . ASP A  1 436 ? -20.78228 -8.13253   44.00820  1.000 72.51027  ? 416  ASP A O   1 
ATOM   3207  C CB  . ASP A  1 436 ? -21.65542 -10.94924  45.44051  1.000 69.64920  ? 416  ASP A CB  1 
ATOM   3208  C CG  . ASP A  1 436 ? -21.25259 -11.71566  46.68167  1.000 70.54608  ? 416  ASP A CG  1 
ATOM   3209  O OD1 . ASP A  1 436 ? -20.74521 -11.06848  47.62375  1.000 67.76289  ? 416  ASP A OD1 1 
ATOM   3210  O OD2 . ASP A  1 436 ? -21.40342 -12.96176  46.70359  1.000 70.70025  ? 416  ASP A OD2 1 
ATOM   3211  N N   . LYS A  1 437 ? -22.97150 -8.57950   43.73618  1.000 77.15232  ? 417  LYS A N   1 
ATOM   3212  C CA  . LYS A  1 437 ? -23.09517 -7.97338   42.41548  1.000 83.83652  ? 417  LYS A CA  1 
ATOM   3213  C C   . LYS A  1 437 ? -22.73887 -6.48866   42.37586  1.000 88.22405  ? 417  LYS A C   1 
ATOM   3214  O O   . LYS A  1 437 ? -22.77440 -5.88465   41.29993  1.000 90.58077  ? 417  LYS A O   1 
ATOM   3215  C CB  . LYS A  1 437 ? -24.52875 -8.14985   41.88740  1.000 83.44768  ? 417  LYS A CB  1 
ATOM   3216  C CG  . LYS A  1 437 ? -24.78353 -9.43946   41.10990  1.000 88.89282  ? 417  LYS A CG  1 
ATOM   3217  C CD  . LYS A  1 437 ? -26.20849 -9.50568   40.53816  1.000 91.19452  ? 417  LYS A CD  1 
ATOM   3218  C CE  . LYS A  1 437 ? -26.40360 -10.73747  39.63113  1.000 93.10992  ? 417  LYS A CE  1 
ATOM   3219  N NZ  . LYS A  1 437 ? -27.73195 -10.78136  38.93612  1.000 91.89455  ? 417  LYS A NZ  1 
ATOM   3220  N N   . LEU A  1 438 ? -22.40372 -5.87798   43.51531  1.000 88.63768  ? 418  LEU A N   1 
ATOM   3221  C CA  . LEU A  1 438 ? -22.40868 -4.42460   43.62099  1.000 90.59151  ? 418  LEU A CA  1 
ATOM   3222  C C   . LEU A  1 438 ? -21.06300 -3.86036   44.05147  1.000 95.82961  ? 418  LEU A C   1 
ATOM   3223  O O   . LEU A  1 438 ? -20.31895 -4.46489   44.83084  1.000 91.75478  ? 418  LEU A O   1 
ATOM   3224  C CB  . LEU A  1 438 ? -23.47495 -3.94903   44.60591  1.000 85.68821  ? 418  LEU A CB  1 
ATOM   3225  C CG  . LEU A  1 438 ? -24.69116 -4.84839   44.50971  1.000 86.76043  ? 418  LEU A CG  1 
ATOM   3226  C CD1 . LEU A  1 438 ? -25.58677 -4.62588   45.74886  1.000 81.88404  ? 418  LEU A CD1 1 
ATOM   3227  C CD2 . LEU A  1 438 ? -25.38570 -4.67414   43.12519  1.000 92.43042  ? 418  LEU A CD2 1 
ATOM   3228  N N   . ASP A  1 439 ? -20.77335 -2.68607   43.49607  1.000 105.26384 ? 419  ASP A N   1 
ATOM   3229  C CA  . ASP A  1 439 ? -19.85461 -1.72121   44.07618  1.000 111.86135 ? 419  ASP A CA  1 
ATOM   3230  C C   . ASP A  1 439 ? -20.59277 -0.38405   44.10876  1.000 114.13222 ? 419  ASP A C   1 
ATOM   3231  O O   . ASP A  1 439 ? -20.42561 0.40144    45.04851  1.000 113.62462 ? 419  ASP A O   1 
ATOM   3232  C CB  . ASP A  1 439 ? -18.54535 -1.68456   43.28517  1.000 119.47473 ? 419  ASP A CB  1 
ATOM   3233  C CG  . ASP A  1 439 ? -17.72050 -2.94951   43.49745  1.000 122.04576 ? 419  ASP A CG  1 
ATOM   3234  O OD1 . ASP A  1 439 ? -17.43960 -3.26792   44.67625  1.000 121.37909 ? 419  ASP A OD1 1 
ATOM   3235  O OD2 . ASP A  1 439 ? -17.39035 -3.64185   42.50524  1.000 122.81494 ? 419  ASP A OD2 1 
ATOM   3236  N N   . LEU A  1 440 ? -21.46373 -0.15474   43.11738  1.000 115.00413 ? 420  LEU A N   1 
ATOM   3237  C CA  . LEU A  1 440 ? -22.38752 0.99246    43.10759  1.000 109.90697 ? 420  LEU A CA  1 
ATOM   3238  C C   . LEU A  1 440 ? -23.81298 0.52127    43.41651  1.000 100.52357 ? 420  LEU A C   1 
ATOM   3239  O O   . LEU A  1 440 ? -24.42984 -0.20108   42.62836  1.000 95.89415  ? 420  LEU A O   1 
ATOM   3240  C CB  . LEU A  1 440 ? -22.35017 1.73162    41.75286  1.000 111.03394 ? 420  LEU A CB  1 
ATOM   3241  C CG  . LEU A  1 440 ? -23.15364 3.03396    41.56478  1.000 106.06795 ? 420  LEU A CG  1 
ATOM   3242  C CD1 . LEU A  1 440 ? -22.43482 3.99662    40.60741  1.000 107.28338 ? 420  LEU A CD1 1 
ATOM   3243  C CD2 . LEU A  1 440 ? -24.58031 2.77209    41.08499  1.000 99.79369  ? 420  LEU A CD2 1 
ATOM   3244  N N   . VAL B  1 26  ? 1.47333   -43.03724  72.36191  1.000 123.73386 ? 6    VAL B N   1 
ATOM   3245  C CA  . VAL B  1 26  ? 0.70639   -43.44127  71.19732  1.000 102.16849 ? 6    VAL B CA  1 
ATOM   3246  C C   . VAL B  1 26  ? -0.69803  -42.80903  71.26618  1.000 91.72423  ? 6    VAL B C   1 
ATOM   3247  O O   . VAL B  1 26  ? -1.00750  -41.87925  70.50767  1.000 89.48107  ? 6    VAL B O   1 
ATOM   3248  C CB  . VAL B  1 26  ? 0.70978   -45.03423  71.03352  1.000 97.67047  ? 6    VAL B CB  1 
ATOM   3249  C CG1 . VAL B  1 26  ? 2.13855   -45.55715  71.02252  1.000 95.91416  ? 6    VAL B CG1 1 
ATOM   3250  C CG2 . VAL B  1 26  ? -0.05634  -45.79065  72.13883  1.000 92.93901  ? 6    VAL B CG2 1 
ATOM   3251  N N   . GLN B  1 27  ? -1.52781  -43.26862  72.21745  1.000 85.55902  ? 7    GLN B N   1 
ATOM   3252  C CA  . GLN B  1 27  ? -2.91894  -42.93073  72.44544  1.000 76.67753  ? 7    GLN B CA  1 
ATOM   3253  C C   . GLN B  1 27  ? -3.02127  -41.73999  73.38036  1.000 71.95268  ? 7    GLN B C   1 
ATOM   3254  O O   . GLN B  1 27  ? -2.19241  -41.57597  74.28175  1.000 77.69523  ? 7    GLN B O   1 
ATOM   3255  C CB  . GLN B  1 27  ? -3.66805  -44.10794  73.06205  1.000 75.83830  ? 7    GLN B CB  1 
ATOM   3256  C CG  . GLN B  1 27  ? -3.68433  -45.36978  72.21709  1.000 82.21697  ? 7    GLN B CG  1 
ATOM   3257  C CD  . GLN B  1 27  ? -4.45892  -46.49471  72.88027  1.000 81.70600  ? 7    GLN B CD  1 
ATOM   3258  O OE1 . GLN B  1 27  ? -5.12465  -46.28911  73.90484  1.000 78.93128  ? 7    GLN B OE1 1 
ATOM   3259  N NE2 . GLN B  1 27  ? -4.37810  -47.69461  72.29790  1.000 81.62533  ? 7    GLN B NE2 1 
ATOM   3260  N N   . PRO B  1 28  ? -4.01403  -40.88921  73.16953  1.000 58.82836  ? 8    PRO B N   1 
ATOM   3261  C CA  . PRO B  1 28  ? -4.28221  -39.84351  74.15200  1.000 53.93977  ? 8    PRO B CA  1 
ATOM   3262  C C   . PRO B  1 28  ? -4.53401  -40.48431  75.50765  1.000 55.47653  ? 8    PRO B C   1 
ATOM   3263  O O   . PRO B  1 28  ? -5.17487  -41.53358  75.60378  1.000 58.57394  ? 8    PRO B O   1 
ATOM   3264  C CB  . PRO B  1 28  ? -5.53055  -39.14371  73.59735  1.000 52.04622  ? 8    PRO B CB  1 
ATOM   3265  C CG  . PRO B  1 28  ? -6.11215  -40.09992  72.58188  1.000 53.52557  ? 8    PRO B CG  1 
ATOM   3266  C CD  . PRO B  1 28  ? -4.93613  -40.84229  72.02406  1.000 55.55304  ? 8    PRO B CD  1 
ATOM   3267  N N   . LEU B  1 29  ? -3.97984  -39.87491  76.55658  1.000 48.39858  ? 9    LEU B N   1 
ATOM   3268  C CA  . LEU B  1 29  ? -4.15512  -40.43094  77.88850  1.000 46.93768  ? 9    LEU B CA  1 
ATOM   3269  C C   . LEU B  1 29  ? -5.52864  -40.13668  78.48007  1.000 51.80108  ? 9    LEU B C   1 
ATOM   3270  O O   . LEU B  1 29  ? -5.96302  -40.85324  79.39220  1.000 52.77991  ? 9    LEU B O   1 
ATOM   3271  C CB  . LEU B  1 29  ? -3.08032  -39.90585  78.83068  1.000 51.86125  ? 9    LEU B CB  1 
ATOM   3272  C CG  . LEU B  1 29  ? -1.65058  -40.18095  78.37927  1.000 57.79188  ? 9    LEU B CG  1 
ATOM   3273  C CD1 . LEU B  1 29  ? -0.80550  -38.93935  78.59027  1.000 58.31813  ? 9    LEU B CD1 1 
ATOM   3274  C CD2 . LEU B  1 29  ? -1.04536  -41.40345  79.07480  1.000 61.32835  ? 9    LEU B CD2 1 
ATOM   3275  N N   . ALA B  1 30  ? -6.22649  -39.10555  77.99762  1.000 49.61121  ? 10   ALA B N   1 
ATOM   3276  C CA  . ALA B  1 30  ? -7.57746  -38.86972  78.49149  1.000 44.28305  ? 10   ALA B CA  1 
ATOM   3277  C C   . ALA B  1 30  ? -8.49599  -40.06336  78.24545  1.000 43.78333  ? 10   ALA B C   1 
ATOM   3278  O O   . ALA B  1 30  ? -9.50847  -40.20794  78.94118  1.000 45.14124  ? 10   ALA B O   1 
ATOM   3279  C CB  . ALA B  1 30  ? -8.15397  -37.61868  77.84880  1.000 39.30600  ? 10   ALA B CB  1 
ATOM   3280  N N   . ARG B  1 31  ? -8.16824  -40.92233  77.27654  1.000 43.92261  ? 11   ARG B N   1 
ATOM   3281  C CA  . ARG B  1 31  ? -8.96203  -42.13192  77.07554  1.000 51.41747  ? 11   ARG B CA  1 
ATOM   3282  C C   . ARG B  1 31  ? -8.98931  -42.98964  78.33139  1.000 51.62385  ? 11   ARG B C   1 
ATOM   3283  O O   . ARG B  1 31  ? -9.98946  -43.65336  78.60872  1.000 57.97996  ? 11   ARG B O   1 
ATOM   3284  C CB  . ARG B  1 31  ? -8.41622  -42.95815  75.89986  1.000 54.47583  ? 11   ARG B CB  1 
ATOM   3285  C CG  . ARG B  1 31  ? -8.78246  -42.43857  74.52273  1.000 54.68992  ? 11   ARG B CG  1 
ATOM   3286  C CD  . ARG B  1 31  ? -8.44272  -43.48395  73.47939  1.000 59.62985  ? 11   ARG B CD  1 
ATOM   3287  N NE  . ARG B  1 31  ? -8.34926  -42.95735  72.11767  1.000 60.96371  ? 11   ARG B NE  1 
ATOM   3288  C CZ  . ARG B  1 31  ? -7.78640  -43.61479  71.10929  1.000 61.76808  ? 11   ARG B CZ  1 
ATOM   3289  N NH1 . ARG B  1 31  ? -7.27019  -44.81853  71.32039  1.000 63.86716  ? 11   ARG B NH1 1 
ATOM   3290  N NH2 . ARG B  1 31  ? -7.73632  -43.07810  69.89496  1.000 61.24600  ? 11   ARG B NH2 1 
ATOM   3291  N N   . ASP B  1 32  ? -7.90761  -42.98567  79.09894  1.000 49.44486  ? 12   ASP B N   1 
ATOM   3292  C CA  . ASP B  1 32  ? -7.73749  -43.86682  80.24011  1.000 49.48851  ? 12   ASP B CA  1 
ATOM   3293  C C   . ASP B  1 32  ? -7.99592  -43.17231  81.56198  1.000 47.80567  ? 12   ASP B C   1 
ATOM   3294  O O   . ASP B  1 32  ? -7.59382  -43.69699  82.60854  1.000 47.05202  ? 12   ASP B O   1 
ATOM   3295  C CB  . ASP B  1 32  ? -6.32613  -44.45052  80.24070  1.000 59.06113  ? 12   ASP B CB  1 
ATOM   3296  C CG  . ASP B  1 32  ? -6.16381  -45.55976  79.24016  1.000 68.63163  ? 12   ASP B CG  1 
ATOM   3297  O OD1 . ASP B  1 32  ? -7.15439  -46.29046  79.02862  1.000 65.48321  ? 12   ASP B OD1 1 
ATOM   3298  O OD2 . ASP B  1 32  ? -5.05301  -45.70285  78.67399  1.000 77.42537  ? 12   ASP B OD2 1 
ATOM   3299  N N   . ALA B  1 33  ? -8.64103  -42.00446  81.53664  1.000 47.27820  ? 13   ALA B N   1 
ATOM   3300  C CA  . ALA B  1 33  ? -8.77738  -41.15392  82.70797  1.000 44.35484  ? 13   ALA B CA  1 
ATOM   3301  C C   . ALA B  1 33  ? -10.22273 -41.11607  83.18372  1.000 44.84933  ? 13   ALA B C   1 
ATOM   3302  O O   . ALA B  1 33  ? -11.17349 -41.22009  82.39297  1.000 48.33251  ? 13   ALA B O   1 
ATOM   3303  C CB  . ALA B  1 33  ? -8.29615  -39.72395  82.41750  1.000 43.73177  ? 13   ALA B CB  1 
ATOM   3304  N N   . MET B  1 34  ? -10.37630 -40.99134  84.49395  1.000 39.96944  ? 14   MET B N   1 
ATOM   3305  C CA  . MET B  1 34  ? -11.66566 -40.71263  85.10564  1.000 40.00248  ? 14   MET B CA  1 
ATOM   3306  C C   . MET B  1 34  ? -11.55824 -39.38027  85.83719  1.000 41.85043  ? 14   MET B C   1 
ATOM   3307  O O   . MET B  1 34  ? -10.70448 -39.23010  86.71837  1.000 43.05749  ? 14   MET B O   1 
ATOM   3308  C CB  . MET B  1 34  ? -12.07485 -41.82468  86.06668  1.000 41.38389  ? 14   MET B CB  1 
ATOM   3309  C CG  . MET B  1 34  ? -13.50474 -41.68944  86.56042  1.000 43.38956  ? 14   MET B CG  1 
ATOM   3310  S SD  . MET B  1 34  ? -13.87836 -42.85786  87.87975  1.000 49.09095  ? 14   MET B SD  1 
ATOM   3311  C CE  . MET B  1 34  ? -15.54233 -42.33597  88.27350  1.000 51.51633  ? 14   MET B CE  1 
ATOM   3312  N N   . ALA B  1 35  ? -12.40046 -38.41161  85.45382  1.000 37.49355  ? 15   ALA B N   1 
ATOM   3313  C CA  . ALA B  1 35  ? -12.49580 -37.14344  86.17788  1.000 35.68257  ? 15   ALA B CA  1 
ATOM   3314  C C   . ALA B  1 35  ? -13.40136 -37.31190  87.38829  1.000 40.98752  ? 15   ALA B C   1 
ATOM   3315  O O   . ALA B  1 35  ? -14.51616 -37.83450  87.26860  1.000 49.78265  ? 15   ALA B O   1 
ATOM   3316  C CB  . ALA B  1 35  ? -13.03866 -36.03008  85.27950  1.000 30.87948  ? 15   ALA B CB  1 
ATOM   3317  N N   . TYR B  1 36  ? -12.92988 -36.86877  88.55286  1.000 41.63505  ? 16   TYR B N   1 
ATOM   3318  C CA  . TYR B  1 36  ? -13.66468 -37.02250  89.80474  1.000 39.71028  ? 16   TYR B CA  1 
ATOM   3319  C C   . TYR B  1 36  ? -13.84589 -35.64763  90.45034  1.000 42.04323  ? 16   TYR B C   1 
ATOM   3320  O O   . TYR B  1 36  ? -12.88974 -35.08117  90.99669  1.000 40.93086  ? 16   TYR B O   1 
ATOM   3321  C CB  . TYR B  1 36  ? -12.94626 -37.99696  90.74265  1.000 43.59310  ? 16   TYR B CB  1 
ATOM   3322  C CG  . TYR B  1 36  ? -13.88851 -38.57272  91.76844  1.000 47.42534  ? 16   TYR B CG  1 
ATOM   3323  C CD1 . TYR B  1 36  ? -14.10872 -37.92068  92.97593  1.000 52.18139  ? 16   TYR B CD1 1 
ATOM   3324  C CD2 . TYR B  1 36  ? -14.59891 -39.73174  91.51117  1.000 45.34914  ? 16   TYR B CD2 1 
ATOM   3325  C CE1 . TYR B  1 36  ? -14.99362 -38.42177  93.90063  1.000 52.19378  ? 16   TYR B CE1 1 
ATOM   3326  C CE2 . TYR B  1 36  ? -15.48068 -40.23360  92.42887  1.000 47.67897  ? 16   TYR B CE2 1 
ATOM   3327  C CZ  . TYR B  1 36  ? -15.67727 -39.57903  93.61942  1.000 51.36466  ? 16   TYR B CZ  1 
ATOM   3328  O OH  . TYR B  1 36  ? -16.55903 -40.09374  94.54139  1.000 55.27197  ? 16   TYR B OH  1 
ATOM   3329  N N   . VAL B  1 37  ? -15.08311 -35.13771  90.42054  1.000 40.86854  ? 17   VAL B N   1 
ATOM   3330  C CA  . VAL B  1 37  ? -15.39437 -33.74739  90.73988  1.000 40.05417  ? 17   VAL B CA  1 
ATOM   3331  C C   . VAL B  1 37  ? -15.87174 -33.65018  92.18523  1.000 42.47464  ? 17   VAL B C   1 
ATOM   3332  O O   . VAL B  1 37  ? -16.89419 -34.23941  92.55072  1.000 43.59072  ? 17   VAL B O   1 
ATOM   3333  C CB  . VAL B  1 37  ? -16.45710 -33.17681  89.78623  1.000 36.65963  ? 17   VAL B CB  1 
ATOM   3334  C CG1 . VAL B  1 37  ? -16.80540 -31.73849  90.18125  1.000 35.00127  ? 17   VAL B CG1 1 
ATOM   3335  C CG2 . VAL B  1 37  ? -15.98075 -33.23944  88.33511  1.000 35.22087  ? 17   VAL B CG2 1 
ATOM   3336  N N   . LEU B  1 38  ? -15.15592 -32.88509  93.00686  1.000 42.60604  ? 18   LEU B N   1 
ATOM   3337  C CA  . LEU B  1 38  ? -15.57650 -32.63511  94.38364  1.000 43.76534  ? 18   LEU B CA  1 
ATOM   3338  C C   . LEU B  1 38  ? -16.53264 -31.45096  94.36739  1.000 44.63384  ? 18   LEU B C   1 
ATOM   3339  O O   . LEU B  1 38  ? -16.12666 -30.31566  94.08055  1.000 42.20741  ? 18   LEU B O   1 
ATOM   3340  C CB  . LEU B  1 38  ? -14.37536 -32.36990  95.28306  1.000 40.91145  ? 18   LEU B CB  1 
ATOM   3341  C CG  . LEU B  1 38  ? -13.33936 -33.48710  95.17318  1.000 48.37552  ? 18   LEU B CG  1 
ATOM   3342  C CD1 . LEU B  1 38  ? -12.10121 -33.13784  95.97220  1.000 53.91912  ? 18   LEU B CD1 1 
ATOM   3343  C CD2 . LEU B  1 38  ? -13.93437 -34.81740  95.63086  1.000 44.58178  ? 18   LEU B CD2 1 
ATOM   3344  N N   . ALA B  1 39  ? -17.80468 -31.71357  94.65360  1.000 42.51748  ? 19   ALA B N   1 
ATOM   3345  C CA  . ALA B  1 39  ? -18.82490 -30.67527  94.58411  1.000 42.21665  ? 19   ALA B CA  1 
ATOM   3346  C C   . ALA B  1 39  ? -19.62518 -30.58793  95.87573  1.000 45.81114  ? 19   ALA B C   1 
ATOM   3347  O O   . ALA B  1 39  ? -20.81791 -30.28707  95.85054  1.000 47.75639  ? 19   ALA B O   1 
ATOM   3348  C CB  . ALA B  1 39  ? -19.75289 -30.90880  93.39421  1.000 41.22173  ? 19   ALA B CB  1 
ATOM   3349  N N   . GLY B  1 40  ? -18.99453 -30.84072  97.01480  1.000 49.66261  ? 20   GLY B N   1 
ATOM   3350  C CA  . GLY B  1 40  ? -19.71612 -30.70671  98.26310  1.000 50.65062  ? 20   GLY B CA  1 
ATOM   3351  C C   . GLY B  1 40  ? -19.64589 -29.34625  98.94028  1.000 54.56002  ? 20   GLY B C   1 
ATOM   3352  O O   . GLY B  1 40  ? -20.28512 -29.15314  99.98206  1.000 56.99076  ? 20   GLY B O   1 
ATOM   3353  N N   . GLY B  1 41  ? -18.91985 -28.38644  98.37227  1.000 54.70829  ? 21   GLY B N   1 
ATOM   3354  C CA  . GLY B  1 41  ? -18.57178 -27.18247  99.11664  1.000 60.36107  ? 21   GLY B CA  1 
ATOM   3355  C C   . GLY B  1 41  ? -19.77030 -26.30592  99.46146  1.000 61.06936  ? 21   GLY B C   1 
ATOM   3356  O O   . GLY B  1 41  ? -20.65019 -26.05355  98.63394  1.000 60.14092  ? 21   GLY B O   1 
ATOM   3357  N N   . ARG B  1 42  ? -19.77253 -25.80067  100.70212 1.000 60.45995  ? 22   ARG B N   1 
ATOM   3358  C CA  . ARG B  1 42  ? -20.86723 -24.94853  101.15591 1.000 60.07690  ? 22   ARG B CA  1 
ATOM   3359  C C   . ARG B  1 42  ? -20.85272 -23.59927  100.44924 1.000 59.99902  ? 22   ARG B C   1 
ATOM   3360  O O   . ARG B  1 42  ? -21.91127 -23.06134  100.11036 1.000 64.69165  ? 22   ARG B O   1 
ATOM   3361  C CB  . ARG B  1 42  ? -20.79644 -24.75599  102.67487 1.000 62.60500  ? 22   ARG B CB  1 
ATOM   3362  N N   . GLY B  1 43  ? -19.66942 -23.04164  100.20809 1.000 57.66464  ? 23   GLY B N   1 
ATOM   3363  C CA  . GLY B  1 43  ? -19.56999 -21.67707  99.72669  1.000 56.03018  ? 23   GLY B CA  1 
ATOM   3364  C C   . GLY B  1 43  ? -20.12204 -20.70478  100.74964 1.000 60.48237  ? 23   GLY B C   1 
ATOM   3365  O O   . GLY B  1 43  ? -20.95447 -19.85262  100.42304 1.000 59.98260  ? 23   GLY B O   1 
ATOM   3366  N N   . SER B  1 44  ? -19.63889 -20.82460  101.99210 1.000 64.69044  ? 24   SER B N   1 
ATOM   3367  C CA  . SER B  1 44  ? -20.27646 -20.16415  103.13041 1.000 65.63551  ? 24   SER B CA  1 
ATOM   3368  C C   . SER B  1 44  ? -20.20167 -18.64736  103.03075 1.000 62.85457  ? 24   SER B C   1 
ATOM   3369  O O   . SER B  1 44  ? -21.14233 -17.94917  103.43817 1.000 63.42518  ? 24   SER B O   1 
ATOM   3370  C CB  . SER B  1 44  ? -19.64192 -20.63139  104.44466 1.000 70.84302  ? 24   SER B CB  1 
ATOM   3371  O OG  . SER B  1 44  ? -20.18670 -21.86880  104.87784 1.000 72.89005  ? 24   SER B OG  1 
ATOM   3372  N N   . ARG B  1 45  ? -19.10401 -18.10786  102.50749 1.000 61.10018  ? 25   ARG B N   1 
ATOM   3373  C CA  . ARG B  1 45  ? -19.00592 -16.65093  102.48020 1.000 66.68217  ? 25   ARG B CA  1 
ATOM   3374  C C   . ARG B  1 45  ? -19.71143 -16.03276  101.27395 1.000 62.90257  ? 25   ARG B C   1 
ATOM   3375  O O   . ARG B  1 45  ? -19.56967 -14.82989  101.02280 1.000 67.83116  ? 25   ARG B O   1 
ATOM   3376  C CB  . ARG B  1 45  ? -17.53727 -16.21801  102.57720 1.000 71.50106  ? 25   ARG B CB  1 
ATOM   3377  C CG  . ARG B  1 45  ? -16.93568 -16.53059  103.97301 1.000 79.24374  ? 25   ARG B CG  1 
ATOM   3378  C CD  . ARG B  1 45  ? -15.96128 -15.45345  104.47522 1.000 86.35018  ? 25   ARG B CD  1 
ATOM   3379  N NE  . ARG B  1 45  ? -16.09823 -15.15449  105.91034 1.000 90.13765  ? 25   ARG B NE  1 
ATOM   3380  C CZ  . ARG B  1 45  ? -16.03852 -13.92577  106.42352 1.000 90.60775  ? 25   ARG B CZ  1 
ATOM   3381  N NH1 . ARG B  1 45  ? -15.84804 -12.89201  105.61688 1.000 89.38092  ? 25   ARG B NH1 1 
ATOM   3382  N NH2 . ARG B  1 45  ? -16.16225 -13.72539  107.73496 1.000 92.98251  ? 25   ARG B NH2 1 
ATOM   3383  N N   . LEU B  1 46  ? -20.48513 -16.83140  100.54332 1.000 55.84637  ? 26   LEU B N   1 
ATOM   3384  C CA  . LEU B  1 46  ? -21.50247 -16.32607  99.63776  1.000 54.56494  ? 26   LEU B CA  1 
ATOM   3385  C C   . LEU B  1 46  ? -22.83464 -16.10579  100.34664 1.000 57.56532  ? 26   LEU B C   1 
ATOM   3386  O O   . LEU B  1 46  ? -23.75990 -15.53543  99.75452  1.000 58.66607  ? 26   LEU B O   1 
ATOM   3387  C CB  . LEU B  1 46  ? -21.68308 -17.29107  98.46270  1.000 51.16069  ? 26   LEU B CB  1 
ATOM   3388  C CG  . LEU B  1 46  ? -20.50803 -17.33385  97.47943  1.000 49.22408  ? 26   LEU B CG  1 
ATOM   3389  C CD1 . LEU B  1 46  ? -20.67483 -18.45183  96.44211  1.000 42.66155  ? 26   LEU B CD1 1 
ATOM   3390  C CD2 . LEU B  1 46  ? -20.34705 -15.96753  96.80944  1.000 48.95936  ? 26   LEU B CD2 1 
ATOM   3391  N N   . LYS B  1 47  ? -22.95370 -16.56581  101.58968 1.000 57.04025  ? 27   LYS B N   1 
ATOM   3392  C CA  . LYS B  1 47  ? -24.06910 -16.20540  102.45026 1.000 55.76314  ? 27   LYS B CA  1 
ATOM   3393  C C   . LYS B  1 47  ? -25.39484 -16.73761  101.91987 1.000 55.14794  ? 27   LYS B C   1 
ATOM   3394  O O   . LYS B  1 47  ? -25.49588 -17.91909  101.56408 1.000 52.78233  ? 27   LYS B O   1 
ATOM   3395  C CB  . LYS B  1 47  ? -24.09887 -14.68544  102.62203 1.000 57.36027  ? 27   LYS B CB  1 
ATOM   3396  C CG  . LYS B  1 47  ? -22.81669 -14.12939  103.23902 1.000 57.71271  ? 27   LYS B CG  1 
ATOM   3397  C CD  . LYS B  1 47  ? -22.47678 -14.82513  104.56106 1.000 60.73133  ? 27   LYS B CD  1 
ATOM   3398  C CE  . LYS B  1 47  ? -21.04535 -14.56522  105.02658 1.000 64.91469  ? 27   LYS B CE  1 
ATOM   3399  N NZ  . LYS B  1 47  ? -20.95748 -13.38754  105.92048 1.000 74.06909  ? 27   LYS B NZ  1 
ATOM   3400  N N   . GLU B  1 48  ? -26.42432 -15.88612  101.86959 1.000 55.20914  ? 28   GLU B N   1 
ATOM   3401  C CA  . GLU B  1 48  ? -27.75207 -16.36768  101.49592 1.000 53.36050  ? 28   GLU B CA  1 
ATOM   3402  C C   . GLU B  1 48  ? -27.81412 -16.91272  100.06894 1.000 50.97141  ? 28   GLU B C   1 
ATOM   3403  O O   . GLU B  1 48  ? -28.78135 -17.60707  99.73575  1.000 47.83568  ? 28   GLU B O   1 
ATOM   3404  C CB  . GLU B  1 48  ? -28.77553 -15.25271  101.68578 1.000 56.53008  ? 28   GLU B CB  1 
ATOM   3405  C CG  . GLU B  1 48  ? -28.93380 -14.80217  103.13721 1.000 60.23590  ? 28   GLU B CG  1 
ATOM   3406  C CD  . GLU B  1 48  ? -27.92110 -13.75030  103.53298 1.000 61.55492  ? 28   GLU B CD  1 
ATOM   3407  O OE1 . GLU B  1 48  ? -27.77894 -13.47967  104.74635 1.000 60.18404  ? 28   GLU B OE1 1 
ATOM   3408  O OE2 . GLU B  1 48  ? -27.26268 -13.20390  102.62214 1.000 63.31767  ? 28   GLU B OE2 1 
ATOM   3409  N N   . LEU B  1 49  ? -26.79517 -16.64676  99.24099  1.000 51.31847  ? 29   LEU B N   1 
ATOM   3410  C CA  . LEU B  1 49  ? -26.75098 -17.15469  97.87006  1.000 53.45522  ? 29   LEU B CA  1 
ATOM   3411  C C   . LEU B  1 49  ? -26.61707 -18.67790  97.82440  1.000 54.13861  ? 29   LEU B C   1 
ATOM   3412  O O   . LEU B  1 49  ? -27.05064 -19.32093  96.85693  1.000 46.14153  ? 29   LEU B O   1 
ATOM   3413  C CB  . LEU B  1 49  ? -25.58831 -16.48533  97.13637  1.000 56.31183  ? 29   LEU B CB  1 
ATOM   3414  C CG  . LEU B  1 49  ? -25.60402 -16.20704  95.63688  1.000 57.89724  ? 29   LEU B CG  1 
ATOM   3415  C CD1 . LEU B  1 49  ? -26.77904 -15.32702  95.24573  1.000 57.76608  ? 29   LEU B CD1 1 
ATOM   3416  C CD2 . LEU B  1 49  ? -24.30090 -15.53757  95.24155  1.000 57.51436  ? 29   LEU B CD2 1 
ATOM   3417  N N   . THR B  1 50  ? -26.02016 -19.27539  98.85136  1.000 57.46616  ? 30   THR B N   1 
ATOM   3418  C CA  . THR B  1 50  ? -25.91764 -20.72671  98.92887  1.000 52.94211  ? 30   THR B CA  1 
ATOM   3419  C C   . THR B  1 50  ? -26.70831 -21.28798  100.10419 1.000 58.50433  ? 30   THR B C   1 
ATOM   3420  O O   . THR B  1 50  ? -26.39265 -22.37707  100.59349 1.000 56.81885  ? 30   THR B O   1 
ATOM   3421  C CB  . THR B  1 50  ? -24.45905 -21.17628  99.03143  1.000 45.18432  ? 30   THR B CB  1 
ATOM   3422  O OG1 . THR B  1 50  ? -23.88571 -20.67287  100.23508 1.000 46.00453  ? 30   THR B OG1 1 
ATOM   3423  C CG2 . THR B  1 50  ? -23.65010 -20.70435  97.84027  1.000 43.87007  ? 30   THR B CG2 1 
ATOM   3424  N N   . ASP B  1 51  ? -27.72346 -20.56229  100.57952 1.000 64.03783  ? 31   ASP B N   1 
ATOM   3425  C CA  . ASP B  1 51  ? -28.45783 -21.02798  101.75223 1.000 70.58835  ? 31   ASP B CA  1 
ATOM   3426  C C   . ASP B  1 51  ? -29.17498 -22.33838  101.46265 1.000 73.66151  ? 31   ASP B C   1 
ATOM   3427  O O   . ASP B  1 51  ? -29.30448 -23.19426  102.34849 1.000 75.40534  ? 31   ASP B O   1 
ATOM   3428  C CB  . ASP B  1 51  ? -29.44988 -19.96136  102.22012 1.000 72.27102  ? 31   ASP B CB  1 
ATOM   3429  C CG  . ASP B  1 51  ? -28.88583 -19.08177  103.33281 1.000 75.17968  ? 31   ASP B CG  1 
ATOM   3430  O OD1 . ASP B  1 51  ? -27.76587 -19.36126  103.80561 1.000 75.57775  ? 31   ASP B OD1 1 
ATOM   3431  O OD2 . ASP B  1 51  ? -29.55933 -18.10726  103.73140 1.000 76.97462  ? 31   ASP B OD2 1 
ATOM   3432  N N   . ARG B  1 52  ? -29.64166 -22.51887  100.22333 1.000 74.19508  ? 32   ARG B N   1 
ATOM   3433  C CA  . ARG B  1 52  ? -30.27295 -23.77124  99.82857  1.000 77.03714  ? 32   ARG B CA  1 
ATOM   3434  C C   . ARG B  1 52  ? -29.68318 -24.39719  98.57163  1.000 73.33971  ? 32   ARG B C   1 
ATOM   3435  O O   . ARG B  1 52  ? -30.21458 -25.40662  98.10068  1.000 78.87994  ? 32   ARG B O   1 
ATOM   3436  C CB  . ARG B  1 52  ? -31.77804 -23.59658  99.64795  1.000 82.22158  ? 32   ARG B CB  1 
ATOM   3437  C CG  . ARG B  1 52  ? -32.46691 -23.61627  100.94970 1.000 89.12737  ? 32   ARG B CG  1 
ATOM   3438  C CD  . ARG B  1 52  ? -32.65069 -25.05137  101.35852 1.000 94.53841  ? 32   ARG B CD  1 
ATOM   3439  N NE  . ARG B  1 52  ? -33.90643 -25.08531  102.06716 1.000 102.04655 ? 32   ARG B NE  1 
ATOM   3440  C CZ  . ARG B  1 52  ? -35.02398 -25.64361  101.61573 1.000 102.77775 ? 32   ARG B CZ  1 
ATOM   3441  N NH1 . ARG B  1 52  ? -35.04268 -26.27508  100.43670 1.000 100.25761 ? 32   ARG B NH1 1 
ATOM   3442  N NH2 . ARG B  1 52  ? -36.12545 -25.53661  102.34749 1.000 102.61573 ? 32   ARG B NH2 1 
ATOM   3443  N N   . ARG B  1 53  ? -28.59905 -23.84774  98.03150  1.000 63.93995  ? 33   ARG B N   1 
ATOM   3444  C CA  . ARG B  1 53  ? -27.85810 -24.45213  96.93662  1.000 57.81923  ? 33   ARG B CA  1 
ATOM   3445  C C   . ARG B  1 53  ? -26.41343 -24.59708  97.36792  1.000 53.99020  ? 33   ARG B C   1 
ATOM   3446  O O   . ARG B  1 53  ? -25.87038 -23.68861  97.99685  1.000 57.13592  ? 33   ARG B O   1 
ATOM   3447  C CB  . ARG B  1 53  ? -27.89464 -23.58691  95.66185  1.000 61.22633  ? 33   ARG B CB  1 
ATOM   3448  C CG  . ARG B  1 53  ? -29.13821 -22.76129  95.50067  1.000 68.56835  ? 33   ARG B CG  1 
ATOM   3449  C CD  . ARG B  1 53  ? -29.09232 -21.92095  94.23898  1.000 74.61300  ? 33   ARG B CD  1 
ATOM   3450  N NE  . ARG B  1 53  ? -30.45125 -21.54652  93.83992  1.000 82.77526  ? 33   ARG B NE  1 
ATOM   3451  C CZ  . ARG B  1 53  ? -31.19532 -22.24310  92.98110  1.000 83.88371  ? 33   ARG B CZ  1 
ATOM   3452  N NH1 . ARG B  1 53  ? -30.69776 -23.32793  92.40222  1.000 80.41514  ? 33   ARG B NH1 1 
ATOM   3453  N NH2 . ARG B  1 53  ? -32.42800 -21.84540  92.68106  1.000 84.97497  ? 33   ARG B NH2 1 
ATOM   3454  N N   . ALA B  1 54  ? -25.78332 -25.71948  97.01702  1.000 45.77027  ? 34   ALA B N   1 
ATOM   3455  C CA  . ALA B  1 54  ? -24.33060 -25.80503  97.10725  1.000 41.79773  ? 34   ALA B CA  1 
ATOM   3456  C C   . ALA B  1 54  ? -23.69941 -24.82829  96.12155  1.000 43.94715  ? 34   ALA B C   1 
ATOM   3457  O O   . ALA B  1 54  ? -24.29923 -24.46881  95.09709  1.000 39.23036  ? 34   ALA B O   1 
ATOM   3458  C CB  . ALA B  1 54  ? -23.83447 -27.22688  96.81755  1.000 41.72137  ? 34   ALA B CB  1 
ATOM   3459  N N   . LYS B  1 55  ? -22.47574 -24.38902  96.45172  1.000 45.16310  ? 35   LYS B N   1 
ATOM   3460  C CA  . LYS B  1 55  ? -21.77509 -23.43146  95.59855  1.000 42.43013  ? 35   LYS B CA  1 
ATOM   3461  C C   . LYS B  1 55  ? -21.63257 -23.90803  94.16200  1.000 44.59184  ? 35   LYS B C   1 
ATOM   3462  O O   . LYS B  1 55  ? -21.91073 -23.11323  93.24933  1.000 45.05457  ? 35   LYS B O   1 
ATOM   3463  C CB  . LYS B  1 55  ? -20.40368 -23.08977  96.19023  1.000 41.44330  ? 35   LYS B CB  1 
ATOM   3464  C CG  . LYS B  1 55  ? -19.59396 -22.19975  95.25410  1.000 40.09082  ? 35   LYS B CG  1 
ATOM   3465  C CD  . LYS B  1 55  ? -18.35313 -21.66277  95.90939  1.000 40.07987  ? 35   LYS B CD  1 
ATOM   3466  C CE  . LYS B  1 55  ? -17.50076 -20.92621  94.89492  1.000 42.60658  ? 35   LYS B CE  1 
ATOM   3467  N NZ  . LYS B  1 55  ? -16.09029 -20.72917  95.36782  1.000 42.99185  ? 35   LYS B NZ  1 
ATOM   3468  N N   . PRO B  1 56  ? -21.21500 -25.14914  93.87476  1.000 44.99803  ? 36   PRO B N   1 
ATOM   3469  C CA  . PRO B  1 56  ? -21.10221 -25.55525  92.46397  1.000 43.76165  ? 36   PRO B CA  1 
ATOM   3470  C C   . PRO B  1 56  ? -22.40033 -25.40332  91.68075  1.000 42.75321  ? 36   PRO B C   1 
ATOM   3471  O O   . PRO B  1 56  ? -22.33913 -25.28933  90.45080  1.000 43.66728  ? 36   PRO B O   1 
ATOM   3472  C CB  . PRO B  1 56  ? -20.66437 -27.02541  92.55244  1.000 37.97481  ? 36   PRO B CB  1 
ATOM   3473  C CG  . PRO B  1 56  ? -20.01472 -27.12718  93.87591  1.000 39.03004  ? 36   PRO B CG  1 
ATOM   3474  C CD  . PRO B  1 56  ? -20.81519 -26.24810  94.77245  1.000 40.35035  ? 36   PRO B CD  1 
ATOM   3475  N N   . ALA B  1 57  ? -23.56074 -25.37355  92.34818  1.000 37.38393  ? 37   ALA B N   1 
ATOM   3476  C CA  . ALA B  1 57  ? -24.85149 -25.20949  91.68682  1.000 35.13346  ? 37   ALA B CA  1 
ATOM   3477  C C   . ALA B  1 57  ? -25.26260 -23.75620  91.51984  1.000 38.10014  ? 37   ALA B C   1 
ATOM   3478  O O   . ALA B  1 57  ? -26.34538 -23.49236  90.97754  1.000 43.81072  ? 37   ALA B O   1 
ATOM   3479  C CB  . ALA B  1 57  ? -25.95431 -25.96247  92.44834  1.000 36.72615  ? 37   ALA B CB  1 
ATOM   3480  N N   . VAL B  1 58  ? -24.43698 -22.81108  91.96983  1.000 39.04886  ? 38   VAL B N   1 
ATOM   3481  C CA  . VAL B  1 58  ? -24.73204 -21.39219  91.78785  1.000 37.45939  ? 38   VAL B CA  1 
ATOM   3482  C C   . VAL B  1 58  ? -24.57029 -20.99370  90.31796  1.000 34.20188  ? 38   VAL B C   1 
ATOM   3483  O O   . VAL B  1 58  ? -23.62434 -21.40337  89.63163  1.000 31.58137  ? 38   VAL B O   1 
ATOM   3484  C CB  . VAL B  1 58  ? -23.82643 -20.55309  92.71179  1.000 40.52172  ? 38   VAL B CB  1 
ATOM   3485  C CG1 . VAL B  1 58  ? -23.92773 -19.06737  92.39333  1.000 36.63828  ? 38   VAL B CG1 1 
ATOM   3486  C CG2 . VAL B  1 58  ? -24.15292 -20.82610  94.19202  1.000 38.46656  ? 38   VAL B CG2 1 
ATOM   3487  N N   . TYR B  1 59  ? -25.50758 -20.19587  89.82411  1.000 38.38892  ? 39   TYR B N   1 
ATOM   3488  C CA  . TYR B  1 59  ? -25.46875 -19.71526  88.45050  1.000 39.26096  ? 39   TYR B CA  1 
ATOM   3489  C C   . TYR B  1 59  ? -24.28320 -18.78742  88.21197  1.000 45.20634  ? 39   TYR B C   1 
ATOM   3490  O O   . TYR B  1 59  ? -23.86862 -18.02127  89.09424  1.000 49.62556  ? 39   TYR B O   1 
ATOM   3491  C CB  . TYR B  1 59  ? -26.75747 -18.96980  88.12622  1.000 40.41815  ? 39   TYR B CB  1 
ATOM   3492  C CG  . TYR B  1 59  ? -27.95282 -19.87541  88.10393  1.000 49.36983  ? 39   TYR B CG  1 
ATOM   3493  C CD1 . TYR B  1 59  ? -28.27177 -20.60720  86.96024  1.000 52.73045  ? 39   TYR B CD1 1 
ATOM   3494  C CD2 . TYR B  1 59  ? -28.75483 -20.02237  89.22771  1.000 50.75699  ? 39   TYR B CD2 1 
ATOM   3495  C CE1 . TYR B  1 59  ? -29.36548 -21.44987  86.93437  1.000 56.50181  ? 39   TYR B CE1 1 
ATOM   3496  C CE2 . TYR B  1 59  ? -29.85620 -20.87048  89.21024  1.000 57.12594  ? 39   TYR B CE2 1 
ATOM   3497  C CZ  . TYR B  1 59  ? -30.15491 -21.58006  88.06291  1.000 60.80700  ? 39   TYR B CZ  1 
ATOM   3498  O OH  . TYR B  1 59  ? -31.25304 -22.42093  88.04603  1.000 70.31768  ? 39   TYR B OH  1 
ATOM   3499  N N   . PHE B  1 60  ? -23.74701 -18.84811  86.99210  1.000 42.50827  ? 40   PHE B N   1 
ATOM   3500  C CA  . PHE B  1 60  ? -22.68628 -17.93907  86.59471  1.000 41.49468  ? 40   PHE B CA  1 
ATOM   3501  C C   . PHE B  1 60  ? -22.74328 -17.66214  85.10398  1.000 38.74561  ? 40   PHE B C   1 
ATOM   3502  O O   . PHE B  1 60  ? -22.90052 -18.57899  84.30185  1.000 44.92608  ? 40   PHE B O   1 
ATOM   3503  C CB  . PHE B  1 60  ? -21.29571 -18.47886  86.92944  1.000 42.83500  ? 40   PHE B CB  1 
ATOM   3504  C CG  . PHE B  1 60  ? -20.18653 -17.56020  86.47968  1.000 45.51043  ? 40   PHE B CG  1 
ATOM   3505  C CD1 . PHE B  1 60  ? -19.83369 -16.45663  87.23967  1.000 50.24180  ? 40   PHE B CD1 1 
ATOM   3506  C CD2 . PHE B  1 60  ? -19.54208 -17.76580  85.28355  1.000 43.80932  ? 40   PHE B CD2 1 
ATOM   3507  C CE1 . PHE B  1 60  ? -18.83087 -15.60426  86.82574  1.000 52.19696  ? 40   PHE B CE1 1 
ATOM   3508  C CE2 . PHE B  1 60  ? -18.53549 -16.92267  84.87384  1.000 50.44472  ? 40   PHE B CE2 1 
ATOM   3509  C CZ  . PHE B  1 60  ? -18.17981 -15.83808  85.64138  1.000 51.78586  ? 40   PHE B CZ  1 
ATOM   3510  N N   . GLY B  1 61  ? -22.57516 -16.39960  84.74137  1.000 36.21259  ? 41   GLY B N   1 
ATOM   3511  C CA  . GLY B  1 61  ? -22.28059 -16.03782  83.37637  1.000 41.80741  ? 41   GLY B CA  1 
ATOM   3512  C C   . GLY B  1 61  ? -23.48151 -15.76592  82.50799  1.000 46.25148  ? 41   GLY B C   1 
ATOM   3513  O O   . GLY B  1 61  ? -23.31213 -15.33565  81.36204  1.000 48.32100  ? 41   GLY B O   1 
ATOM   3514  N N   . GLY B  1 62  ? -24.68784 -15.98658  83.00363  1.000 45.61193  ? 42   GLY B N   1 
ATOM   3515  C CA  . GLY B  1 62  ? -25.83063 -15.77046  82.14738  1.000 50.66989  ? 42   GLY B CA  1 
ATOM   3516  C C   . GLY B  1 62  ? -26.68523 -17.01023  82.00436  1.000 59.26249  ? 42   GLY B C   1 
ATOM   3517  O O   . GLY B  1 62  ? -27.92150 -16.92227  82.01112  1.000 67.05857  ? 42   GLY B O   1 
ATOM   3518  N N   . LYS B  1 63  ? -26.05164 -18.17769  81.86512  1.000 55.95753  ? 43   LYS B N   1 
ATOM   3519  C CA  . LYS B  1 63  ? -26.82552 -19.41717  81.76468  1.000 54.28203  ? 43   LYS B CA  1 
ATOM   3520  C C   . LYS B  1 63  ? -26.27041 -20.56906  82.59812  1.000 50.07553  ? 43   LYS B C   1 
ATOM   3521  O O   . LYS B  1 63  ? -27.01409 -21.14943  83.39320  1.000 56.37787  ? 43   LYS B O   1 
ATOM   3522  C CB  . LYS B  1 63  ? -26.96571 -19.85153  80.30518  1.000 56.03515  ? 43   LYS B CB  1 
ATOM   3523  C CG  . LYS B  1 63  ? -28.06503 -19.12642  79.54311  1.000 71.24721  ? 43   LYS B CG  1 
ATOM   3524  C CD  . LYS B  1 63  ? -27.65347 -17.71326  79.01789  1.000 77.16469  ? 43   LYS B CD  1 
ATOM   3525  C CE  . LYS B  1 63  ? -28.19910 -17.41432  77.59824  1.000 80.87785  ? 43   LYS B CE  1 
ATOM   3526  N NZ  . LYS B  1 63  ? -29.67508 -17.40294  77.47055  1.000 85.21409  ? 43   LYS B NZ  1 
ATOM   3527  N N   . ALA B  1 64  ? -24.98434 -20.90176  82.44532  1.000 41.66663  ? 44   ALA B N   1 
ATOM   3528  C CA  . ALA B  1 64  ? -24.38532 -22.05241  83.12516  1.000 34.16821  ? 44   ALA B CA  1 
ATOM   3529  C C   . ALA B  1 64  ? -24.38746 -21.88976  84.63924  1.000 40.13830  ? 44   ALA B C   1 
ATOM   3530  O O   . ALA B  1 64  ? -24.63601 -20.80929  85.18800  1.000 44.99137  ? 44   ALA B O   1 
ATOM   3531  C CB  . ALA B  1 64  ? -22.94218 -22.25073  82.68595  1.000 30.72370  ? 44   ALA B CB  1 
ATOM   3532  N N   . ARG B  1 65  ? -24.09921 -22.99822  85.31256  1.000 40.18031  ? 45   ARG B N   1 
ATOM   3533  C CA  . ARG B  1 65  ? -23.75978 -23.03054  86.72477  1.000 38.71181  ? 45   ARG B CA  1 
ATOM   3534  C C   . ARG B  1 65  ? -22.26561 -23.25996  86.88810  1.000 44.57241  ? 45   ARG B C   1 
ATOM   3535  O O   . ARG B  1 65  ? -21.57433 -23.67490  85.95888  1.000 47.97919  ? 45   ARG B O   1 
ATOM   3536  C CB  . ARG B  1 65  ? -24.52179 -24.13807  87.44900  1.000 39.79435  ? 45   ARG B CB  1 
ATOM   3537  C CG  . ARG B  1 65  ? -26.01202 -23.89009  87.57110  1.000 40.54946  ? 45   ARG B CG  1 
ATOM   3538  C CD  . ARG B  1 65  ? -26.68120 -25.14075  88.04886  1.000 41.26914  ? 45   ARG B CD  1 
ATOM   3539  N NE  . ARG B  1 65  ? -28.11544 -25.11783  87.82926  1.000 41.79121  ? 45   ARG B NE  1 
ATOM   3540  C CZ  . ARG B  1 65  ? -29.00729 -24.96763  88.79105  1.000 41.21888  ? 45   ARG B CZ  1 
ATOM   3541  N NH1 . ARG B  1 65  ? -28.61440 -24.81286  90.04352  1.000 40.59376  ? 45   ARG B NH1 1 
ATOM   3542  N NH2 . ARG B  1 65  ? -30.29049 -24.97668  88.49532  1.000 43.63115  ? 45   ARG B NH2 1 
ATOM   3543  N N   . ILE B  1 66  ? -21.77724 -23.00566  88.10097  1.000 47.39849  ? 46   ILE B N   1 
ATOM   3544  C CA  . ILE B  1 66  ? -20.33838 -23.05109  88.35055  1.000 45.46475  ? 46   ILE B CA  1 
ATOM   3545  C C   . ILE B  1 66  ? -19.76506 -24.43535  88.03221  1.000 42.36164  ? 46   ILE B C   1 
ATOM   3546  O O   . ILE B  1 66  ? -18.69919 -24.55429  87.41753  1.000 40.22091  ? 46   ILE B O   1 
ATOM   3547  C CB  . ILE B  1 66  ? -20.04528 -22.61418  89.80299  1.000 43.89121  ? 46   ILE B CB  1 
ATOM   3548  C CG1 . ILE B  1 66  ? -20.32657 -21.10300  89.95491  1.000 39.09936  ? 46   ILE B CG1 1 
ATOM   3549  C CG2 . ILE B  1 66  ? -18.60428 -23.00353  90.22721  1.000 36.62732  ? 46   ILE B CG2 1 
ATOM   3550  C CD1 . ILE B  1 66  ? -20.09481 -20.53448  91.35724  1.000 35.01240  ? 46   ILE B CD1 1 
ATOM   3551  N N   . ILE B  1 67  ? -20.45776 -25.50555  88.42079  1.000 40.30107  ? 47   ILE B N   1 
ATOM   3552  C CA  . ILE B  1 67  ? -19.85371 -26.81891  88.21143  1.000 40.44750  ? 47   ILE B CA  1 
ATOM   3553  C C   . ILE B  1 67  ? -19.65258 -27.14693  86.72971  1.000 41.25623  ? 47   ILE B C   1 
ATOM   3554  O O   . ILE B  1 67  ? -18.81204 -27.99869  86.39515  1.000 39.30998  ? 47   ILE B O   1 
ATOM   3555  C CB  . ILE B  1 67  ? -20.67380 -27.91657  88.90706  1.000 39.52484  ? 47   ILE B CB  1 
ATOM   3556  C CG1 . ILE B  1 67  ? -19.81376 -29.18517  89.05765  1.000 36.72513  ? 47   ILE B CG1 1 
ATOM   3557  C CG2 . ILE B  1 67  ? -21.98681 -28.18844  88.15745  1.000 36.08801  ? 47   ILE B CG2 1 
ATOM   3558  C CD1 . ILE B  1 67  ? -20.52508 -30.30333  89.78897  1.000 35.67842  ? 47   ILE B CD1 1 
ATOM   3559  N N   . ASP B  1 68  ? -20.36637 -26.45383  85.82671  1.000 36.89447  ? 48   ASP B N   1 
ATOM   3560  C CA  . ASP B  1 68  ? -20.32671 -26.81817  84.41397  1.000 27.97748  ? 48   ASP B CA  1 
ATOM   3561  C C   . ASP B  1 68  ? -18.94653 -26.59967  83.80769  1.000 31.61985  ? 48   ASP B C   1 
ATOM   3562  O O   . ASP B  1 68  ? -18.58811 -27.26857  82.82933  1.000 32.23658  ? 48   ASP B O   1 
ATOM   3563  C CB  . ASP B  1 68  ? -21.37563 -26.04269  83.62024  1.000 26.59686  ? 48   ASP B CB  1 
ATOM   3564  C CG  . ASP B  1 68  ? -22.81313 -26.39940  84.02166  1.000 35.27626  ? 48   ASP B CG  1 
ATOM   3565  O OD1 . ASP B  1 68  ? -23.11146 -27.60674  84.30107  1.000 38.97635  ? 48   ASP B OD1 1 
ATOM   3566  O OD2 . ASP B  1 68  ? -23.65222 -25.46329  84.04052  1.000 37.10283  ? 48   ASP B OD2 1 
ATOM   3567  N N   . PHE B  1 69  ? -18.15035 -25.69427  84.37362  1.000 31.07760  ? 49   PHE B N   1 
ATOM   3568  C CA  . PHE B  1 69  ? -16.84476 -25.43076  83.78218  1.000 34.70574  ? 49   PHE B CA  1 
ATOM   3569  C C   . PHE B  1 69  ? -15.92880 -26.63876  83.92512  1.000 35.08680  ? 49   PHE B C   1 
ATOM   3570  O O   . PHE B  1 69  ? -15.40196 -27.15089  82.93108  1.000 41.15546  ? 49   PHE B O   1 
ATOM   3571  C CB  . PHE B  1 69  ? -16.23277 -24.16622  84.39861  1.000 36.71374  ? 49   PHE B CB  1 
ATOM   3572  C CG  . PHE B  1 69  ? -16.88793 -22.91826  83.89824  1.000 38.52615  ? 49   PHE B CG  1 
ATOM   3573  C CD1 . PHE B  1 69  ? -16.40135 -22.28052  82.76609  1.000 39.00296  ? 49   PHE B CD1 1 
ATOM   3574  C CD2 . PHE B  1 69  ? -18.05190 -22.43439  84.50305  1.000 34.11393  ? 49   PHE B CD2 1 
ATOM   3575  C CE1 . PHE B  1 69  ? -17.03706 -21.16010  82.25806  1.000 40.06017  ? 49   PHE B CE1 1 
ATOM   3576  C CE2 . PHE B  1 69  ? -18.69431 -21.31923  83.99635  1.000 35.55858  ? 49   PHE B CE2 1 
ATOM   3577  C CZ  . PHE B  1 69  ? -18.19526 -20.68200  82.87869  1.000 36.58418  ? 49   PHE B CZ  1 
ATOM   3578  N N   . ALA B  1 70  ? -15.76338 -27.12907  85.14991  1.000 31.58501  ? 50   ALA B N   1 
ATOM   3579  C CA  . ALA B  1 70  ? -14.94363 -28.30744  85.37332  1.000 30.80449  ? 50   ALA B CA  1 
ATOM   3580  C C   . ALA B  1 70  ? -15.46291 -29.49626  84.56568  1.000 35.95663  ? 50   ALA B C   1 
ATOM   3581  O O   . ALA B  1 70  ? -14.67734 -30.21220  83.92554  1.000 35.72032  ? 50   ALA B O   1 
ATOM   3582  C CB  . ALA B  1 70  ? -14.91324 -28.63258  86.86495  1.000 27.22420  ? 50   ALA B CB  1 
ATOM   3583  N N   . LEU B  1 71  ? -16.79022 -29.70533  84.57507  1.000 35.22564  ? 51   LEU B N   1 
ATOM   3584  C CA  . LEU B  1 71  ? -17.38524 -30.78012  83.79300  1.000 34.56831  ? 51   LEU B CA  1 
ATOM   3585  C C   . LEU B  1 71  ? -17.06890 -30.60960  82.31396  1.000 36.47889  ? 51   LEU B C   1 
ATOM   3586  O O   . LEU B  1 71  ? -16.65244 -31.56348  81.64378  1.000 36.37792  ? 51   LEU B O   1 
ATOM   3587  C CB  . LEU B  1 71  ? -18.90589 -30.83463  84.01700  1.000 32.13679  ? 51   LEU B CB  1 
ATOM   3588  C CG  . LEU B  1 71  ? -19.38372 -31.15126  85.44081  1.000 33.40509  ? 51   LEU B CG  1 
ATOM   3589  C CD1 . LEU B  1 71  ? -20.86936 -30.90622  85.57687  1.000 33.69922  ? 51   LEU B CD1 1 
ATOM   3590  C CD2 . LEU B  1 71  ? -19.02594 -32.57739  85.88441  1.000 32.35637  ? 51   LEU B CD2 1 
ATOM   3591  N N   . SER B  1 72  ? -17.25842 -29.39330  81.78407  1.000 37.44936  ? 52   SER B N   1 
ATOM   3592  C CA  . SER B  1 72  ? -16.95218 -29.16398  80.37524  1.000 37.27325  ? 52   SER B CA  1 
ATOM   3593  C C   . SER B  1 72  ? -15.45320 -29.31200  80.09348  1.000 39.94620  ? 52   SER B C   1 
ATOM   3594  O O   . SER B  1 72  ? -15.07406 -29.77294  79.00865  1.000 35.36229  ? 52   SER B O   1 
ATOM   3595  C CB  . SER B  1 72  ? -17.43322 -27.78368  79.94036  1.000 32.86926  ? 52   SER B CB  1 
ATOM   3596  O OG  . SER B  1 72  ? -18.82769 -27.63042  80.09979  1.000 34.58000  ? 52   SER B OG  1 
ATOM   3597  N N   . ASN B  1 73  ? -14.58914 -28.91239  81.04007  1.000 36.71734  ? 53   ASN B N   1 
ATOM   3598  C CA  . ASN B  1 73  ? -13.15613 -29.12722  80.84194  1.000 42.11875  ? 53   ASN B CA  1 
ATOM   3599  C C   . ASN B  1 73  ? -12.85373 -30.60596  80.60124  1.000 40.37995  ? 53   ASN B C   1 
ATOM   3600  O O   . ASN B  1 73  ? -12.11673 -30.95965  79.67312  1.000 37.21691  ? 53   ASN B O   1 
ATOM   3601  C CB  . ASN B  1 73  ? -12.35975 -28.60701  82.04469  1.000 39.10590  ? 53   ASN B CB  1 
ATOM   3602  C CG  . ASN B  1 73  ? -12.29892 -27.10496  82.09838  1.000 36.00659  ? 53   ASN B CG  1 
ATOM   3603  O OD1 . ASN B  1 73  ? -12.21458 -26.44245  81.07452  1.000 39.65997  ? 53   ASN B OD1 1 
ATOM   3604  N ND2 . ASN B  1 73  ? -12.33700 -26.56158  83.29461  1.000 33.19467  ? 53   ASN B ND2 1 
ATOM   3605  N N   . ALA B  1 74  ? -13.43948 -31.48624  81.41913  1.000 41.67927  ? 54   ALA B N   1 
ATOM   3606  C CA  . ALA B  1 74  ? -13.18501 -32.92227  81.28019  1.000 42.94562  ? 54   ALA B CA  1 
ATOM   3607  C C   . ALA B  1 74  ? -13.71615 -33.45804  79.95493  1.000 41.48501  ? 54   ALA B C   1 
ATOM   3608  O O   . ALA B  1 74  ? -13.07407 -34.29220  79.30310  1.000 43.13394  ? 54   ALA B O   1 
ATOM   3609  C CB  . ALA B  1 74  ? -13.81887 -33.67357  82.45723  1.000 41.16421  ? 54   ALA B CB  1 
ATOM   3610  N N   . LEU B  1 75  ? -14.89849 -32.99707  79.55822  1.000 37.93485  ? 55   LEU B N   1 
ATOM   3611  C CA  . LEU B  1 75  ? -15.50334 -33.41055  78.29587  1.000 37.60393  ? 55   LEU B CA  1 
ATOM   3612  C C   . LEU B  1 75  ? -14.65614 -32.98257  77.09788  1.000 41.96901  ? 55   LEU B C   1 
ATOM   3613  O O   . LEU B  1 75  ? -14.32108 -33.80274  76.23089  1.000 34.54862  ? 55   LEU B O   1 
ATOM   3614  C CB  . LEU B  1 75  ? -16.90502 -32.81367  78.21770  1.000 37.79716  ? 55   LEU B CB  1 
ATOM   3615  C CG  . LEU B  1 75  ? -17.69794 -32.96451  76.94081  1.000 48.09437  ? 55   LEU B CG  1 
ATOM   3616  C CD1 . LEU B  1 75  ? -18.04324 -34.42301  76.71160  1.000 44.95374  ? 55   LEU B CD1 1 
ATOM   3617  C CD2 . LEU B  1 75  ? -18.95456 -32.11566  77.07057  1.000 53.90065  ? 55   LEU B CD2 1 
ATOM   3618  N N   . ASN B  1 76  ? -14.30679 -31.68616  77.02965  1.000 39.38326  ? 56   ASN B N   1 
ATOM   3619  C CA  . ASN B  1 76  ? -13.49021 -31.17857  75.93049  1.000 39.10515  ? 56   ASN B CA  1 
ATOM   3620  C C   . ASN B  1 76  ? -12.08922 -31.76500  75.95114  1.000 40.29885  ? 56   ASN B C   1 
ATOM   3621  O O   . ASN B  1 76  ? -11.42687 -31.78958  74.91417  1.000 38.27309  ? 56   ASN B O   1 
ATOM   3622  C CB  . ASN B  1 76  ? -13.38464 -29.63756  75.97569  1.000 36.81029  ? 56   ASN B CB  1 
ATOM   3623  C CG  . ASN B  1 76  ? -14.74571 -28.93108  75.95000  1.000 38.81870  ? 56   ASN B CG  1 
ATOM   3624  O OD1 . ASN B  1 76  ? -15.76989 -29.50674  75.56471  1.000 44.87824  ? 56   ASN B OD1 1 
ATOM   3625  N ND2 . ASN B  1 76  ? -14.75085 -27.66610  76.34941  1.000 41.51595  ? 56   ASN B ND2 1 
ATOM   3626  N N   . SER B  1 77  ? -11.60717 -32.19036  77.11618  1.000 41.33613  ? 57   SER B N   1 
ATOM   3627  C CA  . SER B  1 77  ? -10.29815 -32.81916  77.20049  1.000 40.50548  ? 57   SER B CA  1 
ATOM   3628  C C   . SER B  1 77  ? -10.29215 -34.25838  76.70089  1.000 42.67449  ? 57   SER B C   1 
ATOM   3629  O O   . SER B  1 77  ? -9.21158  -34.84375  76.59392  1.000 44.96614  ? 57   SER B O   1 
ATOM   3630  C CB  . SER B  1 77  ? -9.78354  -32.79039  78.64221  1.000 37.87760  ? 57   SER B CB  1 
ATOM   3631  O OG  . SER B  1 77  ? -9.34861  -31.49150  79.00403  1.000 46.48677  ? 57   SER B OG  1 
ATOM   3632  N N   . GLY B  1 78  ? -11.45812 -34.84899  76.40772  1.000 44.37485  ? 58   GLY B N   1 
ATOM   3633  C CA  . GLY B  1 78  ? -11.52289 -36.23297  75.98522  1.000 37.25400  ? 58   GLY B CA  1 
ATOM   3634  C C   . GLY B  1 78  ? -11.80251 -37.23785  77.08597  1.000 44.25526  ? 58   GLY B C   1 
ATOM   3635  O O   . GLY B  1 78  ? -11.97544 -38.42590  76.78634  1.000 44.11542  ? 58   GLY B O   1 
ATOM   3636  N N   . ILE B  1 79  ? -11.86884 -36.81124  78.35100  1.000 43.14977  ? 59   ILE B N   1 
ATOM   3637  C CA  . ILE B  1 79  ? -12.23101 -37.73914  79.42151  1.000 44.01289  ? 59   ILE B CA  1 
ATOM   3638  C C   . ILE B  1 79  ? -13.67316 -38.21001  79.23919  1.000 43.90857  ? 59   ILE B C   1 
ATOM   3639  O O   . ILE B  1 79  ? -14.58366 -37.40601  79.02788  1.000 41.87481  ? 59   ILE B O   1 
ATOM   3640  C CB  . ILE B  1 79  ? -12.02520 -37.06872  80.78735  1.000 41.75458  ? 59   ILE B CB  1 
ATOM   3641  C CG1 . ILE B  1 79  ? -10.54941 -36.70903  80.97051  1.000 38.76272  ? 59   ILE B CG1 1 
ATOM   3642  C CG2 . ILE B  1 79  ? -12.53714 -37.96803  81.91743  1.000 40.57512  ? 59   ILE B CG2 1 
ATOM   3643  C CD1 . ILE B  1 79  ? -10.24177 -36.18298  82.34650  1.000 39.54652  ? 59   ILE B CD1 1 
ATOM   3644  N N   . ARG B  1 80  ? -13.89342 -39.51816  79.32897  1.000 49.07700  ? 60   ARG B N   1 
ATOM   3645  C CA  . ARG B  1 80  ? -15.21597 -40.08569  79.09504  1.000 48.90023  ? 60   ARG B CA  1 
ATOM   3646  C C   . ARG B  1 80  ? -15.87220 -40.65205  80.34602  1.000 45.13989  ? 60   ARG B C   1 
ATOM   3647  O O   . ARG B  1 80  ? -17.02315 -41.09008  80.26782  1.000 47.50975  ? 60   ARG B O   1 
ATOM   3648  C CB  . ARG B  1 80  ? -15.15592 -41.17754  78.01980  1.000 51.98798  ? 60   ARG B CB  1 
ATOM   3649  C CG  . ARG B  1 80  ? -14.45709 -40.76252  76.72889  1.000 60.71016  ? 60   ARG B CG  1 
ATOM   3650  C CD  . ARG B  1 80  ? -13.84458 -41.97760  76.03034  1.000 68.01029  ? 60   ARG B CD  1 
ATOM   3651  N NE  . ARG B  1 80  ? -13.47199 -41.72077  74.63521  1.000 78.00513  ? 60   ARG B NE  1 
ATOM   3652  C CZ  . ARG B  1 80  ? -12.81324 -42.58580  73.85756  1.000 81.26181  ? 60   ARG B CZ  1 
ATOM   3653  N NH1 . ARG B  1 80  ? -12.45959 -43.77446  74.33367  1.000 79.48632  ? 60   ARG B NH1 1 
ATOM   3654  N NH2 . ARG B  1 80  ? -12.50997 -42.26979  72.59961  1.000 83.09982  ? 60   ARG B NH2 1 
ATOM   3655  N N   . ARG B  1 81  ? -15.19211 -40.67728  81.49145  1.000 43.09410  ? 61   ARG B N   1 
ATOM   3656  C CA  . ARG B  1 81  ? -15.83452 -41.13204  82.72110  1.000 43.88544  ? 61   ARG B CA  1 
ATOM   3657  C C   . ARG B  1 81  ? -15.71435 -40.08453  83.82266  1.000 43.40358  ? 61   ARG B C   1 
ATOM   3658  O O   . ARG B  1 81  ? -14.60791 -39.77965  84.27883  1.000 43.94734  ? 61   ARG B O   1 
ATOM   3659  C CB  . ARG B  1 81  ? -15.27823 -42.47779  83.19078  1.000 39.17256  ? 61   ARG B CB  1 
ATOM   3660  C CG  . ARG B  1 81  ? -15.24076 -43.54351  82.10943  1.000 39.08923  ? 61   ARG B CG  1 
ATOM   3661  C CD  . ARG B  1 81  ? -14.81789 -44.85202  82.71799  1.000 36.54777  ? 61   ARG B CD  1 
ATOM   3662  N NE  . ARG B  1 81  ? -15.02662 -45.99493  81.83316  1.000 39.78300  ? 61   ARG B NE  1 
ATOM   3663  C CZ  . ARG B  1 81  ? -16.19242 -46.57379  81.56887  1.000 41.53708  ? 61   ARG B CZ  1 
ATOM   3664  N NH1 . ARG B  1 81  ? -17.30198 -46.13092  82.12945  1.000 40.27457  ? 61   ARG B NH1 1 
ATOM   3665  N NH2 . ARG B  1 81  ? -16.24183 -47.61593  80.74003  1.000 45.14511  ? 61   ARG B NH2 1 
ATOM   3666  N N   . ILE B  1 82  ? -16.86073 -39.57858  84.28336  1.000 38.92470  ? 62   ILE B N   1 
ATOM   3667  C CA  . ILE B  1 82  ? -16.91054 -38.49207  85.25102  1.000 42.28040  ? 62   ILE B CA  1 
ATOM   3668  C C   . ILE B  1 82  ? -17.64013 -38.96367  86.50915  1.000 43.67240  ? 62   ILE B C   1 
ATOM   3669  O O   . ILE B  1 82  ? -18.72564 -39.55805  86.42624  1.000 42.96312  ? 62   ILE B O   1 
ATOM   3670  C CB  . ILE B  1 82  ? -17.58565 -37.23641  84.65866  1.000 38.16940  ? 62   ILE B CB  1 
ATOM   3671  C CG1 . ILE B  1 82  ? -16.85080 -36.75154  83.40548  1.000 36.00796  ? 62   ILE B CG1 1 
ATOM   3672  C CG2 . ILE B  1 82  ? -17.66849 -36.13285  85.69802  1.000 33.53004  ? 62   ILE B CG2 1 
ATOM   3673  C CD1 . ILE B  1 82  ? -17.50376 -35.52860  82.77415  1.000 34.25912  ? 62   ILE B CD1 1 
ATOM   3674  N N   . GLY B  1 83  ? -17.03999 -38.69151  87.66436  1.000 39.29605  ? 63   GLY B N   1 
ATOM   3675  C CA  . GLY B  1 83  ? -17.70199 -38.85932  88.94992  1.000 39.87281  ? 63   GLY B CA  1 
ATOM   3676  C C   . GLY B  1 83  ? -17.87078 -37.52022  89.64590  1.000 41.32634  ? 63   GLY B C   1 
ATOM   3677  O O   . GLY B  1 83  ? -16.98550 -36.65574  89.57481  1.000 36.45262  ? 63   GLY B O   1 
ATOM   3678  N N   . VAL B  1 84  ? -19.01735 -37.34641  90.30976  1.000 42.14794  ? 64   VAL B N   1 
ATOM   3679  C CA  . VAL B  1 84  ? -19.37362 -36.08979  90.96763  1.000 43.11650  ? 64   VAL B CA  1 
ATOM   3680  C C   . VAL B  1 84  ? -19.83575 -36.40547  92.38337  1.000 41.62355  ? 64   VAL B C   1 
ATOM   3681  O O   . VAL B  1 84  ? -20.93579 -36.94126  92.58123  1.000 43.39657  ? 64   VAL B O   1 
ATOM   3682  C CB  . VAL B  1 84  ? -20.46083 -35.32703  90.19918  1.000 43.43924  ? 64   VAL B CB  1 
ATOM   3683  C CG1 . VAL B  1 84  ? -20.93875 -34.13231  91.00816  1.000 43.95571  ? 64   VAL B CG1 1 
ATOM   3684  C CG2 . VAL B  1 84  ? -19.94196 -34.91024  88.81330  1.000 36.92060  ? 64   VAL B CG2 1 
ATOM   3685  N N   . ALA B  1 85  ? -18.99928 -36.08966  93.36506  1.000 44.08663  ? 65   ALA B N   1 
ATOM   3686  C CA  . ALA B  1 85  ? -19.34112 -36.28823  94.76913  1.000 46.09653  ? 65   ALA B CA  1 
ATOM   3687  C C   . ALA B  1 85  ? -20.07705 -35.05140  95.27868  1.000 44.80398  ? 65   ALA B C   1 
ATOM   3688  O O   . ALA B  1 85  ? -19.57714 -33.92596  95.14687  1.000 38.75395  ? 65   ALA B O   1 
ATOM   3689  C CB  . ALA B  1 85  ? -18.08361 -36.56294  95.59152  1.000 48.14477  ? 65   ALA B CB  1 
ATOM   3690  N N   . THR B  1 86  ? -21.28438 -35.25165  95.81075  1.000 48.31996  ? 66   THR B N   1 
ATOM   3691  C CA  . THR B  1 86  ? -22.08006 -34.17096  96.38234  1.000 49.08453  ? 66   THR B CA  1 
ATOM   3692  C C   . THR B  1 86  ? -22.42213 -34.53479  97.81583  1.000 52.01132  ? 66   THR B C   1 
ATOM   3693  O O   . THR B  1 86  ? -22.31251 -35.69949  98.21597  1.000 54.74228  ? 66   THR B O   1 
ATOM   3694  C CB  . THR B  1 86  ? -23.37237 -33.91444  95.58276  1.000 49.97470  ? 66   THR B CB  1 
ATOM   3695  O OG1 . THR B  1 86  ? -24.33024 -34.93883  95.87352  1.000 55.02791  ? 66   THR B OG1 1 
ATOM   3696  C CG2 . THR B  1 86  ? -23.09347 -33.91823  94.08506  1.000 45.55638  ? 66   THR B CG2 1 
ATOM   3697  N N   . GLN B  1 87  ? -22.83025 -33.53430  98.59810  1.000 63.56071  ? 67   GLN B N   1 
ATOM   3698  C CA  . GLN B  1 87  ? -23.16342 -33.77045  99.99981  1.000 74.45418  ? 67   GLN B CA  1 
ATOM   3699  C C   . GLN B  1 87  ? -24.67973 -33.92677  100.12915 1.000 80.84314  ? 67   GLN B C   1 
ATOM   3700  O O   . GLN B  1 87  ? -25.41206 -32.98260  100.44270 1.000 83.90432  ? 67   GLN B O   1 
ATOM   3701  C CB  . GLN B  1 87  ? -22.60277 -32.66044  100.89388 1.000 81.36160  ? 67   GLN B CB  1 
ATOM   3702  C CG  . GLN B  1 87  ? -22.53673 -33.03172  102.40761 1.000 88.84768  ? 67   GLN B CG  1 
ATOM   3703  C CD  . GLN B  1 87  ? -21.26507 -33.80597  102.83486 1.000 90.81769  ? 67   GLN B CD  1 
ATOM   3704  O OE1 . GLN B  1 87  ? -21.33037 -34.66807  103.71078 1.000 91.95783  ? 67   GLN B OE1 1 
ATOM   3705  N NE2 . GLN B  1 87  ? -20.11478 -33.47737  102.23885 1.000 88.83562  ? 67   GLN B NE2 1 
ATOM   3706  N N   . TYR B  1 88  ? -25.14209 -35.15941  99.85756  1.000 81.08233  ? 68   TYR B N   1 
ATOM   3707  C CA  . TYR B  1 88  ? -26.46788 -35.69342  100.19237 1.000 84.41710  ? 68   TYR B CA  1 
ATOM   3708  C C   . TYR B  1 88  ? -27.64436 -34.81144  99.78297  1.000 88.46896  ? 68   TYR B C   1 
ATOM   3709  O O   . TYR B  1 88  ? -28.35521 -35.12890  98.81986  1.000 88.71510  ? 68   TYR B O   1 
ATOM   3710  C CB  . TYR B  1 88  ? -26.55916 -35.97623  101.69367 1.000 85.55771  ? 68   TYR B CB  1 
ATOM   3711  N N   . LYS B  1 89  ? -27.88308 -33.72865  100.53303 1.000 87.54277  ? 69   LYS B N   1 
ATOM   3712  C CA  . LYS B  1 89  ? -28.99174 -32.81045  100.25637 1.000 84.10793  ? 69   LYS B CA  1 
ATOM   3713  C C   . LYS B  1 89  ? -28.51972 -31.71462  99.29649  1.000 81.85260  ? 69   LYS B C   1 
ATOM   3714  O O   . LYS B  1 89  ? -28.42460 -30.52891  99.62101  1.000 87.70023  ? 69   LYS B O   1 
ATOM   3715  C CB  . LYS B  1 89  ? -29.54552 -32.23573  101.55462 1.000 86.30300  ? 69   LYS B CB  1 
ATOM   3716  N N   . ALA B  1 90  ? -28.20477 -32.15134  98.08218  1.000 74.38987  ? 70   ALA B N   1 
ATOM   3717  C CA  . ALA B  1 90  ? -27.83528 -31.24750  97.00698  1.000 66.53435  ? 70   ALA B CA  1 
ATOM   3718  C C   . ALA B  1 90  ? -28.88337 -31.31760  95.90457  1.000 65.43493  ? 70   ALA B C   1 
ATOM   3719  O O   . ALA B  1 90  ? -28.54096 -31.52388  94.73534  1.000 68.13960  ? 70   ALA B O   1 
ATOM   3720  C CB  . ALA B  1 90  ? -26.45567 -31.61473  96.46998  1.000 64.62122  ? 70   ALA B CB  1 
ATOM   3721  N N   . HIS B  1 91  ? -30.16146 -31.15532  96.27362  1.000 64.92887  ? 71   HIS B N   1 
ATOM   3722  C CA  . HIS B  1 91  ? -31.26095 -31.44751  95.35145  1.000 67.57014  ? 71   HIS B CA  1 
ATOM   3723  C C   . HIS B  1 91  ? -31.17671 -30.59451  94.09109  1.000 58.71014  ? 71   HIS B C   1 
ATOM   3724  O O   . HIS B  1 91  ? -31.41212 -31.08718  92.98086  1.000 53.58836  ? 71   HIS B O   1 
ATOM   3725  C CB  . HIS B  1 91  ? -32.61686 -31.24819  96.05181  1.000 78.81063  ? 71   HIS B CB  1 
ATOM   3726  C CG  . HIS B  1 91  ? -33.81246 -31.60782  95.20470  1.000 85.81666  ? 71   HIS B CG  1 
ATOM   3727  N ND1 . HIS B  1 91  ? -34.58047 -30.66236  94.55147  1.000 86.80947  ? 71   HIS B ND1 1 
ATOM   3728  C CD2 . HIS B  1 91  ? -34.37301 -32.80967  94.91300  1.000 86.31118  ? 71   HIS B CD2 1 
ATOM   3729  C CE1 . HIS B  1 91  ? -35.55551 -31.26655  93.89291  1.000 87.17878  ? 71   HIS B CE1 1 
ATOM   3730  N NE2 . HIS B  1 91  ? -35.45230 -32.56910  94.09486  1.000 87.05272  ? 71   HIS B NE2 1 
ATOM   3731  N N   . ASP B  1 92  ? -30.83509 -29.31680  94.23726  1.000 53.53228  ? 72   ASP B N   1 
ATOM   3732  C CA  . ASP B  1 92  ? -30.72752 -28.47212  93.06026  1.000 51.27871  ? 72   ASP B CA  1 
ATOM   3733  C C   . ASP B  1 92  ? -29.54669 -28.89691  92.20379  1.000 43.38924  ? 72   ASP B C   1 
ATOM   3734  O O   . ASP B  1 92  ? -29.63972 -28.90842  90.97640  1.000 43.64915  ? 72   ASP B O   1 
ATOM   3735  C CB  . ASP B  1 92  ? -30.61719 -27.00480  93.47689  1.000 63.46833  ? 72   ASP B CB  1 
ATOM   3736  C CG  . ASP B  1 92  ? -31.52278 -26.10289  92.65869  1.000 75.26666  ? 72   ASP B CG  1 
ATOM   3737  O OD1 . ASP B  1 92  ? -32.38659 -25.41994  93.24851  1.000 78.89569  ? 72   ASP B OD1 1 
ATOM   3738  O OD2 . ASP B  1 92  ? -31.36257 -26.06572  91.41851  1.000 80.36001  ? 72   ASP B OD2 1 
ATOM   3739  N N   . LEU B  1 93  ? -28.43807 -29.27464  92.83334  1.000 42.80244  ? 73   LEU B N   1 
ATOM   3740  C CA  . LEU B  1 93  ? -27.27332 -29.69267  92.07218  1.000 41.67868  ? 73   LEU B CA  1 
ATOM   3741  C C   . LEU B  1 93  ? -27.54792 -31.00397  91.34204  1.000 42.81640  ? 73   LEU B C   1 
ATOM   3742  O O   . LEU B  1 93  ? -27.31996 -31.11141  90.13212  1.000 43.94572  ? 73   LEU B O   1 
ATOM   3743  C CB  . LEU B  1 93  ? -26.06202 -29.82617  92.99909  1.000 43.01318  ? 73   LEU B CB  1 
ATOM   3744  C CG  . LEU B  1 93  ? -24.75064 -30.27476  92.31622  1.000 46.58393  ? 73   LEU B CG  1 
ATOM   3745  C CD1 . LEU B  1 93  ? -24.42215 -29.39997  91.10864  1.000 39.57498  ? 73   LEU B CD1 1 
ATOM   3746  C CD2 . LEU B  1 93  ? -23.57891 -30.28658  93.29808  1.000 42.79190  ? 73   LEU B CD2 1 
ATOM   3747  N N   . ILE B  1 94  ? -28.06431 -32.00540  92.06205  1.000 40.14136  ? 74   ILE B N   1 
ATOM   3748  C CA  . ILE B  1 94  ? -28.29084 -33.32084  91.46947  1.000 39.17389  ? 74   ILE B CA  1 
ATOM   3749  C C   . ILE B  1 94  ? -29.28191 -33.22978  90.31493  1.000 41.42927  ? 74   ILE B C   1 
ATOM   3750  O O   . ILE B  1 94  ? -29.06094 -33.81239  89.24474  1.000 37.92567  ? 74   ILE B O   1 
ATOM   3751  C CB  . ILE B  1 94  ? -28.75291 -34.30361  92.55947  1.000 44.70024  ? 74   ILE B CB  1 
ATOM   3752  C CG1 . ILE B  1 94  ? -27.57889 -34.68401  93.45914  1.000 44.09285  ? 74   ILE B CG1 1 
ATOM   3753  C CG2 . ILE B  1 94  ? -29.43961 -35.54869  91.96158  1.000 40.00815  ? 74   ILE B CG2 1 
ATOM   3754  C CD1 . ILE B  1 94  ? -28.02141 -35.32253  94.76632  1.000 42.00600  ? 74   ILE B CD1 1 
ATOM   3755  N N   . ARG B  1 95  ? -30.38244 -32.48286  90.50577  1.000 43.93475  ? 75   ARG B N   1 
ATOM   3756  C CA  . ARG B  1 95  ? -31.34044 -32.26707  89.42252  1.000 45.92496  ? 75   ARG B CA  1 
ATOM   3757  C C   . ARG B  1 95  ? -30.68225 -31.59914  88.21603  1.000 46.27167  ? 75   ARG B C   1 
ATOM   3758  O O   . ARG B  1 95  ? -31.02173 -31.90781  87.06572  1.000 39.57328  ? 75   ARG B O   1 
ATOM   3759  C CB  . ARG B  1 95  ? -32.51541 -31.42017  89.91328  1.000 51.47623  ? 75   ARG B CB  1 
ATOM   3760  C CG  . ARG B  1 95  ? -33.62937 -31.27845  88.87998  1.000 58.82219  ? 75   ARG B CG  1 
ATOM   3761  C CD  . ARG B  1 95  ? -34.92039 -30.74684  89.49378  1.000 68.09953  ? 75   ARG B CD  1 
ATOM   3762  N NE  . ARG B  1 95  ? -34.95267 -29.28861  89.52233  1.000 76.83793  ? 75   ARG B NE  1 
ATOM   3763  C CZ  . ARG B  1 95  ? -34.72782 -28.55367  90.61064  1.000 82.47690  ? 75   ARG B CZ  1 
ATOM   3764  N NH1 . ARG B  1 95  ? -34.77069 -27.22707  90.53890  1.000 82.20235  ? 75   ARG B NH1 1 
ATOM   3765  N NH2 . ARG B  1 95  ? -34.45836 -29.14477  91.77321  1.000 84.56031  ? 75   ARG B NH2 1 
ATOM   3766  N N   . HIS B  1 96  ? -29.76776 -30.65173  88.46055  1.000 39.73343  ? 76   HIS B N   1 
ATOM   3767  C CA  . HIS B  1 96  ? -29.01638 -30.04585  87.36379  1.000 39.49095  ? 76   HIS B CA  1 
ATOM   3768  C C   . HIS B  1 96  ? -28.20926 -31.09555  86.60509  1.000 37.52760  ? 76   HIS B C   1 
ATOM   3769  O O   . HIS B  1 96  ? -28.22330 -31.13341  85.36779  1.000 37.26481  ? 76   HIS B O   1 
ATOM   3770  C CB  . HIS B  1 96  ? -28.08898 -28.93706  87.87402  1.000 39.53217  ? 76   HIS B CB  1 
ATOM   3771  C CG  . HIS B  1 96  ? -27.16178 -28.41579  86.81510  1.000 42.11870  ? 76   HIS B CG  1 
ATOM   3772  N ND1 . HIS B  1 96  ? -27.55889 -27.50039  85.86087  1.000 42.12919  ? 76   HIS B ND1 1 
ATOM   3773  C CD2 . HIS B  1 96  ? -25.87472 -28.72585  86.52287  1.000 38.45262  ? 76   HIS B CD2 1 
ATOM   3774  C CE1 . HIS B  1 96  ? -26.54941 -27.24949  85.04263  1.000 40.01971  ? 76   HIS B CE1 1 
ATOM   3775  N NE2 . HIS B  1 96  ? -25.51809 -27.98551  85.41768  1.000 40.66835  ? 76   HIS B NE2 1 
ATOM   3776  N N   . LEU B  1 97  ? -27.50814 -31.97196  87.32960  1.000 37.31609  ? 77   LEU B N   1 
ATOM   3777  C CA  . LEU B  1 97  ? -26.69830 -32.97714  86.64422  1.000 38.94984  ? 77   LEU B CA  1 
ATOM   3778  C C   . LEU B  1 97  ? -27.57117 -33.99209  85.90575  1.000 39.32276  ? 77   LEU B C   1 
ATOM   3779  O O   . LEU B  1 97  ? -27.23785 -34.39657  84.78476  1.000 35.94402  ? 77   LEU B O   1 
ATOM   3780  C CB  . LEU B  1 97  ? -25.76786 -33.66900  87.63525  1.000 38.95228  ? 77   LEU B CB  1 
ATOM   3781  C CG  . LEU B  1 97  ? -24.81286 -32.72202  88.37138  1.000 40.68075  ? 77   LEU B CG  1 
ATOM   3782  C CD1 . LEU B  1 97  ? -24.14081 -33.43327  89.54486  1.000 37.43429  ? 77   LEU B CD1 1 
ATOM   3783  C CD2 . LEU B  1 97  ? -23.79385 -32.17428  87.39977  1.000 35.60107  ? 77   LEU B CD2 1 
ATOM   3784  N N   . GLN B  1 98  ? -28.70119 -34.39165  86.50658  1.000 42.83233  ? 78   GLN B N   1 
ATOM   3785  C CA  . GLN B  1 98  ? -29.60631 -35.34667  85.86668  1.000 40.46369  ? 78   GLN B CA  1 
ATOM   3786  C C   . GLN B  1 98  ? -30.10990 -34.82716  84.52891  1.000 40.67658  ? 78   GLN B C   1 
ATOM   3787  O O   . GLN B  1 98  ? -30.20149 -35.57573  83.55354  1.000 40.47432  ? 78   GLN B O   1 
ATOM   3788  C CB  . GLN B  1 98  ? -30.80315 -35.62757  86.76991  1.000 41.35905  ? 78   GLN B CB  1 
ATOM   3789  C CG  . GLN B  1 98  ? -30.50117 -36.39804  88.01093  1.000 44.12695  ? 78   GLN B CG  1 
ATOM   3790  C CD  . GLN B  1 98  ? -31.69266 -36.45358  88.92897  1.000 49.77227  ? 78   GLN B CD  1 
ATOM   3791  O OE1 . GLN B  1 98  ? -31.79339 -37.33759  89.78538  1.000 54.65412  ? 78   GLN B OE1 1 
ATOM   3792  N NE2 . GLN B  1 98  ? -32.62369 -35.51971  88.74614  1.000 52.30020  ? 78   GLN B NE2 1 
ATOM   3793  N N   . ARG B  1 99  ? -30.46313 -33.55079  84.47054  1.000 40.28140  ? 79   ARG B N   1 
ATOM   3794  C CA  . ARG B  1 99  ? -31.08223 -33.01608  83.27160  1.000 41.40911  ? 79   ARG B CA  1 
ATOM   3795  C C   . ARG B  1 99  ? -30.05443 -32.50643  82.27212  1.000 43.58127  ? 79   ARG B C   1 
ATOM   3796  O O   . ARG B  1 99  ? -30.24936 -32.65395  81.05571  1.000 40.70115  ? 79   ARG B O   1 
ATOM   3797  C CB  . ARG B  1 99  ? -32.05636 -31.90399  83.65473  1.000 42.06161  ? 79   ARG B CB  1 
ATOM   3798  C CG  . ARG B  1 99  ? -33.42155 -32.44321  84.03374  1.000 56.87955  ? 79   ARG B CG  1 
ATOM   3799  C CD  . ARG B  1 99  ? -33.90562 -31.89936  85.36635  1.000 69.73612  ? 79   ARG B CD  1 
ATOM   3800  N NE  . ARG B  1 99  ? -33.98692 -30.44056  85.36014  1.000 75.48812  ? 79   ARG B NE  1 
ATOM   3801  C CZ  . ARG B  1 99  ? -35.10534 -29.75664  85.57022  1.000 76.39968  ? 79   ARG B CZ  1 
ATOM   3802  N NH1 . ARG B  1 99  ? -36.24086 -30.40592  85.80446  1.000 77.32348  ? 79   ARG B NH1 1 
ATOM   3803  N NH2 . ARG B  1 99  ? -35.08481 -28.43025  85.54570  1.000 74.19171  ? 79   ARG B NH2 1 
ATOM   3804  N N   . GLY B  1 100 ? -28.96022 -31.92413  82.76601  1.000 37.21248  ? 80   GLY B N   1 
ATOM   3805  C CA  . GLY B  1 100 ? -27.95620 -31.34982  81.89597  1.000 38.60053  ? 80   GLY B CA  1 
ATOM   3806  C C   . GLY B  1 100 ? -26.91043 -32.33482  81.40729  1.000 39.17217  ? 80   GLY B C   1 
ATOM   3807  O O   . GLY B  1 100 ? -26.56327 -32.32114  80.22372  1.000 41.98772  ? 80   GLY B O   1 
ATOM   3808  N N   . TRP B  1 101 ? -26.41617 -33.20105  82.28990  1.000 36.24096  ? 81   TRP B N   1 
ATOM   3809  C CA  . TRP B  1 101 ? -25.30874 -34.10743  81.97427  1.000 37.40304  ? 81   TRP B CA  1 
ATOM   3810  C C   . TRP B  1 101 ? -25.82014 -35.54365  81.83423  1.000 40.78965  ? 81   TRP B C   1 
ATOM   3811  O O   . TRP B  1 101 ? -25.49140 -36.44678  82.61712  1.000 35.94595  ? 81   TRP B O   1 
ATOM   3812  C CB  . TRP B  1 101 ? -24.22174 -33.95695  83.03579  1.000 36.44341  ? 81   TRP B CB  1 
ATOM   3813  C CG  . TRP B  1 101 ? -23.57964 -32.61092  82.90848  1.000 35.08958  ? 81   TRP B CG  1 
ATOM   3814  C CD1 . TRP B  1 101 ? -24.00041 -31.45152  83.48163  1.000 37.14200  ? 81   TRP B CD1 1 
ATOM   3815  C CD2 . TRP B  1 101 ? -22.44058 -32.26853  82.09776  1.000 36.59549  ? 81   TRP B CD2 1 
ATOM   3816  N NE1 . TRP B  1 101 ? -23.17968 -30.41315  83.10928  1.000 38.75585  ? 81   TRP B NE1 1 
ATOM   3817  C CE2 . TRP B  1 101 ? -22.21647 -30.88355  82.25904  1.000 37.03877  ? 81   TRP B CE2 1 
ATOM   3818  C CE3 . TRP B  1 101 ? -21.58195 -33.00131  81.26650  1.000 35.83425  ? 81   TRP B CE3 1 
ATOM   3819  C CZ2 . TRP B  1 101 ? -21.16879 -30.20492  81.61858  1.000 39.26761  ? 81   TRP B CZ2 1 
ATOM   3820  C CZ3 . TRP B  1 101 ? -20.53553 -32.32672  80.62668  1.000 41.03073  ? 81   TRP B CZ3 1 
ATOM   3821  C CH2 . TRP B  1 101 ? -20.34395 -30.93639  80.80862  1.000 40.67702  ? 81   TRP B CH2 1 
ATOM   3822  N N   . ASP B  1 102 ? -26.60992 -35.75911  80.77849  1.000 34.18286  ? 82   ASP B N   1 
ATOM   3823  C CA  . ASP B  1 102 ? -27.44351 -36.95267  80.65089  1.000 35.17532  ? 82   ASP B CA  1 
ATOM   3824  C C   . ASP B  1 102 ? -27.15228 -37.75605  79.39493  1.000 36.82860  ? 82   ASP B C   1 
ATOM   3825  O O   . ASP B  1 102 ? -27.95971 -38.60853  79.02792  1.000 41.66724  ? 82   ASP B O   1 
ATOM   3826  C CB  . ASP B  1 102 ? -28.92581 -36.56590  80.64798  1.000 35.19743  ? 82   ASP B CB  1 
ATOM   3827  C CG  . ASP B  1 102 ? -29.28273 -35.65425  79.47248  1.000 38.69006  ? 82   ASP B CG  1 
ATOM   3828  O OD1 . ASP B  1 102 ? -30.47329 -35.57654  79.08908  1.000 40.95174  ? 82   ASP B OD1 1 
ATOM   3829  O OD2 . ASP B  1 102 ? -28.35590 -35.00955  78.92262  1.000 40.32751  ? 82   ASP B OD2 1 
ATOM   3830  N N   . PHE B  1 103 ? -26.04507 -37.50062  78.71599  1.000 34.15889  ? 83   PHE B N   1 
ATOM   3831  C CA  . PHE B  1 103 ? -25.86265 -37.98945  77.35859  1.000 34.77326  ? 83   PHE B CA  1 
ATOM   3832  C C   . PHE B  1 103 ? -24.71065 -38.97592  77.24551  1.000 34.29660  ? 83   PHE B C   1 
ATOM   3833  O O   . PHE B  1 103 ? -24.26743 -39.26684  76.13044  1.000 40.13345  ? 83   PHE B O   1 
ATOM   3834  C CB  . PHE B  1 103 ? -25.64699 -36.81007  76.40722  1.000 35.98397  ? 83   PHE B CB  1 
ATOM   3835  C CG  . PHE B  1 103 ? -24.47200 -35.94654  76.76698  1.000 39.50212  ? 83   PHE B CG  1 
ATOM   3836  C CD1 . PHE B  1 103 ? -23.21030 -36.18125  76.20035  1.000 36.53699  ? 83   PHE B CD1 1 
ATOM   3837  C CD2 . PHE B  1 103 ? -24.62423 -34.87798  77.66127  1.000 38.48158  ? 83   PHE B CD2 1 
ATOM   3838  C CE1 . PHE B  1 103 ? -22.12610 -35.37198  76.51044  1.000 37.08809  ? 83   PHE B CE1 1 
ATOM   3839  C CE2 . PHE B  1 103 ? -23.54463 -34.05611  77.98674  1.000 39.02383  ? 83   PHE B CE2 1 
ATOM   3840  C CZ  . PHE B  1 103 ? -22.29122 -34.29867  77.41050  1.000 38.66667  ? 83   PHE B CZ  1 
ATOM   3841  N N   . PHE B  1 104 ? -24.20812 -39.47976  78.37047  1.000 33.37424  ? 84   PHE B N   1 
ATOM   3842  C CA  . PHE B  1 104 ? -23.15988 -40.48434  78.38882  1.000 33.13132  ? 84   PHE B CA  1 
ATOM   3843  C C   . PHE B  1 104 ? -23.78991 -41.87989  78.28329  1.000 33.72734  ? 84   PHE B C   1 
ATOM   3844  O O   . PHE B  1 104 ? -24.69878 -42.21748  79.04123  1.000 37.73508  ? 84   PHE B O   1 
ATOM   3845  C CB  . PHE B  1 104 ? -22.33101 -40.36074  79.67166  1.000 39.10568  ? 84   PHE B CB  1 
ATOM   3846  C CG  . PHE B  1 104 ? -21.36699 -39.17592  79.68843  1.000 46.51597  ? 84   PHE B CG  1 
ATOM   3847  C CD1 . PHE B  1 104 ? -21.83040 -37.86230  79.56549  1.000 48.49836  ? 84   PHE B CD1 1 
ATOM   3848  C CD2 . PHE B  1 104 ? -19.99669 -39.38061  79.85270  1.000 45.67297  ? 84   PHE B CD2 1 
ATOM   3849  C CE1 . PHE B  1 104 ? -20.93862 -36.77526  79.59022  1.000 48.12128  ? 84   PHE B CE1 1 
ATOM   3850  C CE2 . PHE B  1 104 ? -19.10181 -38.29912  79.87718  1.000 45.82592  ? 84   PHE B CE2 1 
ATOM   3851  C CZ  . PHE B  1 104 ? -19.57849 -36.99540  79.74477  1.000 45.85111  ? 84   PHE B CZ  1 
ATOM   3852  N N   . ARG B  1 105 ? -23.30672 -42.68891  77.35139  1.000 38.05808  ? 85   ARG B N   1 
ATOM   3853  C CA  . ARG B  1 105 ? -23.85779 -44.03603  77.16419  1.000 37.72866  ? 85   ARG B CA  1 
ATOM   3854  C C   . ARG B  1 105 ? -22.83271 -45.08503  77.57003  1.000 36.38752  ? 85   ARG B C   1 
ATOM   3855  O O   . ARG B  1 105 ? -21.77086 -45.18991  76.93849  1.000 38.30085  ? 85   ARG B O   1 
ATOM   3856  C CB  . ARG B  1 105 ? -24.29695 -44.25260  75.71643  1.000 35.47495  ? 85   ARG B CB  1 
ATOM   3857  C CG  . ARG B  1 105 ? -25.50695 -43.44994  75.31582  1.000 35.90250  ? 85   ARG B CG  1 
ATOM   3858  C CD  . ARG B  1 105 ? -26.73776 -43.74759  76.18890  1.000 46.08742  ? 85   ARG B CD  1 
ATOM   3859  N NE  . ARG B  1 105 ? -27.74251 -42.68543  76.03206  1.000 57.96556  ? 85   ARG B NE  1 
ATOM   3860  C CZ  . ARG B  1 105 ? -27.84740 -41.58551  76.79563  1.000 53.03335  ? 85   ARG B CZ  1 
ATOM   3861  N NH1 . ARG B  1 105 ? -27.03497 -41.37240  77.82412  1.000 42.83764  ? 85   ARG B NH1 1 
ATOM   3862  N NH2 . ARG B  1 105 ? -28.79356 -40.69399  76.53210  1.000 58.85354  ? 85   ARG B NH2 1 
ATOM   3863  N N   . PRO B  1 106 ? -23.09163 -45.86307  78.61028  1.000 33.10230  ? 86   PRO B N   1 
ATOM   3864  C CA  . PRO B  1 106 ? -22.10026 -46.86165  79.05101  1.000 33.22478  ? 86   PRO B CA  1 
ATOM   3865  C C   . PRO B  1 106 ? -21.68297 -47.86689  77.98222  1.000 39.98149  ? 86   PRO B C   1 
ATOM   3866  O O   . PRO B  1 106 ? -20.57453 -48.41355  78.08050  1.000 37.96414  ? 86   PRO B O   1 
ATOM   3867  C CB  . PRO B  1 106 ? -22.81418 -47.55874  80.22212  1.000 38.68708  ? 86   PRO B CB  1 
ATOM   3868  C CG  . PRO B  1 106 ? -23.77329 -46.52706  80.75451  1.000 32.73867  ? 86   PRO B CG  1 
ATOM   3869  C CD  . PRO B  1 106 ? -24.23175 -45.74506  79.53412  1.000 34.02798  ? 86   PRO B CD  1 
ATOM   3870  N N   . GLU B  1 107 ? -22.52614 -48.16095  76.98151  1.000 36.78541  ? 87   GLU B N   1 
ATOM   3871  C CA  . GLU B  1 107 ? -22.08863 -49.07996  75.92640  1.000 36.38795  ? 87   GLU B CA  1 
ATOM   3872  C C   . GLU B  1 107 ? -20.98865 -48.49746  75.07302  1.000 37.68010  ? 87   GLU B C   1 
ATOM   3873  O O   . GLU B  1 107 ? -20.32995 -49.24831  74.35382  1.000 44.02314  ? 87   GLU B O   1 
ATOM   3874  C CB  . GLU B  1 107 ? -23.22515 -49.47136  74.98797  1.000 36.56991  ? 87   GLU B CB  1 
ATOM   3875  C CG  . GLU B  1 107 ? -24.46203 -49.69008  75.68248  1.000 42.34345  ? 87   GLU B CG  1 
ATOM   3876  C CD  . GLU B  1 107 ? -25.35929 -48.48254  75.61339  1.000 36.13184  ? 87   GLU B CD  1 
ATOM   3877  O OE1 . GLU B  1 107 ? -26.40824 -48.59120  74.93169  1.000 37.13759  ? 87   GLU B OE1 1 
ATOM   3878  O OE2 . GLU B  1 107 ? -24.99564 -47.44398  76.22460  1.000 35.18708  ? 87   GLU B OE2 1 
ATOM   3879  N N   . ARG B  1 108 ? -20.82558 -47.17719  75.07900  1.000 37.52483  ? 88   ARG B N   1 
ATOM   3880  C CA  . ARG B  1 108 ? -19.69518 -46.53185  74.42457  1.000 38.13312  ? 88   ARG B CA  1 
ATOM   3881  C C   . ARG B  1 108 ? -18.56318 -46.22797  75.38732  1.000 37.15431  ? 88   ARG B C   1 
ATOM   3882  O O   . ARG B  1 108 ? -17.72825 -45.37880  75.08393  1.000 41.58228  ? 88   ARG B O   1 
ATOM   3883  C CB  . ARG B  1 108 ? -20.13893 -45.24935  73.70912  1.000 37.43675  ? 88   ARG B CB  1 
ATOM   3884  C CG  . ARG B  1 108 ? -21.34711 -45.44283  72.80705  1.000 37.93146  ? 88   ARG B CG  1 
ATOM   3885  C CD  . ARG B  1 108 ? -21.54040 -44.25969  71.86327  1.000 42.45772  ? 88   ARG B CD  1 
ATOM   3886  N NE  . ARG B  1 108 ? -21.92884 -43.02292  72.56373  1.000 41.66845  ? 88   ARG B NE  1 
ATOM   3887  C CZ  . ARG B  1 108 ? -23.16688 -42.52129  72.56640  1.000 37.96496  ? 88   ARG B CZ  1 
ATOM   3888  N NH1 . ARG B  1 108 ? -24.15798 -43.15069  71.94129  1.000 40.34232  ? 88   ARG B NH1 1 
ATOM   3889  N NH2 . ARG B  1 108 ? -23.42989 -41.40968  73.22508  1.000 37.37804  ? 88   ARG B NH2 1 
ATOM   3890  N N   . ASN B  1 109 ? -18.50963 -46.91733  76.52908  1.000 40.86410  ? 89   ASN B N   1 
ATOM   3891  C CA  . ASN B  1 109 ? -17.49644 -46.68687  77.56486  1.000 43.77529  ? 89   ASN B CA  1 
ATOM   3892  C C   . ASN B  1 109 ? -17.51616 -45.25051  78.08747  1.000 42.56164  ? 89   ASN B C   1 
ATOM   3893  O O   . ASN B  1 109 ? -16.49479 -44.70079  78.46926  1.000 47.54987  ? 89   ASN B O   1 
ATOM   3894  C CB  . ASN B  1 109 ? -16.09526 -47.05910  77.07767  1.000 43.59776  ? 89   ASN B CB  1 
ATOM   3895  C CG  . ASN B  1 109 ? -15.92437 -48.55226  76.90736  1.000 46.08796  ? 89   ASN B CG  1 
ATOM   3896  O OD1 . ASN B  1 109 ? -16.25749 -49.32625  77.80206  1.000 47.87332  ? 89   ASN B OD1 1 
ATOM   3897  N ND2 . ASN B  1 109 ? -15.40344 -48.96470  75.75886  1.000 46.60130  ? 89   ASN B ND2 1 
ATOM   3898  N N   . GLU B  1 110 ? -18.67835 -44.63679  78.11786  1.000 39.29892  ? 90   GLU B N   1 
ATOM   3899  C CA  . GLU B  1 110 ? -18.87347 -43.36885  78.78392  1.000 43.08018  ? 90   GLU B CA  1 
ATOM   3900  C C   . GLU B  1 110 ? -19.63370 -43.62441  80.07831  1.000 45.10290  ? 90   GLU B C   1 
ATOM   3901  O O   . GLU B  1 110 ? -20.40368 -44.58269  80.18514  1.000 48.93138  ? 90   GLU B O   1 
ATOM   3902  C CB  . GLU B  1 110 ? -19.64498 -42.40274  77.88253  1.000 43.02294  ? 90   GLU B CB  1 
ATOM   3903  C CG  . GLU B  1 110 ? -19.07242 -42.30136  76.48608  1.000 39.70926  ? 90   GLU B CG  1 
ATOM   3904  C CD  . GLU B  1 110 ? -20.07297 -41.81318  75.47347  1.000 43.54577  ? 90   GLU B CD  1 
ATOM   3905  O OE1 . GLU B  1 110 ? -21.24886 -41.57701  75.82667  1.000 42.81700  ? 90   GLU B OE1 1 
ATOM   3906  O OE2 . GLU B  1 110 ? -19.68331 -41.67488  74.30372  1.000 49.03102  ? 90   GLU B OE2 1 
ATOM   3907  N N   . SER B  1 111 ? -19.39512 -42.78983  81.07872  1.000 41.32550  ? 91   SER B N   1 
ATOM   3908  C CA  . SER B  1 111 ? -20.19424 -42.89695  82.28989  1.000 37.52373  ? 91   SER B CA  1 
ATOM   3909  C C   . SER B  1 111 ? -20.21073 -41.54448  82.98599  1.000 34.73301  ? 91   SER B C   1 
ATOM   3910  O O   . SER B  1 111 ? -19.22378 -40.81642  82.94964  1.000 35.19280  ? 91   SER B O   1 
ATOM   3911  C CB  . SER B  1 111 ? -19.66108 -43.98344  83.22956  1.000 32.46791  ? 91   SER B CB  1 
ATOM   3912  O OG  . SER B  1 111 ? -18.29617 -43.78300  83.52779  1.000 34.35188  ? 91   SER B OG  1 
ATOM   3913  N N   . PHE B  1 112 ? -21.35377 -41.21118  83.58355  1.000 40.47986  ? 92   PHE B N   1 
ATOM   3914  C CA  . PHE B  1 112 ? -21.50815 -40.02164  84.41255  1.000 40.70960  ? 92   PHE B CA  1 
ATOM   3915  C C   . PHE B  1 112 ? -22.22072 -40.47289  85.67626  1.000 41.63616  ? 92   PHE B C   1 
ATOM   3916  O O   . PHE B  1 112 ? -23.40218 -40.82592  85.63059  1.000 44.31287  ? 92   PHE B O   1 
ATOM   3917  C CB  . PHE B  1 112 ? -22.28192 -38.92102  83.68419  1.000 36.38306  ? 92   PHE B CB  1 
ATOM   3918  C CG  . PHE B  1 112 ? -22.09870 -37.55556  84.29056  1.000 39.14771  ? 92   PHE B CG  1 
ATOM   3919  C CD1 . PHE B  1 112 ? -22.82248 -37.17757  85.41589  1.000 40.51223  ? 92   PHE B CD1 1 
ATOM   3920  C CD2 . PHE B  1 112 ? -21.20336 -36.65494  83.74567  1.000 41.94929  ? 92   PHE B CD2 1 
ATOM   3921  C CE1 . PHE B  1 112 ? -22.63540 -35.93133  85.99073  1.000 39.94121  ? 92   PHE B CE1 1 
ATOM   3922  C CE2 . PHE B  1 112 ? -21.01260 -35.39919  84.30646  1.000 40.99902  ? 92   PHE B CE2 1 
ATOM   3923  C CZ  . PHE B  1 112 ? -21.72216 -35.03696  85.42795  1.000 40.08195  ? 92   PHE B CZ  1 
ATOM   3924  N N   . ASP B  1 113 ? -21.50237 -40.49272  86.79589  1.000 44.25948  ? 93   ASP B N   1 
ATOM   3925  C CA  . ASP B  1 113 ? -22.03141 -40.98329  88.06479  1.000 41.13237  ? 93   ASP B CA  1 
ATOM   3926  C C   . ASP B  1 113 ? -22.16859 -39.82536  89.04976  1.000 44.98650  ? 93   ASP B C   1 
ATOM   3927  O O   . ASP B  1 113 ? -21.21681 -39.06389  89.25883  1.000 49.44659  ? 93   ASP B O   1 
ATOM   3928  C CB  . ASP B  1 113 ? -21.12788 -42.07562  88.64010  1.000 38.61317  ? 93   ASP B CB  1 
ATOM   3929  C CG  . ASP B  1 113 ? -21.18187 -43.35229  87.83125  1.000 43.60825  ? 93   ASP B CG  1 
ATOM   3930  O OD1 . ASP B  1 113 ? -22.27576 -43.95250  87.76196  1.000 50.97860  ? 93   ASP B OD1 1 
ATOM   3931  O OD2 . ASP B  1 113 ? -20.15239 -43.76446  87.26267  1.000 44.32411  ? 93   ASP B OD2 1 
ATOM   3932  N N   . ILE B  1 114 ? -23.36425 -39.69238  89.62606  1.000 46.63758  ? 94   ILE B N   1 
ATOM   3933  C CA  . ILE B  1 114 ? -23.67609 -38.74273  90.69089  1.000 45.18870  ? 94   ILE B CA  1 
ATOM   3934  C C   . ILE B  1 114 ? -23.59518 -39.50643  92.00533  1.000 48.89831  ? 94   ILE B C   1 
ATOM   3935  O O   . ILE B  1 114 ? -24.30889 -40.50090  92.19784  1.000 46.92757  ? 94   ILE B O   1 
ATOM   3936  C CB  . ILE B  1 114 ? -25.07332 -38.12503  90.49362  1.000 41.83636  ? 94   ILE B CB  1 
ATOM   3937  C CG1 . ILE B  1 114 ? -25.23490 -37.55400  89.07125  1.000 40.22433  ? 94   ILE B CG1 1 
ATOM   3938  C CG2 . ILE B  1 114 ? -25.38157 -37.10053  91.56275  1.000 39.98759  ? 94   ILE B CG2 1 
ATOM   3939  C CD1 . ILE B  1 114 ? -26.66054 -37.14646  88.71452  1.000 38.76100  ? 94   ILE B CD1 1 
ATOM   3940  N N   . LEU B  1 115 ? -22.71501 -39.07576  92.90632  1.000 49.35594  ? 95   LEU B N   1 
ATOM   3941  C CA  . LEU B  1 115 ? -22.43454 -39.83994  94.12151  1.000 49.22446  ? 95   LEU B CA  1 
ATOM   3942  C C   . LEU B  1 115 ? -22.62661 -38.95868  95.34601  1.000 50.29225  ? 95   LEU B C   1 
ATOM   3943  O O   . LEU B  1 115 ? -21.67579 -38.33050  95.82937  1.000 47.78971  ? 95   LEU B O   1 
ATOM   3944  C CB  . LEU B  1 115 ? -21.02660 -40.42511  94.07980  1.000 46.15980  ? 95   LEU B CB  1 
ATOM   3945  C CG  . LEU B  1 115 ? -20.68543 -41.11166  92.75473  1.000 42.23179  ? 95   LEU B CG  1 
ATOM   3946  C CD1 . LEU B  1 115 ? -19.19706 -41.00737  92.47141  1.000 44.60240  ? 95   LEU B CD1 1 
ATOM   3947  C CD2 . LEU B  1 115 ? -21.13312 -42.55700  92.77349  1.000 40.67651  ? 95   LEU B CD2 1 
ATOM   3948  N N   . PRO B  1 116 ? -23.83793 -38.90490  95.88827  1.000 56.72773  ? 96   PRO B N   1 
ATOM   3949  C CA  . PRO B  1 116 ? -24.06739 -38.13075  97.10902  1.000 65.10619  ? 96   PRO B CA  1 
ATOM   3950  C C   . PRO B  1 116 ? -23.74695 -38.94453  98.34975  1.000 71.41283  ? 96   PRO B C   1 
ATOM   3951  O O   . PRO B  1 116 ? -23.89880 -40.16691  98.38133  1.000 70.84788  ? 96   PRO B O   1 
ATOM   3952  C CB  . PRO B  1 116 ? -25.56624 -37.80071  97.04929  1.000 63.61962  ? 96   PRO B CB  1 
ATOM   3953  C CG  . PRO B  1 116 ? -26.12043 -38.58228  95.84461  1.000 61.76781  ? 96   PRO B CG  1 
ATOM   3954  C CD  . PRO B  1 116 ? -25.06857 -39.56367  95.43191  1.000 58.53797  ? 96   PRO B CD  1 
ATOM   3955  N N   . ALA B  1 117 ? -23.29855 -38.23868  99.38328  1.000 87.40085  ? 97   ALA B N   1 
ATOM   3956  C CA  . ALA B  1 117 ? -23.03807 -38.87364  100.66626 1.000 90.00565  ? 97   ALA B CA  1 
ATOM   3957  C C   . ALA B  1 117 ? -24.32058 -39.48472  101.20232 1.000 97.51098  ? 97   ALA B C   1 
ATOM   3958  O O   . ALA B  1 117 ? -25.31723 -38.78312  101.39370 1.000 98.89775  ? 97   ALA B O   1 
ATOM   3959  C CB  . ALA B  1 117 ? -22.47962 -37.85102  101.65130 1.000 90.15384  ? 97   ALA B CB  1 
ATOM   3960  N N   . SER B  1 118 ? -24.30589 -40.79515  101.43520 1.000 106.02215 ? 98   SER B N   1 
ATOM   3961  C CA  . SER B  1 118 ? -25.53800 -41.45999  101.85163 1.000 115.71098 ? 98   SER B CA  1 
ATOM   3962  C C   . SER B  1 118 ? -25.18651 -42.77292  102.55716 1.000 121.79456 ? 98   SER B C   1 
ATOM   3963  O O   . SER B  1 118 ? -24.10476 -42.89501  103.14610 1.000 120.72870 ? 98   SER B O   1 
ATOM   3964  C CB  . SER B  1 118 ? -26.46583 -41.62826  100.62961 1.000 114.73472 ? 98   SER B CB  1 
ATOM   3965  O OG  . SER B  1 118 ? -25.76574 -42.12371  99.49719  1.000 110.38616 ? 98   SER B OG  1 
ATOM   3966  N N   . GLN B  1 119 ? -26.10933 -43.74836  102.50303 1.000 128.51580 ? 99   GLN B N   1 
ATOM   3967  C CA  . GLN B  1 119 ? -26.00048 -45.02424  103.22193 1.000 134.41949 ? 99   GLN B CA  1 
ATOM   3968  C C   . GLN B  1 119 ? -26.35235 -46.17935  102.26984 1.000 135.62138 ? 99   GLN B C   1 
ATOM   3969  O O   . GLN B  1 119 ? -27.48512 -46.66998  102.25551 1.000 137.98896 ? 99   GLN B O   1 
ATOM   3970  C CB  . GLN B  1 119 ? -26.89867 -45.01530  104.47105 1.000 139.12534 ? 99   GLN B CB  1 
ATOM   3971  N N   . ARG B  1 120 ? -25.36361 -46.61484  101.47949 1.000 133.76085 ? 100  ARG B N   1 
ATOM   3972  C CA  . ARG B  1 120 ? -25.51859 -47.76290  100.58522 1.000 135.98383 ? 100  ARG B CA  1 
ATOM   3973  C C   . ARG B  1 120 ? -24.55641 -48.87358  100.99105 1.000 138.32446 ? 100  ARG B C   1 
ATOM   3974  O O   . ARG B  1 120 ? -24.99497 -49.88449  101.54830 1.000 141.74357 ? 100  ARG B O   1 
ATOM   3975  C CB  . ARG B  1 120 ? -25.31650 -47.32424  99.12984  1.000 131.15690 ? 100  ARG B CB  1 
ATOM   3976  C CG  . ARG B  1 120 ? -25.25188 -48.45282  98.09669  1.000 129.46826 ? 100  ARG B CG  1 
ATOM   3977  C CD  . ARG B  1 120 ? -24.79713 -47.92002  96.74521  1.000 124.46677 ? 100  ARG B CD  1 
ATOM   3978  N NE  . ARG B  1 120 ? -23.66257 -47.00806  96.88699  1.000 123.02109 ? 100  ARG B NE  1 
ATOM   3979  C CZ  . ARG B  1 120 ? -22.39515 -47.40122  96.98583  1.000 122.99526 ? 100  ARG B CZ  1 
ATOM   3980  N NH1 . ARG B  1 120 ? -22.09674 -48.69636  96.94977  1.000 125.90535 ? 100  ARG B NH1 1 
ATOM   3981  N NH2 . ARG B  1 120 ? -21.42495 -46.50354  97.11828  1.000 118.36347 ? 100  ARG B NH2 1 
ATOM   3982  N N   . VAL B  1 121 ? -23.25884 -48.72917  100.72160 1.000 137.02317 ? 101  VAL B N   1 
ATOM   3983  C CA  . VAL B  1 121 ? -22.25318 -49.52483  101.41504 1.000 139.15071 ? 101  VAL B CA  1 
ATOM   3984  C C   . VAL B  1 121 ? -21.68523 -48.76126  102.60862 1.000 141.66907 ? 101  VAL B C   1 
ATOM   3985  O O   . VAL B  1 121 ? -21.16239 -49.39389  103.53970 1.000 145.68680 ? 101  VAL B O   1 
ATOM   3986  C CB  . VAL B  1 121 ? -21.11845 -49.97432  100.46730 1.000 132.94521 ? 101  VAL B CB  1 
ATOM   3987  C CG1 . VAL B  1 121 ? -21.65601 -50.93588  99.40785  1.000 131.31433 ? 101  VAL B CG1 1 
ATOM   3988  C CG2 . VAL B  1 121 ? -20.43682 -48.76807  99.82763  1.000 127.49417 ? 101  VAL B CG2 1 
ATOM   3989  N N   . SER B  1 122 ? -21.78572 -47.42749  102.61366 1.000 138.24920 ? 102  SER B N   1 
ATOM   3990  C CA  . SER B  1 122 ? -21.46732 -46.59346  103.76394 1.000 138.22167 ? 102  SER B CA  1 
ATOM   3991  C C   . SER B  1 122 ? -22.74114 -46.34647  104.57606 1.000 141.26084 ? 102  SER B C   1 
ATOM   3992  O O   . SER B  1 122 ? -23.78857 -46.94130  104.31017 1.000 143.22534 ? 102  SER B O   1 
ATOM   3993  C CB  . SER B  1 122 ? -20.82707 -45.28464  103.30616 1.000 133.57362 ? 102  SER B CB  1 
ATOM   3994  N N   . GLU B  1 123 ? -22.66329 -45.45672  105.57464 1.000 141.02376 ? 103  GLU B N   1 
ATOM   3995  C CA  . GLU B  1 123 ? -23.80688 -45.09789  106.41414 1.000 141.67398 ? 103  GLU B CA  1 
ATOM   3996  C C   . GLU B  1 123 ? -23.57520 -43.78295  107.15483 1.000 140.47958 ? 103  GLU B C   1 
ATOM   3997  O O   . GLU B  1 123 ? -24.38871 -43.39423  108.00089 1.000 143.93846 ? 103  GLU B O   1 
ATOM   3998  C CB  . GLU B  1 123 ? -24.10537 -46.20244  107.43569 1.000 144.59410 ? 103  GLU B CB  1 
ATOM   3999  C CG  . GLU B  1 123 ? -25.04722 -47.28911  106.94903 1.000 145.50979 ? 103  GLU B CG  1 
ATOM   4000  C CD  . GLU B  1 123 ? -26.04683 -47.70942  107.99686 1.000 152.31430 ? 103  GLU B CD  1 
ATOM   4001  O OE1 . GLU B  1 123 ? -26.54569 -48.85217  107.91599 1.000 155.47957 ? 103  GLU B OE1 1 
ATOM   4002  O OE2 . GLU B  1 123 ? -26.34193 -46.89387  108.89465 1.000 155.00885 ? 103  GLU B OE2 1 
ATOM   4003  N N   . THR B  1 124 ? -22.47786 -43.08556  106.83575 1.000 135.10562 ? 104  THR B N   1 
ATOM   4004  C CA  . THR B  1 124 ? -22.01509 -41.97170  107.66323 1.000 133.37204 ? 104  THR B CA  1 
ATOM   4005  C C   . THR B  1 124 ? -22.93399 -40.75442  107.60884 1.000 132.51450 ? 104  THR B C   1 
ATOM   4006  O O   . THR B  1 124 ? -22.85666 -39.90364  108.50524 1.000 133.94620 ? 104  THR B O   1 
ATOM   4007  C CB  . THR B  1 124 ? -20.59963 -41.56053  107.24624 1.000 127.16422 ? 104  THR B CB  1 
ATOM   4008  N N   . GLN B  1 125 ? -23.77978 -40.65156  106.57663 1.000 128.86655 ? 105  GLN B N   1 
ATOM   4009  C CA  . GLN B  1 125 ? -24.68487 -39.52675  106.33515 1.000 125.81235 ? 105  GLN B CA  1 
ATOM   4010  C C   . GLN B  1 125 ? -23.94395 -38.28834  105.83001 1.000 121.07044 ? 105  GLN B C   1 
ATOM   4011  O O   . GLN B  1 125 ? -24.55840 -37.41563  105.20726 1.000 118.55319 ? 105  GLN B O   1 
ATOM   4012  C CB  . GLN B  1 125 ? -25.49832 -39.18648  107.59076 1.000 128.92312 ? 105  GLN B CB  1 
ATOM   4013  N N   . TRP B  1 126 ? -22.62956 -38.20834  106.06931 1.000 119.19898 ? 106  TRP B N   1 
ATOM   4014  C CA  . TRP B  1 126 ? -21.80532 -37.07966  105.64415 1.000 111.54972 ? 106  TRP B CA  1 
ATOM   4015  C C   . TRP B  1 126 ? -20.44394 -37.57981  105.16585 1.000 104.81155 ? 106  TRP B C   1 
ATOM   4016  O O   . TRP B  1 126 ? -19.91236 -38.55857  105.70367 1.000 107.33320 ? 106  TRP B O   1 
ATOM   4017  C CB  . TRP B  1 126 ? -21.62523 -36.04932  106.78948 1.000 113.39878 ? 106  TRP B CB  1 
ATOM   4018  C CG  . TRP B  1 126 ? -22.55214 -34.84847  106.68568 1.000 112.51731 ? 106  TRP B CG  1 
ATOM   4019  C CD1 . TRP B  1 126 ? -23.91644 -34.87191  106.58429 1.000 113.86172 ? 106  TRP B CD1 1 
ATOM   4020  C CD2 . TRP B  1 126 ? -22.17547 -33.46128  106.65062 1.000 109.06354 ? 106  TRP B CD2 1 
ATOM   4021  N NE1 . TRP B  1 126 ? -24.40953 -33.59298  106.49022 1.000 112.51393 ? 106  TRP B NE1 1 
ATOM   4022  C CE2 . TRP B  1 126 ? -23.36363 -32.70878  106.52850 1.000 110.06480 ? 106  TRP B CE2 1 
ATOM   4023  C CE3 . TRP B  1 126 ? -20.95262 -32.78406  106.71051 1.000 104.42705 ? 106  TRP B CE3 1 
ATOM   4024  C CZ2 . TRP B  1 126 ? -23.36377 -31.31497  106.46860 1.000 108.43627 ? 106  TRP B CZ2 1 
ATOM   4025  C CZ3 . TRP B  1 126 ? -20.95694 -31.39739  106.64780 1.000 102.51720 ? 106  TRP B CZ3 1 
ATOM   4026  C CH2 . TRP B  1 126 ? -22.15411 -30.67991  106.52997 1.000 104.43422 ? 106  TRP B CH2 1 
ATOM   4027  N N   . TYR B  1 127 ? -19.88899 -36.91438  104.14384 1.000 95.88824  ? 107  TYR B N   1 
ATOM   4028  C CA  . TYR B  1 127 ? -18.52545 -37.19243  103.68844 1.000 90.48071  ? 107  TYR B CA  1 
ATOM   4029  C C   . TYR B  1 127 ? -17.54914 -36.49310  104.62587 1.000 88.11577  ? 107  TYR B C   1 
ATOM   4030  O O   . TYR B  1 127 ? -17.60778 -35.26626  104.77753 1.000 86.08578  ? 107  TYR B O   1 
ATOM   4031  C CB  . TYR B  1 127 ? -18.29462 -36.70683  102.25433 1.000 86.88767  ? 107  TYR B CB  1 
ATOM   4032  C CG  . TYR B  1 127 ? -18.82815 -37.59065  101.13327 1.000 85.09188  ? 107  TYR B CG  1 
ATOM   4033  C CD1 . TYR B  1 127 ? -18.71640 -38.97706  101.18274 1.000 85.89208  ? 107  TYR B CD1 1 
ATOM   4034  C CD2 . TYR B  1 127 ? -19.43919 -37.02423  100.01447 1.000 81.92535  ? 107  TYR B CD2 1 
ATOM   4035  C CE1 . TYR B  1 127 ? -19.21368 -39.77572  100.14762 1.000 84.64796  ? 107  TYR B CE1 1 
ATOM   4036  C CE2 . TYR B  1 127 ? -19.93692 -37.80949  98.97933  1.000 80.13314  ? 107  TYR B CE2 1 
ATOM   4037  C CZ  . TYR B  1 127 ? -19.82231 -39.18282  99.04682  1.000 82.03013  ? 107  TYR B CZ  1 
ATOM   4038  O OH  . TYR B  1 127 ? -20.31268 -39.96194  98.01336  1.000 80.50707  ? 107  TYR B OH  1 
ATOM   4039  N N   . GLU B  1 128 ? -16.64037 -37.26436  105.23805 1.000 85.28867  ? 108  GLU B N   1 
ATOM   4040  C CA  . GLU B  1 128 ? -15.76788 -36.72380  106.27856 1.000 82.24176  ? 108  GLU B CA  1 
ATOM   4041  C C   . GLU B  1 128 ? -14.65890 -35.84063  105.72586 1.000 76.38182  ? 108  GLU B C   1 
ATOM   4042  O O   . GLU B  1 128 ? -13.97513 -35.17156  106.50807 1.000 78.53679  ? 108  GLU B O   1 
ATOM   4043  C CB  . GLU B  1 128 ? -15.17131 -37.86199  107.10834 1.000 85.66558  ? 108  GLU B CB  1 
ATOM   4044  C CG  . GLU B  1 128 ? -16.20042 -38.89038  107.54706 1.000 91.83787  ? 108  GLU B CG  1 
ATOM   4045  C CD  . GLU B  1 128 ? -15.70902 -39.78458  108.67023 1.000 101.34868 ? 108  GLU B CD  1 
ATOM   4046  O OE1 . GLU B  1 128 ? -16.50996 -40.05481  109.58976 1.000 106.76465 ? 108  GLU B OE1 1 
ATOM   4047  O OE2 . GLU B  1 128 ? -14.53515 -40.22580  108.63233 1.000 103.14621 ? 108  GLU B OE2 1 
ATOM   4048  N N   . GLY B  1 129 ? -14.47790 -35.80659  104.41415 1.000 71.02801  ? 109  GLY B N   1 
ATOM   4049  C CA  . GLY B  1 129 ? -13.49588 -34.92926  103.81231 1.000 67.58615  ? 109  GLY B CA  1 
ATOM   4050  C C   . GLY B  1 129 ? -13.38780 -35.21797  102.33235 1.000 66.60164  ? 109  GLY B C   1 
ATOM   4051  O O   . GLY B  1 129 ? -14.06550 -36.10058  101.79726 1.000 72.50510  ? 109  GLY B O   1 
ATOM   4052  N N   . THR B  1 130 ? -12.50558 -34.45829  101.67543 1.000 63.04654  ? 110  THR B N   1 
ATOM   4053  C CA  . THR B  1 130 ? -12.33678 -34.61288  100.23155 1.000 55.83465  ? 110  THR B CA  1 
ATOM   4054  C C   . THR B  1 130 ? -11.80791 -35.99950  99.88298  1.000 59.34256  ? 110  THR B C   1 
ATOM   4055  O O   . THR B  1 130 ? -12.24829 -36.61173  98.89956  1.000 61.69648  ? 110  THR B O   1 
ATOM   4056  C CB  . THR B  1 130 ? -11.41480 -33.52018  99.68295  1.000 55.83517  ? 110  THR B CB  1 
ATOM   4057  O OG1 . THR B  1 130 ? -10.36346 -33.26300  100.61478 1.000 61.05481  ? 110  THR B OG1 1 
ATOM   4058  C CG2 . THR B  1 130 ? -12.18523 -32.22059  99.49022  1.000 55.65293  ? 110  THR B CG2 1 
ATOM   4059  N N   . ALA B  1 131 ? -10.88129 -36.52766  100.68602 1.000 58.92532  ? 111  ALA B N   1 
ATOM   4060  C CA  . ALA B  1 131 ? -10.39036 -37.87864  100.42822 1.000 58.96028  ? 111  ALA B CA  1 
ATOM   4061  C C   . ALA B  1 131 ? -11.48000 -38.91075  100.69524 1.000 61.88467  ? 111  ALA B C   1 
ATOM   4062  O O   . ALA B  1 131 ? -11.67999 -39.84750  99.90574  1.000 62.61080  ? 111  ALA B O   1 
ATOM   4063  C CB  . ALA B  1 131 ? -9.15146  -38.16291  101.27307 1.000 56.76737  ? 111  ALA B CB  1 
ATOM   4064  N N   . ASP B  1 132 ? -12.20627 -38.75102  101.80139 1.000 61.06102  ? 112  ASP B N   1 
ATOM   4065  C CA  . ASP B  1 132 ? -13.27519 -39.69307  102.08836 1.000 63.81417  ? 112  ASP B CA  1 
ATOM   4066  C C   . ASP B  1 132 ? -14.33907 -39.66866  101.00116 1.000 64.82179  ? 112  ASP B C   1 
ATOM   4067  O O   . ASP B  1 132 ? -14.95068 -40.70507  100.70869 1.000 65.76905  ? 112  ASP B O   1 
ATOM   4068  C CB  . ASP B  1 132 ? -13.88592 -39.39213  103.44855 1.000 68.02732  ? 112  ASP B CB  1 
ATOM   4069  C CG  . ASP B  1 132 ? -14.95048 -40.38643  103.83135 1.000 69.93003  ? 112  ASP B CG  1 
ATOM   4070  O OD1 . ASP B  1 132 ? -14.67642 -41.59911  103.75949 1.000 68.25648  ? 112  ASP B OD1 1 
ATOM   4071  O OD2 . ASP B  1 132 ? -16.05849 -39.95156  104.21331 1.000 73.29133  ? 112  ASP B OD2 1 
ATOM   4072  N N   . ALA B  1 133 ? -14.55547 -38.50673  100.37313 1.000 61.63463  ? 113  ALA B N   1 
ATOM   4073  C CA  . ALA B  1 133 ? -15.51796 -38.43295  99.27972  1.000 57.85486  ? 113  ALA B CA  1 
ATOM   4074  C C   . ALA B  1 133 ? -15.15453 -39.38027  98.14138  1.000 56.99017  ? 113  ALA B C   1 
ATOM   4075  O O   . ALA B  1 133 ? -16.04347 -39.94824  97.49870  1.000 56.98947  ? 113  ALA B O   1 
ATOM   4076  C CB  . ALA B  1 133 ? -15.62379 -36.99994  98.77079  1.000 57.96640  ? 113  ALA B CB  1 
ATOM   4077  N N   . VAL B  1 134 ? -13.86336 -39.58108  97.88332  1.000 59.87388  ? 114  VAL B N   1 
ATOM   4078  C CA  . VAL B  1 134 ? -13.46488 -40.55993  96.87730  1.000 56.28968  ? 114  VAL B CA  1 
ATOM   4079  C C   . VAL B  1 134 ? -13.42464 -41.96393  97.46952  1.000 60.40968  ? 114  VAL B C   1 
ATOM   4080  O O   . VAL B  1 134 ? -13.81588 -42.93874  96.81602  1.000 66.48132  ? 114  VAL B O   1 
ATOM   4081  C CB  . VAL B  1 134 ? -12.10835 -40.16731  96.27116  1.000 53.41825  ? 114  VAL B CB  1 
ATOM   4082  C CG1 . VAL B  1 134 ? -11.79701 -41.05294  95.07177  1.000 48.34471  ? 114  VAL B CG1 1 
ATOM   4083  C CG2 . VAL B  1 134 ? -12.10660 -38.68135  95.89426  1.000 50.91813  ? 114  VAL B CG2 1 
ATOM   4084  N N   . TYR B  1 135 ? -12.94213 -42.09429  98.70614  1.000 59.94846  ? 115  TYR B N   1 
ATOM   4085  C CA  . TYR B  1 135 ? -12.78190 -43.41776  99.29350  1.000 56.22052  ? 115  TYR B CA  1 
ATOM   4086  C C   . TYR B  1 135 ? -14.10015 -44.17261  99.29883  1.000 56.30134  ? 115  TYR B C   1 
ATOM   4087  O O   . TYR B  1 135 ? -14.15259 -45.35165  98.93258  1.000 56.69421  ? 115  TYR B O   1 
ATOM   4088  C CB  . TYR B  1 135 ? -12.21944 -43.29957  100.71018 1.000 57.83093  ? 115  TYR B CB  1 
ATOM   4089  C CG  . TYR B  1 135 ? -12.19564 -44.60941  101.46543 1.000 60.67312  ? 115  TYR B CG  1 
ATOM   4090  C CD1 . TYR B  1 135 ? -11.22883 -45.57487  101.20440 1.000 61.36962  ? 115  TYR B CD1 1 
ATOM   4091  C CD2 . TYR B  1 135 ? -13.14595 -44.88464  102.44056 1.000 65.31695  ? 115  TYR B CD2 1 
ATOM   4092  C CE1 . TYR B  1 135 ? -11.21309 -46.78397  101.89532 1.000 64.59400  ? 115  TYR B CE1 1 
ATOM   4093  C CE2 . TYR B  1 135 ? -13.13541 -46.08590  103.13372 1.000 69.29931  ? 115  TYR B CE2 1 
ATOM   4094  C CZ  . TYR B  1 135 ? -12.16863 -47.02925  102.85691 1.000 69.60447  ? 115  TYR B CZ  1 
ATOM   4095  O OH  . TYR B  1 135 ? -12.17010 -48.21620  103.55645 1.000 74.72798  ? 115  TYR B OH  1 
ATOM   4096  N N   . GLN B  1 136 ? -15.18424 -43.49684  99.66298  1.000 58.22015  ? 116  GLN B N   1 
ATOM   4097  C CA  . GLN B  1 136 ? -16.45921 -44.18265  99.81581  1.000 64.59497  ? 116  GLN B CA  1 
ATOM   4098  C C   . GLN B  1 136 ? -16.99526 -44.74843  98.50216  1.000 62.96227  ? 116  GLN B C   1 
ATOM   4099  O O   . GLN B  1 136 ? -17.86493 -45.62683  98.53198  1.000 59.42241  ? 116  GLN B O   1 
ATOM   4100  C CB  . GLN B  1 136 ? -17.48641 -43.23154  100.42978 1.000 67.25543  ? 116  GLN B CB  1 
ATOM   4101  C CG  . GLN B  1 136 ? -17.29032 -42.98705  101.91207 1.000 71.45298  ? 116  GLN B CG  1 
ATOM   4102  C CD  . GLN B  1 136 ? -17.38038 -44.26192  102.71726 1.000 74.70441  ? 116  GLN B CD  1 
ATOM   4103  O OE1 . GLN B  1 136 ? -17.92850 -45.26622  102.25575 1.000 77.45061  ? 116  GLN B OE1 1 
ATOM   4104  N NE2 . GLN B  1 136 ? -16.84149 -44.23283  103.92836 1.000 72.12179  ? 116  GLN B NE2 1 
ATOM   4105  N N   . ASN B  1 137 ? -16.50674 -44.26835  97.35784  1.000 61.21757  ? 117  ASN B N   1 
ATOM   4106  C CA  . ASN B  1 137 ? -16.99554 -44.70542  96.05768  1.000 60.35412  ? 117  ASN B CA  1 
ATOM   4107  C C   . ASN B  1 137 ? -15.93297 -45.47689  95.27753  1.000 63.82515  ? 117  ASN B C   1 
ATOM   4108  O O   . ASN B  1 137 ? -15.95868 -45.50746  94.04426  1.000 61.68488  ? 117  ASN B O   1 
ATOM   4109  C CB  . ASN B  1 137 ? -17.50135 -43.51430  95.24670  1.000 52.24562  ? 117  ASN B CB  1 
ATOM   4110  C CG  . ASN B  1 137 ? -18.57667 -42.72678  95.97411  1.000 53.85590  ? 117  ASN B CG  1 
ATOM   4111  O OD1 . ASN B  1 137 ? -19.68413 -43.21185  96.15253  1.000 51.20781  ? 117  ASN B OD1 1 
ATOM   4112  N ND2 . ASN B  1 137 ? -18.25735 -41.49171  96.37767  1.000 48.47729  ? 117  ASN B ND2 1 
ATOM   4113  N N   . ILE B  1 138 ? -14.98936 -46.09798  95.99108  1.000 66.98412  ? 118  ILE B N   1 
ATOM   4114  C CA  . ILE B  1 138 ? -13.98208 -46.93715  95.34371  1.000 63.76169  ? 118  ILE B CA  1 
ATOM   4115  C C   . ILE B  1 138 ? -14.65227 -48.06878  94.57550  1.000 60.63782  ? 118  ILE B C   1 
ATOM   4116  O O   . ILE B  1 138 ? -14.21348 -48.44155  93.48196  1.000 56.86267  ? 118  ILE B O   1 
ATOM   4117  C CB  . ILE B  1 138 ? -12.98184 -47.46900  96.39281  1.000 64.68797  ? 118  ILE B CB  1 
ATOM   4118  C CG1 . ILE B  1 138 ? -11.96321 -46.38454  96.76754  1.000 62.70092  ? 118  ILE B CG1 1 
ATOM   4119  C CG2 . ILE B  1 138 ? -12.27434 -48.73606  95.90419  1.000 62.61176  ? 118  ILE B CG2 1 
ATOM   4120  C CD1 . ILE B  1 138 ? -10.98179 -46.79848  97.86442  1.000 65.79348  ? 118  ILE B CD1 1 
ATOM   4121  N N   . ASP B  1 139 ? -15.74085 -48.61586  95.12571  1.000 60.75343  ? 119  ASP B N   1 
ATOM   4122  C CA  . ASP B  1 139 ? -16.44884 -49.70541  94.46941  1.000 62.17009  ? 119  ASP B CA  1 
ATOM   4123  C C   . ASP B  1 139 ? -17.09223 -49.27237  93.15681  1.000 63.50199  ? 119  ASP B C   1 
ATOM   4124  O O   . ASP B  1 139 ? -17.47740 -50.13586  92.36386  1.000 65.21917  ? 119  ASP B O   1 
ATOM   4125  C CB  . ASP B  1 139 ? -17.49979 -50.29931  95.41537  1.000 66.48244  ? 119  ASP B CB  1 
ATOM   4126  C CG  . ASP B  1 139 ? -18.60449 -49.30950  95.77446  1.000 74.69323  ? 119  ASP B CG  1 
ATOM   4127  O OD1 . ASP B  1 139 ? -19.77559 -49.74618  95.89918  1.000 77.41475  ? 119  ASP B OD1 1 
ATOM   4128  O OD2 . ASP B  1 139 ? -18.30488 -48.09922  95.94023  1.000 73.47531  ? 119  ASP B OD2 1 
ATOM   4129  N N   . ILE B  1 140 ? -17.21703 -47.96835  92.90991  1.000 58.88040  ? 120  ILE B N   1 
ATOM   4130  C CA  . ILE B  1 140 ? -17.66619 -47.47697  91.61186  1.000 58.15144  ? 120  ILE B CA  1 
ATOM   4131  C C   . ILE B  1 140 ? -16.49785 -47.31432  90.66089  1.000 56.53946  ? 120  ILE B C   1 
ATOM   4132  O O   . ILE B  1 140 ? -16.60949 -47.60654  89.47144  1.000 61.01081  ? 120  ILE B O   1 
ATOM   4133  C CB  . ILE B  1 140 ? -18.41228 -46.14113  91.76969  1.000 64.21165  ? 120  ILE B CB  1 
ATOM   4134  C CG1 . ILE B  1 140 ? -19.49547 -46.24482  92.84411  1.000 69.12314  ? 120  ILE B CG1 1 
ATOM   4135  C CG2 . ILE B  1 140 ? -18.95567 -45.67123  90.40767  1.000 63.34425  ? 120  ILE B CG2 1 
ATOM   4136  C CD1 . ILE B  1 140 ? -20.58124 -47.21763  92.50989  1.000 72.80503  ? 120  ILE B CD1 1 
ATOM   4137  N N   . ILE B  1 141 ? -15.37857 -46.82038  91.17779  1.000 54.08377  ? 121  ILE B N   1 
ATOM   4138  C CA  . ILE B  1 141 ? -14.23370 -46.51137  90.33525  1.000 53.03241  ? 121  ILE B CA  1 
ATOM   4139  C C   . ILE B  1 141 ? -13.58988 -47.79171  89.81901  1.000 56.75759  ? 121  ILE B C   1 
ATOM   4140  O O   . ILE B  1 141 ? -13.35038 -47.93909  88.61579  1.000 58.40429  ? 121  ILE B O   1 
ATOM   4141  C CB  . ILE B  1 141 ? -13.22821 -45.64741  91.11966  1.000 50.93418  ? 121  ILE B CB  1 
ATOM   4142  C CG1 . ILE B  1 141 ? -13.83739 -44.28407  91.46393  1.000 42.80846  ? 121  ILE B CG1 1 
ATOM   4143  C CG2 . ILE B  1 141 ? -11.90549 -45.49970  90.36200  1.000 49.81577  ? 121  ILE B CG2 1 
ATOM   4144  C CD1 . ILE B  1 141 ? -13.26013 -43.68656  92.72484  1.000 43.64054  ? 121  ILE B CD1 1 
ATOM   4145  N N   . GLU B  1 142 ? -13.30648 -48.73488  90.72235  1.000 58.05458  ? 122  GLU B N   1 
ATOM   4146  C CA  . GLU B  1 142 ? -12.47427 -49.88325  90.37070  1.000 59.69441  ? 122  GLU B CA  1 
ATOM   4147  C C   . GLU B  1 142 ? -13.04395 -50.73567  89.23521  1.000 63.70110  ? 122  GLU B C   1 
ATOM   4148  O O   . GLU B  1 142 ? -12.26176 -51.12168  88.34967  1.000 68.59456  ? 122  GLU B O   1 
ATOM   4149  C CB  . GLU B  1 142 ? -12.19030 -50.71603  91.63446  1.000 61.60529  ? 122  GLU B CB  1 
ATOM   4150  C CG  . GLU B  1 142 ? -11.27310 -49.96942  92.65281  1.000 65.42004  ? 122  GLU B CG  1 
ATOM   4151  C CD  . GLU B  1 142 ? -10.56672 -50.87956  93.68336  1.000 64.92027  ? 122  GLU B CD  1 
ATOM   4152  O OE1 . GLU B  1 142 ? -11.11002 -51.95139  94.02232  1.000 64.31023  ? 122  GLU B OE1 1 
ATOM   4153  O OE2 . GLU B  1 142 ? -9.47430  -50.50523  94.17389  1.000 62.07178  ? 122  GLU B OE2 1 
ATOM   4154  N N   . PRO B  1 143 ? -14.34183 -51.04984  89.17216  1.000 61.42161  ? 123  PRO B N   1 
ATOM   4155  C CA  . PRO B  1 143 ? -14.84432 -51.77327  87.99188  1.000 60.05351  ? 123  PRO B CA  1 
ATOM   4156  C C   . PRO B  1 143 ? -14.55314 -51.07009  86.67878  1.000 58.36447  ? 123  PRO B C   1 
ATOM   4157  O O   . PRO B  1 143 ? -14.34774 -51.73980  85.66042  1.000 56.59937  ? 123  PRO B O   1 
ATOM   4158  C CB  . PRO B  1 143 ? -16.35190 -51.86253  88.25336  1.000 61.83086  ? 123  PRO B CB  1 
ATOM   4159  C CG  . PRO B  1 143 ? -16.46764 -51.84226  89.71922  1.000 64.99902  ? 123  PRO B CG  1 
ATOM   4160  C CD  . PRO B  1 143 ? -15.37811 -50.92813  90.21111  1.000 63.38555  ? 123  PRO B CD  1 
ATOM   4161  N N   . TYR B  1 144 ? -14.53782 -49.73726  86.66155  1.000 58.00113  ? 124  TYR B N   1 
ATOM   4162  C CA  . TYR B  1 144 ? -14.15468 -49.02639  85.44582  1.000 56.15826  ? 124  TYR B CA  1 
ATOM   4163  C C   . TYR B  1 144 ? -12.68096 -49.21174  85.10759  1.000 54.45853  ? 124  TYR B C   1 
ATOM   4164  O O   . TYR B  1 144 ? -12.30093 -49.04857  83.94456  1.000 52.86234  ? 124  TYR B O   1 
ATOM   4165  C CB  . TYR B  1 144 ? -14.45058 -47.53495  85.58437  1.000 49.38400  ? 124  TYR B CB  1 
ATOM   4166  C CG  . TYR B  1 144 ? -15.91406 -47.19767  85.63935  1.000 47.97889  ? 124  TYR B CG  1 
ATOM   4167  C CD1 . TYR B  1 144 ? -16.85059 -47.92415  84.91396  1.000 44.17003  ? 124  TYR B CD1 1 
ATOM   4168  C CD2 . TYR B  1 144 ? -16.36384 -46.14626  86.42651  1.000 46.21820  ? 124  TYR B CD2 1 
ATOM   4169  C CE1 . TYR B  1 144 ? -18.20775 -47.59362  84.97088  1.000 44.38379  ? 124  TYR B CE1 1 
ATOM   4170  C CE2 . TYR B  1 144 ? -17.69860 -45.80640  86.49269  1.000 45.14106  ? 124  TYR B CE2 1 
ATOM   4171  C CZ  . TYR B  1 144 ? -18.61846 -46.52545  85.77073  1.000 49.81164  ? 124  TYR B CZ  1 
ATOM   4172  O OH  . TYR B  1 144 ? -19.94191 -46.15672  85.86275  1.000 50.43786  ? 124  TYR B OH  1 
ATOM   4173  N N   . ALA B  1 145 ? -11.85082 -49.52355  86.09806  1.000 54.77175  ? 125  ALA B N   1 
ATOM   4174  C CA  . ALA B  1 145 ? -10.41240 -49.68761  85.92391  1.000 55.28470  ? 125  ALA B CA  1 
ATOM   4175  C C   . ALA B  1 145 ? -9.73480  -48.57810  85.10641  1.000 53.20145  ? 125  ALA B C   1 
ATOM   4176  O O   . ALA B  1 145 ? -8.95754  -48.85904  84.19591  1.000 55.22184  ? 125  ALA B O   1 
ATOM   4177  C CB  . ALA B  1 145 ? -10.11678 -51.04664  85.30277  1.000 50.33371  ? 125  ALA B CB  1 
ATOM   4178  N N   . PRO B  1 146 ? -9.99593  -47.31053  85.41858  1.000 50.71309  ? 126  PRO B N   1 
ATOM   4179  C CA  . PRO B  1 146 ? -9.26089  -46.24509  84.72871  1.000 49.77688  ? 126  PRO B CA  1 
ATOM   4180  C C   . PRO B  1 146 ? -7.79939  -46.29522  85.13657  1.000 54.54120  ? 126  PRO B C   1 
ATOM   4181  O O   . PRO B  1 146 ? -7.45856  -46.70652  86.24958  1.000 55.52691  ? 126  PRO B O   1 
ATOM   4182  C CB  . PRO B  1 146 ? -9.93763  -44.96632  85.22406  1.000 45.12216  ? 126  PRO B CB  1 
ATOM   4183  C CG  . PRO B  1 146 ? -10.31889 -45.29315  86.61561  1.000 45.81158  ? 126  PRO B CG  1 
ATOM   4184  C CD  . PRO B  1 146 ? -10.73753 -46.77824  86.57479  1.000 49.41217  ? 126  PRO B CD  1 
ATOM   4185  N N   . GLU B  1 147 ? -6.92293  -45.92088  84.20422  1.000 55.17852  ? 127  GLU B N   1 
ATOM   4186  C CA  . GLU B  1 147 ? -5.50554  -45.89938  84.53810  1.000 57.60840  ? 127  GLU B CA  1 
ATOM   4187  C C   . GLU B  1 147 ? -5.15727  -44.66939  85.36740  1.000 58.60603  ? 127  GLU B C   1 
ATOM   4188  O O   . GLU B  1 147 ? -4.25065  -44.73306  86.20192  1.000 65.52241  ? 127  GLU B O   1 
ATOM   4189  C CB  . GLU B  1 147 ? -4.66040  -45.96396  83.26270  1.000 60.87125  ? 127  GLU B CB  1 
ATOM   4190  C CG  . GLU B  1 147 ? -3.14706  -45.94466  83.47865  1.000 69.85197  ? 127  GLU B CG  1 
ATOM   4191  C CD  . GLU B  1 147 ? -2.54685  -47.28329  83.93958  1.000 76.27249  ? 127  GLU B CD  1 
ATOM   4192  O OE1 . GLU B  1 147 ? -3.30514  -48.27135  84.09747  1.000 77.80675  ? 127  GLU B OE1 1 
ATOM   4193  O OE2 . GLU B  1 147 ? -1.30444  -47.33877  84.13933  1.000 75.15246  ? 127  GLU B OE2 1 
ATOM   4194  N N   . TYR B  1 148 ? -5.89716  -43.56893  85.19592  1.000 52.89276  ? 128  TYR B N   1 
ATOM   4195  C CA  . TYR B  1 148 ? -5.60194  -42.30480  85.85124  1.000 54.00110  ? 128  TYR B CA  1 
ATOM   4196  C C   . TYR B  1 148 ? -6.86233  -41.71235  86.46769  1.000 56.26857  ? 128  TYR B C   1 
ATOM   4197  O O   . TYR B  1 148 ? -7.97422  -41.89159  85.95298  1.000 54.66512  ? 128  TYR B O   1 
ATOM   4198  C CB  . TYR B  1 148 ? -4.99347  -41.30238  84.86587  1.000 53.49352  ? 128  TYR B CB  1 
ATOM   4199  C CG  . TYR B  1 148 ? -3.90483  -41.90267  84.00782  1.000 56.99724  ? 128  TYR B CG  1 
ATOM   4200  C CD1 . TYR B  1 148 ? -2.67168  -42.24532  84.55437  1.000 61.24022  ? 128  TYR B CD1 1 
ATOM   4201  C CD2 . TYR B  1 148 ? -4.10654  -42.13621  82.65412  1.000 58.81917  ? 128  TYR B CD2 1 
ATOM   4202  C CE1 . TYR B  1 148 ? -1.65675  -42.81760  83.76994  1.000 63.60464  ? 128  TYR B CE1 1 
ATOM   4203  C CE2 . TYR B  1 148 ? -3.10062  -42.70484  81.86147  1.000 62.76545  ? 128  TYR B CE2 1 
ATOM   4204  C CZ  . TYR B  1 148 ? -1.87447  -43.03712  82.42504  1.000 63.27319  ? 128  TYR B CZ  1 
ATOM   4205  O OH  . TYR B  1 148 ? -0.87491  -43.59660  81.64913  1.000 67.63566  ? 128  TYR B OH  1 
ATOM   4206  N N   . MET B  1 149 ? -6.66607  -41.00271  87.58061  1.000 55.69541  ? 129  MET B N   1 
ATOM   4207  C CA  . MET B  1 149 ? -7.70374  -40.21773  88.23302  1.000 49.67248  ? 129  MET B CA  1 
ATOM   4208  C C   . MET B  1 149 ? -7.33801  -38.74547  88.14435  1.000 50.43190  ? 129  MET B C   1 
ATOM   4209  O O   . MET B  1 149 ? -6.19189  -38.36720  88.40876  1.000 52.26802  ? 129  MET B O   1 
ATOM   4210  C CB  . MET B  1 149 ? -7.87271  -40.61191  89.69912  1.000 47.41247  ? 129  MET B CB  1 
ATOM   4211  C CG  . MET B  1 149 ? -8.38491  -42.02057  89.90972  1.000 50.29039  ? 129  MET B CG  1 
ATOM   4212  S SD  . MET B  1 149 ? -10.06907 -42.29220  89.31815  1.000 47.45712  ? 129  MET B SD  1 
ATOM   4213  C CE  . MET B  1 149 ? -11.01159 -41.16280  90.33349  1.000 45.36317  ? 129  MET B CE  1 
ATOM   4214  N N   . VAL B  1 150 ? -8.31086  -37.92514  87.76611  1.000 50.14980  ? 130  VAL B N   1 
ATOM   4215  C CA  . VAL B  1 150 ? -8.15228  -36.48331  87.65918  1.000 47.93617  ? 130  VAL B CA  1 
ATOM   4216  C C   . VAL B  1 150 ? -9.14223  -35.89161  88.65032  1.000 50.20523  ? 130  VAL B C   1 
ATOM   4217  O O   . VAL B  1 150 ? -10.34197 -35.78405  88.35038  1.000 52.42111  ? 130  VAL B O   1 
ATOM   4218  C CB  . VAL B  1 150 ? -8.39804  -35.96503  86.23636  1.000 41.12167  ? 130  VAL B CB  1 
ATOM   4219  C CG1 . VAL B  1 150 ? -8.23961  -34.44843  86.18698  1.000 41.76650  ? 130  VAL B CG1 1 
ATOM   4220  C CG2 . VAL B  1 150 ? -7.42864  -36.59957  85.26981  1.000 41.36815  ? 130  VAL B CG2 1 
ATOM   4221  N N   . ILE B  1 151 ? -8.64754  -35.53661  89.83665  1.000 46.30345  ? 131  ILE B N   1 
ATOM   4222  C CA  . ILE B  1 151 ? -9.46519  -34.97917  90.91508  1.000 43.57971  ? 131  ILE B CA  1 
ATOM   4223  C C   . ILE B  1 151 ? -9.65650  -33.48611  90.66472  1.000 44.13399  ? 131  ILE B C   1 
ATOM   4224  O O   . ILE B  1 151 ? -8.67931  -32.73760  90.55283  1.000 40.88540  ? 131  ILE B O   1 
ATOM   4225  C CB  . ILE B  1 151 ? -8.79756  -35.22134  92.28004  1.000 46.44972  ? 131  ILE B CB  1 
ATOM   4226  C CG1 . ILE B  1 151 ? -8.34906  -36.67466  92.40418  1.000 44.63541  ? 131  ILE B CG1 1 
ATOM   4227  C CG2 . ILE B  1 151 ? -9.69403  -34.78343  93.43280  1.000 46.51366  ? 131  ILE B CG2 1 
ATOM   4228  C CD1 . ILE B  1 151 ? -9.46738  -37.65815  92.34529  1.000 43.75300  ? 131  ILE B CD1 1 
ATOM   4229  N N   . LEU B  1 152 ? -10.91131 -33.03974  90.60526  1.000 41.69968  ? 132  LEU B N   1 
ATOM   4230  C CA  . LEU B  1 152 ? -11.20369 -31.65123  90.27301  1.000 43.87233  ? 132  LEU B CA  1 
ATOM   4231  C C   . LEU B  1 152 ? -12.08817 -31.01621  91.33175  1.000 48.80245  ? 132  LEU B C   1 
ATOM   4232  O O   . LEU B  1 152 ? -13.02621 -31.64905  91.82742  1.000 52.70868  ? 132  LEU B O   1 
ATOM   4233  C CB  . LEU B  1 152 ? -11.88941 -31.53677  88.91289  1.000 41.10767  ? 132  LEU B CB  1 
ATOM   4234  C CG  . LEU B  1 152 ? -11.07597 -32.20513  87.78847  1.000 41.98674  ? 132  LEU B CG  1 
ATOM   4235  C CD1 . LEU B  1 152 ? -11.93367 -32.34000  86.55409  1.000 38.61279  ? 132  LEU B CD1 1 
ATOM   4236  C CD2 . LEU B  1 152 ? -9.78224  -31.43331  87.48834  1.000 43.22135  ? 132  LEU B CD2 1 
ATOM   4237  N N   . ALA B  1 153 ? -11.79090 -29.75733  91.66710  1.000 47.15852  ? 133  ALA B N   1 
ATOM   4238  C CA  . ALA B  1 153 ? -12.70352 -28.95437  92.46871  1.000 43.76126  ? 133  ALA B CA  1 
ATOM   4239  C C   . ALA B  1 153 ? -13.84285 -28.44098  91.59081  1.000 46.67412  ? 133  ALA B C   1 
ATOM   4240  O O   . ALA B  1 153 ? -13.60356 -27.82340  90.54650  1.000 51.33210  ? 133  ALA B O   1 
ATOM   4241  C CB  . ALA B  1 153 ? -11.96430 -27.78128  93.11011  1.000 41.32948  ? 133  ALA B CB  1 
ATOM   4242  N N   . GLY B  1 154 ? -15.08056 -28.68307  92.01397  1.000 39.70670  ? 134  GLY B N   1 
ATOM   4243  C CA  . GLY B  1 154 ? -16.20714 -28.25501  91.21105  1.000 37.69482  ? 134  GLY B CA  1 
ATOM   4244  C C   . GLY B  1 154 ? -16.75203 -26.87224  91.52480  1.000 42.68280  ? 134  GLY B C   1 
ATOM   4245  O O   . GLY B  1 154 ? -17.89253 -26.57080  91.15146  1.000 45.49739  ? 134  GLY B O   1 
ATOM   4246  N N   . ASP B  1 155 ? -15.97331 -26.00770  92.19085  1.000 43.42427  ? 135  ASP B N   1 
ATOM   4247  C CA  . ASP B  1 155 ? -16.48680 -24.70138  92.60070  1.000 44.62524  ? 135  ASP B CA  1 
ATOM   4248  C C   . ASP B  1 155 ? -15.67831 -23.52799  92.04693  1.000 46.32733  ? 135  ASP B C   1 
ATOM   4249  O O   . ASP B  1 155 ? -15.76613 -22.41194  92.57832  1.000 43.67133  ? 135  ASP B O   1 
ATOM   4250  C CB  . ASP B  1 155 ? -16.54779 -24.60917  94.11986  1.000 45.42736  ? 135  ASP B CB  1 
ATOM   4251  C CG  . ASP B  1 155 ? -15.18832 -24.47509  94.73106  1.000 45.63050  ? 135  ASP B CG  1 
ATOM   4252  O OD1 . ASP B  1 155 ? -14.36065 -25.34636  94.45961  1.000 48.68593  ? 135  ASP B OD1 1 
ATOM   4253  O OD2 . ASP B  1 155 ? -14.94270 -23.49609  95.45975  1.000 50.82628  ? 135  ASP B OD2 1 
ATOM   4254  N N   . HIS B  1 156 ? -14.91954 -23.74111  90.97864  1.000 45.62078  ? 136  HIS B N   1 
ATOM   4255  C CA  . HIS B  1 156 ? -14.13973 -22.69440  90.34481  1.000 43.54336  ? 136  HIS B CA  1 
ATOM   4256  C C   . HIS B  1 156 ? -14.55510 -22.52541  88.88664  1.000 42.79670  ? 136  HIS B C   1 
ATOM   4257  O O   . HIS B  1 156 ? -15.13916 -23.42064  88.27039  1.000 42.07416  ? 136  HIS B O   1 
ATOM   4258  C CB  . HIS B  1 156 ? -12.64442 -23.00763  90.43994  1.000 43.74453  ? 136  HIS B CB  1 
ATOM   4259  C CG  . HIS B  1 156 ? -12.18814 -23.32530  91.82679  1.000 53.95566  ? 136  HIS B CG  1 
ATOM   4260  N ND1 . HIS B  1 156 ? -11.17110 -24.21823  92.09058  1.000 57.87867  ? 136  HIS B ND1 1 
ATOM   4261  C CD2 . HIS B  1 156 ? -12.58745 -22.84579  93.02969  1.000 57.72034  ? 136  HIS B CD2 1 
ATOM   4262  C CE1 . HIS B  1 156 ? -10.97589 -24.29035  93.39576  1.000 58.28605  ? 136  HIS B CE1 1 
ATOM   4263  N NE2 . HIS B  1 156 ? -11.82032 -23.46538  93.98879  1.000 58.49954  ? 136  HIS B NE2 1 
ATOM   4264  N N   . ILE B  1 157 ? -14.21861 -21.36587  88.32999  1.000 46.30114  ? 137  ILE B N   1 
ATOM   4265  C CA  . ILE B  1 157 ? -14.55436 -21.00756  86.95386  1.000 48.04227  ? 137  ILE B CA  1 
ATOM   4266  C C   . ILE B  1 157 ? -13.24656 -20.84895  86.18393  1.000 47.76648  ? 137  ILE B C   1 
ATOM   4267  O O   . ILE B  1 157 ? -12.46822 -19.92832  86.46419  1.000 50.33574  ? 137  ILE B O   1 
ATOM   4268  C CB  . ILE B  1 157 ? -15.39124 -19.72712  86.90136  1.000 47.91314  ? 137  ILE B CB  1 
ATOM   4269  C CG1 . ILE B  1 157 ? -16.42260 -19.75604  88.03194  1.000 50.70911  ? 137  ILE B CG1 1 
ATOM   4270  C CG2 . ILE B  1 157 ? -16.00589 -19.54127  85.53527  1.000 42.41581  ? 137  ILE B CG2 1 
ATOM   4271  C CD1 . ILE B  1 157 ? -17.31187 -18.56856  88.08168  1.000 55.17453  ? 137  ILE B CD1 1 
ATOM   4272  N N   . TYR B  1 158 ? -13.00522 -21.74174  85.21816  1.000 41.92377  ? 138  TYR B N   1 
ATOM   4273  C CA  . TYR B  1 158 ? -11.76934 -21.76812  84.44134  1.000 43.45073  ? 138  TYR B CA  1 
ATOM   4274  C C   . TYR B  1 158 ? -11.92327 -22.73690  83.27284  1.000 47.37038  ? 138  TYR B C   1 
ATOM   4275  O O   . TYR B  1 158 ? -12.79691 -23.61169  83.27175  1.000 50.45318  ? 138  TYR B O   1 
ATOM   4276  C CB  . TYR B  1 158 ? -10.57665 -22.17091  85.30942  1.000 44.38838  ? 138  TYR B CB  1 
ATOM   4277  C CG  . TYR B  1 158 ? -10.61297 -23.61733  85.73747  1.000 53.09366  ? 138  TYR B CG  1 
ATOM   4278  C CD1 . TYR B  1 158 ? -11.54985 -24.06838  86.65898  1.000 50.08851  ? 138  TYR B CD1 1 
ATOM   4279  C CD2 . TYR B  1 158 ? -9.70159  -24.53486  85.21890  1.000 51.44277  ? 138  TYR B CD2 1 
ATOM   4280  C CE1 . TYR B  1 158 ? -11.58955 -25.39901  87.03966  1.000 50.63595  ? 138  TYR B CE1 1 
ATOM   4281  C CE2 . TYR B  1 158 ? -9.72570  -25.85653  85.59930  1.000 50.32109  ? 138  TYR B CE2 1 
ATOM   4282  C CZ  . TYR B  1 158 ? -10.66857 -26.28491  86.50833  1.000 50.14493  ? 138  TYR B CZ  1 
ATOM   4283  O OH  . TYR B  1 158 ? -10.67944 -27.60009  86.89147  1.000 46.42645  ? 138  TYR B OH  1 
ATOM   4284  N N   . LYS B  1 159 ? -11.05975 -22.57077  82.27545  1.000 44.80037  ? 139  LYS B N   1 
ATOM   4285  C CA  . LYS B  1 159 ? -11.02842 -23.44061  81.10441  1.000 44.26277  ? 139  LYS B CA  1 
ATOM   4286  C C   . LYS B  1 159 ? -9.63105  -24.03301  80.98766  1.000 51.06421  ? 139  LYS B C   1 
ATOM   4287  O O   . LYS B  1 159 ? -8.64296  -23.28631  80.90317  1.000 52.25752  ? 139  LYS B O   1 
ATOM   4288  C CB  . LYS B  1 159 ? -11.41478 -22.66638  79.84167  1.000 48.57881  ? 139  LYS B CB  1 
ATOM   4289  C CG  . LYS B  1 159 ? -12.86769 -22.18466  79.84061  1.000 44.38075  ? 139  LYS B CG  1 
ATOM   4290  C CD  . LYS B  1 159 ? -13.24546 -21.50822  78.52463  1.000 46.90005  ? 139  LYS B CD  1 
ATOM   4291  C CE  . LYS B  1 159 ? -12.74146 -20.06301  78.47278  1.000 51.24438  ? 139  LYS B CE  1 
ATOM   4292  N NZ  . LYS B  1 159 ? -12.49132 -19.59900  77.07906  1.000 56.62939  ? 139  LYS B NZ  1 
ATOM   4293  N N   . MET B  1 160 ? -9.54519  -25.36809  80.99306  1.000 44.92088  ? 140  MET B N   1 
ATOM   4294  C CA  . MET B  1 160 ? -8.25581  -26.04966  81.06129  1.000 47.86150  ? 140  MET B CA  1 
ATOM   4295  C C   . MET B  1 160 ? -8.31634  -27.39141  80.33323  1.000 54.93794  ? 140  MET B C   1 
ATOM   4296  O O   . MET B  1 160 ? -9.29880  -28.13457  80.45256  1.000 43.26841  ? 140  MET B O   1 
ATOM   4297  C CB  . MET B  1 160 ? -7.84466  -26.25089  82.52101  1.000 46.12797  ? 140  MET B CB  1 
ATOM   4298  C CG  . MET B  1 160 ? -6.74300  -27.24655  82.74742  1.000 49.73026  ? 140  MET B CG  1 
ATOM   4299  S SD  . MET B  1 160 ? -5.94357  -26.85837  84.28691  1.000 55.89978  ? 140  MET B SD  1 
ATOM   4300  C CE  . MET B  1 160 ? -6.66010  -27.92854  85.48201  1.000 57.53590  ? 140  MET B CE  1 
ATOM   4301  N N   . ASP B  1 161 ? -7.25911  -27.69258  79.57314  1.000 55.45383  ? 141  ASP B N   1 
ATOM   4302  C CA  . ASP B  1 161 ? -7.15059  -28.94871  78.83006  1.000 54.21164  ? 141  ASP B CA  1 
ATOM   4303  C C   . ASP B  1 161 ? -6.30788  -29.88904  79.68267  1.000 53.06249  ? 141  ASP B C   1 
ATOM   4304  O O   . ASP B  1 161 ? -5.08638  -29.74094  79.76668  1.000 55.43450  ? 141  ASP B O   1 
ATOM   4305  C CB  . ASP B  1 161 ? -6.52226  -28.74704  77.45436  1.000 56.51499  ? 141  ASP B CB  1 
ATOM   4306  C CG  . ASP B  1 161 ? -6.44545  -30.04277  76.65182  1.000 57.57569  ? 141  ASP B CG  1 
ATOM   4307  O OD1 . ASP B  1 161 ? -6.30309  -31.13422  77.25581  1.000 56.77227  ? 141  ASP B OD1 1 
ATOM   4308  O OD2 . ASP B  1 161 ? -6.58807  -29.95961  75.41093  1.000 56.77221  ? 141  ASP B OD2 1 
ATOM   4309  N N   . TYR B  1 162 ? -6.96556  -30.88324  80.28045  1.000 48.58668  ? 142  TYR B N   1 
ATOM   4310  C CA  . TYR B  1 162 ? -6.33191  -31.80287  81.21432  1.000 47.03289  ? 142  TYR B CA  1 
ATOM   4311  C C   . TYR B  1 162 ? -5.35269  -32.77443  80.56072  1.000 46.84641  ? 142  TYR B C   1 
ATOM   4312  O O   . TYR B  1 162 ? -4.62157  -33.45988  81.28301  1.000 47.62843  ? 142  TYR B O   1 
ATOM   4313  C CB  . TYR B  1 162 ? -7.41770  -32.58458  81.93830  1.000 47.05179  ? 142  TYR B CB  1 
ATOM   4314  C CG  . TYR B  1 162 ? -8.38267  -31.71637  82.70498  1.000 43.54797  ? 142  TYR B CG  1 
ATOM   4315  C CD1 . TYR B  1 162 ? -7.93067  -30.70837  83.54132  1.000 44.20920  ? 142  TYR B CD1 1 
ATOM   4316  C CD2 . TYR B  1 162 ? -9.74365  -31.91743  82.60492  1.000 43.31240  ? 142  TYR B CD2 1 
ATOM   4317  C CE1 . TYR B  1 162 ? -8.81051  -29.93038  84.25661  1.000 42.87027  ? 142  TYR B CE1 1 
ATOM   4318  C CE2 . TYR B  1 162 ? -10.63042 -31.14477  83.32146  1.000 42.82875  ? 142  TYR B CE2 1 
ATOM   4319  C CZ  . TYR B  1 162 ? -10.15719 -30.14512  84.14235  1.000 45.39702  ? 142  TYR B CZ  1 
ATOM   4320  O OH  . TYR B  1 162 ? -11.03473 -29.35461  84.85564  1.000 48.50273  ? 142  TYR B OH  1 
ATOM   4321  N N   . GLU B  1 163 ? -5.33635  -32.88182  79.23130  1.000 48.28095  ? 143  GLU B N   1 
ATOM   4322  C CA  . GLU B  1 163 ? -4.40503  -33.81116  78.59736  1.000 49.90194  ? 143  GLU B CA  1 
ATOM   4323  C C   . GLU B  1 163 ? -2.96384  -33.39429  78.85906  1.000 56.93649  ? 143  GLU B C   1 
ATOM   4324  O O   . GLU B  1 163 ? -2.10379  -34.24656  79.11557  1.000 58.74844  ? 143  GLU B O   1 
ATOM   4325  C CB  . GLU B  1 163 ? -4.67877  -33.90974  77.09437  1.000 49.00598  ? 143  GLU B CB  1 
ATOM   4326  C CG  . GLU B  1 163 ? -3.73820  -34.87770  76.33531  1.000 53.35008  ? 143  GLU B CG  1 
ATOM   4327  C CD  . GLU B  1 163 ? -4.13735  -36.36242  76.49185  1.000 51.37878  ? 143  GLU B CD  1 
ATOM   4328  O OE1 . GLU B  1 163 ? -5.33819  -36.63859  76.70227  1.000 49.08699  ? 143  GLU B OE1 1 
ATOM   4329  O OE2 . GLU B  1 163 ? -3.24989  -37.24994  76.40637  1.000 51.78570  ? 143  GLU B OE2 1 
ATOM   4330  N N   . TYR B  1 164 ? -2.68917  -32.08321  78.83367  1.000 55.76638  ? 144  TYR B N   1 
ATOM   4331  C CA  . TYR B  1 164 ? -1.34005  -31.59941  79.12167  1.000 55.68572  ? 144  TYR B CA  1 
ATOM   4332  C C   . TYR B  1 164 ? -0.88327  -32.03122  80.50539  1.000 54.61560  ? 144  TYR B C   1 
ATOM   4333  O O   . TYR B  1 164 ? 0.26284   -32.45586  80.68733  1.000 55.95569  ? 144  TYR B O   1 
ATOM   4334  C CB  . TYR B  1 164 ? -1.28379  -30.07850  79.01108  1.000 58.64129  ? 144  TYR B CB  1 
ATOM   4335  C CG  . TYR B  1 164 ? -1.37120  -29.56609  77.60115  1.000 62.77488  ? 144  TYR B CG  1 
ATOM   4336  C CD1 . TYR B  1 164 ? -2.60607  -29.40528  76.97977  1.000 61.33604  ? 144  TYR B CD1 1 
ATOM   4337  C CD2 . TYR B  1 164 ? -0.22138  -29.22611  76.88838  1.000 64.70800  ? 144  TYR B CD2 1 
ATOM   4338  C CE1 . TYR B  1 164 ? -2.69633  -28.93591  75.67373  1.000 64.61364  ? 144  TYR B CE1 1 
ATOM   4339  C CE2 . TYR B  1 164 ? -0.30115  -28.74833  75.58604  1.000 66.82681  ? 144  TYR B CE2 1 
ATOM   4340  C CZ  . TYR B  1 164 ? -1.54033  -28.60698  74.98466  1.000 68.63569  ? 144  TYR B CZ  1 
ATOM   4341  O OH  . TYR B  1 164 ? -1.62845  -28.13602  73.69637  1.000 71.50639  ? 144  TYR B OH  1 
ATOM   4342  N N   . MET B  1 165 ? -1.77278  -31.94438  81.49343  1.000 54.60721  ? 145  MET B N   1 
ATOM   4343  C CA  . MET B  1 165 ? -1.39247  -32.32001  82.84834  1.000 56.78206  ? 145  MET B CA  1 
ATOM   4344  C C   . MET B  1 165 ? -1.21271  -33.82825  82.97407  1.000 59.16414  ? 145  MET B C   1 
ATOM   4345  O O   . MET B  1 165 ? -0.34821  -34.28799  83.73488  1.000 61.06644  ? 145  MET B O   1 
ATOM   4346  C CB  . MET B  1 165 ? -2.43681  -31.79871  83.83302  1.000 53.44207  ? 145  MET B CB  1 
ATOM   4347  C CG  . MET B  1 165 ? -1.98648  -31.75495  85.26864  1.000 53.52464  ? 145  MET B CG  1 
ATOM   4348  S SD  . MET B  1 165 ? -3.21541  -30.86856  86.25753  1.000 56.98063  ? 145  MET B SD  1 
ATOM   4349  C CE  . MET B  1 165 ? -2.84319  -31.50895  87.88728  1.000 58.83506  ? 145  MET B CE  1 
ATOM   4350  N N   . LEU B  1 166 ? -1.98937  -34.60963  82.21190  1.000 56.47555  ? 146  LEU B N   1 
ATOM   4351  C CA  . LEU B  1 166 ? -1.80330  -36.05919  82.19535  1.000 54.88557  ? 146  LEU B CA  1 
ATOM   4352  C C   . LEU B  1 166 ? -0.44645  -36.44427  81.60368  1.000 57.79733  ? 146  LEU B C   1 
ATOM   4353  O O   . LEU B  1 166 ? 0.27606   -37.27293  82.17394  1.000 61.06638  ? 146  LEU B O   1 
ATOM   4354  C CB  . LEU B  1 166 ? -2.93611  -36.72049  81.41319  1.000 55.57786  ? 146  LEU B CB  1 
ATOM   4355  C CG  . LEU B  1 166 ? -4.33925  -36.72047  82.02287  1.000 49.43911  ? 146  LEU B CG  1 
ATOM   4356  C CD1 . LEU B  1 166 ? -5.37132  -37.15044  80.99133  1.000 46.73663  ? 146  LEU B CD1 1 
ATOM   4357  C CD2 . LEU B  1 166 ? -4.37866  -37.63529  83.23053  1.000 47.96192  ? 146  LEU B CD2 1 
ATOM   4358  N N   . GLN B  1 167 ? -0.08149  -35.85998  80.45386  1.000 57.38307  ? 147  GLN B N   1 
ATOM   4359  C CA  . GLN B  1 167 ? 1.22842   -36.14231  79.87174  1.000 60.66995  ? 147  GLN B CA  1 
ATOM   4360  C C   . GLN B  1 167 ? 2.33798   -35.87401  80.86835  1.000 63.79454  ? 147  GLN B C   1 
ATOM   4361  O O   . GLN B  1 167 ? 3.26344   -36.68323  81.00727  1.000 63.53249  ? 147  GLN B O   1 
ATOM   4362  C CB  . GLN B  1 167 ? 1.46477   -35.30952  78.61126  1.000 67.36761  ? 147  GLN B CB  1 
ATOM   4363  C CG  . GLN B  1 167 ? 0.30504   -35.32021  77.64999  1.000 77.00316  ? 147  GLN B CG  1 
ATOM   4364  C CD  . GLN B  1 167 ? 0.62698   -35.99265  76.32506  1.000 86.52769  ? 147  GLN B CD  1 
ATOM   4365  O OE1 . GLN B  1 167 ? 1.49742   -36.86694  76.24952  1.000 92.53818  ? 147  GLN B OE1 1 
ATOM   4366  N NE2 . GLN B  1 167 ? -0.11251  -35.62147  75.27918  1.000 87.47466  ? 147  GLN B NE2 1 
ATOM   4367  N N   . GLN B  1 168 ? 2.25166   -34.74813  81.59105  1.000 62.01654  ? 148  GLN B N   1 
ATOM   4368  C CA  . GLN B  1 168 ? 3.34443   -34.38775  82.48445  1.000 66.24553  ? 148  GLN B CA  1 
ATOM   4369  C C   . GLN B  1 168 ? 3.40824   -35.32977  83.67940  1.000 67.66176  ? 148  GLN B C   1 
ATOM   4370  O O   . GLN B  1 168 ? 4.49851   -35.74140  84.09151  1.000 72.86421  ? 148  GLN B O   1 
ATOM   4371  C CB  . GLN B  1 168 ? 3.21631   -32.92847  82.94053  1.000 64.19632  ? 148  GLN B CB  1 
ATOM   4372  C CG  . GLN B  1 168 ? 3.82614   -32.67728  84.31395  1.000 65.24839  ? 148  GLN B CG  1 
ATOM   4373  C CD  . GLN B  1 168 ? 3.88587   -31.20028  84.70790  1.000 67.86004  ? 148  GLN B CD  1 
ATOM   4374  O OE1 . GLN B  1 168 ? 3.87463   -30.29890  83.85943  1.000 64.83824  ? 148  GLN B OE1 1 
ATOM   4375  N NE2 . GLN B  1 168 ? 3.96508   -30.95315  86.01077  1.000 68.25555  ? 148  GLN B NE2 1 
ATOM   4376  N N   . HIS B  1 169 ? 2.25410   -35.69883  84.23376  1.000 64.65382  ? 149  HIS B N   1 
ATOM   4377  C CA  . HIS B  1 169 ? 2.24068   -36.63352  85.35675  1.000 68.23805  ? 149  HIS B CA  1 
ATOM   4378  C C   . HIS B  1 169 ? 2.94092   -37.94554  85.01501  1.000 73.62478  ? 149  HIS B C   1 
ATOM   4379  O O   . HIS B  1 169 ? 3.67945   -38.49459  85.84176  1.000 77.09784  ? 149  HIS B O   1 
ATOM   4380  C CB  . HIS B  1 169 ? 0.80577   -36.91256  85.79468  1.000 63.22460  ? 149  HIS B CB  1 
ATOM   4381  C CG  . HIS B  1 169 ? 0.69642   -37.94726  86.87207  1.000 61.17115  ? 149  HIS B CG  1 
ATOM   4382  N ND1 . HIS B  1 169 ? 0.96331   -37.67361  88.19580  1.000 60.99888  ? 149  HIS B ND1 1 
ATOM   4383  C CD2 . HIS B  1 169 ? 0.34218   -39.25404  86.82287  1.000 59.68839  ? 149  HIS B CD2 1 
ATOM   4384  C CE1 . HIS B  1 169 ? 0.77915   -38.76573  88.91552  1.000 61.15218  ? 149  HIS B CE1 1 
ATOM   4385  N NE2 . HIS B  1 169 ? 0.40008   -39.73932  88.10694  1.000 60.10463  ? 149  HIS B NE2 1 
ATOM   4386  N N   . VAL B  1 170 ? 2.71812   -38.47302  83.81250  1.000 75.05925  ? 150  VAL B N   1 
ATOM   4387  C CA  . VAL B  1 170 ? 3.33065   -39.75348  83.46841  1.000 77.30371  ? 150  VAL B CA  1 
ATOM   4388  C C   . VAL B  1 170 ? 4.75509   -39.57958  82.93321  1.000 79.21314  ? 150  VAL B C   1 
ATOM   4389  O O   . VAL B  1 170 ? 5.61666   -40.42377  83.19419  1.000 79.46137  ? 150  VAL B O   1 
ATOM   4390  C CB  . VAL B  1 170 ? 2.43663   -40.54266  82.48676  1.000 75.83054  ? 150  VAL B CB  1 
ATOM   4391  C CG1 . VAL B  1 170 ? 2.18796   -39.75847  81.21238  1.000 78.66353  ? 150  VAL B CG1 1 
ATOM   4392  C CG2 . VAL B  1 170 ? 3.04676   -41.89916  82.17387  1.000 73.21754  ? 150  VAL B CG2 1 
ATOM   4393  N N   . ASP B  1 171 ? 5.04098   -38.48195  82.22583  1.000 79.59817  ? 151  ASP B N   1 
ATOM   4394  C CA  . ASP B  1 171 ? 6.40631   -38.24332  81.76304  1.000 79.30687  ? 151  ASP B CA  1 
ATOM   4395  C C   . ASP B  1 171 ? 7.34718   -37.91993  82.91664  1.000 80.95705  ? 151  ASP B C   1 
ATOM   4396  O O   . ASP B  1 171 ? 8.54821   -38.19047  82.82663  1.000 86.27095  ? 151  ASP B O   1 
ATOM   4397  C CB  . ASP B  1 171 ? 6.44759   -37.09770  80.74964  1.000 83.83322  ? 151  ASP B CB  1 
ATOM   4398  C CG  . ASP B  1 171 ? 5.76120   -37.43910  79.44095  1.000 88.14492  ? 151  ASP B CG  1 
ATOM   4399  O OD1 . ASP B  1 171 ? 5.56309   -38.64510  79.15813  1.000 89.24790  ? 151  ASP B OD1 1 
ATOM   4400  O OD2 . ASP B  1 171 ? 5.41628   -36.48937  78.69748  1.000 88.85065  ? 151  ASP B OD2 1 
ATOM   4401  N N   . SER B  1 172 ? 6.83873   -37.32695  83.99290  1.000 78.14544  ? 152  SER B N   1 
ATOM   4402  C CA  . SER B  1 172 ? 7.67962   -36.94852  85.11999  1.000 77.15862  ? 152  SER B CA  1 
ATOM   4403  C C   . SER B  1 172 ? 7.79405   -38.03571  86.18056  1.000 78.39648  ? 152  SER B C   1 
ATOM   4404  O O   . SER B  1 172 ? 8.63289   -37.91515  87.07857  1.000 81.79066  ? 152  SER B O   1 
ATOM   4405  C CB  . SER B  1 172 ? 7.14442   -35.67157  85.77010  1.000 75.33768  ? 152  SER B CB  1 
ATOM   4406  O OG  . SER B  1 172 ? 5.86898   -35.89905  86.34613  1.000 71.79179  ? 152  SER B OG  1 
ATOM   4407  N N   . GLY B  1 173 ? 6.97282   -39.07898  86.11264  1.000 76.99339  ? 153  GLY B N   1 
ATOM   4408  C CA  . GLY B  1 173 ? 7.00356   -40.11485  87.12506  1.000 74.43145  ? 153  GLY B CA  1 
ATOM   4409  C C   . GLY B  1 173 ? 6.53500   -39.69573  88.50003  1.000 71.80857  ? 153  GLY B C   1 
ATOM   4410  O O   . GLY B  1 173 ? 6.82122   -40.38857  89.47632  1.000 72.50374  ? 153  GLY B O   1 
ATOM   4411  N N   . ALA B  1 174 ? 5.80563   -38.59090  88.60979  1.000 72.03112  ? 154  ALA B N   1 
ATOM   4412  C CA  . ALA B  1 174 ? 5.38779   -38.12280  89.92139  1.000 72.14298  ? 154  ALA B CA  1 
ATOM   4413  C C   . ALA B  1 174 ? 4.31619   -39.03870  90.50598  1.000 71.81157  ? 154  ALA B C   1 
ATOM   4414  O O   . ALA B  1 174 ? 3.60557   -39.74186  89.78838  1.000 73.11893  ? 154  ALA B O   1 
ATOM   4415  C CB  . ALA B  1 174 ? 4.86309   -36.69202  89.83498  1.000 69.12765  ? 154  ALA B CB  1 
ATOM   4416  N N   . ASP B  1 175 ? 4.21530   -39.03536  91.83658  1.000 70.69272  ? 155  ASP B N   1 
ATOM   4417  C CA  . ASP B  1 175 ? 3.07931   -39.68314  92.48361  1.000 66.75528  ? 155  ASP B CA  1 
ATOM   4418  C C   . ASP B  1 175 ? 1.82648   -38.82927  92.35779  1.000 70.70547  ? 155  ASP B C   1 
ATOM   4419  O O   . ASP B  1 175 ? 0.73521   -39.34289  92.08002  1.000 72.35741  ? 155  ASP B O   1 
ATOM   4420  C CB  . ASP B  1 175 ? 3.38463   -39.93706  93.95509  1.000 68.18961  ? 155  ASP B CB  1 
ATOM   4421  C CG  . ASP B  1 175 ? 4.61179   -40.77829  94.14817  1.000 82.14334  ? 155  ASP B CG  1 
ATOM   4422  O OD1 . ASP B  1 175 ? 5.12519   -40.82047  95.28599  1.000 88.56245  ? 155  ASP B OD1 1 
ATOM   4423  O OD2 . ASP B  1 175 ? 5.05946   -41.40617  93.16185  1.000 87.59113  ? 155  ASP B OD2 1 
ATOM   4424  N N   . VAL B  1 176 ? 1.96292   -37.52940  92.57547  1.000 67.55917  ? 156  VAL B N   1 
ATOM   4425  C CA  . VAL B  1 176 ? 0.86319   -36.59493  92.42504  1.000 65.49180  ? 156  VAL B CA  1 
ATOM   4426  C C   . VAL B  1 176 ? 1.33678   -35.46389  91.53136  1.000 72.01132  ? 156  VAL B C   1 
ATOM   4427  O O   . VAL B  1 176 ? 2.51409   -35.08243  91.55648  1.000 77.76652  ? 156  VAL B O   1 
ATOM   4428  C CB  . VAL B  1 176 ? 0.36151   -36.06240  93.78460  1.000 62.60696  ? 156  VAL B CB  1 
ATOM   4429  C CG1 . VAL B  1 176 ? 1.20202   -34.90898  94.24819  1.000 65.76636  ? 156  VAL B CG1 1 
ATOM   4430  C CG2 . VAL B  1 176 ? -1.07806  -35.61977  93.66424  1.000 57.66776  ? 156  VAL B CG2 1 
ATOM   4431  N N   . THR B  1 177 ? 0.43635   -34.97054  90.70243  1.000 58.46413  ? 157  THR B N   1 
ATOM   4432  C CA  . THR B  1 177 ? 0.67922   -33.77592  89.91955  1.000 60.20365  ? 157  THR B CA  1 
ATOM   4433  C C   . THR B  1 177 ? -0.41691  -32.77879  90.25936  1.000 60.52003  ? 157  THR B C   1 
ATOM   4434  O O   . THR B  1 177 ? -1.60709  -33.12384  90.24969  1.000 59.68532  ? 157  THR B O   1 
ATOM   4435  C CB  . THR B  1 177 ? 0.73626   -34.10396  88.42886  1.000 57.91603  ? 157  THR B CB  1 
ATOM   4436  O OG1 . THR B  1 177 ? 1.85444   -34.95773  88.20168  1.000 59.99865  ? 157  THR B OG1 1 
ATOM   4437  C CG2 . THR B  1 177 ? 0.89344   -32.84900  87.59244  1.000 58.27198  ? 157  THR B CG2 1 
ATOM   4438  N N   . ILE B  1 178 ? -0.00590  -31.56425  90.60162  1.000 57.66739  ? 158  ILE B N   1 
ATOM   4439  C CA  . ILE B  1 178 ? -0.88420  -30.58294  91.21526  1.000 63.45523  ? 158  ILE B CA  1 
ATOM   4440  C C   . ILE B  1 178 ? -0.96885  -29.35780  90.31878  1.000 64.65813  ? 158  ILE B C   1 
ATOM   4441  O O   . ILE B  1 178 ? 0.04681   -28.69627  90.06147  1.000 68.29898  ? 158  ILE B O   1 
ATOM   4442  C CB  . ILE B  1 178 ? -0.40025  -30.18932  92.61616  1.000 61.19285  ? 158  ILE B CB  1 
ATOM   4443  C CG1 . ILE B  1 178 ? -0.32658  -31.42965  93.50912  1.000 62.85899  ? 158  ILE B CG1 1 
ATOM   4444  C CG2 . ILE B  1 178 ? -1.32290  -29.16489  93.19010  1.000 57.29722  ? 158  ILE B CG2 1 
ATOM   4445  C CD1 . ILE B  1 178 ? -0.22242  -31.10598  94.97853  1.000 64.75360  ? 158  ILE B CD1 1 
ATOM   4446  N N   . GLY B  1 179 ? -2.18078  -29.04573  89.86817  1.000 57.59676  ? 159  GLY B N   1 
ATOM   4447  C CA  . GLY B  1 179 ? -2.40137  -27.81259  89.13271  1.000 60.24634  ? 159  GLY B CA  1 
ATOM   4448  C C   . GLY B  1 179 ? -2.24902  -26.59273  90.03815  1.000 63.46425  ? 159  GLY B C   1 
ATOM   4449  O O   . GLY B  1 179 ? -2.81336  -26.53555  91.13949  1.000 54.47622  ? 159  GLY B O   1 
ATOM   4450  N N   . CYS B  1 180 ? -1.50019  -25.60180  89.56337  1.000 65.25992  ? 160  CYS B N   1 
ATOM   4451  C CA  . CYS B  1 180 ? -1.18678  -24.42701  90.36136  1.000 64.76714  ? 160  CYS B CA  1 
ATOM   4452  C C   . CYS B  1 180 ? -1.25583  -23.17558  89.50021  1.000 63.00822  ? 160  CYS B C   1 
ATOM   4453  O O   . CYS B  1 180 ? -0.84588  -23.18846  88.33509  1.000 63.01687  ? 160  CYS B O   1 
ATOM   4454  C CB  . CYS B  1 180 ? 0.20274   -24.53777  90.99051  1.000 68.95347  ? 160  CYS B CB  1 
ATOM   4455  S SG  . CYS B  1 180 ? 0.42180   -25.89013  92.17758  1.000 76.18399  ? 160  CYS B SG  1 
ATOM   4456  N N   . LEU B  1 181 ? -1.77037  -22.09675  90.08236  1.000 61.91995  ? 161  LEU B N   1 
ATOM   4457  C CA  . LEU B  1 181 ? -1.74269  -20.79529  89.43595  1.000 67.24134  ? 161  LEU B CA  1 
ATOM   4458  C C   . LEU B  1 181 ? -0.50274  -20.01871  89.85008  1.000 70.21081  ? 161  LEU B C   1 
ATOM   4459  O O   . LEU B  1 181 ? -0.08697  -20.05275  91.01329  1.000 64.84199  ? 161  LEU B O   1 
ATOM   4460  C CB  . LEU B  1 181 ? -2.98226  -19.97926  89.78567  1.000 70.11250  ? 161  LEU B CB  1 
ATOM   4461  C CG  . LEU B  1 181 ? -4.31384  -20.64712  89.48975  1.000 70.91768  ? 161  LEU B CG  1 
ATOM   4462  C CD1 . LEU B  1 181 ? -5.10738  -20.68891  90.77368  1.000 70.65203  ? 161  LEU B CD1 1 
ATOM   4463  C CD2 . LEU B  1 181 ? -5.04475  -19.87904  88.41491  1.000 71.54558  ? 161  LEU B CD2 1 
ATOM   4464  N N   . GLU B  1 182 ? 0.07076   -19.30762  88.88460  1.000 76.01438  ? 162  GLU B N   1 
ATOM   4465  C CA  . GLU B  1 182 ? 1.25036   -18.46954  89.07636  1.000 72.84268  ? 162  GLU B CA  1 
ATOM   4466  C C   . GLU B  1 182 ? 0.73989   -17.06432  89.38034  1.000 70.84725  ? 162  GLU B C   1 
ATOM   4467  O O   . GLU B  1 182 ? 0.25021   -16.37320  88.48459  1.000 74.82278  ? 162  GLU B O   1 
ATOM   4468  C CB  . GLU B  1 182 ? 2.12781   -18.50677  87.82479  1.000 76.15254  ? 162  GLU B CB  1 
ATOM   4469  C CG  . GLU B  1 182 ? 3.53012   -17.89628  87.98462  1.000 89.93413  ? 162  GLU B CG  1 
ATOM   4470  C CD  . GLU B  1 182 ? 3.72867   -16.59134  87.20097  1.000 97.63870  ? 162  GLU B CD  1 
ATOM   4471  O OE1 . GLU B  1 182 ? 4.89415   -16.15561  87.05062  1.000 100.72044 ? 162  GLU B OE1 1 
ATOM   4472  O OE2 . GLU B  1 182 ? 2.72679   -15.99556  86.73894  1.000 99.51446  ? 162  GLU B OE2 1 
ATOM   4473  N N   . VAL B  1 183 ? 0.83464   -16.64210  90.64120  1.000 67.28724  ? 163  VAL B N   1 
ATOM   4474  C CA  . VAL B  1 183 ? 0.24443   -15.36409  91.05805  1.000 71.15368  ? 163  VAL B CA  1 
ATOM   4475  C C   . VAL B  1 183 ? 1.22156   -14.53533  91.88687  1.000 72.99710  ? 163  VAL B C   1 
ATOM   4476  O O   . VAL B  1 183 ? 2.12778   -15.09677  92.51938  1.000 72.11585  ? 163  VAL B O   1 
ATOM   4477  C CB  . VAL B  1 183 ? -1.05339  -15.58688  91.85311  1.000 72.91676  ? 163  VAL B CB  1 
ATOM   4478  C CG1 . VAL B  1 183 ? -2.09324  -16.29988  90.99832  1.000 70.36464  ? 163  VAL B CG1 1 
ATOM   4479  C CG2 . VAL B  1 183 ? -0.76503  -16.38242  93.11448  1.000 75.55146  ? 163  VAL B CG2 1 
ATOM   4480  N N   . PRO B  1 184 ? 1.07981   -13.20798  91.92327  1.000 74.73862  ? 164  PRO B N   1 
ATOM   4481  C CA  . PRO B  1 184 ? 1.91377   -12.40815  92.83362  1.000 73.06488  ? 164  PRO B CA  1 
ATOM   4482  C C   . PRO B  1 184 ? 1.73887   -12.87206  94.27135  1.000 73.71771  ? 164  PRO B C   1 
ATOM   4483  O O   . PRO B  1 184 ? 0.64933   -13.27659  94.68365  1.000 73.72040  ? 164  PRO B O   1 
ATOM   4484  C CB  . PRO B  1 184 ? 1.39629   -10.98374  92.62938  1.000 73.19923  ? 164  PRO B CB  1 
ATOM   4485  C CG  . PRO B  1 184 ? 0.81847   -10.98525  91.26829  1.000 72.04772  ? 164  PRO B CG  1 
ATOM   4486  C CD  . PRO B  1 184 ? 0.22452   -12.35966  91.07321  1.000 72.31396  ? 164  PRO B CD  1 
ATOM   4487  N N   . ARG B  1 185 ? 2.83274   -12.82488  95.03232  1.000 75.16099  ? 165  ARG B N   1 
ATOM   4488  C CA  . ARG B  1 185 ? 2.85763   -13.50242  96.32595  1.000 78.25304  ? 165  ARG B CA  1 
ATOM   4489  C C   . ARG B  1 185 ? 1.85127   -12.91097  97.30723  1.000 84.77605  ? 165  ARG B C   1 
ATOM   4490  O O   . ARG B  1 185 ? 1.22124   -13.65112  98.07405  1.000 84.57241  ? 165  ARG B O   1 
ATOM   4491  C CB  . ARG B  1 185 ? 4.25807   -13.44444  96.91414  1.000 78.54073  ? 165  ARG B CB  1 
ATOM   4492  C CG  . ARG B  1 185 ? 5.35577   -13.54663  95.89176  1.000 82.08405  ? 165  ARG B CG  1 
ATOM   4493  C CD  . ARG B  1 185 ? 6.65942   -13.94352  96.55372  1.000 87.72633  ? 165  ARG B CD  1 
ATOM   4494  N NE  . ARG B  1 185 ? 6.65414   -13.68722  97.99417  1.000 89.08611  ? 165  ARG B NE  1 
ATOM   4495  C CZ  . ARG B  1 185 ? 6.87252   -12.50566  98.56819  1.000 90.48463  ? 165  ARG B CZ  1 
ATOM   4496  N NH1 . ARG B  1 185 ? 7.12664   -11.41958  97.83942  1.000 90.32117  ? 165  ARG B NH1 1 
ATOM   4497  N NH2 . ARG B  1 185 ? 6.83290   -12.41423  99.88793  1.000 95.93974  ? 165  ARG B NH2 1 
ATOM   4498  N N   . MET B  1 186 ? 1.70282   -11.58045  97.31858  1.000 86.56285  ? 166  MET B N   1 
ATOM   4499  C CA  . MET B  1 186 ? 0.72259   -10.95385  98.20033  1.000 81.77390  ? 166  MET B CA  1 
ATOM   4500  C C   . MET B  1 186 ? -0.68058  -11.51696  97.98533  1.000 81.50474  ? 166  MET B C   1 
ATOM   4501  O O   . MET B  1 186 ? -1.46103  -11.64926  98.93536  1.000 82.04565  ? 166  MET B O   1 
ATOM   4502  C CB  . MET B  1 186 ? 0.71037   -9.44810   97.99262  1.000 77.55074  ? 166  MET B CB  1 
ATOM   4503  C CG  . MET B  1 186 ? -0.17079  -8.79812   99.00231  1.000 83.54282  ? 166  MET B CG  1 
ATOM   4504  S SD  . MET B  1 186 ? 0.21977   -7.08120   99.25181  1.000 94.54425  ? 166  MET B SD  1 
ATOM   4505  C CE  . MET B  1 186 ? -0.92260  -6.70884   100.57001 1.000 92.99214  ? 166  MET B CE  1 
ATOM   4506  N N   . GLU B  1 187 ? -1.02348  -11.85071  96.74362  1.000 80.04566  ? 167  GLU B N   1 
ATOM   4507  C CA  . GLU B  1 187 ? -2.34077  -12.40479  96.46503  1.000 76.85570  ? 167  GLU B CA  1 
ATOM   4508  C C   . GLU B  1 187 ? -2.41875  -13.89796  96.72039  1.000 71.44014  ? 167  GLU B C   1 
ATOM   4509  O O   . GLU B  1 187 ? -3.51857  -14.45250  96.70422  1.000 72.39235  ? 167  GLU B O   1 
ATOM   4510  C CB  . GLU B  1 187 ? -2.74412  -12.09360  95.02598  1.000 79.96289  ? 167  GLU B CB  1 
ATOM   4511  C CG  . GLU B  1 187 ? -2.81800  -10.59536  94.77208  1.000 88.53331  ? 167  GLU B CG  1 
ATOM   4512  C CD  . GLU B  1 187 ? -2.69491  -10.23302  93.31096  1.000 90.27799  ? 167  GLU B CD  1 
ATOM   4513  O OE1 . GLU B  1 187 ? -1.98591  -9.24090   93.01856  1.000 92.02927  ? 167  GLU B OE1 1 
ATOM   4514  O OE2 . GLU B  1 187 ? -3.30495  -10.93204  92.46865  1.000 86.47376  ? 167  GLU B OE2 1 
ATOM   4515  N N   . ALA B  1 188 ? -1.29368  -14.54927  96.97196  1.000 71.19517  ? 168  ALA B N   1 
ATOM   4516  C CA  . ALA B  1 188 ? -1.27005  -15.97024  97.26857  1.000 73.19940  ? 168  ALA B CA  1 
ATOM   4517  C C   . ALA B  1 188 ? -1.57653  -16.27295  98.72737  1.000 75.21507  ? 168  ALA B C   1 
ATOM   4518  O O   . ALA B  1 188 ? -1.77634  -17.44333  99.07351  1.000 72.72052  ? 168  ALA B O   1 
ATOM   4519  C CB  . ALA B  1 188 ? 0.09776   -16.56096  96.89757  1.000 76.09430  ? 168  ALA B CB  1 
ATOM   4520  N N   . THR B  1 189 ? -1.63093  -15.25080  99.58330  1.000 80.50348  ? 169  THR B N   1 
ATOM   4521  C CA  . THR B  1 189 ? -1.83854  -15.47947  101.00863 1.000 82.03826  ? 169  THR B CA  1 
ATOM   4522  C C   . THR B  1 189 ? -3.16671  -16.15405  101.29470 1.000 81.47434  ? 169  THR B C   1 
ATOM   4523  O O   . THR B  1 189 ? -3.32897  -16.73822  102.36679 1.000 86.08800  ? 169  THR B O   1 
ATOM   4524  C CB  . THR B  1 189 ? -1.78639  -14.16902  101.78753 1.000 82.56752  ? 169  THR B CB  1 
ATOM   4525  O OG1 . THR B  1 189 ? -2.73894  -13.25553  101.22935 1.000 86.61562  ? 169  THR B OG1 1 
ATOM   4526  C CG2 . THR B  1 189 ? -0.39563  -13.56084  101.72178 1.000 83.19875  ? 169  THR B CG2 1 
ATOM   4527  N N   . GLY B  1 190 ? -4.12181  -16.08204  100.38009 1.000 75.92049  ? 170  GLY B N   1 
ATOM   4528  C CA  . GLY B  1 190 ? -5.35758  -16.79450  100.62478 1.000 73.23516  ? 170  GLY B CA  1 
ATOM   4529  C C   . GLY B  1 190 ? -5.41137  -18.22445  100.12791 1.000 70.40687  ? 170  GLY B C   1 
ATOM   4530  O O   . GLY B  1 190 ? -6.46434  -18.85333  100.23295 1.000 70.78616  ? 170  GLY B O   1 
ATOM   4531  N N   . PHE B  1 191 ? -4.31881  -18.77289  99.60613  1.000 67.73038  ? 171  PHE B N   1 
ATOM   4532  C CA  . PHE B  1 191 ? -4.34836  -20.08048  98.97294  1.000 65.46251  ? 171  PHE B CA  1 
ATOM   4533  C C   . PHE B  1 191 ? -3.45924  -21.06556  99.71215  1.000 70.55744  ? 171  PHE B C   1 
ATOM   4534  O O   . PHE B  1 191 ? -2.59804  -20.69175  100.51292 1.000 76.55298  ? 171  PHE B O   1 
ATOM   4535  C CB  . PHE B  1 191 ? -3.87293  -20.02065  97.51282  1.000 65.47051  ? 171  PHE B CB  1 
ATOM   4536  C CG  . PHE B  1 191 ? -4.75361  -19.20928  96.60347  1.000 64.45105  ? 171  PHE B CG  1 
ATOM   4537  C CD1 . PHE B  1 191 ? -4.79459  -17.83017  96.70863  1.000 62.32395  ? 171  PHE B CD1 1 
ATOM   4538  C CD2 . PHE B  1 191 ? -5.51080  -19.82523  95.61459  1.000 64.98015  ? 171  PHE B CD2 1 
ATOM   4539  C CE1 . PHE B  1 191 ? -5.58696  -17.07428  95.87042  1.000 63.09027  ? 171  PHE B CE1 1 
ATOM   4540  C CE2 . PHE B  1 191 ? -6.30854  -19.07191  94.76351  1.000 64.01753  ? 171  PHE B CE2 1 
ATOM   4541  C CZ  . PHE B  1 191 ? -6.34518  -17.69006  94.89871  1.000 65.32556  ? 171  PHE B CZ  1 
ATOM   4542  N N   . GLY B  1 192 ? -3.67589  -22.34240  99.40919  1.000 71.18121  ? 172  GLY B N   1 
ATOM   4543  C CA  . GLY B  1 192 ? -2.64682  -23.33871  99.64943  1.000 69.76203  ? 172  GLY B CA  1 
ATOM   4544  C C   . GLY B  1 192 ? -1.49509  -23.10313  98.69443  1.000 68.39520  ? 172  GLY B C   1 
ATOM   4545  O O   . GLY B  1 192 ? -1.68514  -23.01714  97.47621  1.000 62.20531  ? 172  GLY B O   1 
ATOM   4546  N N   . VAL B  1 193 ? -0.29739  -22.95936  99.23900  1.000 69.84700  ? 173  VAL B N   1 
ATOM   4547  C CA  . VAL B  1 193 ? 0.85486   -22.55377  98.45298  1.000 71.36679  ? 173  VAL B CA  1 
ATOM   4548  C C   . VAL B  1 193 ? 1.85347   -23.69440  98.38719  1.000 75.24120  ? 173  VAL B C   1 
ATOM   4549  O O   . VAL B  1 193 ? 2.16245   -24.32719  99.40549  1.000 75.65765  ? 173  VAL B O   1 
ATOM   4550  C CB  . VAL B  1 193 ? 1.49537   -21.28558  99.02823  1.000 69.82711  ? 173  VAL B CB  1 
ATOM   4551  C CG1 . VAL B  1 193 ? 2.68352   -20.89667  98.18478  1.000 71.37683  ? 173  VAL B CG1 1 
ATOM   4552  C CG2 . VAL B  1 193 ? 0.45067   -20.19048  99.02984  1.000 68.64465  ? 173  VAL B CG2 1 
ATOM   4553  N N   . MET B  1 194 ? 2.36035   -23.94107  97.18743  1.000 75.64866  ? 174  MET B N   1 
ATOM   4554  C CA  . MET B  1 194 ? 3.36244   -24.96145  96.94243  1.000 79.50858  ? 174  MET B CA  1 
ATOM   4555  C C   . MET B  1 194 ? 4.70995   -24.28080  96.78357  1.000 81.66413  ? 174  MET B C   1 
ATOM   4556  O O   . MET B  1 194 ? 4.90260   -23.51134  95.83453  1.000 77.54527  ? 174  MET B O   1 
ATOM   4557  C CB  . MET B  1 194 ? 3.04573   -25.75154  95.67452  1.000 77.18832  ? 174  MET B CB  1 
ATOM   4558  C CG  . MET B  1 194 ? 1.63704   -26.22735  95.50808  1.000 75.35614  ? 174  MET B CG  1 
ATOM   4559  S SD  . MET B  1 194 ? 1.58361   -27.84774  96.22662  1.000 79.11707  ? 174  MET B SD  1 
ATOM   4560  C CE  . MET B  1 194 ? 0.38344   -27.60907  97.49847  1.000 72.52497  ? 174  MET B CE  1 
ATOM   4561  N N   . HIS B  1 195 ? 5.64296   -24.56687  97.69292  1.000 87.31811  ? 175  HIS B N   1 
ATOM   4562  C CA  . HIS B  1 195 ? 7.01478   -24.13695  97.47695  1.000 88.09349  ? 175  HIS B CA  1 
ATOM   4563  C C   . HIS B  1 195 ? 7.68934   -25.13247  96.54349  1.000 84.80939  ? 175  HIS B C   1 
ATOM   4564  O O   . HIS B  1 195 ? 7.60958   -26.35142  96.72851  1.000 79.22965  ? 175  HIS B O   1 
ATOM   4565  C CB  . HIS B  1 195 ? 7.80012   -23.97756  98.78473  1.000 93.51148  ? 175  HIS B CB  1 
ATOM   4566  C CG  . HIS B  1 195 ? 9.18132   -23.40230  98.59615  1.000 97.06499  ? 175  HIS B CG  1 
ATOM   4567  N ND1 . HIS B  1 195 ? 10.14800  -23.42310  99.58178  1.000 101.40985 ? 175  HIS B ND1 1 
ATOM   4568  C CD2 . HIS B  1 195 ? 9.75652   -22.79969  97.52591  1.000 98.84818  ? 175  HIS B CD2 1 
ATOM   4569  C CE1 . HIS B  1 195 ? 11.25363  -22.85359  99.13013  1.000 103.18498 ? 175  HIS B CE1 1 
ATOM   4570  N NE2 . HIS B  1 195 ? 11.04363  -22.46981  97.88386  1.000 103.95077 ? 175  HIS B NE2 1 
ATOM   4571  N N   . VAL B  1 196 ? 8.39664   -24.57286  95.57813  1.000 89.97409  ? 176  VAL B N   1 
ATOM   4572  C CA  . VAL B  1 196 ? 8.80304   -25.12986  94.30287  1.000 90.64157  ? 176  VAL B CA  1 
ATOM   4573  C C   . VAL B  1 196 ? 10.30743  -25.35544  94.40215  1.000 96.30532  ? 176  VAL B C   1 
ATOM   4574  O O   . VAL B  1 196 ? 10.89748  -25.11913  95.46156  1.000 101.51433 ? 176  VAL B O   1 
ATOM   4575  C CB  . VAL B  1 196 ? 8.38555   -24.09658  93.23485  1.000 88.93237  ? 176  VAL B CB  1 
ATOM   4576  C CG1 . VAL B  1 196 ? 8.85988   -22.72414  93.70221  1.000 94.01196  ? 176  VAL B CG1 1 
ATOM   4577  C CG2 . VAL B  1 196 ? 8.84137   -24.40185  91.82092  1.000 86.49460  ? 176  VAL B CG2 1 
ATOM   4578  N N   . ASN B  1 197 ? 10.93220  -25.85251  93.33894  1.000 95.73348  ? 177  ASN B N   1 
ATOM   4579  C CA  . ASN B  1 197 ? 12.36284  -25.66922  93.11849  1.000 98.45711  ? 177  ASN B CA  1 
ATOM   4580  C C   . ASN B  1 197 ? 12.56284  -25.44133  91.62393  1.000 99.52592  ? 177  ASN B C   1 
ATOM   4581  O O   . ASN B  1 197 ? 11.60348  -25.22405  90.87602  1.000 99.62141  ? 177  ASN B O   1 
ATOM   4582  C CB  . ASN B  1 197 ? 13.17776  -26.85156  93.66435  1.000 99.90055  ? 177  ASN B CB  1 
ATOM   4583  C CG  . ASN B  1 197 ? 12.78638  -28.17862  93.03451  1.000 103.57834 ? 177  ASN B CG  1 
ATOM   4584  O OD1 . ASN B  1 197 ? 12.68631  -28.30247  91.81373  1.000 103.56971 ? 177  ASN B OD1 1 
ATOM   4585  N ND2 . ASN B  1 197 ? 12.56449  -29.18284  93.87232  1.000 104.63118 ? 177  ASN B ND2 1 
ATOM   4586  N N   . GLU B  1 198 ? 13.81544  -25.50315  91.17493  1.000 100.90473 ? 178  GLU B N   1 
ATOM   4587  C CA  . GLU B  1 198 ? 14.08965  -25.30381  89.75688  1.000 102.75739 ? 178  GLU B CA  1 
ATOM   4588  C C   . GLU B  1 198 ? 13.46775  -26.39000  88.88338  1.000 99.42688  ? 178  GLU B C   1 
ATOM   4589  O O   . GLU B  1 198 ? 13.18616  -26.13279  87.70824  1.000 95.81857  ? 178  GLU B O   1 
ATOM   4590  C CB  . GLU B  1 198 ? 15.59908  -25.23488  89.51739  1.000 111.31841 ? 178  GLU B CB  1 
ATOM   4591  C CG  . GLU B  1 198 ? 16.34321  -26.53592  89.81081  1.000 117.65648 ? 178  GLU B CG  1 
ATOM   4592  C CD  . GLU B  1 198 ? 16.65793  -26.71594  91.28789  1.000 121.85698 ? 178  GLU B CD  1 
ATOM   4593  O OE1 . GLU B  1 198 ? 17.06586  -27.83501  91.67635  1.000 123.30507 ? 178  GLU B OE1 1 
ATOM   4594  O OE2 . GLU B  1 198 ? 16.49824  -25.73627  92.05548  1.000 122.15745 ? 178  GLU B OE2 1 
ATOM   4595  N N   . LYS B  1 199 ? 13.24458  -27.58797  89.42557  1.000 98.98088  ? 179  LYS B N   1 
ATOM   4596  C CA  . LYS B  1 199 ? 12.60748  -28.67755  88.69908  1.000 95.07879  ? 179  LYS B CA  1 
ATOM   4597  C C   . LYS B  1 199 ? 11.08988  -28.68041  88.86920  1.000 89.56702  ? 179  LYS B C   1 
ATOM   4598  O O   . LYS B  1 199 ? 10.44062  -29.66581  88.50732  1.000 83.82391  ? 179  LYS B O   1 
ATOM   4599  C CB  . LYS B  1 199 ? 13.18323  -30.02775  89.15133  1.000 95.01138  ? 179  LYS B CB  1 
ATOM   4600  C CG  . LYS B  1 199 ? 14.70138  -30.17395  89.06530  1.000 99.86573  ? 179  LYS B CG  1 
ATOM   4601  C CD  . LYS B  1 199 ? 15.10745  -31.65171  89.07477  1.000 101.52703 ? 179  LYS B CD  1 
ATOM   4602  C CE  . LYS B  1 199 ? 15.69602  -32.08550  90.41639  1.000 104.22640 ? 179  LYS B CE  1 
ATOM   4603  N NZ  . LYS B  1 199 ? 16.10719  -33.52086  90.40678  1.000 106.17982 ? 179  LYS B NZ  1 
ATOM   4604  N N   . ASP B  1 200 ? 10.51940  -27.60551  89.41902  1.000 88.96606  ? 180  ASP B N   1 
ATOM   4605  C CA  . ASP B  1 200 ? 9.08040   -27.50725  89.67487  1.000 86.76555  ? 180  ASP B CA  1 
ATOM   4606  C C   . ASP B  1 200 ? 8.57074   -28.68433  90.51795  1.000 85.64457  ? 180  ASP B C   1 
ATOM   4607  O O   . ASP B  1 200 ? 7.39658   -29.06834  90.43907  1.000 81.09925  ? 180  ASP B O   1 
ATOM   4608  C CB  . ASP B  1 200 ? 8.29464   -27.38090  88.36047  1.000 86.04000  ? 180  ASP B CB  1 
ATOM   4609  C CG  . ASP B  1 200 ? 7.79380   -25.95087  88.09526  1.000 85.76109  ? 180  ASP B CG  1 
ATOM   4610  O OD1 . ASP B  1 200 ? 7.90771   -25.09635  88.99697  1.000 87.41468  ? 180  ASP B OD1 1 
ATOM   4611  O OD2 . ASP B  1 200 ? 7.28204   -25.67698  86.98370  1.000 82.40397  ? 180  ASP B OD2 1 
ATOM   4612  N N   . GLU B  1 201 ? 9.44799   -29.26424  91.34166  1.000 88.97784  ? 181  GLU B N   1 
ATOM   4613  C CA  . GLU B  1 201 ? 9.05040   -30.28770  92.30458  1.000 87.08044  ? 181  GLU B CA  1 
ATOM   4614  C C   . GLU B  1 201 ? 8.72685   -29.64078  93.64720  1.000 86.74764  ? 181  GLU B C   1 
ATOM   4615  O O   . GLU B  1 201 ? 9.46128   -28.77221  94.12563  1.000 90.07990  ? 181  GLU B O   1 
ATOM   4616  C CB  . GLU B  1 201 ? 10.14813  -31.34276  92.46907  1.000 86.16091  ? 181  GLU B CB  1 
ATOM   4617  C CG  . GLU B  1 201 ? 10.96761  -31.56057  91.21001  1.000 91.36458  ? 181  GLU B CG  1 
ATOM   4618  C CD  . GLU B  1 201 ? 12.04722  -32.63996  91.35022  1.000 97.53495  ? 181  GLU B CD  1 
ATOM   4619  O OE1 . GLU B  1 201 ? 12.13421  -33.51983  90.46377  1.000 97.79779  ? 181  GLU B OE1 1 
ATOM   4620  O OE2 . GLU B  1 201 ? 12.81288  -32.60957  92.33867  1.000 99.47206  ? 181  GLU B OE2 1 
ATOM   4621  N N   . ILE B  1 202 ? 7.61874   -30.06201  94.25069  1.000 85.13283  ? 182  ILE B N   1 
ATOM   4622  C CA  . ILE B  1 202 ? 7.10596   -29.37751  95.43406  1.000 86.51921  ? 182  ILE B CA  1 
ATOM   4623  C C   . ILE B  1 202 ? 7.89489   -29.81800  96.65965  1.000 86.88224  ? 182  ILE B C   1 
ATOM   4624  O O   . ILE B  1 202 ? 7.91394   -31.00434  97.00022  1.000 87.07566  ? 182  ILE B O   1 
ATOM   4625  C CB  . ILE B  1 202 ? 5.60394   -29.63172  95.62526  1.000 81.81547  ? 182  ILE B CB  1 
ATOM   4626  C CG1 . ILE B  1 202 ? 4.80352   -28.93848  94.52497  1.000 79.78658  ? 182  ILE B CG1 1 
ATOM   4627  C CG2 . ILE B  1 202 ? 5.14993   -29.09051  96.96661  1.000 77.27492  ? 182  ILE B CG2 1 
ATOM   4628  C CD1 . ILE B  1 202 ? 4.15099   -29.87319  93.56860  1.000 77.19993  ? 182  ILE B CD1 1 
ATOM   4629  N N   . ILE B  1 203 ? 8.52585   -28.85384  97.33298  1.000 86.71470  ? 183  ILE B N   1 
ATOM   4630  C CA  . ILE B  1 203 ? 9.27375   -29.11952  98.55877  1.000 90.53194  ? 183  ILE B CA  1 
ATOM   4631  C C   . ILE B  1 203 ? 8.39348   -29.03448  99.80563  1.000 91.35985  ? 183  ILE B C   1 
ATOM   4632  O O   . ILE B  1 203 ? 8.65369   -29.73317  100.79501 1.000 92.21242  ? 183  ILE B O   1 
ATOM   4633  C CB  . ILE B  1 203 ? 10.45688  -28.14329  98.66566  1.000 93.36821  ? 183  ILE B CB  1 
ATOM   4634  C CG1 . ILE B  1 203 ? 11.26269  -28.15084  97.36820  1.000 93.47756  ? 183  ILE B CG1 1 
ATOM   4635  C CG2 . ILE B  1 203 ? 11.33806  -28.50069  99.84415  1.000 96.31851  ? 183  ILE B CG2 1 
ATOM   4636  C CD1 . ILE B  1 203 ? 11.69237  -29.53691  96.93995  1.000 92.02243  ? 183  ILE B CD1 1 
ATOM   4637  N N   . ASP B  1 204 ? 7.36923   -28.17992  99.78497  1.000 87.69525  ? 184  ASP B N   1 
ATOM   4638  C CA  . ASP B  1 204 ? 6.46091   -28.03462  100.91265 1.000 90.85117  ? 184  ASP B CA  1 
ATOM   4639  C C   . ASP B  1 204 ? 5.14331   -27.45534  100.41325 1.000 89.54399  ? 184  ASP B C   1 
ATOM   4640  O O   . ASP B  1 204 ? 5.06405   -26.87685  99.32457  1.000 86.79889  ? 184  ASP B O   1 
ATOM   4641  C CB  . ASP B  1 204 ? 7.06726   -27.15032  102.02081 1.000 98.14107  ? 184  ASP B CB  1 
ATOM   4642  C CG  . ASP B  1 204 ? 6.32853   -27.27956  103.35698 1.000 100.61849 ? 184  ASP B CG  1 
ATOM   4643  O OD1 . ASP B  1 204 ? 6.92968   -26.96097  104.39697 1.000 103.88185 ? 184  ASP B OD1 1 
ATOM   4644  O OD2 . ASP B  1 204 ? 5.14456   -27.68848  103.37416 1.000 101.23841 ? 184  ASP B OD2 1 
ATOM   4645  N N   . PHE B  1 205 ? 4.10588   -27.63947  101.22970 1.000 90.51356  ? 185  PHE B N   1 
ATOM   4646  C CA  . PHE B  1 205 ? 2.78114   -27.08055  100.99617 1.000 90.04737  ? 185  PHE B CA  1 
ATOM   4647  C C   . PHE B  1 205 ? 2.32615   -26.41999  102.28202 1.000 90.57508  ? 185  PHE B C   1 
ATOM   4648  O O   . PHE B  1 205 ? 2.18427   -27.09262  103.30860 1.000 94.81005  ? 185  PHE B O   1 
ATOM   4649  C CB  . PHE B  1 205 ? 1.78145   -28.15727  100.58431 1.000 92.42004  ? 185  PHE B CB  1 
ATOM   4650  C CG  . PHE B  1 205 ? 0.37372   -27.91178  101.06756 1.000 98.10543  ? 185  PHE B CG  1 
ATOM   4651  C CD1 . PHE B  1 205 ? -0.40177  -26.90564  100.51195 1.000 97.45170  ? 185  PHE B CD1 1 
ATOM   4652  C CD2 . PHE B  1 205 ? -0.19534  -28.71855  102.03471 1.000 103.33773 ? 185  PHE B CD2 1 
ATOM   4653  C CE1 . PHE B  1 205 ? -1.69896  -26.69218  100.92121 1.000 94.60548  ? 185  PHE B CE1 1 
ATOM   4654  C CE2 . PHE B  1 205 ? -1.49537  -28.50692  102.44918 1.000 102.54325 ? 185  PHE B CE2 1 
ATOM   4655  C CZ  . PHE B  1 205 ? -2.24644  -27.49720  101.88957 1.000 96.72559  ? 185  PHE B CZ  1 
ATOM   4656  N N   . ILE B  1 206 ? 2.08338   -25.11736  102.23276 1.000 85.78964  ? 186  ILE B N   1 
ATOM   4657  C CA  . ILE B  1 206 ? 1.65584   -24.38197  103.41095 1.000 85.52025  ? 186  ILE B CA  1 
ATOM   4658  C C   . ILE B  1 206 ? 0.27259   -23.80445  103.15839 1.000 85.84093  ? 186  ILE B C   1 
ATOM   4659  O O   . ILE B  1 206 ? 0.02050   -23.21198  102.10127 1.000 85.99189  ? 186  ILE B O   1 
ATOM   4660  C CB  . ILE B  1 206 ? 2.65879   -23.28147  103.79047 1.000 84.43477  ? 186  ILE B CB  1 
ATOM   4661  C CG1 . ILE B  1 206 ? 4.09449   -23.80764  103.69228 1.000 82.53391  ? 186  ILE B CG1 1 
ATOM   4662  C CG2 . ILE B  1 206 ? 2.35891   -22.77969  105.18779 1.000 86.68550  ? 186  ILE B CG2 1 
ATOM   4663  C CD1 . ILE B  1 206 ? 4.85177   -23.26615  102.51059 1.000 81.91092  ? 186  ILE B CD1 1 
ATOM   4664  N N   . GLU B  1 207 ? -0.61929  -23.98415  104.12988 1.000 84.68786  ? 187  GLU B N   1 
ATOM   4665  C CA  . GLU B  1 207 ? -1.97520  -23.45886  104.04181 1.000 84.17365  ? 187  GLU B CA  1 
ATOM   4666  C C   . GLU B  1 207 ? -1.98879  -21.99314  104.47630 1.000 86.45571  ? 187  GLU B C   1 
ATOM   4667  O O   . GLU B  1 207 ? -1.64585  -21.66950  105.62260 1.000 83.96611  ? 187  GLU B O   1 
ATOM   4668  C CB  . GLU B  1 207 ? -2.91578  -24.29719  104.90571 1.000 85.72020  ? 187  GLU B CB  1 
ATOM   4669  C CG  . GLU B  1 207 ? -4.35409  -24.38930  104.39308 1.000 89.43988  ? 187  GLU B CG  1 
ATOM   4670  C CD  . GLU B  1 207 ? -4.45938  -24.40569  102.86663 1.000 94.24406  ? 187  GLU B CD  1 
ATOM   4671  O OE1 . GLU B  1 207 ? -4.75808  -23.33605  102.27923 1.000 91.73174  ? 187  GLU B OE1 1 
ATOM   4672  O OE2 . GLU B  1 207 ? -4.26636  -25.48687  102.25636 1.000 97.18104  ? 187  GLU B OE2 1 
ATOM   4673  N N   . LYS B  1 208 ? -2.36125  -21.10681  103.55694 1.000 84.70717  ? 188  LYS B N   1 
ATOM   4674  C CA  . LYS B  1 208 ? -2.53940  -19.69077  103.84553 1.000 84.62621  ? 188  LYS B CA  1 
ATOM   4675  C C   . LYS B  1 208 ? -1.30167  -19.03194  104.47570 1.000 88.05244  ? 188  LYS B C   1 
ATOM   4676  O O   . LYS B  1 208 ? -1.39094  -18.43258  105.54467 1.000 91.54522  ? 188  LYS B O   1 
ATOM   4677  C CB  . LYS B  1 208 ? -3.74826  -19.51372  104.75585 1.000 87.67500  ? 188  LYS B CB  1 
ATOM   4678  C CG  . LYS B  1 208 ? -4.27222  -18.07517  104.88358 1.000 95.23807  ? 188  LYS B CG  1 
ATOM   4679  C CD  . LYS B  1 208 ? -4.57662  -17.66892  106.33792 1.000 95.89060  ? 188  LYS B CD  1 
ATOM   4680  C CE  . LYS B  1 208 ? -5.20991  -16.29214  106.40672 1.000 90.92599  ? 188  LYS B CE  1 
ATOM   4681  N NZ  . LYS B  1 208 ? -6.14513  -16.21037  107.55457 1.000 96.11780  ? 188  LYS B NZ  1 
ATOM   4682  N N   . PRO B  1 209 ? -0.12959  -19.12327  103.82884 1.000 85.27173  ? 189  PRO B N   1 
ATOM   4683  C CA  . PRO B  1 209 ? 1.05031   -18.44047  104.38383 1.000 84.28934  ? 189  PRO B CA  1 
ATOM   4684  C C   . PRO B  1 209 ? 0.85925   -16.93150  104.36717 1.000 82.64374  ? 189  PRO B C   1 
ATOM   4685  O O   . PRO B  1 209 ? 0.48581   -16.34127  103.34860 1.000 78.49938  ? 189  PRO B O   1 
ATOM   4686  C CB  . PRO B  1 209 ? 2.18953   -18.87519  103.45378 1.000 83.64947  ? 189  PRO B CB  1 
ATOM   4687  C CG  . PRO B  1 209 ? 1.53082   -19.11630  102.17710 1.000 80.49311  ? 189  PRO B CG  1 
ATOM   4688  C CD  . PRO B  1 209 ? 0.17620   -19.70762  102.51323 1.000 81.13698  ? 189  PRO B CD  1 
ATOM   4689  N N   . ALA B  1 210 ? 1.09866   -16.30829  105.51983 1.000 85.10298  ? 190  ALA B N   1 
ATOM   4690  C CA  . ALA B  1 210 ? 1.07046   -14.85381  105.56894 1.000 84.51692  ? 190  ALA B CA  1 
ATOM   4691  C C   . ALA B  1 210 ? 2.16276   -14.25896  104.69004 1.000 86.84422  ? 190  ALA B C   1 
ATOM   4692  O O   . ALA B  1 210 ? 1.93638   -13.24968  104.01519 1.000 89.39744  ? 190  ALA B O   1 
ATOM   4693  C CB  . ALA B  1 210 ? 1.19519   -14.37314  107.01033 1.000 83.44695  ? 190  ALA B CB  1 
ATOM   4694  N N   . ASP B  1 211 ? 3.34592   -14.87429  104.66564 1.000 84.77918  ? 191  ASP B N   1 
ATOM   4695  C CA  . ASP B  1 211 ? 4.39920   -14.48355  103.72410 1.000 86.51357  ? 191  ASP B CA  1 
ATOM   4696  C C   . ASP B  1 211 ? 4.77047   -15.68225  102.86437 1.000 89.01159  ? 191  ASP B C   1 
ATOM   4697  O O   . ASP B  1 211 ? 5.59658   -16.51853  103.27436 1.000 91.02769  ? 191  ASP B O   1 
ATOM   4698  C CB  . ASP B  1 211 ? 5.63276   -13.92551  104.43284 1.000 88.34459  ? 191  ASP B CB  1 
ATOM   4699  C CG  . ASP B  1 211 ? 6.43914   -12.98784  103.54146 1.000 91.46503  ? 191  ASP B CG  1 
ATOM   4700  O OD1 . ASP B  1 211 ? 7.53135   -12.54414  103.95523 1.000 96.47579  ? 191  ASP B OD1 1 
ATOM   4701  O OD2 . ASP B  1 211 ? 5.97825   -12.69045  102.42189 1.000 91.05428  ? 191  ASP B OD2 1 
ATOM   4702  N N   . PRO B  1 212 ? 4.21537   -15.78899  101.66136 1.000 88.31578  ? 192  PRO B N   1 
ATOM   4703  C CA  . PRO B  1 212 ? 4.34766   -17.01413  100.87371 1.000 85.71389  ? 192  PRO B CA  1 
ATOM   4704  C C   . PRO B  1 212 ? 5.69728   -17.10572  100.18705 1.000 87.10644  ? 192  PRO B C   1 
ATOM   4705  O O   . PRO B  1 212 ? 6.17904   -16.12316  99.60539  1.000 82.41172  ? 192  PRO B O   1 
ATOM   4706  C CB  . PRO B  1 212 ? 3.21985   -16.88966  99.83916  1.000 85.17520  ? 192  PRO B CB  1 
ATOM   4707  C CG  . PRO B  1 212 ? 2.39313   -15.68269  100.27351 1.000 86.09338  ? 192  PRO B CG  1 
ATOM   4708  C CD  . PRO B  1 212 ? 3.31494   -14.81401  101.02674 1.000 88.19048  ? 192  PRO B CD  1 
ATOM   4709  N N   . PRO B  1 213 ? 6.31095   -18.29105  100.18398 1.000 86.77955  ? 193  PRO B N   1 
ATOM   4710  C CA  . PRO B  1 213 ? 7.53702   -18.48721  99.40268  1.000 85.11204  ? 193  PRO B CA  1 
ATOM   4711  C C   . PRO B  1 213 ? 7.28156   -18.28757  97.91512  1.000 83.54959  ? 193  PRO B C   1 
ATOM   4712  O O   . PRO B  1 213 ? 6.19791   -18.57625  97.40277  1.000 78.82524  ? 193  PRO B O   1 
ATOM   4713  C CB  . PRO B  1 213 ? 7.92323   -19.93945  99.70695  1.000 85.38542  ? 193  PRO B CB  1 
ATOM   4714  C CG  . PRO B  1 213 ? 6.62836   -20.59690  100.08298 1.000 85.46395  ? 193  PRO B CG  1 
ATOM   4715  C CD  . PRO B  1 213 ? 5.81892   -19.54613  100.77957 1.000 86.71114  ? 193  PRO B CD  1 
ATOM   4716  N N   . GLY B  1 214 ? 8.29993   -17.77598  97.22227  1.000 86.98710  ? 194  GLY B N   1 
ATOM   4717  C CA  . GLY B  1 214 ? 8.24390   -17.57164  95.79186  1.000 85.59637  ? 194  GLY B CA  1 
ATOM   4718  C C   . GLY B  1 214 ? 8.90052   -18.70625  95.02501  1.000 89.55317  ? 194  GLY B C   1 
ATOM   4719  O O   . GLY B  1 214 ? 9.28735   -19.73510  95.58283  1.000 90.83983  ? 194  GLY B O   1 
ATOM   4720  N N   . ILE B  1 215 ? 9.03380   -18.50599  93.72185  1.000 91.58082  ? 195  ILE B N   1 
ATOM   4721  C CA  . ILE B  1 215 ? 9.53258   -19.53772  92.81267  1.000 93.06309  ? 195  ILE B CA  1 
ATOM   4722  C C   . ILE B  1 215 ? 10.90242  -19.11610  92.29295  1.000 97.79120  ? 195  ILE B C   1 
ATOM   4723  O O   . ILE B  1 215 ? 11.08835  -17.93924  91.95558  1.000 97.66056  ? 195  ILE B O   1 
ATOM   4724  C CB  . ILE B  1 215 ? 8.54767   -19.82126  91.65491  1.000 90.71644  ? 195  ILE B CB  1 
ATOM   4725  C CG1 . ILE B  1 215 ? 8.57379   -18.74723  90.56046  1.000 91.93920  ? 195  ILE B CG1 1 
ATOM   4726  C CG2 . ILE B  1 215 ? 7.11873   -19.96477  92.20101  1.000 87.84038  ? 195  ILE B CG2 1 
ATOM   4727  C CD1 . ILE B  1 215 ? 7.40860   -18.86645  89.55871  1.000 86.68463  ? 195  ILE B CD1 1 
ATOM   4728  N N   . PRO B  1 216 ? 11.89633  -20.01699  92.28485  1.000 100.90758 ? 196  PRO B N   1 
ATOM   4729  C CA  . PRO B  1 216 ? 13.22070  -19.67502  91.74448  1.000 101.96633 ? 196  PRO B CA  1 
ATOM   4730  C C   . PRO B  1 216 ? 13.14147  -19.09518  90.33819  1.000 99.78846  ? 196  PRO B C   1 
ATOM   4731  O O   . PRO B  1 216 ? 12.30774  -19.49643  89.52191  1.000 95.52854  ? 196  PRO B O   1 
ATOM   4732  C CB  . PRO B  1 216 ? 13.96462  -21.01598  91.75570  1.000 100.78704 ? 196  PRO B CB  1 
ATOM   4733  C CG  . PRO B  1 216 ? 13.24161  -21.87866  92.75365  1.000 100.71715 ? 196  PRO B CG  1 
ATOM   4734  C CD  . PRO B  1 216 ? 11.95413  -21.20517  93.15524  1.000 100.30427 ? 196  PRO B CD  1 
ATOM   4735  N N   . GLY B  1 217 ? 14.02502  -18.13296  90.06272  1.000 100.25923 ? 197  GLY B N   1 
ATOM   4736  C CA  . GLY B  1 217 ? 14.01749  -17.41080  88.80928  1.000 99.25336  ? 197  GLY B CA  1 
ATOM   4737  C C   . GLY B  1 217 ? 12.89812  -16.40769  88.65552  1.000 98.67880  ? 197  GLY B C   1 
ATOM   4738  O O   . GLY B  1 217 ? 12.90476  -15.64593  87.67986  1.000 100.61021 ? 197  GLY B O   1 
ATOM   4739  N N   . ASN B  1 218 ? 11.92705  -16.39033  89.57008  1.000 95.48710  ? 198  ASN B N   1 
ATOM   4740  C CA  . ASN B  1 218 ? 10.88910  -15.37015  89.57952  1.000 93.38760  ? 198  ASN B CA  1 
ATOM   4741  C C   . ASN B  1 218 ? 10.25006  -15.27251  90.95923  1.000 94.01859  ? 198  ASN B C   1 
ATOM   4742  O O   . ASN B  1 218 ? 9.14709   -15.78744  91.17728  1.000 92.59189  ? 198  ASN B O   1 
ATOM   4743  C CB  . ASN B  1 218 ? 9.82861   -15.66409  88.52530  1.000 89.18305  ? 198  ASN B CB  1 
ATOM   4744  C CG  . ASN B  1 218 ? 8.85386   -14.53001  88.37478  1.000 90.65523  ? 198  ASN B CG  1 
ATOM   4745  O OD1 . ASN B  1 218 ? 9.16062   -13.38781  88.71655  1.000 94.45595  ? 198  ASN B OD1 1 
ATOM   4746  N ND2 . ASN B  1 218 ? 7.67313   -14.83028  87.86413  1.000 88.96965  ? 198  ASN B ND2 1 
ATOM   4747  N N   . GLU B  1 219 ? 10.93019  -14.60529  91.89374  1.000 94.81004  ? 199  GLU B N   1 
ATOM   4748  C CA  . GLU B  1 219 ? 10.50016  -14.59961  93.28518  1.000 92.75742  ? 199  GLU B CA  1 
ATOM   4749  C C   . GLU B  1 219 ? 9.43492   -13.55535  93.57568  1.000 88.33249  ? 199  GLU B C   1 
ATOM   4750  O O   . GLU B  1 219 ? 9.02208   -13.42705  94.73235  1.000 86.52275  ? 199  GLU B O   1 
ATOM   4751  C CB  . GLU B  1 219 ? 11.69806  -14.39144  94.21731  1.000 97.62716  ? 199  GLU B CB  1 
ATOM   4752  C CG  . GLU B  1 219 ? 12.73285  -15.50466  94.16450  1.000 100.88647 ? 199  GLU B CG  1 
ATOM   4753  C CD  . GLU B  1 219 ? 13.50672  -15.48989  92.86903  1.000 104.82424 ? 199  GLU B CD  1 
ATOM   4754  O OE1 . GLU B  1 219 ? 14.01861  -16.55446  92.45376  1.000 103.70920 ? 199  GLU B OE1 1 
ATOM   4755  O OE2 . GLU B  1 219 ? 13.57096  -14.40261  92.25405  1.000 107.25824 ? 199  GLU B OE2 1 
ATOM   4756  N N   . GLY B  1 220 ? 8.98742   -12.80538  92.57113  1.000 85.74919  ? 200  GLY B N   1 
ATOM   4757  C CA  . GLY B  1 220 ? 7.81173   -11.98318  92.75999  1.000 84.12100  ? 200  GLY B CA  1 
ATOM   4758  C C   . GLY B  1 220 ? 6.50652   -12.74472  92.72094  1.000 81.80535  ? 200  GLY B C   1 
ATOM   4759  O O   . GLY B  1 220 ? 5.45057   -12.15771  92.97644  1.000 79.37043  ? 200  GLY B O   1 
ATOM   4760  N N   . PHE B  1 221 ? 6.54970   -14.04176  92.41849  1.000 79.51693  ? 201  PHE B N   1 
ATOM   4761  C CA  . PHE B  1 221 ? 5.34026   -14.82880  92.23373  1.000 81.61393  ? 201  PHE B CA  1 
ATOM   4762  C C   . PHE B  1 221 ? 5.39956   -16.09608  93.07575  1.000 81.95392  ? 201  PHE B C   1 
ATOM   4763  O O   . PHE B  1 221 ? 6.45495   -16.49254  93.57516  1.000 90.81541  ? 201  PHE B O   1 
ATOM   4764  C CB  . PHE B  1 221 ? 5.12190   -15.16742  90.75373  1.000 78.43421  ? 201  PHE B CB  1 
ATOM   4765  C CG  . PHE B  1 221 ? 4.75112   -13.97290  89.91067  1.000 77.05553  ? 201  PHE B CG  1 
ATOM   4766  C CD1 . PHE B  1 221 ? 5.70394   -13.01774  89.57333  1.000 77.59661  ? 201  PHE B CD1 1 
ATOM   4767  C CD2 . PHE B  1 221 ? 3.45090   -13.79964  89.46617  1.000 76.20192  ? 201  PHE B CD2 1 
ATOM   4768  C CE1 . PHE B  1 221 ? 5.36433   -11.92083  88.80115  1.000 77.78458  ? 201  PHE B CE1 1 
ATOM   4769  C CE2 . PHE B  1 221 ? 3.10174   -12.70201  88.69221  1.000 77.69085  ? 201  PHE B CE2 1 
ATOM   4770  C CZ  . PHE B  1 221 ? 4.06328   -11.75889  88.35935  1.000 77.08328  ? 201  PHE B CZ  1 
ATOM   4771  N N   . ALA B  1 222 ? 4.23590   -16.72097  93.23951  1.000 74.63003  ? 202  ALA B N   1 
ATOM   4772  C CA  . ALA B  1 222 ? 4.08711   -17.91369  94.05742  1.000 75.62189  ? 202  ALA B CA  1 
ATOM   4773  C C   . ALA B  1 222 ? 3.07522   -18.84652  93.40439  1.000 76.11621  ? 202  ALA B C   1 
ATOM   4774  O O   . ALA B  1 222 ? 2.19344   -18.40771  92.65864  1.000 75.83961  ? 202  ALA B O   1 
ATOM   4775  C CB  . ALA B  1 222 ? 3.65042   -17.56249  95.48772  1.000 75.18573  ? 202  ALA B CB  1 
ATOM   4776  N N   . LEU B  1 223 ? 3.21015   -20.14284  93.69331  1.000 77.15326  ? 203  LEU B N   1 
ATOM   4777  C CA  . LEU B  1 223 ? 2.35501   -21.17941  93.11466  1.000 72.46757  ? 203  LEU B CA  1 
ATOM   4778  C C   . LEU B  1 223 ? 1.22164   -21.50507  94.08568  1.000 67.62393  ? 203  LEU B C   1 
ATOM   4779  O O   . LEU B  1 223 ? 1.46145   -22.02432  95.18174  1.000 66.10921  ? 203  LEU B O   1 
ATOM   4780  C CB  . LEU B  1 223 ? 3.17080   -22.42638  92.77864  1.000 70.47071  ? 203  LEU B CB  1 
ATOM   4781  C CG  . LEU B  1 223 ? 4.06267   -22.32071  91.53506  1.000 71.37655  ? 203  LEU B CG  1 
ATOM   4782  C CD1 . LEU B  1 223 ? 4.77610   -23.63908  91.22694  1.000 73.06462  ? 203  LEU B CD1 1 
ATOM   4783  C CD2 . LEU B  1 223 ? 3.24421   -21.86989  90.34140  1.000 66.62956  ? 203  LEU B CD2 1 
ATOM   4784  N N   . ALA B  1 224 ? -0.00978  -21.20349  93.67877  1.000 63.00772  ? 204  ALA B N   1 
ATOM   4785  C CA  . ALA B  1 224 ? -1.19277  -21.41444  94.50165  1.000 61.50562  ? 204  ALA B CA  1 
ATOM   4786  C C   . ALA B  1 224 ? -1.97740  -22.60983  93.97334  1.000 59.24494  ? 204  ALA B C   1 
ATOM   4787  O O   . ALA B  1 224 ? -2.18189  -22.73164  92.76110  1.000 58.10227  ? 204  ALA B O   1 
ATOM   4788  C CB  . ALA B  1 224 ? -2.07683  -20.16784  94.51716  1.000 60.91661  ? 204  ALA B CB  1 
ATOM   4789  N N   . SER B  1 225 ? -2.43597  -23.46608  94.89107  1.000 58.73336  ? 205  SER B N   1 
ATOM   4790  C CA  . SER B  1 225 ? -3.03828  -24.74429  94.52641  1.000 61.85942  ? 205  SER B CA  1 
ATOM   4791  C C   . SER B  1 225 ? -4.44128  -24.54908  93.97651  1.000 59.61973  ? 205  SER B C   1 
ATOM   4792  O O   . SER B  1 225 ? -5.29197  -23.92752  94.61836  1.000 60.31876  ? 205  SER B O   1 
ATOM   4793  C CB  . SER B  1 225 ? -3.08492  -25.67992  95.73726  1.000 62.57132  ? 205  SER B CB  1 
ATOM   4794  O OG  . SER B  1 225 ? -3.88008  -26.83064  95.47615  1.000 55.58482  ? 205  SER B OG  1 
ATOM   4795  N N   . MET B  1 226 ? -4.68000  -25.08722  92.78840  1.000 59.64607  ? 206  MET B N   1 
ATOM   4796  C CA  . MET B  1 226 ? -6.00831  -25.09485  92.19605  1.000 59.05198  ? 206  MET B CA  1 
ATOM   4797  C C   . MET B  1 226 ? -6.92509  -26.17548  92.73884  1.000 59.68384  ? 206  MET B C   1 
ATOM   4798  O O   . MET B  1 226 ? -8.08223  -26.24979  92.30488  1.000 60.00511  ? 206  MET B O   1 
ATOM   4799  C CB  . MET B  1 226 ? -5.89318  -25.26704  90.70433  1.000 60.11727  ? 206  MET B CB  1 
ATOM   4800  C CG  . MET B  1 226 ? -5.17918  -24.15245  90.09114  1.000 61.02038  ? 206  MET B CG  1 
ATOM   4801  S SD  . MET B  1 226 ? -4.61422  -24.83967  88.57162  1.000 59.88082  ? 206  MET B SD  1 
ATOM   4802  C CE  . MET B  1 226 ? -5.80373  -24.04684  87.52333  1.000 49.96017  ? 206  MET B CE  1 
ATOM   4803  N N   . GLY B  1 227 ? -6.45263  -26.99858  93.66953  1.000 59.75929  ? 207  GLY B N   1 
ATOM   4804  C CA  . GLY B  1 227 ? -7.25198  -28.11348  94.13585  1.000 53.58578  ? 207  GLY B CA  1 
ATOM   4805  C C   . GLY B  1 227 ? -7.48417  -29.15238  93.07055  1.000 50.98107  ? 207  GLY B C   1 
ATOM   4806  O O   . GLY B  1 227 ? -8.47443  -29.88224  93.13441  1.000 51.14548  ? 207  GLY B O   1 
ATOM   4807  N N   . ILE B  1 228 ? -6.60113  -29.21797  92.07499  1.000 53.03403  ? 208  ILE B N   1 
ATOM   4808  C CA  . ILE B  1 228 ? -6.64119  -30.21039  91.00776  1.000 51.22367  ? 208  ILE B CA  1 
ATOM   4809  C C   . ILE B  1 228 ? -5.47997  -31.16819  91.20013  1.000 55.00438  ? 208  ILE B C   1 
ATOM   4810  O O   . ILE B  1 228 ? -4.32534  -30.73465  91.30205  1.000 63.76034  ? 208  ILE B O   1 
ATOM   4811  C CB  . ILE B  1 228 ? -6.56851  -29.55099  89.62252  1.000 52.05595  ? 208  ILE B CB  1 
ATOM   4812  C CG1 . ILE B  1 228 ? -7.88787  -28.84414  89.31079  1.000 51.17890  ? 208  ILE B CG1 1 
ATOM   4813  C CG2 . ILE B  1 228 ? -6.23950  -30.57996  88.56286  1.000 47.06395  ? 208  ILE B CG2 1 
ATOM   4814  C CD1 . ILE B  1 228 ? -7.70684  -27.55168  88.62813  1.000 50.78349  ? 208  ILE B CD1 1 
ATOM   4815  N N   . TYR B  1 229 ? -5.77864  -32.46528  91.23675  1.000 50.96961  ? 209  TYR B N   1 
ATOM   4816  C CA  . TYR B  1 229 ? -4.76935  -33.48664  91.47568  1.000 55.79171  ? 209  TYR B CA  1 
ATOM   4817  C C   . TYR B  1 229 ? -4.87872  -34.59358  90.43849  1.000 60.32288  ? 209  TYR B C   1 
ATOM   4818  O O   . TYR B  1 229 ? -5.98361  -35.01114  90.07528  1.000 62.39591  ? 209  TYR B O   1 
ATOM   4819  C CB  . TYR B  1 229 ? -4.90487  -34.09169  92.87980  1.000 54.57092  ? 209  TYR B CB  1 
ATOM   4820  C CG  . TYR B  1 229 ? -5.16924  -33.08302  93.97115  1.000 53.56415  ? 209  TYR B CG  1 
ATOM   4821  C CD1 . TYR B  1 229 ? -4.24271  -32.08308  94.26360  1.000 60.65447  ? 209  TYR B CD1 1 
ATOM   4822  C CD2 . TYR B  1 229 ? -6.33472  -33.13349  94.71836  1.000 50.13277  ? 209  TYR B CD2 1 
ATOM   4823  C CE1 . TYR B  1 229 ? -4.47908  -31.15029  95.27006  1.000 58.49481  ? 209  TYR B CE1 1 
ATOM   4824  C CE2 . TYR B  1 229 ? -6.57312  -32.22761  95.72018  1.000 51.23143  ? 209  TYR B CE2 1 
ATOM   4825  C CZ  . TYR B  1 229 ? -5.64472  -31.23201  95.99164  1.000 55.59172  ? 209  TYR B CZ  1 
ATOM   4826  O OH  . TYR B  1 229 ? -5.89003  -30.32386  96.98821  1.000 60.36201  ? 209  TYR B OH  1 
ATOM   4827  N N   . VAL B  1 230 ? -3.72140  -35.06542  89.97292  1.000 61.79568  ? 210  VAL B N   1 
ATOM   4828  C CA  . VAL B  1 230 ? -3.61212  -36.21755  89.08307  1.000 55.30729  ? 210  VAL B CA  1 
ATOM   4829  C C   . VAL B  1 230 ? -2.84205  -37.31390  89.80861  1.000 54.14704  ? 210  VAL B C   1 
ATOM   4830  O O   . VAL B  1 230 ? -1.80359  -37.04426  90.42124  1.000 54.49285  ? 210  VAL B O   1 
ATOM   4831  C CB  . VAL B  1 230 ? -2.91226  -35.86463  87.75732  1.000 51.87353  ? 210  VAL B CB  1 
ATOM   4832  C CG1 . VAL B  1 230 ? -2.71191  -37.10773  86.93372  1.000 51.87792  ? 210  VAL B CG1 1 
ATOM   4833  C CG2 . VAL B  1 230 ? -3.72775  -34.86363  86.97265  1.000 50.48204  ? 210  VAL B CG2 1 
ATOM   4834  N N   . PHE B  1 231 ? -3.35805  -38.54215  89.73935  1.000 51.73896  ? 211  PHE B N   1 
ATOM   4835  C CA  . PHE B  1 231 ? -2.70676  -39.73006  90.26932  1.000 53.38191  ? 211  PHE B CA  1 
ATOM   4836  C C   . PHE B  1 231 ? -2.80154  -40.86549  89.25475  1.000 57.07147  ? 211  PHE B C   1 
ATOM   4837  O O   . PHE B  1 231 ? -3.69023  -40.89142  88.39828  1.000 54.00836  ? 211  PHE B O   1 
ATOM   4838  C CB  . PHE B  1 231 ? -3.34391  -40.25512  91.57179  1.000 53.22027  ? 211  PHE B CB  1 
ATOM   4839  C CG  . PHE B  1 231 ? -3.44119  -39.25826  92.68658  1.000 53.54243  ? 211  PHE B CG  1 
ATOM   4840  C CD1 . PHE B  1 231 ? -4.41942  -38.27567  92.67889  1.000 55.39316  ? 211  PHE B CD1 1 
ATOM   4841  C CD2 . PHE B  1 231 ? -2.61330  -39.36143  93.78966  1.000 55.77378  ? 211  PHE B CD2 1 
ATOM   4842  C CE1 . PHE B  1 231 ? -4.54080  -37.38619  93.72623  1.000 55.53036  ? 211  PHE B CE1 1 
ATOM   4843  C CE2 . PHE B  1 231 ? -2.72284  -38.47150  94.84434  1.000 56.21124  ? 211  PHE B CE2 1 
ATOM   4844  C CZ  . PHE B  1 231 ? -3.69065  -37.48047  94.81205  1.000 54.38659  ? 211  PHE B CZ  1 
ATOM   4845  N N   . HIS B  1 232 ? -1.87980  -41.82042  89.37860  1.000 61.47209  ? 212  HIS B N   1 
ATOM   4846  C CA  . HIS B  1 232 ? -2.13917  -43.16698  88.89304  1.000 61.44330  ? 212  HIS B CA  1 
ATOM   4847  C C   . HIS B  1 232 ? -3.21710  -43.79475  89.75963  1.000 61.03970  ? 212  HIS B C   1 
ATOM   4848  O O   . HIS B  1 232 ? -3.11626  -43.78933  90.99027  1.000 62.98197  ? 212  HIS B O   1 
ATOM   4849  C CB  . HIS B  1 232 ? -0.87101  -44.01198  88.93757  1.000 64.15334  ? 212  HIS B CB  1 
ATOM   4850  C CG  . HIS B  1 232 ? 0.06850   -43.72891  87.81440  1.000 64.95946  ? 212  HIS B CG  1 
ATOM   4851  N ND1 . HIS B  1 232 ? 1.01210   -42.72815  87.87155  1.000 66.66700  ? 212  HIS B ND1 1 
ATOM   4852  C CD2 . HIS B  1 232 ? 0.19060   -44.29589  86.59134  1.000 65.66315  ? 212  HIS B CD2 1 
ATOM   4853  C CE1 . HIS B  1 232 ? 1.68588   -42.69876  86.73596  1.000 68.78492  ? 212  HIS B CE1 1 
ATOM   4854  N NE2 . HIS B  1 232 ? 1.20683   -43.63918  85.94162  1.000 67.18700  ? 212  HIS B NE2 1 
ATOM   4855  N N   . THR B  1 233 ? -4.25254  -44.33071  89.11749  1.000 59.07139  ? 213  THR B N   1 
ATOM   4856  C CA  . THR B  1 233 ? -5.41308  -44.80310  89.86125  1.000 60.71883  ? 213  THR B CA  1 
ATOM   4857  C C   . THR B  1 233 ? -5.03222  -45.79401  90.95626  1.000 59.33596  ? 213  THR B C   1 
ATOM   4858  O O   . THR B  1 233 ? -5.55943  -45.73251  92.07345  1.000 58.50367  ? 213  THR B O   1 
ATOM   4859  C CB  . THR B  1 233 ? -6.42345  -45.42164  88.90335  1.000 60.53228  ? 213  THR B CB  1 
ATOM   4860  O OG1 . THR B  1 233 ? -7.00387  -44.37985  88.10366  1.000 63.33211  ? 213  THR B OG1 1 
ATOM   4861  C CG2 . THR B  1 233 ? -7.51697  -46.13486  89.67396  1.000 55.24107  ? 213  THR B CG2 1 
ATOM   4862  N N   . LYS B  1 234 ? -4.09699  -46.69318  90.68215  1.000 61.89061  ? 214  LYS B N   1 
ATOM   4863  C CA  . LYS B  1 234 ? -3.79225  -47.68321  91.70811  1.000 66.28635  ? 214  LYS B CA  1 
ATOM   4864  C C   . LYS B  1 234 ? -3.05335  -47.06479  92.88974  1.000 63.98863  ? 214  LYS B C   1 
ATOM   4865  O O   . LYS B  1 234 ? -3.31441  -47.42360  94.04413  1.000 64.21176  ? 214  LYS B O   1 
ATOM   4866  C CB  . LYS B  1 234 ? -3.00472  -48.84978  91.12115  1.000 71.08625  ? 214  LYS B CB  1 
ATOM   4867  C CG  . LYS B  1 234 ? -3.86565  -49.80254  90.27106  1.000 79.66369  ? 214  LYS B CG  1 
ATOM   4868  C CD  . LYS B  1 234 ? -5.30617  -50.07089  90.80928  1.000 81.03558  ? 214  LYS B CD  1 
ATOM   4869  C CE  . LYS B  1 234 ? -5.40571  -50.49710  92.28920  1.000 79.80372  ? 214  LYS B CE  1 
ATOM   4870  N NZ  . LYS B  1 234 ? -6.67404  -49.99597  92.89866  1.000 72.51727  ? 214  LYS B NZ  1 
ATOM   4871  N N   . PHE B  1 235 ? -2.12147  -46.14979  92.62869  1.000 60.10297  ? 215  PHE B N   1 
ATOM   4872  C CA  . PHE B  1 235 ? -1.49408  -45.42548  93.72798  1.000 64.67163  ? 215  PHE B CA  1 
ATOM   4873  C C   . PHE B  1 235 ? -2.54061  -44.69183  94.56086  1.000 69.39997  ? 215  PHE B C   1 
ATOM   4874  O O   . PHE B  1 235 ? -2.48956  -44.71618  95.79636  1.000 77.86449  ? 215  PHE B O   1 
ATOM   4875  C CB  . PHE B  1 235 ? -0.45080  -44.44999  93.17981  1.000 66.48636  ? 215  PHE B CB  1 
ATOM   4876  C CG  . PHE B  1 235 ? 0.21644   -43.61371  94.22981  1.000 70.18573  ? 215  PHE B CG  1 
ATOM   4877  C CD1 . PHE B  1 235 ? 1.39272   -44.03746  94.82305  1.000 70.44764  ? 215  PHE B CD1 1 
ATOM   4878  C CD2 . PHE B  1 235 ? -0.32518  -42.39184  94.61858  1.000 69.87675  ? 215  PHE B CD2 1 
ATOM   4879  C CE1 . PHE B  1 235 ? 2.01349   -43.26744  95.78935  1.000 69.35442  ? 215  PHE B CE1 1 
ATOM   4880  C CE2 . PHE B  1 235 ? 0.29368   -41.62501  95.58838  1.000 69.85722  ? 215  PHE B CE2 1 
ATOM   4881  C CZ  . PHE B  1 235 ? 1.47134   -42.07017  96.17133  1.000 68.57189  ? 215  PHE B CZ  1 
ATOM   4882  N N   . LEU B  1 236 ? -3.50690  -44.04479  93.89898  1.000 61.67794  ? 216  LEU B N   1 
ATOM   4883  C CA  . LEU B  1 236 ? -4.52706  -43.28785  94.61921  1.000 61.81086  ? 216  LEU B CA  1 
ATOM   4884  C C   . LEU B  1 236 ? -5.39178  -44.19463  95.48508  1.000 62.66774  ? 216  LEU B C   1 
ATOM   4885  O O   . LEU B  1 236 ? -5.73608  -43.83691  96.61586  1.000 62.78438  ? 216  LEU B O   1 
ATOM   4886  C CB  . LEU B  1 236 ? -5.40233  -42.51329  93.63755  1.000 52.10207  ? 216  LEU B CB  1 
ATOM   4887  C CG  . LEU B  1 236 ? -6.51104  -41.67972  94.27794  1.000 56.24740  ? 216  LEU B CG  1 
ATOM   4888  C CD1 . LEU B  1 236 ? -5.97986  -40.88720  95.47353  1.000 56.19026  ? 216  LEU B CD1 1 
ATOM   4889  C CD2 . LEU B  1 236 ? -7.14265  -40.75918  93.25136  1.000 53.18049  ? 216  LEU B CD2 1 
ATOM   4890  N N   . MET B  1 237 ? -5.77181  -45.36517  94.96623  1.000 67.47094  ? 217  MET B N   1 
ATOM   4891  C CA  . MET B  1 237 ? -6.62191  -46.26153  95.74233  1.000 69.01632  ? 217  MET B CA  1 
ATOM   4892  C C   . MET B  1 237 ? -5.92108  -46.68666  97.02701  1.000 73.84892  ? 217  MET B C   1 
ATOM   4893  O O   . MET B  1 237 ? -6.46712  -46.52168  98.12559  1.000 75.54155  ? 217  MET B O   1 
ATOM   4894  C CB  . MET B  1 237 ? -7.02467  -47.47816  94.90038  1.000 65.84080  ? 217  MET B CB  1 
ATOM   4895  C CG  . MET B  1 237 ? -7.90574  -47.14765  93.69731  1.000 63.89731  ? 217  MET B CG  1 
ATOM   4896  S SD  . MET B  1 237 ? -9.39770  -46.21816  94.10436  1.000 63.90661  ? 217  MET B SD  1 
ATOM   4897  C CE  . MET B  1 237 ? -9.00241  -44.59925  93.43906  1.000 62.23521  ? 217  MET B CE  1 
ATOM   4898  N N   . GLU B  1 238 ? -4.69293  -47.21484  96.90422  1.000 75.13034  ? 218  GLU B N   1 
ATOM   4899  C CA  . GLU B  1 238 ? -3.88755  -47.55126  98.07656  1.000 74.08340  ? 218  GLU B CA  1 
ATOM   4900  C C   . GLU B  1 238 ? -3.73981  -46.35292  99.00317  1.000 74.97600  ? 218  GLU B C   1 
ATOM   4901  O O   . GLU B  1 238 ? -3.85490  -46.49151  100.22536 1.000 79.74710  ? 218  GLU B O   1 
ATOM   4902  C CB  . GLU B  1 238 ? -2.51229  -48.06951  97.64595  1.000 74.28063  ? 218  GLU B CB  1 
ATOM   4903  N N   . ALA B  1 239 ? -3.50860  -45.16158  98.43625  1.000 69.68365  ? 219  ALA B N   1 
ATOM   4904  C CA  . ALA B  1 239 ? -3.41394  -43.95585  99.25327  1.000 72.32387  ? 219  ALA B CA  1 
ATOM   4905  C C   . ALA B  1 239 ? -4.69521  -43.71771  100.03757 1.000 73.69061  ? 219  ALA B C   1 
ATOM   4906  O O   . ALA B  1 239 ? -4.65059  -43.41738  101.23480 1.000 74.21582  ? 219  ALA B O   1 
ATOM   4907  C CB  . ALA B  1 239 ? -3.10174  -42.74092  98.37910  1.000 74.02729  ? 219  ALA B CB  1 
ATOM   4908  N N   . LEU B  1 240 ? -5.85042  -43.84537  99.37870  1.000 75.10003  ? 220  LEU B N   1 
ATOM   4909  C CA  . LEU B  1 240 ? -7.11600  -43.63497  100.07283 1.000 70.87842  ? 220  LEU B CA  1 
ATOM   4910  C C   . LEU B  1 240 ? -7.32782  -44.66498  101.17391 1.000 74.64658  ? 220  LEU B C   1 
ATOM   4911  O O   . LEU B  1 240 ? -7.94688  -44.35838  102.19716 1.000 77.80543  ? 220  LEU B O   1 
ATOM   4912  C CB  . LEU B  1 240 ? -8.27431  -43.67607  99.08078  1.000 60.31218  ? 220  LEU B CB  1 
ATOM   4913  C CG  . LEU B  1 240 ? -8.33270  -42.54664  98.06289  1.000 59.40005  ? 220  LEU B CG  1 
ATOM   4914  C CD1 . LEU B  1 240 ? -9.50512  -42.75298  97.13986  1.000 57.30115  ? 220  LEU B CD1 1 
ATOM   4915  C CD2 . LEU B  1 240 ? -8.45383  -41.20722  98.77991  1.000 62.85693  ? 220  LEU B CD2 1 
ATOM   4916  N N   . ARG B  1 241 ? -6.82550  -45.88654  100.98487 1.000 76.89063  ? 221  ARG B N   1 
ATOM   4917  C CA  . ARG B  1 241 ? -6.94136  -46.90601  102.02330 1.000 77.12196  ? 221  ARG B CA  1 
ATOM   4918  C C   . ARG B  1 241 ? -5.98362  -46.64206  103.18140 1.000 79.99414  ? 221  ARG B C   1 
ATOM   4919  O O   . ARG B  1 241 ? -6.32761  -46.92420  104.33404 1.000 77.99886  ? 221  ARG B O   1 
ATOM   4920  C CB  . ARG B  1 241 ? -6.70184  -48.29395  101.42205 1.000 69.25932  ? 221  ARG B CB  1 
ATOM   4921  C CG  . ARG B  1 241 ? -7.82960  -48.77858  100.52410 1.000 67.10610  ? 221  ARG B CG  1 
ATOM   4922  C CD  . ARG B  1 241 ? -7.64605  -50.23223  100.12836 1.000 75.08370  ? 221  ARG B CD  1 
ATOM   4923  N NE  . ARG B  1 241 ? -8.76964  -50.73689  99.34249  1.000 79.84548  ? 221  ARG B NE  1 
ATOM   4924  C CZ  . ARG B  1 241 ? -8.82724  -50.69913  98.01424  1.000 81.06295  ? 221  ARG B CZ  1 
ATOM   4925  N NH1 . ARG B  1 241 ? -7.82553  -50.17808  97.32365  1.000 84.28462  ? 221  ARG B NH1 1 
ATOM   4926  N NH2 . ARG B  1 241 ? -9.88232  -51.18159  97.37257  1.000 76.67059  ? 221  ARG B NH2 1 
ATOM   4927  N N   . ARG B  1 242 ? -4.78342  -46.11727  102.88980 1.000 83.04577  ? 222  ARG B N   1 
ATOM   4928  C CA  . ARG B  1 242 ? -3.88346  -45.63583  103.93864 1.000 83.71635  ? 222  ARG B CA  1 
ATOM   4929  C C   . ARG B  1 242 ? -4.55600  -44.57013  104.79087 1.000 79.08248  ? 222  ARG B C   1 
ATOM   4930  O O   . ARG B  1 242 ? -4.41383  -44.55620  106.01975 1.000 81.58526  ? 222  ARG B O   1 
ATOM   4931  C CB  . ARG B  1 242 ? -2.60820  -45.04125  103.32830 1.000 88.08900  ? 222  ARG B CB  1 
ATOM   4932  C CG  . ARG B  1 242 ? -1.65950  -45.98357  102.59773 1.000 94.88132  ? 222  ARG B CG  1 
ATOM   4933  C CD  . ARG B  1 242 ? -0.33485  -45.24754  102.30051 1.000 102.04407 ? 222  ARG B CD  1 
ATOM   4934  N NE  . ARG B  1 242 ? 0.08763   -45.34464  100.89765 1.000 104.67949 ? 222  ARG B NE  1 
ATOM   4935  C CZ  . ARG B  1 242 ? 0.62653   -44.34556  100.19485 1.000 102.71210 ? 222  ARG B CZ  1 
ATOM   4936  N NH1 . ARG B  1 242 ? 0.81080   -43.14908  100.75164 1.000 97.70035  ? 222  ARG B NH1 1 
ATOM   4937  N NH2 . ARG B  1 242 ? 0.97725   -44.54403  98.92682  1.000 101.71044 ? 222  ARG B NH2 1 
ATOM   4938  N N   . ASP B  1 243 ? -5.26950  -43.64844  104.14616 1.000 74.64676  ? 223  ASP B N   1 
ATOM   4939  C CA  . ASP B  1 243 ? -5.81828  -42.49894  104.85519 1.000 71.83872  ? 223  ASP B CA  1 
ATOM   4940  C C   . ASP B  1 243 ? -6.97823  -42.90692  105.74847 1.000 74.73894  ? 223  ASP B C   1 
ATOM   4941  O O   . ASP B  1 243 ? -7.06390  -42.47041  106.90116 1.000 80.76534  ? 223  ASP B O   1 
ATOM   4942  C CB  . ASP B  1 243 ? -6.25558  -41.43093  103.85564 1.000 66.40429  ? 223  ASP B CB  1 
ATOM   4943  C CG  . ASP B  1 243 ? -6.71706  -40.14841  104.53351 1.000 75.45662  ? 223  ASP B CG  1 
ATOM   4944  O OD1 . ASP B  1 243 ? -5.85071  -39.30758  104.87381 1.000 78.25016  ? 223  ASP B OD1 1 
ATOM   4945  O OD2 . ASP B  1 243 ? -7.94393  -39.97864  104.72248 1.000 75.21142  ? 223  ASP B OD2 1 
ATOM   4946  N N   . ALA B  1 244 ? -7.87982  -43.74217  105.23561 1.000 71.91262  ? 224  ALA B N   1 
ATOM   4947  C CA  . ALA B  1 244 ? -9.04219  -44.13872  106.01877 1.000 74.28237  ? 224  ALA B CA  1 
ATOM   4948  C C   . ALA B  1 244 ? -8.62603  -44.81996  107.31538 1.000 81.86868  ? 224  ALA B C   1 
ATOM   4949  O O   . ALA B  1 244 ? -9.19964  -44.54823  108.37648 1.000 88.39770  ? 224  ALA B O   1 
ATOM   4950  C CB  . ALA B  1 244 ? -9.94658  -45.05525  105.19331 1.000 73.87460  ? 224  ALA B CB  1 
ATOM   4951  N N   . ALA B  1 245 ? -7.61485  -45.68736  107.25727 1.000 80.53763  ? 225  ALA B N   1 
ATOM   4952  C CA  . ALA B  1 245 ? -7.17839  -46.44093  108.42511 1.000 83.38775  ? 225  ALA B CA  1 
ATOM   4953  C C   . ALA B  1 245 ? -6.37488  -45.61008  109.41454 1.000 90.13761  ? 225  ALA B C   1 
ATOM   4954  O O   . ALA B  1 245 ? -5.93496  -46.15689  110.43295 1.000 97.89534  ? 225  ALA B O   1 
ATOM   4955  C CB  . ALA B  1 245 ? -6.34894  -47.64834  107.99117 1.000 84.97991  ? 225  ALA B CB  1 
ATOM   4956  N N   . ASP B  1 246 ? -6.17131  -44.32006  109.14588 1.000 87.84515  ? 226  ASP B N   1 
ATOM   4957  C CA  . ASP B  1 246 ? -5.41676  -43.43840  110.03093 1.000 90.32383  ? 226  ASP B CA  1 
ATOM   4958  C C   . ASP B  1 246 ? -6.36481  -42.52184  110.78796 1.000 89.90278  ? 226  ASP B C   1 
ATOM   4959  O O   . ASP B  1 246 ? -6.98369  -41.63315  110.17687 1.000 88.25377  ? 226  ASP B O   1 
ATOM   4960  C CB  . ASP B  1 246 ? -4.40968  -42.60699  109.23630 1.000 93.57201  ? 226  ASP B CB  1 
ATOM   4961  C CG  . ASP B  1 246 ? -3.76280  -41.52206  110.07389 1.000 98.12731  ? 226  ASP B CG  1 
ATOM   4962  O OD1 . ASP B  1 246 ? -3.62738  -41.71906  111.29982 1.000 101.80354 ? 226  ASP B OD1 1 
ATOM   4963  O OD2 . ASP B  1 246 ? -3.41407  -40.46246  109.51052 1.000 98.92945  ? 226  ASP B OD2 1 
ATOM   4964  N N   . PRO B  1 247 ? -6.49853  -42.67327  112.10494 1.000 88.18152  ? 227  PRO B N   1 
ATOM   4965  C CA  . PRO B  1 247 ? -7.38454  -41.77083  112.84857 1.000 86.46415  ? 227  PRO B CA  1 
ATOM   4966  C C   . PRO B  1 247 ? -6.85194  -40.35762  112.95208 1.000 88.52487  ? 227  PRO B C   1 
ATOM   4967  O O   . PRO B  1 247 ? -7.63889  -39.44661  113.22533 1.000 92.92029  ? 227  PRO B O   1 
ATOM   4968  C CB  . PRO B  1 247 ? -7.49047  -42.43826  114.22526 1.000 91.11544  ? 227  PRO B CB  1 
ATOM   4969  C CG  . PRO B  1 247 ? -7.00253  -43.85853  114.01387 1.000 89.29777  ? 227  PRO B CG  1 
ATOM   4970  C CD  . PRO B  1 247 ? -5.96332  -43.74671  112.95381 1.000 87.99895  ? 227  PRO B CD  1 
ATOM   4971  N N   . THR B  1 248 ? -5.55090  -40.13762  112.73791 1.000 91.14704  ? 228  THR B N   1 
ATOM   4972  C CA  . THR B  1 248 ? -5.01723  -38.77545  112.74689 1.000 93.54895  ? 228  THR B CA  1 
ATOM   4973  C C   . THR B  1 248 ? -5.63118  -37.92447  111.63853 1.000 89.32662  ? 228  THR B C   1 
ATOM   4974  O O   . THR B  1 248 ? -5.79461  -36.70944  111.79718 1.000 86.48694  ? 228  THR B O   1 
ATOM   4975  C CB  . THR B  1 248 ? -3.49289  -38.81333  112.59829 1.000 95.15905  ? 228  THR B CB  1 
ATOM   4976  O OG1 . THR B  1 248 ? -2.90480  -39.31176  113.80651 1.000 99.02962  ? 228  THR B OG1 1 
ATOM   4977  C CG2 . THR B  1 248 ? -2.92714  -37.42249  112.29363 1.000 94.39097  ? 228  THR B CG2 1 
ATOM   4978  N N   . SER B  1 249 ? -6.00093  -38.54930  110.52704 1.000 88.51238  ? 229  SER B N   1 
ATOM   4979  C CA  . SER B  1 249 ? -6.36469  -37.82069  109.32373 1.000 85.49235  ? 229  SER B CA  1 
ATOM   4980  C C   . SER B  1 249 ? -7.76059  -37.21643  109.42748 1.000 81.74844  ? 229  SER B C   1 
ATOM   4981  O O   . SER B  1 249 ? -8.69089  -37.83938  109.94729 1.000 83.58770  ? 229  SER B O   1 
ATOM   4982  C CB  . SER B  1 249 ? -6.28934  -38.75716  108.11790 1.000 83.52722  ? 229  SER B CB  1 
ATOM   4983  O OG  . SER B  1 249 ? -7.00294  -38.23314  107.01191 1.000 83.91204  ? 229  SER B OG  1 
ATOM   4984  N N   . SER B  1 250 ? -7.90861  -35.99865  108.90990 1.000 77.34272  ? 230  SER B N   1 
ATOM   4985  C CA  . SER B  1 250 ? -9.22786  -35.41983  108.70420 1.000 79.16896  ? 230  SER B CA  1 
ATOM   4986  C C   . SER B  1 250 ? -9.80788  -35.79299  107.33901 1.000 74.02227  ? 230  SER B C   1 
ATOM   4987  O O   . SER B  1 250 ? -10.69094 -35.09057  106.83079 1.000 67.87490  ? 230  SER B O   1 
ATOM   4988  C CB  . SER B  1 250 ? -9.19107  -33.89157  108.88405 1.000 82.61650  ? 230  SER B CB  1 
ATOM   4989  O OG  . SER B  1 250 ? -8.22914  -33.26527  108.04791 1.000 85.43241  ? 230  SER B OG  1 
ATOM   4990  N N   . ARG B  1 251 ? -9.31823  -36.88111  106.73899 1.000 76.89939  ? 231  ARG B N   1 
ATOM   4991  C CA  . ARG B  1 251 ? -9.89240  -37.44763  105.51797 1.000 76.24020  ? 231  ARG B CA  1 
ATOM   4992  C C   . ARG B  1 251 ? -9.92992  -36.42625  104.37992 1.000 75.23890  ? 231  ARG B C   1 
ATOM   4993  O O   . ARG B  1 251 ? -10.84604 -36.42705  103.55807 1.000 76.53515  ? 231  ARG B O   1 
ATOM   4994  C CB  . ARG B  1 251 ? -11.29397 -38.01542  105.78158 1.000 73.60283  ? 231  ARG B CB  1 
ATOM   4995  C CG  . ARG B  1 251 ? -11.46410 -38.77964  107.10815 1.000 72.15018  ? 231  ARG B CG  1 
ATOM   4996  C CD  . ARG B  1 251 ? -10.58765 -40.01805  107.20057 1.000 70.98850  ? 231  ARG B CD  1 
ATOM   4997  N NE  . ARG B  1 251 ? -10.42149 -40.69271  105.91468 1.000 70.58951  ? 231  ARG B NE  1 
ATOM   4998  C CZ  . ARG B  1 251 ? -11.33546 -41.47550  105.34182 1.000 69.41734  ? 231  ARG B CZ  1 
ATOM   4999  N NH1 . ARG B  1 251 ? -12.50232 -41.69792  105.94157 1.000 70.84009  ? 231  ARG B NH1 1 
ATOM   5000  N NH2 . ARG B  1 251 ? -11.07441 -42.04846  104.16927 1.000 62.37762  ? 231  ARG B NH2 1 
ATOM   5001  N N   . ASP B  1 252 ? -8.92398  -35.55363  104.31570 1.000 73.56401  ? 232  ASP B N   1 
ATOM   5002  C CA  . ASP B  1 252 ? -8.91918  -34.45293  103.36097 1.000 72.86738  ? 232  ASP B CA  1 
ATOM   5003  C C   . ASP B  1 252 ? -7.73524  -34.54246  102.40684 1.000 72.36047  ? 232  ASP B C   1 
ATOM   5004  O O   . ASP B  1 252 ? -6.63378  -34.94476  102.79294 1.000 79.13631  ? 232  ASP B O   1 
ATOM   5005  C CB  . ASP B  1 252 ? -8.89435  -33.09930  104.07447 1.000 80.29846  ? 232  ASP B CB  1 
ATOM   5006  C CG  . ASP B  1 252 ? -9.78801  -32.08752  103.40352 1.000 86.71229  ? 232  ASP B CG  1 
ATOM   5007  O OD1 . ASP B  1 252 ? -10.97108 -32.43072  103.17204 1.000 88.69923  ? 232  ASP B OD1 1 
ATOM   5008  O OD2 . ASP B  1 252 ? -9.31722  -30.97131  103.08549 1.000 89.27286  ? 232  ASP B OD2 1 
ATOM   5009  N N   . PHE B  1 253 ? -7.97314  -34.14870  101.15604 1.000 65.80971  ? 233  PHE B N   1 
ATOM   5010  C CA  . PHE B  1 253 ? -6.91410  -34.16265  100.15641 1.000 63.28671  ? 233  PHE B CA  1 
ATOM   5011  C C   . PHE B  1 253 ? -5.81857  -33.16635  100.49292 1.000 67.11025  ? 233  PHE B C   1 
ATOM   5012  O O   . PHE B  1 253 ? -4.63265  -33.51381  100.48322 1.000 69.96581  ? 233  PHE B O   1 
ATOM   5013  C CB  . PHE B  1 253 ? -7.49467  -33.87500  98.77497  1.000 60.20685  ? 233  PHE B CB  1 
ATOM   5014  C CG  . PHE B  1 253 ? -7.72140  -35.11736  97.95222  1.000 60.30155  ? 233  PHE B CG  1 
ATOM   5015  C CD1 . PHE B  1 253 ? -9.00448  -35.58359  97.71416  1.000 57.70022  ? 233  PHE B CD1 1 
ATOM   5016  C CD2 . PHE B  1 253 ? -6.64636  -35.83572  97.44873  1.000 57.91877  ? 233  PHE B CD2 1 
ATOM   5017  C CE1 . PHE B  1 253 ? -9.21224  -36.72626  96.97040  1.000 56.36768  ? 233  PHE B CE1 1 
ATOM   5018  C CE2 . PHE B  1 253 ? -6.85104  -36.97735  96.70072  1.000 59.48199  ? 233  PHE B CE2 1 
ATOM   5019  C CZ  . PHE B  1 253 ? -8.13608  -37.42541  96.46148  1.000 57.79644  ? 233  PHE B CZ  1 
ATOM   5020  N N   . GLY B  1 254 ? -6.20030  -31.92160  100.79605 1.000 70.69298  ? 234  GLY B N   1 
ATOM   5021  C CA  . GLY B  1 254 ? -5.26687  -30.83735  101.04294 1.000 71.75131  ? 234  GLY B CA  1 
ATOM   5022  C C   . GLY B  1 254 ? -4.57811  -30.95170  102.38380 1.000 75.42652  ? 234  GLY B C   1 
ATOM   5023  O O   . GLY B  1 254 ? -3.36812  -30.73264  102.49228 1.000 79.44773  ? 234  GLY B O   1 
ATOM   5024  N N   . LYS B  1 255 ? -5.34160  -31.32197  103.41299 1.000 74.08168  ? 235  LYS B N   1 
ATOM   5025  C CA  . LYS B  1 255 ? -4.78890  -31.39954  104.75981 1.000 78.38634  ? 235  LYS B CA  1 
ATOM   5026  C C   . LYS B  1 255 ? -3.91051  -32.62200  104.97418 1.000 83.31452  ? 235  LYS B C   1 
ATOM   5027  O O   . LYS B  1 255 ? -2.92409  -32.54024  105.71432 1.000 89.71075  ? 235  LYS B O   1 
ATOM   5028  C CB  . LYS B  1 255 ? -5.90897  -31.39135  105.80692 1.000 80.40993  ? 235  LYS B CB  1 
ATOM   5029  C CG  . LYS B  1 255 ? -6.47664  -30.00149  106.09064 1.000 87.24222  ? 235  LYS B CG  1 
ATOM   5030  C CD  . LYS B  1 255 ? -7.81926  -29.81658  105.40162 1.000 87.52735  ? 235  LYS B CD  1 
ATOM   5031  C CE  . LYS B  1 255 ? -8.21273  -28.34884  105.23396 1.000 87.54888  ? 235  LYS B CE  1 
ATOM   5032  N NZ  . LYS B  1 255 ? -7.19151  -27.55044  104.49475 1.000 87.03677  ? 235  LYS B NZ  1 
ATOM   5033  N N   . ASP B  1 256 ? -4.23478  -33.75628  104.35559 1.000 83.20136  ? 236  ASP B N   1 
ATOM   5034  C CA  . ASP B  1 256 ? -3.63756  -35.02348  104.76557 1.000 86.14955  ? 236  ASP B CA  1 
ATOM   5035  C C   . ASP B  1 256 ? -2.86313  -35.70416  103.64447 1.000 84.62603  ? 236  ASP B C   1 
ATOM   5036  O O   . ASP B  1 256 ? -1.64969  -35.90836  103.77712 1.000 88.84269  ? 236  ASP B O   1 
ATOM   5037  C CB  . ASP B  1 256 ? -4.74096  -35.93812  105.32268 1.000 86.59865  ? 236  ASP B CB  1 
ATOM   5038  C CG  . ASP B  1 256 ? -5.58333  -35.24766  106.40528 1.000 88.52332  ? 236  ASP B CG  1 
ATOM   5039  O OD1 . ASP B  1 256 ? -5.02417  -34.42696  107.17507 1.000 89.66745  ? 236  ASP B OD1 1 
ATOM   5040  O OD2 . ASP B  1 256 ? -6.80552  -35.50777  106.47492 1.000 85.93735  ? 236  ASP B OD2 1 
ATOM   5041  N N   . ILE B  1 257 ? -3.51439  -36.05137  102.53615 1.000 77.40395  ? 237  ILE B N   1 
ATOM   5042  C CA  . ILE B  1 257 ? -2.85720  -36.89473  101.54710 1.000 75.61074  ? 237  ILE B CA  1 
ATOM   5043  C C   . ILE B  1 257 ? -1.78713  -36.11674  100.78671 1.000 75.24604  ? 237  ILE B C   1 
ATOM   5044  O O   . ILE B  1 257 ? -0.67692  -36.61467  100.58036 1.000 78.31483  ? 237  ILE B O   1 
ATOM   5045  C CB  . ILE B  1 257 ? -3.89442  -37.52028  100.60173 1.000 73.03844  ? 237  ILE B CB  1 
ATOM   5046  C CG1 . ILE B  1 257 ? -4.96066  -38.25689  101.42033 1.000 72.12850  ? 237  ILE B CG1 1 
ATOM   5047  C CG2 . ILE B  1 257 ? -3.20765  -38.46549  99.63598  1.000 70.83717  ? 237  ILE B CG2 1 
ATOM   5048  C CD1 . ILE B  1 257 ? -5.77202  -39.26384  100.62150 1.000 68.42645  ? 237  ILE B CD1 1 
ATOM   5049  N N   . ILE B  1 258 ? -2.09339  -34.89162  100.35311 1.000 72.03795  ? 238  ILE B N   1 
ATOM   5050  C CA  . ILE B  1 258 ? -1.11225  -34.12117  99.58106  1.000 75.53791  ? 238  ILE B CA  1 
ATOM   5051  C C   . ILE B  1 258 ? 0.17488   -33.86708  100.36049 1.000 83.14303  ? 238  ILE B C   1 
ATOM   5052  O O   . ILE B  1 258 ? 1.26324   -34.09605  99.80560  1.000 88.90579  ? 238  ILE B O   1 
ATOM   5053  C CB  . ILE B  1 258 ? -1.74832  -32.82251  99.05580  1.000 74.85206  ? 238  ILE B CB  1 
ATOM   5054  C CG1 . ILE B  1 258 ? -2.76059  -33.14462  97.95603  1.000 76.01734  ? 238  ILE B CG1 1 
ATOM   5055  C CG2 . ILE B  1 258 ? -0.66850  -31.89737  98.52772  1.000 70.91529  ? 238  ILE B CG2 1 
ATOM   5056  C CD1 . ILE B  1 258 ? -2.12942  -33.74424  96.72013  1.000 77.12923  ? 238  ILE B CD1 1 
ATOM   5057  N N   . PRO B  1 259 ? 0.14213   -33.40719  101.61447 1.000 84.31321  ? 239  PRO B N   1 
ATOM   5058  C CA  . PRO B  1 259 ? 1.42132   -33.18020  102.31238 1.000 82.74536  ? 239  PRO B CA  1 
ATOM   5059  C C   . PRO B  1 259 ? 2.18560   -34.46494  102.58539 1.000 84.39832  ? 239  PRO B C   1 
ATOM   5060  O O   . PRO B  1 259 ? 3.42405   -34.46861  102.54084 1.000 82.86247  ? 239  PRO B O   1 
ATOM   5061  C CB  . PRO B  1 259 ? 0.98871   -32.48175  103.60871 1.000 80.59482  ? 239  PRO B CB  1 
ATOM   5062  C CG  . PRO B  1 259 ? -0.36137  -31.93094  103.31804 1.000 78.66549  ? 239  PRO B CG  1 
ATOM   5063  C CD  . PRO B  1 259 ? -0.99853  -32.93558  102.41835 1.000 82.37098  ? 239  PRO B CD  1 
ATOM   5064  N N   . TYR B  1 260 ? 1.47136   -35.55488  102.88202 1.000 84.54556  ? 240  TYR B N   1 
ATOM   5065  C CA  . TYR B  1 260 ? 2.09966   -36.86422  103.03827 1.000 83.51752  ? 240  TYR B CA  1 
ATOM   5066  C C   . TYR B  1 260 ? 3.05166   -37.14218  101.88275 1.000 78.69244  ? 240  TYR B C   1 
ATOM   5067  O O   . TYR B  1 260 ? 4.20186   -37.55062  102.08635 1.000 81.79509  ? 240  TYR B O   1 
ATOM   5068  C CB  . TYR B  1 260 ? 0.99691   -37.93556  103.13327 1.000 87.51626  ? 240  TYR B CB  1 
ATOM   5069  C CG  . TYR B  1 260 ? 1.39442   -39.36899  103.52716 1.000 95.27872  ? 240  TYR B CG  1 
ATOM   5070  C CD1 . TYR B  1 260 ? 2.66024   -39.88729  103.25847 1.000 99.04844  ? 240  TYR B CD1 1 
ATOM   5071  C CD2 . TYR B  1 260 ? 0.48323   -40.20068  104.18336 1.000 96.25931  ? 240  TYR B CD2 1 
ATOM   5072  C CE1 . TYR B  1 260 ? 3.00078   -41.19377  103.61982 1.000 100.63675 ? 240  TYR B CE1 1 
ATOM   5073  C CE2 . TYR B  1 260 ? 0.82040   -41.50270  104.55085 1.000 98.50721  ? 240  TYR B CE2 1 
ATOM   5074  C CZ  . TYR B  1 260 ? 2.08225   -41.98916  104.26766 1.000 100.15812 ? 240  TYR B CZ  1 
ATOM   5075  O OH  . TYR B  1 260 ? 2.42228   -43.27010  104.62903 1.000 101.04856 ? 240  TYR B OH  1 
ATOM   5076  N N   . ILE B  1 261 ? 2.59624   -36.88289  100.65918 1.000 73.71504  ? 241  ILE B N   1 
ATOM   5077  C CA  . ILE B  1 261 ? 3.33288   -37.32438  99.48138  1.000 75.41151  ? 241  ILE B CA  1 
ATOM   5078  C C   . ILE B  1 261 ? 4.50731   -36.40086  99.17901  1.000 81.84139  ? 241  ILE B C   1 
ATOM   5079  O O   . ILE B  1 261 ? 5.57359   -36.86884  98.77107  1.000 87.79334  ? 241  ILE B O   1 
ATOM   5080  C CB  . ILE B  1 261 ? 2.38560   -37.45546  98.27479  1.000 70.84663  ? 241  ILE B CB  1 
ATOM   5081  C CG1 . ILE B  1 261 ? 1.24768   -38.42528  98.59471  1.000 68.53978  ? 241  ILE B CG1 1 
ATOM   5082  C CG2 . ILE B  1 261 ? 3.15324   -37.89134  97.03515  1.000 71.21351  ? 241  ILE B CG2 1 
ATOM   5083  C CD1 . ILE B  1 261 ? 0.16372   -38.40629  97.57841  1.000 65.21083  ? 241  ILE B CD1 1 
ATOM   5084  N N   . VAL B  1 262 ? 4.34114   -35.08336  99.35007  1.000 82.02519  ? 242  VAL B N   1 
ATOM   5085  C CA  . VAL B  1 262 ? 5.45611   -34.17398  99.08854  1.000 81.56728  ? 242  VAL B CA  1 
ATOM   5086  C C   . VAL B  1 262 ? 6.64006   -34.54125  99.96188  1.000 87.83773  ? 242  VAL B C   1 
ATOM   5087  O O   . VAL B  1 262 ? 7.79009   -34.56192  99.50663  1.000 92.08140  ? 242  VAL B O   1 
ATOM   5088  C CB  . VAL B  1 262 ? 5.04535   -32.71503  99.32588  1.000 76.63393  ? 242  VAL B CB  1 
ATOM   5089  C CG1 . VAL B  1 262 ? 6.28614   -31.86440  99.57906  1.000 77.34867  ? 242  VAL B CG1 1 
ATOM   5090  C CG2 . VAL B  1 262 ? 4.29043   -32.19483  98.17320  1.000 73.10215  ? 242  VAL B CG2 1 
ATOM   5091  N N   . GLU B  1 263 ? 6.36719   -34.83372  101.23421 1.000 90.03699  ? 243  GLU B N   1 
ATOM   5092  C CA  . GLU B  1 263 ? 7.42083   -35.20763  102.16895 1.000 95.93859  ? 243  GLU B CA  1 
ATOM   5093  C C   . GLU B  1 263 ? 7.99665   -36.58033  101.83395 1.000 99.30093  ? 243  GLU B C   1 
ATOM   5094  O O   . GLU B  1 263 ? 9.20970   -36.72137  101.64273 1.000 100.78264 ? 243  GLU B O   1 
ATOM   5095  C CB  . GLU B  1 263 ? 6.88780   -35.18269  103.60641 1.000 97.37996  ? 243  GLU B CB  1 
ATOM   5096  C CG  . GLU B  1 263 ? 7.96159   -35.43843  104.66453 1.000 103.13311 ? 243  GLU B CG  1 
ATOM   5097  C CD  . GLU B  1 263 ? 7.75470   -34.62747  105.93380 1.000 108.39521 ? 243  GLU B CD  1 
ATOM   5098  O OE1 . GLU B  1 263 ? 8.13268   -35.10452  107.02885 1.000 112.31169 ? 243  GLU B OE1 1 
ATOM   5099  O OE2 . GLU B  1 263 ? 7.21832   -33.50320  105.83477 1.000 107.89783 ? 243  GLU B OE2 1 
ATOM   5100  N N   . HIS B  1 264 ? 7.14091   -37.60408  101.73088 1.000 98.98311  ? 244  HIS B N   1 
ATOM   5101  C CA  . HIS B  1 264 ? 7.63952   -38.97075  101.59445 1.000 99.48848  ? 244  HIS B CA  1 
ATOM   5102  C C   . HIS B  1 264 ? 7.74666   -39.43648  100.14766 1.000 92.76282  ? 244  HIS B C   1 
ATOM   5103  O O   . HIS B  1 264 ? 8.58168   -40.29846  99.84870  1.000 92.72090  ? 244  HIS B O   1 
ATOM   5104  C CB  . HIS B  1 264 ? 6.75393   -39.95388  102.37332 1.000 103.02786 ? 244  HIS B CB  1 
ATOM   5105  C CG  . HIS B  1 264 ? 6.44371   -39.51881  103.77576 1.000 110.56567 ? 244  HIS B CG  1 
ATOM   5106  N ND1 . HIS B  1 264 ? 7.11314   -38.49392  104.41060 1.000 113.40101 ? 244  HIS B ND1 1 
ATOM   5107  C CD2 . HIS B  1 264 ? 5.53132   -39.97301  104.66635 1.000 111.23159 ? 244  HIS B CD2 1 
ATOM   5108  C CE1 . HIS B  1 264 ? 6.61942   -38.32961  105.62558 1.000 113.38411 ? 244  HIS B CE1 1 
ATOM   5109  N NE2 . HIS B  1 264 ? 5.65880   -39.21638  105.80643 1.000 113.05279 ? 244  HIS B NE2 1 
ATOM   5110  N N   . GLY B  1 265 ? 6.92584   -38.90358  99.24500  1.000 87.70918  ? 245  GLY B N   1 
ATOM   5111  C CA  . GLY B  1 265 ? 6.97778   -39.32272  97.85603  1.000 86.79642  ? 245  GLY B CA  1 
ATOM   5112  C C   . GLY B  1 265 ? 7.42609   -38.20659  96.93919  1.000 86.10425  ? 245  GLY B C   1 
ATOM   5113  O O   . GLY B  1 265 ? 8.16202   -37.30993  97.36182  1.000 86.39547  ? 245  GLY B O   1 
ATOM   5114  N N   . LYS B  1 266 ? 6.98874   -38.23704  95.68554  1.000 84.68046  ? 246  LYS B N   1 
ATOM   5115  C CA  . LYS B  1 266 ? 7.31360   -37.18692  94.72863  1.000 85.17385  ? 246  LYS B CA  1 
ATOM   5116  C C   . LYS B  1 266 ? 6.04345   -36.45155  94.32037  1.000 81.56263  ? 246  LYS B C   1 
ATOM   5117  O O   . LYS B  1 266 ? 5.09114   -37.06965  93.82976  1.000 77.61125  ? 246  LYS B O   1 
ATOM   5118  C CB  . LYS B  1 266 ? 8.01088   -37.75267  93.49179  1.000 84.98868  ? 246  LYS B CB  1 
ATOM   5119  C CG  . LYS B  1 266 ? 8.17622   -36.70918  92.38889  1.000 85.09200  ? 246  LYS B CG  1 
ATOM   5120  C CD  . LYS B  1 266 ? 9.22540   -37.09182  91.35197  1.000 84.28984  ? 246  LYS B CD  1 
ATOM   5121  C CE  . LYS B  1 266 ? 9.90376   -35.83995  90.79015  1.000 82.43524  ? 246  LYS B CE  1 
ATOM   5122  N NZ  . LYS B  1 266 ? 10.51562  -36.05833  89.45153  1.000 80.95846  ? 246  LYS B NZ  1 
ATOM   5123  N N   . ALA B  1 267 ? 6.03969   -35.13547  94.50003  1.000 81.99279  ? 247  ALA B N   1 
ATOM   5124  C CA  . ALA B  1 267 ? 4.97230   -34.28662  93.99117  1.000 75.16193  ? 247  ALA B CA  1 
ATOM   5125  C C   . ALA B  1 267 ? 5.54430   -33.21441  93.08477  1.000 74.20668  ? 247  ALA B C   1 
ATOM   5126  O O   . ALA B  1 267 ? 6.57420   -32.60470  93.39304  1.000 77.29189  ? 247  ALA B O   1 
ATOM   5127  C CB  . ALA B  1 267 ? 4.18048   -33.62023  95.10368  1.000 69.46423  ? 247  ALA B CB  1 
ATOM   5128  N N   . VAL B  1 268 ? 4.83196   -32.95599  91.99723  1.000 69.11627  ? 248  VAL B N   1 
ATOM   5129  C CA  . VAL B  1 268 ? 5.30649   -32.10367  90.92280  1.000 73.76577  ? 248  VAL B CA  1 
ATOM   5130  C C   . VAL B  1 268 ? 4.19450   -31.12869  90.56560  1.000 72.06460  ? 248  VAL B C   1 
ATOM   5131  O O   . VAL B  1 268 ? 3.00838   -31.47612  90.59562  1.000 76.69760  ? 248  VAL B O   1 
ATOM   5132  C CB  . VAL B  1 268 ? 5.74728   -32.94430  89.70501  1.000 77.33717  ? 248  VAL B CB  1 
ATOM   5133  C CG1 . VAL B  1 268 ? 6.11764   -32.05225  88.54755  1.000 80.12821  ? 248  VAL B CG1 1 
ATOM   5134  C CG2 . VAL B  1 268 ? 6.93573   -33.83027  90.07921  1.000 79.96354  ? 248  VAL B CG2 1 
ATOM   5135  N N   . ALA B  1 269 ? 4.57763   -29.89980  90.26587  1.000 69.77500  ? 249  ALA B N   1 
ATOM   5136  C CA  . ALA B  1 269 ? 3.63186   -28.83644  89.99383  1.000 70.07180  ? 249  ALA B CA  1 
ATOM   5137  C C   . ALA B  1 269 ? 3.40248   -28.72567  88.49757  1.000 67.49871  ? 249  ALA B C   1 
ATOM   5138  O O   . ALA B  1 269 ? 4.35533   -28.67296  87.71214  1.000 67.88390  ? 249  ALA B O   1 
ATOM   5139  C CB  . ALA B  1 269 ? 4.13161   -27.50444  90.55058  1.000 66.23220  ? 249  ALA B CB  1 
ATOM   5140  N N   . HIS B  1 270 ? 2.14168   -28.69320  88.11327  1.000 61.04893  ? 250  HIS B N   1 
ATOM   5141  C CA  . HIS B  1 270 ? 1.75298   -28.32774  86.76962  1.000 60.00859  ? 250  HIS B CA  1 
ATOM   5142  C C   . HIS B  1 270 ? 1.17925   -26.93057  86.83944  1.000 67.32357  ? 250  HIS B C   1 
ATOM   5143  O O   . HIS B  1 270 ? 0.28936   -26.66428  87.65426  1.000 65.82762  ? 250  HIS B O   1 
ATOM   5144  C CB  . HIS B  1 270 ? 0.71087   -29.28427  86.19739  1.000 57.71231  ? 250  HIS B CB  1 
ATOM   5145  C CG  . HIS B  1 270 ? 0.16054   -28.83267  84.88485  1.000 58.15751  ? 250  HIS B CG  1 
ATOM   5146  N ND1 . HIS B  1 270 ? 0.81337   -29.05557  83.69061  1.000 60.31238  ? 250  HIS B ND1 1 
ATOM   5147  C CD2 . HIS B  1 270 ? -0.95909  -28.13432  84.57994  1.000 57.38473  ? 250  HIS B CD2 1 
ATOM   5148  C CE1 . HIS B  1 270 ? 0.10503   -28.53359  82.70398  1.000 60.97244  ? 250  HIS B CE1 1 
ATOM   5149  N NE2 . HIS B  1 270 ? -0.97579  -27.97112  83.21633  1.000 57.15805  ? 250  HIS B NE2 1 
ATOM   5150  N N   . ARG B  1 271 ? 1.67629   -26.04514  85.99327  1.000 69.83613  ? 251  ARG B N   1 
ATOM   5151  C CA  . ARG B  1 271 ? 1.29705   -24.64432  86.06244  1.000 69.96895  ? 251  ARG B CA  1 
ATOM   5152  C C   . ARG B  1 271 ? 0.17456   -24.36788  85.07465  1.000 67.94622  ? 251  ARG B C   1 
ATOM   5153  O O   . ARG B  1 271 ? 0.27965   -24.71696  83.89248  1.000 58.26352  ? 251  ARG B O   1 
ATOM   5154  C CB  . ARG B  1 271 ? 2.50406   -23.74275  85.81300  1.000 70.97420  ? 251  ARG B CB  1 
ATOM   5155  C CG  . ARG B  1 271 ? 3.12109   -23.31654  87.13250  1.000 77.24256  ? 251  ARG B CG  1 
ATOM   5156  C CD  . ARG B  1 271 ? 4.60988   -23.05077  87.04454  1.000 85.41347  ? 251  ARG B CD  1 
ATOM   5157  N NE  . ARG B  1 271 ? 4.89459   -21.80921  86.33948  1.000 88.60920  ? 251  ARG B NE  1 
ATOM   5158  C CZ  . ARG B  1 271 ? 5.95910   -21.06017  86.58534  1.000 93.61686  ? 251  ARG B CZ  1 
ATOM   5159  N NH1 . ARG B  1 271 ? 6.81995   -21.44940  87.51242  1.000 95.72489  ? 251  ARG B NH1 1 
ATOM   5160  N NH2 . ARG B  1 271 ? 6.16362   -19.93202  85.91265  1.000 96.31235  ? 251  ARG B NH2 1 
ATOM   5161  N N   . PHE B  1 272 ? -0.90018  -23.74895  85.58958  1.000 68.10364  ? 252  PHE B N   1 
ATOM   5162  C CA  . PHE B  1 272 ? -2.12340  -23.47952  84.83155  1.000 60.35517  ? 252  PHE B CA  1 
ATOM   5163  C C   . PHE B  1 272 ? -1.83282  -22.88106  83.47076  1.000 57.74661  ? 252  PHE B C   1 
ATOM   5164  O O   . PHE B  1 272 ? -2.50221  -23.20185  82.48324  1.000 54.53872  ? 252  PHE B O   1 
ATOM   5165  C CB  . PHE B  1 272 ? -3.00382  -22.52432  85.63541  1.000 61.54255  ? 252  PHE B CB  1 
ATOM   5166  C CG  . PHE B  1 272 ? -4.32013  -22.18884  84.99139  1.000 62.37769  ? 252  PHE B CG  1 
ATOM   5167  C CD1 . PHE B  1 272 ? -5.06774  -23.16440  84.36996  1.000 62.46730  ? 252  PHE B CD1 1 
ATOM   5168  C CD2 . PHE B  1 272 ? -4.85251  -20.91840  85.10852  1.000 62.97799  ? 252  PHE B CD2 1 
ATOM   5169  C CE1 . PHE B  1 272 ? -6.28802  -22.86094  83.82444  1.000 63.24123  ? 252  PHE B CE1 1 
ATOM   5170  C CE2 . PHE B  1 272 ? -6.08370  -20.60773  84.57502  1.000 62.72357  ? 252  PHE B CE2 1 
ATOM   5171  C CZ  . PHE B  1 272 ? -6.80372  -21.57933  83.93069  1.000 63.32839  ? 252  PHE B CZ  1 
ATOM   5172  N N   . ALA B  1 273 ? -0.84329  -21.99471  83.40201  1.000 58.42129  ? 253  ALA B N   1 
ATOM   5173  C CA  . ALA B  1 273 ? -0.62488  -21.25621  82.17397  1.000 59.40656  ? 253  ALA B CA  1 
ATOM   5174  C C   . ALA B  1 273 ? -0.24984  -22.16780  81.01557  1.000 59.93153  ? 253  ALA B C   1 
ATOM   5175  O O   . ALA B  1 273 ? -0.42736  -21.78012  79.85807  1.000 60.91298  ? 253  ALA B O   1 
ATOM   5176  C CB  . ALA B  1 273 ? 0.44355   -20.18883  82.40112  1.000 61.24573  ? 253  ALA B CB  1 
ATOM   5177  N N   . ASP B  1 274 ? 0.23625   -23.37828  81.29327  1.000 59.08116  ? 254  ASP B N   1 
ATOM   5178  C CA  . ASP B  1 274 ? 0.59851   -24.28189  80.20866  1.000 60.84809  ? 254  ASP B CA  1 
ATOM   5179  C C   . ASP B  1 274 ? -0.60662  -25.00193  79.61292  1.000 60.15351  ? 254  ASP B C   1 
ATOM   5180  O O   . ASP B  1 274 ? -0.59238  -25.33741  78.42626  1.000 62.87243  ? 254  ASP B O   1 
ATOM   5181  C CB  . ASP B  1 274 ? 1.61450   -25.31136  80.69296  1.000 65.78254  ? 254  ASP B CB  1 
ATOM   5182  C CG  . ASP B  1 274 ? 2.96072   -24.69569  81.00833  1.000 71.33038  ? 254  ASP B CG  1 
ATOM   5183  O OD1 . ASP B  1 274 ? 3.24407   -23.57932  80.50636  1.000 69.19295  ? 254  ASP B OD1 1 
ATOM   5184  O OD2 . ASP B  1 274 ? 3.72891   -25.33868  81.75924  1.000 73.25377  ? 254  ASP B OD2 1 
ATOM   5185  N N   . SER B  1 275 ? -1.64716  -25.26099  80.39485  1.000 57.71541  ? 255  SER B N   1 
ATOM   5186  C CA  . SER B  1 275 ? -2.77010  -26.03267  79.88178  1.000 57.40273  ? 255  SER B CA  1 
ATOM   5187  C C   . SER B  1 275 ? -4.07326  -25.24876  79.82004  1.000 57.27492  ? 255  SER B C   1 
ATOM   5188  O O   . SER B  1 275 ? -5.07842  -25.79606  79.35630  1.000 54.45465  ? 255  SER B O   1 
ATOM   5189  C CB  . SER B  1 275 ? -2.97000  -27.30513  80.71578  1.000 51.89413  ? 255  SER B CB  1 
ATOM   5190  O OG  . SER B  1 275 ? -3.03434  -27.01481  82.09937  1.000 51.79997  ? 255  SER B OG  1 
ATOM   5191  N N   . CYS B  1 276 ? -4.08409  -23.99137  80.25928  1.000 54.72616  ? 256  CYS B N   1 
ATOM   5192  C CA  . CYS B  1 276 ? -5.27465  -23.15970  80.15529  1.000 52.63717  ? 256  CYS B CA  1 
ATOM   5193  C C   . CYS B  1 276 ? -5.67425  -22.96616  78.69856  1.000 48.59751  ? 256  CYS B C   1 
ATOM   5194  O O   . CYS B  1 276 ? -4.82581  -22.76549  77.82691  1.000 50.71133  ? 256  CYS B O   1 
ATOM   5195  C CB  . CYS B  1 276 ? -5.01593  -21.79945  80.79978  1.000 59.67164  ? 256  CYS B CB  1 
ATOM   5196  S SG  . CYS B  1 276 ? -6.34694  -20.58923  80.54623  1.000 59.74535  ? 256  CYS B SG  1 
ATOM   5197  N N   . VAL B  1 277 ? -6.97470  -23.01226  78.43587  1.000 47.85390  ? 257  VAL B N   1 
ATOM   5198  C CA  . VAL B  1 277 ? -7.50489  -22.87033  77.08496  1.000 53.08648  ? 257  VAL B CA  1 
ATOM   5199  C C   . VAL B  1 277 ? -7.97997  -21.42768  76.95054  1.000 56.90421  ? 257  VAL B C   1 
ATOM   5200  O O   . VAL B  1 277 ? -9.07594  -21.07529  77.39800  1.000 57.82596  ? 257  VAL B O   1 
ATOM   5201  C CB  . VAL B  1 277 ? -8.62633  -23.87579  76.80367  1.000 52.26498  ? 257  VAL B CB  1 
ATOM   5202  C CG1 . VAL B  1 277 ? -9.10834  -23.75376  75.35727  1.000 51.13993  ? 257  VAL B CG1 1 
ATOM   5203  C CG2 . VAL B  1 277 ? -8.14410  -25.30400  77.07684  1.000 53.45890  ? 257  VAL B CG2 1 
ATOM   5204  N N   . ARG B  1 278 ? -7.15312  -20.58645  76.33909  1.000 56.83101  ? 258  ARG B N   1 
ATOM   5205  C CA  . ARG B  1 278 ? -7.44573  -19.16810  76.18786  1.000 61.27397  ? 258  ARG B CA  1 
ATOM   5206  C C   . ARG B  1 278 ? -7.97992  -18.87040  74.79450  1.000 63.87813  ? 258  ARG B C   1 
ATOM   5207  O O   . ARG B  1 278 ? -7.42122  -19.32244  73.79268  1.000 68.51453  ? 258  ARG B O   1 
ATOM   5208  C CB  . ARG B  1 278 ? -6.20500  -18.31124  76.43448  1.000 68.48507  ? 258  ARG B CB  1 
ATOM   5209  C CG  . ARG B  1 278 ? -5.79995  -18.18084  77.88060  1.000 72.20635  ? 258  ARG B CG  1 
ATOM   5210  C CD  . ARG B  1 278 ? -4.45254  -17.51104  77.96501  1.000 78.59293  ? 258  ARG B CD  1 
ATOM   5211  N NE  . ARG B  1 278 ? -4.46523  -16.20495  77.31629  1.000 84.13347  ? 258  ARG B NE  1 
ATOM   5212  C CZ  . ARG B  1 278 ? -3.38757  -15.61628  76.81104  1.000 90.17416  ? 258  ARG B CZ  1 
ATOM   5213  N NH1 . ARG B  1 278 ? -2.21154  -16.22439  76.87846  1.000 92.81715  ? 258  ARG B NH1 1 
ATOM   5214  N NH2 . ARG B  1 278 ? -3.48391  -14.41989  76.24466  1.000 92.52205  ? 258  ARG B NH2 1 
ATOM   5215  N N   . SER B  1 279 ? -9.04727  -18.08765  74.74300  1.000 64.81416  ? 259  SER B N   1 
ATOM   5216  C CA  . SER B  1 279 ? -9.57262  -17.56290  73.50087  1.000 64.00539  ? 259  SER B CA  1 
ATOM   5217  C C   . SER B  1 279 ? -8.62056  -16.50319  72.93758  1.000 71.42348  ? 259  SER B C   1 
ATOM   5218  O O   . SER B  1 279 ? -7.71816  -16.00915  73.62210  1.000 71.98215  ? 259  SER B O   1 
ATOM   5219  C CB  . SER B  1 279 ? -10.97189 -16.99864  73.75522  1.000 58.08492  ? 259  SER B CB  1 
ATOM   5220  O OG  . SER B  1 279 ? -11.27227 -15.88775  72.94645  1.000 63.25629  ? 259  SER B OG  1 
ATOM   5221  N N   . ASP B  1 280 ? -8.82201  -16.15500  71.66261  1.000 74.47338  ? 260  ASP B N   1 
ATOM   5222  C CA  . ASP B  1 280 ? -8.05912  -15.05702  71.07594  1.000 77.32401  ? 260  ASP B CA  1 
ATOM   5223  C C   . ASP B  1 280 ? -8.34910  -13.73184  71.76689  1.000 79.20834  ? 260  ASP B C   1 
ATOM   5224  O O   . ASP B  1 280 ? -7.57204  -12.78109  71.62194  1.000 83.71056  ? 260  ASP B O   1 
ATOM   5225  C CB  . ASP B  1 280 ? -8.36632  -14.93051  69.58166  1.000 80.03097  ? 260  ASP B CB  1 
ATOM   5226  C CG  . ASP B  1 280 ? -7.56010  -15.90238  68.72903  1.000 83.91531  ? 260  ASP B CG  1 
ATOM   5227  O OD1 . ASP B  1 280 ? -6.45194  -16.29642  69.15218  1.000 84.81334  ? 260  ASP B OD1 1 
ATOM   5228  O OD2 . ASP B  1 280 ? -8.03164  -16.26132  67.62722  1.000 84.73576  ? 260  ASP B OD2 1 
ATOM   5229  N N   . PHE B  1 281 ? -9.44180  -13.65547  72.52739  1.000 76.71230  ? 261  PHE B N   1 
ATOM   5230  C CA  . PHE B  1 281 ? -9.92022  -12.41147  73.11458  1.000 76.34572  ? 261  PHE B CA  1 
ATOM   5231  C C   . PHE B  1 281 ? -9.83254  -12.40702  74.64286  1.000 73.33840  ? 261  PHE B C   1 
ATOM   5232  O O   . PHE B  1 281 ? -10.45654 -11.55890  75.29205  1.000 67.10934  ? 261  PHE B O   1 
ATOM   5233  C CB  . PHE B  1 281 ? -11.35773 -12.14466  72.66002  1.000 75.00944  ? 261  PHE B CB  1 
ATOM   5234  C CG  . PHE B  1 281 ? -11.55192 -12.21289  71.16366  1.000 76.63043  ? 261  PHE B CG  1 
ATOM   5235  C CD1 . PHE B  1 281 ? -11.39871 -11.07853  70.37777  1.000 82.18929  ? 261  PHE B CD1 1 
ATOM   5236  C CD2 . PHE B  1 281 ? -11.89836 -13.40503  70.54600  1.000 72.76796  ? 261  PHE B CD2 1 
ATOM   5237  C CE1 . PHE B  1 281 ? -11.58006 -11.13561  69.00146  1.000 84.03901  ? 261  PHE B CE1 1 
ATOM   5238  C CE2 . PHE B  1 281 ? -12.07915 -13.46796  69.17123  1.000 76.03089  ? 261  PHE B CE2 1 
ATOM   5239  C CZ  . PHE B  1 281 ? -11.92154 -12.33097  68.39891  1.000 79.80530  ? 261  PHE B CZ  1 
ATOM   5240  N N   . GLU B  1 282 ? -9.06930  -13.33327  75.22885  1.000 75.25057  ? 262  GLU B N   1 
ATOM   5241  C CA  . GLU B  1 282 ? -8.81033  -13.37900  76.66790  1.000 74.94652  ? 262  GLU B CA  1 
ATOM   5242  C C   . GLU B  1 282 ? -7.34762  -13.01860  76.91165  1.000 78.09606  ? 262  GLU B C   1 
ATOM   5243  O O   . GLU B  1 282 ? -6.44715  -13.75519  76.49222  1.000 79.79336  ? 262  GLU B O   1 
ATOM   5244  C CB  . GLU B  1 282 ? -9.12815  -14.76257  77.24027  1.000 72.05169  ? 262  GLU B CB  1 
ATOM   5245  C CG  . GLU B  1 282 ? -10.58355 -15.17070  77.08703  1.000 71.88113  ? 262  GLU B CG  1 
ATOM   5246  C CD  . GLU B  1 282 ? -10.87920 -16.56053  77.64135  1.000 69.60360  ? 262  GLU B CD  1 
ATOM   5247  O OE1 . GLU B  1 282 ? -9.92809  -17.36657  77.78509  1.000 70.90222  ? 262  GLU B OE1 1 
ATOM   5248  O OE2 . GLU B  1 282 ? -12.06287 -16.83303  77.94964  1.000 64.94023  ? 262  GLU B OE2 1 
ATOM   5249  N N   . HIS B  1 283 ? -7.11170  -11.89733  77.59954  1.000 79.16887  ? 263  HIS B N   1 
ATOM   5250  C CA  . HIS B  1 283 ? -5.77933  -11.29788  77.65410  1.000 81.07103  ? 263  HIS B CA  1 
ATOM   5251  C C   . HIS B  1 283 ? -4.82352  -11.99630  78.61874  1.000 81.95396  ? 263  HIS B C   1 
ATOM   5252  O O   . HIS B  1 283 ? -3.65775  -11.59486  78.70273  1.000 87.26800  ? 263  HIS B O   1 
ATOM   5253  C CB  . HIS B  1 283 ? -5.89402  -9.80218   78.00204  1.000 80.65576  ? 263  HIS B CB  1 
ATOM   5254  C CG  . HIS B  1 283 ? -6.01399  -9.50737   79.46954  1.000 78.29900  ? 263  HIS B CG  1 
ATOM   5255  N ND1 . HIS B  1 283 ? -7.21015  -9.59090   80.15353  1.000 75.07962  ? 263  HIS B ND1 1 
ATOM   5256  C CD2 . HIS B  1 283 ? -5.09543  -9.08490   80.37260  1.000 78.85811  ? 263  HIS B CD2 1 
ATOM   5257  C CE1 . HIS B  1 283 ? -7.01775  -9.25655   81.41837  1.000 74.88706  ? 263  HIS B CE1 1 
ATOM   5258  N NE2 . HIS B  1 283 ? -5.74358  -8.94108   81.57650  1.000 77.15573  ? 263  HIS B NE2 1 
ATOM   5259  N N   . GLU B  1 284 ? -5.26825  -13.02874  79.32176  1.000 78.96116  ? 264  GLU B N   1 
ATOM   5260  C CA  . GLU B  1 284 ? -4.45454  -13.73471  80.30327  1.000 76.88714  ? 264  GLU B CA  1 
ATOM   5261  C C   . GLU B  1 284 ? -5.23696  -14.96090  80.77676  1.000 67.10250  ? 264  GLU B C   1 
ATOM   5262  O O   . GLU B  1 284 ? -6.46397  -14.99810  80.64918  1.000 57.93681  ? 264  GLU B O   1 
ATOM   5263  C CB  . GLU B  1 284 ? -4.10186  -12.83166  81.50072  1.000 78.00934  ? 264  GLU B CB  1 
ATOM   5264  C CG  . GLU B  1 284 ? -5.20751  -12.75493  82.54824  1.000 79.08240  ? 264  GLU B CG  1 
ATOM   5265  C CD  . GLU B  1 284 ? -4.83924  -11.90116  83.74779  1.000 85.12648  ? 264  GLU B CD  1 
ATOM   5266  O OE1 . GLU B  1 284 ? -3.98474  -10.99395  83.59965  1.000 85.44609  ? 264  GLU B OE1 1 
ATOM   5267  O OE2 . GLU B  1 284 ? -5.42595  -12.12855  84.83312  1.000 86.70214  ? 264  GLU B OE2 1 
ATOM   5268  N N   . PRO B  1 285 ? -4.54648  -15.96883  81.30936  1.000 67.28747  ? 265  PRO B N   1 
ATOM   5269  C CA  . PRO B  1 285 ? -5.24857  -17.14000  81.85281  1.000 62.79929  ? 265  PRO B CA  1 
ATOM   5270  C C   . PRO B  1 285 ? -6.29493  -16.74380  82.89073  1.000 57.91519  ? 265  PRO B C   1 
ATOM   5271  O O   . PRO B  1 285 ? -6.01791  -15.99208  83.82821  1.000 60.55630  ? 265  PRO B O   1 
ATOM   5272  C CB  . PRO B  1 285 ? -4.12138  -17.97562  82.47352  1.000 64.18121  ? 265  PRO B CB  1 
ATOM   5273  C CG  . PRO B  1 285 ? -2.83323  -17.44713  81.92345  1.000 67.26725  ? 265  PRO B CG  1 
ATOM   5274  C CD  . PRO B  1 285 ? -3.09874  -16.19717  81.13838  1.000 68.99369  ? 265  PRO B CD  1 
ATOM   5275  N N   . TYR B  1 286 ? -7.50692  -17.26776  82.72627  1.000 52.71929  ? 266  TYR B N   1 
ATOM   5276  C CA  . TYR B  1 286 ? -8.65551  -16.87536  83.53307  1.000 46.93652  ? 266  TYR B CA  1 
ATOM   5277  C C   . TYR B  1 286 ? -9.00799  -17.96429  84.53961  1.000 48.83776  ? 266  TYR B C   1 
ATOM   5278  O O   . TYR B  1 286 ? -9.09536  -19.14299  84.18896  1.000 52.68879  ? 266  TYR B O   1 
ATOM   5279  C CB  . TYR B  1 286 ? -9.85782  -16.57149  82.63928  1.000 45.97370  ? 266  TYR B CB  1 
ATOM   5280  C CG  . TYR B  1 286 ? -11.12265 -16.10509  83.36303  1.000 45.98619  ? 266  TYR B CG  1 
ATOM   5281  C CD1 . TYR B  1 286 ? -11.99407 -17.02303  83.93406  1.000 43.48634  ? 266  TYR B CD1 1 
ATOM   5282  C CD2 . TYR B  1 286 ? -11.45861 -14.75437  83.43517  1.000 45.20591  ? 266  TYR B CD2 1 
ATOM   5283  C CE1 . TYR B  1 286 ? -13.14287 -16.62530  84.56871  1.000 44.42767  ? 266  TYR B CE1 1 
ATOM   5284  C CE2 . TYR B  1 286 ? -12.61776 -14.34732  84.06812  1.000 46.10163  ? 266  TYR B CE2 1 
ATOM   5285  C CZ  . TYR B  1 286 ? -13.44919 -15.28825  84.62880  1.000 46.22075  ? 266  TYR B CZ  1 
ATOM   5286  O OH  . TYR B  1 286 ? -14.59376 -14.90074  85.25503  1.000 48.96547  ? 266  TYR B OH  1 
ATOM   5287  N N   . TRP B  1 287 ? -9.23144  -17.55278  85.78312  1.000 48.74498  ? 267  TRP B N   1 
ATOM   5288  C CA  . TRP B  1 287 ? -9.60118  -18.43969  86.87693  1.000 46.71558  ? 267  TRP B CA  1 
ATOM   5289  C C   . TRP B  1 287 ? -10.21429 -17.57263  87.96729  1.000 48.58370  ? 267  TRP B C   1 
ATOM   5290  O O   . TRP B  1 287 ? -9.61580  -16.57330  88.36640  1.000 50.33615  ? 267  TRP B O   1 
ATOM   5291  C CB  . TRP B  1 287 ? -8.38404  -19.19685  87.40881  1.000 44.66610  ? 267  TRP B CB  1 
ATOM   5292  C CG  . TRP B  1 287 ? -8.69870  -20.21526  88.47347  1.000 49.98840  ? 267  TRP B CG  1 
ATOM   5293  C CD1 . TRP B  1 287 ? -8.92883  -21.55088  88.28524  1.000 52.51986  ? 267  TRP B CD1 1 
ATOM   5294  C CD2 . TRP B  1 287 ? -8.79056  -19.99318  89.88954  1.000 52.86299  ? 267  TRP B CD2 1 
ATOM   5295  N NE1 . TRP B  1 287 ? -9.16096  -22.17184  89.48820  1.000 50.39417  ? 267  TRP B NE1 1 
ATOM   5296  C CE2 . TRP B  1 287 ? -9.08513  -21.23885  90.48825  1.000 50.86841  ? 267  TRP B CE2 1 
ATOM   5297  C CE3 . TRP B  1 287 ? -8.65165  -18.85997  90.71301  1.000 55.23568  ? 267  TRP B CE3 1 
ATOM   5298  C CZ2 . TRP B  1 287 ? -9.25049  -21.38606  91.86815  1.000 52.17814  ? 267  TRP B CZ2 1 
ATOM   5299  C CZ3 . TRP B  1 287 ? -8.81449  -19.00965  92.08695  1.000 53.60509  ? 267  TRP B CZ3 1 
ATOM   5300  C CH2 . TRP B  1 287 ? -9.11390  -20.26501  92.64783  1.000 53.92056  ? 267  TRP B CH2 1 
ATOM   5301  N N   . ARG B  1 288 ? -11.41702 -17.92100  88.41236  1.000 46.06944  ? 268  ARG B N   1 
ATOM   5302  C CA  . ARG B  1 288 ? -12.04980 -17.21984  89.52133  1.000 50.24734  ? 268  ARG B CA  1 
ATOM   5303  C C   . ARG B  1 288 ? -12.64632 -18.25854  90.45154  1.000 53.26183  ? 268  ARG B C   1 
ATOM   5304  O O   . ARG B  1 288 ? -13.12173 -19.31148  90.00214  1.000 57.10505  ? 268  ARG B O   1 
ATOM   5305  C CB  . ARG B  1 288 ? -13.15499 -16.24916  89.06154  1.000 41.23587  ? 268  ARG B CB  1 
ATOM   5306  C CG  . ARG B  1 288 ? -12.75833 -15.32691  87.92146  1.000 54.24231  ? 268  ARG B CG  1 
ATOM   5307  C CD  . ARG B  1 288 ? -11.91443 -14.14428  88.40894  1.000 56.12272  ? 268  ARG B CD  1 
ATOM   5308  N NE  . ARG B  1 288 ? -11.69682 -13.12469  87.38365  1.000 56.72191  ? 268  ARG B NE  1 
ATOM   5309  C CZ  . ARG B  1 288 ? -10.57263 -12.98795  86.68042  1.000 61.80314  ? 268  ARG B CZ  1 
ATOM   5310  N NH1 . ARG B  1 288 ? -9.55180  -13.82399  86.87014  1.000 64.22277  ? 268  ARG B NH1 1 
ATOM   5311  N NH2 . ARG B  1 288 ? -10.47235 -12.02161  85.77119  1.000 61.59782  ? 268  ARG B NH2 1 
ATOM   5312  N N   . ASP B  1 289 ? -12.61701 -17.98038  91.75430  1.000 51.13531  ? 269  ASP B N   1 
ATOM   5313  C CA  . ASP B  1 289 ? -13.31319 -18.87256  92.67031  1.000 55.18220  ? 269  ASP B CA  1 
ATOM   5314  C C   . ASP B  1 289 ? -14.52558 -18.21057  93.30031  1.000 59.47211  ? 269  ASP B C   1 
ATOM   5315  O O   . ASP B  1 289 ? -15.13030 -18.79570  94.20568  1.000 63.97689  ? 269  ASP B O   1 
ATOM   5316  C CB  . ASP B  1 289 ? -12.37040 -19.42582  93.73430  1.000 56.76966  ? 269  ASP B CB  1 
ATOM   5317  C CG  . ASP B  1 289 ? -12.22894 -18.52935  94.90443  1.000 68.11716  ? 269  ASP B CG  1 
ATOM   5318  O OD1 . ASP B  1 289 ? -11.60857 -17.45883  94.75108  1.000 75.49118  ? 269  ASP B OD1 1 
ATOM   5319  O OD2 . ASP B  1 289 ? -12.74511 -18.90223  95.97980  1.000 71.70792  ? 269  ASP B OD2 1 
ATOM   5320  N N   . VAL B  1 290 ? -14.91859 -17.03818  92.78242  1.000 52.81696  ? 270  VAL B N   1 
ATOM   5321  C CA  . VAL B  1 290 ? -16.03294 -16.19899  93.21799  1.000 48.58006  ? 270  VAL B CA  1 
ATOM   5322  C C   . VAL B  1 290 ? -16.49552 -16.53773  94.62933  1.000 46.50334  ? 270  VAL B C   1 
ATOM   5323  O O   . VAL B  1 290 ? -17.67165 -16.82358  94.87210  1.000 42.52952  ? 270  VAL B O   1 
ATOM   5324  C CB  . VAL B  1 290 ? -17.18209 -16.27465  92.19962  1.000 47.46440  ? 270  VAL B CB  1 
ATOM   5325  C CG1 . VAL B  1 290 ? -16.82994 -15.43298  90.98237  1.000 38.81207  ? 270  VAL B CG1 1 
ATOM   5326  C CG2 . VAL B  1 290 ? -17.47555 -17.72271  91.78664  1.000 47.10334  ? 270  VAL B CG2 1 
ATOM   5327  N N   . GLY B  1 291 ? -15.55655 -16.48336  95.57478  1.000 54.27854  ? 271  GLY B N   1 
ATOM   5328  C CA  . GLY B  1 291 ? -15.83493 -16.88021  96.93764  1.000 58.79015  ? 271  GLY B CA  1 
ATOM   5329  C C   . GLY B  1 291 ? -16.55446 -15.84835  97.77030  1.000 57.14534  ? 271  GLY B C   1 
ATOM   5330  O O   . GLY B  1 291 ? -17.16972 -16.21657  98.77472  1.000 64.03384  ? 271  GLY B O   1 
ATOM   5331  N N   . THR B  1 292 ? -16.49331 -14.57385  97.39372  1.000 53.12371  ? 272  THR B N   1 
ATOM   5332  C CA  . THR B  1 292 ? -17.19467 -13.53526  98.13815  1.000 51.98086  ? 272  THR B CA  1 
ATOM   5333  C C   . THR B  1 292 ? -18.38342 -13.05644  97.32287  1.000 53.88254  ? 272  THR B C   1 
ATOM   5334  O O   . THR B  1 292 ? -18.50681 -13.35346  96.13470  1.000 55.11401  ? 272  THR B O   1 
ATOM   5335  C CB  . THR B  1 292 ? -16.28164 -12.34513  98.46069  1.000 49.78102  ? 272  THR B CB  1 
ATOM   5336  O OG1 . THR B  1 292 ? -15.87190 -11.71217  97.24610  1.000 55.81516  ? 272  THR B OG1 1 
ATOM   5337  C CG2 . THR B  1 292 ? -15.06438 -12.82889  99.16913  1.000 47.54007  ? 272  THR B CG2 1 
ATOM   5338  N N   . ILE B  1 293 ? -19.26076 -12.28826  97.96799  1.000 55.50393  ? 273  ILE B N   1 
ATOM   5339  C CA  . ILE B  1 293 ? -20.34709 -11.67103  97.21688  1.000 56.66731  ? 273  ILE B CA  1 
ATOM   5340  C C   . ILE B  1 293 ? -19.79672 -10.60720  96.27767  1.000 58.74594  ? 273  ILE B C   1 
ATOM   5341  O O   . ILE B  1 293 ? -20.21448 -10.50558  95.11124  1.000 57.21165  ? 273  ILE B O   1 
ATOM   5342  C CB  . ILE B  1 293 ? -21.40907 -11.10999  98.17359  1.000 56.60997  ? 273  ILE B CB  1 
ATOM   5343  C CG1 . ILE B  1 293 ? -22.11862 -12.26689  98.87666  1.000 56.57716  ? 273  ILE B CG1 1 
ATOM   5344  C CG2 . ILE B  1 293 ? -22.41630 -10.22538  97.41661  1.000 54.40586  ? 273  ILE B CG2 1 
ATOM   5345  C CD1 . ILE B  1 293 ? -23.27746 -11.81431  99.74713  1.000 60.75259  ? 273  ILE B CD1 1 
ATOM   5346  N N   . ASP B  1 294 ? -18.84205 -9.81164   96.77172  1.000 56.14719  ? 274  ASP B N   1 
ATOM   5347  C CA  . ASP B  1 294 ? -18.09477 -8.88539   95.92926  1.000 53.53750  ? 274  ASP B CA  1 
ATOM   5348  C C   . ASP B  1 294 ? -17.51595 -9.60715   94.71563  1.000 49.07408  ? 274  ASP B C   1 
ATOM   5349  O O   . ASP B  1 294 ? -17.72993 -9.19000   93.57199  1.000 45.55704  ? 274  ASP B O   1 
ATOM   5350  C CB  . ASP B  1 294 ? -16.97484 -8.21311   96.75031  1.000 58.70714  ? 274  ASP B CB  1 
ATOM   5351  C CG  . ASP B  1 294 ? -17.44416 -6.95964   97.50756  1.000 67.25658  ? 274  ASP B CG  1 
ATOM   5352  O OD1 . ASP B  1 294 ? -18.65595 -6.67483   97.51266  1.000 71.34196  ? 274  ASP B OD1 1 
ATOM   5353  O OD2 . ASP B  1 294 ? -16.59643 -6.25596   98.11186  1.000 72.01080  ? 274  ASP B OD2 1 
ATOM   5354  N N   . ALA B  1 295 ? -16.77978 -10.70253  94.94786  1.000 51.17842  ? 275  ALA B N   1 
ATOM   5355  C CA  . ALA B  1 295 ? -16.15469 -11.42182  93.83903  1.000 53.62861  ? 275  ALA B CA  1 
ATOM   5356  C C   . ALA B  1 295 ? -17.20019 -11.97466  92.87809  1.000 50.37040  ? 275  ALA B C   1 
ATOM   5357  O O   . ALA B  1 295 ? -17.03843 -11.91546  91.64940  1.000 47.66011  ? 275  ALA B O   1 
ATOM   5358  C CB  . ALA B  1 295 ? -15.27369 -12.55746  94.36062  1.000 52.38706  ? 275  ALA B CB  1 
ATOM   5359  N N   . TYR B  1 296 ? -18.27022 -12.54634  93.42122  1.000 47.35203  ? 276  TYR B N   1 
ATOM   5360  C CA  . TYR B  1 296 ? -19.30107 -13.09752  92.55464  1.000 43.32545  ? 276  TYR B CA  1 
ATOM   5361  C C   . TYR B  1 296 ? -19.87546 -12.00361  91.67356  1.000 45.69890  ? 276  TYR B C   1 
ATOM   5362  O O   . TYR B  1 296 ? -19.93816 -12.14309  90.44575  1.000 49.26654  ? 276  TYR B O   1 
ATOM   5363  C CB  . TYR B  1 296 ? -20.38361 -13.76415  93.39892  1.000 42.29452  ? 276  TYR B CB  1 
ATOM   5364  C CG  . TYR B  1 296 ? -21.53820 -14.32681  92.60389  1.000 45.50290  ? 276  TYR B CG  1 
ATOM   5365  C CD1 . TYR B  1 296 ? -21.39618 -15.51541  91.87669  1.000 41.33061  ? 276  TYR B CD1 1 
ATOM   5366  C CD2 . TYR B  1 296 ? -22.77132 -13.68007  92.57795  1.000 37.18280  ? 276  TYR B CD2 1 
ATOM   5367  C CE1 . TYR B  1 296 ? -22.44083 -16.03958  91.15902  1.000 35.22807  ? 276  TYR B CE1 1 
ATOM   5368  C CE2 . TYR B  1 296 ? -23.83091 -14.20211  91.85254  1.000 38.53463  ? 276  TYR B CE2 1 
ATOM   5369  C CZ  . TYR B  1 296 ? -23.65283 -15.38461  91.14640  1.000 41.58889  ? 276  TYR B CZ  1 
ATOM   5370  O OH  . TYR B  1 296 ? -24.68898 -15.92128  90.41959  1.000 43.23529  ? 276  TYR B OH  1 
ATOM   5371  N N   . TRP B  1 297 ? -20.23050 -10.87427  92.28703  1.000 47.06499  ? 277  TRP B N   1 
ATOM   5372  C CA  . TRP B  1 297 ? -20.80405 -9.76170   91.54101  1.000 46.64143  ? 277  TRP B CA  1 
ATOM   5373  C C   . TRP B  1 297 ? -19.83325 -9.27523   90.47699  1.000 44.18031  ? 277  TRP B C   1 
ATOM   5374  O O   . TRP B  1 297 ? -20.20709 -9.09001   89.31486  1.000 43.90116  ? 277  TRP B O   1 
ATOM   5375  C CB  . TRP B  1 297 ? -21.17580 -8.62848   92.51220  1.000 48.93524  ? 277  TRP B CB  1 
ATOM   5376  C CG  . TRP B  1 297 ? -21.67995 -7.37294   91.85695  1.000 46.16290  ? 277  TRP B CG  1 
ATOM   5377  C CD1 . TRP B  1 297 ? -22.97423 -7.08230   91.51551  1.000 46.27129  ? 277  TRP B CD1 1 
ATOM   5378  C CD2 . TRP B  1 297 ? -20.90074 -6.24345   91.46544  1.000 46.48301  ? 277  TRP B CD2 1 
ATOM   5379  N NE1 . TRP B  1 297 ? -23.04361 -5.83527   90.93399  1.000 45.65962  ? 277  TRP B NE1 1 
ATOM   5380  C CE2 . TRP B  1 297 ? -21.78391 -5.29867   90.89644  1.000 46.66550  ? 277  TRP B CE2 1 
ATOM   5381  C CE3 . TRP B  1 297 ? -19.54109 -5.93046   91.54805  1.000 52.09950  ? 277  TRP B CE3 1 
ATOM   5382  C CZ2 . TRP B  1 297 ? -21.34726 -4.06142   90.41148  1.000 52.75482  ? 277  TRP B CZ2 1 
ATOM   5383  C CZ3 . TRP B  1 297 ? -19.10661 -4.68926   91.07035  1.000 54.61759  ? 277  TRP B CZ3 1 
ATOM   5384  C CH2 . TRP B  1 297 ? -20.00706 -3.77706   90.50532  1.000 53.60966  ? 277  TRP B CH2 1 
ATOM   5385  N N   . GLN B  1 298 ? -18.57125 -9.08027   90.86161  1.000 43.52238  ? 278  GLN B N   1 
ATOM   5386  C CA  . GLN B  1 298 ? -17.58880 -8.52438   89.94263  1.000 47.70215  ? 278  GLN B CA  1 
ATOM   5387  C C   . GLN B  1 298 ? -17.38941 -9.43243   88.73891  1.000 48.77188  ? 278  GLN B C   1 
ATOM   5388  O O   . GLN B  1 298 ? -17.43375 -8.97119   87.59192  1.000 52.02494  ? 278  GLN B O   1 
ATOM   5389  C CB  . GLN B  1 298 ? -16.26193 -8.29090   90.67070  1.000 50.98558  ? 278  GLN B CB  1 
ATOM   5390  C CG  . GLN B  1 298 ? -15.26169 -7.46775   89.87765  1.000 53.62360  ? 278  GLN B CG  1 
ATOM   5391  C CD  . GLN B  1 298 ? -15.63590 -5.99186   89.80184  1.000 62.48577  ? 278  GLN B CD  1 
ATOM   5392  O OE1 . GLN B  1 298 ? -15.75373 -5.31026   90.82850  1.000 65.27873  ? 278  GLN B OE1 1 
ATOM   5393  N NE2 . GLN B  1 298 ? -15.81449 -5.48709   88.57892  1.000 65.80181  ? 278  GLN B NE2 1 
ATOM   5394  N N   . ALA B  1 299 ? -17.17930 -10.73554  88.98004  1.000 43.54925  ? 279  ALA B N   1 
ATOM   5395  C CA  . ALA B  1 299 ? -16.91430 -11.65812  87.87701  1.000 41.57509  ? 279  ALA B CA  1 
ATOM   5396  C C   . ALA B  1 299 ? -18.06799 -11.69655  86.88372  1.000 44.68052  ? 279  ALA B C   1 
ATOM   5397  O O   . ALA B  1 299 ? -17.84661 -11.85972  85.67728  1.000 43.14942  ? 279  ALA B O   1 
ATOM   5398  C CB  . ALA B  1 299 ? -16.63706 -13.05649  88.41812  1.000 42.24394  ? 279  ALA B CB  1 
ATOM   5399  N N   . ASN B  1 300 ? -19.29962 -11.53345  87.37046  1.000 45.13193  ? 280  ASN B N   1 
ATOM   5400  C CA  . ASN B  1 300 ? -20.46055 -11.51600  86.49231  1.000 48.68616  ? 280  ASN B CA  1 
ATOM   5401  C C   . ASN B  1 300 ? -20.59624 -10.17247  85.77945  1.000 47.79624  ? 280  ASN B C   1 
ATOM   5402  O O   . ASN B  1 300 ? -20.86757 -10.13403  84.57326  1.000 47.56019  ? 280  ASN B O   1 
ATOM   5403  C CB  . ASN B  1 300 ? -21.73143 -11.83884  87.29467  1.000 50.57625  ? 280  ASN B CB  1 
ATOM   5404  C CG  . ASN B  1 300 ? -21.89736 -13.33974  87.57977  1.000 46.65944  ? 280  ASN B CG  1 
ATOM   5405  O OD1 . ASN B  1 300 ? -22.39234 -14.09732  86.72969  1.000 43.73445  ? 280  ASN B OD1 1 
ATOM   5406  N ND2 . ASN B  1 300 ? -21.49926 -13.76797  88.78783  1.000 42.97141  ? 280  ASN B ND2 1 
ATOM   5407  N N   . ILE B  1 301 ? -20.41093 -9.06316   86.50035  1.000 44.03368  ? 281  ILE B N   1 
ATOM   5408  C CA  . ILE B  1 301 ? -20.58456 -7.75441   85.87318  1.000 49.84913  ? 281  ILE B CA  1 
ATOM   5409  C C   . ILE B  1 301 ? -19.45176 -7.47000   84.88348  1.000 48.76726  ? 281  ILE B C   1 
ATOM   5410  O O   . ILE B  1 301 ? -19.64833 -6.74696   83.90234  1.000 45.23845  ? 281  ILE B O   1 
ATOM   5411  C CB  . ILE B  1 301 ? -20.72456 -6.64794   86.94982  1.000 50.93210  ? 281  ILE B CB  1 
ATOM   5412  C CG1 . ILE B  1 301 ? -21.75737 -5.60349   86.52393  1.000 51.33272  ? 281  ILE B CG1 1 
ATOM   5413  C CG2 . ILE B  1 301 ? -19.41752 -5.92978   87.19336  1.000 54.53110  ? 281  ILE B CG2 1 
ATOM   5414  C CD1 . ILE B  1 301 ? -23.16370 -6.16234   86.38901  1.000 52.38077  ? 281  ILE B CD1 1 
ATOM   5415  N N   . ASP B  1 302 ? -18.27705 -8.07617   85.07858  1.000 50.79652  ? 282  ASP B N   1 
ATOM   5416  C CA  . ASP B  1 302 ? -17.18514 -7.87317   84.13085  1.000 55.13874  ? 282  ASP B CA  1 
ATOM   5417  C C   . ASP B  1 302 ? -17.53447 -8.39280   82.74140  1.000 49.92448  ? 282  ASP B C   1 
ATOM   5418  O O   . ASP B  1 302 ? -16.99749 -7.89216   81.74676  1.000 51.66749  ? 282  ASP B O   1 
ATOM   5419  C CB  . ASP B  1 302 ? -15.90625 -8.53744   84.64183  1.000 65.07972  ? 282  ASP B CB  1 
ATOM   5420  C CG  . ASP B  1 302 ? -15.21936 -7.72226   85.74068  1.000 73.58652  ? 282  ASP B CG  1 
ATOM   5421  O OD1 . ASP B  1 302 ? -15.48012 -6.50049   85.85782  1.000 76.01989  ? 282  ASP B OD1 1 
ATOM   5422  O OD2 . ASP B  1 302 ? -14.43200 -8.32231   86.50598  1.000 75.44565  ? 282  ASP B OD2 1 
ATOM   5423  N N   . LEU B  1 303 ? -18.43184 -9.38275   82.64484  1.000 44.31634  ? 283  LEU B N   1 
ATOM   5424  C CA  . LEU B  1 303 ? -18.87449 -9.86201   81.33463  1.000 44.59264  ? 283  LEU B CA  1 
ATOM   5425  C C   . LEU B  1 303 ? -19.63687 -8.80054   80.55051  1.000 49.46211  ? 283  LEU B C   1 
ATOM   5426  O O   . LEU B  1 303 ? -19.84267 -8.98443   79.34226  1.000 44.78131  ? 283  LEU B O   1 
ATOM   5427  C CB  . LEU B  1 303 ? -19.75941 -11.11104  81.47419  1.000 43.17213  ? 283  LEU B CB  1 
ATOM   5428  C CG  . LEU B  1 303 ? -19.16785 -12.36380  82.12913  1.000 44.28963  ? 283  LEU B CG  1 
ATOM   5429  C CD1 . LEU B  1 303 ? -20.24618 -13.38394  82.27461  1.000 41.60963  ? 283  LEU B CD1 1 
ATOM   5430  C CD2 . LEU B  1 303 ? -17.99679 -12.93729  81.34722  1.000 47.61244  ? 283  LEU B CD2 1 
ATOM   5431  N N   . THR B  1 304 ? -20.06753 -7.70661   81.20113  1.000 49.14873  ? 284  THR B N   1 
ATOM   5432  C CA  . THR B  1 304 ? -20.66085 -6.56946   80.50357  1.000 53.23430  ? 284  THR B CA  1 
ATOM   5433  C C   . THR B  1 304 ? -19.62288 -5.66797   79.81770  1.000 56.36730  ? 284  THR B C   1 
ATOM   5434  O O   . THR B  1 304 ? -20.01493 -4.72056   79.12162  1.000 57.30353  ? 284  THR B O   1 
ATOM   5435  C CB  . THR B  1 304 ? -21.52101 -5.73240   81.48202  1.000 52.21333  ? 284  THR B CB  1 
ATOM   5436  O OG1 . THR B  1 304 ? -20.67414 -4.96326   82.33087  1.000 47.25547  ? 284  THR B OG1 1 
ATOM   5437  C CG2 . THR B  1 304 ? -22.43419 -6.60901   82.34731  1.000 53.14285  ? 284  THR B CG2 1 
ATOM   5438  N N   . ASP B  1 305 ? -18.32352 -5.92238   79.99860  1.000 51.30009  ? 285  ASP B N   1 
ATOM   5439  C CA  . ASP B  1 305 ? -17.30967 -5.06074   79.39686  1.000 53.02538  ? 285  ASP B CA  1 
ATOM   5440  C C   . ASP B  1 305 ? -17.33725 -5.16239   77.87012  1.000 55.40398  ? 285  ASP B C   1 
ATOM   5441  O O   . ASP B  1 305 ? -17.91400 -6.08810   77.28459  1.000 61.91014  ? 285  ASP B O   1 
ATOM   5442  C CB  . ASP B  1 305 ? -15.90682 -5.42168   79.90936  1.000 52.70166  ? 285  ASP B CB  1 
ATOM   5443  C CG  . ASP B  1 305 ? -15.69782 -5.06112   81.38289  1.000 53.54203  ? 285  ASP B CG  1 
ATOM   5444  O OD1 . ASP B  1 305 ? -16.44834 -4.21947   81.91186  1.000 53.77316  ? 285  ASP B OD1 1 
ATOM   5445  O OD2 . ASP B  1 305 ? -14.78518 -5.62113   82.02534  1.000 53.91706  ? 285  ASP B OD2 1 
ATOM   5446  N N   . VAL B  1 306 ? -16.68874 -4.19282   77.22658  1.000 55.48800  ? 286  VAL B N   1 
ATOM   5447  C CA  . VAL B  1 306 ? -16.45197 -4.27370   75.78825  1.000 56.99347  ? 286  VAL B CA  1 
ATOM   5448  C C   . VAL B  1 306 ? -15.51577 -5.43380   75.47884  1.000 60.31627  ? 286  VAL B C   1 
ATOM   5449  O O   . VAL B  1 306 ? -15.75206 -6.21417   74.55055  1.000 56.33105  ? 286  VAL B O   1 
ATOM   5450  C CB  . VAL B  1 306 ? -15.88055 -2.94846   75.25378  1.000 60.17560  ? 286  VAL B CB  1 
ATOM   5451  C CG1 . VAL B  1 306 ? -15.70573 -3.02130   73.75547  1.000 61.94212  ? 286  VAL B CG1 1 
ATOM   5452  C CG2 . VAL B  1 306 ? -16.76843 -1.79064   75.62835  1.000 61.62155  ? 286  VAL B CG2 1 
ATOM   5453  N N   . VAL B  1 307 ? -14.43633 -5.55773   76.24809  1.000 59.46816  ? 287  VAL B N   1 
ATOM   5454  C CA  . VAL B  1 307 ? -13.48984 -6.66347   76.10115  1.000 62.31044  ? 287  VAL B CA  1 
ATOM   5455  C C   . VAL B  1 307 ? -13.40646 -7.42269   77.42199  1.000 60.52225  ? 287  VAL B C   1 
ATOM   5456  O O   . VAL B  1 307 ? -12.51001 -7.14866   78.23536  1.000 55.67864  ? 287  VAL B O   1 
ATOM   5457  C CB  . VAL B  1 307 ? -12.10472 -6.15392   75.66346  1.000 68.08954  ? 287  VAL B CB  1 
ATOM   5458  C CG1 . VAL B  1 307 ? -11.25952 -7.29103   75.14812  1.000 67.86693  ? 287  VAL B CG1 1 
ATOM   5459  C CG2 . VAL B  1 307 ? -12.24371 -5.07512   74.60360  1.000 68.26841  ? 287  VAL B CG2 1 
ATOM   5460  N N   . PRO B  1 308 ? -14.29991 -8.37952   77.67848  1.000 55.37919  ? 288  PRO B N   1 
ATOM   5461  C CA  . PRO B  1 308 ? -14.30321 -9.05860   78.98247  1.000 54.94406  ? 288  PRO B CA  1 
ATOM   5462  C C   . PRO B  1 308 ? -13.07759 -9.94718   79.16121  1.000 56.09652  ? 288  PRO B C   1 
ATOM   5463  O O   . PRO B  1 308 ? -12.45979 -10.40951  78.20024  1.000 51.58306  ? 288  PRO B O   1 
ATOM   5464  C CB  . PRO B  1 308 ? -15.58781 -9.90166   78.94908  1.000 55.06219  ? 288  PRO B CB  1 
ATOM   5465  C CG  . PRO B  1 308 ? -16.37461 -9.41896   77.72065  1.000 53.64748  ? 288  PRO B CG  1 
ATOM   5466  C CD  . PRO B  1 308 ? -15.33598 -8.91074   76.77146  1.000 53.87677  ? 288  PRO B CD  1 
ATOM   5467  N N   . ASP B  1 309 ? -12.73110 -10.18952  80.42958  1.000 53.38654  ? 289  ASP B N   1 
ATOM   5468  C CA  . ASP B  1 309 ? -11.66095 -11.13768  80.72468  1.000 52.92748  ? 289  ASP B CA  1 
ATOM   5469  C C   . ASP B  1 309 ? -12.01756 -12.55070  80.27637  1.000 58.38611  ? 289  ASP B C   1 
ATOM   5470  O O   . ASP B  1 309 ? -11.13329 -13.30764  79.86201  1.000 64.51925  ? 289  ASP B O   1 
ATOM   5471  C CB  . ASP B  1 309 ? -11.34436 -11.13166  82.21758  1.000 52.11961  ? 289  ASP B CB  1 
ATOM   5472  C CG  . ASP B  1 309 ? -10.74260 -9.82378   82.67545  1.000 57.87376  ? 289  ASP B CG  1 
ATOM   5473  O OD1 . ASP B  1 309 ? -10.18853 -9.07890   81.83871  1.000 60.50360  ? 289  ASP B OD1 1 
ATOM   5474  O OD2 . ASP B  1 309 ? -10.81460 -9.54168   83.88204  1.000 61.33313  ? 289  ASP B OD2 1 
ATOM   5475  N N   . LEU B  1 310 ? -13.29246 -12.92493  80.34876  1.000 53.25488  ? 290  LEU B N   1 
ATOM   5476  C CA  . LEU B  1 310 ? -13.74984 -14.25153  79.96930  1.000 46.54092  ? 290  LEU B CA  1 
ATOM   5477  C C   . LEU B  1 310 ? -14.58561 -14.13187  78.70414  1.000 52.68103  ? 290  LEU B C   1 
ATOM   5478  O O   . LEU B  1 310 ? -15.54700 -13.35324  78.66448  1.000 51.91188  ? 290  LEU B O   1 
ATOM   5479  C CB  . LEU B  1 310 ? -14.55580 -14.89051  81.09981  1.000 43.55629  ? 290  LEU B CB  1 
ATOM   5480  C CG  . LEU B  1 310 ? -15.19768 -16.25676  80.80605  1.000 41.59959  ? 290  LEU B CG  1 
ATOM   5481  C CD1 . LEU B  1 310 ? -14.15709 -17.37211  80.68381  1.000 40.88969  ? 290  LEU B CD1 1 
ATOM   5482  C CD2 . LEU B  1 310 ? -16.22262 -16.59028  81.87217  1.000 40.78053  ? 290  LEU B CD2 1 
ATOM   5483  N N   . ASP B  1 311 ? -14.22231 -14.90782  77.67778  1.000 55.41860  ? 291  ASP B N   1 
ATOM   5484  C CA  . ASP B  1 311 ? -14.89166 -14.87090  76.37568  1.000 58.15939  ? 291  ASP B CA  1 
ATOM   5485  C C   . ASP B  1 311 ? -15.98865 -15.92949  76.35682  1.000 56.13195  ? 291  ASP B C   1 
ATOM   5486  O O   . ASP B  1 311 ? -15.76498 -17.08604  75.98376  1.000 49.37229  ? 291  ASP B O   1 
ATOM   5487  C CB  . ASP B  1 311 ? -13.88824 -15.09250  75.24992  1.000 61.51007  ? 291  ASP B CB  1 
ATOM   5488  C CG  . ASP B  1 311 ? -14.53707 -15.07399  73.87267  1.000 61.15533  ? 291  ASP B CG  1 
ATOM   5489  O OD1 . ASP B  1 311 ? -15.72791 -14.68525  73.78269  1.000 60.29562  ? 291  ASP B OD1 1 
ATOM   5490  O OD2 . ASP B  1 311 ? -13.85312 -15.43723  72.88464  1.000 56.94975  ? 291  ASP B OD2 1 
ATOM   5491  N N   . ILE B  1 312 ? -17.20548 -15.52626  76.74537  1.000 54.82531  ? 292  ILE B N   1 
ATOM   5492  C CA  . ILE B  1 312 ? -18.32280 -16.47012  76.72953  1.000 50.93141  ? 292  ILE B CA  1 
ATOM   5493  C C   . ILE B  1 312 ? -18.83888 -16.72324  75.32374  1.000 49.44134  ? 292  ILE B C   1 
ATOM   5494  O O   . ILE B  1 312 ? -19.83421 -17.43723  75.16017  1.000 50.06592  ? 292  ILE B O   1 
ATOM   5495  C CB  . ILE B  1 312 ? -19.48492 -16.01279  77.64365  1.000 46.74896  ? 292  ILE B CB  1 
ATOM   5496  C CG1 . ILE B  1 312 ? -20.24733 -14.81910  77.06011  1.000 42.78276  ? 292  ILE B CG1 1 
ATOM   5497  C CG2 . ILE B  1 312 ? -18.98781 -15.64145  79.03882  1.000 45.00399  ? 292  ILE B CG2 1 
ATOM   5498  C CD1 . ILE B  1 312 ? -21.39455 -14.32446  77.98424  1.000 39.30564  ? 292  ILE B CD1 1 
ATOM   5499  N N   . TYR B  1 313 ? -18.19925 -16.16363  74.30125  1.000 50.85287  ? 293  TYR B N   1 
ATOM   5500  C CA  . TYR B  1 313 ? -18.58277 -16.41813  72.92135  1.000 50.77416  ? 293  TYR B CA  1 
ATOM   5501  C C   . TYR B  1 313 ? -17.58382 -17.31445  72.21133  1.000 52.60679  ? 293  TYR B C   1 
ATOM   5502  O O   . TYR B  1 313 ? -17.73416 -17.55694  71.01212  1.000 57.81645  ? 293  TYR B O   1 
ATOM   5503  C CB  . TYR B  1 313 ? -18.77133 -15.09034  72.16331  1.000 49.79263  ? 293  TYR B CB  1 
ATOM   5504  C CG  . TYR B  1 313 ? -19.95506 -14.31021  72.70176  1.000 55.19114  ? 293  TYR B CG  1 
ATOM   5505  C CD1 . TYR B  1 313 ? -19.80398 -13.44064  73.77609  1.000 56.66008  ? 293  TYR B CD1 1 
ATOM   5506  C CD2 . TYR B  1 313 ? -21.22640 -14.46722  72.16269  1.000 56.93202  ? 293  TYR B CD2 1 
ATOM   5507  C CE1 . TYR B  1 313 ? -20.87196 -12.75455  74.29261  1.000 56.17503  ? 293  TYR B CE1 1 
ATOM   5508  C CE2 . TYR B  1 313 ? -22.31099 -13.77258  72.68039  1.000 58.83156  ? 293  TYR B CE2 1 
ATOM   5509  C CZ  . TYR B  1 313 ? -22.12430 -12.92166  73.74557  1.000 55.97749  ? 293  TYR B CZ  1 
ATOM   5510  O OH  . TYR B  1 313 ? -23.19450 -12.23214  74.26758  1.000 53.08572  ? 293  TYR B OH  1 
ATOM   5511  N N   . ASP B  1 314 ? -16.59040 -17.83462  72.92918  1.000 51.71497  ? 294  ASP B N   1 
ATOM   5512  C CA  . ASP B  1 314 ? -15.60919 -18.74178  72.34692  1.000 57.71574  ? 294  ASP B CA  1 
ATOM   5513  C C   . ASP B  1 314 ? -16.23852 -20.09652  72.02348  1.000 57.38483  ? 294  ASP B C   1 
ATOM   5514  O O   . ASP B  1 314 ? -16.64561 -20.83271  72.92641  1.000 57.20148  ? 294  ASP B O   1 
ATOM   5515  C CB  . ASP B  1 314 ? -14.43654 -18.92453  73.30286  1.000 62.21695  ? 294  ASP B CB  1 
ATOM   5516  C CG  . ASP B  1 314 ? -13.44272 -19.95499  72.80299  1.000 69.63901  ? 294  ASP B CG  1 
ATOM   5517  O OD1 . ASP B  1 314 ? -12.43431 -19.56797  72.18004  1.000 73.02756  ? 294  ASP B OD1 1 
ATOM   5518  O OD2 . ASP B  1 314 ? -13.67516 -21.15899  73.02253  1.000 72.79328  ? 294  ASP B OD2 1 
ATOM   5519  N N   . LYS B  1 315 ? -16.27833 -20.44570  70.74204  1.000 54.89277  ? 295  LYS B N   1 
ATOM   5520  C CA  . LYS B  1 315 ? -16.88647 -21.68999  70.30234  1.000 55.47911  ? 295  LYS B CA  1 
ATOM   5521  C C   . LYS B  1 315 ? -15.90706 -22.85417  70.26911  1.000 55.35253  ? 295  LYS B C   1 
ATOM   5522  O O   . LYS B  1 315 ? -16.30910 -23.97193  69.91402  1.000 53.22425  ? 295  LYS B O   1 
ATOM   5523  C CB  . LYS B  1 315 ? -17.52169 -21.50615  68.91413  1.000 59.63198  ? 295  LYS B CB  1 
ATOM   5524  C CG  . LYS B  1 315 ? -18.73515 -20.56992  68.90353  1.000 61.84966  ? 295  LYS B CG  1 
ATOM   5525  C CD  . LYS B  1 315 ? -19.10244 -20.10288  67.49496  1.000 68.85743  ? 295  LYS B CD  1 
ATOM   5526  C CE  . LYS B  1 315 ? -19.96005 -21.12991  66.75185  1.000 74.74083  ? 295  LYS B CE  1 
ATOM   5527  N NZ  . LYS B  1 315 ? -21.40785 -21.09732  67.14053  1.000 75.72115  ? 295  LYS B NZ  1 
ATOM   5528  N N   . SER B  1 316 ? -14.64732 -22.63190  70.64536  1.000 52.47146  ? 296  SER B N   1 
ATOM   5529  C CA  . SER B  1 316 ? -13.62004 -23.65656  70.50722  1.000 56.09464  ? 296  SER B CA  1 
ATOM   5530  C C   . SER B  1 316 ? -13.40539 -24.48565  71.77188  1.000 53.47040  ? 296  SER B C   1 
ATOM   5531  O O   . SER B  1 316 ? -12.84181 -25.58188  71.69195  1.000 52.76181  ? 296  SER B O   1 
ATOM   5532  C CB  . SER B  1 316 ? -12.29060 -23.01561  70.08962  1.000 62.68044  ? 296  SER B CB  1 
ATOM   5533  O OG  . SER B  1 316 ? -11.84702 -22.11248  71.08971  1.000 65.32381  ? 296  SER B OG  1 
ATOM   5534  N N   . TRP B  1 317 ? -13.80707 -23.99271  72.93418  1.000 53.60214  ? 297  TRP B N   1 
ATOM   5535  C CA  . TRP B  1 317 ? -13.78932 -24.77175  74.17161  1.000 47.73505  ? 297  TRP B CA  1 
ATOM   5536  C C   . TRP B  1 317 ? -15.12234 -24.53798  74.84208  1.000 45.03599  ? 297  TRP B C   1 
ATOM   5537  O O   . TRP B  1 317 ? -15.20561 -23.84939  75.86425  1.000 44.09548  ? 297  TRP B O   1 
ATOM   5538  C CB  . TRP B  1 317 ? -12.64083 -24.37174  75.09177  1.000 41.41128  ? 297  TRP B CB  1 
ATOM   5539  C CG  . TRP B  1 317 ? -12.26835 -25.39835  76.14908  1.000 43.11684  ? 297  TRP B CG  1 
ATOM   5540  C CD1 . TRP B  1 317 ? -12.63541 -25.38817  77.46645  1.000 39.44870  ? 297  TRP B CD1 1 
ATOM   5541  C CD2 . TRP B  1 317 ? -11.42358 -26.55282  75.97833  1.000 40.43667  ? 297  TRP B CD2 1 
ATOM   5542  N NE1 . TRP B  1 317 ? -12.07994 -26.46712  78.11875  1.000 38.44671  ? 297  TRP B NE1 1 
ATOM   5543  C CE2 . TRP B  1 317 ? -11.32262 -27.18660  77.23210  1.000 39.34617  ? 297  TRP B CE2 1 
ATOM   5544  C CE3 . TRP B  1 317 ? -10.75347 -27.11132  74.88655  1.000 41.75475  ? 297  TRP B CE3 1 
ATOM   5545  C CZ2 . TRP B  1 317 ? -10.57457 -28.35313  77.42749  1.000 40.23271  ? 297  TRP B CZ2 1 
ATOM   5546  C CZ3 . TRP B  1 317 ? -10.00549 -28.27782  75.08012  1.000 46.24104  ? 297  TRP B CZ3 1 
ATOM   5547  C CH2 . TRP B  1 317 ? -9.92594  -28.88459  76.34135  1.000 45.32723  ? 297  TRP B CH2 1 
ATOM   5548  N N   . PRO B  1 318 ? -16.18967 -25.09515  74.28511  1.000 44.15172  ? 298  PRO B N   1 
ATOM   5549  C CA  . PRO B  1 318 ? -17.53371 -24.67131  74.69136  1.000 42.19950  ? 298  PRO B CA  1 
ATOM   5550  C C   . PRO B  1 318 ? -17.87286 -25.14762  76.09426  1.000 40.94217  ? 298  PRO B C   1 
ATOM   5551  O O   . PRO B  1 318 ? -17.36661 -26.17022  76.57155  1.000 40.26629  ? 298  PRO B O   1 
ATOM   5552  C CB  . PRO B  1 318 ? -18.44232 -25.32344  73.64183  1.000 38.15834  ? 298  PRO B CB  1 
ATOM   5553  C CG  . PRO B  1 318 ? -17.66721 -26.57462  73.22220  1.000 40.56002  ? 298  PRO B CG  1 
ATOM   5554  C CD  . PRO B  1 318 ? -16.20958 -26.17976  73.27961  1.000 43.90959  ? 298  PRO B CD  1 
ATOM   5555  N N   . ILE B  1 319 ? -18.73331 -24.38011  76.75610  1.000 39.38762  ? 299  ILE B N   1 
ATOM   5556  C CA  . ILE B  1 319 ? -19.26733 -24.74376  78.06224  1.000 40.35697  ? 299  ILE B CA  1 
ATOM   5557  C C   . ILE B  1 319 ? -20.63634 -25.38273  77.84623  1.000 41.25695  ? 299  ILE B C   1 
ATOM   5558  O O   . ILE B  1 319 ? -21.59704 -24.71417  77.44533  1.000 32.87793  ? 299  ILE B O   1 
ATOM   5559  C CB  . ILE B  1 319 ? -19.34643 -23.53849  79.00977  1.000 38.65975  ? 299  ILE B CB  1 
ATOM   5560  C CG1 . ILE B  1 319 ? -17.96210 -22.92385  79.16777  1.000 42.06363  ? 299  ILE B CG1 1 
ATOM   5561  C CG2 . ILE B  1 319 ? -19.84334 -23.97092  80.37359  1.000 34.54604  ? 299  ILE B CG2 1 
ATOM   5562  C CD1 . ILE B  1 319 ? -16.92754 -23.92457  79.61318  1.000 42.41984  ? 299  ILE B CD1 1 
ATOM   5563  N N   . TRP B  1 320 ? -20.71466 -26.68590  78.10259  1.000 37.46368  ? 300  TRP B N   1 
ATOM   5564  C CA  . TRP B  1 320 ? -21.99246 -27.38921  78.10638  1.000 38.92573  ? 300  TRP B CA  1 
ATOM   5565  C C   . TRP B  1 320 ? -22.71323 -27.12443  79.41981  1.000 38.65107  ? 300  TRP B C   1 
ATOM   5566  O O   . TRP B  1 320 ? -22.07749 -27.00572  80.46962  1.000 30.56307  ? 300  TRP B O   1 
ATOM   5567  C CB  . TRP B  1 320 ? -21.80132 -28.90045  77.93105  1.000 40.85118  ? 300  TRP B CB  1 
ATOM   5568  C CG  . TRP B  1 320 ? -23.11562 -29.60875  77.85773  1.000 42.77698  ? 300  TRP B CG  1 
ATOM   5569  C CD1 . TRP B  1 320 ? -23.78892 -30.25392  78.88623  1.000 37.67843  ? 300  TRP B CD1 1 
ATOM   5570  C CD2 . TRP B  1 320 ? -23.95419 -29.71864  76.70010  1.000 39.46880  ? 300  TRP B CD2 1 
ATOM   5571  N NE1 . TRP B  1 320 ? -24.97242 -30.76875  78.41230  1.000 30.36300  ? 300  TRP B NE1 1 
ATOM   5572  C CE2 . TRP B  1 320 ? -25.10447 -30.45029  77.08309  1.000 36.23963  ? 300  TRP B CE2 1 
ATOM   5573  C CE3 . TRP B  1 320 ? -23.84211 -29.27390  75.37599  1.000 38.69852  ? 300  TRP B CE3 1 
ATOM   5574  C CZ2 . TRP B  1 320 ? -26.14195 -30.73419  76.18467  1.000 31.97646  ? 300  TRP B CZ2 1 
ATOM   5575  C CZ3 . TRP B  1 320 ? -24.86670 -29.57326  74.48035  1.000 38.34183  ? 300  TRP B CZ3 1 
ATOM   5576  C CH2 . TRP B  1 320 ? -26.00109 -30.29308  74.89389  1.000 33.84882  ? 300  TRP B CH2 1 
ATOM   5577  N N   . THR B  1 321 ? -24.04004 -27.04367  79.34952  1.000 34.33110  ? 301  THR B N   1 
ATOM   5578  C CA  . THR B  1 321 ? -24.89116 -26.76942  80.49984  1.000 34.34752  ? 301  THR B CA  1 
ATOM   5579  C C   . THR B  1 321 ? -26.28135 -27.33658  80.23972  1.000 37.67176  ? 301  THR B C   1 
ATOM   5580  O O   . THR B  1 321 ? -26.58359 -27.81577  79.14540  1.000 38.53210  ? 301  THR B O   1 
ATOM   5581  C CB  . THR B  1 321 ? -25.00300 -25.27041  80.78703  1.000 38.17413  ? 301  THR B CB  1 
ATOM   5582  O OG1 . THR B  1 321 ? -25.36299 -25.13083  82.16215  1.000 37.53595  ? 301  THR B OG1 1 
ATOM   5583  C CG2 . THR B  1 321 ? -26.07559 -24.58413  79.84610  1.000 30.93150  ? 301  THR B CG2 1 
ATOM   5584  N N   . TYR B  1 322 ? -27.14362 -27.25325  81.25351  1.000 40.27533  ? 302  TYR B N   1 
ATOM   5585  C CA  . TYR B  1 322 ? -28.55290 -27.53440  81.02436  1.000 36.21408  ? 302  TYR B CA  1 
ATOM   5586  C C   . TYR B  1 322 ? -29.23664 -26.30749  80.42547  1.000 37.94654  ? 302  TYR B C   1 
ATOM   5587  O O   . TYR B  1 322 ? -29.09986 -25.19015  80.93304  1.000 41.03648  ? 302  TYR B O   1 
ATOM   5588  C CB  . TYR B  1 322 ? -29.27434 -27.95627  82.30107  1.000 34.95252  ? 302  TYR B CB  1 
ATOM   5589  C CG  . TYR B  1 322 ? -30.75203 -28.14910  82.02987  1.000 35.87958  ? 302  TYR B CG  1 
ATOM   5590  C CD1 . TYR B  1 322 ? -31.20263 -29.21633  81.24477  1.000 38.17827  ? 302  TYR B CD1 1 
ATOM   5591  C CD2 . TYR B  1 322 ? -31.69518 -27.23601  82.50525  1.000 31.13338  ? 302  TYR B CD2 1 
ATOM   5592  C CE1 . TYR B  1 322 ? -32.53845 -29.37942  80.97166  1.000 31.80270  ? 302  TYR B CE1 1 
ATOM   5593  C CE2 . TYR B  1 322 ? -33.03040 -27.39602  82.24163  1.000 31.86774  ? 302  TYR B CE2 1 
ATOM   5594  C CZ  . TYR B  1 322 ? -33.44719 -28.45980  81.47916  1.000 32.22755  ? 302  TYR B CZ  1 
ATOM   5595  O OH  . TYR B  1 322 ? -34.77754 -28.61367  81.21942  1.000 39.66801  ? 302  TYR B OH  1 
ATOM   5596  N N   . ALA B  1 323 ? -29.96387 -26.51692  79.33654  1.000 34.28549  ? 303  ALA B N   1 
ATOM   5597  C CA  . ALA B  1 323 ? -30.62999 -25.42054  78.66714  1.000 34.76837  ? 303  ALA B CA  1 
ATOM   5598  C C   . ALA B  1 323 ? -31.91514 -25.94432  78.04064  1.000 39.98923  ? 303  ALA B C   1 
ATOM   5599  O O   . ALA B  1 323 ? -32.08767 -27.15005  77.82565  1.000 35.21638  ? 303  ALA B O   1 
ATOM   5600  C CB  . ALA B  1 323 ? -29.72902 -24.77284  77.61145  1.000 40.59612  ? 303  ALA B CB  1 
ATOM   5601  N N   . GLU B  1 324 ? -32.83009 -25.01563  77.79019  1.000 33.33290  ? 304  GLU B N   1 
ATOM   5602  C CA  . GLU B  1 324 ? -34.11052 -25.30254  77.17710  1.000 35.76465  ? 304  GLU B CA  1 
ATOM   5603  C C   . GLU B  1 324 ? -34.31698 -24.36433  75.99842  1.000 38.19676  ? 304  GLU B C   1 
ATOM   5604  O O   . GLU B  1 324 ? -33.71497 -23.29327  75.91870  1.000 39.81396  ? 304  GLU B O   1 
ATOM   5605  C CB  . GLU B  1 324 ? -35.26784 -25.13825  78.17598  1.000 35.24852  ? 304  GLU B CB  1 
ATOM   5606  C CG  . GLU B  1 324 ? -35.30818 -26.20497  79.25332  1.000 43.17453  ? 304  GLU B CG  1 
ATOM   5607  C CD  . GLU B  1 324 ? -36.39900 -25.97132  80.30169  1.000 46.11107  ? 304  GLU B CD  1 
ATOM   5608  O OE1 . GLU B  1 324 ? -37.19129 -25.00469  80.17507  1.000 46.90401  ? 304  GLU B OE1 1 
ATOM   5609  O OE2 . GLU B  1 324 ? -36.45970 -26.76735  81.25722  1.000 46.70711  ? 304  GLU B OE2 1 
ATOM   5610  N N   . ILE B  1 325 ? -35.19002 -24.77637  75.08393  1.000 41.87102  ? 305  ILE B N   1 
ATOM   5611  C CA  . ILE B  1 325 ? -35.66621 -23.86887  74.04855  1.000 41.35611  ? 305  ILE B CA  1 
ATOM   5612  C C   . ILE B  1 325 ? -36.43369 -22.74038  74.73829  1.000 43.66706  ? 305  ILE B C   1 
ATOM   5613  O O   . ILE B  1 325 ? -37.48386 -22.96873  75.34450  1.000 45.10329  ? 305  ILE B O   1 
ATOM   5614  C CB  . ILE B  1 325 ? -36.54345 -24.59558  73.02344  1.000 45.32215  ? 305  ILE B CB  1 
ATOM   5615  C CG1 . ILE B  1 325 ? -35.75498 -25.69274  72.29972  1.000 42.72545  ? 305  ILE B CG1 1 
ATOM   5616  C CG2 . ILE B  1 325 ? -37.07816 -23.60243  72.01668  1.000 50.58733  ? 305  ILE B CG2 1 
ATOM   5617  C CD1 . ILE B  1 325 ? -36.59669 -26.54298  71.40331  1.000 42.26520  ? 305  ILE B CD1 1 
ATOM   5618  N N   . THR B  1 326 ? -35.90383 -21.52741  74.66455  1.000 44.10583  ? 306  THR B N   1 
ATOM   5619  C CA  . THR B  1 326 ? -36.50629 -20.35849  75.27573  1.000 50.14966  ? 306  THR B CA  1 
ATOM   5620  C C   . THR B  1 326 ? -36.88708 -19.35396  74.19685  1.000 52.69228  ? 306  THR B C   1 
ATOM   5621  O O   . THR B  1 326 ? -36.26305 -19.30970  73.13237  1.000 50.47523  ? 306  THR B O   1 
ATOM   5622  C CB  . THR B  1 326 ? -35.56081 -19.67498  76.27796  1.000 51.74805  ? 306  THR B CB  1 
ATOM   5623  O OG1 . THR B  1 326 ? -34.34709 -19.29547  75.61335  1.000 54.52394  ? 306  THR B OG1 1 
ATOM   5624  C CG2 . THR B  1 326 ? -35.24427 -20.60514  77.44003  1.000 49.73185  ? 306  THR B CG2 1 
ATOM   5625  N N   . PRO B  1 327 ? -37.91673 -18.55344  74.43434  1.000 48.54388  ? 307  PRO B N   1 
ATOM   5626  C CA  . PRO B  1 327 ? -38.22562 -17.45325  73.52509  1.000 48.81918  ? 307  PRO B CA  1 
ATOM   5627  C C   . PRO B  1 327 ? -37.07516 -16.46690  73.47871  1.000 43.85678  ? 307  PRO B C   1 
ATOM   5628  O O   . PRO B  1 327 ? -36.21732 -16.46908  74.37486  1.000 41.84790  ? 307  PRO B O   1 
ATOM   5629  C CB  . PRO B  1 327 ? -39.47745 -16.82156  74.15202  1.000 49.70596  ? 307  PRO B CB  1 
ATOM   5630  C CG  . PRO B  1 327 ? -40.07134 -17.92476  74.95996  1.000 49.09215  ? 307  PRO B CG  1 
ATOM   5631  C CD  . PRO B  1 327 ? -38.92730 -18.71200  75.48912  1.000 43.84142  ? 307  PRO B CD  1 
ATOM   5632  N N   . PRO B  1 328 ? -37.01177 -15.62624  72.44746  1.000 39.92239  ? 308  PRO B N   1 
ATOM   5633  C CA  . PRO B  1 328 ? -35.99622 -14.55751  72.40909  1.000 39.87291  ? 308  PRO B CA  1 
ATOM   5634  C C   . PRO B  1 328 ? -36.24856 -13.48018  73.46765  1.000 39.97955  ? 308  PRO B C   1 
ATOM   5635  O O   . PRO B  1 328 ? -37.26224 -13.45697  74.16181  1.000 40.48393  ? 308  PRO B O   1 
ATOM   5636  C CB  . PRO B  1 328 ? -36.13526 -13.98779  70.99133  1.000 41.20404  ? 308  PRO B CB  1 
ATOM   5637  C CG  . PRO B  1 328 ? -37.55784 -14.35912  70.58126  1.000 42.73300  ? 308  PRO B CG  1 
ATOM   5638  C CD  . PRO B  1 328 ? -37.82913 -15.67844  71.22380  1.000 39.46281  ? 308  PRO B CD  1 
ATOM   5639  N N   . ALA B  1 329 ? -35.27990 -12.57818  73.60109  1.000 41.96107  ? 309  ALA B N   1 
ATOM   5640  C CA  . ALA B  1 329 ? -35.43562 -11.42958  74.48739  1.000 38.51449  ? 309  ALA B CA  1 
ATOM   5641  C C   . ALA B  1 329 ? -36.23169 -10.34344  73.78298  1.000 40.41555  ? 309  ALA B C   1 
ATOM   5642  O O   . ALA B  1 329 ? -36.14649 -10.18539  72.56359  1.000 45.87057  ? 309  ALA B O   1 
ATOM   5643  C CB  . ALA B  1 329 ? -34.06985 -10.89721  74.92078  1.000 35.19043  ? 309  ALA B CB  1 
ATOM   5644  N N   . LYS B  1 330 ? -37.01853 -9.59455   74.55593  1.000 39.88610  ? 310  LYS B N   1 
ATOM   5645  C CA  . LYS B  1 330 ? -37.94527 -8.60320   74.00659  1.000 38.50435  ? 310  LYS B CA  1 
ATOM   5646  C C   . LYS B  1 330 ? -37.78195 -7.25643   74.71436  1.000 38.93288  ? 310  LYS B C   1 
ATOM   5647  O O   . LYS B  1 330 ? -37.75199 -7.19895   75.94421  1.000 40.01834  ? 310  LYS B O   1 
ATOM   5648  C CB  . LYS B  1 330 ? -39.39507 -9.09720   74.14208  1.000 39.48484  ? 310  LYS B CB  1 
ATOM   5649  C CG  . LYS B  1 330 ? -40.44117 -8.20160   73.51025  1.000 40.11432  ? 310  LYS B CG  1 
ATOM   5650  C CD  . LYS B  1 330 ? -41.72596 -8.95420   73.17341  1.000 43.06267  ? 310  LYS B CD  1 
ATOM   5651  C CE  . LYS B  1 330 ? -42.85213 -7.98952   72.74660  1.000 42.21700  ? 310  LYS B CE  1 
ATOM   5652  N NZ  . LYS B  1 330 ? -42.56456 -7.43501   71.39365  1.000 46.33660  ? 310  LYS B NZ  1 
ATOM   5653  N N   . PHE B  1 331 ? -37.68794 -6.17653   73.93474  1.000 42.54256  ? 311  PHE B N   1 
ATOM   5654  C CA  . PHE B  1 331 ? -37.56985 -4.81013   74.44077  1.000 45.97023  ? 311  PHE B CA  1 
ATOM   5655  C C   . PHE B  1 331 ? -38.75197 -4.01195   73.91672  1.000 43.64374  ? 311  PHE B C   1 
ATOM   5656  O O   . PHE B  1 331 ? -38.92586 -3.89740   72.70223  1.000 47.96958  ? 311  PHE B O   1 
ATOM   5657  C CB  . PHE B  1 331 ? -36.24519 -4.17985   73.99942  1.000 40.26134  ? 311  PHE B CB  1 
ATOM   5658  C CG  . PHE B  1 331 ? -35.03592 -4.98741   74.41974  1.000 39.18535  ? 311  PHE B CG  1 
ATOM   5659  C CD1 . PHE B  1 331 ? -34.40648 -4.73331   75.62995  1.000 39.13164  ? 311  PHE B CD1 1 
ATOM   5660  C CD2 . PHE B  1 331 ? -34.56528 -6.03476   73.62841  1.000 49.41948  ? 311  PHE B CD2 1 
ATOM   5661  C CE1 . PHE B  1 331 ? -33.32434 -5.45760   76.04011  1.000 38.22142  ? 311  PHE B CE1 1 
ATOM   5662  C CE2 . PHE B  1 331 ? -33.45934 -6.80184   74.04202  1.000 44.42017  ? 311  PHE B CE2 1 
ATOM   5663  C CZ  . PHE B  1 331 ? -32.83893 -6.50301   75.25194  1.000 39.22090  ? 311  PHE B CZ  1 
ATOM   5664  N N   . VAL B  1 332 ? -39.56488 -3.47017   74.82053  1.000 42.88060  ? 312  VAL B N   1 
ATOM   5665  C CA  . VAL B  1 332 ? -40.81426 -2.83539   74.42512  1.000 48.49909  ? 312  VAL B CA  1 
ATOM   5666  C C   . VAL B  1 332 ? -40.97951 -1.48360   75.12697  1.000 50.23773  ? 312  VAL B C   1 
ATOM   5667  O O   . VAL B  1 332 ? -40.40086 -1.23777   76.19129  1.000 48.01105  ? 312  VAL B O   1 
ATOM   5668  C CB  . VAL B  1 332 ? -42.00691 -3.78819   74.69882  1.000 54.01067  ? 312  VAL B CB  1 
ATOM   5669  C CG1 . VAL B  1 332 ? -42.25263 -3.94247   76.17371  1.000 52.34140  ? 312  VAL B CG1 1 
ATOM   5670  C CG2 . VAL B  1 332 ? -43.25751 -3.31251   74.00852  1.000 57.79713  ? 312  VAL B CG2 1 
ATOM   5671  N N   . HIS B  1 333 ? -41.75498 -0.59669   74.48306  1.000 46.47610  ? 313  HIS B N   1 
ATOM   5672  C CA  . HIS B  1 333 ? -42.12321 0.75412    74.91512  1.000 50.14443  ? 313  HIS B CA  1 
ATOM   5673  C C   . HIS B  1 333 ? -41.06974 1.79503    74.54594  1.000 49.78914  ? 313  HIS B C   1 
ATOM   5674  O O   . HIS B  1 333 ? -39.86612 1.57399    74.70636  1.000 49.71855  ? 313  HIS B O   1 
ATOM   5675  C CB  . HIS B  1 333 ? -42.41715 0.81678    76.42159  1.000 50.69269  ? 313  HIS B CB  1 
ATOM   5676  C CG  . HIS B  1 333 ? -43.69705 0.14947    76.81429  1.000 48.66073  ? 313  HIS B CG  1 
ATOM   5677  N ND1 . HIS B  1 333 ? -44.93194 0.61878    76.41829  1.000 50.44482  ? 313  HIS B ND1 1 
ATOM   5678  C CD2 . HIS B  1 333 ? -43.93386 -0.94319   77.57732  1.000 47.58094  ? 313  HIS B CD2 1 
ATOM   5679  C CE1 . HIS B  1 333 ? -45.87275 -0.16527   76.91252  1.000 50.47848  ? 313  HIS B CE1 1 
ATOM   5680  N NE2 . HIS B  1 333 ? -45.29360 -1.11958   77.62014  1.000 48.77199  ? 313  HIS B NE2 1 
ATOM   5681  N N   . ASP B  1 334 ? -41.52301 2.94129    74.04976  1.000 52.29009  ? 314  ASP B N   1 
ATOM   5682  C CA  . ASP B  1 334 ? -40.60965 3.99690    73.64164  1.000 53.14725  ? 314  ASP B CA  1 
ATOM   5683  C C   . ASP B  1 334 ? -41.32731 5.33877    73.57140  1.000 56.71419  ? 314  ASP B C   1 
ATOM   5684  O O   . ASP B  1 334 ? -41.37942 5.97661    72.51501  1.000 57.05825  ? 314  ASP B O   1 
ATOM   5685  C CB  . ASP B  1 334 ? -39.97675 3.65053    72.29623  1.000 55.35493  ? 314  ASP B CB  1 
ATOM   5686  C CG  . ASP B  1 334 ? -38.93084 4.64839    71.87937  1.000 64.20045  ? 314  ASP B CG  1 
ATOM   5687  O OD1 . ASP B  1 334 ? -38.11084 5.04952    72.73438  1.000 67.31799  ? 314  ASP B OD1 1 
ATOM   5688  O OD2 . ASP B  1 334 ? -38.93627 5.04055    70.69568  1.000 69.28976  ? 314  ASP B OD2 1 
ATOM   5689  N N   . ASP B  1 335 ? -41.90771 5.76906    74.67736  1.000 59.26837  ? 315  ASP B N   1 
ATOM   5690  C CA  . ASP B  1 335 ? -42.45029 7.11541    74.78317  1.000 66.91711  ? 315  ASP B CA  1 
ATOM   5691  C C   . ASP B  1 335 ? -41.55662 7.91611    75.72963  1.000 71.35215  ? 315  ASP B C   1 
ATOM   5692  O O   . ASP B  1 335 ? -40.59229 7.39040    76.28859  1.000 73.19964  ? 315  ASP B O   1 
ATOM   5693  C CB  . ASP B  1 335 ? -43.91293 7.07521    75.23824  1.000 69.37535  ? 315  ASP B CB  1 
ATOM   5694  C CG  . ASP B  1 335 ? -44.12599 6.22661    76.49133  1.000 71.16956  ? 315  ASP B CG  1 
ATOM   5695  O OD1 . ASP B  1 335 ? -43.44874 6.49863    77.50325  1.000 72.43746  ? 315  ASP B OD1 1 
ATOM   5696  O OD2 . ASP B  1 335 ? -44.98984 5.31446    76.48178  1.000 70.23198  ? 315  ASP B OD2 1 
ATOM   5697  N N   . GLU B  1 336 ? -41.85847 9.20505    75.90438  1.000 77.32814  ? 316  GLU B N   1 
ATOM   5698  C CA  . GLU B  1 336 ? -41.00647 10.01172   76.77669  1.000 81.04955  ? 316  GLU B CA  1 
ATOM   5699  C C   . GLU B  1 336 ? -41.05967 9.53965    78.22582  1.000 78.79653  ? 316  GLU B C   1 
ATOM   5700  O O   . GLU B  1 336 ? -40.11422 9.77738    78.98075  1.000 78.56826  ? 316  GLU B O   1 
ATOM   5701  C CB  . GLU B  1 336 ? -41.38575 11.49332   76.67994  1.000 89.67360  ? 316  GLU B CB  1 
ATOM   5702  C CG  . GLU B  1 336 ? -40.36208 12.50164   77.27453  1.000 96.55627  ? 316  GLU B CG  1 
ATOM   5703  C CD  . GLU B  1 336 ? -38.92118 11.97813   77.35538  1.000 101.42984 ? 316  GLU B CD  1 
ATOM   5704  O OE1 . GLU B  1 336 ? -38.44615 11.68942   78.47998  1.000 102.90077 ? 316  GLU B OE1 1 
ATOM   5705  O OE2 . GLU B  1 336 ? -38.25973 11.85592   76.29902  1.000 102.92546 ? 316  GLU B OE2 1 
ATOM   5706  N N   . ASP B  1 337 ? -42.11599 8.83683    78.62392  1.000 79.07214  ? 317  ASP B N   1 
ATOM   5707  C CA  . ASP B  1 337 ? -42.19711 8.36229    80.00032  1.000 79.13609  ? 317  ASP B CA  1 
ATOM   5708  C C   . ASP B  1 337 ? -41.31629 7.13874    80.25690  1.000 75.14690  ? 317  ASP B C   1 
ATOM   5709  O O   . ASP B  1 337 ? -40.76193 6.99991    81.35408  1.000 73.95539  ? 317  ASP B O   1 
ATOM   5710  C CB  . ASP B  1 337 ? -43.65741 8.06433    80.35006  1.000 81.76310  ? 317  ASP B CB  1 
ATOM   5711  C CG  . ASP B  1 337 ? -44.51550 9.33823    80.42185  1.000 86.29132  ? 317  ASP B CG  1 
ATOM   5712  O OD1 . ASP B  1 337 ? -44.00055 10.38581   80.88397  1.000 81.68756  ? 317  ASP B OD1 1 
ATOM   5713  O OD2 . ASP B  1 337 ? -45.70493 9.28287    80.02755  1.000 89.41797  ? 317  ASP B OD2 1 
ATOM   5714  N N   . ARG B  1 338 ? -41.16044 6.25354    79.27340  1.000 69.61718  ? 318  ARG B N   1 
ATOM   5715  C CA  . ARG B  1 338 ? -40.49512 4.98205    79.51624  1.000 62.90844  ? 318  ARG B CA  1 
ATOM   5716  C C   . ARG B  1 338 ? -39.84672 4.48483    78.23717  1.000 59.12501  ? 318  ARG B C   1 
ATOM   5717  O O   . ARG B  1 338 ? -40.29538 4.79085    77.13149  1.000 57.96325  ? 318  ARG B O   1 
ATOM   5718  C CB  . ARG B  1 338 ? -41.47318 3.91835    80.03177  1.000 56.83714  ? 318  ARG B CB  1 
ATOM   5719  C CG  . ARG B  1 338 ? -42.59097 3.62608    79.05040  1.000 56.00571  ? 318  ARG B CG  1 
ATOM   5720  C CD  . ARG B  1 338 ? -43.64215 2.69221    79.60818  1.000 54.53546  ? 318  ARG B CD  1 
ATOM   5721  N NE  . ARG B  1 338 ? -44.91261 2.89858    78.92277  1.000 59.55631  ? 318  ARG B NE  1 
ATOM   5722  C CZ  . ARG B  1 338 ? -46.04344 2.28547    79.24938  1.000 61.83415  ? 318  ARG B CZ  1 
ATOM   5723  N NH1 . ARG B  1 338 ? -46.05331 1.41750    80.25543  1.000 61.60275  ? 318  ARG B NH1 1 
ATOM   5724  N NH2 . ARG B  1 338 ? -47.15932 2.53952    78.57013  1.000 61.32388  ? 318  ARG B NH2 1 
ATOM   5725  N N   . ARG B  1 339 ? -38.79665 3.68981    78.40393  1.000 57.15186  ? 319  ARG B N   1 
ATOM   5726  C CA  . ARG B  1 339 ? -38.15684 3.03370    77.27717  1.000 52.91007  ? 319  ARG B CA  1 
ATOM   5727  C C   . ARG B  1 339 ? -37.53073 1.74425    77.77563  1.000 52.47636  ? 319  ARG B C   1 
ATOM   5728  O O   . ARG B  1 339 ? -36.66479 1.77231    78.65817  1.000 49.61927  ? 319  ARG B O   1 
ATOM   5729  C CB  . ARG B  1 339 ? -37.10309 3.92519    76.61849  1.000 55.77408  ? 319  ARG B CB  1 
ATOM   5730  C CG  . ARG B  1 339 ? -36.36117 3.22070    75.47425  1.000 57.83202  ? 319  ARG B CG  1 
ATOM   5731  C CD  . ARG B  1 339 ? -35.15965 3.99786    74.98282  1.000 58.53091  ? 319  ARG B CD  1 
ATOM   5732  N NE  . ARG B  1 339 ? -35.55603 5.30123    74.46303  1.000 65.13901  ? 319  ARG B NE  1 
ATOM   5733  C CZ  . ARG B  1 339 ? -34.70715 6.28145    74.16964  1.000 65.50702  ? 319  ARG B CZ  1 
ATOM   5734  N NH1 . ARG B  1 339 ? -33.40412 6.11311    74.33655  1.000 69.77153  ? 319  ARG B NH1 1 
ATOM   5735  N NH2 . ARG B  1 339 ? -35.16277 7.42553    73.70788  1.000 62.70284  ? 319  ARG B NH2 1 
ATOM   5736  N N   . GLY B  1 340 ? -37.98112 0.62268    77.21836  1.000 50.38125  ? 320  GLY B N   1 
ATOM   5737  C CA  . GLY B  1 340 ? -37.36932 -0.65477   77.51638  1.000 49.01386  ? 320  GLY B CA  1 
ATOM   5738  C C   . GLY B  1 340 ? -36.15710 -0.87183   76.63522  1.000 47.57855  ? 320  GLY B C   1 
ATOM   5739  O O   . GLY B  1 340 ? -36.29783 -1.03622   75.42170  1.000 46.76428  ? 320  GLY B O   1 
ATOM   5740  N N   . SER B  1 341 ? -34.96481 -0.83573   77.22706  1.000 45.67627  ? 321  SER B N   1 
ATOM   5741  C CA  . SER B  1 341 ? -33.73575 -1.04247   76.47606  1.000 49.33133  ? 321  SER B CA  1 
ATOM   5742  C C   . SER B  1 341 ? -32.63223 -1.45779   77.43045  1.000 47.33645  ? 321  SER B C   1 
ATOM   5743  O O   . SER B  1 341 ? -32.70675 -1.22432   78.63826  1.000 44.74000  ? 321  SER B O   1 
ATOM   5744  C CB  . SER B  1 341 ? -33.31806 0.21172    75.71645  1.000 53.98145  ? 321  SER B CB  1 
ATOM   5745  O OG  . SER B  1 341 ? -32.97777 1.22743    76.64479  1.000 59.87727  ? 321  SER B OG  1 
ATOM   5746  N N   . ALA B  1 342 ? -31.60713 -2.08385   76.86062  1.000 51.91091  ? 322  ALA B N   1 
ATOM   5747  C CA  . ALA B  1 342 ? -30.41279 -2.48823   77.58973  1.000 50.51602  ? 322  ALA B CA  1 
ATOM   5748  C C   . ALA B  1 342 ? -29.18946 -1.85141   76.94198  1.000 52.16647  ? 322  ALA B C   1 
ATOM   5749  O O   . ALA B  1 342 ? -29.01602 -1.90512   75.71612  1.000 49.96704  ? 322  ALA B O   1 
ATOM   5750  C CB  . ALA B  1 342 ? -30.26405 -4.01441   77.62989  1.000 45.76706  ? 322  ALA B CB  1 
ATOM   5751  N N   . VAL B  1 343 ? -28.34406 -1.26899   77.77389  1.000 43.53836  ? 323  VAL B N   1 
ATOM   5752  C CA  . VAL B  1 343 ? -27.16648 -0.53875   77.33790  1.000 49.58149  ? 323  VAL B CA  1 
ATOM   5753  C C   . VAL B  1 343 ? -25.98638 -1.12092   78.09141  1.000 47.63528  ? 323  VAL B C   1 
ATOM   5754  O O   . VAL B  1 343 ? -26.03641 -1.25542   79.32098  1.000 47.08317  ? 323  VAL B O   1 
ATOM   5755  C CB  . VAL B  1 343 ? -27.30561 0.97645    77.60639  1.000 49.01768  ? 323  VAL B CB  1 
ATOM   5756  C CG1 . VAL B  1 343 ? -25.97565 1.70292    77.39197  1.000 49.37517  ? 323  VAL B CG1 1 
ATOM   5757  C CG2 . VAL B  1 343 ? -28.38969 1.55956    76.72821  1.000 48.15403  ? 323  VAL B CG2 1 
ATOM   5758  N N   . SER B  1 344 ? -24.94648 -1.49501   77.35341  1.000 54.27201  ? 324  SER B N   1 
ATOM   5759  C CA  . SER B  1 344 ? -23.74226 -2.06249   77.94728  1.000 61.56179  ? 324  SER B CA  1 
ATOM   5760  C C   . SER B  1 344 ? -24.08759 -3.21395   78.89017  1.000 51.69227  ? 324  SER B C   1 
ATOM   5761  O O   . SER B  1 344 ? -23.58356 -3.30630   80.00989  1.000 48.08670  ? 324  SER B O   1 
ATOM   5762  C CB  . SER B  1 344 ? -22.95458 -0.97506   78.66370  1.000 75.97224  ? 324  SER B CB  1 
ATOM   5763  O OG  . SER B  1 344 ? -22.93157 0.21299    77.89454  1.000 91.77879  ? 324  SER B OG  1 
ATOM   5764  N N   . SER B  1 345 ? -24.97034 -4.09659   78.42829  1.000 47.60376  ? 325  SER B N   1 
ATOM   5765  C CA  . SER B  1 345 ? -25.54135 -5.13887   79.26465  1.000 44.27239  ? 325  SER B CA  1 
ATOM   5766  C C   . SER B  1 345 ? -25.56217 -6.45988   78.50393  1.000 47.86872  ? 325  SER B C   1 
ATOM   5767  O O   . SER B  1 345 ? -25.34564 -6.51606   77.28771  1.000 48.58547  ? 325  SER B O   1 
ATOM   5768  C CB  . SER B  1 345 ? -26.94865 -4.75155   79.71992  1.000 43.70553  ? 325  SER B CB  1 
ATOM   5769  O OG  . SER B  1 345 ? -26.90112 -3.64163   80.60703  1.000 46.29282  ? 325  SER B OG  1 
ATOM   5770  N N   . VAL B  1 346 ? -25.81437 -7.53122   79.25222  1.000 48.20603  ? 326  VAL B N   1 
ATOM   5771  C CA  . VAL B  1 346 ? -25.97658 -8.88301   78.72858  1.000 41.91922  ? 326  VAL B CA  1 
ATOM   5772  C C   . VAL B  1 346 ? -27.37237 -9.36804   79.13457  1.000 44.32506  ? 326  VAL B C   1 
ATOM   5773  O O   . VAL B  1 346 ? -27.72734 -9.33682   80.32207  1.000 45.18121  ? 326  VAL B O   1 
ATOM   5774  C CB  . VAL B  1 346 ? -24.87479 -9.81150   79.25923  1.000 41.63887  ? 326  VAL B CB  1 
ATOM   5775  C CG1 . VAL B  1 346 ? -25.14668 -11.26954  78.86438  1.000 42.30519  ? 326  VAL B CG1 1 
ATOM   5776  C CG2 . VAL B  1 346 ? -23.50963 -9.36228   78.75688  1.000 39.12043  ? 326  VAL B CG2 1 
ATOM   5777  N N   . VAL B  1 347 ? -28.17950 -9.77819   78.15315  1.000 46.17537  ? 327  VAL B N   1 
ATOM   5778  C CA  . VAL B  1 347 ? -29.57581 -10.15433  78.39506  1.000 44.81369  ? 327  VAL B CA  1 
ATOM   5779  C C   . VAL B  1 347 ? -29.83187 -11.53786  77.80762  1.000 43.18230  ? 327  VAL B C   1 
ATOM   5780  O O   . VAL B  1 347 ? -29.67869 -11.74272  76.59744  1.000 43.97730  ? 327  VAL B O   1 
ATOM   5781  C CB  . VAL B  1 347 ? -30.57021 -9.15049   77.79167  1.000 43.50442  ? 327  VAL B CB  1 
ATOM   5782  C CG1 . VAL B  1 347 ? -31.98271 -9.61340   78.09791  1.000 41.01806  ? 327  VAL B CG1 1 
ATOM   5783  C CG2 . VAL B  1 347 ? -30.32201 -7.73283   78.32502  1.000 37.63493  ? 327  VAL B CG2 1 
ATOM   5784  N N   . SER B  1 348 ? -30.26192 -12.46996  78.64696  1.000 41.91342  ? 328  SER B N   1 
ATOM   5785  C CA  . SER B  1 348 ? -30.49189 -13.83358  78.19490  1.000 40.84091  ? 328  SER B CA  1 
ATOM   5786  C C   . SER B  1 348 ? -31.85677 -13.97350  77.51904  1.000 39.80671  ? 328  SER B C   1 
ATOM   5787  O O   . SER B  1 348 ? -32.65096 -13.03415  77.43786  1.000 41.98624  ? 328  SER B O   1 
ATOM   5788  C CB  . SER B  1 348 ? -30.38589 -14.80326  79.36823  1.000 44.18725  ? 328  SER B CB  1 
ATOM   5789  O OG  . SER B  1 348 ? -29.08444 -14.78463  79.92075  1.000 45.24709  ? 328  SER B OG  1 
ATOM   5790  N N   . GLY B  1 349 ? -32.14397 -15.18632  77.05627  1.000 40.70595  ? 329  GLY B N   1 
ATOM   5791  C CA  . GLY B  1 349 ? -33.42259 -15.45763  76.43637  1.000 37.99011  ? 329  GLY B CA  1 
ATOM   5792  C C   . GLY B  1 349 ? -34.56027 -15.43642  77.43627  1.000 40.84641  ? 329  GLY B C   1 
ATOM   5793  O O   . GLY B  1 349 ? -34.37136 -15.46627  78.65295  1.000 43.63091  ? 329  GLY B O   1 
ATOM   5794  N N   . ASP B  1 350 ? -35.77261 -15.34963  76.89622  1.000 40.98909  ? 330  ASP B N   1 
ATOM   5795  C CA  . ASP B  1 350 ? -36.98536 -15.33529  77.69797  1.000 34.86261  ? 330  ASP B CA  1 
ATOM   5796  C C   . ASP B  1 350 ? -36.98763 -14.17288  78.69179  1.000 34.82736  ? 330  ASP B C   1 
ATOM   5797  O O   . ASP B  1 350 ? -37.57241 -14.26623  79.77676  1.000 35.17363  ? 330  ASP B O   1 
ATOM   5798  C CB  . ASP B  1 350 ? -37.17730 -16.67547  78.41718  1.000 36.72661  ? 330  ASP B CB  1 
ATOM   5799  C CG  . ASP B  1 350 ? -38.59572 -16.86974  78.92552  1.000 39.08266  ? 330  ASP B CG  1 
ATOM   5800  O OD1 . ASP B  1 350 ? -38.77672 -17.57989  79.91935  1.000 43.37337  ? 330  ASP B OD1 1 
ATOM   5801  O OD2 . ASP B  1 350 ? -39.53320 -16.30778  78.33070  1.000 44.10234  ? 330  ASP B OD2 1 
ATOM   5802  N N   . CYS B  1 351 ? -36.33361 -13.07404  78.32361  1.000 34.64680  ? 331  CYS B N   1 
ATOM   5803  C CA  . CYS B  1 351 ? -36.35091 -11.83267  79.08261  1.000 37.00136  ? 331  CYS B CA  1 
ATOM   5804  C C   . CYS B  1 351 ? -37.21687 -10.79830  78.38174  1.000 37.09651  ? 331  CYS B C   1 
ATOM   5805  O O   . CYS B  1 351 ? -37.06142 -10.55355  77.17919  1.000 36.91902  ? 331  CYS B O   1 
ATOM   5806  C CB  . CYS B  1 351 ? -34.94817 -11.26896  79.25707  1.000 40.83594  ? 331  CYS B CB  1 
ATOM   5807  S SG  . CYS B  1 351 ? -33.94043 -12.25107  80.28798  1.000 44.74347  ? 331  CYS B SG  1 
ATOM   5808  N N   . ILE B  1 352 ? -38.10986 -10.17805  79.13939  1.000 41.29853  ? 332  ILE B N   1 
ATOM   5809  C CA  . ILE B  1 352 ? -39.02733 -9.17294   78.61045  1.000 44.52714  ? 332  ILE B CA  1 
ATOM   5810  C C   . ILE B  1 352 ? -38.72866 -7.86645   79.32443  1.000 43.01540  ? 332  ILE B C   1 
ATOM   5811  O O   . ILE B  1 352 ? -39.01974 -7.71693   80.52016  1.000 40.73375  ? 332  ILE B O   1 
ATOM   5812  C CB  . ILE B  1 352 ? -40.48977 -9.58354   78.77719  1.000 38.02094  ? 332  ILE B CB  1 
ATOM   5813  C CG1 . ILE B  1 352 ? -40.70685 -10.94868  78.12528  1.000 37.68852  ? 332  ILE B CG1 1 
ATOM   5814  C CG2 . ILE B  1 352 ? -41.39845 -8.49769   78.19731  1.000 39.19702  ? 332  ILE B CG2 1 
ATOM   5815  C CD1 . ILE B  1 352 ? -42.15845 -11.29020  77.84125  1.000 38.82053  ? 332  ILE B CD1 1 
ATOM   5816  N N   . ILE B  1 353 ? -38.12176 -6.93676   78.59606  1.000 41.75413  ? 333  ILE B N   1 
ATOM   5817  C CA  . ILE B  1 353 ? -37.71575 -5.64526   79.13851  1.000 41.82697  ? 333  ILE B CA  1 
ATOM   5818  C C   . ILE B  1 353 ? -38.81999 -4.68107   78.74229  1.000 40.03975  ? 333  ILE B C   1 
ATOM   5819  O O   . ILE B  1 353 ? -38.79575 -4.06933   77.67486  1.000 40.59346  ? 333  ILE B O   1 
ATOM   5820  C CB  . ILE B  1 353 ? -36.35607 -5.20604   78.61583  1.000 43.12822  ? 333  ILE B CB  1 
ATOM   5821  C CG1 . ILE B  1 353 ? -35.33980 -6.34358   78.77706  1.000 42.69598  ? 333  ILE B CG1 1 
ATOM   5822  C CG2 . ILE B  1 353 ? -35.93490 -3.95685   79.30622  1.000 39.51814  ? 333  ILE B CG2 1 
ATOM   5823  C CD1 . ILE B  1 353 ? -35.30709 -6.93754   80.18017  1.000 36.90015  ? 333  ILE B CD1 1 
ATOM   5824  N N   . SER B  1 354 ? -39.80685 -4.56758   79.60879  1.000 40.76659  ? 334  SER B N   1 
ATOM   5825  C CA  . SER B  1 354 ? -41.01155 -3.80638   79.33278  1.000 42.25726  ? 334  SER B CA  1 
ATOM   5826  C C   . SER B  1 354 ? -40.86256 -2.42878   79.96761  1.000 54.75611  ? 334  SER B C   1 
ATOM   5827  O O   . SER B  1 354 ? -41.03723 -2.27565   81.18157  1.000 52.45608  ? 334  SER B O   1 
ATOM   5828  C CB  . SER B  1 354 ? -42.22343 -4.55380   79.87183  1.000 42.65390  ? 334  SER B CB  1 
ATOM   5829  O OG  . SER B  1 354 ? -43.40217 -4.03463   79.31206  1.000 54.73562  ? 334  SER B OG  1 
ATOM   5830  N N   . GLY B  1 355 ? -40.53948 -1.42388   79.14587  1.000 49.75054  ? 335  GLY B N   1 
ATOM   5831  C CA  . GLY B  1 355 ? -40.39258 -0.06593   79.65308  1.000 45.88938  ? 335  GLY B CA  1 
ATOM   5832  C C   . GLY B  1 355 ? -39.36661 0.09783    80.75643  1.000 48.91710  ? 335  GLY B C   1 
ATOM   5833  O O   . GLY B  1 355 ? -39.44530 1.05920    81.52933  1.000 54.30076  ? 335  GLY B O   1 
ATOM   5834  N N   . ALA B  1 356 ? -38.40192 -0.81597   80.85141  1.000 49.15642  ? 336  ALA B N   1 
ATOM   5835  C CA  . ALA B  1 356 ? -37.39897 -0.82046   81.90603  1.000 50.35242  ? 336  ALA B CA  1 
ATOM   5836  C C   . ALA B  1 356 ? -36.04259 -0.39230   81.35738  1.000 50.99809  ? 336  ALA B C   1 
ATOM   5837  O O   . ALA B  1 356 ? -35.63608 -0.81264   80.26866  1.000 53.89670  ? 336  ALA B O   1 
ATOM   5838  C CB  . ALA B  1 356 ? -37.28043 -2.20636   82.54727  1.000 48.67649  ? 336  ALA B CB  1 
ATOM   5839  N N   . ALA B  1 357 ? -35.34092 0.42729    82.13315  1.000 48.97640  ? 337  ALA B N   1 
ATOM   5840  C CA  . ALA B  1 357 ? -34.03106 0.95573    81.77483  1.000 49.05010  ? 337  ALA B CA  1 
ATOM   5841  C C   . ALA B  1 357 ? -32.95479 0.07164    82.38681  1.000 46.92832  ? 337  ALA B C   1 
ATOM   5842  O O   . ALA B  1 357 ? -32.90515 -0.08360   83.60729  1.000 50.14513  ? 337  ALA B O   1 
ATOM   5843  C CB  . ALA B  1 357 ? -33.88126 2.39643    82.27268  1.000 47.25046  ? 337  ALA B CB  1 
ATOM   5844  N N   . LEU B  1 358 ? -32.09240 -0.49605   81.54950  1.000 47.44202  ? 338  LEU B N   1 
ATOM   5845  C CA  . LEU B  1 358 ? -31.01016 -1.36904   82.00183  1.000 43.62853  ? 338  LEU B CA  1 
ATOM   5846  C C   . LEU B  1 358 ? -29.67387 -0.77182   81.59094  1.000 44.97608  ? 338  LEU B C   1 
ATOM   5847  O O   . LEU B  1 358 ? -29.52104 -0.31485   80.45314  1.000 47.02964  ? 338  LEU B O   1 
ATOM   5848  C CB  . LEU B  1 358 ? -31.11953 -2.78435   81.39559  1.000 41.51365  ? 338  LEU B CB  1 
ATOM   5849  C CG  . LEU B  1 358 ? -32.41704 -3.58754   81.46174  1.000 41.94918  ? 338  LEU B CG  1 
ATOM   5850  C CD1 . LEU B  1 358 ? -32.16413 -5.06756   81.13433  1.000 42.09499  ? 338  LEU B CD1 1 
ATOM   5851  C CD2 . LEU B  1 358 ? -33.07160 -3.43697   82.82272  1.000 46.96409  ? 338  LEU B CD2 1 
ATOM   5852  N N   . ASN B  1 359 ? -28.70055 -0.77458   82.50261  1.000 43.75887  ? 339  ASN B N   1 
ATOM   5853  C CA  . ASN B  1 359 ? -27.34871 -0.38610   82.11422  1.000 52.03913  ? 339  ASN B CA  1 
ATOM   5854  C C   . ASN B  1 359 ? -26.34875 -1.17488   82.95565  1.000 49.40829  ? 339  ASN B C   1 
ATOM   5855  O O   . ASN B  1 359 ? -26.61979 -1.48350   84.12064  1.000 44.60671  ? 339  ASN B O   1 
ATOM   5856  C CB  . ASN B  1 359 ? -27.15054 1.13821    82.23502  1.000 57.36333  ? 339  ASN B CB  1 
ATOM   5857  C CG  . ASN B  1 359 ? -25.69458 1.55485    82.12553  1.000 67.26670  ? 339  ASN B CG  1 
ATOM   5858  O OD1 . ASN B  1 359 ? -25.02222 1.75873    83.13023  1.000 74.45313  ? 339  ASN B OD1 1 
ATOM   5859  N ND2 . ASN B  1 359 ? -25.19237 1.65154    80.89936  1.000 69.92254  ? 339  ASN B ND2 1 
ATOM   5860  N N   . ARG B  1 360 ? -25.19751 -1.48668   82.34796  1.000 46.23681  ? 340  ARG B N   1 
ATOM   5861  C CA  . ARG B  1 360 ? -24.23865 -2.47164   82.84560  1.000 51.88501  ? 340  ARG B CA  1 
ATOM   5862  C C   . ARG B  1 360 ? -24.89441 -3.47645   83.79295  1.000 51.32952  ? 340  ARG B C   1 
ATOM   5863  O O   . ARG B  1 360 ? -24.64260 -3.48411   85.00283  1.000 45.27268  ? 340  ARG B O   1 
ATOM   5864  C CB  . ARG B  1 360 ? -23.02731 -1.78638   83.49576  1.000 61.13667  ? 340  ARG B CB  1 
ATOM   5865  C CG  . ARG B  1 360 ? -22.42445 -0.62456   82.67638  1.000 71.56201  ? 340  ARG B CG  1 
ATOM   5866  C CD  . ARG B  1 360 ? -21.38195 -1.03483   81.59561  1.000 80.98972  ? 340  ARG B CD  1 
ATOM   5867  N NE  . ARG B  1 360 ? -20.45142 -2.09952   81.96405  1.000 85.78865  ? 340  ARG B NE  1 
ATOM   5868  C CZ  . ARG B  1 360 ? -19.14656 -1.92645   82.15649  1.000 84.02563  ? 340  ARG B CZ  1 
ATOM   5869  N NH1 . ARG B  1 360 ? -18.60402 -0.71860   82.01943  1.000 80.05271  ? 340  ARG B NH1 1 
ATOM   5870  N NH2 . ARG B  1 360 ? -18.38941 -2.96937   82.48787  1.000 81.97862  ? 340  ARG B NH2 1 
ATOM   5871  N N   . SER B  1 361 ? -25.75412 -4.32511   83.23530  1.000 51.42289  ? 341  SER B N   1 
ATOM   5872  C CA  . SER B  1 361 ? -26.39693 -5.38903   83.98353  1.000 47.69036  ? 341  SER B CA  1 
ATOM   5873  C C   . SER B  1 361 ? -26.31339 -6.70306   83.21226  1.000 46.25024  ? 341  SER B C   1 
ATOM   5874  O O   . SER B  1 361 ? -26.25610 -6.72891   81.98010  1.000 38.35141  ? 341  SER B O   1 
ATOM   5875  C CB  . SER B  1 361 ? -27.86179 -5.04014   84.29226  1.000 47.53167  ? 341  SER B CB  1 
ATOM   5876  O OG  . SER B  1 361 ? -27.93655 -3.87646   85.09410  1.000 49.55885  ? 341  SER B OG  1 
ATOM   5877  N N   . LEU B  1 362 ? -26.28897 -7.80030   83.95700  1.000 43.27900  ? 342  LEU B N   1 
ATOM   5878  C CA  . LEU B  1 362 ? -26.30376 -9.13620   83.38556  1.000 43.74045  ? 342  LEU B CA  1 
ATOM   5879  C C   . LEU B  1 362 ? -27.60489 -9.78950   83.83029  1.000 41.00553  ? 342  LEU B C   1 
ATOM   5880  O O   . LEU B  1 362 ? -27.88078 -9.86027   85.03214  1.000 42.17357  ? 342  LEU B O   1 
ATOM   5881  C CB  . LEU B  1 362 ? -25.07533 -9.93843   83.83438  1.000 48.07067  ? 342  LEU B CB  1 
ATOM   5882  C CG  . LEU B  1 362 ? -24.80901 -11.28498  83.13591  1.000 50.73496  ? 342  LEU B CG  1 
ATOM   5883  C CD1 . LEU B  1 362 ? -23.33033 -11.53139  82.93316  1.000 55.22893  ? 342  LEU B CD1 1 
ATOM   5884  C CD2 . LEU B  1 362 ? -25.36897 -12.39433  83.93696  1.000 51.90907  ? 342  LEU B CD2 1 
ATOM   5885  N N   . LEU B  1 363 ? -28.42410 -10.21760  82.86705  1.000 41.06574  ? 343  LEU B N   1 
ATOM   5886  C CA  . LEU B  1 363 ? -29.71843 -10.84716  83.14402  1.000 38.05982  ? 343  LEU B CA  1 
ATOM   5887  C C   . LEU B  1 363 ? -29.68551 -12.28690  82.67051  1.000 39.26663  ? 343  LEU B C   1 
ATOM   5888  O O   . LEU B  1 363 ? -29.42946 -12.54109  81.48768  1.000 42.12110  ? 343  LEU B O   1 
ATOM   5889  C CB  . LEU B  1 363 ? -30.86998 -10.11489  82.45056  1.000 37.21192  ? 343  LEU B CB  1 
ATOM   5890  C CG  . LEU B  1 363 ? -31.61907 -9.06047   83.26408  1.000 39.19905  ? 343  LEU B CG  1 
ATOM   5891  C CD1 . LEU B  1 363 ? -30.63924 -8.00391   83.75079  1.000 40.93121  ? 343  LEU B CD1 1 
ATOM   5892  C CD2 . LEU B  1 363 ? -32.72912 -8.44081   82.42747  1.000 35.68724  ? 343  LEU B CD2 1 
ATOM   5893  N N   . PHE B  1 364 ? -29.93990 -13.21624  83.59241  1.000 40.75040  ? 344  PHE B N   1 
ATOM   5894  C CA  . PHE B  1 364 ? -30.11338 -14.62772  83.27442  1.000 40.77999  ? 344  PHE B CA  1 
ATOM   5895  C C   . PHE B  1 364 ? -31.47695 -14.83711  82.61497  1.000 40.93674  ? 344  PHE B C   1 
ATOM   5896  O O   . PHE B  1 364 ? -32.25779 -13.89955  82.42150  1.000 41.46332  ? 344  PHE B O   1 
ATOM   5897  C CB  . PHE B  1 364 ? -29.98375 -15.47556  84.53992  1.000 42.55691  ? 344  PHE B CB  1 
ATOM   5898  C CG  . PHE B  1 364 ? -28.57809 -15.55165  85.09046  1.000 48.14672  ? 344  PHE B CG  1 
ATOM   5899  C CD1 . PHE B  1 364 ? -27.98738 -14.45878  85.69767  1.000 51.55262  ? 344  PHE B CD1 1 
ATOM   5900  C CD2 . PHE B  1 364 ? -27.84769 -16.73083  85.01017  1.000 53.39073  ? 344  PHE B CD2 1 
ATOM   5901  C CE1 . PHE B  1 364 ? -26.69570 -14.53716  86.21113  1.000 54.89296  ? 344  PHE B CE1 1 
ATOM   5902  C CE2 . PHE B  1 364 ? -26.54891 -16.81437  85.50907  1.000 54.23277  ? 344  PHE B CE2 1 
ATOM   5903  C CZ  . PHE B  1 364 ? -25.97767 -15.71894  86.11442  1.000 56.31861  ? 344  PHE B CZ  1 
ATOM   5904  N N   . THR B  1 365 ? -31.79687 -16.08394  82.29571  1.000 36.42637  ? 345  THR B N   1 
ATOM   5905  C CA  . THR B  1 365 ? -32.98035 -16.32414  81.48092  1.000 39.04449  ? 345  THR B CA  1 
ATOM   5906  C C   . THR B  1 365 ? -34.27296 -16.16207  82.29177  1.000 35.68457  ? 345  THR B C   1 
ATOM   5907  O O   . THR B  1 365 ? -34.30934 -16.36087  83.51297  1.000 35.63626  ? 345  THR B O   1 
ATOM   5908  C CB  . THR B  1 365 ? -32.88842 -17.70683  80.80664  1.000 41.08388  ? 345  THR B CB  1 
ATOM   5909  O OG1 . THR B  1 365 ? -33.39353 -18.73188  81.65940  1.000 41.52032  ? 345  THR B OG1 1 
ATOM   5910  C CG2 . THR B  1 365 ? -31.41535 -18.02940  80.49011  1.000 45.24834  ? 345  THR B CG2 1 
ATOM   5911  N N   . GLY B  1 366 ? -35.33052 -15.73067  81.60344  1.000 35.79578  ? 346  GLY B N   1 
ATOM   5912  C CA  . GLY B  1 366 ? -36.64737 -15.63228  82.21960  1.000 35.08558  ? 346  GLY B CA  1 
ATOM   5913  C C   . GLY B  1 366 ? -36.93462 -14.37464  83.01188  1.000 39.68927  ? 346  GLY B C   1 
ATOM   5914  O O   . GLY B  1 366 ? -37.95756 -14.32946  83.70884  1.000 43.10187  ? 346  GLY B O   1 
ATOM   5915  N N   . VAL B  1 367 ? -36.07441 -13.34509  82.93590  1.000 39.34960  ? 347  VAL B N   1 
ATOM   5916  C CA  . VAL B  1 367 ? -36.25681 -12.13083  83.72551  1.000 38.51443  ? 347  VAL B CA  1 
ATOM   5917  C C   . VAL B  1 367 ? -37.36938 -11.28802  83.12056  1.000 41.58841  ? 347  VAL B C   1 
ATOM   5918  O O   . VAL B  1 367 ? -37.46026 -11.15171  81.89322  1.000 42.27254  ? 347  VAL B O   1 
ATOM   5919  C CB  . VAL B  1 367 ? -34.94790 -11.32685  83.79685  1.000 39.20229  ? 347  VAL B CB  1 
ATOM   5920  C CG1 . VAL B  1 367 ? -35.21723 -9.95221   84.37840  1.000 41.13738  ? 347  VAL B CG1 1 
ATOM   5921  C CG2 . VAL B  1 367 ? -33.90059 -12.06013  84.61202  1.000 36.89464  ? 347  VAL B CG2 1 
ATOM   5922  N N   . ARG B  1 368 ? -38.21006 -10.70157  83.98474  1.000 39.10035  ? 348  ARG B N   1 
ATOM   5923  C CA  . ARG B  1 368 ? -39.26648 -9.77477   83.58518  1.000 42.15030  ? 348  ARG B CA  1 
ATOM   5924  C C   . ARG B  1 368 ? -39.07500 -8.45797   84.33192  1.000 45.17615  ? 348  ARG B C   1 
ATOM   5925  O O   . ARG B  1 368 ? -39.18894 -8.41993   85.56250  1.000 43.97792  ? 348  ARG B O   1 
ATOM   5926  C CB  . ARG B  1 368 ? -40.66182 -10.34252  83.88154  1.000 47.46025  ? 348  ARG B CB  1 
ATOM   5927  C CG  . ARG B  1 368 ? -41.01295 -11.67715  83.20644  1.000 53.43209  ? 348  ARG B CG  1 
ATOM   5928  C CD  . ARG B  1 368 ? -41.65871 -11.47488  81.83909  1.000 58.09555  ? 348  ARG B CD  1 
ATOM   5929  N NE  . ARG B  1 368 ? -41.98162 -12.73537  81.16524  1.000 60.02601  ? 348  ARG B NE  1 
ATOM   5930  C CZ  . ARG B  1 368 ? -41.08102 -13.53566  80.59596  1.000 53.88842  ? 348  ARG B CZ  1 
ATOM   5931  N NH1 . ARG B  1 368 ? -41.46893 -14.65726  80.00280  1.000 49.63849  ? 348  ARG B NH1 1 
ATOM   5932  N NH2 . ARG B  1 368 ? -39.79053 -13.22246  80.63741  1.000 51.29188  ? 348  ARG B NH2 1 
ATOM   5933  N N   . ALA B  1 369 ? -38.79912 -7.38411   83.59031  1.000 41.42792  ? 349  ALA B N   1 
ATOM   5934  C CA  . ALA B  1 369 ? -38.60748 -6.04910   84.14736  1.000 41.39181  ? 349  ALA B CA  1 
ATOM   5935  C C   . ALA B  1 369 ? -39.69042 -5.14219   83.58338  1.000 43.86402  ? 349  ALA B C   1 
ATOM   5936  O O   . ALA B  1 369 ? -39.79937 -4.99578   82.36026  1.000 42.40377  ? 349  ALA B O   1 
ATOM   5937  C CB  . ALA B  1 369 ? -37.22109 -5.50195   83.81208  1.000 39.31482  ? 349  ALA B CB  1 
ATOM   5938  N N   . ASN B  1 370 ? -40.48445 -4.54093   84.46738  1.000 45.63475  ? 350  ASN B N   1 
ATOM   5939  C CA  . ASN B  1 370 ? -41.70696 -3.85072   84.07722  1.000 50.67887  ? 350  ASN B CA  1 
ATOM   5940  C C   . ASN B  1 370 ? -41.50740 -2.33465   84.01773  1.000 53.15769  ? 350  ASN B C   1 
ATOM   5941  O O   . ASN B  1 370 ? -40.46049 -1.79457   84.39402  1.000 50.07294  ? 350  ASN B O   1 
ATOM   5942  C CB  . ASN B  1 370 ? -42.85188 -4.22365   85.02659  1.000 52.57119  ? 350  ASN B CB  1 
ATOM   5943  C CG  . ASN B  1 370 ? -43.23854 -5.69299   84.91696  1.000 51.63750  ? 350  ASN B CG  1 
ATOM   5944  O OD1 . ASN B  1 370 ? -43.42567 -6.21262   83.81546  1.000 52.36287  ? 350  ASN B OD1 1 
ATOM   5945  N ND2 . ASN B  1 370 ? -43.35121 -6.36736   86.05129  1.000 46.69600  ? 350  ASN B ND2 1 
ATOM   5946  N N   . SER B  1 371 ? -42.54700 -1.65239   83.52289  1.000 52.22451  ? 351  SER B N   1 
ATOM   5947  C CA  . SER B  1 371 ? -42.42328 -0.26491   83.09295  1.000 50.16957  ? 351  SER B CA  1 
ATOM   5948  C C   . SER B  1 371 ? -41.92172 0.63037    84.21816  1.000 51.24983  ? 351  SER B C   1 
ATOM   5949  O O   . SER B  1 371 ? -42.28469 0.46321    85.38761  1.000 52.53140  ? 351  SER B O   1 
ATOM   5950  C CB  . SER B  1 371 ? -43.76916 0.25556    82.57302  1.000 54.80003  ? 351  SER B CB  1 
ATOM   5951  O OG  . SER B  1 371 ? -44.22802 -0.47513   81.44325  1.000 51.31489  ? 351  SER B OG  1 
ATOM   5952  N N   . TYR B  1 372 ? -41.07277 1.58459    83.84604  1.000 54.19564  ? 352  TYR B N   1 
ATOM   5953  C CA  . TYR B  1 372 ? -40.54296 2.63855    84.70737  1.000 55.85199  ? 352  TYR B CA  1 
ATOM   5954  C C   . TYR B  1 372 ? -39.54348 2.12257    85.72856  1.000 58.19675  ? 352  TYR B C   1 
ATOM   5955  O O   . TYR B  1 372 ? -39.20377 2.84684    86.65660  1.000 63.52518  ? 352  TYR B O   1 
ATOM   5956  C CB  . TYR B  1 372 ? -41.66410 3.41045    85.41708  1.000 53.18713  ? 352  TYR B CB  1 
ATOM   5957  C CG  . TYR B  1 372 ? -42.77645 3.82805    84.48199  1.000 54.40158  ? 352  TYR B CG  1 
ATOM   5958  C CD1 . TYR B  1 372 ? -42.54224 4.75382    83.46386  1.000 58.96082  ? 352  TYR B CD1 1 
ATOM   5959  C CD2 . TYR B  1 372 ? -44.05902 3.29830    84.60405  1.000 54.90403  ? 352  TYR B CD2 1 
ATOM   5960  C CE1 . TYR B  1 372 ? -43.55773 5.14774    82.59060  1.000 56.57435  ? 352  TYR B CE1 1 
ATOM   5961  C CE2 . TYR B  1 372 ? -45.07533 3.67729    83.72975  1.000 56.20164  ? 352  TYR B CE2 1 
ATOM   5962  C CZ  . TYR B  1 372 ? -44.81961 4.60683    82.72689  1.000 56.99912  ? 352  TYR B CZ  1 
ATOM   5963  O OH  . TYR B  1 372 ? -45.82343 4.99862    81.86303  1.000 59.02260  ? 352  TYR B OH  1 
ATOM   5964  N N   . SER B  1 373 ? -39.06150 0.89424    85.58903  1.000 55.71400  ? 353  SER B N   1 
ATOM   5965  C CA  . SER B  1 373 ? -38.04080 0.39289    86.49247  1.000 52.64630  ? 353  SER B CA  1 
ATOM   5966  C C   . SER B  1 373 ? -36.65091 0.57057    85.87611  1.000 50.27859  ? 353  SER B C   1 
ATOM   5967  O O   . SER B  1 373 ? -36.49278 0.74715    84.66094  1.000 45.95703  ? 353  SER B O   1 
ATOM   5968  C CB  . SER B  1 373 ? -38.30280 -1.07565   86.86342  1.000 52.99642  ? 353  SER B CB  1 
ATOM   5969  O OG  . SER B  1 373 ? -38.08886 -1.97254   85.78253  1.000 55.47146  ? 353  SER B OG  1 
ATOM   5970  N N   . ARG B  1 374 ? -35.63565 0.55513    86.74174  1.000 50.17500  ? 354  ARG B N   1 
ATOM   5971  C CA  . ARG B  1 374 ? -34.25647 0.80458    86.32488  1.000 50.94413  ? 354  ARG B CA  1 
ATOM   5972  C C   . ARG B  1 374 ? -33.31666 -0.17584   87.01576  1.000 52.58636  ? 354  ARG B C   1 
ATOM   5973  O O   . ARG B  1 374 ? -33.41129 -0.38663   88.22746  1.000 50.06597  ? 354  ARG B O   1 
ATOM   5974  C CB  . ARG B  1 374 ? -33.81006 2.23896    86.64638  1.000 53.08270  ? 354  ARG B CB  1 
ATOM   5975  C CG  . ARG B  1 374 ? -34.89431 3.31566    86.61831  1.000 62.61590  ? 354  ARG B CG  1 
ATOM   5976  C CD  . ARG B  1 374 ? -34.26126 4.69181    86.73923  1.000 66.24055  ? 354  ARG B CD  1 
ATOM   5977  N NE  . ARG B  1 374 ? -33.20327 4.81010    85.74683  1.000 72.54982  ? 354  ARG B NE  1 
ATOM   5978  C CZ  . ARG B  1 374 ? -33.33475 5.44056    84.58443  1.000 77.43493  ? 354  ARG B CZ  1 
ATOM   5979  N NH1 . ARG B  1 374 ? -34.48163 6.04832    84.28768  1.000 81.16987  ? 354  ARG B NH1 1 
ATOM   5980  N NH2 . ARG B  1 374 ? -32.31506 5.47688    83.72790  1.000 72.75869  ? 354  ARG B NH2 1 
ATOM   5981  N N   . LEU B  1 375 ? -32.40705 -0.76718   86.25011  1.000 55.88466  ? 355  LEU B N   1 
ATOM   5982  C CA  . LEU B  1 375 ? -31.36431 -1.62886   86.78939  1.000 52.63801  ? 355  LEU B CA  1 
ATOM   5983  C C   . LEU B  1 375 ? -30.01430 -1.06278   86.39110  1.000 50.26033  ? 355  LEU B C   1 
ATOM   5984  O O   . LEU B  1 375 ? -29.81709 -0.69776   85.23389  1.000 53.99258  ? 355  LEU B O   1 
ATOM   5985  C CB  . LEU B  1 375 ? -31.49897 -3.05775   86.27443  1.000 50.14870  ? 355  LEU B CB  1 
ATOM   5986  C CG  . LEU B  1 375 ? -32.67105 -3.87837   86.79858  1.000 49.81859  ? 355  LEU B CG  1 
ATOM   5987  C CD1 . LEU B  1 375 ? -32.70959 -5.22873   86.09635  1.000 46.57754  ? 355  LEU B CD1 1 
ATOM   5988  C CD2 . LEU B  1 375 ? -32.54440 -4.07675   88.28673  1.000 53.57636  ? 355  LEU B CD2 1 
ATOM   5989  N N   . GLU B  1 376 ? -29.08843 -0.99334   87.34040  1.000 50.53506  ? 356  GLU B N   1 
ATOM   5990  C CA  . GLU B  1 376 ? -27.72644 -0.56776   87.03780  1.000 56.59877  ? 356  GLU B CA  1 
ATOM   5991  C C   . GLU B  1 376 ? -26.72921 -1.32038   87.90887  1.000 55.11715  ? 356  GLU B C   1 
ATOM   5992  O O   . GLU B  1 376 ? -26.91979 -1.42161   89.12605  1.000 53.07323  ? 356  GLU B O   1 
ATOM   5993  C CB  . GLU B  1 376 ? -27.56405 0.94017    87.23684  1.000 59.03059  ? 356  GLU B CB  1 
ATOM   5994  C CG  . GLU B  1 376 ? -26.34904 1.49711    86.52373  1.000 65.41181  ? 356  GLU B CG  1 
ATOM   5995  C CD  . GLU B  1 376 ? -26.37740 3.00536    86.43182  1.000 74.06484  ? 356  GLU B CD  1 
ATOM   5996  O OE1 . GLU B  1 376 ? -25.83144 3.66194    87.35025  1.000 78.08578  ? 356  GLU B OE1 1 
ATOM   5997  O OE2 . GLU B  1 376 ? -26.95790 3.53116    85.45317  1.000 76.09862  ? 356  GLU B OE2 1 
ATOM   5998  N N   . ASN B  1 377 ? -25.66077 -1.82677   87.28705  1.000 51.87531  ? 357  ASN B N   1 
ATOM   5999  C CA  . ASN B  1 377 ? -24.67766 -2.67109   87.97461  1.000 52.70449  ? 357  ASN B CA  1 
ATOM   6000  C C   . ASN B  1 377 ? -25.37186 -3.83369   88.67590  1.000 51.89203  ? 357  ASN B C   1 
ATOM   6001  O O   . ASN B  1 377 ? -25.11997 -4.13531   89.84805  1.000 51.32097  ? 357  ASN B O   1 
ATOM   6002  C CB  . ASN B  1 377 ? -23.85010 -1.86921   88.97390  1.000 55.25896  ? 357  ASN B CB  1 
ATOM   6003  C CG  . ASN B  1 377 ? -22.97622 -0.82654   88.31266  1.000 61.80778  ? 357  ASN B CG  1 
ATOM   6004  O OD1 . ASN B  1 377 ? -23.10450 -0.54918   87.12035  1.000 66.52811  ? 357  ASN B OD1 1 
ATOM   6005  N ND2 . ASN B  1 377 ? -22.09924 -0.21537   89.09846  1.000 61.07114  ? 357  ASN B ND2 1 
ATOM   6006  N N   . ALA B  1 378 ? -26.28610 -4.46610   87.95374  1.000 48.62631  ? 358  ALA B N   1 
ATOM   6007  C CA  . ALA B  1 378 ? -27.16553 -5.47814   88.51779  1.000 44.72393  ? 358  ALA B CA  1 
ATOM   6008  C C   . ALA B  1 378 ? -26.85499 -6.82909   87.89238  1.000 44.02861  ? 358  ALA B C   1 
ATOM   6009  O O   . ALA B  1 378 ? -26.72609 -6.93366   86.66651  1.000 43.60820  ? 358  ALA B O   1 
ATOM   6010  C CB  . ALA B  1 378 ? -28.63694 -5.10898   88.29217  1.000 43.47088  ? 358  ALA B CB  1 
ATOM   6011  N N   . VAL B  1 379 ? -26.72723 -7.84891   88.73534  1.000 41.66688  ? 359  VAL B N   1 
ATOM   6012  C CA  . VAL B  1 379 ? -26.60081 -9.24065   88.30520  1.000 38.92383  ? 359  VAL B CA  1 
ATOM   6013  C C   . VAL B  1 379 ? -27.89843 -9.92331   88.70125  1.000 42.46339  ? 359  VAL B C   1 
ATOM   6014  O O   . VAL B  1 379 ? -28.22559 -10.00037  89.89381  1.000 45.57699  ? 359  VAL B O   1 
ATOM   6015  C CB  . VAL B  1 379 ? -25.38815 -9.93600   88.94699  1.000 39.20867  ? 359  VAL B CB  1 
ATOM   6016  C CG1 . VAL B  1 379 ? -25.33686 -11.42977  88.56414  1.000 44.44744  ? 359  VAL B CG1 1 
ATOM   6017  C CG2 . VAL B  1 379 ? -24.10917 -9.23339   88.54511  1.000 38.96943  ? 359  VAL B CG2 1 
ATOM   6018  N N   . VAL B  1 380 ? -28.66064 -10.38107  87.71310  1.000 38.68596  ? 360  VAL B N   1 
ATOM   6019  C CA  . VAL B  1 380 ? -30.05467 -10.75221  87.93427  1.000 42.72702  ? 360  VAL B CA  1 
ATOM   6020  C C   . VAL B  1 380 ? -30.22238 -12.19846  87.51485  1.000 41.86388  ? 360  VAL B C   1 
ATOM   6021  O O   . VAL B  1 380 ? -30.10056 -12.52665  86.32845  1.000 43.23254  ? 360  VAL B O   1 
ATOM   6022  C CB  . VAL B  1 380 ? -31.02645 -9.83637   87.17567  1.000 41.12886  ? 360  VAL B CB  1 
ATOM   6023  C CG1 . VAL B  1 380 ? -32.45054 -10.22583  87.46782  1.000 38.75038  ? 360  VAL B CG1 1 
ATOM   6024  C CG2 . VAL B  1 380 ? -30.77713 -8.36868   87.53191  1.000 37.07247  ? 360  VAL B CG2 1 
ATOM   6025  N N   . LEU B  1 381 ? -30.52514 -13.05332  88.47960  1.000 39.50633  ? 361  LEU B N   1 
ATOM   6026  C CA  . LEU B  1 381 ? -30.52541 -14.49088  88.27921  1.000 40.30202  ? 361  LEU B CA  1 
ATOM   6027  C C   . LEU B  1 381 ? -31.83405 -14.91905  87.61503  1.000 39.82875  ? 361  LEU B C   1 
ATOM   6028  O O   . LEU B  1 381 ? -32.73104 -14.08597  87.41486  1.000 39.30523  ? 361  LEU B O   1 
ATOM   6029  C CB  . LEU B  1 381 ? -30.27684 -15.16188  89.62622  1.000 44.59947  ? 361  LEU B CB  1 
ATOM   6030  C CG  . LEU B  1 381 ? -28.79837 -15.42983  89.91905  1.000 46.05927  ? 361  LEU B CG  1 
ATOM   6031  C CD1 . LEU B  1 381 ? -27.93800 -14.18359  89.72776  1.000 47.78048  ? 361  LEU B CD1 1 
ATOM   6032  C CD2 . LEU B  1 381 ? -28.66254 -15.94315  91.32199  1.000 45.54117  ? 361  LEU B CD2 1 
ATOM   6033  N N   . PRO B  1 382 ? -31.97229 -16.20585  87.23603  1.000 39.02831  ? 362  PRO B N   1 
ATOM   6034  C CA  . PRO B  1 382 ? -33.14419 -16.61628  86.43825  1.000 38.57911  ? 362  PRO B CA  1 
ATOM   6035  C C   . PRO B  1 382 ? -34.48547 -16.32673  87.10514  1.000 35.84089  ? 362  PRO B C   1 
ATOM   6036  O O   . PRO B  1 382 ? -34.63266 -16.41105  88.32136  1.000 41.80856  ? 362  PRO B O   1 
ATOM   6037  C CB  . PRO B  1 382 ? -32.93603 -18.12830  86.25201  1.000 40.23719  ? 362  PRO B CB  1 
ATOM   6038  C CG  . PRO B  1 382 ? -31.46694 -18.31444  86.29428  1.000 35.05293  ? 362  PRO B CG  1 
ATOM   6039  C CD  . PRO B  1 382 ? -30.97897 -17.30181  87.32138  1.000 42.00113  ? 362  PRO B CD  1 
ATOM   6040  N N   . SER B  1 383 ? -35.46439 -15.95822  86.27544  1.000 47.12481  ? 363  SER B N   1 
ATOM   6041  C CA  . SER B  1 383 ? -36.88348 -15.88314  86.64579  1.000 46.20045  ? 363  SER B CA  1 
ATOM   6042  C C   . SER B  1 383 ? -37.19290 -14.76492  87.64993  1.000 47.92990  ? 363  SER B C   1 
ATOM   6043  O O   . SER B  1 383 ? -38.15977 -14.85300  88.40997  1.000 49.07450  ? 363  SER B O   1 
ATOM   6044  C CB  . SER B  1 383 ? -37.37544 -17.23286  87.17851  1.000 47.09695  ? 363  SER B CB  1 
ATOM   6045  O OG  . SER B  1 383 ? -37.07007 -18.26495  86.25556  1.000 46.15011  ? 363  SER B OG  1 
ATOM   6046  N N   . VAL B  1 384 ? -36.41011 -13.70564  87.65060  1.000 43.70247  ? 364  VAL B N   1 
ATOM   6047  C CA  . VAL B  1 384 ? -36.65010 -12.57608  88.53813  1.000 43.84218  ? 364  VAL B CA  1 
ATOM   6048  C C   . VAL B  1 384 ? -37.71576 -11.66975  87.92434  1.000 43.88141  ? 364  VAL B C   1 
ATOM   6049  O O   . VAL B  1 384 ? -37.82846 -11.54829  86.70129  1.000 44.01078  ? 364  VAL B O   1 
ATOM   6050  C CB  . VAL B  1 384 ? -35.31844 -11.83417  88.79524  1.000 42.77409  ? 364  VAL B CB  1 
ATOM   6051  C CG1 . VAL B  1 384 ? -35.53702 -10.39501  89.26778  1.000 39.73632  ? 364  VAL B CG1 1 
ATOM   6052  C CG2 . VAL B  1 384 ? -34.46523 -12.61315  89.78461  1.000 41.19484  ? 364  VAL B CG2 1 
ATOM   6053  N N   . LYS B  1 385 ? -38.53871 -11.05354  88.77230  1.000 43.70528  ? 365  LYS B N   1 
ATOM   6054  C CA  . LYS B  1 385 ? -39.56576 -10.11597  88.32805  1.000 44.60106  ? 365  LYS B CA  1 
ATOM   6055  C C   . LYS B  1 385 ? -39.31453 -8.77746   89.00558  1.000 46.61021  ? 365  LYS B C   1 
ATOM   6056  O O   . LYS B  1 385 ? -39.38652 -8.69255   90.23581  1.000 42.07904  ? 365  LYS B O   1 
ATOM   6057  C CB  . LYS B  1 385 ? -40.97700 -10.61805  88.66676  1.000 47.82556  ? 365  LYS B CB  1 
ATOM   6058  C CG  . LYS B  1 385 ? -41.28284 -12.07613  88.31250  1.000 57.56715  ? 365  LYS B CG  1 
ATOM   6059  C CD  . LYS B  1 385 ? -40.98978 -12.37765  86.84107  1.000 68.42627  ? 365  LYS B CD  1 
ATOM   6060  C CE  . LYS B  1 385 ? -41.75754 -13.60255  86.32802  1.000 73.93706  ? 365  LYS B CE  1 
ATOM   6061  N NZ  . LYS B  1 385 ? -43.18106 -13.28763  85.97995  1.000 74.74142  ? 365  LYS B NZ  1 
ATOM   6062  N N   . ILE B  1 386 ? -39.02964 -7.74310   88.21043  1.000 40.92019  ? 366  ILE B N   1 
ATOM   6063  C CA  . ILE B  1 386 ? -38.84170 -6.38088   88.70384  1.000 46.75707  ? 366  ILE B CA  1 
ATOM   6064  C C   . ILE B  1 386 ? -40.17043 -5.64649   88.58702  1.000 51.25283  ? 366  ILE B C   1 
ATOM   6065  O O   . ILE B  1 386 ? -40.63633 -5.35771   87.47790  1.000 54.19283  ? 366  ILE B O   1 
ATOM   6066  C CB  . ILE B  1 386 ? -37.75038 -5.62014   87.93812  1.000 43.47229  ? 366  ILE B CB  1 
ATOM   6067  C CG1 . ILE B  1 386 ? -36.51777 -6.49960   87.68628  1.000 43.85943  ? 366  ILE B CG1 1 
ATOM   6068  C CG2 . ILE B  1 386 ? -37.38243 -4.33518   88.70447  1.000 42.55520  ? 366  ILE B CG2 1 
ATOM   6069  C CD1 . ILE B  1 386 ? -35.71633 -6.83177   88.93588  1.000 41.64326  ? 366  ILE B CD1 1 
ATOM   6070  N N   . GLY B  1 387 ? -40.77293 -5.30982   89.72312  1.000 48.40139  ? 367  GLY B N   1 
ATOM   6071  C CA  . GLY B  1 387 ? -41.99929 -4.54000   89.68881  1.000 51.16329  ? 367  GLY B CA  1 
ATOM   6072  C C   . GLY B  1 387 ? -41.80216 -3.16133   89.08680  1.000 52.26936  ? 367  GLY B C   1 
ATOM   6073  O O   . GLY B  1 387 ? -40.69604 -2.63859   88.98585  1.000 50.96051  ? 367  GLY B O   1 
ATOM   6074  N N   . ARG B  1 388 ? -42.91397 -2.57214   88.66620  1.000 56.14475  ? 368  ARG B N   1 
ATOM   6075  C CA  . ARG B  1 388 ? -42.88622 -1.22864   88.10504  1.000 57.40480  ? 368  ARG B CA  1 
ATOM   6076  C C   . ARG B  1 388 ? -42.25478 -0.25537   89.08921  1.000 58.43676  ? 368  ARG B C   1 
ATOM   6077  O O   . ARG B  1 388 ? -42.36794 -0.41571   90.30765  1.000 68.12575  ? 368  ARG B O   1 
ATOM   6078  C CB  . ARG B  1 388 ? -44.30648 -0.75984   87.78868  1.000 59.48141  ? 368  ARG B CB  1 
ATOM   6079  C CG  . ARG B  1 388 ? -44.99138 -1.44201   86.62583  1.000 52.50553  ? 368  ARG B CG  1 
ATOM   6080  C CD  . ARG B  1 388 ? -46.23770 -0.67690   86.28922  1.000 53.25496  ? 368  ARG B CD  1 
ATOM   6081  N NE  . ARG B  1 388 ? -46.77934 -1.04232   84.99132  1.000 58.71791  ? 368  ARG B NE  1 
ATOM   6082  C CZ  . ARG B  1 388 ? -47.46471 -0.20348   84.22202  1.000 60.08139  ? 368  ARG B CZ  1 
ATOM   6083  N NH1 . ARG B  1 388 ? -47.67203 1.04714    84.62937  1.000 61.23227  ? 368  ARG B NH1 1 
ATOM   6084  N NH2 . ARG B  1 388 ? -47.92892 -0.60277   83.04517  1.000 54.06462  ? 368  ARG B NH2 1 
ATOM   6085  N N   . HIS B  1 389 ? -41.59567 0.77238    88.55763  1.000 52.78524  ? 369  HIS B N   1 
ATOM   6086  C CA  . HIS B  1 389 ? -41.08003 1.89799    89.33134  1.000 55.80322  ? 369  HIS B CA  1 
ATOM   6087  C C   . HIS B  1 389 ? -39.97690 1.48885    90.30562  1.000 54.11060  ? 369  HIS B C   1 
ATOM   6088  O O   . HIS B  1 389 ? -39.49027 2.33374    91.06022  1.000 56.55938  ? 369  HIS B O   1 
ATOM   6089  C CB  . HIS B  1 389 ? -42.19737 2.61949    90.11188  1.000 59.77800  ? 369  HIS B CB  1 
ATOM   6090  C CG  . HIS B  1 389 ? -43.23273 3.26249    89.23757  1.000 59.17388  ? 369  HIS B CG  1 
ATOM   6091  N ND1 . HIS B  1 389 ? -44.44466 2.66892    88.95908  1.000 59.61982  ? 369  HIS B ND1 1 
ATOM   6092  C CD2 . HIS B  1 389 ? -43.24866 4.45729    88.60347  1.000 59.99822  ? 369  HIS B CD2 1 
ATOM   6093  C CE1 . HIS B  1 389 ? -45.15009 3.45903    88.16924  1.000 61.25634  ? 369  HIS B CE1 1 
ATOM   6094  N NE2 . HIS B  1 389 ? -44.44677 4.55218    87.93924  1.000 60.87761  ? 369  HIS B NE2 1 
ATOM   6095  N N   . ALA B  1 390 ? -39.57651 0.22393    90.33236  1.000 54.75629  ? 370  ALA B N   1 
ATOM   6096  C CA  . ALA B  1 390 ? -38.44776 -0.19075   91.15215  1.000 56.64172  ? 370  ALA B CA  1 
ATOM   6097  C C   . ALA B  1 390 ? -37.15442 0.27749    90.50224  1.000 58.95111  ? 370  ALA B C   1 
ATOM   6098  O O   . ALA B  1 390 ? -37.05605 0.34703    89.27906  1.000 61.33658  ? 370  ALA B O   1 
ATOM   6099  C CB  . ALA B  1 390 ? -38.43781 -1.71050   91.32616  1.000 53.17850  ? 370  ALA B CB  1 
ATOM   6100  N N   . GLN B  1 391 ? -36.16954 0.64740    91.31903  1.000 61.56769  ? 371  GLN B N   1 
ATOM   6101  C CA  . GLN B  1 391 ? -34.87663 1.10485    90.80242  1.000 63.59862  ? 371  GLN B CA  1 
ATOM   6102  C C   . GLN B  1 391 ? -33.76739 0.57371    91.69681  1.000 63.50579  ? 371  GLN B C   1 
ATOM   6103  O O   . GLN B  1 391 ? -33.59457 1.04593    92.82515  1.000 66.53092  ? 371  GLN B O   1 
ATOM   6104  C CB  . GLN B  1 391 ? -34.81696 2.63143    90.70034  1.000 63.36098  ? 371  GLN B CB  1 
ATOM   6105  C CG  . GLN B  1 391 ? -36.15405 3.25343    90.43547  1.000 68.97105  ? 371  GLN B CG  1 
ATOM   6106  C CD  . GLN B  1 391 ? -36.05662 4.70870    90.11379  1.000 76.01686  ? 371  GLN B CD  1 
ATOM   6107  O OE1 . GLN B  1 391 ? -35.15830 5.39353    90.58296  1.000 73.44414  ? 371  GLN B OE1 1 
ATOM   6108  N NE2 . GLN B  1 391 ? -36.97558 5.19552    89.28724  1.000 83.77546  ? 371  GLN B NE2 1 
ATOM   6109  N N   . LEU B  1 392 ? -33.00456 -0.38387   91.18226  1.000 61.95909  ? 372  LEU B N   1 
ATOM   6110  C CA  . LEU B  1 392 ? -32.01779 -1.12094   91.96054  1.000 61.26508  ? 372  LEU B CA  1 
ATOM   6111  C C   . LEU B  1 392 ? -30.62816 -0.91628   91.36556  1.000 56.90618  ? 372  LEU B C   1 
ATOM   6112  O O   . LEU B  1 392 ? -30.45113 -1.03448   90.15141  1.000 55.28904  ? 372  LEU B O   1 
ATOM   6113  C CB  . LEU B  1 392 ? -32.38740 -2.60571   91.99080  1.000 58.91187  ? 372  LEU B CB  1 
ATOM   6114  C CG  . LEU B  1 392 ? -33.78431 -2.87468   92.56153  1.000 60.62052  ? 372  LEU B CG  1 
ATOM   6115  C CD1 . LEU B  1 392 ? -34.63608 -3.69093   91.60085  1.000 62.02474  ? 372  LEU B CD1 1 
ATOM   6116  C CD2 . LEU B  1 392 ? -33.66725 -3.60863   93.85736  1.000 66.08911  ? 372  LEU B CD2 1 
ATOM   6117  N N   . SER B  1 393 ? -29.64607 -0.61856   92.22057  1.000 59.21592  ? 373  SER B N   1 
ATOM   6118  C CA  . SER B  1 393 ? -28.26976 -0.35272   91.80133  1.000 60.23420  ? 373  SER B CA  1 
ATOM   6119  C C   . SER B  1 393 ? -27.30433 -1.15794   92.65372  1.000 58.86191  ? 373  SER B C   1 
ATOM   6120  O O   . SER B  1 393 ? -27.43390 -1.18368   93.88251  1.000 60.68500  ? 373  SER B O   1 
ATOM   6121  C CB  . SER B  1 393 ? -27.90494 1.13493    91.92136  1.000 63.18319  ? 373  SER B CB  1 
ATOM   6122  O OG  . SER B  1 393 ? -28.78706 1.93671    91.16527  1.000 67.47673  ? 373  SER B OG  1 
ATOM   6123  N N   . ASN B  1 394 ? -26.32424 -1.78325   91.99678  1.000 57.71180  ? 374  ASN B N   1 
ATOM   6124  C CA  . ASN B  1 394 ? -25.25748 -2.54519   92.64558  1.000 55.67157  ? 374  ASN B CA  1 
ATOM   6125  C C   . ASN B  1 394 ? -25.83895 -3.69098   93.48056  1.000 52.37891  ? 374  ASN B C   1 
ATOM   6126  O O   . ASN B  1 394 ? -25.77767 -3.71283   94.71315  1.000 50.59156  ? 374  ASN B O   1 
ATOM   6127  C CB  . ASN B  1 394 ? -24.37156 -1.62131   93.48649  1.000 58.16097  ? 374  ASN B CB  1 
ATOM   6128  C CG  . ASN B  1 394 ? -23.52487 -0.70159   92.63252  1.000 63.86524  ? 374  ASN B CG  1 
ATOM   6129  O OD1 . ASN B  1 394 ? -22.82165 -1.15250   91.73440  1.000 68.03041  ? 374  ASN B OD1 1 
ATOM   6130  N ND2 . ASN B  1 394 ? -23.58468 0.59539    92.91053  1.000 68.65850  ? 374  ASN B ND2 1 
ATOM   6131  N N   . VAL B  1 395 ? -26.40483 -4.66247   92.75960  1.000 50.28442  ? 375  VAL B N   1 
ATOM   6132  C CA  . VAL B  1 395 ? -27.13395 -5.74873   93.39375  1.000 46.08490  ? 375  VAL B CA  1 
ATOM   6133  C C   . VAL B  1 395 ? -26.80457 -7.09224   92.75185  1.000 47.82345  ? 375  VAL B C   1 
ATOM   6134  O O   . VAL B  1 395 ? -26.36504 -7.18997   91.59872  1.000 46.02432  ? 375  VAL B O   1 
ATOM   6135  C CB  . VAL B  1 395 ? -28.66826 -5.53678   93.36815  1.000 43.36411  ? 375  VAL B CB  1 
ATOM   6136  C CG1 . VAL B  1 395 ? -29.08736 -4.45895   94.35252  1.000 47.25981  ? 375  VAL B CG1 1 
ATOM   6137  C CG2 . VAL B  1 395 ? -29.13914 -5.20770   91.96314  1.000 44.42054  ? 375  VAL B CG2 1 
ATOM   6138  N N   . VAL B  1 396 ? -26.99385 -8.12984   93.56101  1.000 44.85005  ? 376  VAL B N   1 
ATOM   6139  C CA  . VAL B  1 396 ? -27.18616 -9.49517   93.11344  1.000 47.27602  ? 376  VAL B CA  1 
ATOM   6140  C C   . VAL B  1 396 ? -28.58827 -9.89668   93.54880  1.000 52.41088  ? 376  VAL B C   1 
ATOM   6141  O O   . VAL B  1 396 ? -28.89812 -9.87355   94.74671  1.000 57.09096  ? 376  VAL B O   1 
ATOM   6142  C CB  . VAL B  1 396 ? -26.13832 -10.44113  93.71461  1.000 48.45801  ? 376  VAL B CB  1 
ATOM   6143  C CG1 . VAL B  1 396 ? -26.49224 -11.90166  93.39699  1.000 43.44462  ? 376  VAL B CG1 1 
ATOM   6144  C CG2 . VAL B  1 396 ? -24.73159 -10.06218  93.21605  1.000 54.28628  ? 376  VAL B CG2 1 
ATOM   6145  N N   . ILE B  1 397 ? -29.43753 -10.24786  92.58943  1.000 49.16903  ? 377  ILE B N   1 
ATOM   6146  C CA  . ILE B  1 397 ? -30.80908 -10.64812  92.87303  1.000 49.76017  ? 377  ILE B CA  1 
ATOM   6147  C C   . ILE B  1 397 ? -30.91728 -12.15691  92.70259  1.000 48.19813  ? 377  ILE B C   1 
ATOM   6148  O O   . ILE B  1 397 ? -30.56751 -12.70120  91.64657  1.000 51.26918  ? 377  ILE B O   1 
ATOM   6149  C CB  . ILE B  1 397 ? -31.82075 -9.91086   91.97864  1.000 48.75232  ? 377  ILE B CB  1 
ATOM   6150  C CG1 . ILE B  1 397 ? -31.54234 -8.40249   91.96811  1.000 47.21191  ? 377  ILE B CG1 1 
ATOM   6151  C CG2 . ILE B  1 397 ? -33.23073 -10.15836  92.47383  1.000 46.85785  ? 377  ILE B CG2 1 
ATOM   6152  C CD1 . ILE B  1 397 ? -32.61982 -7.59236   91.21629  1.000 43.74757  ? 377  ILE B CD1 1 
ATOM   6153  N N   . ASP B  1 398 ? -31.39843 -12.82333  93.74772  1.000 48.03878  ? 378  ASP B N   1 
ATOM   6154  C CA  . ASP B  1 398 ? -31.46884 -14.26970  93.78898  1.000 49.77495  ? 378  ASP B CA  1 
ATOM   6155  C C   . ASP B  1 398 ? -32.45738 -14.79643  92.75941  1.000 48.07402  ? 378  ASP B C   1 
ATOM   6156  O O   . ASP B  1 398 ? -33.34672 -14.08356  92.28188  1.000 44.55124  ? 378  ASP B O   1 
ATOM   6157  C CB  . ASP B  1 398 ? -31.88449 -14.75687  95.18086  1.000 48.82740  ? 378  ASP B CB  1 
ATOM   6158  C CG  . ASP B  1 398 ? -31.42229 -16.18134  95.47330  1.000 50.49561  ? 378  ASP B CG  1 
ATOM   6159  O OD1 . ASP B  1 398 ? -30.60403 -16.73484  94.70370  1.000 49.33569  ? 378  ASP B OD1 1 
ATOM   6160  O OD2 . ASP B  1 398 ? -31.84813 -16.73797  96.50212  1.000 53.95872  ? 378  ASP B OD2 1 
ATOM   6161  N N   . HIS B  1 399 ? -32.27018 -16.07594  92.43647  1.000 45.10160  ? 379  HIS B N   1 
ATOM   6162  C CA  . HIS B  1 399 ? -33.16421 -16.84054  91.59019  1.000 44.86258  ? 379  HIS B CA  1 
ATOM   6163  C C   . HIS B  1 399 ? -34.60807 -16.65366  92.03117  1.000 49.47220  ? 379  HIS B C   1 
ATOM   6164  O O   . HIS B  1 399 ? -34.93577 -16.81563  93.21225  1.000 46.75375  ? 379  HIS B O   1 
ATOM   6165  C CB  . HIS B  1 399 ? -32.75002 -18.32161  91.66036  1.000 49.02550  ? 379  HIS B CB  1 
ATOM   6166  C CG  . HIS B  1 399 ? -33.52400 -19.23399  90.75371  1.000 56.71010  ? 379  HIS B CG  1 
ATOM   6167  N ND1 . HIS B  1 399 ? -34.87847 -19.10964  90.52885  1.000 59.81060  ? 379  HIS B ND1 1 
ATOM   6168  C CD2 . HIS B  1 399 ? -33.11979 -20.28723  90.00570  1.000 59.12660  ? 379  HIS B CD2 1 
ATOM   6169  C CE1 . HIS B  1 399 ? -35.27501 -20.04547  89.68485  1.000 59.19276  ? 379  HIS B CE1 1 
ATOM   6170  N NE2 . HIS B  1 399 ? -34.22601 -20.77098  89.34957  1.000 59.69306  ? 379  HIS B NE2 1 
ATOM   6171  N N   . GLY B  1 400 ? -35.46307 -16.28904  91.06802  1.000 49.20782  ? 380  GLY B N   1 
ATOM   6172  C CA  . GLY B  1 400 ? -36.90241 -16.29594  91.23599  1.000 50.13805  ? 380  GLY B CA  1 
ATOM   6173  C C   . GLY B  1 400 ? -37.48566 -15.18971  92.09220  1.000 50.71035  ? 380  GLY B C   1 
ATOM   6174  O O   . GLY B  1 400 ? -38.69465 -15.20366  92.33970  1.000 55.35756  ? 380  GLY B O   1 
ATOM   6175  N N   . VAL B  1 401 ? -36.67623 -14.22755  92.53537  1.000 47.82358  ? 381  VAL B N   1 
ATOM   6176  C CA  . VAL B  1 401 ? -37.13641 -13.20576  93.46601  1.000 48.23392  ? 381  VAL B CA  1 
ATOM   6177  C C   . VAL B  1 401 ? -38.10613 -12.25853  92.76653  1.000 46.08661  ? 381  VAL B C   1 
ATOM   6178  O O   . VAL B  1 401 ? -37.90619 -11.87510  91.60610  1.000 48.55154  ? 381  VAL B O   1 
ATOM   6179  C CB  . VAL B  1 401 ? -35.91911 -12.45701  94.04093  1.000 48.66165  ? 381  VAL B CB  1 
ATOM   6180  C CG1 . VAL B  1 401 ? -36.33788 -11.17517  94.78167  1.000 42.72173  ? 381  VAL B CG1 1 
ATOM   6181  C CG2 . VAL B  1 401 ? -35.10416 -13.38945  94.93257  1.000 41.69890  ? 381  VAL B CG2 1 
ATOM   6182  N N   . VAL B  1 402 ? -39.16698 -11.87935  93.46823  1.000 46.41139  ? 382  VAL B N   1 
ATOM   6183  C CA  . VAL B  1 402 ? -40.12706 -10.89421  92.97976  1.000 52.64099  ? 382  VAL B CA  1 
ATOM   6184  C C   . VAL B  1 402 ? -39.86647 -9.56852   93.69066  1.000 54.19488  ? 382  VAL B C   1 
ATOM   6185  O O   . VAL B  1 402 ? -39.99840 -9.47173   94.91785  1.000 56.36307  ? 382  VAL B O   1 
ATOM   6186  C CB  . VAL B  1 402 ? -41.57464 -11.37297  93.18170  1.000 52.59860  ? 382  VAL B CB  1 
ATOM   6187  C CG1 . VAL B  1 402 ? -42.57076 -10.22547  92.94115  1.000 51.78265  ? 382  VAL B CG1 1 
ATOM   6188  C CG2 . VAL B  1 402 ? -41.85659 -12.54520  92.24012  1.000 49.73484  ? 382  VAL B CG2 1 
ATOM   6189  N N   . ILE B  1 403 ? -39.48241 -8.55447   92.92150  1.000 49.76886  ? 383  ILE B N   1 
ATOM   6190  C CA  . ILE B  1 403 ? -39.15538 -7.23813   93.45998  1.000 54.25906  ? 383  ILE B CA  1 
ATOM   6191  C C   . ILE B  1 403 ? -40.44328 -6.41940   93.53055  1.000 55.82788  ? 383  ILE B C   1 
ATOM   6192  O O   . ILE B  1 403 ? -41.11460 -6.24944   92.49423  1.000 55.25840  ? 383  ILE B O   1 
ATOM   6193  C CB  . ILE B  1 403 ? -38.09608 -6.52868   92.60703  1.000 51.50157  ? 383  ILE B CB  1 
ATOM   6194  C CG1 . ILE B  1 403 ? -36.80765 -7.35991   92.57451  1.000 46.47302  ? 383  ILE B CG1 1 
ATOM   6195  C CG2 . ILE B  1 403 ? -37.84057 -5.09852   93.12084  1.000 48.61776  ? 383  ILE B CG2 1 
ATOM   6196  C CD1 . ILE B  1 403 ? -36.00916 -7.29798   93.84558  1.000 43.36135  ? 383  ILE B CD1 1 
ATOM   6197  N N   . PRO B  1 404 ? -40.82182 -5.90858   94.69842  1.000 53.57749  ? 384  PRO B N   1 
ATOM   6198  C CA  . PRO B  1 404 ? -42.06548 -5.14164   94.80114  1.000 57.54479  ? 384  PRO B CA  1 
ATOM   6199  C C   . PRO B  1 404 ? -41.99581 -3.84272   94.01524  1.000 57.47327  ? 384  PRO B C   1 
ATOM   6200  O O   . PRO B  1 404 ? -40.92465 -3.28984   93.75913  1.000 55.72747  ? 384  PRO B O   1 
ATOM   6201  C CB  . PRO B  1 404 ? -42.19636 -4.87330   96.30435  1.000 57.07090  ? 384  PRO B CB  1 
ATOM   6202  C CG  . PRO B  1 404 ? -41.32915 -5.91428   96.94661  1.000 51.97253  ? 384  PRO B CG  1 
ATOM   6203  C CD  . PRO B  1 404 ? -40.18950 -6.10762   96.00845  1.000 49.57474  ? 384  PRO B CD  1 
ATOM   6204  N N   . GLU B  1 405 ? -43.17935 -3.35919   93.63795  1.000 60.66491  ? 385  GLU B N   1 
ATOM   6205  C CA  . GLU B  1 405 ? -43.28585 -2.12005   92.87896  1.000 61.49013  ? 385  GLU B CA  1 
ATOM   6206  C C   . GLU B  1 405 ? -42.66912 -0.95001   93.64326  1.000 63.51504  ? 385  GLU B C   1 
ATOM   6207  O O   . GLU B  1 405 ? -42.94191 -0.75066   94.83071  1.000 66.05681  ? 385  GLU B O   1 
ATOM   6208  C CB  . GLU B  1 405 ? -44.75254 -1.82703   92.56791  1.000 63.59299  ? 385  GLU B CB  1 
ATOM   6209  C CG  . GLU B  1 405 ? -45.31504 -2.53842   91.35018  1.000 66.81083  ? 385  GLU B CG  1 
ATOM   6210  C CD  . GLU B  1 405 ? -46.51327 -1.80043   90.75845  1.000 77.36254  ? 385  GLU B CD  1 
ATOM   6211  O OE1 . GLU B  1 405 ? -46.72191 -0.60968   91.09221  1.000 81.98389  ? 385  GLU B OE1 1 
ATOM   6212  O OE2 . GLU B  1 405 ? -47.24734 -2.40387   89.94906  1.000 81.13635  ? 385  GLU B OE2 1 
ATOM   6213  N N   . GLY B  1 406 ? -41.83036 -0.17650   92.95691  1.000 62.24626  ? 386  GLY B N   1 
ATOM   6214  C CA  . GLY B  1 406 ? -41.30999 1.05414    93.51693  1.000 60.95520  ? 386  GLY B CA  1 
ATOM   6215  C C   . GLY B  1 406 ? -40.20708 0.90190    94.53605  1.000 61.29132  ? 386  GLY B C   1 
ATOM   6216  O O   . GLY B  1 406 ? -39.80873 1.90334    95.14790  1.000 63.07012  ? 386  GLY B O   1 
ATOM   6217  N N   . LEU B  1 407 ? -39.69157 -0.30922   94.73292  1.000 60.32345  ? 387  LEU B N   1 
ATOM   6218  C CA  . LEU B  1 407 ? -38.60201 -0.51379   95.67530  1.000 58.22923  ? 387  LEU B CA  1 
ATOM   6219  C C   . LEU B  1 407 ? -37.33182 0.17017    95.18256  1.000 60.17171  ? 387  LEU B C   1 
ATOM   6220  O O   . LEU B  1 407 ? -36.95126 0.02264    94.01275  1.000 55.13701  ? 387  LEU B O   1 
ATOM   6221  C CB  . LEU B  1 407 ? -38.35044 -2.00664   95.87855  1.000 54.71010  ? 387  LEU B CB  1 
ATOM   6222  C CG  . LEU B  1 407 ? -37.09932 -2.30521   96.71035  1.000 53.35391  ? 387  LEU B CG  1 
ATOM   6223  C CD1 . LEU B  1 407 ? -37.40663 -2.12152   98.17633  1.000 53.05005  ? 387  LEU B CD1 1 
ATOM   6224  C CD2 . LEU B  1 407 ? -36.59332 -3.71815   96.46435  1.000 49.02013  ? 387  LEU B CD2 1 
ATOM   6225  N N   . ILE B  1 408 ? -36.66748 0.89489    96.08865  1.000 53.86832  ? 388  ILE B N   1 
ATOM   6226  C CA  . ILE B  1 408 ? -35.40654 1.58391    95.82194  1.000 58.63652  ? 388  ILE B CA  1 
ATOM   6227  C C   . ILE B  1 408 ? -34.27273 0.89707    96.58300  1.000 61.28627  ? 388  ILE B C   1 
ATOM   6228  O O   . ILE B  1 408 ? -34.37802 0.66311    97.79553  1.000 64.66735  ? 388  ILE B O   1 
ATOM   6229  C CB  . ILE B  1 408 ? -35.48080 3.06790    96.21793  1.000 61.10386  ? 388  ILE B CB  1 
ATOM   6230  C CG1 . ILE B  1 408 ? -36.81974 3.68933    95.78933  1.000 60.93000  ? 388  ILE B CG1 1 
ATOM   6231  C CG2 . ILE B  1 408 ? -34.29005 3.81083    95.63746  1.000 60.88684  ? 388  ILE B CG2 1 
ATOM   6232  C CD1 . ILE B  1 408 ? -37.03982 3.70395    94.28183  1.000 57.45727  ? 388  ILE B CD1 1 
ATOM   6233  N N   . VAL B  1 409 ? -33.17531 0.61172    95.87782  1.000 59.30517  ? 389  VAL B N   1 
ATOM   6234  C CA  . VAL B  1 409 ? -31.97756 -0.01100   96.44830  1.000 60.07067  ? 389  VAL B CA  1 
ATOM   6235  C C   . VAL B  1 409 ? -30.74674 0.64440    95.82499  1.000 61.27644  ? 389  VAL B C   1 
ATOM   6236  O O   . VAL B  1 409 ? -30.65870 0.76360    94.59770  1.000 62.08511  ? 389  VAL B O   1 
ATOM   6237  C CB  . VAL B  1 409 ? -31.92985 -1.54271   96.21390  1.000 51.24820  ? 389  VAL B CB  1 
ATOM   6238  C CG1 . VAL B  1 409 ? -30.60362 -2.09091   96.68236  1.000 48.78654  ? 389  VAL B CG1 1 
ATOM   6239  C CG2 . VAL B  1 409 ? -33.06716 -2.25494   96.93739  1.000 49.31372  ? 389  VAL B CG2 1 
ATOM   6240  N N   . GLY B  1 410 ? -29.78731 1.03889    96.66109  1.000 58.24586  ? 390  GLY B N   1 
ATOM   6241  C CA  . GLY B  1 410 ? -28.59267 1.71246    96.19657  1.000 59.14381  ? 390  GLY B CA  1 
ATOM   6242  C C   . GLY B  1 410 ? -28.60749 3.21409    96.36154  1.000 67.46934  ? 390  GLY B C   1 
ATOM   6243  O O   . GLY B  1 410 ? -27.68843 3.88649    95.87591  1.000 70.88898  ? 390  GLY B O   1 
ATOM   6244  N N   . GLU B  1 411 ? -29.62658 3.76273    97.01870  1.000 69.75184  ? 391  GLU B N   1 
ATOM   6245  C CA  . GLU B  1 411 ? -29.71068 5.18626    97.29229  1.000 69.30150  ? 391  GLU B CA  1 
ATOM   6246  C C   . GLU B  1 411 ? -29.46706 5.52529    98.74791  1.000 70.69617  ? 391  GLU B C   1 
ATOM   6247  O O   . GLU B  1 411 ? -28.90861 6.58839    99.03271  1.000 72.39660  ? 391  GLU B O   1 
ATOM   6248  C CB  . GLU B  1 411 ? -31.08609 5.72734    96.88498  1.000 72.62891  ? 391  GLU B CB  1 
ATOM   6249  C CG  . GLU B  1 411 ? -31.04098 7.05259    96.15715  1.000 78.85772  ? 391  GLU B CG  1 
ATOM   6250  C CD  . GLU B  1 411 ? -30.72055 6.89356    94.68546  1.000 82.02845  ? 391  GLU B CD  1 
ATOM   6251  O OE1 . GLU B  1 411 ? -31.23358 5.93198    94.06150  1.000 78.10297  ? 391  GLU B OE1 1 
ATOM   6252  O OE2 . GLU B  1 411 ? -29.97124 7.74166    94.15070  1.000 86.09387  ? 391  GLU B OE2 1 
ATOM   6253  N N   . ASP B  1 412 ? -29.87793 4.66090    99.67303  1.000 68.37505  ? 392  ASP B N   1 
ATOM   6254  C CA  . ASP B  1 412 ? -29.59441 4.85596    101.09488 1.000 72.87469  ? 392  ASP B CA  1 
ATOM   6255  C C   . ASP B  1 412 ? -28.76152 3.70174    101.61895 1.000 71.62633  ? 392  ASP B C   1 
ATOM   6256  O O   . ASP B  1 412 ? -29.30448 2.61527    101.88762 1.000 72.67384  ? 392  ASP B O   1 
ATOM   6257  C CB  . ASP B  1 412 ? -30.86996 4.98920    101.91879 1.000 77.16260  ? 392  ASP B CB  1 
ATOM   6258  C CG  . ASP B  1 412 ? -30.57575 5.37659    103.35189 1.000 81.42267  ? 392  ASP B CG  1 
ATOM   6259  O OD1 . ASP B  1 412 ? -29.45009 5.86179    103.60286 1.000 82.63593  ? 392  ASP B OD1 1 
ATOM   6260  O OD2 . ASP B  1 412 ? -31.45297 5.21161    104.22100 1.000 82.62492  ? 392  ASP B OD2 1 
ATOM   6261  N N   . PRO B  1 413 ? -27.45090 3.88928    101.79632 1.000 71.57612  ? 393  PRO B N   1 
ATOM   6262  C CA  . PRO B  1 413 ? -26.60980 2.78362    102.28845 1.000 70.97503  ? 393  PRO B CA  1 
ATOM   6263  C C   . PRO B  1 413 ? -27.05249 2.23430    103.63344 1.000 73.31205  ? 393  PRO B C   1 
ATOM   6264  O O   . PRO B  1 413 ? -26.95751 1.01965    103.85369 1.000 72.62211  ? 393  PRO B O   1 
ATOM   6265  C CB  . PRO B  1 413 ? -25.21326 3.41888    102.37203 1.000 71.49484  ? 393  PRO B CB  1 
ATOM   6266  C CG  . PRO B  1 413 ? -25.26261 4.58837    101.43485 1.000 70.96846  ? 393  PRO B CG  1 
ATOM   6267  C CD  . PRO B  1 413 ? -26.66918 5.09889    101.49117 1.000 71.53489  ? 393  PRO B CD  1 
ATOM   6268  N N   . GLU B  1 414 ? -27.55235 3.09089    104.53144 1.000 73.88917  ? 394  GLU B N   1 
ATOM   6269  C CA  . GLU B  1 414 ? -27.94841 2.62982    105.85777 1.000 75.25572  ? 394  GLU B CA  1 
ATOM   6270  C C   . GLU B  1 414 ? -29.24389 1.83620    105.80282 1.000 71.37937  ? 394  GLU B C   1 
ATOM   6271  O O   . GLU B  1 414 ? -29.37758 0.81259    106.48334 1.000 73.42958  ? 394  GLU B O   1 
ATOM   6272  C CB  . GLU B  1 414 ? -28.09204 3.81940    106.81473 1.000 80.23234  ? 394  GLU B CB  1 
ATOM   6273  C CG  . GLU B  1 414 ? -26.92937 4.79161    106.75892 1.000 85.54592  ? 394  GLU B CG  1 
ATOM   6274  C CD  . GLU B  1 414 ? -27.20651 5.96799    105.82862 1.000 94.55217  ? 394  GLU B CD  1 
ATOM   6275  O OE1 . GLU B  1 414 ? -28.15652 6.74687    106.10308 1.000 99.21649  ? 394  GLU B OE1 1 
ATOM   6276  O OE2 . GLU B  1 414 ? -26.48655 6.09838    104.80822 1.000 94.62626  ? 394  GLU B OE2 1 
ATOM   6277  N N   . LEU B  1 415 ? -30.21403 2.29528    105.00931 1.000 67.87948  ? 395  LEU B N   1 
ATOM   6278  C CA  . LEU B  1 415 ? -31.47036 1.55968    104.88736 1.000 67.32620  ? 395  LEU B CA  1 
ATOM   6279  C C   . LEU B  1 415 ? -31.26953 0.24039    104.14286 1.000 65.21636  ? 395  LEU B C   1 
ATOM   6280  O O   . LEU B  1 415 ? -31.74760 -0.81115   104.58856 1.000 63.83967  ? 395  LEU B O   1 
ATOM   6281  C CB  . LEU B  1 415 ? -32.51652 2.42505    104.18653 1.000 65.38582  ? 395  LEU B CB  1 
ATOM   6282  C CG  . LEU B  1 415 ? -33.90497 1.83695    103.94158 1.000 67.00317  ? 395  LEU B CG  1 
ATOM   6283  C CD1 . LEU B  1 415 ? -34.61120 1.50806    105.25869 1.000 68.07913  ? 395  LEU B CD1 1 
ATOM   6284  C CD2 . LEU B  1 415 ? -34.73441 2.81208    103.13234 1.000 68.54041  ? 395  LEU B CD2 1 
ATOM   6285  N N   . ASP B  1 416 ? -30.57305 0.28396    102.99817 1.000 63.17328  ? 396  ASP B N   1 
ATOM   6286  C CA  . ASP B  1 416 ? -30.28867 -0.93475   102.24185 1.000 62.11598  ? 396  ASP B CA  1 
ATOM   6287  C C   . ASP B  1 416 ? -29.59836 -1.96811   103.10842 1.000 65.55896  ? 396  ASP B C   1 
ATOM   6288  O O   . ASP B  1 416 ? -29.91111 -3.16176   103.03227 1.000 67.62792  ? 396  ASP B O   1 
ATOM   6289  C CB  . ASP B  1 416 ? -29.41568 -0.62685   101.03230 1.000 58.84852  ? 396  ASP B CB  1 
ATOM   6290  C CG  . ASP B  1 416 ? -30.11802 0.22363    100.02267 1.000 61.25689  ? 396  ASP B CG  1 
ATOM   6291  O OD1 . ASP B  1 416 ? -31.36288 0.35214    100.12513 1.000 65.19920  ? 396  ASP B OD1 1 
ATOM   6292  O OD2 . ASP B  1 416 ? -29.42662 0.75067    99.12505  1.000 58.91121  ? 396  ASP B OD2 1 
ATOM   6293  N N   . ALA B  1 417 ? -28.65478 -1.52739   103.94243 1.000 67.83811  ? 397  ALA B N   1 
ATOM   6294  C CA  . ALA B  1 417 ? -27.98451 -2.46444   104.83128 1.000 64.47528  ? 397  ALA B CA  1 
ATOM   6295  C C   . ALA B  1 417 ? -28.95228 -3.04731   105.84431 1.000 63.92779  ? 397  ALA B C   1 
ATOM   6296  O O   . ALA B  1 417 ? -28.82001 -4.21712   106.21825 1.000 63.06981  ? 397  ALA B O   1 
ATOM   6297  C CB  . ALA B  1 417 ? -26.81592 -1.78286   105.53589 1.000 62.31507  ? 397  ALA B CB  1 
ATOM   6298  N N   . LYS B  1 418 ? -29.93765 -2.25979   106.28567 1.000 64.84054  ? 398  LYS B N   1 
ATOM   6299  C CA  . LYS B  1 418 ? -30.91153 -2.77697   107.24194 1.000 65.75433  ? 398  LYS B CA  1 
ATOM   6300  C C   . LYS B  1 418 ? -31.78934 -3.85985   106.61354 1.000 66.81992  ? 398  LYS B C   1 
ATOM   6301  O O   . LYS B  1 418 ? -32.15089 -4.83709   107.27976 1.000 66.85066  ? 398  LYS B O   1 
ATOM   6302  C CB  . LYS B  1 418 ? -31.76091 -1.63226   107.79087 1.000 65.77168  ? 398  LYS B CB  1 
ATOM   6303  N N   . ARG B  1 419 ? -32.11821 -3.72016   105.32885 1.000 66.26695  ? 399  ARG B N   1 
ATOM   6304  C CA  . ARG B  1 419 ? -33.07637 -4.61385   104.68691 1.000 68.30783  ? 399  ARG B CA  1 
ATOM   6305  C C   . ARG B  1 419 ? -32.43928 -5.82459   104.01454 1.000 64.21521  ? 399  ARG B C   1 
ATOM   6306  O O   . ARG B  1 419 ? -33.09218 -6.86364   103.89443 1.000 67.08945  ? 399  ARG B O   1 
ATOM   6307  C CB  . ARG B  1 419 ? -33.88447 -3.86423   103.62861 1.000 68.51703  ? 399  ARG B CB  1 
ATOM   6308  C CG  . ARG B  1 419 ? -34.44778 -2.55312   104.07333 1.000 68.27806  ? 399  ARG B CG  1 
ATOM   6309  C CD  . ARG B  1 419 ? -34.95464 -1.76912   102.88275 1.000 68.63108  ? 399  ARG B CD  1 
ATOM   6310  N NE  . ARG B  1 419 ? -36.08636 -0.93766   103.26907 1.000 74.73459  ? 399  ARG B NE  1 
ATOM   6311  C CZ  . ARG B  1 419 ? -36.62624 -0.00124   102.49772 1.000 76.54879  ? 399  ARG B CZ  1 
ATOM   6312  N NH1 . ARG B  1 419 ? -36.12826 0.22188    101.28484 1.000 77.58474  ? 399  ARG B NH1 1 
ATOM   6313  N NH2 . ARG B  1 419 ? -37.66022 0.71089    102.94036 1.000 72.67918  ? 399  ARG B NH2 1 
ATOM   6314  N N   . PHE B  1 420 ? -31.19924 -5.72222   103.55596 1.000 60.93455  ? 400  PHE B N   1 
ATOM   6315  C CA  . PHE B  1 420 ? -30.59768 -6.77216   102.74975 1.000 60.12785  ? 400  PHE B CA  1 
ATOM   6316  C C   . PHE B  1 420 ? -29.22020 -7.11437   103.29056 1.000 61.90160  ? 400  PHE B C   1 
ATOM   6317  O O   . PHE B  1 420 ? -28.74352 -6.53473   104.26939 1.000 66.02999  ? 400  PHE B O   1 
ATOM   6318  C CB  . PHE B  1 420 ? -30.49243 -6.34466   101.28191 1.000 58.26531  ? 400  PHE B CB  1 
ATOM   6319  C CG  . PHE B  1 420 ? -31.73432 -5.69669   100.75836 1.000 56.08692  ? 400  PHE B CG  1 
ATOM   6320  C CD1 . PHE B  1 420 ? -32.93109 -6.39262   100.71809 1.000 54.95787  ? 400  PHE B CD1 1 
ATOM   6321  C CD2 . PHE B  1 420 ? -31.71796 -4.36826   100.36164 1.000 55.62819  ? 400  PHE B CD2 1 
ATOM   6322  C CE1 . PHE B  1 420 ? -34.08576 -5.78383   100.24238 1.000 56.69645  ? 400  PHE B CE1 1 
ATOM   6323  C CE2 . PHE B  1 420 ? -32.85937 -3.75916   99.90131  1.000 54.92298  ? 400  PHE B CE2 1 
ATOM   6324  C CZ  . PHE B  1 420 ? -34.04697 -4.46467   99.83643  1.000 54.80797  ? 400  PHE B CZ  1 
ATOM   6325  N N   . ARG B  1 421 ? -28.58513 -8.07704   102.63139 1.000 59.34386  ? 401  ARG B N   1 
ATOM   6326  C CA  . ARG B  1 421 ? -27.18461 -8.40082   102.86226 1.000 56.84186  ? 401  ARG B CA  1 
ATOM   6327  C C   . ARG B  1 421 ? -26.35058 -7.44989   102.01575 1.000 57.37902  ? 401  ARG B C   1 
ATOM   6328  O O   . ARG B  1 421 ? -26.38809 -7.51511   100.78358 1.000 57.80060  ? 401  ARG B O   1 
ATOM   6329  C CB  . ARG B  1 421 ? -26.92908 -9.86086   102.49417 1.000 53.48246  ? 401  ARG B CB  1 
ATOM   6330  C CG  . ARG B  1 421 ? -25.48901 -10.20994  102.15946 1.000 54.07481  ? 401  ARG B CG  1 
ATOM   6331  C CD  . ARG B  1 421 ? -24.71243 -10.62621  103.39708 1.000 53.92148  ? 401  ARG B CD  1 
ATOM   6332  N NE  . ARG B  1 421 ? -25.56291 -11.38448  104.30323 1.000 52.93880  ? 401  ARG B NE  1 
ATOM   6333  C CZ  . ARG B  1 421 ? -25.15781 -11.92398  105.44356 1.000 58.43310  ? 401  ARG B CZ  1 
ATOM   6334  N NH1 . ARG B  1 421 ? -23.89425 -11.79881  105.83074 1.000 57.31948  ? 401  ARG B NH1 1 
ATOM   6335  N NH2 . ARG B  1 421 ? -26.02803 -12.58477  106.20094 1.000 64.57770  ? 401  ARG B NH2 1 
ATOM   6336  N N   . ARG B  1 422 ? -25.61512 -6.55026   102.66185 1.000 59.20413  ? 402  ARG B N   1 
ATOM   6337  C CA  . ARG B  1 422 ? -24.82815 -5.54508   101.95928 1.000 59.85788  ? 402  ARG B CA  1 
ATOM   6338  C C   . ARG B  1 422 ? -23.34754 -5.73277   102.26154 1.000 60.04508  ? 402  ARG B C   1 
ATOM   6339  O O   . ARG B  1 422 ? -22.94880 -5.87447   103.42295 1.000 64.41503  ? 402  ARG B O   1 
ATOM   6340  C CB  . ARG B  1 422 ? -25.28462 -4.12481   102.32344 1.000 57.18300  ? 402  ARG B CB  1 
ATOM   6341  C CG  . ARG B  1 422 ? -24.61280 -3.01749   101.51638 1.000 54.60154  ? 402  ARG B CG  1 
ATOM   6342  C CD  . ARG B  1 422 ? -25.15228 -1.63505   101.92033 1.000 56.88277  ? 402  ARG B CD  1 
ATOM   6343  N NE  . ARG B  1 422 ? -24.93171 -0.60690   100.90634 1.000 56.22293  ? 402  ARG B NE  1 
ATOM   6344  C CZ  . ARG B  1 422 ? -24.00701 0.33805    101.02215 1.000 63.39489  ? 402  ARG B CZ  1 
ATOM   6345  N NH1 . ARG B  1 422 ? -23.21682 0.33909    102.08682 1.000 68.17059  ? 402  ARG B NH1 1 
ATOM   6346  N NH2 . ARG B  1 422 ? -23.85139 1.26046    100.07794 1.000 65.96994  ? 402  ARG B NH2 1 
ATOM   6347  N N   . THR B  1 423 ? -22.54282 -5.75026   101.21013 1.000 53.46561  ? 403  THR B N   1 
ATOM   6348  C CA  . THR B  1 423 ? -21.10558 -5.79352   101.36563 1.000 56.48425  ? 403  THR B CA  1 
ATOM   6349  C C   . THR B  1 423 ? -20.59052 -4.40189   101.72500 1.000 63.97211  ? 403  THR B C   1 
ATOM   6350  O O   . THR B  1 423 ? -21.30252 -3.39802   101.60097 1.000 61.60637  ? 403  THR B O   1 
ATOM   6351  C CB  . THR B  1 423 ? -20.45681 -6.28699   100.07974 1.000 57.69605  ? 403  THR B CB  1 
ATOM   6352  O OG1 . THR B  1 423 ? -20.53690 -5.25960   99.08100  1.000 58.61122  ? 403  THR B OG1 1 
ATOM   6353  C CG2 . THR B  1 423 ? -21.18195 -7.52566   99.57097  1.000 55.85983  ? 403  THR B CG2 1 
ATOM   6354  N N   . GLU B  1 424 ? -19.33491 -4.34179   102.17690 1.000 68.44221  ? 404  GLU B N   1 
ATOM   6355  C CA  . GLU B  1 424 ? -18.72773 -3.04006   102.41745 1.000 76.59697  ? 404  GLU B CA  1 
ATOM   6356  C C   . GLU B  1 424 ? -18.69954 -2.22182   101.13624 1.000 76.11625  ? 404  GLU B C   1 
ATOM   6357  O O   . GLU B  1 424 ? -19.10030 -1.04961   101.15459 1.000 80.79496  ? 404  GLU B O   1 
ATOM   6358  C CB  . GLU B  1 424 ? -17.33970 -3.23541   103.04680 1.000 82.84305  ? 404  GLU B CB  1 
ATOM   6359  C CG  . GLU B  1 424 ? -16.60067 -1.96044   103.51435 1.000 93.81373  ? 404  GLU B CG  1 
ATOM   6360  C CD  . GLU B  1 424 ? -16.12289 -1.00739   102.41889 1.000 100.54678 ? 404  GLU B CD  1 
ATOM   6361  O OE1 . GLU B  1 424 ? -16.09588 0.22353    102.68222 1.000 103.30392 ? 404  GLU B OE1 1 
ATOM   6362  O OE2 . GLU B  1 424 ? -15.61683 -1.50402   101.38302 1.000 101.41536 ? 404  GLU B OE2 1 
ATOM   6363  N N   . SER B  1 425 ? -18.37070 -2.85041   100.01056 1.000 69.60458  ? 405  SER B N   1 
ATOM   6364  C CA  . SER B  1 425 ? -18.21012 -2.15217   98.74503  1.000 69.85156  ? 405  SER B CA  1 
ATOM   6365  C C   . SER B  1 425 ? -19.49771 -1.52240   98.22861  1.000 68.04003  ? 405  SER B C   1 
ATOM   6366  O O   . SER B  1 425 ? -19.43315 -0.73723   97.27510  1.000 72.54775  ? 405  SER B O   1 
ATOM   6367  C CB  . SER B  1 425 ? -17.66427 -3.10741   97.69080  1.000 72.15184  ? 405  SER B CB  1 
ATOM   6368  O OG  . SER B  1 425 ? -18.60269 -4.14085   97.45225  1.000 77.20238  ? 405  SER B OG  1 
ATOM   6369  N N   . GLY B  1 426 ? -20.65041 -1.83276   98.82946  1.000 62.66867  ? 406  GLY B N   1 
ATOM   6370  C CA  . GLY B  1 426 ? -21.92971 -1.29678   98.40066  1.000 60.38923  ? 406  GLY B CA  1 
ATOM   6371  C C   . GLY B  1 426 ? -22.84877 -2.27278   97.68967  1.000 56.54167  ? 406  GLY B C   1 
ATOM   6372  O O   . GLY B  1 426 ? -23.95343 -1.87868   97.30223  1.000 55.95776  ? 406  GLY B O   1 
ATOM   6373  N N   . ILE B  1 427 ? -22.44317 -3.52441   97.50140  1.000 59.83624  ? 407  ILE B N   1 
ATOM   6374  C CA  . ILE B  1 427 ? -23.26762 -4.49390   96.78230  1.000 55.42049  ? 407  ILE B CA  1 
ATOM   6375  C C   . ILE B  1 427 ? -24.32701 -5.04161   97.72977  1.000 55.83569  ? 407  ILE B C   1 
ATOM   6376  O O   . ILE B  1 427 ? -24.02218 -5.43839   98.86199  1.000 56.31160  ? 407  ILE B O   1 
ATOM   6377  C CB  . ILE B  1 427 ? -22.39709 -5.62234   96.20425  1.000 52.03285  ? 407  ILE B CB  1 
ATOM   6378  C CG1 . ILE B  1 427 ? -21.34754 -5.05201   95.24689  1.000 51.61049  ? 407  ILE B CG1 1 
ATOM   6379  C CG2 . ILE B  1 427 ? -23.26540 -6.70873   95.51105  1.000 45.17441  ? 407  ILE B CG2 1 
ATOM   6380  C CD1 . ILE B  1 427 ? -21.93133 -4.26401   94.10764  1.000 51.52804  ? 407  ILE B CD1 1 
ATOM   6381  N N   . CYS B  1 428 ? -25.57681 -5.05580   97.27951  1.000 47.00897  ? 408  CYS B N   1 
ATOM   6382  C CA  . CYS B  1 428 ? -26.66507 -5.67195   98.02776  1.000 46.84415  ? 408  CYS B CA  1 
ATOM   6383  C C   . CYS B  1 428 ? -27.05176 -7.00387   97.38796  1.000 51.31541  ? 408  CYS B C   1 
ATOM   6384  O O   . CYS B  1 428 ? -27.27103 -7.07745   96.17664  1.000 49.19957  ? 408  CYS B O   1 
ATOM   6385  C CB  . CYS B  1 428 ? -27.87564 -4.74247   98.07893  1.000 53.36210  ? 408  CYS B CB  1 
ATOM   6386  S SG  . CYS B  1 428 ? -27.71320 -3.34516   99.24205  1.000 56.47790  ? 408  CYS B SG  1 
ATOM   6387  N N   . LEU B  1 429 ? -27.13603 -8.05018   98.19765  1.000 49.17708  ? 409  LEU B N   1 
ATOM   6388  C CA  . LEU B  1 429 ? -27.68009 -9.32862   97.76835  1.000 48.72409  ? 409  LEU B CA  1 
ATOM   6389  C C   . LEU B  1 429 ? -29.10549 -9.44199   98.29389  1.000 54.15402  ? 409  LEU B C   1 
ATOM   6390  O O   . LEU B  1 429 ? -29.34254 -9.26392   99.49326  1.000 60.09185  ? 409  LEU B O   1 
ATOM   6391  C CB  . LEU B  1 429 ? -26.81979 -10.48584  98.27862  1.000 48.45810  ? 409  LEU B CB  1 
ATOM   6392  C CG  . LEU B  1 429 ? -27.53431 -11.83304  98.41559  1.000 48.78763  ? 409  LEU B CG  1 
ATOM   6393  C CD1 . LEU B  1 429 ? -27.74433 -12.43552  97.06187  1.000 49.41122  ? 409  LEU B CD1 1 
ATOM   6394  C CD2 . LEU B  1 429 ? -26.76242 -12.77428  99.30534  1.000 47.22432  ? 409  LEU B CD2 1 
ATOM   6395  N N   . ILE B  1 430 ? -30.05049 -9.74300   97.40613  1.000 49.87704  ? 410  ILE B N   1 
ATOM   6396  C CA  . ILE B  1 430 ? -31.47315 -9.66805   97.72483  1.000 51.18354  ? 410  ILE B CA  1 
ATOM   6397  C C   . ILE B  1 430 ? -32.11408 -11.03189  97.50925  1.000 50.29796  ? 410  ILE B C   1 
ATOM   6398  O O   . ILE B  1 430 ? -32.11934 -11.55059  96.38676  1.000 46.91819  ? 410  ILE B O   1 
ATOM   6399  C CB  . ILE B  1 430 ? -32.18892 -8.60791   96.87502  1.000 50.27794  ? 410  ILE B CB  1 
ATOM   6400  C CG1 . ILE B  1 430 ? -31.55340 -7.23615   97.08417  1.000 55.96886  ? 410  ILE B CG1 1 
ATOM   6401  C CG2 . ILE B  1 430 ? -33.67209 -8.60489   97.17889  1.000 47.65353  ? 410  ILE B CG2 1 
ATOM   6402  C CD1 . ILE B  1 430 ? -32.01070 -6.18457   96.06846  1.000 55.60157  ? 410  ILE B CD1 1 
ATOM   6403  N N   . THR B  1 431 ? -32.70264 -11.58370  98.56484  1.000 52.97986  ? 411  THR B N   1 
ATOM   6404  C CA  A THR B  1 431 ? -33.43296 -12.83872  98.51579  0.046 52.75824  ? 411  THR B CA  1 
ATOM   6405  C CA  B THR B  1 431 ? -33.44879 -12.82857  98.44987  0.954 52.97237  ? 411  THR B CA  1 
ATOM   6406  C C   . THR B  1 431 ? -34.91735 -12.57835  98.74712  1.000 54.41180  ? 411  THR B C   1 
ATOM   6407  O O   . THR B  1 431 ? -35.30930 -11.52858  99.26249  1.000 53.38592  ? 411  THR B O   1 
ATOM   6408  C CB  A THR B  1 431 ? -32.89648 -13.81762  99.56865  0.046 52.45178  ? 411  THR B CB  1 
ATOM   6409  C CB  B THR B  1 431 ? -32.91518 -13.90874  99.39625  0.954 52.52074  ? 411  THR B CB  1 
ATOM   6410  O OG1 A THR B  1 431 ? -31.50967 -13.54632  99.81059  0.046 51.90710  ? 411  THR B OG1 1 
ATOM   6411  O OG1 B THR B  1 431 ? -33.08611 -13.47209  100.74856 0.954 54.48535  ? 411  THR B OG1 1 
ATOM   6412  C CG2 A THR B  1 431 ? -33.04763 -15.25443  99.09944  0.046 51.13646  ? 411  THR B CG2 1 
ATOM   6413  C CG2 B THR B  1 431 ? -31.45216 -14.16146  99.12688  0.954 49.89012  ? 411  THR B CG2 1 
ATOM   6414  N N   . GLN B  1 432 ? -35.73974 -13.56571  98.38206  1.000 57.84148  ? 412  GLN B N   1 
ATOM   6415  C CA  . GLN B  1 432 ? -37.16921 -13.46797  98.64502  1.000 57.13744  ? 412  GLN B CA  1 
ATOM   6416  C C   . GLN B  1 432 ? -37.45679 -13.34551  100.13163 1.000 62.70545  ? 412  GLN B C   1 
ATOM   6417  O O   . GLN B  1 432 ? -38.40212 -12.65313  100.51768 1.000 69.92258  ? 412  GLN B O   1 
ATOM   6418  C CB  . GLN B  1 432 ? -37.89665 -14.67775  98.06745  1.000 55.49188  ? 412  GLN B CB  1 
ATOM   6419  C CG  . GLN B  1 432 ? -39.40518 -14.53704  98.05752  1.000 55.20792  ? 412  GLN B CG  1 
ATOM   6420  C CD  . GLN B  1 432 ? -39.86691 -13.38988  97.16339  1.000 56.18944  ? 412  GLN B CD  1 
ATOM   6421  O OE1 . GLN B  1 432 ? -39.46795 -13.30705  95.99665  1.000 52.65874  ? 412  GLN B OE1 1 
ATOM   6422  N NE2 . GLN B  1 432 ? -40.71669 -12.50146  97.70648  1.000 55.47851  ? 412  GLN B NE2 1 
ATOM   6423  N N   . SER B  1 433 ? -36.65663 -14.00032  100.97908 1.000 64.41320  ? 413  SER B N   1 
ATOM   6424  C CA  . SER B  1 433 ? -36.86135 -13.90300  102.42419 1.000 61.11277  ? 413  SER B CA  1 
ATOM   6425  C C   . SER B  1 433 ? -36.75238 -12.46393  102.89551 1.000 60.31374  ? 413  SER B C   1 
ATOM   6426  O O   . SER B  1 433 ? -37.58804 -11.99063  103.67199 1.000 62.13309  ? 413  SER B O   1 
ATOM   6427  C CB  . SER B  1 433 ? -35.84726 -14.76461  103.17401 1.000 61.34491  ? 413  SER B CB  1 
ATOM   6428  O OG  . SER B  1 433 ? -35.92986 -16.11797  102.78847 1.000 67.59535  ? 413  SER B OG  1 
ATOM   6429  N N   . MET B  1 434 ? -35.70237 -11.76194  102.45952 1.000 59.49957  ? 414  MET B N   1 
ATOM   6430  C CA  . MET B  1 434 ? -35.54351 -10.36229  102.83890 1.000 61.18644  ? 414  MET B CA  1 
ATOM   6431  C C   . MET B  1 434 ? -36.71619 -9.53593   102.33568 1.000 64.87912  ? 414  MET B C   1 
ATOM   6432  O O   . MET B  1 434 ? -37.24999 -8.68792   103.06315 1.000 67.75479  ? 414  MET B O   1 
ATOM   6433  C CB  . MET B  1 434 ? -34.22289 -9.80243   102.29882 1.000 57.11470  ? 414  MET B CB  1 
ATOM   6434  C CG  . MET B  1 434 ? -32.98207 -10.62739  102.63555 1.000 55.12102  ? 414  MET B CG  1 
ATOM   6435  S SD  . MET B  1 434 ? -31.57786 -10.16726  101.59715 1.000 56.10786  ? 414  MET B SD  1 
ATOM   6436  C CE  . MET B  1 434 ? -30.34964 -11.36013  102.12030 1.000 52.88962  ? 414  MET B CE  1 
ATOM   6437  N N   . ILE B  1 435 ? -37.14739 -9.79145   101.09939 1.000 62.37252  ? 415  ILE B N   1 
ATOM   6438  C CA  . ILE B  1 435 ? -38.27677 -9.06256   100.53642 1.000 60.36689  ? 415  ILE B CA  1 
ATOM   6439  C C   . ILE B  1 435 ? -39.52958 -9.28592   101.37403 1.000 67.14608  ? 415  ILE B C   1 
ATOM   6440  O O   . ILE B  1 435 ? -40.30436 -8.35311   101.62789 1.000 68.19838  ? 415  ILE B O   1 
ATOM   6441  C CB  . ILE B  1 435 ? -38.48189 -9.48017   99.07205  1.000 56.67782  ? 415  ILE B CB  1 
ATOM   6442  C CG1 . ILE B  1 435 ? -37.32903 -8.94712   98.22688  1.000 53.95556  ? 415  ILE B CG1 1 
ATOM   6443  C CG2 . ILE B  1 435 ? -39.80668 -8.98293   98.54643  1.000 59.53009  ? 415  ILE B CG2 1 
ATOM   6444  C CD1 . ILE B  1 435 ? -37.18762 -7.45069   98.27259  1.000 53.31852  ? 415  ILE B CD1 1 
ATOM   6445  N N   . ASP B  1 436 ? -39.73563 -10.51979  101.83747 1.000 70.85066  ? 416  ASP B N   1 
ATOM   6446  C CA  . ASP B  1 436 ? -40.93825 -10.83316  102.59841 1.000 72.94046  ? 416  ASP B CA  1 
ATOM   6447  C C   . ASP B  1 436 ? -40.96615 -10.11620  103.94073 1.000 73.83051  ? 416  ASP B C   1 
ATOM   6448  O O   . ASP B  1 436 ? -42.04391 -9.72776   104.40682 1.000 74.34955  ? 416  ASP B O   1 
ATOM   6449  C CB  . ASP B  1 436 ? -41.04617 -12.34292  102.79969 1.000 74.26912  ? 416  ASP B CB  1 
ATOM   6450  C CG  . ASP B  1 436 ? -41.39927 -13.07161  101.52343 1.000 71.86654  ? 416  ASP B CG  1 
ATOM   6451  O OD1 . ASP B  1 436 ? -41.78149 -12.39849  100.53962 1.000 71.37383  ? 416  ASP B OD1 1 
ATOM   6452  O OD2 . ASP B  1 436 ? -41.30046 -14.31325  101.50790 1.000 71.31889  ? 416  ASP B OD2 1 
ATOM   6453  N N   . LYS B  1 437 ? -39.79970 -9.92647   104.57270 1.000 74.46036  ? 417  LYS B N   1 
ATOM   6454  C CA  . LYS B  1 437 ? -39.67116 -9.23720   105.86503 1.000 75.98365  ? 417  LYS B CA  1 
ATOM   6455  C C   . LYS B  1 437 ? -39.88698 -7.71637   105.76566 1.000 79.94526  ? 417  LYS B C   1 
ATOM   6456  O O   . LYS B  1 437 ? -39.73578 -7.01953   106.78877 1.000 82.16952  ? 417  LYS B O   1 
ATOM   6457  C CB  . LYS B  1 437 ? -38.29064 -9.51006   106.46766 1.000 72.71438  ? 417  LYS B CB  1 
ATOM   6458  C CG  . LYS B  1 437 ? -38.03568 -10.95319  106.87825 1.000 74.87122  ? 417  LYS B CG  1 
ATOM   6459  C CD  . LYS B  1 437 ? -36.65358 -11.10579  107.52224 1.000 76.87093  ? 417  LYS B CD  1 
ATOM   6460  C CE  . LYS B  1 437 ? -36.49932 -12.44440  108.25048 1.000 80.51297  ? 417  LYS B CE  1 
ATOM   6461  N NZ  . LYS B  1 437 ? -36.18888 -12.27860  109.71901 1.000 84.88501  ? 417  LYS B NZ  1 
ATOM   6462  N N   . LEU B  1 438 ? -40.24211 -7.18233   104.59877 1.000 79.49288  ? 418  LEU B N   1 
ATOM   6463  C CA  . LEU B  1 438 ? -40.12175 -5.75776   104.32348 1.000 78.96256  ? 418  LEU B CA  1 
ATOM   6464  C C   . LEU B  1 438 ? -41.45357 -5.04286   104.50861 1.000 85.91413  ? 418  LEU B C   1 
ATOM   6465  O O   . LEU B  1 438 ? -42.44582 -5.36556   103.84323 1.000 85.65389  ? 418  LEU B O   1 
ATOM   6466  C CB  . LEU B  1 438 ? -39.59160 -5.52178   102.91087 1.000 73.49632  ? 418  LEU B CB  1 
ATOM   6467  C CG  . LEU B  1 438 ? -38.07204 -5.36718   102.81996 1.000 73.65004  ? 418  LEU B CG  1 
ATOM   6468  C CD1 . LEU B  1 438 ? -37.60535 -5.47838   101.38544 1.000 72.28032  ? 418  LEU B CD1 1 
ATOM   6469  C CD2 . LEU B  1 438 ? -37.62747 -4.04824   103.41476 1.000 74.94209  ? 418  LEU B CD2 1 
ATOM   6470  N N   . ASP B  1 439 ? -41.46395 -4.08639   105.42804 1.000 93.18249  ? 419  ASP B N   1 
ATOM   6471  C CA  . ASP B  1 439 ? -42.40590 -2.97666   105.44191 1.000 103.03237 ? 419  ASP B CA  1 
ATOM   6472  C C   . ASP B  1 439 ? -41.70959 -1.65192   105.17180 1.000 105.36275 ? 419  ASP B C   1 
ATOM   6473  O O   . ASP B  1 439 ? -42.21904 -0.82691   104.40262 1.000 104.76512 ? 419  ASP B O   1 
ATOM   6474  C CB  . ASP B  1 439 ? -43.13868 -2.90370   106.79560 1.000 108.60820 ? 419  ASP B CB  1 
ATOM   6475  C CG  . ASP B  1 439 ? -44.31394 -3.87439   106.89053 1.000 111.32015 ? 419  ASP B CG  1 
ATOM   6476  O OD1 . ASP B  1 439 ? -44.99009 -4.10697   105.86180 1.000 111.30076 ? 419  ASP B OD1 1 
ATOM   6477  O OD2 . ASP B  1 439 ? -44.56536 -4.39731   108.00053 1.000 113.64882 ? 419  ASP B OD2 1 
ATOM   6478  N N   . LEU B  1 440 ? -40.53790 -1.45626   105.77907 1.000 104.42193 ? 420  LEU B N   1 
ATOM   6479  C CA  . LEU B  1 440 ? -39.72017 -0.26179   105.60571 1.000 98.49481  ? 420  LEU B CA  1 
ATOM   6480  C C   . LEU B  1 440 ? -38.26738 -0.61818   105.91140 1.000 93.54770  ? 420  LEU B C   1 
ATOM   6481  O O   . LEU B  1 440 ? -37.95926 -1.75631   106.27256 1.000 88.18547  ? 420  LEU B O   1 
ATOM   6482  C CB  . LEU B  1 440 ? -40.20646 0.89381    106.50493 1.000 97.12918  ? 420  LEU B CB  1 
ATOM   6483  C CG  . LEU B  1 440 ? -40.37304 0.70469    108.01793 1.000 98.73309  ? 420  LEU B CG  1 
ATOM   6484  C CD1 . LEU B  1 440 ? -40.16092 2.02616    108.76665 1.000 101.50411 ? 420  LEU B CD1 1 
ATOM   6485  C CD2 . LEU B  1 440 ? -41.74660 0.13690    108.34719 1.000 99.28514  ? 420  LEU B CD2 1 
ATOM   6486  N N   . VAL C  1 26  ? -64.32887 -33.00815  75.12696  1.000 85.66984  ? 6    VAL C N   1 
ATOM   6487  C CA  . VAL C  1 26  ? -63.55812 -33.36390  73.93781  1.000 86.44086  ? 6    VAL C CA  1 
ATOM   6488  C C   . VAL C  1 26  ? -62.10718 -33.70159  74.28505  1.000 82.00360  ? 6    VAL C C   1 
ATOM   6489  O O   . VAL C  1 26  ? -61.57901 -34.72570  73.84964  1.000 78.88817  ? 6    VAL C O   1 
ATOM   6490  C CB  . VAL C  1 26  ? -63.59417 -32.23593  72.88421  1.000 87.98923  ? 6    VAL C CB  1 
ATOM   6491  C CG1 . VAL C  1 26  ? -62.50734 -32.45188  71.82392  1.000 84.16723  ? 6    VAL C CG1 1 
ATOM   6492  C CG2 . VAL C  1 26  ? -64.97668 -32.13772  72.24156  1.000 92.60387  ? 6    VAL C CG2 1 
ATOM   6493  N N   . GLN C  1 27  ? -61.46443 -32.83277  75.06350  1.000 79.29785  ? 7    GLN C N   1 
ATOM   6494  C CA  . GLN C  1 27  ? -60.03387 -33.00562  75.27688  1.000 72.94263  ? 7    GLN C CA  1 
ATOM   6495  C C   . GLN C  1 27  ? -59.77905 -34.15083  76.24978  1.000 70.01270  ? 7    GLN C C   1 
ATOM   6496  O O   . GLN C  1 27  ? -60.53801 -34.33620  77.20621  1.000 73.03305  ? 7    GLN C O   1 
ATOM   6497  C CB  . GLN C  1 27  ? -59.40105 -31.71912  75.80360  1.000 71.56191  ? 7    GLN C CB  1 
ATOM   6498  C CG  . GLN C  1 27  ? -59.22571 -30.67842  74.71592  1.000 79.88599  ? 7    GLN C CG  1 
ATOM   6499  C CD  . GLN C  1 27  ? -58.71978 -29.35194  75.24205  1.000 87.07344  ? 7    GLN C CD  1 
ATOM   6500  O OE1 . GLN C  1 27  ? -58.59574 -28.37806  74.49131  1.000 92.01800  ? 7    GLN C OE1 1 
ATOM   6501  N NE2 . GLN C  1 27  ? -58.40612 -29.30782  76.53282  1.000 86.52000  ? 7    GLN C NE2 1 
ATOM   6502  N N   . PRO C  1 28  ? -58.74236 -34.94846  76.00522  1.000 60.76648  ? 8    PRO C N   1 
ATOM   6503  C CA  . PRO C  1 28  ? -58.38861 -36.00084  76.96183  1.000 55.86956  ? 8    PRO C CA  1 
ATOM   6504  C C   . PRO C  1 28  ? -57.98615 -35.39259  78.29487  1.000 54.14197  ? 8    PRO C C   1 
ATOM   6505  O O   . PRO C  1 28  ? -57.32132 -34.35576  78.35188  1.000 52.35159  ? 8    PRO C O   1 
ATOM   6506  C CB  . PRO C  1 28  ? -57.21742 -36.72407  76.28558  1.000 54.56291  ? 8    PRO C CB  1 
ATOM   6507  C CG  . PRO C  1 28  ? -56.72055 -35.75872  75.22064  1.000 55.63948  ? 8    PRO C CG  1 
ATOM   6508  C CD  . PRO C  1 28  ? -57.89551 -34.95928  74.79850  1.000 57.03046  ? 8    PRO C CD  1 
ATOM   6509  N N   . LEU C  1 29  ? -58.41117 -36.04075  79.38114  1.000 51.83903  ? 9    LEU C N   1 
ATOM   6510  C CA  . LEU C  1 29  ? -58.10472 -35.50109  80.69531  1.000 49.73008  ? 9    LEU C CA  1 
ATOM   6511  C C   . LEU C  1 29  ? -56.71101 -35.84187  81.17179  1.000 49.46312  ? 9    LEU C C   1 
ATOM   6512  O O   . LEU C  1 29  ? -56.21414 -35.16413  82.07874  1.000 53.74651  ? 9    LEU C O   1 
ATOM   6513  C CB  . LEU C  1 29  ? -59.13004 -35.95888  81.71588  1.000 47.79572  ? 9    LEU C CB  1 
ATOM   6514  C CG  . LEU C  1 29  ? -60.51950 -35.63535  81.18749  1.000 56.18819  ? 9    LEU C CG  1 
ATOM   6515  C CD1 . LEU C  1 29  ? -61.49409 -36.64310  81.72050  1.000 57.03169  ? 9    LEU C CD1 1 
ATOM   6516  C CD2 . LEU C  1 29  ? -60.91713 -34.22056  81.55275  1.000 52.40676  ? 9    LEU C CD2 1 
ATOM   6517  N N   . ALA C  1 30  ? -56.06364 -36.85191  80.57344  1.000 49.03583  ? 10   ALA C N   1 
ATOM   6518  C CA  . ALA C  1 30  ? -54.67405 -37.14965  80.92318  1.000 44.81202  ? 10   ALA C CA  1 
ATOM   6519  C C   . ALA C  1 30  ? -53.75914 -35.96609  80.62900  1.000 44.53222  ? 10   ALA C C   1 
ATOM   6520  O O   . ALA C  1 30  ? -52.70727 -35.82712  81.26453  1.000 38.72739  ? 10   ALA C O   1 
ATOM   6521  C CB  . ALA C  1 30  ? -54.18825 -38.39655  80.17928  1.000 39.93361  ? 10   ALA C CB  1 
ATOM   6522  N N   . ARG C  1 31  ? -54.14928 -35.10778  79.67251  1.000 46.30620  ? 11   ARG C N   1 
ATOM   6523  C CA  . ARG C  1 31  ? -53.40281 -33.89139  79.37433  1.000 42.33149  ? 11   ARG C CA  1 
ATOM   6524  C C   . ARG C  1 31  ? -53.19968 -33.02748  80.60781  1.000 51.45553  ? 11   ARG C C   1 
ATOM   6525  O O   . ARG C  1 31  ? -52.19010 -32.31808  80.70762  1.000 48.04943  ? 11   ARG C O   1 
ATOM   6526  C CB  . ARG C  1 31  ? -54.14160 -33.05700  78.32406  1.000 44.80083  ? 11   ARG C CB  1 
ATOM   6527  C CG  . ARG C  1 31  ? -53.83699 -33.38852  76.88120  1.000 45.65409  ? 11   ARG C CG  1 
ATOM   6528  C CD  . ARG C  1 31  ? -54.59637 -32.43028  75.96877  1.000 53.62288  ? 11   ARG C CD  1 
ATOM   6529  N NE  . ARG C  1 31  ? -54.77191 -32.91287  74.60115  1.000 49.97541  ? 11   ARG C NE  1 
ATOM   6530  C CZ  . ARG C  1 31  ? -55.24012 -32.15717  73.61559  1.000 52.53495  ? 11   ARG C CZ  1 
ATOM   6531  N NH1 . ARG C  1 31  ? -55.59164 -30.90375  73.86204  1.000 53.67787  ? 11   ARG C NH1 1 
ATOM   6532  N NH2 . ARG C  1 31  ? -55.38066 -32.65458  72.39380  1.000 54.20330  ? 11   ARG C NH2 1 
ATOM   6533  N N   . ASP C  1 32  ? -54.16893 -33.03098  81.52819  1.000 49.80385  ? 12   ASP C N   1 
ATOM   6534  C CA  . ASP C  1 32  ? -54.17165 -32.16565  82.70438  1.000 50.58461  ? 12   ASP C CA  1 
ATOM   6535  C C   . ASP C  1 32  ? -53.99023 -32.95575  84.00020  1.000 47.14040  ? 12   ASP C C   1 
ATOM   6536  O O   . ASP C  1 32  ? -54.41898 -32.51817  85.07647  1.000 46.99797  ? 12   ASP C O   1 
ATOM   6537  C CB  . ASP C  1 32  ? -55.45734 -31.34399  82.75253  1.000 58.46691  ? 12   ASP C CB  1 
ATOM   6538  C CG  . ASP C  1 32  ? -55.65789 -30.51216  81.49715  1.000 66.31269  ? 12   ASP C CG  1 
ATOM   6539  O OD1 . ASP C  1 32  ? -54.67205 -29.88100  81.06503  1.000 68.47878  ? 12   ASP C OD1 1 
ATOM   6540  O OD2 . ASP C  1 32  ? -56.78343 -30.48904  80.94296  1.000 66.71815  ? 12   ASP C OD2 1 
ATOM   6541  N N   . ALA C  1 33  ? -53.34987 -34.11450  83.90800  1.000 41.27767  ? 13   ALA C N   1 
ATOM   6542  C CA  . ALA C  1 33  ? -53.11545 -34.96876  85.05992  1.000 43.11696  ? 13   ALA C CA  1 
ATOM   6543  C C   . ALA C  1 33  ? -51.62034 -35.15444  85.29965  1.000 43.06267  ? 13   ALA C C   1 
ATOM   6544  O O   . ALA C  1 33  ? -50.80630 -35.13108  84.37026  1.000 43.40340  ? 13   ALA C O   1 
ATOM   6545  C CB  . ALA C  1 33  ? -53.79699 -36.33859  84.88323  1.000 41.60554  ? 13   ALA C CB  1 
ATOM   6546  N N   . MET C  1 34  ? -51.27136 -35.31759  86.56907  1.000 41.25342  ? 14   MET C N   1 
ATOM   6547  C CA  . MET C  1 34  ? -49.93166 -35.68131  86.99217  1.000 39.82387  ? 14   MET C CA  1 
ATOM   6548  C C   . MET C  1 34  ? -49.98532 -37.04648  87.65963  1.000 39.54930  ? 14   MET C C   1 
ATOM   6549  O O   . MET C  1 34  ? -50.83420 -37.27946  88.53150  1.000 38.07590  ? 14   MET C O   1 
ATOM   6550  C CB  . MET C  1 34  ? -49.37322 -34.65734  87.96614  1.000 45.37267  ? 14   MET C CB  1 
ATOM   6551  C CG  . MET C  1 34  ? -48.05362 -35.06760  88.59037  1.000 47.01544  ? 14   MET C CG  1 
ATOM   6552  S SD  . MET C  1 34  ? -47.43428 -33.70866  89.58590  1.000 51.24346  ? 14   MET C SD  1 
ATOM   6553  C CE  . MET C  1 34  ? -45.73263 -34.22354  89.84404  1.000 54.22022  ? 14   MET C CE  1 
ATOM   6554  N N   . ALA C  1 35  ? -49.09857 -37.94583  87.23888  1.000 40.68259  ? 15   ALA C N   1 
ATOM   6555  C CA  . ALA C  1 35  ? -48.95486 -39.24882  87.87970  1.000 31.00157  ? 15   ALA C CA  1 
ATOM   6556  C C   . ALA C  1 35  ? -47.93632 -39.13412  89.00073  1.000 30.54436  ? 15   ALA C C   1 
ATOM   6557  O O   . ALA C  1 35  ? -46.83739 -38.59769  88.80734  1.000 37.40664  ? 15   ALA C O   1 
ATOM   6558  C CB  . ALA C  1 35  ? -48.52757 -40.33415  86.88446  1.000 30.20595  ? 15   ALA C CB  1 
ATOM   6559  N N   . TYR C  1 36  ? -48.30625 -39.63333  90.17059  1.000 30.60060  ? 16   TYR C N   1 
ATOM   6560  C CA  . TYR C  1 36  ? -47.45775 -39.57991  91.35028  1.000 36.73991  ? 16   TYR C CA  1 
ATOM   6561  C C   . TYR C  1 36  ? -47.30202 -40.99425  91.89743  1.000 37.57868  ? 16   TYR C C   1 
ATOM   6562  O O   . TYR C  1 36  ? -48.27533 -41.60287  92.36253  1.000 38.90244  ? 16   TYR C O   1 
ATOM   6563  C CB  . TYR C  1 36  ? -48.04969 -38.63343  92.39634  1.000 35.74860  ? 16   TYR C CB  1 
ATOM   6564  C CG  . TYR C  1 36  ? -47.03188 -38.11604  93.35834  1.000 34.30612  ? 16   TYR C CG  1 
ATOM   6565  C CD1 . TYR C  1 36  ? -46.71105 -38.81918  94.50774  1.000 37.79880  ? 16   TYR C CD1 1 
ATOM   6566  C CD2 . TYR C  1 36  ? -46.35607 -36.93800  93.10067  1.000 35.08249  ? 16   TYR C CD2 1 
ATOM   6567  C CE1 . TYR C  1 36  ? -45.76665 -38.34032  95.39283  1.000 41.92985  ? 16   TYR C CE1 1 
ATOM   6568  C CE2 . TYR C  1 36  ? -45.41432 -36.45107  93.97759  1.000 38.78736  ? 16   TYR C CE2 1 
ATOM   6569  C CZ  . TYR C  1 36  ? -45.12658 -37.14694  95.12188  1.000 41.20664  ? 16   TYR C CZ  1 
ATOM   6570  O OH  . TYR C  1 36  ? -44.18072 -36.64806  95.98086  1.000 46.65302  ? 16   TYR C OH  1 
ATOM   6571  N N   . VAL C  1 37  ? -46.08062 -41.51010  91.84061  1.000 33.30680  ? 17   VAL C N   1 
ATOM   6572  C CA  . VAL C  1 37  ? -45.80301 -42.92729  92.04861  1.000 34.70073  ? 17   VAL C CA  1 
ATOM   6573  C C   . VAL C  1 37  ? -45.12807 -43.08028  93.40243  1.000 37.02967  ? 17   VAL C C   1 
ATOM   6574  O O   . VAL C  1 37  ? -44.04012 -42.53547  93.62716  1.000 37.62606  ? 17   VAL C O   1 
ATOM   6575  C CB  . VAL C  1 37  ? -44.91795 -43.50435  90.92560  1.000 37.02089  ? 17   VAL C CB  1 
ATOM   6576  C CG1 . VAL C  1 37  ? -44.49836 -44.93706  91.24640  1.000 36.66993  ? 17   VAL C CG1 1 
ATOM   6577  C CG2 . VAL C  1 37  ? -45.62341 -43.43741  89.55480  1.000 27.42409  ? 17   VAL C CG2 1 
ATOM   6578  N N   . LEU C  1 38  ? -45.77740 -43.81060  94.30321  1.000 36.39606  ? 18   LEU C N   1 
ATOM   6579  C CA  . LEU C  1 38  ? -45.21900 -44.13756  95.61562  1.000 40.33021  ? 18   LEU C CA  1 
ATOM   6580  C C   . LEU C  1 38  ? -44.25787 -45.30022  95.43717  1.000 28.78192  ? 18   LEU C C   1 
ATOM   6581  O O   . LEU C  1 38  ? -44.67803 -46.44404  95.27053  1.000 33.19882  ? 18   LEU C O   1 
ATOM   6582  C CB  . LEU C  1 38  ? -46.33090 -44.49480  96.59788  1.000 36.60101  ? 18   LEU C CB  1 
ATOM   6583  C CG  . LEU C  1 38  ? -47.47255 -43.48214  96.59951  1.000 40.17141  ? 18   LEU C CG  1 
ATOM   6584  C CD1 . LEU C  1 38  ? -48.53310 -43.85201  97.62370  1.000 45.88866  ? 18   LEU C CD1 1 
ATOM   6585  C CD2 . LEU C  1 38  ? -46.91586 -42.09718  96.87463  1.000 32.11028  ? 18   LEU C CD2 1 
ATOM   6586  N N   . ALA C  1 39  ? -42.96256 -45.01693  95.46091  1.000 33.50516  ? 19   ALA C N   1 
ATOM   6587  C CA  . ALA C  1 39  ? -41.95203 -46.03246  95.18304  1.000 32.80861  ? 19   ALA C CA  1 
ATOM   6588  C C   . ALA C  1 39  ? -41.05726 -46.27964  96.38043  1.000 39.30622  ? 19   ALA C C   1 
ATOM   6589  O O   . ALA C  1 39  ? -39.92204 -46.72609  96.20641  1.000 44.09517  ? 19   ALA C O   1 
ATOM   6590  C CB  . ALA C  1 39  ? -41.09558 -45.64183  93.97947  1.000 31.94397  ? 19   ALA C CB  1 
ATOM   6591  N N   . GLY C  1 40  ? -41.54281 -45.99860  97.58816  1.000 42.67194  ? 20   GLY C N   1 
ATOM   6592  C CA  . GLY C  1 40  ? -40.78236 -46.19437  98.80305  1.000 46.06958  ? 20   GLY C CA  1 
ATOM   6593  C C   . GLY C  1 40  ? -40.94069 -47.56465  99.42241  1.000 52.91014  ? 20   GLY C C   1 
ATOM   6594  O O   . GLY C  1 40  ? -40.42390 -47.80141  100.51963 1.000 57.59404  ? 20   GLY C O   1 
ATOM   6595  N N   . GLY C  1 41  ? -41.64251 -48.47632  98.75162  1.000 55.32511  ? 21   GLY C N   1 
ATOM   6596  C CA  . GLY C  1 41  ? -41.87297 -49.80894  99.27508  1.000 58.68514  ? 21   GLY C CA  1 
ATOM   6597  C C   . GLY C  1 41  ? -40.61210 -50.58293  99.61620  1.000 57.93109  ? 21   GLY C C   1 
ATOM   6598  O O   . GLY C  1 41  ? -39.70715 -50.71358  98.78680  1.000 51.12020  ? 21   GLY C O   1 
ATOM   6599  N N   . ARG C  1 42  ? -40.55140 -51.10888  100.84511 1.000 60.13319  ? 22   ARG C N   1 
ATOM   6600  C CA  . ARG C  1 42  ? -39.38533 -51.86923  101.28504 1.000 60.61003  ? 22   ARG C CA  1 
ATOM   6601  C C   . ARG C  1 42  ? -39.38727 -53.28288  100.71300 1.000 55.29388  ? 22   ARG C C   1 
ATOM   6602  O O   . ARG C  1 42  ? -38.33200 -53.80286  100.33689 1.000 54.93508  ? 22   ARG C O   1 
ATOM   6603  C CB  . ARG C  1 42  ? -39.33703 -51.91046  102.81461 1.000 65.04234  ? 22   ARG C CB  1 
ATOM   6604  N N   . GLY C  1 43  ? -40.56149 -53.90708  100.62715 1.000 52.96926  ? 23   GLY C N   1 
ATOM   6605  C CA  . GLY C  1 43  ? -40.68747 -55.26327  100.13040 1.000 46.87125  ? 23   GLY C CA  1 
ATOM   6606  C C   . GLY C  1 43  ? -40.16014 -56.26362  101.13322 1.000 52.05414  ? 23   GLY C C   1 
ATOM   6607  O O   . GLY C  1 43  ? -39.30265 -57.10018  100.80852 1.000 51.22862  ? 23   GLY C O   1 
ATOM   6608  N N   . SER C  1 44  ? -40.67756 -56.19031  102.36262 1.000 53.73344  ? 24   SER C N   1 
ATOM   6609  C CA  . SER C  1 44  ? -40.04933 -56.92517  103.45521 1.000 57.93501  ? 24   SER C CA  1 
ATOM   6610  C C   . SER C  1 44  ? -40.11336 -58.43179  103.23546 1.000 55.78312  ? 24   SER C C   1 
ATOM   6611  O O   . SER C  1 44  ? -39.11803 -59.13319  103.44168 1.000 55.64183  ? 24   SER C O   1 
ATOM   6612  C CB  . SER C  1 44  ? -40.68279 -56.53480  104.78922 1.000 59.20074  ? 24   SER C CB  1 
ATOM   6613  O OG  . SER C  1 44  ? -39.92735 -55.49829  105.39252 1.000 61.01336  ? 24   SER C OG  1 
ATOM   6614  N N   . ARG C  1 45  ? -41.25109 -58.94702  102.77743 1.000 52.74446  ? 25   ARG C N   1 
ATOM   6615  C CA  . ARG C  1 45  ? -41.37271 -60.39188  102.63805 1.000 52.53427  ? 25   ARG C CA  1 
ATOM   6616  C C   . ARG C  1 45  ? -40.65104 -60.95623  101.41657 1.000 51.23516  ? 25   ARG C C   1 
ATOM   6617  O O   . ARG C  1 45  ? -40.73351 -62.16839  101.17470 1.000 52.34536  ? 25   ARG C O   1 
ATOM   6618  C CB  . ARG C  1 45  ? -42.84341 -60.78543  102.62832 1.000 58.63143  ? 25   ARG C CB  1 
ATOM   6619  C CG  . ARG C  1 45  ? -43.44730 -60.75353  104.03501 1.000 67.69693  ? 25   ARG C CG  1 
ATOM   6620  C CD  . ARG C  1 45  ? -44.84544 -61.35963  104.06271 1.000 72.49875  ? 25   ARG C CD  1 
ATOM   6621  N NE  . ARG C  1 45  ? -45.72397 -60.67111  103.11746 1.000 75.25724  ? 25   ARG C NE  1 
ATOM   6622  C CZ  . ARG C  1 45  ? -46.79805 -61.20622  102.54468 1.000 75.44073  ? 25   ARG C CZ  1 
ATOM   6623  N NH1 . ARG C  1 45  ? -47.14822 -62.45739  102.81860 1.000 75.63266  ? 25   ARG C NH1 1 
ATOM   6624  N NH2 . ARG C  1 45  ? -47.51533 -60.48535  101.68705 1.000 75.18988  ? 25   ARG C NH2 1 
ATOM   6625  N N   . LEU C  1 46  ? -39.92463 -60.13218  100.66294 1.000 49.40552  ? 26   LEU C N   1 
ATOM   6626  C CA  . LEU C  1 46  ? -38.96425 -60.64615  99.69265  1.000 46.11952  ? 26   LEU C CA  1 
ATOM   6627  C C   . LEU C  1 46  ? -37.57479 -60.83532  100.28664 1.000 41.11155  ? 26   LEU C C   1 
ATOM   6628  O O   . LEU C  1 46  ? -36.68135 -61.30009  99.57758  1.000 37.73362  ? 26   LEU C O   1 
ATOM   6629  C CB  . LEU C  1 46  ? -38.87417 -59.73540  98.46492  1.000 40.55721  ? 26   LEU C CB  1 
ATOM   6630  C CG  . LEU C  1 46  ? -40.16802 -59.52433  97.68213  1.000 40.51311  ? 26   LEU C CG  1 
ATOM   6631  C CD1 . LEU C  1 46  ? -40.01973 -58.32105  96.76646  1.000 39.64672  ? 26   LEU C CD1 1 
ATOM   6632  C CD2 . LEU C  1 46  ? -40.50160 -60.77441  96.88294  1.000 45.13362  ? 26   LEU C CD2 1 
ATOM   6633  N N   . LYS C  1 47  ? -37.37034 -60.46256  101.55090 1.000 40.70194  ? 27   LYS C N   1 
ATOM   6634  C CA  . LYS C  1 47  ? -36.18929 -60.86062  102.33336 1.000 38.02502  ? 27   LYS C CA  1 
ATOM   6635  C C   . LYS C  1 47  ? -34.92543 -60.32079  101.66408 1.000 38.96066  ? 27   LYS C C   1 
ATOM   6636  O O   . LYS C  1 47  ? -34.86462 -59.12122  101.34948 1.000 37.10169  ? 27   LYS C O   1 
ATOM   6637  C CB  . LYS C  1 47  ? -36.24773 -62.36158  102.51401 1.000 42.18839  ? 27   LYS C CB  1 
ATOM   6638  C CG  . LYS C  1 47  ? -37.51885 -62.83917  103.19075 1.000 43.42650  ? 27   LYS C CG  1 
ATOM   6639  C CD  . LYS C  1 47  ? -37.48549 -62.58086  104.68516 1.000 53.62830  ? 27   LYS C CD  1 
ATOM   6640  C CE  . LYS C  1 47  ? -38.86811 -62.80893  105.33894 1.000 61.01987  ? 27   LYS C CE  1 
ATOM   6641  N NZ  . LYS C  1 47  ? -39.54249 -64.06684  104.85962 1.000 63.97025  ? 27   LYS C NZ  1 
ATOM   6642  N N   . GLU C  1 48  ? -33.90403 -61.14509  101.41359 1.000 38.78263  ? 28   GLU C N   1 
ATOM   6643  C CA  . GLU C  1 48  ? -32.65118 -60.59371  100.90789 1.000 42.15127  ? 28   GLU C CA  1 
ATOM   6644  C C   . GLU C  1 48  ? -32.76742 -60.05901  99.48356  1.000 41.07091  ? 28   GLU C C   1 
ATOM   6645  O O   . GLU C  1 48  ? -31.90249 -59.28815  99.05651  1.000 40.38834  ? 28   GLU C O   1 
ATOM   6646  C CB  . GLU C  1 48  ? -31.53073 -61.63618  100.98255 1.000 44.06820  ? 28   GLU C CB  1 
ATOM   6647  C CG  . GLU C  1 48  ? -31.33161 -62.27461  102.36224 1.000 44.98000  ? 28   GLU C CG  1 
ATOM   6648  C CD  . GLU C  1 48  ? -32.35180 -63.35233  102.66514 1.000 48.43972  ? 28   GLU C CD  1 
ATOM   6649  O OE1 . GLU C  1 48  ? -32.98710 -63.85881  101.72818 1.000 50.73504  ? 28   GLU C OE1 1 
ATOM   6650  O OE2 . GLU C  1 48  ? -32.51732 -63.70341  103.84591 1.000 57.60403  ? 28   GLU C OE2 1 
ATOM   6651  N N   . LEU C  1 49  ? -33.80474 -60.44162  98.74141  1.000 35.85964  ? 29   LEU C N   1 
ATOM   6652  C CA  . LEU C  1 49  ? -34.00454 -59.85145  97.42244  1.000 44.59312  ? 29   LEU C CA  1 
ATOM   6653  C C   . LEU C  1 49  ? -34.10156 -58.33077  97.48942  1.000 45.84960  ? 29   LEU C C   1 
ATOM   6654  O O   . LEU C  1 49  ? -33.69235 -57.64277  96.54879  1.000 45.50031  ? 29   LEU C O   1 
ATOM   6655  C CB  . LEU C  1 49  ? -35.26119 -60.42844  96.77851  1.000 38.29178  ? 29   LEU C CB  1 
ATOM   6656  C CG  . LEU C  1 49  ? -35.34746 -60.44889  95.25340  1.000 42.35480  ? 29   LEU C CG  1 
ATOM   6657  C CD1 . LEU C  1 49  ? -34.05962 -60.98318  94.61838  1.000 39.97588  ? 29   LEU C CD1 1 
ATOM   6658  C CD2 . LEU C  1 49  ? -36.54088 -61.29372  94.84811  1.000 46.62001  ? 29   LEU C CD2 1 
ATOM   6659  N N   . THR C  1 50  ? -34.63231 -57.78936  98.58692  1.000 46.07281  ? 30   THR C N   1 
ATOM   6660  C CA  . THR C  1 50  ? -34.74252 -56.34831  98.77375  1.000 44.99360  ? 30   THR C CA  1 
ATOM   6661  C C   . THR C  1 50  ? -33.83860 -55.83454  99.88519  1.000 47.32166  ? 30   THR C C   1 
ATOM   6662  O O   . THR C  1 50  ? -34.09559 -54.76505  100.43598 1.000 50.30503  ? 30   THR C O   1 
ATOM   6663  C CB  . THR C  1 50  ? -36.18611 -55.93951  99.06950  1.000 45.33841  ? 30   THR C CB  1 
ATOM   6664  O OG1 . THR C  1 50  ? -36.72826 -56.78089  100.09548 1.000 45.68452  ? 30   THR C OG1 1 
ATOM   6665  C CG2 . THR C  1 50  ? -37.05480 -56.02294  97.80012  1.000 39.15501  ? 30   THR C CG2 1 
ATOM   6666  N N   . ASP C  1 51  ? -32.78298 -56.57120  100.22610 1.000 52.80851  ? 31   ASP C N   1 
ATOM   6667  C CA  . ASP C  1 51  ? -31.86910 -56.09903  101.26359 1.000 59.64976  ? 31   ASP C CA  1 
ATOM   6668  C C   . ASP C  1 51  ? -31.07134 -54.87778  100.81900 1.000 58.45519  ? 31   ASP C C   1 
ATOM   6669  O O   . ASP C  1 51  ? -30.64583 -54.08146  101.66101 1.000 60.79537  ? 31   ASP C O   1 
ATOM   6670  C CB  . ASP C  1 51  ? -30.91535 -57.21780  101.67525 1.000 61.78253  ? 31   ASP C CB  1 
ATOM   6671  C CG  . ASP C  1 51  ? -31.46100 -58.05491  102.80896 1.000 63.44229  ? 31   ASP C CG  1 
ATOM   6672  O OD1 . ASP C  1 51  ? -32.52453 -57.70897  103.36178 1.000 64.00404  ? 31   ASP C OD1 1 
ATOM   6673  O OD2 . ASP C  1 51  ? -30.82988 -59.07213  103.14069 1.000 67.21536  ? 31   ASP C OD2 1 
ATOM   6674  N N   . ARG C  1 52  ? -30.84091 -54.71791  99.51695  1.000 53.64030  ? 32   ARG C N   1 
ATOM   6675  C CA  . ARG C  1 52  ? -30.11689 -53.55935  99.01548  1.000 55.57393  ? 32   ARG C CA  1 
ATOM   6676  C C   . ARG C  1 52  ? -30.84564 -52.83865  97.87787  1.000 57.95825  ? 32   ARG C C   1 
ATOM   6677  O O   . ARG C  1 52  ? -30.25779 -51.95237  97.24742  1.000 60.99174  ? 32   ARG C O   1 
ATOM   6678  C CB  . ARG C  1 52  ? -28.70615 -53.97775  98.58989  1.000 59.43771  ? 32   ARG C CB  1 
ATOM   6679  C CG  . ARG C  1 52  ? -27.80343 -54.27731  99.80051  1.000 67.80322  ? 32   ARG C CG  1 
ATOM   6680  C CD  . ARG C  1 52  ? -26.70326 -55.30038  99.50054  1.000 73.35266  ? 32   ARG C CD  1 
ATOM   6681  N NE  . ARG C  1 52  ? -25.36606 -54.69724  99.51311  1.000 79.25974  ? 32   ARG C NE  1 
ATOM   6682  C CZ  . ARG C  1 52  ? -24.22378 -55.38281  99.58857  1.000 82.32103  ? 32   ARG C CZ  1 
ATOM   6683  N NH1 . ARG C  1 52  ? -24.23204 -56.71141  99.66593  1.000 81.51434  ? 32   ARG C NH1 1 
ATOM   6684  N NH2 . ARG C  1 52  ? -23.06470 -54.73613  99.59226  1.000 85.87483  ? 32   ARG C NH2 1 
ATOM   6685  N N   . ARG C  1 53  ? -32.10789 -53.18709  97.60449  1.000 53.21869  ? 33   ARG C N   1 
ATOM   6686  C CA  . ARG C  1 53  ? -32.95152 -52.47989  96.65300  1.000 48.72418  ? 33   ARG C CA  1 
ATOM   6687  C C   . ARG C  1 53  ? -34.34257 -52.35573  97.24196  1.000 47.25675  ? 33   ARG C C   1 
ATOM   6688  O O   . ARG C  1 53  ? -34.80674 -53.26431  97.93880  1.000 51.05397  ? 33   ARG C O   1 
ATOM   6689  C CB  . ARG C  1 53  ? -33.09349 -53.20916  95.31829  1.000 51.70110  ? 33   ARG C CB  1 
ATOM   6690  C CG  . ARG C  1 53  ? -31.83283 -53.67400  94.74019  1.000 60.11552  ? 33   ARG C CG  1 
ATOM   6691  C CD  . ARG C  1 53  ? -32.08629 -54.84409  93.78976  1.000 64.69209  ? 33   ARG C CD  1 
ATOM   6692  N NE  . ARG C  1 53  ? -30.92489 -55.02383  92.90772  1.000 74.91766  ? 33   ARG C NE  1 
ATOM   6693  C CZ  . ARG C  1 53  ? -30.50149 -54.14754  91.99075  1.000 77.17887  ? 33   ARG C CZ  1 
ATOM   6694  N NH1 . ARG C  1 53  ? -31.20184 -53.05074  91.72712  1.000 75.24982  ? 33   ARG C NH1 1 
ATOM   6695  N NH2 . ARG C  1 53  ? -29.40419 -54.41191  91.27137  1.000 77.91364  ? 33   ARG C NH2 1 
ATOM   6696  N N   . ALA C  1 54  ? -35.01300 -51.24348  96.94473  1.000 38.23082  ? 34   ALA C N   1 
ATOM   6697  C CA  . ALA C  1 54  ? -36.43694 -51.15978  97.20952  1.000 31.68616  ? 34   ALA C CA  1 
ATOM   6698  C C   . ALA C  1 54  ? -37.19662 -52.06528  96.23536  1.000 36.02399  ? 34   ALA C C   1 
ATOM   6699  O O   . ALA C  1 54  ? -36.73295 -52.35665  95.13030  1.000 37.15690  ? 34   ALA C O   1 
ATOM   6700  C CB  . ALA C  1 54  ? -36.91236 -49.71589  97.09256  1.000 33.12809  ? 34   ALA C CB  1 
ATOM   6701  N N   . LYS C  1 55  ? -38.35723 -52.55014  96.66717  1.000 37.59355  ? 35   LYS C N   1 
ATOM   6702  C CA  . LYS C  1 55  ? -39.14439 -53.42655  95.80384  1.000 38.48758  ? 35   LYS C CA  1 
ATOM   6703  C C   . LYS C  1 55  ? -39.42437 -52.85305  94.40944  1.000 38.91179  ? 35   LYS C C   1 
ATOM   6704  O O   . LYS C  1 55  ? -39.31121 -53.61460  93.43420  1.000 32.26175  ? 35   LYS C O   1 
ATOM   6705  C CB  . LYS C  1 55  ? -40.45318 -53.79997  96.51225  1.000 37.50544  ? 35   LYS C CB  1 
ATOM   6706  C CG  . LYS C  1 55  ? -41.27392 -54.85650  95.76921  1.000 35.37476  ? 35   LYS C CG  1 
ATOM   6707  C CD  . LYS C  1 55  ? -42.61853 -55.07632  96.47296  1.000 36.61477  ? 35   LYS C CD  1 
ATOM   6708  C CE  . LYS C  1 55  ? -43.55942 -55.90807  95.60757  1.000 34.12004  ? 35   LYS C CE  1 
ATOM   6709  N NZ  . LYS C  1 55  ? -44.92719 -55.97933  96.19441  1.000 35.21179  ? 35   LYS C NZ  1 
ATOM   6710  N N   . PRO C  1 56  ? -39.75236 -51.56314  94.22394  1.000 40.81854  ? 36   PRO C N   1 
ATOM   6711  C CA  . PRO C  1 56  ? -39.97709 -51.07215  92.84932  1.000 38.04574  ? 36   PRO C CA  1 
ATOM   6712  C C   . PRO C  1 56  ? -38.75897 -51.21329  91.94855  1.000 40.28637  ? 36   PRO C C   1 
ATOM   6713  O O   . PRO C  1 56  ? -38.91495 -51.17550  90.71781  1.000 40.04599  ? 36   PRO C O   1 
ATOM   6714  C CB  . PRO C  1 56  ? -40.35324 -49.59447  93.05115  1.000 37.55780  ? 36   PRO C CB  1 
ATOM   6715  C CG  . PRO C  1 56  ? -40.75915 -49.48744  94.50371  1.000 37.74634  ? 36   PRO C CG  1 
ATOM   6716  C CD  . PRO C  1 56  ? -39.92589 -50.48283  95.21780  1.000 38.18229  ? 36   PRO C CD  1 
ATOM   6717  N N   . ALA C  1 57  ? -37.55473 -51.37507  92.51362  1.000 34.65684  ? 37   ALA C N   1 
ATOM   6718  C CA  . ALA C  1 57  ? -36.33223 -51.51358  91.73108  1.000 29.23936  ? 37   ALA C CA  1 
ATOM   6719  C C   . ALA C  1 57  ? -35.99265 -52.96738  91.37419  1.000 36.43084  ? 37   ALA C C   1 
ATOM   6720  O O   . ALA C  1 57  ? -34.97812 -53.21593  90.70241  1.000 37.35182  ? 37   ALA C O   1 
ATOM   6721  C CB  . ALA C  1 57  ? -35.16664 -50.87948  92.49053  1.000 29.13764  ? 37   ALA C CB  1 
ATOM   6722  N N   . VAL C  1 58  ? -36.80497 -53.93248  91.81138  1.000 37.44074  ? 38   VAL C N   1 
ATOM   6723  C CA  . VAL C  1 58  ? -36.48976 -55.33843  91.59475  1.000 35.53764  ? 38   VAL C CA  1 
ATOM   6724  C C   . VAL C  1 58  ? -36.72483 -55.70112  90.12949  1.000 34.02189  ? 38   VAL C C   1 
ATOM   6725  O O   . VAL C  1 58  ? -37.69817 -55.26744  89.49566  1.000 30.84663  ? 38   VAL C O   1 
ATOM   6726  C CB  . VAL C  1 58  ? -37.32974 -56.22468  92.53916  1.000 37.19098  ? 38   VAL C CB  1 
ATOM   6727  C CG1 . VAL C  1 58  ? -37.25911 -57.72209  92.12429  1.000 38.96571  ? 38   VAL C CG1 1 
ATOM   6728  C CG2 . VAL C  1 58  ? -36.89449 -56.05301  94.02135  1.000 32.70370  ? 38   VAL C CG2 1 
ATOM   6729  N N   . TYR C  1 59  ? -35.82829 -56.50180  89.58260  1.000 33.78197  ? 39   TYR C N   1 
ATOM   6730  C CA  . TYR C  1 59  ? -35.95449 -56.92017  88.19980  1.000 31.71985  ? 39   TYR C CA  1 
ATOM   6731  C C   . TYR C  1 59  ? -37.17416 -57.82377  88.00712  1.000 36.61871  ? 39   TYR C C   1 
ATOM   6732  O O   . TYR C  1 59  ? -37.55212 -58.61526  88.88444  1.000 34.72555  ? 39   TYR C O   1 
ATOM   6733  C CB  . TYR C  1 59  ? -34.67805 -57.63202  87.76509  1.000 30.58169  ? 39   TYR C CB  1 
ATOM   6734  C CG  . TYR C  1 59  ? -33.46126 -56.71956  87.71652  1.000 38.56016  ? 39   TYR C CG  1 
ATOM   6735  C CD1 . TYR C  1 59  ? -33.25278 -55.86167  86.64491  1.000 44.43717  ? 39   TYR C CD1 1 
ATOM   6736  C CD2 . TYR C  1 59  ? -32.51959 -56.72363  88.73518  1.000 48.41582  ? 39   TYR C CD2 1 
ATOM   6737  C CE1 . TYR C  1 59  ? -32.14439 -55.03604  86.58741  1.000 49.64136  ? 39   TYR C CE1 1 
ATOM   6738  C CE2 . TYR C  1 59  ? -31.39101 -55.89568  88.68365  1.000 52.55931  ? 39   TYR C CE2 1 
ATOM   6739  C CZ  . TYR C  1 59  ? -31.21809 -55.05572  87.60665  1.000 57.32431  ? 39   TYR C CZ  1 
ATOM   6740  O OH  . TYR C  1 59  ? -30.11104 -54.22709  87.52753  1.000 69.82696  ? 39   TYR C OH  1 
ATOM   6741  N N   . PHE C  1 60  ? -37.81391 -57.67769  86.85332  1.000 34.71003  ? 40   PHE C N   1 
ATOM   6742  C CA  . PHE C  1 60  ? -38.93542 -58.54155  86.54479  1.000 37.12889  ? 40   PHE C CA  1 
ATOM   6743  C C   . PHE C  1 60  ? -38.98277 -58.80151  85.05218  1.000 40.16644  ? 40   PHE C C   1 
ATOM   6744  O O   . PHE C  1 60  ? -38.84307 -57.87985  84.23773  1.000 41.17008  ? 40   PHE C O   1 
ATOM   6745  C CB  . PHE C  1 60  ? -40.28721 -57.95636  86.98615  1.000 38.96666  ? 40   PHE C CB  1 
ATOM   6746  C CG  . PHE C  1 60  ? -41.45127 -58.83150  86.60018  1.000 38.15506  ? 40   PHE C CG  1 
ATOM   6747  C CD1 . PHE C  1 60  ? -41.69960 -60.01152  87.29218  1.000 40.90044  ? 40   PHE C CD1 1 
ATOM   6748  C CD2 . PHE C  1 60  ? -42.25398 -58.51971  85.51208  1.000 36.16941  ? 40   PHE C CD2 1 
ATOM   6749  C CE1 . PHE C  1 60  ? -42.74275 -60.87510  86.91999  1.000 37.78334  ? 40   PHE C CE1 1 
ATOM   6750  C CE2 . PHE C  1 60  ? -43.30219 -59.37702  85.13458  1.000 37.45761  ? 40   PHE C CE2 1 
ATOM   6751  C CZ  . PHE C  1 60  ? -43.54306 -60.55312  85.84627  1.000 35.29648  ? 40   PHE C CZ  1 
ATOM   6752  N N   . GLY C  1 61  ? -39.20234 -60.05941  84.70875  1.000 31.15219  ? 41   GLY C N   1 
ATOM   6753  C CA  . GLY C  1 61  ? -39.63444 -60.40957  83.38512  1.000 32.31691  ? 41   GLY C CA  1 
ATOM   6754  C C   . GLY C  1 61  ? -38.55203 -60.56447  82.35984  1.000 36.24761  ? 41   GLY C C   1 
ATOM   6755  O O   . GLY C  1 61  ? -38.87336 -60.83768  81.20128  1.000 42.90641  ? 41   GLY C O   1 
ATOM   6756  N N   . GLY C  1 62  ? -37.28536 -60.41652  82.72951  1.000 33.22449  ? 42   GLY C N   1 
ATOM   6757  C CA  . GLY C  1 62  ? -36.23624 -60.58268  81.74829  1.000 34.57469  ? 42   GLY C CA  1 
ATOM   6758  C C   . GLY C  1 62  ? -35.40445 -59.33450  81.51687  1.000 51.75476  ? 42   GLY C C   1 
ATOM   6759  O O   . GLY C  1 62  ? -34.18279 -59.43305  81.34407  1.000 49.50621  ? 42   GLY C O   1 
ATOM   6760  N N   . LYS C  1 63  ? -36.03412 -58.15237  81.51643  1.000 49.03837  ? 43   LYS C N   1 
ATOM   6761  C CA  . LYS C  1 63  ? -35.28233 -56.92089  81.27938  1.000 47.42984  ? 43   LYS C CA  1 
ATOM   6762  C C   . LYS C  1 63  ? -35.73780 -55.74665  82.16256  1.000 44.90787  ? 43   LYS C C   1 
ATOM   6763  O O   . LYS C  1 63  ? -34.89457 -54.97529  82.63252  1.000 45.93151  ? 43   LYS C O   1 
ATOM   6764  C CB  . LYS C  1 63  ? -35.33462 -56.55494  79.78203  1.000 49.47481  ? 43   LYS C CB  1 
ATOM   6765  C CG  . LYS C  1 63  ? -34.19116 -57.21337  78.93832  1.000 63.12451  ? 43   LYS C CG  1 
ATOM   6766  C CD  . LYS C  1 63  ? -34.61082 -57.84996  77.55644  1.000 67.34171  ? 43   LYS C CD  1 
ATOM   6767  C CE  . LYS C  1 63  ? -33.35328 -58.26574  76.70462  1.000 64.80094  ? 43   LYS C CE  1 
ATOM   6768  N NZ  . LYS C  1 63  ? -33.41748 -58.28512  75.18106  1.000 57.13709  ? 43   LYS C NZ  1 
ATOM   6769  N N   . ALA C  1 64  ? -37.04404 -55.60023  82.41639  1.000 37.06399  ? 44   ALA C N   1 
ATOM   6770  C CA  . ALA C  1 64  ? -37.57838 -54.43996  83.12269  1.000 31.31809  ? 44   ALA C CA  1 
ATOM   6771  C C   . ALA C  1 64  ? -37.37489 -54.53124  84.64231  1.000 39.35037  ? 44   ALA C C   1 
ATOM   6772  O O   . ALA C  1 64  ? -36.83434 -55.50715  85.18407  1.000 38.97456  ? 44   ALA C O   1 
ATOM   6773  C CB  . ALA C  1 64  ? -39.06392 -54.27821  82.83027  1.000 29.07691  ? 44   ALA C CB  1 
ATOM   6774  N N   . ARG C  1 65  ? -37.80884 -53.47869  85.33837  1.000 27.79729  ? 45   ARG C N   1 
ATOM   6775  C CA  . ARG C  1 65  ? -38.00618 -53.50788  86.77440  1.000 29.66954  ? 45   ARG C CA  1 
ATOM   6776  C C   . ARG C  1 65  ? -39.46660 -53.23203  87.06280  1.000 32.05163  ? 45   ARG C C   1 
ATOM   6777  O O   . ARG C  1 65  ? -40.19691 -52.71177  86.21525  1.000 35.59229  ? 45   ARG C O   1 
ATOM   6778  C CB  . ARG C  1 65  ? -37.14873 -52.47790  87.49835  1.000 30.80263  ? 45   ARG C CB  1 
ATOM   6779  C CG  . ARG C  1 65  ? -35.72389 -52.45643  86.99510  1.000 36.29618  ? 45   ARG C CG  1 
ATOM   6780  C CD  . ARG C  1 65  ? -34.87160 -51.67653  87.93874  1.000 32.93878  ? 45   ARG C CD  1 
ATOM   6781  N NE  . ARG C  1 65  ? -33.50250 -51.55377  87.47297  1.000 34.78005  ? 45   ARG C NE  1 
ATOM   6782  C CZ  . ARG C  1 65  ? -32.44780 -51.69657  88.25709  1.000 31.03562  ? 45   ARG C CZ  1 
ATOM   6783  N NH1 . ARG C  1 65  ? -32.62626 -52.03891  89.52202  1.000 32.70224  ? 45   ARG C NH1 1 
ATOM   6784  N NH2 . ARG C  1 65  ? -31.24119 -51.50908  87.77338  1.000 32.51862  ? 45   ARG C NH2 1 
ATOM   6785  N N   . ILE C  1 66  ? -39.87269 -53.55811  88.28645  1.000 32.41845  ? 46   ILE C N   1 
ATOM   6786  C CA  . ILE C  1 66  ? -41.28599 -53.49070  88.63327  1.000 30.56272  ? 46   ILE C CA  1 
ATOM   6787  C C   . ILE C  1 66  ? -41.83450 -52.08224  88.42290  1.000 30.00446  ? 46   ILE C C   1 
ATOM   6788  O O   . ILE C  1 66  ? -42.93274 -51.91204  87.88060  1.000 31.83184  ? 46   ILE C O   1 
ATOM   6789  C CB  . ILE C  1 66  ? -41.49821 -53.99379  90.07419  1.000 31.95091  ? 46   ILE C CB  1 
ATOM   6790  C CG1 . ILE C  1 66  ? -41.06318 -55.45731  90.17297  1.000 26.73326  ? 46   ILE C CG1 1 
ATOM   6791  C CG2 . ILE C  1 66  ? -42.95003 -53.82706  90.47723  1.000 36.72173  ? 46   ILE C CG2 1 
ATOM   6792  C CD1 . ILE C  1 66  ? -41.09255 -56.06242  91.60867  1.000 28.40708  ? 46   ILE C CD1 1 
ATOM   6793  N N   . ILE C  1 67  ? -41.06802 -51.05487  88.81698  1.000 27.73920  ? 47   ILE C N   1 
ATOM   6794  C CA  . ILE C  1 67  ? -41.50279 -49.66134  88.70078  1.000 28.72161  ? 47   ILE C CA  1 
ATOM   6795  C C   . ILE C  1 67  ? -41.90077 -49.32289  87.27213  1.000 33.55252  ? 47   ILE C C   1 
ATOM   6796  O O   . ILE C  1 67  ? -42.71959 -48.43226  87.04522  1.000 35.05635  ? 47   ILE C O   1 
ATOM   6797  C CB  . ILE C  1 67  ? -40.38632 -48.70677  89.19179  1.000 32.71132  ? 47   ILE C CB  1 
ATOM   6798  C CG1 . ILE C  1 67  ? -40.87732 -47.25326  89.30584  1.000 39.64406  ? 47   ILE C CG1 1 
ATOM   6799  C CG2 . ILE C  1 67  ? -39.26666 -48.63667  88.21815  1.000 26.23113  ? 47   ILE C CG2 1 
ATOM   6800  C CD1 . ILE C  1 67  ? -41.33467 -46.82511  90.64698  1.000 41.53247  ? 47   ILE C CD1 1 
ATOM   6801  N N   . ASP C  1 68  ? -41.31394 -50.00647  86.28378  1.000 35.34290  ? 48   ASP C N   1 
ATOM   6802  C CA  . ASP C  1 68  ? -41.51418 -49.62825  84.88805  1.000 31.05367  ? 48   ASP C CA  1 
ATOM   6803  C C   . ASP C  1 68  ? -42.94661 -49.82770  84.40512  1.000 30.69476  ? 48   ASP C C   1 
ATOM   6804  O O   . ASP C  1 68  ? -43.35248 -49.17263  83.43084  1.000 32.46610  ? 48   ASP C O   1 
ATOM   6805  C CB  . ASP C  1 68  ? -40.54133 -50.40591  83.99898  1.000 27.15774  ? 48   ASP C CB  1 
ATOM   6806  C CG  . ASP C  1 68  ? -39.09196 -49.97187  84.21899  1.000 32.54892  ? 48   ASP C CG  1 
ATOM   6807  O OD1 . ASP C  1 68  ? -38.86905 -48.76078  84.47860  1.000 34.18791  ? 48   ASP C OD1 1 
ATOM   6808  O OD2 . ASP C  1 68  ? -38.18364 -50.82211  84.12581  1.000 33.22721  ? 48   ASP C OD2 1 
ATOM   6809  N N   . PHE C  1 69  ? -43.72315 -50.70467  85.05138  1.000 26.88622  ? 49   PHE C N   1 
ATOM   6810  C CA  . PHE C  1 69  ? -45.08072 -50.93143  84.57887  1.000 27.63350  ? 49   PHE C CA  1 
ATOM   6811  C C   . PHE C  1 69  ? -45.95473 -49.70849  84.84849  1.000 28.63552  ? 49   PHE C C   1 
ATOM   6812  O O   . PHE C  1 69  ? -46.55747 -49.15431  83.92303  1.000 32.44498  ? 49   PHE C O   1 
ATOM   6813  C CB  . PHE C  1 69  ? -45.64617 -52.21255  85.20777  1.000 27.93585  ? 49   PHE C CB  1 
ATOM   6814  C CG  . PHE C  1 69  ? -45.05999 -53.46001  84.60241  1.000 28.42039  ? 49   PHE C CG  1 
ATOM   6815  C CD1 . PHE C  1 69  ? -43.78438 -53.89261  84.96488  1.000 27.88256  ? 49   PHE C CD1 1 
ATOM   6816  C CD2 . PHE C  1 69  ? -45.73254 -54.14325  83.61601  1.000 29.70745  ? 49   PHE C CD2 1 
ATOM   6817  C CE1 . PHE C  1 69  ? -43.20868 -55.00903  84.37729  1.000 31.90815  ? 49   PHE C CE1 1 
ATOM   6818  C CE2 . PHE C  1 69  ? -45.16527 -55.27676  83.01983  1.000 34.78844  ? 49   PHE C CE2 1 
ATOM   6819  C CZ  . PHE C  1 69  ? -43.90104 -55.70430  83.39952  1.000 29.79196  ? 49   PHE C CZ  1 
ATOM   6820  N N   . ALA C  1 70  ? -45.97815 -49.23898  86.09950  1.000 29.59163  ? 50   ALA C N   1 
ATOM   6821  C CA  . ALA C  1 70  ? -46.75035 -48.04888  86.43924  1.000 34.27561  ? 50   ALA C CA  1 
ATOM   6822  C C   . ALA C  1 70  ? -46.28044 -46.83540  85.62906  1.000 32.30286  ? 50   ALA C C   1 
ATOM   6823  O O   . ALA C  1 70  ? -47.10338 -46.09372  85.07055  1.000 32.98311  ? 50   ALA C O   1 
ATOM   6824  C CB  . ALA C  1 70  ? -46.66037 -47.78015  87.94419  1.000 29.94031  ? 50   ALA C CB  1 
ATOM   6825  N N   . LEU C  1 71  ? -44.95604 -46.63685  85.52603  1.000 26.90791  ? 51   LEU C N   1 
ATOM   6826  C CA  . LEU C  1 71  ? -44.45891 -45.53065  84.72410  1.000 27.23528  ? 51   LEU C CA  1 
ATOM   6827  C C   . LEU C  1 71  ? -44.91031 -45.66238  83.27811  1.000 35.59727  ? 51   LEU C C   1 
ATOM   6828  O O   . LEU C  1 71  ? -45.32804 -44.67686  82.66159  1.000 37.37821  ? 51   LEU C O   1 
ATOM   6829  C CB  . LEU C  1 71  ? -42.93804 -45.44797  84.80173  1.000 33.47501  ? 51   LEU C CB  1 
ATOM   6830  C CG  . LEU C  1 71  ? -42.34784 -45.18989  86.19173  1.000 32.24970  ? 51   LEU C CG  1 
ATOM   6831  C CD1 . LEU C  1 71  ? -40.83714 -45.24971  86.13897  1.000 26.79692  ? 51   LEU C CD1 1 
ATOM   6832  C CD2 . LEU C  1 71  ? -42.88315 -43.87447  86.78191  1.000 26.91614  ? 51   LEU C CD2 1 
ATOM   6833  N N   . SER C  1 72  ? -44.86781 -46.87661  82.72238  1.000 33.56811  ? 52   SER C N   1 
ATOM   6834  C CA  . SER C  1 72  ? -45.27438 -47.02199  81.33183  1.000 30.72159  ? 52   SER C CA  1 
ATOM   6835  C C   . SER C  1 72  ? -46.79123 -46.86631  81.18118  1.000 38.11020  ? 52   SER C C   1 
ATOM   6836  O O   . SER C  1 72  ? -47.25988 -46.32724  80.16507  1.000 31.45770  ? 52   SER C O   1 
ATOM   6837  C CB  . SER C  1 72  ? -44.78809 -48.36760  80.78874  1.000 29.74336  ? 52   SER C CB  1 
ATOM   6838  O OG  . SER C  1 72  ? -43.36765 -48.48188  80.87548  1.000 29.26066  ? 52   SER C OG  1 
ATOM   6839  N N   . ASN C  1 73  ? -47.57275 -47.31329  82.17715  1.000 30.02920  ? 53   ASN C N   1 
ATOM   6840  C CA  . ASN C  1 73  ? -49.00778 -47.04541  82.13435  1.000 43.96215  ? 53   ASN C CA  1 
ATOM   6841  C C   . ASN C  1 73  ? -49.27948 -45.53825  82.08296  1.000 43.23508  ? 53   ASN C C   1 
ATOM   6842  O O   . ASN C  1 73  ? -50.13125 -45.08062  81.30412  1.000 35.38744  ? 53   ASN C O   1 
ATOM   6843  C CB  . ASN C  1 73  ? -49.71405 -47.68247  83.33562  1.000 38.22841  ? 53   ASN C CB  1 
ATOM   6844  C CG  . ASN C  1 73  ? -49.72586 -49.20042  83.28001  1.000 34.80704  ? 53   ASN C CG  1 
ATOM   6845  O OD1 . ASN C  1 73  ? -49.72865 -49.79991  82.20547  1.000 34.81762  ? 53   ASN C OD1 1 
ATOM   6846  N ND2 . ASN C  1 73  ? -49.77628 -49.82639  84.44458  1.000 30.76552  ? 53   ASN C ND2 1 
ATOM   6847  N N   . ALA C  1 74  ? -48.54770 -44.75352  82.89436  1.000 30.32704  ? 54   ALA C N   1 
ATOM   6848  C CA  . ALA C  1 74  ? -48.71464 -43.30121  82.87686  1.000 39.45424  ? 54   ALA C CA  1 
ATOM   6849  C C   . ALA C  1 74  ? -48.37249 -42.73561  81.50256  1.000 40.14569  ? 54   ALA C C   1 
ATOM   6850  O O   . ALA C  1 74  ? -49.13303 -41.94737  80.92788  1.000 38.18867  ? 54   ALA C O   1 
ATOM   6851  C CB  . ALA C  1 74  ? -47.84563 -42.65515  83.96112  1.000 35.40201  ? 54   ALA C CB  1 
ATOM   6852  N N   . LEU C  1 75  ? -47.23479 -43.15785  80.95655  1.000 31.12302  ? 55   LEU C N   1 
ATOM   6853  C CA  . LEU C  1 75  ? -46.83076 -42.77735  79.60674  1.000 42.40687  ? 55   LEU C CA  1 
ATOM   6854  C C   . LEU C  1 75  ? -47.87015 -43.19288  78.55994  1.000 40.65849  ? 55   LEU C C   1 
ATOM   6855  O O   . LEU C  1 75  ? -48.37933 -42.35804  77.80356  1.000 35.03155  ? 55   LEU C O   1 
ATOM   6856  C CB  . LEU C  1 75  ? -45.46811 -43.41088  79.29335  1.000 40.39978  ? 55   LEU C CB  1 
ATOM   6857  C CG  . LEU C  1 75  ? -44.82721 -43.04355  77.96442  1.000 37.92772  ? 55   LEU C CG  1 
ATOM   6858  C CD1 . LEU C  1 75  ? -44.56061 -41.54125  77.92937  1.000 33.63725  ? 55   LEU C CD1 1 
ATOM   6859  C CD2 . LEU C  1 75  ? -43.56295 -43.82679  77.78767  1.000 38.79371  ? 55   LEU C CD2 1 
ATOM   6860  N N   . ASN C  1 76  ? -48.18474 -44.48920  78.48254  1.000 33.83626  ? 56   ASN C N   1 
ATOM   6861  C CA  . ASN C  1 76  ? -49.09520 -44.94491  77.43511  1.000 39.84983  ? 56   ASN C CA  1 
ATOM   6862  C C   . ASN C  1 76  ? -50.47836 -44.32282  77.56174  1.000 43.67026  ? 56   ASN C C   1 
ATOM   6863  O O   . ASN C  1 76  ? -51.20210 -44.24300  76.55755  1.000 38.92091  ? 56   ASN C O   1 
ATOM   6864  C CB  . ASN C  1 76  ? -49.20201 -46.48090  77.43655  1.000 42.61548  ? 56   ASN C CB  1 
ATOM   6865  C CG  . ASN C  1 76  ? -47.87065 -47.15958  77.10822  1.000 43.54641  ? 56   ASN C CG  1 
ATOM   6866  O OD1 . ASN C  1 76  ? -46.97617 -46.53819  76.51430  1.000 46.59559  ? 56   ASN C OD1 1 
ATOM   6867  N ND2 . ASN C  1 76  ? -47.72856 -48.42053  77.49946  1.000 38.07009  ? 56   ASN C ND2 1 
ATOM   6868  N N   . SER C  1 77  ? -50.84777 -43.86579  78.76371  1.000 35.95366  ? 57   SER C N   1 
ATOM   6869  C CA  . SER C  1 77  ? -52.14299 -43.24187  78.98356  1.000 42.96655  ? 57   SER C CA  1 
ATOM   6870  C C   . SER C  1 77  ? -52.15765 -41.77185  78.59013  1.000 40.80745  ? 57   SER C C   1 
ATOM   6871  O O   . SER C  1 77  ? -53.23782 -41.18070  78.52005  1.000 39.81508  ? 57   SER C O   1 
ATOM   6872  C CB  . SER C  1 77  ? -52.56757 -43.37571  80.45938  1.000 43.39718  ? 57   SER C CB  1 
ATOM   6873  O OG  . SER C  1 77  ? -52.78922 -44.72556  80.84148  1.000 44.19164  ? 57   SER C OG  1 
ATOM   6874  N N   . GLY C  1 78  ? -51.00555 -41.16842  78.32981  1.000 41.93677  ? 58   GLY C N   1 
ATOM   6875  C CA  . GLY C  1 78  ? -50.96845 -39.77941  77.92508  1.000 41.54818  ? 58   GLY C CA  1 
ATOM   6876  C C   . GLY C  1 78  ? -50.63666 -38.79326  79.02114  1.000 40.55776  ? 58   GLY C C   1 
ATOM   6877  O O   . GLY C  1 78  ? -50.72323 -37.58006  78.78733  1.000 39.45432  ? 58   GLY C O   1 
ATOM   6878  N N   . ILE C  1 79  ? -50.27244 -39.27217  80.20265  1.000 37.15461  ? 59   ILE C N   1 
ATOM   6879  C CA  . ILE C  1 79  ? -49.84482 -38.40728  81.28738  1.000 35.94713  ? 59   ILE C CA  1 
ATOM   6880  C C   . ILE C  1 79  ? -48.39488 -38.02514  81.03684  1.000 40.39891  ? 59   ILE C C   1 
ATOM   6881  O O   . ILE C  1 79  ? -47.54401 -38.89047  80.80955  1.000 42.91895  ? 59   ILE C O   1 
ATOM   6882  C CB  . ILE C  1 79  ? -50.03296 -39.11446  82.63925  1.000 37.21893  ? 59   ILE C CB  1 
ATOM   6883  C CG1 . ILE C  1 79  ? -51.51936 -39.49508  82.81284  1.000 41.39926  ? 59   ILE C CG1 1 
ATOM   6884  C CG2 . ILE C  1 79  ? -49.51135 -38.26371  83.78642  1.000 35.33216  ? 59   ILE C CG2 1 
ATOM   6885  C CD1 . ILE C  1 79  ? -51.82066 -40.37327  83.99234  1.000 39.57627  ? 59   ILE C CD1 1 
ATOM   6886  N N   . ARG C  1 80  ? -48.11685 -36.72599  81.04547  1.000 45.92849  ? 60   ARG C N   1 
ATOM   6887  C CA  . ARG C  1 80  ? -46.81143 -36.19235  80.67725  1.000 48.49667  ? 60   ARG C CA  1 
ATOM   6888  C C   . ARG C  1 80  ? -46.07414 -35.55867  81.85217  1.000 44.75582  ? 60   ARG C C   1 
ATOM   6889  O O   . ARG C  1 80  ? -44.93961 -35.08808  81.68457  1.000 38.23971  ? 60   ARG C O   1 
ATOM   6890  C CB  . ARG C  1 80  ? -46.97086 -35.18047  79.53219  1.000 55.03481  ? 60   ARG C CB  1 
ATOM   6891  C CG  . ARG C  1 80  ? -48.14549 -34.25554  79.72103  1.000 62.48699  ? 60   ARG C CG  1 
ATOM   6892  C CD  . ARG C  1 80  ? -48.29390 -33.29470  78.56483  1.000 72.13121  ? 60   ARG C CD  1 
ATOM   6893  N NE  . ARG C  1 80  ? -49.09821 -33.82758  77.47491  1.000 77.79584  ? 60   ARG C NE  1 
ATOM   6894  C CZ  . ARG C  1 80  ? -49.45955 -33.11375  76.41117  1.000 82.59990  ? 60   ARG C CZ  1 
ATOM   6895  N NH1 . ARG C  1 80  ? -49.08718 -31.84324  76.31123  1.000 83.90491  ? 60   ARG C NH1 1 
ATOM   6896  N NH2 . ARG C  1 80  ? -50.19835 -33.66078  75.45065  1.000 84.34239  ? 60   ARG C NH2 1 
ATOM   6897  N N   . ARG C  1 81  ? -46.67195 -35.55766  83.04139  1.000 43.26117  ? 61   ARG C N   1 
ATOM   6898  C CA  . ARG C  1 81  ? -45.98759 -35.15924  84.26253  1.000 33.01147  ? 61   ARG C CA  1 
ATOM   6899  C C   . ARG C  1 81  ? -46.02049 -36.32997  85.23375  1.000 30.68655  ? 61   ARG C C   1 
ATOM   6900  O O   . ARG C  1 81  ? -47.10381 -36.76925  85.65132  1.000 31.83576  ? 61   ARG C O   1 
ATOM   6901  C CB  . ARG C  1 81  ? -46.65153 -33.92993  84.88129  1.000 31.29316  ? 61   ARG C CB  1 
ATOM   6902  C CG  . ARG C  1 81  ? -46.61052 -32.72069  84.00297  1.000 32.61795  ? 61   ARG C CG  1 
ATOM   6903  C CD  . ARG C  1 81  ? -46.73456 -31.46255  84.85248  1.000 34.86325  ? 61   ARG C CD  1 
ATOM   6904  N NE  . ARG C  1 81  ? -46.80767 -30.25394  84.04413  1.000 39.19745  ? 61   ARG C NE  1 
ATOM   6905  C CZ  . ARG C  1 81  ? -45.74989 -29.69236  83.46125  1.000 43.85326  ? 61   ARG C CZ  1 
ATOM   6906  N NH1 . ARG C  1 81  ? -44.53561 -30.23662  83.59048  1.000 40.45341  ? 61   ARG C NH1 1 
ATOM   6907  N NH2 . ARG C  1 81  ? -45.89656 -28.58054  82.76061  1.000 39.21923  ? 61   ARG C NH2 1 
ATOM   6908  N N   . ILE C  1 82  ? -44.84058 -36.81063  85.61057  1.000 29.04759  ? 62   ILE C N   1 
ATOM   6909  C CA  . ILE C  1 82  ? -44.68822 -37.91291  86.55363  1.000 28.33416  ? 62   ILE C CA  1 
ATOM   6910  C C   . ILE C  1 82  ? -43.81344 -37.45460  87.71168  1.000 30.50832  ? 62   ILE C C   1 
ATOM   6911  O O   . ILE C  1 82  ? -42.77316 -36.82661  87.49885  1.000 35.54278  ? 62   ILE C O   1 
ATOM   6912  C CB  . ILE C  1 82  ? -44.08560 -39.14961  85.86874  1.000 28.20286  ? 62   ILE C CB  1 
ATOM   6913  C CG1 . ILE C  1 82  ? -44.97442 -39.58420  84.69119  1.000 30.55537  ? 62   ILE C CG1 1 
ATOM   6914  C CG2 . ILE C  1 82  ? -43.88040 -40.29013  86.87840  1.000 27.45433  ? 62   ILE C CG2 1 
ATOM   6915  C CD1 . ILE C  1 82  ? -44.54942 -40.91452  84.04442  1.000 28.80634  ? 62   ILE C CD1 1 
ATOM   6916  N N   . GLY C  1 83  ? -44.23966 -37.75058  88.92531  1.000 31.12466  ? 63   GLY C N   1 
ATOM   6917  C CA  . GLY C  1 83  ? -43.38360 -37.64046  90.09884  1.000 32.18517  ? 63   GLY C CA  1 
ATOM   6918  C C   . GLY C  1 83  ? -43.20692 -39.01475  90.71328  1.000 37.32405  ? 63   GLY C C   1 
ATOM   6919  O O   . GLY C  1 83  ? -44.12919 -39.83175  90.68665  1.000 43.58529  ? 63   GLY C O   1 
ATOM   6920  N N   . VAL C  1 84  ? -42.00840 -39.28167  91.22813  1.000 37.68338  ? 64   VAL C N   1 
ATOM   6921  C CA  . VAL C  1 84  ? -41.70421 -40.54864  91.88548  1.000 36.08266  ? 64   VAL C CA  1 
ATOM   6922  C C   . VAL C  1 84  ? -41.09687 -40.25693  93.25355  1.000 40.83031  ? 64   VAL C C   1 
ATOM   6923  O O   . VAL C  1 84  ? -39.99895 -39.69088  93.34148  1.000 41.53081  ? 64   VAL C O   1 
ATOM   6924  C CB  . VAL C  1 84  ? -40.74493 -41.41444  91.05733  1.000 33.45283  ? 64   VAL C CB  1 
ATOM   6925  C CG1 . VAL C  1 84  ? -40.56405 -42.78598  91.73235  1.000 32.06763  ? 64   VAL C CG1 1 
ATOM   6926  C CG2 . VAL C  1 84  ? -41.25550 -41.56134  89.64507  1.000 30.64006  ? 64   VAL C CG2 1 
ATOM   6927  N N   . ALA C  1 85  ? -41.80164 -40.65359  94.31210  1.000 41.03895  ? 65   ALA C N   1 
ATOM   6928  C CA  . ALA C  1 85  ? -41.30575 -40.52465  95.67844  1.000 42.24584  ? 65   ALA C CA  1 
ATOM   6929  C C   . ALA C  1 85  ? -40.55064 -41.78968  96.08309  1.000 43.67640  ? 65   ALA C C   1 
ATOM   6930  O O   . ALA C  1 85  ? -41.08961 -42.89976  95.99515  1.000 36.42577  ? 65   ALA C O   1 
ATOM   6931  C CB  . ALA C  1 85  ? -42.46106 -40.26277  96.65233  1.000 39.53113  ? 65   ALA C CB  1 
ATOM   6932  N N   . THR C  1 86  ? -39.30920 -41.61732  96.53513  1.000 41.35345  ? 66   THR C N   1 
ATOM   6933  C CA  . THR C  1 86  ? -38.45672 -42.72869  96.93259  1.000 41.55598  ? 66   THR C CA  1 
ATOM   6934  C C   . THR C  1 86  ? -38.00759 -42.53161  98.37335  1.000 43.88835  ? 66   THR C C   1 
ATOM   6935  O O   . THR C  1 86  ? -38.16593 -41.45629  98.95576  1.000 43.91308  ? 66   THR C O   1 
ATOM   6936  C CB  . THR C  1 86  ? -37.23830 -42.86448  96.01199  1.000 37.56613  ? 66   THR C CB  1 
ATOM   6937  O OG1 . THR C  1 86  ? -36.34326 -41.78616  96.25869  1.000 42.14009  ? 66   THR C OG1 1 
ATOM   6938  C CG2 . THR C  1 86  ? -37.65048 -42.79592  94.57043  1.000 41.21478  ? 66   THR C CG2 1 
ATOM   6939  N N   . GLN C  1 87  ? -37.41500 -43.57799  98.93991  1.000 46.13866  ? 67   GLN C N   1 
ATOM   6940  C CA  . GLN C  1 87  ? -37.22953 -43.61351  100.38224 1.000 63.05976  ? 67   GLN C CA  1 
ATOM   6941  C C   . GLN C  1 87  ? -36.18430 -44.64213  100.77601 1.000 72.89633  ? 67   GLN C C   1 
ATOM   6942  O O   . GLN C  1 87  ? -34.99373 -44.32218  100.84175 1.000 79.62995  ? 67   GLN C O   1 
ATOM   6943  C CB  . GLN C  1 87  ? -38.56884 -43.92075  101.06638 1.000 73.86002  ? 67   GLN C CB  1 
ATOM   6944  C CG  . GLN C  1 87  ? -38.74486 -43.37634  102.48409 1.000 80.97862  ? 67   GLN C CG  1 
ATOM   6945  C CD  . GLN C  1 87  ? -40.18556 -43.51255  102.99038 1.000 80.58243  ? 67   GLN C CD  1 
ATOM   6946  O OE1 . GLN C  1 87  ? -41.08772 -43.94212  102.25510 1.000 77.37240  ? 67   GLN C OE1 1 
ATOM   6947  N NE2 . GLN C  1 87  ? -40.40242 -43.14254  104.25015 1.000 82.30803  ? 67   GLN C NE2 1 
ATOM   6948  N N   . TYR C  1 88  ? -36.62591 -45.87794  101.02709 1.000 81.59348  ? 68   TYR C N   1 
ATOM   6949  C CA  . TYR C  1 88  ? -35.77088 -46.93253  101.57295 1.000 88.03534  ? 68   TYR C CA  1 
ATOM   6950  C C   . TYR C  1 88  ? -34.82117 -47.46583  100.49971 1.000 93.11563  ? 68   TYR C C   1 
ATOM   6951  O O   . TYR C  1 88  ? -35.27145 -47.91647  99.43488  1.000 91.07710  ? 68   TYR C O   1 
ATOM   6952  C CB  . TYR C  1 88  ? -36.62628 -48.06483  102.14102 1.000 85.29514  ? 68   TYR C CB  1 
ATOM   6953  N N   . LYS C  1 89  ? -33.50907 -47.41491  100.79578 1.000 96.33321  ? 69   LYS C N   1 
ATOM   6954  C CA  . LYS C  1 89  ? -32.42367 -47.90953  99.94437  1.000 92.55199  ? 69   LYS C CA  1 
ATOM   6955  C C   . LYS C  1 89  ? -32.64766 -47.55408  98.47897  1.000 89.53134  ? 69   LYS C C   1 
ATOM   6956  O O   . LYS C  1 89  ? -32.94771 -48.43987  97.67172  1.000 92.48320  ? 69   LYS C O   1 
ATOM   6957  C CB  . LYS C  1 89  ? -32.27181 -49.42825  100.09505 1.000 90.03724  ? 69   LYS C CB  1 
ATOM   6958  N N   . ALA C  1 90  ? -32.50204 -46.27407  98.11595  1.000 80.69437  ? 70   ALA C N   1 
ATOM   6959  C CA  . ALA C  1 90  ? -33.04250 -45.77907  96.85472  1.000 67.44769  ? 70   ALA C CA  1 
ATOM   6960  C C   . ALA C  1 90  ? -31.99767 -45.49278  95.78198  1.000 57.92481  ? 70   ALA C C   1 
ATOM   6961  O O   . ALA C  1 90  ? -32.37575 -45.22049  94.63966  1.000 52.97285  ? 70   ALA C O   1 
ATOM   6962  C CB  . ALA C  1 90  ? -33.88488 -44.51851  97.10749  1.000 66.73106  ? 70   ALA C CB  1 
ATOM   6963  N N   . HIS C  1 91  ? -30.70519 -45.54513  96.10221  1.000 60.20789  ? 71   HIS C N   1 
ATOM   6964  C CA  . HIS C  1 91  ? -29.68465 -45.25617  95.09531  1.000 62.15056  ? 71   HIS C CA  1 
ATOM   6965  C C   . HIS C  1 91  ? -29.92547 -46.06290  93.82246  1.000 56.35888  ? 71   HIS C C   1 
ATOM   6966  O O   . HIS C  1 91  ? -29.88594 -45.52520  92.71237  1.000 46.41725  ? 71   HIS C O   1 
ATOM   6967  C CB  . HIS C  1 91  ? -28.30396 -45.53826  95.68770  1.000 74.49840  ? 71   HIS C CB  1 
ATOM   6968  C CG  . HIS C  1 91  ? -27.18913 -45.61991  94.68563  1.000 87.82845  ? 71   HIS C CG  1 
ATOM   6969  N ND1 . HIS C  1 91  ? -26.68003 -46.82168  94.23411  1.000 92.66946  ? 71   HIS C ND1 1 
ATOM   6970  C CD2 . HIS C  1 91  ? -26.43336 -44.65251  94.10895  1.000 91.51540  ? 71   HIS C CD2 1 
ATOM   6971  C CE1 . HIS C  1 91  ? -25.68164 -46.59010  93.40012  1.000 95.21461  ? 71   HIS C CE1 1 
ATOM   6972  N NE2 . HIS C  1 91  ? -25.51075 -45.28233  93.30798  1.000 94.11531  ? 71   HIS C NE2 1 
ATOM   6973  N N   . ASP C  1 92  ? -30.25506 -47.33671  93.97242  1.000 49.01231  ? 72   ASP C N   1 
ATOM   6974  C CA  . ASP C  1 92  ? -30.41491 -48.20239  92.81737  1.000 48.74559  ? 72   ASP C CA  1 
ATOM   6975  C C   . ASP C  1 92  ? -31.63263 -47.80604  91.99911  1.000 43.96817  ? 72   ASP C C   1 
ATOM   6976  O O   . ASP C  1 92  ? -31.58599 -47.74328  90.76466  1.000 42.88557  ? 72   ASP C O   1 
ATOM   6977  C CB  . ASP C  1 92  ? -30.53234 -49.63782  93.30682  1.000 64.44621  ? 72   ASP C CB  1 
ATOM   6978  C CG  . ASP C  1 92  ? -29.94493 -50.60685  92.35272  1.000 73.32698  ? 72   ASP C CG  1 
ATOM   6979  O OD1 . ASP C  1 92  ? -30.43304 -50.65992  91.19890  1.000 74.29604  ? 72   ASP C OD1 1 
ATOM   6980  O OD2 . ASP C  1 92  ? -29.00126 -51.31801  92.75790  1.000 78.31886  ? 72   ASP C OD2 1 
ATOM   6981  N N   . LEU C  1 93  ? -32.74267 -47.54378  92.67825  1.000 43.06101  ? 73   LEU C N   1 
ATOM   6982  C CA  . LEU C  1 93  ? -33.93454 -47.06934  91.99550  1.000 39.62552  ? 73   LEU C CA  1 
ATOM   6983  C C   . LEU C  1 93  ? -33.70437 -45.70237  91.34477  1.000 39.51943  ? 73   LEU C C   1 
ATOM   6984  O O   . LEU C  1 93  ? -34.07853 -45.48698  90.18361  1.000 37.50779  ? 73   LEU C O   1 
ATOM   6985  C CB  . LEU C  1 93  ? -35.08369 -47.02327  92.99252  1.000 37.98944  ? 73   LEU C CB  1 
ATOM   6986  C CG  . LEU C  1 93  ? -36.39005 -46.46162  92.46675  1.000 35.13742  ? 73   LEU C CG  1 
ATOM   6987  C CD1 . LEU C  1 93  ? -36.93159 -47.36068  91.37233  1.000 34.62093  ? 73   LEU C CD1 1 
ATOM   6988  C CD2 . LEU C  1 93  ? -37.37477 -46.35036  93.61745  1.000 40.62550  ? 73   LEU C CD2 1 
ATOM   6989  N N   . ILE C  1 94  ? -33.08115 -44.77011  92.07101  1.000 37.75631  ? 74   ILE C N   1 
ATOM   6990  C CA  . ILE C  1 94  ? -32.84940 -43.43073  91.52680  1.000 36.73979  ? 74   ILE C CA  1 
ATOM   6991  C C   . ILE C  1 94  ? -31.99551 -43.50144  90.27147  1.000 37.95296  ? 74   ILE C C   1 
ATOM   6992  O O   . ILE C  1 94  ? -32.28404 -42.84224  89.26708  1.000 38.11032  ? 74   ILE C O   1 
ATOM   6993  C CB  . ILE C  1 94  ? -32.22116 -42.51745  92.60279  1.000 44.86414  ? 74   ILE C CB  1 
ATOM   6994  C CG1 . ILE C  1 94  ? -33.16479 -42.46704  93.81761  1.000 44.98523  ? 74   ILE C CG1 1 
ATOM   6995  C CG2 . ILE C  1 94  ? -31.86112 -41.12230  92.02221  1.000 38.87241  ? 74   ILE C CG2 1 
ATOM   6996  C CD1 . ILE C  1 94  ? -32.91918 -41.34577  94.82165  1.000 43.11156  ? 74   ILE C CD1 1 
ATOM   6997  N N   . ARG C  1 95  ? -30.94156 -44.31277  90.29175  1.000 41.56659  ? 75   ARG C N   1 
ATOM   6998  C CA  . ARG C  1 95  ? -30.12496 -44.41042  89.09349  1.000 41.73006  ? 75   ARG C CA  1 
ATOM   6999  C C   . ARG C  1 95  ? -30.89368 -45.00546  87.92461  1.000 42.29473  ? 75   ARG C C   1 
ATOM   7000  O O   . ARG C  1 95  ? -30.74418 -44.54957  86.78788  1.000 39.57022  ? 75   ARG C O   1 
ATOM   7001  C CB  . ARG C  1 95  ? -28.88989 -45.21183  89.38011  1.000 47.20430  ? 75   ARG C CB  1 
ATOM   7002  C CG  . ARG C  1 95  ? -28.11448 -44.53941  90.42790  1.000 67.66751  ? 75   ARG C CG  1 
ATOM   7003  C CD  . ARG C  1 95  ? -26.70950 -45.09524  90.56395  1.000 89.56883  ? 75   ARG C CD  1 
ATOM   7004  N NE  . ARG C  1 95  ? -26.52868 -46.49944  90.16938  1.000 101.56907 ? 75   ARG C NE  1 
ATOM   7005  C CZ  . ARG C  1 95  ? -26.29200 -46.90855  88.92220  1.000 113.81036 ? 75   ARG C CZ  1 
ATOM   7006  N NH1 . ARG C  1 95  ? -26.13544 -48.20009  88.64554  1.000 116.39285 ? 75   ARG C NH1 1 
ATOM   7007  N NH2 . ARG C  1 95  ? -26.19657 -46.01344  87.95109  1.000 130.11123 ? 75   ARG C NH2 1 
ATOM   7008  N N   . HIS C  1 96  ? -31.71219 -46.02284  88.17045  1.000 40.58400  ? 76   HIS C N   1 
ATOM   7009  C CA  . HIS C  1 96  ? -32.49290 -46.56126  87.07050  1.000 37.77870  ? 76   HIS C CA  1 
ATOM   7010  C C   . HIS C  1 96  ? -33.43226 -45.49977  86.52570  1.000 34.62112  ? 76   HIS C C   1 
ATOM   7011  O O   . HIS C  1 96  ? -33.56502 -45.34492  85.30247  1.000 36.56152  ? 76   HIS C O   1 
ATOM   7012  C CB  . HIS C  1 96  ? -33.26035 -47.80290  87.52598  1.000 39.34156  ? 76   HIS C CB  1 
ATOM   7013  C CG  . HIS C  1 96  ? -34.33103 -48.22721  86.57579  1.000 37.01395  ? 76   HIS C CG  1 
ATOM   7014  N ND1 . HIS C  1 96  ? -34.12448 -49.17074  85.59224  1.000 39.29463  ? 76   HIS C ND1 1 
ATOM   7015  C CD2 . HIS C  1 96  ? -35.62025 -47.82822  86.45436  1.000 34.99373  ? 76   HIS C CD2 1 
ATOM   7016  C CE1 . HIS C  1 96  ? -35.24498 -49.34020  84.91060  1.000 38.24382  ? 76   HIS C CE1 1 
ATOM   7017  N NE2 . HIS C  1 96  ? -36.16678 -48.53460  85.41185  1.000 35.34449  ? 76   HIS C NE2 1 
ATOM   7018  N N   . LEU C  1 97  ? -34.04570 -44.71745  87.42187  1.000 32.82074  ? 77   LEU C N   1 
ATOM   7019  C CA  . LEU C  1 97  ? -34.94906 -43.65012  86.98597  1.000 38.07519  ? 77   LEU C CA  1 
ATOM   7020  C C   . LEU C  1 97  ? -34.20115 -42.58514  86.19472  1.000 34.73948  ? 77   LEU C C   1 
ATOM   7021  O O   . LEU C  1 97  ? -34.68167 -42.12036  85.14454  1.000 34.08555  ? 77   LEU C O   1 
ATOM   7022  C CB  . LEU C  1 97  ? -35.65588 -43.02578  88.19505  1.000 29.40638  ? 77   LEU C CB  1 
ATOM   7023  C CG  . LEU C  1 97  ? -36.64903 -43.93416  88.90010  1.000 31.29347  ? 77   LEU C CG  1 
ATOM   7024  C CD1 . LEU C  1 97  ? -37.28539 -43.25477  90.10750  1.000 29.05142  ? 77   LEU C CD1 1 
ATOM   7025  C CD2 . LEU C  1 97  ? -37.71695 -44.38963  87.88194  1.000 28.20202  ? 77   LEU C CD2 1 
ATOM   7026  N N   . GLN C  1 98  ? -33.00312 -42.21859  86.66199  1.000 32.92964  ? 78   GLN C N   1 
ATOM   7027  C CA  . GLN C  1 98  ? -32.22620 -41.17940  85.99190  1.000 35.26760  ? 78   GLN C CA  1 
ATOM   7028  C C   . GLN C  1 98  ? -31.88545 -41.54294  84.55142  1.000 40.54678  ? 78   GLN C C   1 
ATOM   7029  O O   . GLN C  1 98  ? -31.69811 -40.65677  83.71466  1.000 41.43688  ? 78   GLN C O   1 
ATOM   7030  C CB  . GLN C  1 98  ? -30.93183 -40.89350  86.75553  1.000 40.64669  ? 78   GLN C CB  1 
ATOM   7031  C CG  . GLN C  1 98  ? -31.12090 -40.17170  88.08121  1.000 46.02250  ? 78   GLN C CG  1 
ATOM   7032  C CD  . GLN C  1 98  ? -29.83475 -40.14297  88.89137  1.000 51.72877  ? 78   GLN C CD  1 
ATOM   7033  O OE1 . GLN C  1 98  ? -29.01015 -41.04947  88.79227  1.000 56.23160  ? 78   GLN C OE1 1 
ATOM   7034  N NE2 . GLN C  1 98  ? -29.65196 -39.09373  89.67947  1.000 54.68983  ? 78   GLN C NE2 1 
ATOM   7035  N N   . ARG C  1 99  ? -31.77445 -42.82175  84.22681  1.000 43.57309  ? 79   ARG C N   1 
ATOM   7036  C CA  . ARG C  1 99  ? -31.31140 -43.11127  82.87518  1.000 52.10300  ? 79   ARG C CA  1 
ATOM   7037  C C   . ARG C  1 99  ? -32.30813 -43.81163  81.98856  1.000 43.08995  ? 79   ARG C C   1 
ATOM   7038  O O   . ARG C  1 99  ? -32.19852 -43.70768  80.76828  1.000 47.71329  ? 79   ARG C O   1 
ATOM   7039  C CB  . ARG C  1 99  ? -30.06143 -43.92797  82.94972  1.000 75.69564  ? 79   ARG C CB  1 
ATOM   7040  C CG  . ARG C  1 99  ? -29.43162 -43.53118  84.18337  1.000 101.22645 ? 79   ARG C CG  1 
ATOM   7041  C CD  . ARG C  1 99  ? -28.48295 -44.49129  84.72951  1.000 130.91826 ? 79   ARG C CD  1 
ATOM   7042  N NE  . ARG C  1 99  ? -29.23485 -45.81413  84.95605  1.000 140.89672 ? 79   ARG C NE  1 
ATOM   7043  C CZ  . ARG C  1 99  ? -28.69068 -46.94620  85.01960  1.000 159.45364 ? 79   ARG C CZ  1 
ATOM   7044  N NH1 . ARG C  1 99  ? -27.45627 -47.32590  84.99357  1.000 169.80303 ? 79   ARG C NH1 1 
ATOM   7045  N NH2 . ARG C  1 99  ? -29.65443 -47.92322  85.22742  1.000 148.81585 ? 79   ARG C NH2 1 
ATOM   7046  N N   . GLY C  1 100 ? -33.25779 -44.53540  82.55816  1.000 35.46097  ? 80   GLY C N   1 
ATOM   7047  C CA  . GLY C  1 100 ? -34.32319 -45.05142  81.73093  1.000 39.15527  ? 80   GLY C CA  1 
ATOM   7048  C C   . GLY C  1 100 ? -35.32943 -43.97053  81.38666  1.000 38.06017  ? 80   GLY C C   1 
ATOM   7049  O O   . GLY C  1 100 ? -35.82323 -43.91629  80.25003  1.000 39.92833  ? 80   GLY C O   1 
ATOM   7050  N N   . TRP C  1 101 ? -35.61921 -43.08938  82.35463  1.000 31.12561  ? 81   TRP C N   1 
ATOM   7051  C CA  . TRP C  1 101 ? -36.74003 -42.16152  82.23536  1.000 30.89767  ? 81   TRP C CA  1 
ATOM   7052  C C   . TRP C  1 101 ? -36.20666 -40.73800  82.10872  1.000 32.17979  ? 81   TRP C C   1 
ATOM   7053  O O   . TRP C  1 101 ? -36.51924 -39.84417  82.90503  1.000 33.01224  ? 81   TRP C O   1 
ATOM   7054  C CB  . TRP C  1 101 ? -37.71073 -42.36352  83.41330  1.000 26.91280  ? 81   TRP C CB  1 
ATOM   7055  C CG  . TRP C  1 101 ? -38.37522 -43.73980  83.31394  1.000 33.11465  ? 81   TRP C CG  1 
ATOM   7056  C CD1 . TRP C  1 101 ? -37.88495 -44.93663  83.80451  1.000 37.14769  ? 81   TRP C CD1 1 
ATOM   7057  C CD2 . TRP C  1 101 ? -39.59389 -44.07313  82.63187  1.000 32.65647  ? 81   TRP C CD2 1 
ATOM   7058  N NE1 . TRP C  1 101 ? -38.72878 -45.96565  83.48512  1.000 33.56758  ? 81   TRP C NE1 1 
ATOM   7059  C CE2 . TRP C  1 101 ? -39.78171 -45.47404  82.76669  1.000 33.58340  ? 81   TRP C CE2 1 
ATOM   7060  C CE3 . TRP C  1 101 ? -40.54377 -43.33197  81.92070  1.000 27.30155  ? 81   TRP C CE3 1 
ATOM   7061  C CZ2 . TRP C  1 101 ? -40.88094 -46.14112  82.21947  1.000 34.41500  ? 81   TRP C CZ2 1 
ATOM   7062  C CZ3 . TRP C  1 101 ? -41.64101 -43.99898  81.38090  1.000 29.66954  ? 81   TRP C CZ3 1 
ATOM   7063  C CH2 . TRP C  1 101 ? -41.80185 -45.38381  81.53347  1.000 31.35363  ? 81   TRP C CH2 1 
ATOM   7064  N N   . ASP C  1 102 ? -35.41287 -40.52939  81.06255  1.000 30.39256  ? 82   ASP C N   1 
ATOM   7065  C CA  . ASP C  1 102 ? -34.61357 -39.32921  80.89856  1.000 34.93558  ? 82   ASP C CA  1 
ATOM   7066  C C   . ASP C  1 102 ? -35.07585 -38.44909  79.74212  1.000 35.52717  ? 82   ASP C C   1 
ATOM   7067  O O   . ASP C  1 102 ? -34.34932 -37.53381  79.36499  1.000 34.05083  ? 82   ASP C O   1 
ATOM   7068  C CB  . ASP C  1 102 ? -33.15373 -39.72349  80.65470  1.000 34.66254  ? 82   ASP C CB  1 
ATOM   7069  C CG  . ASP C  1 102 ? -32.99186 -40.58725  79.38989  1.000 47.59289  ? 82   ASP C CG  1 
ATOM   7070  O OD1 . ASP C  1 102 ? -31.82762 -40.94441  79.05501  1.000 44.41717  ? 82   ASP C OD1 1 
ATOM   7071  O OD2 . ASP C  1 102 ? -34.03845 -40.96019  78.78672  1.000 43.64231  ? 82   ASP C OD2 1 
ATOM   7072  N N   . PHE C  1 103 ? -36.22622 -38.72886  79.12879  1.000 35.57624  ? 83   PHE C N   1 
ATOM   7073  C CA  . PHE C  1 103 ? -36.58426 -38.10902  77.85654  1.000 32.49423  ? 83   PHE C CA  1 
ATOM   7074  C C   . PHE C  1 103 ? -37.75341 -37.12798  77.97658  1.000 35.48138  ? 83   PHE C C   1 
ATOM   7075  O O   . PHE C  1 103 ? -38.31720 -36.71142  76.95647  1.000 39.10983  ? 83   PHE C O   1 
ATOM   7076  C CB  . PHE C  1 103 ? -36.88826 -39.20011  76.82357  1.000 33.79318  ? 83   PHE C CB  1 
ATOM   7077  C CG  . PHE C  1 103 ? -37.93949 -40.17516  77.27681  1.000 42.66608  ? 83   PHE C CG  1 
ATOM   7078  C CD1 . PHE C  1 103 ? -37.58440 -41.34250  77.94197  1.000 39.77244  ? 83   PHE C CD1 1 
ATOM   7079  C CD2 . PHE C  1 103 ? -39.28929 -39.89798  77.08624  1.000 31.46953  ? 83   PHE C CD2 1 
ATOM   7080  C CE1 . PHE C  1 103 ? -38.56041 -42.22956  78.39681  1.000 36.93037  ? 83   PHE C CE1 1 
ATOM   7081  C CE2 . PHE C  1 103 ? -40.26590 -40.78555  77.51741  1.000 35.88682  ? 83   PHE C CE2 1 
ATOM   7082  C CZ  . PHE C  1 103 ? -39.90227 -41.95723  78.17474  1.000 34.69025  ? 83   PHE C CZ  1 
ATOM   7083  N N   . PHE C  1 104 ? -38.12190 -36.72982  79.18733  1.000 29.53108  ? 84   PHE C N   1 
ATOM   7084  C CA  . PHE C  1 104 ? -39.15852 -35.72221  79.36156  1.000 34.55792  ? 84   PHE C CA  1 
ATOM   7085  C C   . PHE C  1 104 ? -38.53135 -34.32842  79.23371  1.000 38.02076  ? 84   PHE C C   1 
ATOM   7086  O O   . PHE C  1 104 ? -37.51094 -34.04483  79.86696  1.000 41.22957  ? 84   PHE C O   1 
ATOM   7087  C CB  . PHE C  1 104 ? -39.84804 -35.91075  80.71620  1.000 36.19221  ? 84   PHE C CB  1 
ATOM   7088  C CG  . PHE C  1 104 ? -40.78069 -37.11303  80.76453  1.000 40.52871  ? 84   PHE C CG  1 
ATOM   7089  C CD1 . PHE C  1 104 ? -40.30413 -38.40167  80.53863  1.000 42.10894  ? 84   PHE C CD1 1 
ATOM   7090  C CD2 . PHE C  1 104 ? -42.13913 -36.94463  81.01384  1.000 43.82741  ? 84   PHE C CD2 1 
ATOM   7091  C CE1 . PHE C  1 104 ? -41.17538 -39.50116  80.57288  1.000 45.78551  ? 84   PHE C CE1 1 
ATOM   7092  C CE2 . PHE C  1 104 ? -43.01320 -38.03916  81.04588  1.000 39.63303  ? 84   PHE C CE2 1 
ATOM   7093  C CZ  . PHE C  1 104 ? -42.53501 -39.31279  80.83117  1.000 36.71561  ? 84   PHE C CZ  1 
ATOM   7094  N N   . ARG C  1 105 ? -39.10980 -33.47430  78.37608  1.000 37.15812  ? 85   ARG C N   1 
ATOM   7095  C CA  . ARG C  1 105 ? -38.58480 -32.11947  78.15465  1.000 36.12251  ? 85   ARG C CA  1 
ATOM   7096  C C   . ARG C  1 105 ? -39.57797 -31.08695  78.67005  1.000 40.64315  ? 85   ARG C C   1 
ATOM   7097  O O   . ARG C  1 105 ? -40.73482 -31.05694  78.22324  1.000 37.42957  ? 85   ARG C O   1 
ATOM   7098  C CB  . ARG C  1 105 ? -38.28192 -31.87475  76.68579  1.000 37.26092  ? 85   ARG C CB  1 
ATOM   7099  C CG  . ARG C  1 105 ? -37.08927 -32.68397  76.14211  1.000 55.28586  ? 85   ARG C CG  1 
ATOM   7100  C CD  . ARG C  1 105 ? -35.77378 -32.42261  76.90478  1.000 55.67211  ? 85   ARG C CD  1 
ATOM   7101  N NE  . ARG C  1 105 ? -35.65901 -31.06228  77.44062  1.000 62.45709  ? 85   ARG C NE  1 
ATOM   7102  C CZ  . ARG C  1 105 ? -34.50976 -30.44302  77.74388  1.000 71.97394  ? 85   ARG C CZ  1 
ATOM   7103  N NH1 . ARG C  1 105 ? -33.33035 -31.03406  77.55588  1.000 73.68979  ? 85   ARG C NH1 1 
ATOM   7104  N NH2 . ARG C  1 105 ? -34.53318 -29.21111  78.23363  1.000 75.14794  ? 85   ARG C NH2 1 
ATOM   7105  N N   . PRO C  1 106 ? -39.17678 -30.25853  79.63615  1.000 40.72475  ? 86   PRO C N   1 
ATOM   7106  C CA  . PRO C  1 106 ? -40.11337 -29.27562  80.20810  1.000 39.96188  ? 86   PRO C CA  1 
ATOM   7107  C C   . PRO C  1 106 ? -40.68204 -28.27199  79.21402  1.000 46.96371  ? 86   PRO C C   1 
ATOM   7108  O O   . PRO C  1 106 ? -41.81402 -27.81312  79.42428  1.000 46.65159  ? 86   PRO C O   1 
ATOM   7109  C CB  . PRO C  1 106 ? -39.26444 -28.59073  81.29136  1.000 38.22219  ? 86   PRO C CB  1 
ATOM   7110  C CG  . PRO C  1 106 ? -38.35432 -29.71875  81.77161  1.000 38.20391  ? 86   PRO C CG  1 
ATOM   7111  C CD  . PRO C  1 106 ? -38.03647 -30.53758  80.52981  1.000 38.67345  ? 86   PRO C CD  1 
ATOM   7112  N N   . GLU C  1 107 ? -39.95071 -27.90227  78.15276  1.000 41.66183  ? 87   GLU C N   1 
ATOM   7113  C CA  . GLU C  1 107 ? -40.50256 -26.94435  77.19413  1.000 48.65102  ? 87   GLU C CA  1 
ATOM   7114  C C   . GLU C  1 107 ? -41.68816 -27.50841  76.44402  1.000 44.02897  ? 87   GLU C C   1 
ATOM   7115  O O   . GLU C  1 107 ? -42.41161 -26.73804  75.80071  1.000 47.90448  ? 87   GLU C O   1 
ATOM   7116  C CB  . GLU C  1 107 ? -39.48868 -26.49559  76.13314  1.000 53.00867  ? 87   GLU C CB  1 
ATOM   7117  C CG  . GLU C  1 107 ? -38.09607 -26.30802  76.60944  1.000 57.90372  ? 87   GLU C CG  1 
ATOM   7118  C CD  . GLU C  1 107 ? -37.26071 -27.57710  76.51740  1.000 46.81305  ? 87   GLU C CD  1 
ATOM   7119  O OE1 . GLU C  1 107 ? -36.26110 -27.52921  75.76100  1.000 49.42595  ? 87   GLU C OE1 1 
ATOM   7120  O OE2 . GLU C  1 107 ? -37.57566 -28.56653  77.20765  1.000 43.25776  ? 87   GLU C OE2 1 
ATOM   7121  N N   . ARG C  1 108 ? -41.87033 -28.82856  76.47657  1.000 41.09076  ? 88   ARG C N   1 
ATOM   7122  C CA  . ARG C  1 108 ? -43.02314 -29.49793  75.89136  1.000 40.75024  ? 88   ARG C CA  1 
ATOM   7123  C C   . ARG C  1 108 ? -44.06422 -29.86364  76.94000  1.000 39.02715  ? 88   ARG C C   1 
ATOM   7124  O O   . ARG C  1 108 ? -44.89526 -30.74549  76.69572  1.000 38.40790  ? 88   ARG C O   1 
ATOM   7125  C CB  . ARG C  1 108 ? -42.59044 -30.75012  75.11675  1.000 39.77930  ? 88   ARG C CB  1 
ATOM   7126  C CG  . ARG C  1 108 ? -41.47384 -30.54536  74.08217  1.000 43.88215  ? 88   ARG C CG  1 
ATOM   7127  C CD  . ARG C  1 108 ? -41.29406 -31.78014  73.13134  1.000 43.44757  ? 88   ARG C CD  1 
ATOM   7128  N NE  . ARG C  1 108 ? -40.82748 -32.94978  73.87526  1.000 39.37247  ? 88   ARG C NE  1 
ATOM   7129  C CZ  . ARG C  1 108 ? -39.66848 -33.55404  73.64886  1.000 39.74775  ? 88   ARG C CZ  1 
ATOM   7130  N NH1 . ARG C  1 108 ? -38.84878 -33.04668  72.73765  1.000 45.49678  ? 88   ARG C NH1 1 
ATOM   7131  N NH2 . ARG C  1 108 ? -39.29616 -34.59915  74.38508  1.000 37.56024  ? 88   ARG C NH2 1 
ATOM   7132  N N   . ASN C  1 109 ? -44.01613 -29.21736  78.11124  1.000 40.69790  ? 89   ASN C N   1 
ATOM   7133  C CA  . ASN C  1 109 ? -44.92299 -29.49846  79.23119  1.000 44.06535  ? 89   ASN C CA  1 
ATOM   7134  C C   . ASN C  1 109 ? -44.79627 -30.93481  79.73308  1.000 45.57900  ? 89   ASN C C   1 
ATOM   7135  O O   . ASN C  1 109 ? -45.74901 -31.51179  80.26246  1.000 48.33050  ? 89   ASN C O   1 
ATOM   7136  C CB  . ASN C  1 109 ? -46.37691 -29.17491  78.87168  1.000 42.84286  ? 89   ASN C CB  1 
ATOM   7137  C CG  . ASN C  1 109 ? -46.56663 -27.71401  78.56033  1.000 48.57761  ? 89   ASN C CG  1 
ATOM   7138  O OD1 . ASN C  1 109 ? -46.01718 -26.86229  79.24925  1.000 48.84114  ? 89   ASN C OD1 1 
ATOM   7139  N ND2 . ASN C  1 109 ? -47.31955 -27.41051  77.50484  1.000 52.20105  ? 89   ASN C ND2 1 
ATOM   7140  N N   . GLU C  1 110 ? -43.62201 -31.52155  79.58234  1.000 43.11821  ? 90   GLU C N   1 
ATOM   7141  C CA  . GLU C  1 110 ? -43.31850 -32.81571  80.16818  1.000 40.07200  ? 90   GLU C CA  1 
ATOM   7142  C C   . GLU C  1 110 ? -42.44789 -32.60697  81.39445  1.000 39.98259  ? 90   GLU C C   1 
ATOM   7143  O O   . GLU C  1 110 ? -41.62391 -31.69145  81.43321  1.000 49.59877  ? 90   GLU C O   1 
ATOM   7144  C CB  . GLU C  1 110 ? -42.59789 -33.71862  79.16269  1.000 41.53957  ? 90   GLU C CB  1 
ATOM   7145  C CG  . GLU C  1 110 ? -43.38730 -33.96615  77.89364  1.000 41.83234  ? 90   GLU C CG  1 
ATOM   7146  C CD  . GLU C  1 110 ? -42.52304 -34.40082  76.73086  1.000 44.46277  ? 90   GLU C CD  1 
ATOM   7147  O OE1 . GLU C  1 110 ? -41.29925 -34.63058  76.91804  1.000 45.28881  ? 90   GLU C OE1 1 
ATOM   7148  O OE2 . GLU C  1 110 ? -43.07419 -34.50013  75.61563  1.000 49.81000  ? 90   GLU C OE2 1 
ATOM   7149  N N   . SER C  1 111 ? -42.64281 -33.44460  82.40801  1.000 38.79880  ? 91   SER C N   1 
ATOM   7150  C CA  . SER C  1 111 ? -41.73047 -33.44369  83.54622  1.000 37.74354  ? 91   SER C CA  1 
ATOM   7151  C C   . SER C  1 111 ? -41.65704 -34.83960  84.15322  1.000 40.90959  ? 91   SER C C   1 
ATOM   7152  O O   . SER C  1 111 ? -42.64234 -35.58687  84.14254  1.000 45.33523  ? 91   SER C O   1 
ATOM   7153  C CB  . SER C  1 111 ? -42.12261 -32.40726  84.61228  1.000 38.54808  ? 91   SER C CB  1 
ATOM   7154  O OG  . SER C  1 111 ? -43.50805 -32.40378  84.94421  1.000 41.76763  ? 91   SER C OG  1 
ATOM   7155  N N   . PHE C  1 112 ? -40.46451 -35.19511  84.63963  1.000 37.88950  ? 92   PHE C N   1 
ATOM   7156  C CA  . PHE C  1 112 ? -40.22848 -36.41292  85.41885  1.000 32.03327  ? 92   PHE C CA  1 
ATOM   7157  C C   . PHE C  1 112 ? -39.42489 -35.96119  86.62658  1.000 32.63643  ? 92   PHE C C   1 
ATOM   7158  O O   . PHE C  1 112 ? -38.24209 -35.65081  86.49499  1.000 38.44030  ? 92   PHE C O   1 
ATOM   7159  C CB  . PHE C  1 112 ? -39.47959 -37.48004  84.61784  1.000 29.34196  ? 92   PHE C CB  1 
ATOM   7160  C CG  . PHE C  1 112 ? -39.60059 -38.88136  85.18397  1.000 28.76015  ? 92   PHE C CG  1 
ATOM   7161  C CD1 . PHE C  1 112 ? -40.51000 -39.77825  84.65631  1.000 25.78084  ? 92   PHE C CD1 1 
ATOM   7162  C CD2 . PHE C  1 112 ? -38.76969 -39.30472  86.22844  1.000 35.47903  ? 92   PHE C CD2 1 
ATOM   7163  C CE1 . PHE C  1 112 ? -40.62974 -41.08184  85.17765  1.000 35.37859  ? 92   PHE C CE1 1 
ATOM   7164  C CE2 . PHE C  1 112 ? -38.85961 -40.59514  86.75168  1.000 32.93451  ? 92   PHE C CE2 1 
ATOM   7165  C CZ  . PHE C  1 112 ? -39.79707 -41.48787  86.22907  1.000 37.68040  ? 92   PHE C CZ  1 
ATOM   7166  N N   . ASP C  1 113 ? -40.05696 -35.87816  87.79210  1.000 34.57318  ? 93   ASP C N   1 
ATOM   7167  C CA  . ASP C  1 113 ? -39.35583 -35.46936  89.00518  1.000 38.05019  ? 93   ASP C CA  1 
ATOM   7168  C C   . ASP C  1 113 ? -39.07666 -36.68297  89.88066  1.000 39.09575  ? 93   ASP C C   1 
ATOM   7169  O O   . ASP C  1 113 ? -39.97305 -37.50665  90.11909  1.000 41.09291  ? 93   ASP C O   1 
ATOM   7170  C CB  . ASP C  1 113 ? -40.16002 -34.42259  89.77600  1.000 40.64711  ? 93   ASP C CB  1 
ATOM   7171  C CG  . ASP C  1 113 ? -40.30087 -33.13187  89.00178  1.000 44.04639  ? 93   ASP C CG  1 
ATOM   7172  O OD1 . ASP C  1 113 ? -41.42651 -32.79279  88.57338  1.000 47.79013  ? 93   ASP C OD1 1 
ATOM   7173  O OD2 . ASP C  1 113 ? -39.27115 -32.47455  88.78603  1.000 45.49301  ? 93   ASP C OD2 1 
ATOM   7174  N N   . ILE C  1 114 ? -37.82717 -36.81212  90.31505  1.000 37.77773  ? 94   ILE C N   1 
ATOM   7175  C CA  . ILE C  1 114 ? -37.42512 -37.82394  91.28740  1.000 36.78766  ? 94   ILE C CA  1 
ATOM   7176  C C   . ILE C  1 114 ? -37.37764 -37.13770  92.64163  1.000 40.35613  ? 94   ILE C C   1 
ATOM   7177  O O   . ILE C  1 114 ? -36.71050 -36.10640  92.79700  1.000 41.41227  ? 94   ILE C O   1 
ATOM   7178  C CB  . ILE C  1 114 ? -36.07329 -38.45904  90.91961  1.000 34.70294  ? 94   ILE C CB  1 
ATOM   7179  C CG1 . ILE C  1 114 ? -36.12193 -38.99601  89.48198  1.000 32.32616  ? 94   ILE C CG1 1 
ATOM   7180  C CG2 . ILE C  1 114 ? -35.72185 -39.55804  91.90143  1.000 37.17844  ? 94   ILE C CG2 1 
ATOM   7181  C CD1 . ILE C  1 114 ? -34.80158 -39.55160  88.94438  1.000 30.46818  ? 94   ILE C CD1 1 
ATOM   7182  N N   . LEU C  1 115 ? -38.12050 -37.67481  93.61535  1.000 43.35837  ? 95   LEU C N   1 
ATOM   7183  C CA  . LEU C  1 115 ? -38.35058 -36.99311  94.89269  1.000 42.12200  ? 95   LEU C CA  1 
ATOM   7184  C C   . LEU C  1 115 ? -38.02484 -37.90479  96.07134  1.000 44.44899  ? 95   LEU C C   1 
ATOM   7185  O O   . LEU C  1 115 ? -38.92510 -38.44497  96.72773  1.000 46.04268  ? 95   LEU C O   1 
ATOM   7186  C CB  . LEU C  1 115 ? -39.78478 -36.47127  94.96528  1.000 41.09952  ? 95   LEU C CB  1 
ATOM   7187  C CG  . LEU C  1 115 ? -40.13640 -35.64621  93.71496  1.000 43.78624  ? 95   LEU C CG  1 
ATOM   7188  C CD1 . LEU C  1 115 ? -41.62507 -35.64471  93.46202  1.000 46.41038  ? 95   LEU C CD1 1 
ATOM   7189  C CD2 . LEU C  1 115 ? -39.59710 -34.21061  93.81453  1.000 40.20987  ? 95   LEU C CD2 1 
ATOM   7190  N N   . PRO C  1 116 ? -36.74432 -38.07141  96.39144  1.000 47.41138  ? 96   PRO C N   1 
ATOM   7191  C CA  . PRO C  1 116 ? -36.38062 -38.86790  97.56810  1.000 54.40652  ? 96   PRO C CA  1 
ATOM   7192  C C   . PRO C  1 116 ? -36.55202 -38.06096  98.84188  1.000 61.52846  ? 96   PRO C C   1 
ATOM   7193  O O   . PRO C  1 116 ? -36.17340 -36.89077  98.90817  1.000 59.97777  ? 96   PRO C O   1 
ATOM   7194  C CB  . PRO C  1 116 ? -34.89784 -39.20298  97.34006  1.000 56.81430  ? 96   PRO C CB  1 
ATOM   7195  C CG  . PRO C  1 116 ? -34.46145 -38.40823  96.11043  1.000 53.93252  ? 96   PRO C CG  1 
ATOM   7196  C CD  . PRO C  1 116 ? -35.56855 -37.44414  95.76578  1.000 48.70601  ? 96   PRO C CD  1 
ATOM   7197  N N   . ALA C  1 117 ? -37.12869 -38.69884  99.85972  1.000 71.92991  ? 97   ALA C N   1 
ATOM   7198  C CA  . ALA C  1 117 ? -37.17110 -38.10071  101.18648 1.000 73.29217  ? 97   ALA C CA  1 
ATOM   7199  C C   . ALA C  1 117 ? -35.76147 -37.74434  101.62575 1.000 80.76801  ? 97   ALA C C   1 
ATOM   7200  O O   . ALA C  1 117 ? -34.88275 -38.61022  101.65144 1.000 86.24885  ? 97   ALA C O   1 
ATOM   7201  C CB  . ALA C  1 117 ? -37.80535 -39.07593  102.17332 1.000 70.31295  ? 97   ALA C CB  1 
ATOM   7202  N N   . SER C  1 118 ? -35.53013 -36.47198  101.95265 1.000 87.43632  ? 98   SER C N   1 
ATOM   7203  C CA  . SER C  1 118 ? -34.18525 -36.06517  102.36054 1.000 99.28306  ? 98   SER C CA  1 
ATOM   7204  C C   . SER C  1 118 ? -34.19667 -34.86718  103.30826 1.000 109.63730 ? 98   SER C C   1 
ATOM   7205  O O   . SER C  1 118 ? -34.77764 -34.94181  104.39692 1.000 110.01923 ? 98   SER C O   1 
ATOM   7206  C CB  . SER C  1 118 ? -33.31802 -35.77172  101.13034 1.000 96.06086  ? 98   SER C CB  1 
ATOM   7207  O OG  . SER C  1 118 ? -32.74976 -36.96602  100.61669 1.000 92.98484  ? 98   SER C OG  1 
ATOM   7208  N N   . GLN C  1 119 ? -33.54386 -33.76374  102.91592 1.000 117.47786 ? 99   GLN C N   1 
ATOM   7209  C CA  . GLN C  1 119 ? -33.37242 -32.60236  103.78777 1.000 123.33817 ? 99   GLN C CA  1 
ATOM   7210  C C   . GLN C  1 119 ? -33.68444 -31.29253  103.06066 1.000 125.00358 ? 99   GLN C C   1 
ATOM   7211  O O   . GLN C  1 119 ? -33.13325 -30.24233  103.40459 1.000 127.06711 ? 99   GLN C O   1 
ATOM   7212  C CB  . GLN C  1 119 ? -31.96113 -32.56910  104.37785 1.000 127.40850 ? 99   GLN C CB  1 
ATOM   7213  N N   . ARG C  1 120 ? -34.57584 -31.35422  102.06099 1.000 124.32471 ? 100  ARG C N   1 
ATOM   7214  C CA  . ARG C  1 120 ? -35.07217 -30.23954  101.24597 1.000 124.33002 ? 100  ARG C CA  1 
ATOM   7215  C C   . ARG C  1 120 ? -35.56329 -29.07092  102.10729 1.000 128.69809 ? 100  ARG C C   1 
ATOM   7216  O O   . ARG C  1 120 ? -34.74676 -28.35973  102.70244 1.000 132.62490 ? 100  ARG C O   1 
ATOM   7217  C CB  . ARG C  1 120 ? -36.19266 -30.74119  100.31436 1.000 116.06163 ? 100  ARG C CB  1 
ATOM   7218  C CG  . ARG C  1 120 ? -37.22585 -31.65937  100.98592 1.000 110.77211 ? 100  ARG C CG  1 
ATOM   7219  C CD  . ARG C  1 120 ? -36.74395 -33.09236  101.11817 1.000 109.35052 ? 100  ARG C CD  1 
ATOM   7220  N NE  . ARG C  1 120 ? -36.67846 -33.73963  99.82317  1.000 108.88535 ? 100  ARG C NE  1 
ATOM   7221  C CZ  . ARG C  1 120 ? -37.73931 -34.22989  99.19423  1.000 106.16947 ? 100  ARG C CZ  1 
ATOM   7222  N NH1 . ARG C  1 120 ? -37.60361 -34.80662  98.00715  1.000 102.01736 ? 100  ARG C NH1 1 
ATOM   7223  N NH2 . ARG C  1 120 ? -38.93877 -34.14358  99.75565  1.000 106.60229 ? 100  ARG C NH2 1 
ATOM   7224  N N   . VAL C  1 121 ? -36.88482 -28.83382  102.15900 1.000 127.49333 ? 101  VAL C N   1 
ATOM   7225  C CA  . VAL C  1 121 ? -37.47612 -28.11020  103.28993 1.000 130.07843 ? 101  VAL C CA  1 
ATOM   7226  C C   . VAL C  1 121 ? -37.51996 -29.01957  104.50954 1.000 132.22946 ? 101  VAL C C   1 
ATOM   7227  O O   . VAL C  1 121 ? -37.78281 -28.55838  105.62890 1.000 136.54157 ? 101  VAL C O   1 
ATOM   7228  C CB  . VAL C  1 121 ? -38.88445 -27.54981  102.94990 1.000 124.20825 ? 101  VAL C CB  1 
ATOM   7229  C CG1 . VAL C  1 121 ? -39.50236 -26.73816  104.09516 1.000 126.88409 ? 101  VAL C CG1 1 
ATOM   7230  C CG2 . VAL C  1 121 ? -38.89331 -26.70815  101.69176 1.000 121.06931 ? 101  VAL C CG2 1 
ATOM   7231  N N   . SER C  1 122 ? -37.16173 -30.29405  104.33063 1.000 128.78990 ? 102  SER C N   1 
ATOM   7232  C CA  . SER C  1 122 ? -37.35270 -31.38958  105.27450 1.000 126.82382 ? 102  SER C CA  1 
ATOM   7233  C C   . SER C  1 122 ? -36.45899 -31.30852  106.51098 1.000 132.21651 ? 102  SER C C   1 
ATOM   7234  O O   . SER C  1 122 ? -36.90378 -30.88816  107.58738 1.000 135.52731 ? 102  SER C O   1 
ATOM   7235  C CB  . SER C  1 122 ? -37.11568 -32.70704  104.52734 1.000 120.58100 ? 102  SER C CB  1 
ATOM   7236  O OG  . SER C  1 122 ? -37.38991 -33.83270  105.33192 1.000 117.58786 ? 102  SER C OG  1 
ATOM   7237  N N   . GLU C  1 123 ? -35.19530 -31.72129  106.35497 1.000 132.57584 ? 103  GLU C N   1 
ATOM   7238  C CA  . GLU C  1 123 ? -34.21868 -31.78689  107.44981 1.000 135.50397 ? 103  GLU C CA  1 
ATOM   7239  C C   . GLU C  1 123 ? -34.71996 -32.66893  108.59238 1.000 134.79261 ? 103  GLU C C   1 
ATOM   7240  O O   . GLU C  1 123 ? -34.52041 -32.36158  109.76686 1.000 140.39831 ? 103  GLU C O   1 
ATOM   7241  C CB  . GLU C  1 123 ? -33.84831 -30.39086  107.95411 1.000 139.25051 ? 103  GLU C CB  1 
ATOM   7242  N N   . THR C  1 124 ? -35.37840 -33.79261  108.24332 1.000 127.85547 ? 104  THR C N   1 
ATOM   7243  C CA  . THR C  1 124 ? -35.90283 -34.69877  109.26339 1.000 125.28443 ? 104  THR C CA  1 
ATOM   7244  C C   . THR C  1 124 ? -35.99863 -36.14204  108.76988 1.000 119.18872 ? 104  THR C C   1 
ATOM   7245  O O   . THR C  1 124 ? -36.92121 -36.86417  109.16471 1.000 116.45213 ? 104  THR C O   1 
ATOM   7246  C CB  . THR C  1 124 ? -37.28620 -34.24408  109.74931 1.000 123.38493 ? 104  THR C CB  1 
ATOM   7247  N N   . GLN C  1 125 ? -35.07024 -36.56617  107.90277 1.000 117.23008 ? 105  GLN C N   1 
ATOM   7248  C CA  . GLN C  1 125 ? -34.92677 -37.94226  107.41729 1.000 113.60394 ? 105  GLN C CA  1 
ATOM   7249  C C   . GLN C  1 125 ? -35.97916 -38.34765  106.37775 1.000 109.57109 ? 105  GLN C C   1 
ATOM   7250  O O   . GLN C  1 125 ? -35.93338 -37.87761  105.23395 1.000 105.35548 ? 105  GLN C O   1 
ATOM   7251  C CB  . GLN C  1 125 ? -34.93194 -38.93330  108.58878 1.000 112.80415 ? 105  GLN C CB  1 
ATOM   7252  N N   . TRP C  1 126 ? -36.92618 -39.21742  106.76194 1.000 107.91420 ? 106  TRP C N   1 
ATOM   7253  C CA  . TRP C  1 126 ? -37.76359 -39.98547  105.84169 1.000 100.81969 ? 106  TRP C CA  1 
ATOM   7254  C C   . TRP C  1 126 ? -39.19148 -39.43088  105.74534 1.000 93.04187  ? 106  TRP C C   1 
ATOM   7255  O O   . TRP C  1 126 ? -39.56593 -38.47044  106.42625 1.000 95.99385  ? 106  TRP C O   1 
ATOM   7256  C CB  . TRP C  1 126 ? -37.81362 -41.44959  106.28608 1.000 104.18995 ? 106  TRP C CB  1 
ATOM   7257  C CG  . TRP C  1 126 ? -36.66723 -42.29888  105.82560 1.000 107.80086 ? 106  TRP C CG  1 
ATOM   7258  C CD1 . TRP C  1 126 ? -35.40054 -41.88430  105.51184 1.000 111.97514 ? 106  TRP C CD1 1 
ATOM   7259  C CD2 . TRP C  1 126 ? -36.68140 -43.71951  105.64641 1.000 105.75013 ? 106  TRP C CD2 1 
ATOM   7260  N NE1 . TRP C  1 126 ? -34.63009 -42.96206  105.13729 1.000 112.92705 ? 106  TRP C NE1 1 
ATOM   7261  C CE2 . TRP C  1 126 ? -35.39362 -44.09956  105.21174 1.000 109.46412 ? 106  TRP C CE2 1 
ATOM   7262  C CE3 . TRP C  1 126 ? -37.66143 -44.70685  105.80404 1.000 100.98748 ? 106  TRP C CE3 1 
ATOM   7263  C CZ2 . TRP C  1 126 ? -35.06234 -45.42660  104.93330 1.000 108.45707 ? 106  TRP C CZ2 1 
ATOM   7264  C CZ3 . TRP C  1 126 ? -37.33245 -46.02023  105.52756 1.000 100.64347 ? 106  TRP C CZ3 1 
ATOM   7265  C CH2 . TRP C  1 126 ? -36.04391 -46.36941  105.09861 1.000 104.37451 ? 106  TRP C CH2 1 
ATOM   7266  N N   . TYR C  1 127 ? -40.00582 -40.06786  104.89035 1.000 81.66188  ? 107  TYR C N   1 
ATOM   7267  C CA  . TYR C  1 127 ? -41.42772 -39.73553  104.78061 1.000 71.71528  ? 107  TYR C CA  1 
ATOM   7268  C C   . TYR C  1 127 ? -42.22928 -40.46910  105.84915 1.000 69.20333  ? 107  TYR C C   1 
ATOM   7269  O O   . TYR C  1 127 ? -42.05357 -41.67131  106.05436 1.000 70.88535  ? 107  TYR C O   1 
ATOM   7270  C CB  . TYR C  1 127 ? -41.99301 -40.11488  103.40563 1.000 64.01930  ? 107  TYR C CB  1 
ATOM   7271  C CG  . TYR C  1 127 ? -41.52205 -39.28615  102.22846 1.000 59.92614  ? 107  TYR C CG  1 
ATOM   7272  C CD1 . TYR C  1 127 ? -41.65053 -37.90035  102.22175 1.000 59.49868  ? 107  TYR C CD1 1 
ATOM   7273  C CD2 . TYR C  1 127 ? -40.96359 -39.89758  101.11177 1.000 58.08858  ? 107  TYR C CD2 1 
ATOM   7274  C CE1 . TYR C  1 127 ? -41.21907 -37.14572  101.14043 1.000 58.60816  ? 107  TYR C CE1 1 
ATOM   7275  C CE2 . TYR C  1 127 ? -40.53170 -39.16255  100.02720 1.000 59.32478  ? 107  TYR C CE2 1 
ATOM   7276  C CZ  . TYR C  1 127 ? -40.66084 -37.78504  100.04004 1.000 60.10491  ? 107  TYR C CZ  1 
ATOM   7277  O OH  . TYR C  1 127 ? -40.22721 -37.05124  98.95624  1.000 55.85321  ? 107  TYR C OH  1 
ATOM   7278  N N   . GLU C  1 128 ? -43.14548 -39.74796  106.50072 1.000 69.48560  ? 108  GLU C N   1 
ATOM   7279  C CA  . GLU C  1 128 ? -43.96279 -40.31395  107.57718 1.000 70.46367  ? 108  GLU C CA  1 
ATOM   7280  C C   . GLU C  1 128 ? -45.01349 -41.29751  107.08500 1.000 67.87952  ? 108  GLU C C   1 
ATOM   7281  O O   . GLU C  1 128 ? -45.68116 -41.92171  107.91507 1.000 67.30546  ? 108  GLU C O   1 
ATOM   7282  C CB  . GLU C  1 128 ? -44.68078 -39.20857  108.35880 1.000 68.74969  ? 108  GLU C CB  1 
ATOM   7283  C CG  . GLU C  1 128 ? -43.82820 -38.01068  108.68980 1.000 72.77462  ? 108  GLU C CG  1 
ATOM   7284  C CD  . GLU C  1 128 ? -43.40546 -37.97830  110.13743 1.000 81.17597  ? 108  GLU C CD  1 
ATOM   7285  O OE1 . GLU C  1 128 ? -43.60662 -36.92801  110.78593 1.000 84.85385  ? 108  GLU C OE1 1 
ATOM   7286  O OE2 . GLU C  1 128 ? -42.87705 -39.00115  110.62723 1.000 83.21665  ? 108  GLU C OE2 1 
ATOM   7287  N N   . GLY C  1 129 ? -45.18369 -41.43918  105.78109 1.000 65.17255  ? 109  GLY C N   1 
ATOM   7288  C CA  . GLY C  1 129 ? -46.25339 -42.25018  105.24035 1.000 64.48653  ? 109  GLY C CA  1 
ATOM   7289  C C   . GLY C  1 129 ? -46.53550 -41.83583  103.81419 1.000 61.17670  ? 109  GLY C C   1 
ATOM   7290  O O   . GLY C  1 129 ? -45.95539 -40.88157  103.29541 1.000 62.91791  ? 109  GLY C O   1 
ATOM   7291  N N   . THR C  1 130 ? -47.44895 -42.58472  103.18589 1.000 55.41646  ? 110  THR C N   1 
ATOM   7292  C CA  . THR C  1 130 ? -47.73237 -42.36996  101.76787 1.000 49.63249  ? 110  THR C CA  1 
ATOM   7293  C C   . THR C  1 130 ? -48.35219 -41.00101  101.52003 1.000 53.14746  ? 110  THR C C   1 
ATOM   7294  O O   . THR C  1 130 ? -48.10717 -40.38377  100.47449 1.000 59.34646  ? 110  THR C O   1 
ATOM   7295  C CB  . THR C  1 130 ? -48.64540 -43.48281  101.24148 1.000 44.35197  ? 110  THR C CB  1 
ATOM   7296  O OG1 . THR C  1 130 ? -49.81116 -43.59776  102.07305 1.000 49.03692  ? 110  THR C OG1 1 
ATOM   7297  C CG2 . THR C  1 130 ? -47.89155 -44.82648  101.22473 1.000 41.74512  ? 110  THR C CG2 1 
ATOM   7298  N N   . ALA C  1 131 ? -49.14728 -40.50151  102.46670 1.000 48.19000  ? 111  ALA C N   1 
ATOM   7299  C CA  . ALA C  1 131 ? -49.69016 -39.16577  102.29754 1.000 48.43464  ? 111  ALA C CA  1 
ATOM   7300  C C   . ALA C  1 131 ? -48.60505 -38.11448  102.47072 1.000 49.49156  ? 111  ALA C C   1 
ATOM   7301  O O   . ALA C  1 131 ? -48.60816 -37.09031  101.78239 1.000 48.91650  ? 111  ALA C O   1 
ATOM   7302  C CB  . ALA C  1 131 ? -50.83463 -38.93109  103.28588 1.000 52.15157  ? 111  ALA C CB  1 
ATOM   7303  N N   . ASP C  1 132 ? -47.68814 -38.33382  103.41223 1.000 53.24653  ? 112  ASP C N   1 
ATOM   7304  C CA  . ASP C  1 132 ? -46.59354 -37.39050  103.59814 1.000 50.92148  ? 112  ASP C CA  1 
ATOM   7305  C C   . ASP C  1 132 ? -45.68861 -37.35502  102.37562 1.000 48.21356  ? 112  ASP C C   1 
ATOM   7306  O O   . ASP C  1 132 ? -45.07539 -36.32225  102.08569 1.000 50.41535  ? 112  ASP C O   1 
ATOM   7307  C CB  . ASP C  1 132 ? -45.79786 -37.75815  104.84645 1.000 47.50873  ? 112  ASP C CB  1 
ATOM   7308  C CG  . ASP C  1 132 ? -44.83824 -36.67299  105.25902 1.000 51.68638  ? 112  ASP C CG  1 
ATOM   7309  O OD1 . ASP C  1 132 ? -45.21566 -35.47578  105.21307 1.000 52.13869  ? 112  ASP C OD1 1 
ATOM   7310  O OD2 . ASP C  1 132 ? -43.70658 -37.01973  105.65137 1.000 50.50827  ? 112  ASP C OD2 1 
ATOM   7311  N N   . ALA C  1 133 ? -45.60464 -38.47038  101.64395 1.000 43.83371  ? 113  ALA C N   1 
ATOM   7312  C CA  . ALA C  1 133 ? -44.77730 -38.51405  100.44731 1.000 45.80748  ? 113  ALA C CA  1 
ATOM   7313  C C   . ALA C  1 133 ? -45.27654 -37.53530  99.39178  1.000 48.07216  ? 113  ALA C C   1 
ATOM   7314  O O   . ALA C  1 133 ? -44.48058 -37.01965  98.60037  1.000 48.18188  ? 113  ALA C O   1 
ATOM   7315  C CB  . ALA C  1 133 ? -44.72497 -39.93393  99.88801  1.000 42.46894  ? 113  ALA C CB  1 
ATOM   7316  N N   . VAL C  1 134 ? -46.57132 -37.23395  99.38543  1.000 45.42661  ? 114  VAL C N   1 
ATOM   7317  C CA  . VAL C  1 134 ? -47.06938 -36.18807  98.50048  1.000 42.83366  ? 114  VAL C CA  1 
ATOM   7318  C C   . VAL C  1 134 ? -47.01746 -34.82770  99.17501  1.000 47.51490  ? 114  VAL C C   1 
ATOM   7319  O O   . VAL C  1 134 ? -46.60135 -33.83971  98.56156  1.000 48.49841  ? 114  VAL C O   1 
ATOM   7320  C CB  . VAL C  1 134 ? -48.49603 -36.51654  98.02286  1.000 40.19262  ? 114  VAL C CB  1 
ATOM   7321  C CG1 . VAL C  1 134 ? -48.84375 -35.65802  96.81631  1.000 37.42703  ? 114  VAL C CG1 1 
ATOM   7322  C CG2 . VAL C  1 134 ? -48.63261 -38.00741  97.70813  1.000 44.71759  ? 114  VAL C CG2 1 
ATOM   7323  N N   . TYR C  1 135 ? -47.44497 -34.76584  100.43711 1.000 47.85387  ? 115  TYR C N   1 
ATOM   7324  C CA  . TYR C  1 135 ? -47.48287 -33.49502  101.15181 1.000 47.00385  ? 115  TYR C CA  1 
ATOM   7325  C C   . TYR C  1 135 ? -46.13948 -32.77347  101.09516 1.000 47.99152  ? 115  TYR C C   1 
ATOM   7326  O O   . TYR C  1 135 ? -46.08903 -31.56394  100.85950 1.000 50.19073  ? 115  TYR C O   1 
ATOM   7327  C CB  . TYR C  1 135 ? -47.89716 -33.72558  102.60685 1.000 44.03680  ? 115  TYR C CB  1 
ATOM   7328  C CG  . TYR C  1 135 ? -47.74858 -32.49474  103.44966 1.000 48.20101  ? 115  TYR C CG  1 
ATOM   7329  C CD1 . TYR C  1 135 ? -48.64122 -31.43894  103.32003 1.000 53.24909  ? 115  TYR C CD1 1 
ATOM   7330  C CD2 . TYR C  1 135 ? -46.71253 -32.36989  104.36220 1.000 54.20080  ? 115  TYR C CD2 1 
ATOM   7331  C CE1 . TYR C  1 135 ? -48.51631 -30.29318  104.08200 1.000 57.23784  ? 115  TYR C CE1 1 
ATOM   7332  C CE2 . TYR C  1 135 ? -46.57563 -31.22512  105.13617 1.000 58.18581  ? 115  TYR C CE2 1 
ATOM   7333  C CZ  . TYR C  1 135 ? -47.48298 -30.18805  104.98924 1.000 60.18597  ? 115  TYR C CZ  1 
ATOM   7334  O OH  . TYR C  1 135 ? -47.36594 -29.04289  105.74630 1.000 64.84319  ? 115  TYR C OH  1 
ATOM   7335  N N   . GLN C  1 136 ? -45.03722 -33.50253  101.30005 1.000 47.59033  ? 116  GLN C N   1 
ATOM   7336  C CA  . GLN C  1 136 ? -43.73318 -32.85648  101.37309 1.000 48.96882  ? 116  GLN C CA  1 
ATOM   7337  C C   . GLN C  1 136 ? -43.35260 -32.18605  100.06419 1.000 46.56426  ? 116  GLN C C   1 
ATOM   7338  O O   . GLN C  1 136 ? -42.49828 -31.29871  100.06418 1.000 47.88870  ? 116  GLN C O   1 
ATOM   7339  C CB  . GLN C  1 136 ? -42.65224 -33.86878  101.77620 1.000 46.81919  ? 116  GLN C CB  1 
ATOM   7340  C CG  . GLN C  1 136 ? -42.78550 -34.38474  103.20594 1.000 48.87511  ? 116  GLN C CG  1 
ATOM   7341  C CD  . GLN C  1 136 ? -42.58628 -33.30895  104.26689 1.000 52.91117  ? 116  GLN C CD  1 
ATOM   7342  O OE1 . GLN C  1 136 ? -41.72381 -32.44212  104.15176 1.000 55.25495  ? 116  GLN C OE1 1 
ATOM   7343  N NE2 . GLN C  1 136 ? -43.39668 -33.36596  105.30697 1.000 55.57718  ? 116  GLN C NE2 1 
ATOM   7344  N N   . ASN C  1 137 ? -43.98013 -32.57065  98.95530  1.000 42.31453  ? 117  ASN C N   1 
ATOM   7345  C CA  . ASN C  1 137 ? -43.57973 -32.08766  97.64196  1.000 42.56359  ? 117  ASN C CA  1 
ATOM   7346  C C   . ASN C  1 137 ? -44.67168 -31.26498  96.97368  1.000 47.85529  ? 117  ASN C C   1 
ATOM   7347  O O   . ASN C  1 137 ? -44.65519 -31.08622  95.74824  1.000 48.83488  ? 117  ASN C O   1 
ATOM   7348  C CB  . ASN C  1 137 ? -43.16066 -33.26295  96.75641  1.000 40.98083  ? 117  ASN C CB  1 
ATOM   7349  C CG  . ASN C  1 137 ? -41.98178 -34.01223  97.33388  1.000 48.61922  ? 117  ASN C CG  1 
ATOM   7350  O OD1 . ASN C  1 137 ? -40.85012 -33.53187  97.26816  1.000 55.34187  ? 117  ASN C OD1 1 
ATOM   7351  N ND2 . ASN C  1 137 ? -42.23525 -35.17799  97.92492  1.000 42.44854  ? 117  ASN C ND2 1 
ATOM   7352  N N   . ILE C  1 138 ? -45.62240 -30.75580  97.75635  1.000 50.96499  ? 118  ILE C N   1 
ATOM   7353  C CA  . ILE C  1 138 ? -46.63930 -29.87381  97.19738  1.000 51.72143  ? 118  ILE C CA  1 
ATOM   7354  C C   . ILE C  1 138 ? -45.99674 -28.67045  96.50602  1.000 52.34764  ? 118  ILE C C   1 
ATOM   7355  O O   . ILE C  1 138 ? -46.50210 -28.18997  95.48184  1.000 47.29231  ? 118  ILE C O   1 
ATOM   7356  C CB  . ILE C  1 138 ? -47.62208 -29.45389  98.30465  1.000 51.05114  ? 118  ILE C CB  1 
ATOM   7357  C CG1 . ILE C  1 138 ? -48.54716 -30.62676  98.65377  1.000 48.44764  ? 118  ILE C CG1 1 
ATOM   7358  C CG2 . ILE C  1 138 ? -48.41903 -28.25407  97.87268  1.000 51.58747  ? 118  ILE C CG2 1 
ATOM   7359  C CD1 . ILE C  1 138 ? -49.54138 -30.32869  99.76683  1.000 50.77115  ? 118  ILE C CD1 1 
ATOM   7360  N N   . ASP C  1 139 ? -44.85357 -28.19894  97.01144  1.000 44.11276  ? 119  ASP C N   1 
ATOM   7361  C CA  . ASP C  1 139 ? -44.17272 -27.09331  96.34446  1.000 56.11786  ? 119  ASP C CA  1 
ATOM   7362  C C   . ASP C  1 139 ? -43.72757 -27.46010  94.93278  1.000 51.93788  ? 119  ASP C C   1 
ATOM   7363  O O   . ASP C  1 139 ? -43.54518 -26.56570  94.10887  1.000 53.92569  ? 119  ASP C O   1 
ATOM   7364  C CB  . ASP C  1 139 ? -42.97932 -26.62019  97.17989  1.000 58.95887  ? 119  ASP C CB  1 
ATOM   7365  C CG  . ASP C  1 139 ? -41.96767 -27.72651  97.43203  1.000 64.72646  ? 119  ASP C CG  1 
ATOM   7366  O OD1 . ASP C  1 139 ? -42.30780 -28.91297  97.21292  1.000 63.01785  ? 119  ASP C OD1 1 
ATOM   7367  O OD2 . ASP C  1 139 ? -40.82887 -27.40772  97.84808  1.000 70.63058  ? 119  ASP C OD2 1 
ATOM   7368  N N   . ILE C  1 140 ? -43.55668 -28.74898  94.63712  1.000 51.76698  ? 120  ILE C N   1 
ATOM   7369  C CA  . ILE C  1 140 ? -43.26809 -29.20172  93.27601  1.000 52.12722  ? 120  ILE C CA  1 
ATOM   7370  C C   . ILE C  1 140 ? -44.54027 -29.22790  92.43454  1.000 50.80766  ? 120  ILE C C   1 
ATOM   7371  O O   . ILE C  1 140 ? -44.53296 -28.83892  91.26207  1.000 47.79306  ? 120  ILE C O   1 
ATOM   7372  C CB  . ILE C  1 140 ? -42.60708 -30.59639  93.30400  1.000 51.41393  ? 120  ILE C CB  1 
ATOM   7373  C CG1 . ILE C  1 140 ? -41.34273 -30.60598  94.16725  1.000 52.27377  ? 120  ILE C CG1 1 
ATOM   7374  C CG2 . ILE C  1 140 ? -42.30269 -31.06837  91.89547  1.000 53.11429  ? 120  ILE C CG2 1 
ATOM   7375  C CD1 . ILE C  1 140 ? -40.20334 -29.80173  93.58930  1.000 50.27902  ? 120  ILE C CD1 1 
ATOM   7376  N N   . ILE C  1 141 ? -45.63915 -29.71530  93.01732  1.000 50.15819  ? 121  ILE C N   1 
ATOM   7377  C CA  . ILE C  1 141 ? -46.86172 -29.97057  92.26378  1.000 49.69685  ? 121  ILE C CA  1 
ATOM   7378  C C   . ILE C  1 141 ? -47.55139 -28.66342  91.87803  1.000 53.99844  ? 121  ILE C C   1 
ATOM   7379  O O   . ILE C  1 141 ? -47.99509 -28.49519  90.73442  1.000 51.94643  ? 121  ILE C O   1 
ATOM   7380  C CB  . ILE C  1 141 ? -47.79371 -30.87980  93.08596  1.000 48.90756  ? 121  ILE C CB  1 
ATOM   7381  C CG1 . ILE C  1 141 ? -47.13785 -32.23667  93.34369  1.000 45.40133  ? 121  ILE C CG1 1 
ATOM   7382  C CG2 . ILE C  1 141 ? -49.13977 -31.07186  92.39751  1.000 49.59905  ? 121  ILE C CG2 1 
ATOM   7383  C CD1 . ILE C  1 141 ? -47.72460 -32.94835  94.52521  1.000 43.25041  ? 121  ILE C CD1 1 
ATOM   7384  N N   . GLU C  1 142 ? -47.66237 -27.72349  92.82012  1.000 57.12921  ? 122  GLU C N   1 
ATOM   7385  C CA  . GLU C  1 142 ? -48.50171 -26.54901  92.58754  1.000 57.70526  ? 122  GLU C CA  1 
ATOM   7386  C C   . GLU C  1 142 ? -48.05688 -25.70039  91.40083  1.000 57.68138  ? 122  GLU C C   1 
ATOM   7387  O O   . GLU C  1 142 ? -48.93736 -25.26622  90.63900  1.000 58.05920  ? 122  GLU C O   1 
ATOM   7388  C CB  . GLU C  1 142 ? -48.60730 -25.72145  93.87681  1.000 58.70325  ? 122  GLU C CB  1 
ATOM   7389  C CG  . GLU C  1 142 ? -49.42198 -26.46758  94.93492  1.000 64.77163  ? 122  GLU C CG  1 
ATOM   7390  C CD  . GLU C  1 142 ? -49.82707 -25.61702  96.13349  1.000 68.06618  ? 122  GLU C CD  1 
ATOM   7391  O OE1 . GLU C  1 142 ? -50.89842 -25.90944  96.73694  1.000 59.40154  ? 122  GLU C OE1 1 
ATOM   7392  O OE2 . GLU C  1 142 ? -49.06495 -24.67936  96.47408  1.000 72.77154  ? 122  GLU C OE2 1 
ATOM   7393  N N   . PRO C  1 143 ? -46.76246 -25.45836  91.15297  1.000 54.84270  ? 123  PRO C N   1 
ATOM   7394  C CA  . PRO C  1 143 ? -46.39501 -24.69263  89.94421  1.000 54.68108  ? 123  PRO C CA  1 
ATOM   7395  C C   . PRO C  1 143 ? -46.84828 -25.33792  88.64231  1.000 51.55199  ? 123  PRO C C   1 
ATOM   7396  O O   . PRO C  1 143 ? -47.27019 -24.63635  87.71658  1.000 56.33982  ? 123  PRO C O   1 
ATOM   7397  C CB  . PRO C  1 143 ? -44.86679 -24.61112  90.03976  1.000 53.72950  ? 123  PRO C CB  1 
ATOM   7398  C CG  . PRO C  1 143 ? -44.58460 -24.71510  91.48211  1.000 55.00957  ? 123  PRO C CG  1 
ATOM   7399  C CD  . PRO C  1 143 ? -45.59185 -25.70099  92.00985  1.000 53.57807  ? 123  PRO C CD  1 
ATOM   7400  N N   . TYR C  1 144 ? -46.76552 -26.65929  88.54132  1.000 47.66989  ? 124  TYR C N   1 
ATOM   7401  C CA  . TYR C  1 144 ? -47.32494 -27.36130  87.39140  1.000 43.95741  ? 124  TYR C CA  1 
ATOM   7402  C C   . TYR C  1 144 ? -48.83055 -27.15769  87.28545  1.000 47.20951  ? 124  TYR C C   1 
ATOM   7403  O O   . TYR C  1 144 ? -49.38554 -27.18881  86.17974  1.000 50.50550  ? 124  TYR C O   1 
ATOM   7404  C CB  . TYR C  1 144 ? -47.03428 -28.85632  87.50285  1.000 40.46659  ? 124  TYR C CB  1 
ATOM   7405  C CG  . TYR C  1 144 ? -45.57738 -29.23903  87.45825  1.000 42.94840  ? 124  TYR C CG  1 
ATOM   7406  C CD1 . TYR C  1 144 ? -44.67506 -28.54622  86.64657  1.000 43.64988  ? 124  TYR C CD1 1 
ATOM   7407  C CD2 . TYR C  1 144 ? -45.10447 -30.31704  88.20332  1.000 41.70395  ? 124  TYR C CD2 1 
ATOM   7408  C CE1 . TYR C  1 144 ? -43.34717 -28.90726  86.58737  1.000 45.15154  ? 124  TYR C CE1 1 
ATOM   7409  C CE2 . TYR C  1 144 ? -43.77586 -30.68839  88.14405  1.000 43.93480  ? 124  TYR C CE2 1 
ATOM   7410  C CZ  . TYR C  1 144 ? -42.90253 -29.98085  87.33649  1.000 44.33374  ? 124  TYR C CZ  1 
ATOM   7411  O OH  . TYR C  1 144 ? -41.59057 -30.34989  87.28843  1.000 46.22952  ? 124  TYR C OH  1 
ATOM   7412  N N   . ALA C  1 145 ? -49.50188 -26.98289  88.42354  1.000 44.94217  ? 125  ALA C N   1 
ATOM   7413  C CA  . ALA C  1 145 ? -50.94891 -26.82557  88.49415  1.000 45.93657  ? 125  ALA C CA  1 
ATOM   7414  C C   . ALA C  1 145 ? -51.74496 -27.86120  87.69135  1.000 46.70344  ? 125  ALA C C   1 
ATOM   7415  O O   . ALA C  1 145 ? -52.65659 -27.50051  86.94401  1.000 47.42256  ? 125  ALA C O   1 
ATOM   7416  C CB  . ALA C  1 145 ? -51.34571 -25.41930  88.06320  1.000 44.61452  ? 125  ALA C CB  1 
ATOM   7417  N N   . PRO C  1 146 ? -51.44834 -29.15520  87.84290  1.000 46.84901  ? 126  PRO C N   1 
ATOM   7418  C CA  . PRO C  1 146 ? -52.31101 -30.16154  87.21116  1.000 45.98216  ? 126  PRO C CA  1 
ATOM   7419  C C   . PRO C  1 146 ? -53.73285 -30.05961  87.73580  1.000 46.26073  ? 126  PRO C C   1 
ATOM   7420  O O   . PRO C  1 146 ? -53.98006 -29.59440  88.85076  1.000 44.69287  ? 126  PRO C O   1 
ATOM   7421  C CB  . PRO C  1 146 ? -51.66929 -31.49418  87.60814  1.000 47.57702  ? 126  PRO C CB  1 
ATOM   7422  C CG  . PRO C  1 146 ? -50.95506 -31.19302  88.88755  1.000 50.05229  ? 126  PRO C CG  1 
ATOM   7423  C CD  . PRO C  1 146 ? -50.42804 -29.78761  88.70149  1.000 49.32057  ? 126  PRO C CD  1 
ATOM   7424  N N   . GLU C  1 147 ? -54.67793 -30.47126  86.89660  1.000 45.66311  ? 127  GLU C N   1 
ATOM   7425  C CA  . GLU C  1 147 ? -56.06784 -30.48298  87.32813  1.000 44.86524  ? 127  GLU C CA  1 
ATOM   7426  C C   . GLU C  1 147 ? -56.38837 -31.74725  88.11813  1.000 43.28993  ? 127  GLU C C   1 
ATOM   7427  O O   . GLU C  1 147 ? -57.19029 -31.70465  89.05468  1.000 44.30187  ? 127  GLU C O   1 
ATOM   7428  C CB  . GLU C  1 147 ? -56.98217 -30.34327  86.11325  1.000 46.52131  ? 127  GLU C CB  1 
ATOM   7429  C CG  . GLU C  1 147 ? -58.44147 -30.16704  86.44959  1.000 56.14059  ? 127  GLU C CG  1 
ATOM   7430  C CD  . GLU C  1 147 ? -58.78679 -28.78408  87.00550  1.000 59.84124  ? 127  GLU C CD  1 
ATOM   7431  O OE1 . GLU C  1 147 ? -57.93305 -27.86961  86.96964  1.000 57.31901  ? 127  GLU C OE1 1 
ATOM   7432  O OE2 . GLU C  1 147 ? -59.93383 -28.62324  87.47895  1.000 62.52389  ? 127  GLU C OE2 1 
ATOM   7433  N N   . TYR C  1 148 ? -55.74630 -32.86360  87.78504  1.000 43.51673  ? 128  TYR C N   1 
ATOM   7434  C CA  . TYR C  1 148 ? -55.98998 -34.14380  88.43977  1.000 44.93791  ? 128  TYR C CA  1 
ATOM   7435  C C   . TYR C  1 148 ? -54.68038 -34.73655  88.92873  1.000 43.90432  ? 128  TYR C C   1 
ATOM   7436  O O   . TYR C  1 148 ? -53.63893 -34.57455  88.28292  1.000 41.89949  ? 128  TYR C O   1 
ATOM   7437  C CB  . TYR C  1 148 ? -56.68094 -35.11762  87.48829  1.000 41.41454  ? 128  TYR C CB  1 
ATOM   7438  C CG  . TYR C  1 148 ? -57.75347 -34.42584  86.71932  1.000 43.84530  ? 128  TYR C CG  1 
ATOM   7439  C CD1 . TYR C  1 148 ? -58.93056 -34.03793  87.34389  1.000 49.92797  ? 128  TYR C CD1 1 
ATOM   7440  C CD2 . TYR C  1 148 ? -57.58673 -34.12536  85.37819  1.000 44.85293  ? 128  TYR C CD2 1 
ATOM   7441  C CE1 . TYR C  1 148 ? -59.92865 -33.37238  86.64681  1.000 50.39995  ? 128  TYR C CE1 1 
ATOM   7442  C CE2 . TYR C  1 148 ? -58.56607 -33.46377  84.67515  1.000 49.08831  ? 128  TYR C CE2 1 
ATOM   7443  C CZ  . TYR C  1 148 ? -59.73332 -33.09206  85.30969  1.000 52.55793  ? 128  TYR C CZ  1 
ATOM   7444  O OH  . TYR C  1 148 ? -60.70301 -32.43144  84.59662  1.000 56.94328  ? 128  TYR C OH  1 
ATOM   7445  N N   . MET C  1 149 ? -54.74239 -35.40428  90.08034  1.000 44.43742  ? 129  MET C N   1 
ATOM   7446  C CA  . MET C  1 149 ? -53.63138 -36.18715  90.61423  1.000 42.71011  ? 129  MET C CA  1 
ATOM   7447  C C   . MET C  1 149 ? -53.96207 -37.66653  90.49979  1.000 43.08581  ? 129  MET C C   1 
ATOM   7448  O O   . MET C  1 149 ? -55.06460 -38.08062  90.86190  1.000 38.26523  ? 129  MET C O   1 
ATOM   7449  C CB  . MET C  1 149 ? -53.35163 -35.83881  92.07450  1.000 41.66570  ? 129  MET C CB  1 
ATOM   7450  C CG  . MET C  1 149 ? -52.79390 -34.44181  92.29024  1.000 45.51717  ? 129  MET C CG  1 
ATOM   7451  S SD  . MET C  1 149 ? -51.19808 -34.17404  91.49909  1.000 44.20394  ? 129  MET C SD  1 
ATOM   7452  C CE  . MET C  1 149 ? -50.18445 -35.40822  92.30977  1.000 43.21735  ? 129  MET C CE  1 
ATOM   7453  N N   . VAL C  1 150 ? -53.00497 -38.45276  90.00548  1.000 45.28029  ? 130  VAL C N   1 
ATOM   7454  C CA  . VAL C  1 150 ? -53.13611 -39.89988  89.85342  1.000 42.71912  ? 130  VAL C CA  1 
ATOM   7455  C C   . VAL C  1 150 ? -52.07256 -40.55640  90.73361  1.000 38.69119  ? 130  VAL C C   1 
ATOM   7456  O O   . VAL C  1 150 ? -50.90005 -40.64795  90.35178  1.000 36.95953  ? 130  VAL C O   1 
ATOM   7457  C CB  . VAL C  1 150 ? -53.01223 -40.34457  88.39351  1.000 41.23664  ? 130  VAL C CB  1 
ATOM   7458  C CG1 . VAL C  1 150 ? -53.05921 -41.87039  88.30715  1.000 43.22325  ? 130  VAL C CG1 1 
ATOM   7459  C CG2 . VAL C  1 150 ? -54.14443 -39.74682  87.58319  1.000 39.17754  ? 130  VAL C CG2 1 
ATOM   7460  N N   . ILE C  1 151 ? -52.48271 -41.00134  91.92021  1.000 38.07529  ? 131  ILE C N   1 
ATOM   7461  C CA  . ILE C  1 151 ? -51.58972 -41.63670  92.88277  1.000 37.63234  ? 131  ILE C CA  1 
ATOM   7462  C C   . ILE C  1 151 ? -51.45730 -43.11156  92.52799  1.000 38.87704  ? 131  ILE C C   1 
ATOM   7463  O O   . ILE C  1 151 ? -52.46248 -43.81976  92.39933  1.000 37.91504  ? 131  ILE C O   1 
ATOM   7464  C CB  . ILE C  1 151 ? -52.12276 -41.45399  94.31495  1.000 40.09075  ? 131  ILE C CB  1 
ATOM   7465  C CG1 . ILE C  1 151 ? -52.49952 -39.98853  94.58012  1.000 38.59416  ? 131  ILE C CG1 1 
ATOM   7466  C CG2 . ILE C  1 151 ? -51.10451 -41.91924  95.32505  1.000 44.59730  ? 131  ILE C CG2 1 
ATOM   7467  C CD1 . ILE C  1 151 ? -51.36503 -38.98642  94.36716  1.000 36.66356  ? 131  ILE C CD1 1 
ATOM   7468  N N   . LEU C  1 152 ? -50.22022 -43.58298  92.36953  1.000 33.74565  ? 132  LEU C N   1 
ATOM   7469  C CA  . LEU C  1 152 ? -49.97492 -44.95260  91.94318  1.000 33.78753  ? 132  LEU C CA  1 
ATOM   7470  C C   . LEU C  1 152 ? -49.01556 -45.66029  92.88800  1.000 39.56285  ? 132  LEU C C   1 
ATOM   7471  O O   . LEU C  1 152 ? -48.00233 -45.08922  93.29923  1.000 41.23334  ? 132  LEU C O   1 
ATOM   7472  C CB  . LEU C  1 152 ? -49.38029 -45.01533  90.53208  1.000 32.44094  ? 132  LEU C CB  1 
ATOM   7473  C CG  . LEU C  1 152 ? -50.25747 -44.43825  89.43476  1.000 33.21792  ? 132  LEU C CG  1 
ATOM   7474  C CD1 . LEU C  1 152 ? -49.44705 -44.27831  88.16215  1.000 32.32766  ? 132  LEU C CD1 1 
ATOM   7475  C CD2 . LEU C  1 152 ? -51.47892 -45.30855  89.23323  1.000 33.32755  ? 132  LEU C CD2 1 
ATOM   7476  N N   . ALA C  1 153 ? -49.31505 -46.92374  93.19273  1.000 41.77333  ? 133  ALA C N   1 
ATOM   7477  C CA  . ALA C  1 153 ? -48.34467 -47.78233  93.85758  1.000 36.81313  ? 133  ALA C CA  1 
ATOM   7478  C C   . ALA C  1 153 ? -47.31757 -48.27422  92.84041  1.000 36.68572  ? 133  ALA C C   1 
ATOM   7479  O O   . ALA C  1 153 ? -47.67841 -48.82682  91.79748  1.000 39.98997  ? 133  ALA C O   1 
ATOM   7480  C CB  . ALA C  1 153 ? -49.04605 -48.96731  94.53423  1.000 37.77205  ? 133  ALA C CB  1 
ATOM   7481  N N   . GLY C  1 154 ? -46.04003 -48.10452  93.15741  1.000 33.66795  ? 134  GLY C N   1 
ATOM   7482  C CA  . GLY C  1 154 ? -44.96942 -48.42516  92.23655  1.000 31.74110  ? 134  GLY C CA  1 
ATOM   7483  C C   . GLY C  1 154 ? -44.44058 -49.84043  92.29263  1.000 34.11189  ? 134  GLY C C   1 
ATOM   7484  O O   . GLY C  1 154 ? -43.43113 -50.13703  91.64658  1.000 35.60878  ? 134  GLY C O   1 
ATOM   7485  N N   . ASP C  1 155 ? -45.09586 -50.74067  93.02214  1.000 32.82227  ? 135  ASP C N   1 
ATOM   7486  C CA  . ASP C  1 155 ? -44.52612 -52.05707  93.29273  1.000 34.50777  ? 135  ASP C CA  1 
ATOM   7487  C C   . ASP C  1 155 ? -45.40658 -53.19986  92.77885  1.000 36.39300  ? 135  ASP C C   1 
ATOM   7488  O O   . ASP C  1 155 ? -45.28010 -54.32943  93.26621  1.000 38.90020  ? 135  ASP C O   1 
ATOM   7489  C CB  . ASP C  1 155 ? -44.22604 -52.20801  94.79454  1.000 30.44181  ? 135  ASP C CB  1 
ATOM   7490  C CG  . ASP C  1 155 ? -45.50395 -52.29080  95.66772  1.000 52.43646  ? 135  ASP C CG  1 
ATOM   7491  O OD1 . ASP C  1 155 ? -46.40188 -51.42055  95.54531  1.000 49.23979  ? 135  ASP C OD1 1 
ATOM   7492  O OD2 . ASP C  1 155 ? -45.61749 -53.23913  96.48599  1.000 50.88585  ? 135  ASP C OD2 1 
ATOM   7493  N N   . HIS C  1 156 ? -46.27328 -52.94499  91.78345  1.000 33.12024  ? 136  HIS C N   1 
ATOM   7494  C CA  . HIS C  1 156 ? -47.14311 -53.96833  91.20090  1.000 30.23521  ? 136  HIS C CA  1 
ATOM   7495  C C   . HIS C  1 156 ? -46.89896 -54.07702  89.69729  1.000 35.01692  ? 136  HIS C C   1 
ATOM   7496  O O   . HIS C  1 156 ? -46.50812 -53.10014  89.04875  1.000 35.00447  ? 136  HIS C O   1 
ATOM   7497  C CB  . HIS C  1 156 ? -48.65745 -53.68907  91.47421  1.000 32.60904  ? 136  HIS C CB  1 
ATOM   7498  C CG  . HIS C  1 156 ? -48.98802 -53.44304  92.91946  1.000 37.11010  ? 136  HIS C CG  1 
ATOM   7499  N ND1 . HIS C  1 156 ? -49.95570 -52.54744  93.33316  1.000 39.98093  ? 136  HIS C ND1 1 
ATOM   7500  C CD2 . HIS C  1 156 ? -48.44601 -53.95626  94.05103  1.000 39.65789  ? 136  HIS C CD2 1 
ATOM   7501  C CE1 . HIS C  1 156 ? -50.02114 -52.55256  94.65464  1.000 40.81312  ? 136  HIS C CE1 1 
ATOM   7502  N NE2 . HIS C  1 156 ? -49.10721 -53.38979  95.11555  1.000 40.60947  ? 136  HIS C NE2 1 
ATOM   7503  N N   . ILE C  1 157 ? -47.09313 -55.28007  89.14468  1.000 35.68633  ? 137  ILE C N   1 
ATOM   7504  C CA  . ILE C  1 157 ? -46.99877 -55.50881  87.70100  1.000 35.61152  ? 137  ILE C CA  1 
ATOM   7505  C C   . ILE C  1 157 ? -48.41047 -55.59648  87.14533  1.000 37.19778  ? 137  ILE C C   1 
ATOM   7506  O O   . ILE C  1 157 ? -49.17866 -56.47901  87.54536  1.000 35.55092  ? 137  ILE C O   1 
ATOM   7507  C CB  . ILE C  1 157 ? -46.20425 -56.78131  87.36196  1.000 35.77455  ? 137  ILE C CB  1 
ATOM   7508  C CG1 . ILE C  1 157 ? -44.78844 -56.71679  87.94186  1.000 31.62016  ? 137  ILE C CG1 1 
ATOM   7509  C CG2 . ILE C  1 157 ? -46.10432 -56.95357  85.83378  1.000 32.38764  ? 137  ILE C CG2 1 
ATOM   7510  C CD1 . ILE C  1 157 ? -44.36345 -58.03590  88.53105  1.000 33.63888  ? 137  ILE C CD1 1 
ATOM   7511  N N   . TYR C  1 158 ? -48.74928 -54.68229  86.22786  1.000 36.74798  ? 138  TYR C N   1 
ATOM   7512  C CA  . TYR C  1 158 ? -50.07817 -54.59215  85.61766  1.000 34.53642  ? 138  TYR C CA  1 
ATOM   7513  C C   . TYR C  1 158 ? -50.03777 -53.53647  84.52237  1.000 31.55341  ? 138  TYR C C   1 
ATOM   7514  O O   . TYR C  1 158 ? -49.16131 -52.66925  84.50251  1.000 34.17232  ? 138  TYR C O   1 
ATOM   7515  C CB  . TYR C  1 158 ? -51.16836 -54.23025  86.64138  1.000 32.60504  ? 138  TYR C CB  1 
ATOM   7516  C CG  . TYR C  1 158 ? -51.05409 -52.80544  87.13162  1.000 31.95145  ? 138  TYR C CG  1 
ATOM   7517  C CD1 . TYR C  1 158 ? -50.07780 -52.44099  88.06288  1.000 34.60274  ? 138  TYR C CD1 1 
ATOM   7518  C CD2 . TYR C  1 158 ? -51.91426 -51.81559  86.65310  1.000 32.57232  ? 138  TYR C CD2 1 
ATOM   7519  C CE1 . TYR C  1 158 ? -49.95567 -51.12252  88.49758  1.000 32.25060  ? 138  TYR C CE1 1 
ATOM   7520  C CE2 . TYR C  1 158 ? -51.79617 -50.50218  87.07386  1.000 32.65461  ? 138  TYR C CE2 1 
ATOM   7521  C CZ  . TYR C  1 158 ? -50.82678 -50.16171  87.99195  1.000 32.70548  ? 138  TYR C CZ  1 
ATOM   7522  O OH  . TYR C  1 158 ? -50.75753 -48.86266  88.39977  1.000 34.44387  ? 138  TYR C OH  1 
ATOM   7523  N N   . LYS C  1 159 ? -51.00591 -53.61769  83.61994  1.000 34.26051  ? 139  LYS C N   1 
ATOM   7524  C CA  . LYS C  1 159 ? -51.14711 -52.69683  82.50548  1.000 32.28311  ? 139  LYS C CA  1 
ATOM   7525  C C   . LYS C  1 159 ? -52.52469 -52.07270  82.58088  1.000 43.47605  ? 139  LYS C C   1 
ATOM   7526  O O   . LYS C  1 159 ? -53.52640 -52.79818  82.65013  1.000 42.08262  ? 139  LYS C O   1 
ATOM   7527  C CB  . LYS C  1 159 ? -50.95441 -53.42104  81.17730  1.000 36.30864  ? 139  LYS C CB  1 
ATOM   7528  C CG  . LYS C  1 159 ? -49.51817 -53.86516  80.95368  1.000 40.67152  ? 139  LYS C CG  1 
ATOM   7529  C CD  . LYS C  1 159 ? -49.33554 -54.52003  79.61827  1.000 47.50672  ? 139  LYS C CD  1 
ATOM   7530  C CE  . LYS C  1 159 ? -49.86138 -55.93245  79.65365  1.000 51.62114  ? 139  LYS C CE  1 
ATOM   7531  N NZ  . LYS C  1 159 ? -50.01220 -56.44423  78.27609  1.000 57.31884  ? 139  LYS C NZ  1 
ATOM   7532  N N   . MET C  1 160 ? -52.58404 -50.73419  82.55374  1.000 42.88295  ? 140  MET C N   1 
ATOM   7533  C CA  . MET C  1 160 ? -53.84473 -50.04373  82.79292  1.000 38.35217  ? 140  MET C CA  1 
ATOM   7534  C C   . MET C  1 160 ? -53.87077 -48.67592  82.11123  1.000 39.52940  ? 140  MET C C   1 
ATOM   7535  O O   . MET C  1 160 ? -52.89664 -47.92148  82.16940  1.000 38.38667  ? 140  MET C O   1 
ATOM   7536  C CB  . MET C  1 160 ? -54.09203 -49.90572  84.30112  1.000 37.09904  ? 140  MET C CB  1 
ATOM   7537  C CG  . MET C  1 160 ? -55.25552 -49.01353  84.65687  1.000 44.71243  ? 140  MET C CG  1 
ATOM   7538  S SD  . MET C  1 160 ? -56.03895 -49.32862  86.24697  1.000 47.88076  ? 140  MET C SD  1 
ATOM   7539  C CE  . MET C  1 160 ? -54.72174 -49.12024  87.35106  1.000 45.49646  ? 140  MET C CE  1 
ATOM   7540  N N   . ASP C  1 161 ? -55.01455 -48.34964  81.48902  1.000 40.42265  ? 141  ASP C N   1 
ATOM   7541  C CA  . ASP C  1 161 ? -55.20403 -47.08062  80.79533  1.000 40.29783  ? 141  ASP C CA  1 
ATOM   7542  C C   . ASP C  1 161 ? -55.96786 -46.15107  81.74212  1.000 40.74135  ? 141  ASP C C   1 
ATOM   7543  O O   . ASP C  1 161 ? -57.17941 -46.29985  81.93575  1.000 40.09100  ? 141  ASP C O   1 
ATOM   7544  C CB  . ASP C  1 161 ? -55.93263 -47.30047  79.47014  1.000 40.59678  ? 141  ASP C CB  1 
ATOM   7545  C CG  . ASP C  1 161 ? -56.17663 -45.99067  78.68400  1.000 45.14322  ? 141  ASP C CG  1 
ATOM   7546  O OD1 . ASP C  1 161 ? -55.92710 -44.86787  79.19484  1.000 44.09663  ? 141  ASP C OD1 1 
ATOM   7547  O OD2 . ASP C  1 161 ? -56.63721 -46.09298  77.53365  1.000 45.70909  ? 141  ASP C OD2 1 
ATOM   7548  N N   . TYR C  1 162 ? -55.25193 -45.17913  82.31913  1.000 36.47616  ? 142  TYR C N   1 
ATOM   7549  C CA  . TYR C  1 162 ? -55.79074 -44.33768  83.37747  1.000 36.88635  ? 142  TYR C CA  1 
ATOM   7550  C C   . TYR C  1 162 ? -56.81876 -43.31752  82.88799  1.000 38.12276  ? 142  TYR C C   1 
ATOM   7551  O O   . TYR C  1 162 ? -57.52101 -42.71789  83.71440  1.000 40.92693  ? 142  TYR C O   1 
ATOM   7552  C CB  . TYR C  1 162 ? -54.64948 -43.62330  84.08015  1.000 38.80279  ? 142  TYR C CB  1 
ATOM   7553  C CG  . TYR C  1 162 ? -53.61431 -44.55723  84.67087  1.000 40.33810  ? 142  TYR C CG  1 
ATOM   7554  C CD1 . TYR C  1 162 ? -53.99104 -45.62249  85.48542  1.000 39.77576  ? 142  TYR C CD1 1 
ATOM   7555  C CD2 . TYR C  1 162 ? -52.26432 -44.37361  84.41503  1.000 35.05278  ? 142  TYR C CD2 1 
ATOM   7556  C CE1 . TYR C  1 162 ? -53.04898 -46.46304  86.03329  1.000 39.51718  ? 142  TYR C CE1 1 
ATOM   7557  C CE2 . TYR C  1 162 ? -51.31768 -45.21768  84.95024  1.000 33.13449  ? 142  TYR C CE2 1 
ATOM   7558  C CZ  . TYR C  1 162 ? -51.71467 -46.26335  85.75996  1.000 39.23357  ? 142  TYR C CZ  1 
ATOM   7559  O OH  . TYR C  1 162 ? -50.77254 -47.10764  86.30950  1.000 41.73140  ? 142  TYR C OH  1 
ATOM   7560  N N   . GLU C  1 163 ? -56.93306 -43.10034  81.57886  1.000 38.62709  ? 143  GLU C N   1 
ATOM   7561  C CA  . GLU C  1 163 ? -57.92276 -42.14686  81.10087  1.000 40.52537  ? 143  GLU C CA  1 
ATOM   7562  C C   . GLU C  1 163 ? -59.34324 -42.61116  81.44101  1.000 49.39719  ? 143  GLU C C   1 
ATOM   7563  O O   . GLU C  1 163 ? -60.22642 -41.77904  81.68232  1.000 42.08047  ? 143  GLU C O   1 
ATOM   7564  C CB  . GLU C  1 163 ? -57.73578 -41.91220  79.60043  1.000 42.90458  ? 143  GLU C CB  1 
ATOM   7565  C CG  . GLU C  1 163 ? -58.72870 -40.88963  78.98946  1.000 48.75319  ? 143  GLU C CG  1 
ATOM   7566  C CD  . GLU C  1 163 ? -58.33942 -39.42491  79.26098  1.000 49.40112  ? 143  GLU C CD  1 
ATOM   7567  O OE1 . GLU C  1 163 ? -59.26368 -38.60981  79.50638  1.000 52.02261  ? 143  GLU C OE1 1 
ATOM   7568  O OE2 . GLU C  1 163 ? -57.13347 -39.08951  79.25213  1.000 45.53227  ? 143  GLU C OE2 1 
ATOM   7569  N N   . TYR C  1 164 ? -59.56049 -43.93063  81.54128  1.000 47.96807  ? 144  TYR C N   1 
ATOM   7570  C CA  . TYR C  1 164 ? -60.85235 -44.44370  81.98973  1.000 46.51057  ? 144  TYR C CA  1 
ATOM   7571  C C   . TYR C  1 164 ? -61.15943 -44.00647  83.41656  1.000 45.85200  ? 144  TYR C C   1 
ATOM   7572  O O   . TYR C  1 164 ? -62.24821 -43.48456  83.69974  1.000 43.41212  ? 144  TYR C O   1 
ATOM   7573  C CB  . TYR C  1 164 ? -60.87927 -45.96985  81.88043  1.000 50.39689  ? 144  TYR C CB  1 
ATOM   7574  C CG  . TYR C  1 164 ? -60.92123 -46.46769  80.45792  1.000 54.22546  ? 144  TYR C CG  1 
ATOM   7575  C CD1 . TYR C  1 164 ? -59.76151 -46.58577  79.71357  1.000 51.24451  ? 144  TYR C CD1 1 
ATOM   7576  C CD2 . TYR C  1 164 ? -62.12997 -46.80203  79.84944  1.000 61.74309  ? 144  TYR C CD2 1 
ATOM   7577  C CE1 . TYR C  1 164 ? -59.79332 -47.03332  78.40936  1.000 54.97596  ? 144  TYR C CE1 1 
ATOM   7578  C CE2 . TYR C  1 164 ? -62.17452 -47.25200  78.53699  1.000 63.84690  ? 144  TYR C CE2 1 
ATOM   7579  C CZ  . TYR C  1 164 ? -60.99877 -47.36331  77.82449  1.000 64.85743  ? 144  TYR C CZ  1 
ATOM   7580  O OH  . TYR C  1 164 ? -61.03168 -47.80253  76.52176  1.000 72.32071  ? 144  TYR C OH  1 
ATOM   7581  N N   . MET C  1 165 ? -60.21999 -44.23545  84.33741  1.000 48.52825  ? 145  MET C N   1 
ATOM   7582  C CA  . MET C  1 165 ? -60.39339 -43.75737  85.70575  1.000 47.45740  ? 145  MET C CA  1 
ATOM   7583  C C   . MET C  1 165 ? -60.69961 -42.26723  85.73795  1.000 48.44990  ? 145  MET C C   1 
ATOM   7584  O O   . MET C  1 165 ? -61.62121 -41.82791  86.43573  1.000 51.02301  ? 145  MET C O   1 
ATOM   7585  C CB  . MET C  1 165 ? -59.14274 -44.04030  86.52540  1.000 47.34043  ? 145  MET C CB  1 
ATOM   7586  C CG  . MET C  1 165 ? -59.25195 -45.26990  87.35832  1.000 52.08132  ? 145  MET C CG  1 
ATOM   7587  S SD  . MET C  1 165 ? -58.03962 -45.35796  88.68165  1.000 45.71330  ? 145  MET C SD  1 
ATOM   7588  C CE  . MET C  1 165 ? -58.98698 -44.62959  90.01894  1.000 42.83128  ? 145  MET C CE  1 
ATOM   7589  N N   . LEU C  1 166 ? -59.92134 -41.46950  84.99235  1.000 47.25381  ? 146  LEU C N   1 
ATOM   7590  C CA  . LEU C  1 166 ? -60.08196 -40.02139  85.04840  1.000 46.13262  ? 146  LEU C CA  1 
ATOM   7591  C C   . LEU C  1 166 ? -61.48886 -39.60464  84.62748  1.000 44.69096  ? 146  LEU C C   1 
ATOM   7592  O O   . LEU C  1 166 ? -62.12261 -38.76915  85.28323  1.000 44.02109  ? 146  LEU C O   1 
ATOM   7593  C CB  . LEU C  1 166 ? -59.02305 -39.33827  84.17766  1.000 46.87009  ? 146  LEU C CB  1 
ATOM   7594  C CG  . LEU C  1 166 ? -57.60072 -39.36187  84.74369  1.000 44.07433  ? 146  LEU C CG  1 
ATOM   7595  C CD1 . LEU C  1 166 ? -56.57371 -39.06996  83.65637  1.000 40.68209  ? 146  LEU C CD1 1 
ATOM   7596  C CD2 . LEU C  1 166 ? -57.46090 -38.39614  85.91759  1.000 39.77126  ? 146  LEU C CD2 1 
ATOM   7597  N N   . GLN C  1 167 ? -62.00063 -40.18647  83.54078  1.000 46.68160  ? 147  GLN C N   1 
ATOM   7598  C CA  . GLN C  1 167 ? -63.33967 -39.81873  83.08706  1.000 54.43196  ? 147  GLN C CA  1 
ATOM   7599  C C   . GLN C  1 167 ? -64.39960 -40.25100  84.08897  1.000 54.09688  ? 147  GLN C C   1 
ATOM   7600  O O   . GLN C  1 167 ? -65.36001 -39.51387  84.33775  1.000 55.82355  ? 147  GLN C O   1 
ATOM   7601  C CB  . GLN C  1 167 ? -63.61932 -40.39953  81.69802  1.000 59.39383  ? 147  GLN C CB  1 
ATOM   7602  C CG  . GLN C  1 167 ? -62.49224 -40.09416  80.71385  1.000 64.03550  ? 147  GLN C CG  1 
ATOM   7603  C CD  . GLN C  1 167 ? -62.88875 -39.17637  79.55907  1.000 66.35971  ? 147  GLN C CD  1 
ATOM   7604  O OE1 . GLN C  1 167 ? -63.53586 -38.13269  79.75429  1.000 71.40748  ? 147  GLN C OE1 1 
ATOM   7605  N NE2 . GLN C  1 167 ? -62.46061 -39.54128  78.35052  1.000 59.88425  ? 147  GLN C NE2 1 
ATOM   7606  N N   . GLN C  1 168 ? -64.23723 -41.43237  84.68827  1.000 50.04668  ? 148  GLN C N   1 
ATOM   7607  C CA  . GLN C  1 168 ? -65.17244 -41.84330  85.72699  1.000 53.15887  ? 148  GLN C CA  1 
ATOM   7608  C C   . GLN C  1 168 ? -65.14803 -40.85409  86.88223  1.000 54.02699  ? 148  GLN C C   1 
ATOM   7609  O O   . GLN C  1 168 ? -66.20218 -40.39729  87.34500  1.000 53.45018  ? 148  GLN C O   1 
ATOM   7610  C CB  . GLN C  1 168 ? -64.86280 -43.25770  86.23191  1.000 51.82242  ? 148  GLN C CB  1 
ATOM   7611  C CG  . GLN C  1 168 ? -65.76759 -43.67769  87.41489  1.000 54.78011  ? 148  GLN C CG  1 
ATOM   7612  C CD  . GLN C  1 168 ? -65.54151 -45.12929  87.90132  1.000 61.41373  ? 148  GLN C CD  1 
ATOM   7613  O OE1 . GLN C  1 168 ? -65.20848 -46.03805  87.12383  1.000 59.94309  ? 148  GLN C OE1 1 
ATOM   7614  N NE2 . GLN C  1 168 ? -65.71645 -45.33415  89.20132  1.000 63.08213  ? 148  GLN C NE2 1 
ATOM   7615  N N   . HIS C  1 169 ? -63.94620 -40.48538  87.34331  1.000 47.83693  ? 149  HIS C N   1 
ATOM   7616  C CA  . HIS C  1 169 ? -63.85776 -39.58244  88.48809  1.000 53.08888  ? 149  HIS C CA  1 
ATOM   7617  C C   . HIS C  1 169 ? -64.61305 -38.27154  88.23346  1.000 56.14834  ? 149  HIS C C   1 
ATOM   7618  O O   . HIS C  1 169 ? -65.41044 -37.82605  89.06991  1.000 54.70948  ? 149  HIS C O   1 
ATOM   7619  C CB  . HIS C  1 169 ? -62.39938 -39.31091  88.82992  1.000 43.84544  ? 149  HIS C CB  1 
ATOM   7620  C CG  . HIS C  1 169 ? -62.21436 -38.37802  89.99071  1.000 50.06444  ? 149  HIS C CG  1 
ATOM   7621  N ND1 . HIS C  1 169 ? -62.21230 -38.80904  91.30159  1.000 43.97220  ? 149  HIS C ND1 1 
ATOM   7622  C CD2 . HIS C  1 169 ? -62.03360 -37.03283  90.03716  1.000 44.27484  ? 149  HIS C CD2 1 
ATOM   7623  C CE1 . HIS C  1 169 ? -62.01463 -37.77440  92.10230  1.000 52.95107  ? 149  HIS C CE1 1 
ATOM   7624  N NE2 . HIS C  1 169 ? -61.91141 -36.68257  91.36199  1.000 47.40255  ? 149  HIS C NE2 1 
ATOM   7625  N N   . VAL C  1 170 ? -64.38562 -37.64091  87.07885  1.000 56.35695  ? 150  VAL C N   1 
ATOM   7626  C CA  . VAL C  1 170 ? -65.04301 -36.36374  86.83574  1.000 57.78011  ? 150  VAL C CA  1 
ATOM   7627  C C   . VAL C  1 170 ? -66.52601 -36.57251  86.54716  1.000 60.60401  ? 150  VAL C C   1 
ATOM   7628  O O   . VAL C  1 170 ? -67.36733 -35.77396  86.97026  1.000 63.91684  ? 150  VAL C O   1 
ATOM   7629  C CB  . VAL C  1 170 ? -64.32166 -35.57605  85.71851  1.000 59.82819  ? 150  VAL C CB  1 
ATOM   7630  C CG1 . VAL C  1 170 ? -64.24522 -36.37277  84.43446  1.000 61.70112  ? 150  VAL C CG1 1 
ATOM   7631  C CG2 . VAL C  1 170 ? -65.01606 -34.23571  85.47380  1.000 58.80521  ? 150  VAL C CG2 1 
ATOM   7632  N N   . ASP C  1 171 ? -66.88144 -37.66630  85.87061  1.000 62.45911  ? 151  ASP C N   1 
ATOM   7633  C CA  . ASP C  1 171 ? -68.29544 -37.92462  85.61079  1.000 61.90011  ? 151  ASP C CA  1 
ATOM   7634  C C   . ASP C  1 171 ? -69.05153 -38.26066  86.88333  1.000 63.39101  ? 151  ASP C C   1 
ATOM   7635  O O   . ASP C  1 171 ? -70.24803 -37.96995  86.98392  1.000 65.38681  ? 151  ASP C O   1 
ATOM   7636  C CB  . ASP C  1 171 ? -68.46556 -39.04758  84.59368  1.000 62.96831  ? 151  ASP C CB  1 
ATOM   7637  C CG  . ASP C  1 171 ? -68.08620 -38.61427  83.19706  1.000 73.31513  ? 151  ASP C CG  1 
ATOM   7638  O OD1 . ASP C  1 171 ? -67.96531 -39.48681  82.31081  1.000 78.25227  ? 151  ASP C OD1 1 
ATOM   7639  O OD2 . ASP C  1 171 ? -67.90500 -37.39178  82.98899  1.000 75.71103  ? 151  ASP C OD2 1 
ATOM   7640  N N   . SER C  1 172 ? -68.38413 -38.84771  87.86840  1.000 62.29925  ? 152  SER C N   1 
ATOM   7641  C CA  . SER C  1 172 ? -69.06772 -39.24922  89.08848  1.000 60.57500  ? 152  SER C CA  1 
ATOM   7642  C C   . SER C  1 172 ? -69.18072 -38.13270  90.12157  1.000 58.06695  ? 152  SER C C   1 
ATOM   7643  O O   . SER C  1 172 ? -69.97082 -38.26184  91.06279  1.000 54.03234  ? 152  SER C O   1 
ATOM   7644  C CB  . SER C  1 172 ? -68.35054 -40.44353  89.71790  1.000 56.46324  ? 152  SER C CB  1 
ATOM   7645  O OG  . SER C  1 172 ? -67.13056 -40.02697  90.29369  1.000 56.67935  ? 152  SER C OG  1 
ATOM   7646  N N   . GLY C  1 173 ? -68.42085 -37.04812  89.98111  1.000 55.75880  ? 153  GLY C N   1 
ATOM   7647  C CA  . GLY C  1 173 ? -68.37959 -36.05889  91.04020  1.000 52.01753  ? 153  GLY C CA  1 
ATOM   7648  C C   . GLY C  1 173 ? -67.77151 -36.55719  92.33448  1.000 57.76946  ? 153  GLY C C   1 
ATOM   7649  O O   . GLY C  1 173 ? -68.05368 -35.99778  93.39481  1.000 66.82931  ? 153  GLY C O   1 
ATOM   7650  N N   . ALA C  1 174 ? -66.93783 -37.59354  92.28445  1.000 54.96601  ? 154  ALA C N   1 
ATOM   7651  C CA  . ALA C  1 174 ? -66.40002 -38.15409  93.51021  1.000 53.77160  ? 154  ALA C CA  1 
ATOM   7652  C C   . ALA C  1 174 ? -65.30130 -37.25917  94.08190  1.000 55.27475  ? 154  ALA C C   1 
ATOM   7653  O O   . ALA C  1 174 ? -64.69531 -36.45033  93.37748  1.000 52.05361  ? 154  ALA C O   1 
ATOM   7654  C CB  . ALA C  1 174 ? -65.85917 -39.56142  93.25465  1.000 52.95502  ? 154  ALA C CB  1 
ATOM   7655  N N   . ASP C  1 175 ? -65.05656 -37.40931  95.38981  1.000 58.95639  ? 155  ASP C N   1 
ATOM   7656  C CA  . ASP C  1 175 ? -63.88989 -36.78473  96.01342  1.000 53.87587  ? 155  ASP C CA  1 
ATOM   7657  C C   . ASP C  1 175 ? -62.62551 -37.61137  95.78182  1.000 50.25628  ? 155  ASP C C   1 
ATOM   7658  O O   . ASP C  1 175 ? -61.53755 -37.05336  95.60926  1.000 51.52595  ? 155  ASP C O   1 
ATOM   7659  C CB  . ASP C  1 175 ? -64.13277 -36.58487  97.51131  1.000 54.85116  ? 155  ASP C CB  1 
ATOM   7660  C CG  . ASP C  1 175 ? -65.28043 -35.63557  97.79754  1.000 62.01233  ? 155  ASP C CG  1 
ATOM   7661  O OD1 . ASP C  1 175 ? -65.56426 -34.76449  96.94584  1.000 65.01549  ? 155  ASP C OD1 1 
ATOM   7662  O OD2 . ASP C  1 175 ? -65.89323 -35.74776  98.88147  1.000 65.71668  ? 155  ASP C OD2 1 
ATOM   7663  N N   . VAL C  1 176 ? -62.74874 -38.93486  95.77836  1.000 47.32918  ? 156  VAL C N   1 
ATOM   7664  C CA  . VAL C  1 176 ? -61.66308 -39.81743  95.36323  1.000 49.89127  ? 156  VAL C CA  1 
ATOM   7665  C C   . VAL C  1 176 ? -62.26505 -41.01617  94.64448  1.000 50.89355  ? 156  VAL C C   1 
ATOM   7666  O O   . VAL C  1 176 ? -63.33913 -41.51369  95.00913  1.000 50.92404  ? 156  VAL C O   1 
ATOM   7667  C CB  . VAL C  1 176 ? -60.77939 -40.26807  96.54767  1.000 48.50693  ? 156  VAL C CB  1 
ATOM   7668  C CG1 . VAL C  1 176 ? -61.58242 -41.12239  97.54663  1.000 44.58281  ? 156  VAL C CG1 1 
ATOM   7669  C CG2 . VAL C  1 176 ? -59.57078 -41.02498  96.04053  1.000 44.06062  ? 156  VAL C CG2 1 
ATOM   7670  N N   . THR C  1 177 ? -61.57242 -41.44834  93.59727  1.000 47.39050  ? 157  THR C N   1 
ATOM   7671  C CA  . THR C  1 177 ? -61.90473 -42.64580  92.84679  1.000 43.02408  ? 157  THR C CA  1 
ATOM   7672  C C   . THR C  1 177 ? -60.77324 -43.63437  93.05198  1.000 41.78455  ? 157  THR C C   1 
ATOM   7673  O O   . THR C  1 177 ? -59.60343 -43.25968  92.93645  1.000 40.70980  ? 157  THR C O   1 
ATOM   7674  C CB  . THR C  1 177 ? -62.07398 -42.34051  91.36054  1.000 42.97915  ? 157  THR C CB  1 
ATOM   7675  O OG1 . THR C  1 177 ? -63.13022 -41.39047  91.17923  1.000 44.90635  ? 157  THR C OG1 1 
ATOM   7676  C CG2 . THR C  1 177 ? -62.40167 -43.60269  90.60201  1.000 43.01957  ? 157  THR C CG2 1 
ATOM   7677  N N   . ILE C  1 178 ? -61.12122 -44.88971  93.34086  1.000 43.19450  ? 158  ILE C N   1 
ATOM   7678  C CA  . ILE C  1 178 ? -60.18043 -45.88176  93.84258  1.000 41.15356  ? 158  ILE C CA  1 
ATOM   7679  C C   . ILE C  1 178 ? -60.20685 -47.09988  92.93237  1.000 44.72363  ? 158  ILE C C   1 
ATOM   7680  O O   . ILE C  1 178 ? -61.26966 -47.68468  92.70737  1.000 48.94809  ? 158  ILE C O   1 
ATOM   7681  C CB  . ILE C  1 178 ? -60.51665 -46.27101  95.29289  1.000 46.19742  ? 158  ILE C CB  1 
ATOM   7682  C CG1 . ILE C  1 178 ? -60.41540 -45.03001  96.18927  1.000 48.33617  ? 158  ILE C CG1 1 
ATOM   7683  C CG2 . ILE C  1 178 ? -59.59978 -47.39126  95.75951  1.000 41.17399  ? 158  ILE C CG2 1 
ATOM   7684  C CD1 . ILE C  1 178 ? -60.65356 -45.28896  97.64702  1.000 45.47845  ? 158  ILE C CD1 1 
ATOM   7685  N N   . GLY C  1 179 ? -59.03658 -47.48602  92.42514  1.000 39.56125  ? 159  GLY C N   1 
ATOM   7686  C CA  . GLY C  1 179 ? -58.93906 -48.66716  91.58361  1.000 41.47497  ? 159  GLY C CA  1 
ATOM   7687  C C   . GLY C  1 179 ? -59.00454 -49.94506  92.40697  1.000 42.57756  ? 159  GLY C C   1 
ATOM   7688  O O   . GLY C  1 179 ? -58.36348 -50.07061  93.44896  1.000 42.90837  ? 159  GLY C O   1 
ATOM   7689  N N   . CYS C  1 180 ? -59.77946 -50.90899  91.90881  1.000 40.22225  ? 160  CYS C N   1 
ATOM   7690  C CA  . CYS C  1 180 ? -60.08240 -52.12265  92.65016  1.000 40.83699  ? 160  CYS C CA  1 
ATOM   7691  C C   . CYS C  1 180 ? -60.07984 -53.32816  91.72451  1.000 41.78226  ? 160  CYS C C   1 
ATOM   7692  O O   . CYS C  1 180 ? -60.60415 -53.25942  90.60759  1.000 47.72518  ? 160  CYS C O   1 
ATOM   7693  C CB  . CYS C  1 180 ? -61.45433 -52.03434  93.34066  1.000 48.33544  ? 160  CYS C CB  1 
ATOM   7694  S SG  . CYS C  1 180 ? -61.61118 -50.75857  94.62770  1.000 49.57904  ? 160  CYS C SG  1 
ATOM   7695  N N   . LEU C  1 181 ? -59.51517 -54.43664  92.20287  1.000 40.47347  ? 161  LEU C N   1 
ATOM   7696  C CA  . LEU C  1 181 ? -59.65555 -55.71175  91.51624  1.000 41.56217  ? 161  LEU C CA  1 
ATOM   7697  C C   . LEU C  1 181 ? -60.91924 -56.45764  91.96245  1.000 47.67568  ? 161  LEU C C   1 
ATOM   7698  O O   . LEU C  1 181 ? -61.35249 -56.36552  93.11190  1.000 50.43012  ? 161  LEU C O   1 
ATOM   7699  C CB  . LEU C  1 181 ? -58.44353 -56.59667  91.76764  1.000 43.25473  ? 161  LEU C CB  1 
ATOM   7700  C CG  . LEU C  1 181 ? -57.05533 -55.97264  91.63968  1.000 43.68037  ? 161  LEU C CG  1 
ATOM   7701  C CD1 . LEU C  1 181 ? -56.09964 -56.69383  92.58684  1.000 40.33844  ? 161  LEU C CD1 1 
ATOM   7702  C CD2 . LEU C  1 181 ? -56.54353 -55.98502  90.18613  1.000 40.61206  ? 161  LEU C CD2 1 
ATOM   7703  N N   . GLU C  1 182 ? -61.50680 -57.20891  91.03452  1.000 52.38372  ? 162  GLU C N   1 
ATOM   7704  C CA  . GLU C  1 182 ? -62.61481 -58.11241  91.34687  1.000 53.07507  ? 162  GLU C CA  1 
ATOM   7705  C C   . GLU C  1 182 ? -62.00584 -59.45872  91.69663  1.000 51.44185  ? 162  GLU C C   1 
ATOM   7706  O O   . GLU C  1 182 ? -61.60668 -60.20920  90.80734  1.000 54.93912  ? 162  GLU C O   1 
ATOM   7707  C CB  . GLU C  1 182 ? -63.55946 -58.24979  90.16127  1.000 60.81772  ? 162  GLU C CB  1 
ATOM   7708  C CG  . GLU C  1 182 ? -64.11688 -56.94195  89.65784  1.000 71.38517  ? 162  GLU C CG  1 
ATOM   7709  C CD  . GLU C  1 182 ? -65.09356 -57.12540  88.51358  1.000 77.89350  ? 162  GLU C CD  1 
ATOM   7710  O OE1 . GLU C  1 182 ? -65.73746 -58.20440  88.44805  1.000 80.02182  ? 162  GLU C OE1 1 
ATOM   7711  O OE2 . GLU C  1 182 ? -65.22106 -56.17897  87.69834  1.000 76.66820  ? 162  GLU C OE2 1 
ATOM   7712  N N   . VAL C  1 183 ? -61.94034 -59.77521  92.98701  1.000 51.22686  ? 163  VAL C N   1 
ATOM   7713  C CA  . VAL C  1 183 ? -61.25825 -60.98675  93.45366  1.000 52.73340  ? 163  VAL C CA  1 
ATOM   7714  C C   . VAL C  1 183 ? -62.25982 -61.90483  94.15162  1.000 53.17949  ? 163  VAL C C   1 
ATOM   7715  O O   . VAL C  1 183 ? -63.16725 -61.41627  94.83642  1.000 53.87916  ? 163  VAL C O   1 
ATOM   7716  C CB  . VAL C  1 183 ? -60.07421 -60.62044  94.37152  1.000 55.56029  ? 163  VAL C CB  1 
ATOM   7717  C CG1 . VAL C  1 183 ? -60.51222 -59.60849  95.39527  1.000 60.08280  ? 163  VAL C CG1 1 
ATOM   7718  C CG2 . VAL C  1 183 ? -59.51068 -61.83092  95.07458  1.000 56.08713  ? 163  VAL C CG2 1 
ATOM   7719  N N   . PRO C  1 184 ? -62.16848 -63.22440  93.98163  1.000 55.53988  ? 164  PRO C N   1 
ATOM   7720  C CA  . PRO C  1 184 ? -62.99067 -64.12894  94.79806  1.000 55.48050  ? 164  PRO C CA  1 
ATOM   7721  C C   . PRO C  1 184 ? -62.77621 -63.83244  96.27365  1.000 56.49615  ? 164  PRO C C   1 
ATOM   7722  O O   . PRO C  1 184 ? -61.64385 -63.62156  96.71897  1.000 50.46805  ? 164  PRO C O   1 
ATOM   7723  C CB  . PRO C  1 184 ? -62.46895 -65.51574  94.42115  1.000 49.15344  ? 164  PRO C CB  1 
ATOM   7724  C CG  . PRO C  1 184 ? -61.88577 -65.34322  93.07143  1.000 47.80557  ? 164  PRO C CG  1 
ATOM   7725  C CD  . PRO C  1 184 ? -61.31749 -63.96114  93.03055  1.000 53.94279  ? 164  PRO C CD  1 
ATOM   7726  N N   . ARG C  1 185 ? -63.87304 -63.81973  97.04208  1.000 51.17905  ? 165  ARG C N   1 
ATOM   7727  C CA  . ARG C  1 185 ? -63.80196 -63.21308  98.37079  1.000 56.79149  ? 165  ARG C CA  1 
ATOM   7728  C C   . ARG C  1 185 ? -62.91003 -63.97478  99.33798  1.000 59.04669  ? 165  ARG C C   1 
ATOM   7729  O O   . ARG C  1 185 ? -62.37526 -63.37006  100.27319 1.000 63.43669  ? 165  ARG C O   1 
ATOM   7730  C CB  . ARG C  1 185 ? -65.18016 -63.08140  98.96938  1.000 64.20079  ? 165  ARG C CB  1 
ATOM   7731  C CG  . ARG C  1 185 ? -66.18562 -62.72250  97.96935  1.000 67.75301  ? 165  ARG C CG  1 
ATOM   7732  C CD  . ARG C  1 185 ? -67.48922 -63.15515  98.51690  1.000 73.01566  ? 165  ARG C CD  1 
ATOM   7733  N NE  . ARG C  1 185 ? -67.63925 -62.76333  99.90319  1.000 70.68355  ? 165  ARG C NE  1 
ATOM   7734  C CZ  . ARG C  1 185 ? -68.08513 -63.55552  100.85724 1.000 70.72441  ? 165  ARG C CZ  1 
ATOM   7735  N NH1 . ARG C  1 185 ? -68.45500 -64.80272  100.57752 1.000 72.99823  ? 165  ARG C NH1 1 
ATOM   7736  N NH2 . ARG C  1 185 ? -68.16899 -63.08052  102.08900 1.000 72.32249  ? 165  ARG C NH2 1 
ATOM   7737  N N   . MET C  1 186 ? -62.72638 -65.27918  99.15712  1.000 58.57876  ? 166  MET C N   1 
ATOM   7738  C CA  . MET C  1 186 ? -61.73615 -65.95163  99.99196  1.000 61.13516  ? 166  MET C CA  1 
ATOM   7739  C C   . MET C  1 186 ? -60.33741 -65.40393  99.74291  1.000 61.44566  ? 166  MET C C   1 
ATOM   7740  O O   . MET C  1 186 ? -59.56259 -65.21704  100.68593 1.000 61.44637  ? 166  MET C O   1 
ATOM   7741  C CB  . MET C  1 186 ? -61.74487 -67.45226  99.76542  1.000 62.22935  ? 166  MET C CB  1 
ATOM   7742  C CG  . MET C  1 186 ? -60.86705 -68.12343  100.77426 1.000 66.70156  ? 166  MET C CG  1 
ATOM   7743  S SD  . MET C  1 186 ? -61.33283 -69.81378  101.01242 1.000 77.20276  ? 166  MET C SD  1 
ATOM   7744  C CE  . MET C  1 186 ? -60.48536 -70.15386  102.55217 1.000 80.78387  ? 166  MET C CE  1 
ATOM   7745  N N   . GLU C  1 187 ? -59.99074 -65.14307  98.48036  1.000 61.57678  ? 167  GLU C N   1 
ATOM   7746  C CA  . GLU C  1 187 ? -58.68149 -64.56374  98.19420  1.000 61.25973  ? 167  GLU C CA  1 
ATOM   7747  C C   . GLU C  1 187 ? -58.59685 -63.10738  98.62249  1.000 56.59050  ? 167  GLU C C   1 
ATOM   7748  O O   . GLU C  1 187 ? -57.49586 -62.58294  98.78130  1.000 59.61857  ? 167  GLU C O   1 
ATOM   7749  C CB  . GLU C  1 187 ? -58.34827 -64.67377  96.70403  1.000 65.59648  ? 167  GLU C CB  1 
ATOM   7750  C CG  . GLU C  1 187 ? -58.39257 -66.09250  96.12594  1.000 74.58396  ? 167  GLU C CG  1 
ATOM   7751  C CD  . GLU C  1 187 ? -58.14324 -66.11162  94.61517  1.000 78.44808  ? 167  GLU C CD  1 
ATOM   7752  O OE1 . GLU C  1 187 ? -57.57828 -65.11960  94.08559  1.000 77.73907  ? 167  GLU C OE1 1 
ATOM   7753  O OE2 . GLU C  1 187 ? -58.52210 -67.11461  93.96219  1.000 79.23535  ? 167  GLU C OE2 1 
ATOM   7754  N N   . ALA C  1 188 ? -59.73027 -62.45000  98.81790  1.000 55.68860  ? 168  ALA C N   1 
ATOM   7755  C CA  . ALA C  1 188 ? -59.75545 -61.04233  99.17858  1.000 54.67789  ? 168  ALA C CA  1 
ATOM   7756  C C   . ALA C  1 188 ? -59.38884 -60.79198  100.63391 1.000 53.69062  ? 168  ALA C C   1 
ATOM   7757  O O   . ALA C  1 188 ? -59.19581 -59.63006  101.01398 1.000 50.70773  ? 168  ALA C O   1 
ATOM   7758  C CB  . ALA C  1 188 ? -61.14620 -60.45766  98.89902  1.000 47.02196  ? 168  ALA C CB  1 
ATOM   7759  N N   . THR C  1 189 ? -59.30618 -61.84219  101.45179 1.000 52.68580  ? 169  THR C N   1 
ATOM   7760  C CA  . THR C  1 189 ? -59.00473 -61.67959  102.86874 1.000 52.91000  ? 169  THR C CA  1 
ATOM   7761  C C   . THR C  1 189 ? -57.64988 -61.02156  103.10979 1.000 51.23378  ? 169  THR C C   1 
ATOM   7762  O O   . THR C  1 189 ? -57.43513 -60.44727  104.18402 1.000 52.66038  ? 169  THR C O   1 
ATOM   7763  C CB  . THR C  1 189 ? -59.03439 -63.04000  103.56342 1.000 50.71768  ? 169  THR C CB  1 
ATOM   7764  O OG1 . THR C  1 189 ? -58.12568 -63.90758  102.88540 1.000 54.15479  ? 169  THR C OG1 1 
ATOM   7765  C CG2 . THR C  1 189 ? -60.43113 -63.63657  103.51114 1.000 51.06656  ? 169  THR C CG2 1 
ATOM   7766  N N   . GLY C  1 190 ? -56.73497 -61.09219  102.14481 1.000 47.57629  ? 170  GLY C N   1 
ATOM   7767  C CA  . GLY C  1 190 ? -55.40821 -60.53102  102.31291 1.000 47.14527  ? 170  GLY C CA  1 
ATOM   7768  C C   . GLY C  1 190 ? -55.27689 -59.09146  101.85432 1.000 49.23010  ? 170  GLY C C   1 
ATOM   7769  O O   . GLY C  1 190 ? -54.16357 -58.58929  101.69927 1.000 51.65856  ? 170  GLY C O   1 
ATOM   7770  N N   . PHE C  1 191 ? -56.39733 -58.40086  101.67502 1.000 48.62239  ? 171  PHE C N   1 
ATOM   7771  C CA  . PHE C  1 191 ? -56.43814 -57.14936  100.93806 1.000 47.21970  ? 171  PHE C CA  1 
ATOM   7772  C C   . PHE C  1 191 ? -57.10385 -56.05990  101.76441 1.000 49.20466  ? 171  PHE C C   1 
ATOM   7773  O O   . PHE C  1 191 ? -57.77736 -56.31552  102.76950 1.000 51.33552  ? 171  PHE C O   1 
ATOM   7774  C CB  . PHE C  1 191 ? -57.22458 -57.32575  99.63943  1.000 44.60697  ? 171  PHE C CB  1 
ATOM   7775  C CG  . PHE C  1 191 ? -56.41883 -57.84452  98.49101  1.000 40.84520  ? 171  PHE C CG  1 
ATOM   7776  C CD1 . PHE C  1 191 ? -55.67922 -56.97557  97.70028  1.000 47.66836  ? 171  PHE C CD1 1 
ATOM   7777  C CD2 . PHE C  1 191 ? -56.41354 -59.19045  98.18419  1.000 42.58973  ? 171  PHE C CD2 1 
ATOM   7778  C CE1 . PHE C  1 191 ? -54.97077 -57.43616  96.61522  1.000 38.37537  ? 171  PHE C CE1 1 
ATOM   7779  C CE2 . PHE C  1 191 ? -55.67989 -59.67607  97.10910  1.000 43.28931  ? 171  PHE C CE2 1 
ATOM   7780  C CZ  . PHE C  1 191 ? -54.95937 -58.79163  96.32209  1.000 42.40278  ? 171  PHE C CZ  1 
ATOM   7781  N N   . GLY C  1 192 ? -56.92172 -54.82853  101.31007 1.000 48.52330  ? 172  GLY C N   1 
ATOM   7782  C CA  . GLY C  1 192 ? -57.79377 -53.75244  101.73315 1.000 54.07405  ? 172  GLY C CA  1 
ATOM   7783  C C   . GLY C  1 192 ? -59.02244 -53.81896  100.85413 1.000 54.13612  ? 172  GLY C C   1 
ATOM   7784  O O   . GLY C  1 192 ? -58.89706 -53.86098  99.62820  1.000 51.45086  ? 172  GLY C O   1 
ATOM   7785  N N   . VAL C  1 193 ? -60.21001 -53.88346  101.44028 1.000 51.91536  ? 173  VAL C N   1 
ATOM   7786  C CA  . VAL C  1 193 ? -61.39862 -54.24492  100.68763 1.000 48.50001  ? 173  VAL C CA  1 
ATOM   7787  C C   . VAL C  1 193 ? -62.39386 -53.11210  100.77453 1.000 51.99908  ? 173  VAL C C   1 
ATOM   7788  O O   . VAL C  1 193 ? -62.64674 -52.57808  101.86015 1.000 55.25584  ? 173  VAL C O   1 
ATOM   7789  C CB  . VAL C  1 193 ? -62.01407 -55.55982  101.19077 1.000 47.69568  ? 173  VAL C CB  1 
ATOM   7790  C CG1 . VAL C  1 193 ? -63.43470 -55.70566  100.68207 1.000 49.05626  ? 173  VAL C CG1 1 
ATOM   7791  C CG2 . VAL C  1 193 ? -61.13161 -56.73166  100.73757 1.000 46.75883  ? 173  VAL C CG2 1 
ATOM   7792  N N   . MET C  1 194 ? -62.95939 -52.76135  99.63276  1.000 50.14773  ? 174  MET C N   1 
ATOM   7793  C CA  . MET C  1 194 ? -63.91522 -51.67720  99.51371  1.000 50.16892  ? 174  MET C CA  1 
ATOM   7794  C C   . MET C  1 194 ? -65.31670 -52.28761  99.55916  1.000 54.75920  ? 174  MET C C   1 
ATOM   7795  O O   . MET C  1 194 ? -65.61592 -53.21123  98.78960  1.000 51.62550  ? 174  MET C O   1 
ATOM   7796  C CB  . MET C  1 194 ? -63.67790 -50.93622  98.20052  1.000 48.51067  ? 174  MET C CB  1 
ATOM   7797  C CG  . MET C  1 194 ? -62.42883 -50.05569  98.14979  1.000 55.88326  ? 174  MET C CG  1 
ATOM   7798  S SD  . MET C  1 194 ? -62.19879 -49.13957  99.68388  1.000 58.93067  ? 174  MET C SD  1 
ATOM   7799  C CE  . MET C  1 194 ? -60.43734 -48.85052  99.75948  1.000 53.69415  ? 174  MET C CE  1 
ATOM   7800  N N   . HIS C  1 195 ? -66.15489 -51.79881  100.47899 1.000 56.07017  ? 175  HIS C N   1 
ATOM   7801  C CA  . HIS C  1 195 ? -67.54316 -52.23057  100.59515 1.000 57.26750  ? 175  HIS C CA  1 
ATOM   7802  C C   . HIS C  1 195 ? -68.41165 -51.25780  99.81029  1.000 58.28122  ? 175  HIS C C   1 
ATOM   7803  O O   . HIS C  1 195 ? -68.46106 -50.06209  100.12584 1.000 57.96206  ? 175  HIS C O   1 
ATOM   7804  C CB  . HIS C  1 195 ? -67.97862 -52.28965  102.05656 1.000 58.23771  ? 175  HIS C CB  1 
ATOM   7805  C CG  . HIS C  1 195 ? -69.28906 -52.97599  102.26381 1.000 62.66360  ? 175  HIS C CG  1 
ATOM   7806  N ND1 . HIS C  1 195 ? -70.21906 -53.12046  101.25667 1.000 64.78153  ? 175  HIS C ND1 1 
ATOM   7807  C CD2 . HIS C  1 195 ? -69.82880 -53.55777  103.36085 1.000 64.82818  ? 175  HIS C CD2 1 
ATOM   7808  C CE1 . HIS C  1 195 ? -71.27696 -53.76007  101.72372 1.000 65.87784  ? 175  HIS C CE1 1 
ATOM   7809  N NE2 . HIS C  1 195 ? -71.06444 -54.03816  102.99752 1.000 66.87527  ? 175  HIS C NE2 1 
ATOM   7810  N N   . VAL C  1 196 ? -69.09951 -51.77326  98.80122  1.000 56.12206  ? 176  VAL C N   1 
ATOM   7811  C CA  . VAL C  1 196 ? -69.66502 -50.95395  97.74165  1.000 56.46660  ? 176  VAL C CA  1 
ATOM   7812  C C   . VAL C  1 196 ? -71.17081 -51.17018  97.68937  1.000 63.72354  ? 176  VAL C C   1 
ATOM   7813  O O   . VAL C  1 196 ? -71.67401 -52.24249  98.03904  1.000 63.25484  ? 176  VAL C O   1 
ATOM   7814  C CB  . VAL C  1 196 ? -68.97511 -51.30430  96.40343  1.000 54.33468  ? 176  VAL C CB  1 
ATOM   7815  C CG1 . VAL C  1 196 ? -69.91861 -51.96462  95.41762  1.000 54.10246  ? 176  VAL C CG1 1 
ATOM   7816  C CG2 . VAL C  1 196 ? -68.26718 -50.10088  95.81845  1.000 51.47891  ? 176  VAL C CG2 1 
ATOM   7817  N N   . ASN C  1 197 ? -71.89779 -50.13033  97.28049  1.000 64.57856  ? 177  ASN C N   1 
ATOM   7818  C CA  . ASN C  1 197 ? -73.31429 -50.26989  96.99640  1.000 64.91158  ? 177  ASN C CA  1 
ATOM   7819  C C   . ASN C  1 197 ? -73.51721 -50.50581  95.49711  1.000 62.77867  ? 177  ASN C C   1 
ATOM   7820  O O   . ASN C  1 197 ? -72.56633 -50.65460  94.72846  1.000 57.61356  ? 177  ASN C O   1 
ATOM   7821  C CB  . ASN C  1 197 ? -74.09515 -49.05672  97.52603  1.000 60.56935  ? 177  ASN C CB  1 
ATOM   7822  C CG  . ASN C  1 197 ? -73.83636 -47.79135  96.74007  1.000 63.54843  ? 177  ASN C CG  1 
ATOM   7823  O OD1 . ASN C  1 197 ? -73.29300 -47.82756  95.64534  1.000 64.09224  ? 177  ASN C OD1 1 
ATOM   7824  N ND2 . ASN C  1 197 ? -74.21421 -46.65051  97.31088  1.000 60.23089  ? 177  ASN C ND2 1 
ATOM   7825  N N   . GLU C  1 198 ? -74.77966 -50.52744  95.07156  1.000 63.75760  ? 178  GLU C N   1 
ATOM   7826  C CA  . GLU C  1 198 ? -75.06810 -50.82255  93.67553  1.000 62.60282  ? 178  GLU C CA  1 
ATOM   7827  C C   . GLU C  1 198 ? -74.70154 -49.67031  92.75749  1.000 60.45114  ? 178  GLU C C   1 
ATOM   7828  O O   . GLU C  1 198 ? -74.73165 -49.83934  91.53434  1.000 60.40363  ? 178  GLU C O   1 
ATOM   7829  C CB  . GLU C  1 198 ? -76.54149 -51.19070  93.52007  1.000 70.48144  ? 178  GLU C CB  1 
ATOM   7830  C CG  . GLU C  1 198 ? -76.89317 -52.50308  94.20566  1.000 75.88782  ? 178  GLU C CG  1 
ATOM   7831  C CD  . GLU C  1 198 ? -77.68482 -52.30603  95.49107  1.000 79.74435  ? 178  GLU C CD  1 
ATOM   7832  O OE1 . GLU C  1 198 ? -77.79252 -51.13902  95.95628  1.000 75.54400  ? 178  GLU C OE1 1 
ATOM   7833  O OE2 . GLU C  1 198 ? -78.19283 -53.32512  96.02886  1.000 82.45136  ? 178  GLU C OE2 1 
ATOM   7834  N N   . LYS C  1 199 ? -74.34543 -48.51798  93.31929  1.000 59.69901  ? 179  LYS C N   1 
ATOM   7835  C CA  . LYS C  1 199 ? -73.83635 -47.37917  92.56727  1.000 66.77194  ? 179  LYS C CA  1 
ATOM   7836  C C   . LYS C  1 199 ? -72.30519 -47.41337  92.49667  1.000 63.56925  ? 179  LYS C C   1 
ATOM   7837  O O   . LYS C  1 199 ? -71.69240 -46.55747  91.84559  1.000 59.70256  ? 179  LYS C O   1 
ATOM   7838  C CB  . LYS C  1 199 ? -74.35923 -46.07020  93.21655  1.000 71.64477  ? 179  LYS C CB  1 
ATOM   7839  C CG  . LYS C  1 199 ? -74.04154 -44.70997  92.51611  1.000 74.83503  ? 179  LYS C CG  1 
ATOM   7840  C CD  . LYS C  1 199 ? -74.34339 -43.55366  93.51503  1.000 76.81950  ? 179  LYS C CD  1 
ATOM   7841  C CE  . LYS C  1 199 ? -73.33216 -42.39551  93.54400  1.000 77.84101  ? 179  LYS C CE  1 
ATOM   7842  N NZ  . LYS C  1 199 ? -73.73714 -41.30834  94.52122  1.000 82.91886  ? 179  LYS C NZ  1 
ATOM   7843  N N   . ASP C  1 200 ? -71.69316 -48.42941  93.11363  1.000 61.20602  ? 180  ASP C N   1 
ATOM   7844  C CA  . ASP C  1 200 ? -70.24965 -48.56306  93.27406  1.000 61.38712  ? 180  ASP C CA  1 
ATOM   7845  C C   . ASP C  1 200 ? -69.65696 -47.45974  94.15403  1.000 62.26202  ? 180  ASP C C   1 
ATOM   7846  O O   . ASP C  1 200 ? -68.46556 -47.15608  94.05282  1.000 60.62228  ? 180  ASP C O   1 
ATOM   7847  C CB  . ASP C  1 200 ? -69.52443 -48.63435  91.92102  1.000 59.99285  ? 180  ASP C CB  1 
ATOM   7848  C CG  . ASP C  1 200 ? -69.10760 -50.05060  91.55742  1.000 62.32643  ? 180  ASP C CG  1 
ATOM   7849  O OD1 . ASP C  1 200 ? -69.37607 -50.97428  92.36348  1.000 64.08673  ? 180  ASP C OD1 1 
ATOM   7850  O OD2 . ASP C  1 200 ? -68.52212 -50.24670  90.46700  1.000 61.73144  ? 180  ASP C OD2 1 
ATOM   7851  N N   . GLU C  1 201 ? -70.45192 -46.87884  95.05705  1.000 63.12345  ? 181  GLU C N   1 
ATOM   7852  C CA  . GLU C  1 201 ? -69.88034 -46.01807  96.08172  1.000 60.23430  ? 181  GLU C CA  1 
ATOM   7853  C C   . GLU C  1 201 ? -69.33024 -46.83475  97.22205  1.000 57.28408  ? 181  GLU C C   1 
ATOM   7854  O O   . GLU C  1 201 ? -69.98504 -47.76085  97.71709  1.000 54.23767  ? 181  GLU C O   1 
ATOM   7855  C CB  . GLU C  1 201 ? -70.89048 -45.07931  96.71734  1.000 62.24118  ? 181  GLU C CB  1 
ATOM   7856  C CG  . GLU C  1 201 ? -71.81050 -44.39410  95.82288  1.000 71.58765  ? 181  GLU C CG  1 
ATOM   7857  C CD  . GLU C  1 201 ? -72.87533 -43.67253  96.62778  1.000 82.72200  ? 181  GLU C CD  1 
ATOM   7858  O OE1 . GLU C  1 201 ? -72.54628 -42.62812  97.25022  1.000 83.98774  ? 181  GLU C OE1 1 
ATOM   7859  O OE2 . GLU C  1 201 ? -74.01274 -44.19232  96.69305  1.000 84.73054  ? 181  GLU C OE2 1 
ATOM   7860  N N   . ILE C  1 202 ? -68.20424 -46.36693  97.74278  1.000 57.70391  ? 182  ILE C N   1 
ATOM   7861  C CA  . ILE C  1 202 ? -67.57535 -46.99446  98.89287  1.000 60.86308  ? 182  ILE C CA  1 
ATOM   7862  C C   . ILE C  1 202 ? -68.31217 -46.54781  100.15774 1.000 61.56089  ? 182  ILE C C   1 
ATOM   7863  O O   . ILE C  1 202 ? -68.25114 -45.38417  100.56101 1.000 53.12727  ? 182  ILE C O   1 
ATOM   7864  C CB  . ILE C  1 202 ? -66.08346 -46.66570  98.93539  1.000 55.25269  ? 182  ILE C CB  1 
ATOM   7865  C CG1 . ILE C  1 202 ? -65.52501 -46.85120  97.51612  1.000 51.50616  ? 182  ILE C CG1 1 
ATOM   7866  C CG2 . ILE C  1 202 ? -65.37726 -47.58362  99.91584  1.000 52.90427  ? 182  ILE C CG2 1 
ATOM   7867  C CD1 . ILE C  1 202 ? -64.09386 -46.42215  97.32634  1.000 50.41751  ? 182  ILE C CD1 1 
ATOM   7868  N N   . ILE C  1 203 ? -69.04889 -47.48019  100.76760 1.000 63.15790  ? 183  ILE C N   1 
ATOM   7869  C CA  . ILE C  1 203 ? -69.74585 -47.19827  102.01816 1.000 65.76899  ? 183  ILE C CA  1 
ATOM   7870  C C   . ILE C  1 203 ? -68.94591 -47.63161  103.23450 1.000 65.08496  ? 183  ILE C C   1 
ATOM   7871  O O   . ILE C  1 203 ? -69.28166 -47.22849  104.35904 1.000 66.87974  ? 183  ILE C O   1 
ATOM   7872  C CB  . ILE C  1 203 ? -71.13491 -47.87028  102.03631 1.000 63.81412  ? 183  ILE C CB  1 
ATOM   7873  C CG1 . ILE C  1 203 ? -70.98913 -49.37474  101.84376 1.000 59.24709  ? 183  ILE C CG1 1 
ATOM   7874  C CG2 . ILE C  1 203 ? -72.02586 -47.27124  100.95142 1.000 58.68122  ? 183  ILE C CG2 1 
ATOM   7875  C CD1 . ILE C  1 203 ? -72.28282 -50.07795  101.56149 1.000 60.60681  ? 183  ILE C CD1 1 
ATOM   7876  N N   . ASP C  1 204 ? -67.90170 -48.43519  103.04757 1.000 62.49851  ? 184  ASP C N   1 
ATOM   7877  C CA  . ASP C  1 204 ? -66.99515 -48.79636  104.12488 1.000 62.03135  ? 184  ASP C CA  1 
ATOM   7878  C C   . ASP C  1 204 ? -65.68752 -49.28903  103.50809 1.000 63.19354  ? 184  ASP C C   1 
ATOM   7879  O O   . ASP C  1 204 ? -65.63983 -49.71007  102.34572 1.000 57.16040  ? 184  ASP C O   1 
ATOM   7880  C CB  . ASP C  1 204 ? -67.62176 -49.85304  105.04723 1.000 62.54135  ? 184  ASP C CB  1 
ATOM   7881  C CG  . ASP C  1 204 ? -66.88390 -49.99120  106.37164 1.000 71.07028  ? 184  ASP C CG  1 
ATOM   7882  O OD1 . ASP C  1 204 ? -65.99237 -49.16290  106.65958 1.000 73.57221  ? 184  ASP C OD1 1 
ATOM   7883  O OD2 . ASP C  1 204 ? -67.18980 -50.94116  107.12814 1.000 76.24975  ? 184  ASP C OD2 1 
ATOM   7884  N N   . PHE C  1 205 ? -64.62013 -49.20430  104.29752 1.000 62.92160  ? 185  PHE C N   1 
ATOM   7885  C CA  . PHE C  1 205 ? -63.33632 -49.78909  103.95287 1.000 60.09932  ? 185  PHE C CA  1 
ATOM   7886  C C   . PHE C  1 205 ? -62.86648 -50.61558  105.13944 1.000 59.96833  ? 185  PHE C C   1 
ATOM   7887  O O   . PHE C  1 205 ? -63.00241 -50.18015  106.28682 1.000 67.06939  ? 185  PHE C O   1 
ATOM   7888  C CB  . PHE C  1 205 ? -62.30027 -48.70364  103.59899 1.000 58.58744  ? 185  PHE C CB  1 
ATOM   7889  C CG  . PHE C  1 205 ? -60.87014 -49.18578  103.64531 1.000 60.68690  ? 185  PHE C CG  1 
ATOM   7890  C CD1 . PHE C  1 205 ? -60.44200 -50.21397  102.82708 1.000 61.03412  ? 185  PHE C CD1 1 
ATOM   7891  C CD2 . PHE C  1 205 ? -59.95445 -48.60460  104.50388 1.000 66.58269  ? 185  PHE C CD2 1 
ATOM   7892  C CE1 . PHE C  1 205 ? -59.13076 -50.66295  102.86857 1.000 64.01730  ? 185  PHE C CE1 1 
ATOM   7893  C CE2 . PHE C  1 205 ? -58.63975 -49.04508  104.54665 1.000 69.15068  ? 185  PHE C CE2 1 
ATOM   7894  C CZ  . PHE C  1 205 ? -58.22848 -50.07753  103.72718 1.000 66.27151  ? 185  PHE C CZ  1 
ATOM   7895  N N   . ILE C  1 206 ? -62.32991 -51.81091  104.86753 1.000 52.83148  ? 186  ILE C N   1 
ATOM   7896  C CA  . ILE C  1 206 ? -61.87613 -52.72848  105.90779 1.000 50.57918  ? 186  ILE C CA  1 
ATOM   7897  C C   . ILE C  1 206 ? -60.50199 -53.25495  105.53676 1.000 50.70670  ? 186  ILE C C   1 
ATOM   7898  O O   . ILE C  1 206 ? -60.29647 -53.73514  104.41488 1.000 52.61247  ? 186  ILE C O   1 
ATOM   7899  C CB  . ILE C