data_6V9A
# 
_entry.id   6V9A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.336 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6V9A         
WWPDB D_1000245871 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6V9A 
_pdbx_database_status.recvd_initial_deposition_date   2019-12-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zheng, Y.'       1 ? 
'Alghamdi, M.A.'  2 ? 
'Ballicora, M.A.' 3 ? 
'Liu, D.'         4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
;Site directed mutagenesis of Serine-72 reveals  the location of the fructose 6-phosphate regulatory site of the  Agrobacterium tumefaciens ADP-glucose pyrophosphorylase
;
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Alghamdi, M.A.'  1 ? 
primary 'Hussien, R.'     2 ? 
primary 'Zheng, Y.'       3 ? 
primary 'Patel, H.P.'     4 ? 
primary 'Iglesias, A.A.'  5 ? 
primary 'Liu, D.'         6 ? 
primary 'Ballicora, M.A.' 7 ? 
# 
_cell.angle_alpha                  107.998 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   101.626 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.019 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6V9A 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     92.231 
_cell.length_a_esd                 ? 
_cell.length_b                     141.404 
_cell.length_b_esd                 ? 
_cell.length_c                     228.648 
_cell.length_c_esd                 ? 
_cell.volume                       2771591.561 
_cell.volume_esd                   ? 
_cell.Z_PDB                        20 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6V9A 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            'P 1' 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucose-1-phosphate adenylyltransferase' 49300.516 20   2.7.7.27 S72D ? ? 
2 non-polymer syn 'CITRIC ACID'                             192.124   20   ?        ?    ? ? 
3 non-polymer syn GLYCEROL                                  92.094    22   ?        ?    ? ? 
4 water       nat water                                     18.015    3971 ?        ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ADP-glucose pyrophosphorylase,ADPGlc PPase,ADP-glucose synthase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMSEKRVQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIR
RIGVATQYKAHDLIRHLQRGWDFFRPERNESFDILPASQRVSETQWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKM
DYEYMLQQHVDSGADVTIGCLEVPRMEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFLMEAL
RRDAADPTSSRDFGKDIIPYIVEHGKAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPIW
TYAEITPPAKFVHDDEDRRGSAVSSVVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHG
VVIPEGLIVGEDPELDAKRFRRTESGICLITQSMIDKLDL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMSEKRVQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIR
RIGVATQYKAHDLIRHLQRGWDFFRPERNESFDILPASQRVSETQWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKM
DYEYMLQQHVDSGADVTIGCLEVPRMEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFLMEAL
RRDAADPTSSRDFGKDIIPYIVEHGKAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPIW
TYAEITPPAKFVHDDEDRRGSAVSSVVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHG
VVIPEGLIVGEDPELDAKRFRRTESGICLITQSMIDKLDL
;
_entity_poly.pdbx_strand_id                 H,A,B,C,D,E,F,G,I,J,K,L,M,N,O,P,Q,R,V,T 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  SER n 
1 23  GLU n 
1 24  LYS n 
1 25  ARG n 
1 26  VAL n 
1 27  GLN n 
1 28  PRO n 
1 29  LEU n 
1 30  ALA n 
1 31  ARG n 
1 32  ASP n 
1 33  ALA n 
1 34  MET n 
1 35  ALA n 
1 36  TYR n 
1 37  VAL n 
1 38  LEU n 
1 39  ALA n 
1 40  GLY n 
1 41  GLY n 
1 42  ARG n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  LEU n 
1 47  LYS n 
1 48  GLU n 
1 49  LEU n 
1 50  THR n 
1 51  ASP n 
1 52  ARG n 
1 53  ARG n 
1 54  ALA n 
1 55  LYS n 
1 56  PRO n 
1 57  ALA n 
1 58  VAL n 
1 59  TYR n 
1 60  PHE n 
1 61  GLY n 
1 62  GLY n 
1 63  LYS n 
1 64  ALA n 
1 65  ARG n 
1 66  ILE n 
1 67  ILE n 
1 68  ASP n 
1 69  PHE n 
1 70  ALA n 
1 71  LEU n 
1 72  SER n 
1 73  ASN n 
1 74  ALA n 
1 75  LEU n 
1 76  ASN n 
1 77  SER n 
1 78  GLY n 
1 79  ILE n 
1 80  ARG n 
1 81  ARG n 
1 82  ILE n 
1 83  GLY n 
1 84  VAL n 
1 85  ALA n 
1 86  THR n 
1 87  GLN n 
1 88  TYR n 
1 89  LYS n 
1 90  ALA n 
1 91  HIS n 
1 92  ASP n 
1 93  LEU n 
1 94  ILE n 
1 95  ARG n 
1 96  HIS n 
1 97  LEU n 
1 98  GLN n 
1 99  ARG n 
1 100 GLY n 
1 101 TRP n 
1 102 ASP n 
1 103 PHE n 
1 104 PHE n 
1 105 ARG n 
1 106 PRO n 
1 107 GLU n 
1 108 ARG n 
1 109 ASN n 
1 110 GLU n 
1 111 SER n 
1 112 PHE n 
1 113 ASP n 
1 114 ILE n 
1 115 LEU n 
1 116 PRO n 
1 117 ALA n 
1 118 SER n 
1 119 GLN n 
1 120 ARG n 
1 121 VAL n 
1 122 SER n 
1 123 GLU n 
1 124 THR n 
1 125 GLN n 
1 126 TRP n 
1 127 TYR n 
1 128 GLU n 
1 129 GLY n 
1 130 THR n 
1 131 ALA n 
1 132 ASP n 
1 133 ALA n 
1 134 VAL n 
1 135 TYR n 
1 136 GLN n 
1 137 ASN n 
1 138 ILE n 
1 139 ASP n 
1 140 ILE n 
1 141 ILE n 
1 142 GLU n 
1 143 PRO n 
1 144 TYR n 
1 145 ALA n 
1 146 PRO n 
1 147 GLU n 
1 148 TYR n 
1 149 MET n 
1 150 VAL n 
1 151 ILE n 
1 152 LEU n 
1 153 ALA n 
1 154 GLY n 
1 155 ASP n 
1 156 HIS n 
1 157 ILE n 
1 158 TYR n 
1 159 LYS n 
1 160 MET n 
1 161 ASP n 
1 162 TYR n 
1 163 GLU n 
1 164 TYR n 
1 165 MET n 
1 166 LEU n 
1 167 GLN n 
1 168 GLN n 
1 169 HIS n 
1 170 VAL n 
1 171 ASP n 
1 172 SER n 
1 173 GLY n 
1 174 ALA n 
1 175 ASP n 
1 176 VAL n 
1 177 THR n 
1 178 ILE n 
1 179 GLY n 
1 180 CYS n 
1 181 LEU n 
1 182 GLU n 
1 183 VAL n 
1 184 PRO n 
1 185 ARG n 
1 186 MET n 
1 187 GLU n 
1 188 ALA n 
1 189 THR n 
1 190 GLY n 
1 191 PHE n 
1 192 GLY n 
1 193 VAL n 
1 194 MET n 
1 195 HIS n 
1 196 VAL n 
1 197 ASN n 
1 198 GLU n 
1 199 LYS n 
1 200 ASP n 
1 201 GLU n 
1 202 ILE n 
1 203 ILE n 
1 204 ASP n 
1 205 PHE n 
1 206 ILE n 
1 207 GLU n 
1 208 LYS n 
1 209 PRO n 
1 210 ALA n 
1 211 ASP n 
1 212 PRO n 
1 213 PRO n 
1 214 GLY n 
1 215 ILE n 
1 216 PRO n 
1 217 GLY n 
1 218 ASN n 
1 219 GLU n 
1 220 GLY n 
1 221 PHE n 
1 222 ALA n 
1 223 LEU n 
1 224 ALA n 
1 225 SER n 
1 226 MET n 
1 227 GLY n 
1 228 ILE n 
1 229 TYR n 
1 230 VAL n 
1 231 PHE n 
1 232 HIS n 
1 233 THR n 
1 234 LYS n 
1 235 PHE n 
1 236 LEU n 
1 237 MET n 
1 238 GLU n 
1 239 ALA n 
1 240 LEU n 
1 241 ARG n 
1 242 ARG n 
1 243 ASP n 
1 244 ALA n 
1 245 ALA n 
1 246 ASP n 
1 247 PRO n 
1 248 THR n 
1 249 SER n 
1 250 SER n 
1 251 ARG n 
1 252 ASP n 
1 253 PHE n 
1 254 GLY n 
1 255 LYS n 
1 256 ASP n 
1 257 ILE n 
1 258 ILE n 
1 259 PRO n 
1 260 TYR n 
1 261 ILE n 
1 262 VAL n 
1 263 GLU n 
1 264 HIS n 
1 265 GLY n 
1 266 LYS n 
1 267 ALA n 
1 268 VAL n 
1 269 ALA n 
1 270 HIS n 
1 271 ARG n 
1 272 PHE n 
1 273 ALA n 
1 274 ASP n 
1 275 SER n 
1 276 CYS n 
1 277 VAL n 
1 278 ARG n 
1 279 SER n 
1 280 ASP n 
1 281 PHE n 
1 282 GLU n 
1 283 HIS n 
1 284 GLU n 
1 285 PRO n 
1 286 TYR n 
1 287 TRP n 
1 288 ARG n 
1 289 ASP n 
1 290 VAL n 
1 291 GLY n 
1 292 THR n 
1 293 ILE n 
1 294 ASP n 
1 295 ALA n 
1 296 TYR n 
1 297 TRP n 
1 298 GLN n 
1 299 ALA n 
1 300 ASN n 
1 301 ILE n 
1 302 ASP n 
1 303 LEU n 
1 304 THR n 
1 305 ASP n 
1 306 VAL n 
1 307 VAL n 
1 308 PRO n 
1 309 ASP n 
1 310 LEU n 
1 311 ASP n 
1 312 ILE n 
1 313 TYR n 
1 314 ASP n 
1 315 LYS n 
1 316 SER n 
1 317 TRP n 
1 318 PRO n 
1 319 ILE n 
1 320 TRP n 
1 321 THR n 
1 322 TYR n 
1 323 ALA n 
1 324 GLU n 
1 325 ILE n 
1 326 THR n 
1 327 PRO n 
1 328 PRO n 
1 329 ALA n 
1 330 LYS n 
1 331 PHE n 
1 332 VAL n 
1 333 HIS n 
1 334 ASP n 
1 335 ASP n 
1 336 GLU n 
1 337 ASP n 
1 338 ARG n 
1 339 ARG n 
1 340 GLY n 
1 341 SER n 
1 342 ALA n 
1 343 VAL n 
1 344 SER n 
1 345 SER n 
1 346 VAL n 
1 347 VAL n 
1 348 SER n 
1 349 GLY n 
1 350 ASP n 
1 351 CYS n 
1 352 ILE n 
1 353 ILE n 
1 354 SER n 
1 355 GLY n 
1 356 ALA n 
1 357 ALA n 
1 358 LEU n 
1 359 ASN n 
1 360 ARG n 
1 361 SER n 
1 362 LEU n 
1 363 LEU n 
1 364 PHE n 
1 365 THR n 
1 366 GLY n 
1 367 VAL n 
1 368 ARG n 
1 369 ALA n 
1 370 ASN n 
1 371 SER n 
1 372 TYR n 
1 373 SER n 
1 374 ARG n 
1 375 LEU n 
1 376 GLU n 
1 377 ASN n 
1 378 ALA n 
1 379 VAL n 
1 380 VAL n 
1 381 LEU n 
1 382 PRO n 
1 383 SER n 
1 384 VAL n 
1 385 LYS n 
1 386 ILE n 
1 387 GLY n 
1 388 ARG n 
1 389 HIS n 
1 390 ALA n 
1 391 GLN n 
1 392 LEU n 
1 393 SER n 
1 394 ASN n 
1 395 VAL n 
1 396 VAL n 
1 397 ILE n 
1 398 ASP n 
1 399 HIS n 
1 400 GLY n 
1 401 VAL n 
1 402 VAL n 
1 403 ILE n 
1 404 PRO n 
1 405 GLU n 
1 406 GLY n 
1 407 LEU n 
1 408 ILE n 
1 409 VAL n 
1 410 GLY n 
1 411 GLU n 
1 412 ASP n 
1 413 PRO n 
1 414 GLU n 
1 415 LEU n 
1 416 ASP n 
1 417 ALA n 
1 418 LYS n 
1 419 ARG n 
1 420 PHE n 
1 421 ARG n 
1 422 ARG n 
1 423 THR n 
1 424 GLU n 
1 425 SER n 
1 426 GLY n 
1 427 ILE n 
1 428 CYS n 
1 429 LEU n 
1 430 ILE n 
1 431 THR n 
1 432 GLN n 
1 433 SER n 
1 434 MET n 
1 435 ILE n 
1 436 ASP n 
1 437 LYS n 
1 438 LEU n 
1 439 ASP n 
1 440 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   440 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'glgC, Atu4076, AGR_L_1560' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'C58 / ATCC 33970' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Agrobacterium fabrum (strain C58 / ATCC 33970)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     176299 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GLGC_AGRFC 
_struct_ref.pdbx_db_accession          Q8U8L5 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSEKRVQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRG
WDFFRPERNESFDILPASQRVSETQWYEGTADAVYQNIDIIEPYAPEYMVILAGDHIYKMDYEYMLQQHVDSGADVTIGC
LEVPRMEATGFGVMHVNEKDEIIDFIEKPADPPGIPGNEGFALASMGIYVFHTKFLMEALRRDAADPTSSRDFGKDIIPY
IVEHGKAVAHRFADSCVRSDFEHEPYWRDVGTIDAYWQANIDLTDVVPDLDIYDKSWPIWTYAEITPPAKFVHDDEDRRG
SAVSSVVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLSNVVIDHGVVIPEGLIVGEDPELDAKRF
RRTESGICLITQSMIDKLDL
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6V9A H 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
2  1 6V9A A 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
3  1 6V9A B 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
4  1 6V9A C 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
5  1 6V9A D 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
6  1 6V9A E 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
7  1 6V9A F 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
8  1 6V9A G 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
9  1 6V9A I 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
10 1 6V9A J 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
11 1 6V9A K 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
12 1 6V9A L 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
13 1 6V9A M 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
14 1 6V9A N 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
15 1 6V9A O 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
16 1 6V9A P 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
17 1 6V9A Q 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
18 1 6V9A R 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
19 1 6V9A V 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
20 1 6V9A T 21 ? 440 ? Q8U8L5 1 ? 420 ? 1 420 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  6V9A MET H 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 1   
1  6V9A GLY H 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 2   
1  6V9A SER H 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 3   
1  6V9A SER H 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 4   
1  6V9A HIS H 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 5   
1  6V9A HIS H 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 6   
1  6V9A HIS H 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 7   
1  6V9A HIS H 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 8   
1  6V9A HIS H 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 9   
1  6V9A HIS H 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 10  
1  6V9A SER H 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  11  
1  6V9A SER H 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  12  
1  6V9A GLY H 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  13  
1  6V9A LEU H 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  14  
1  6V9A VAL H 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  15  
1  6V9A PRO H 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  16  
1  6V9A ARG H 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  17  
1  6V9A GLY H 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  18  
1  6V9A SER H 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  19  
1  6V9A HIS H 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   20  
1  6V9A ASP H 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  21  
2  6V9A MET A 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 22  
2  6V9A GLY A 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 23  
2  6V9A SER A 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 24  
2  6V9A SER A 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 25  
2  6V9A HIS A 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 26  
2  6V9A HIS A 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 27  
2  6V9A HIS A 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 28  
2  6V9A HIS A 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 29  
2  6V9A HIS A 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 30  
2  6V9A HIS A 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 31  
2  6V9A SER A 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  32  
2  6V9A SER A 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  33  
2  6V9A GLY A 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  34  
2  6V9A LEU A 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  35  
2  6V9A VAL A 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  36  
2  6V9A PRO A 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  37  
2  6V9A ARG A 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  38  
2  6V9A GLY A 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  39  
2  6V9A SER A 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  40  
2  6V9A HIS A 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   41  
2  6V9A ASP A 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  42  
3  6V9A MET B 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 43  
3  6V9A GLY B 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 44  
3  6V9A SER B 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 45  
3  6V9A SER B 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 46  
3  6V9A HIS B 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 47  
3  6V9A HIS B 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 48  
3  6V9A HIS B 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 49  
3  6V9A HIS B 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 50  
3  6V9A HIS B 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 51  
3  6V9A HIS B 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 52  
3  6V9A SER B 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  53  
3  6V9A SER B 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  54  
3  6V9A GLY B 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  55  
3  6V9A LEU B 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  56  
3  6V9A VAL B 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  57  
3  6V9A PRO B 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  58  
3  6V9A ARG B 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  59  
3  6V9A GLY B 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  60  
3  6V9A SER B 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  61  
3  6V9A HIS B 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   62  
3  6V9A ASP B 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  63  
4  6V9A MET C 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 64  
4  6V9A GLY C 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 65  
4  6V9A SER C 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 66  
4  6V9A SER C 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 67  
4  6V9A HIS C 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 68  
4  6V9A HIS C 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 69  
4  6V9A HIS C 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 70  
4  6V9A HIS C 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 71  
4  6V9A HIS C 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 72  
4  6V9A HIS C 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 73  
4  6V9A SER C 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  74  
4  6V9A SER C 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  75  
4  6V9A GLY C 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  76  
4  6V9A LEU C 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  77  
4  6V9A VAL C 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  78  
4  6V9A PRO C 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  79  
4  6V9A ARG C 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  80  
4  6V9A GLY C 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  81  
4  6V9A SER C 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  82  
4  6V9A HIS C 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   83  
4  6V9A ASP C 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  84  
5  6V9A MET D 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 85  
5  6V9A GLY D 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 86  
5  6V9A SER D 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 87  
5  6V9A SER D 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 88  
5  6V9A HIS D 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 89  
5  6V9A HIS D 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 90  
5  6V9A HIS D 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 91  
5  6V9A HIS D 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 92  
5  6V9A HIS D 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 93  
5  6V9A HIS D 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 94  
5  6V9A SER D 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  95  
5  6V9A SER D 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  96  
5  6V9A GLY D 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  97  
5  6V9A LEU D 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  98  
5  6V9A VAL D 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  99  
5  6V9A PRO D 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  100 
5  6V9A ARG D 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  101 
5  6V9A GLY D 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  102 
5  6V9A SER D 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  103 
5  6V9A HIS D 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   104 
5  6V9A ASP D 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  105 
6  6V9A MET E 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 106 
6  6V9A GLY E 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 107 
6  6V9A SER E 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 108 
6  6V9A SER E 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 109 
6  6V9A HIS E 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 110 
6  6V9A HIS E 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 111 
6  6V9A HIS E 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 112 
6  6V9A HIS E 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 113 
6  6V9A HIS E 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 114 
6  6V9A HIS E 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 115 
6  6V9A SER E 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  116 
6  6V9A SER E 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  117 
6  6V9A GLY E 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  118 
6  6V9A LEU E 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  119 
6  6V9A VAL E 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  120 
6  6V9A PRO E 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  121 
6  6V9A ARG E 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  122 
6  6V9A GLY E 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  123 
6  6V9A SER E 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  124 
6  6V9A HIS E 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   125 
6  6V9A ASP E 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  126 
7  6V9A MET F 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 127 
7  6V9A GLY F 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 128 
7  6V9A SER F 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 129 
7  6V9A SER F 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 130 
7  6V9A HIS F 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 131 
7  6V9A HIS F 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 132 
7  6V9A HIS F 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 133 
7  6V9A HIS F 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 134 
7  6V9A HIS F 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 135 
7  6V9A HIS F 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 136 
7  6V9A SER F 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  137 
7  6V9A SER F 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  138 
7  6V9A GLY F 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  139 
7  6V9A LEU F 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  140 
7  6V9A VAL F 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  141 
7  6V9A PRO F 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  142 
7  6V9A ARG F 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  143 
7  6V9A GLY F 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  144 
7  6V9A SER F 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  145 
7  6V9A HIS F 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   146 
7  6V9A ASP F 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  147 
8  6V9A MET G 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 148 
8  6V9A GLY G 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 149 
8  6V9A SER G 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 150 
8  6V9A SER G 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 151 
8  6V9A HIS G 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 152 
8  6V9A HIS G 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 153 
8  6V9A HIS G 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 154 
8  6V9A HIS G 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 155 
8  6V9A HIS G 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 156 
8  6V9A HIS G 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 157 
8  6V9A SER G 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  158 
8  6V9A SER G 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  159 
8  6V9A GLY G 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  160 
8  6V9A LEU G 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  161 
8  6V9A VAL G 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  162 
8  6V9A PRO G 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  163 
8  6V9A ARG G 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  164 
8  6V9A GLY G 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  165 
8  6V9A SER G 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  166 
8  6V9A HIS G 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   167 
8  6V9A ASP G 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  168 
9  6V9A MET I 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 169 
9  6V9A GLY I 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 170 
9  6V9A SER I 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 171 
9  6V9A SER I 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 172 
9  6V9A HIS I 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 173 
9  6V9A HIS I 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 174 
9  6V9A HIS I 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 175 
9  6V9A HIS I 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 176 
9  6V9A HIS I 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 177 
9  6V9A HIS I 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 178 
9  6V9A SER I 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  179 
9  6V9A SER I 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  180 
9  6V9A GLY I 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  181 
9  6V9A LEU I 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  182 
9  6V9A VAL I 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  183 
9  6V9A PRO I 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  184 
9  6V9A ARG I 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  185 
9  6V9A GLY I 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  186 
9  6V9A SER I 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  187 
9  6V9A HIS I 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   188 
9  6V9A ASP I 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  189 
10 6V9A MET J 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 190 
10 6V9A GLY J 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 191 
10 6V9A SER J 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 192 
10 6V9A SER J 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 193 
10 6V9A HIS J 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 194 
10 6V9A HIS J 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 195 
10 6V9A HIS J 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 196 
10 6V9A HIS J 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 197 
10 6V9A HIS J 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 198 
10 6V9A HIS J 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 199 
10 6V9A SER J 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  200 
10 6V9A SER J 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  201 
10 6V9A GLY J 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  202 
10 6V9A LEU J 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  203 
10 6V9A VAL J 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  204 
10 6V9A PRO J 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  205 
10 6V9A ARG J 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  206 
10 6V9A GLY J 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  207 
10 6V9A SER J 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  208 
10 6V9A HIS J 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   209 
10 6V9A ASP J 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  210 
11 6V9A MET K 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 211 
11 6V9A GLY K 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 212 
11 6V9A SER K 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 213 
11 6V9A SER K 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 214 
11 6V9A HIS K 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 215 
11 6V9A HIS K 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 216 
11 6V9A HIS K 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 217 
11 6V9A HIS K 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 218 
11 6V9A HIS K 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 219 
11 6V9A HIS K 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 220 
11 6V9A SER K 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  221 
11 6V9A SER K 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  222 
11 6V9A GLY K 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  223 
11 6V9A LEU K 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  224 
11 6V9A VAL K 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  225 
11 6V9A PRO K 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  226 
11 6V9A ARG K 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  227 
11 6V9A GLY K 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  228 
11 6V9A SER K 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  229 
11 6V9A HIS K 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   230 
11 6V9A ASP K 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  231 
12 6V9A MET L 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 232 
12 6V9A GLY L 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 233 
12 6V9A SER L 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 234 
12 6V9A SER L 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 235 
12 6V9A HIS L 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 236 
12 6V9A HIS L 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 237 
12 6V9A HIS L 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 238 
12 6V9A HIS L 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 239 
12 6V9A HIS L 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 240 
12 6V9A HIS L 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 241 
12 6V9A SER L 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  242 
12 6V9A SER L 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  243 
12 6V9A GLY L 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  244 
12 6V9A LEU L 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  245 
12 6V9A VAL L 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  246 
12 6V9A PRO L 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  247 
12 6V9A ARG L 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  248 
12 6V9A GLY L 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  249 
12 6V9A SER L 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  250 
12 6V9A HIS L 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   251 
12 6V9A ASP L 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  252 
13 6V9A MET M 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 253 
13 6V9A GLY M 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 254 
13 6V9A SER M 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 255 
13 6V9A SER M 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 256 
13 6V9A HIS M 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 257 
13 6V9A HIS M 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 258 
13 6V9A HIS M 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 259 
13 6V9A HIS M 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 260 
13 6V9A HIS M 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 261 
13 6V9A HIS M 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 262 
13 6V9A SER M 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  263 
13 6V9A SER M 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  264 
13 6V9A GLY M 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  265 
13 6V9A LEU M 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  266 
13 6V9A VAL M 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  267 
13 6V9A PRO M 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  268 
13 6V9A ARG M 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  269 
13 6V9A GLY M 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  270 
13 6V9A SER M 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  271 
13 6V9A HIS M 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   272 
13 6V9A ASP M 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  273 
14 6V9A MET N 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 274 
14 6V9A GLY N 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 275 
14 6V9A SER N 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 276 
14 6V9A SER N 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 277 
14 6V9A HIS N 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 278 
14 6V9A HIS N 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 279 
14 6V9A HIS N 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 280 
14 6V9A HIS N 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 281 
14 6V9A HIS N 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 282 
14 6V9A HIS N 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 283 
14 6V9A SER N 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  284 
14 6V9A SER N 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  285 
14 6V9A GLY N 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  286 
14 6V9A LEU N 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  287 
14 6V9A VAL N 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  288 
14 6V9A PRO N 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  289 
14 6V9A ARG N 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  290 
14 6V9A GLY N 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  291 
14 6V9A SER N 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  292 
14 6V9A HIS N 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   293 
14 6V9A ASP N 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  294 
15 6V9A MET O 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 295 
15 6V9A GLY O 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 296 
15 6V9A SER O 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 297 
15 6V9A SER O 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 298 
15 6V9A HIS O 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 299 
15 6V9A HIS O 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 300 
15 6V9A HIS O 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 301 
15 6V9A HIS O 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 302 
15 6V9A HIS O 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 303 
15 6V9A HIS O 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 304 
15 6V9A SER O 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  305 
15 6V9A SER O 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  306 
15 6V9A GLY O 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  307 
15 6V9A LEU O 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  308 
15 6V9A VAL O 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  309 
15 6V9A PRO O 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  310 
15 6V9A ARG O 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  311 
15 6V9A GLY O 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  312 
15 6V9A SER O 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  313 
15 6V9A HIS O 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   314 
15 6V9A ASP O 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  315 
16 6V9A MET P 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 316 
16 6V9A GLY P 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 317 
16 6V9A SER P 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 318 
16 6V9A SER P 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 319 
16 6V9A HIS P 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 320 
16 6V9A HIS P 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 321 
16 6V9A HIS P 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 322 
16 6V9A HIS P 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 323 
16 6V9A HIS P 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 324 
16 6V9A HIS P 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 325 
16 6V9A SER P 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  326 
16 6V9A SER P 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  327 
16 6V9A GLY P 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  328 
16 6V9A LEU P 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  329 
16 6V9A VAL P 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  330 
16 6V9A PRO P 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  331 
16 6V9A ARG P 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  332 
16 6V9A GLY P 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  333 
16 6V9A SER P 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  334 
16 6V9A HIS P 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   335 
16 6V9A ASP P 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  336 
17 6V9A MET Q 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 337 
17 6V9A GLY Q 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 338 
17 6V9A SER Q 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 339 
17 6V9A SER Q 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 340 
17 6V9A HIS Q 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 341 
17 6V9A HIS Q 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 342 
17 6V9A HIS Q 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 343 
17 6V9A HIS Q 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 344 
17 6V9A HIS Q 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 345 
17 6V9A HIS Q 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 346 
17 6V9A SER Q 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  347 
17 6V9A SER Q 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  348 
17 6V9A GLY Q 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  349 
17 6V9A LEU Q 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  350 
17 6V9A VAL Q 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  351 
17 6V9A PRO Q 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  352 
17 6V9A ARG Q 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  353 
17 6V9A GLY Q 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  354 
17 6V9A SER Q 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  355 
17 6V9A HIS Q 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   356 
17 6V9A ASP Q 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  357 
18 6V9A MET R 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 358 
18 6V9A GLY R 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 359 
18 6V9A SER R 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 360 
18 6V9A SER R 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 361 
18 6V9A HIS R 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 362 
18 6V9A HIS R 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 363 
18 6V9A HIS R 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 364 
18 6V9A HIS R 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 365 
18 6V9A HIS R 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 366 
18 6V9A HIS R 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 367 
18 6V9A SER R 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  368 
18 6V9A SER R 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  369 
18 6V9A GLY R 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  370 
18 6V9A LEU R 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  371 
18 6V9A VAL R 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  372 
18 6V9A PRO R 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  373 
18 6V9A ARG R 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  374 
18 6V9A GLY R 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  375 
18 6V9A SER R 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  376 
18 6V9A HIS R 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   377 
18 6V9A ASP R 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  378 
19 6V9A MET V 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 379 
19 6V9A GLY V 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 380 
19 6V9A SER V 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 381 
19 6V9A SER V 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 382 
19 6V9A HIS V 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 383 
19 6V9A HIS V 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 384 
19 6V9A HIS V 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 385 
19 6V9A HIS V 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 386 
19 6V9A HIS V 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 387 
19 6V9A HIS V 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 388 
19 6V9A SER V 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  389 
19 6V9A SER V 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  390 
19 6V9A GLY V 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  391 
19 6V9A LEU V 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  392 
19 6V9A VAL V 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  393 
19 6V9A PRO V 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  394 
19 6V9A ARG V 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  395 
19 6V9A GLY V 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  396 
19 6V9A SER V 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  397 
19 6V9A HIS V 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   398 
19 6V9A ASP V 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  399 
20 6V9A MET T 1  ? UNP Q8U8L5 ?   ?  'expression tag'      -19 400 
20 6V9A GLY T 2  ? UNP Q8U8L5 ?   ?  'expression tag'      -18 401 
20 6V9A SER T 3  ? UNP Q8U8L5 ?   ?  'expression tag'      -17 402 
20 6V9A SER T 4  ? UNP Q8U8L5 ?   ?  'expression tag'      -16 403 
20 6V9A HIS T 5  ? UNP Q8U8L5 ?   ?  'expression tag'      -15 404 
20 6V9A HIS T 6  ? UNP Q8U8L5 ?   ?  'expression tag'      -14 405 
20 6V9A HIS T 7  ? UNP Q8U8L5 ?   ?  'expression tag'      -13 406 
20 6V9A HIS T 8  ? UNP Q8U8L5 ?   ?  'expression tag'      -12 407 
20 6V9A HIS T 9  ? UNP Q8U8L5 ?   ?  'expression tag'      -11 408 
20 6V9A HIS T 10 ? UNP Q8U8L5 ?   ?  'expression tag'      -10 409 
20 6V9A SER T 11 ? UNP Q8U8L5 ?   ?  'expression tag'      -9  410 
20 6V9A SER T 12 ? UNP Q8U8L5 ?   ?  'expression tag'      -8  411 
20 6V9A GLY T 13 ? UNP Q8U8L5 ?   ?  'expression tag'      -7  412 
20 6V9A LEU T 14 ? UNP Q8U8L5 ?   ?  'expression tag'      -6  413 
20 6V9A VAL T 15 ? UNP Q8U8L5 ?   ?  'expression tag'      -5  414 
20 6V9A PRO T 16 ? UNP Q8U8L5 ?   ?  'expression tag'      -4  415 
20 6V9A ARG T 17 ? UNP Q8U8L5 ?   ?  'expression tag'      -3  416 
20 6V9A GLY T 18 ? UNP Q8U8L5 ?   ?  'expression tag'      -2  417 
20 6V9A SER T 19 ? UNP Q8U8L5 ?   ?  'expression tag'      -1  418 
20 6V9A HIS T 20 ? UNP Q8U8L5 ?   ?  'expression tag'      0   419 
20 6V9A ASP T 92 ? UNP Q8U8L5 SER 72 'engineered mutation' 72  420 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CIT non-polymer         . 'CITRIC ACID'   ?                               'C6 H8 O7'       192.124 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6V9A 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.81 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.24 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            297 
_exptl_crystal_grow.temp_details    'room temperature' 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'Sodium citrate, imidazole' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX300HE' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-02-06 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9787 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9787 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            38.4 
_reflns.entry_id                         6V9A 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.3 
_reflns.d_resolution_low                 77.26 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       465495 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.0 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.0 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.145 
_reflns.pdbx_Rpim_I_all                  0.083 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.3 
_reflns_shell.d_res_low                   5.54 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           33456 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.795 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               41.64 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6V9A 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.30 
_refine.ls_d_res_low                             62.50 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     465487 
_refine.ls_number_reflns_R_free                  23598 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.57 
_refine.ls_percent_reflns_R_free                 5.07 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2363 
_refine.ls_R_factor_R_free                       0.2787 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2340 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.96 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5W6J 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 33.72 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.295 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        62.50 
_refine_hist.number_atoms_solvent             3971 
_refine_hist.number_atoms_total               69256 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        64893 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         392 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0049876332414  ? 67760 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.763406204476   ? 92197 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0502118140553  ? 10021 ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.00510974376914 ? 12160 ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 8.02502712941    ? 55209 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.3261 2.3535 . . 823 14562 97.0478773734 . . . 0.3444         . 0.2783         . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3535 2.3822 . . 792 14698 97.0551378446 . . . 0.319788371639 . 0.273575937424 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3822 2.4124 . . 839 14694 97.2392638037 . . . 0.377240260725 . 0.284498407077 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4124 2.4441 . . 787 14556 97.2984970512 . . . 0.310491394363 . 0.27142129199  . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4441 2.4776 . . 768 14689 97.4590163934 . . . 0.31732113582  . 0.268987939032 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4776 2.513  . . 844 14756 97.4512743628 . . . 0.326066402136 . 0.268906863939 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.513  2.5505 . . 912 14592 97.5646592411 . . . 0.340963660231 . 0.277256788694 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5505 2.5904 . . 696 14818 97.6952141058 . . . 0.32326412167  . 0.273244087317 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5904 2.6328 . . 828 14808 97.7311081943 . . . 0.327863798373 . 0.264729917654 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6328 2.6782 . . 735 14705 97.8019889783 . . . 0.32753867774  . 0.269085730677 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6782 2.7269 . . 770 14849 97.7531605958 . . . 0.311312890574 . 0.281968262874 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7269 2.7794 . . 710 14785 98.0137896135 . . . 0.335954647879 . 0.26496490684  . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7794 2.8361 . . 700 14732 97.5412426522 . . . 0.316843701805 . 0.267808342304 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8361 2.8978 . . 790 14907 97.6728268309 . . . 0.313605871231 . 0.261459072966 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8978 2.9652 . . 721 14807 97.7402908038 . . . 0.299125993762 . 0.255875679494 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9652 3.0393 . . 779 14697 98.0362346383 . . . 0.279171726113 . 0.256177764748 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0393 3.1215 . . 791 14874 98.280946107  . . . 0.317371740528 . 0.252237247394 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1215 3.2134 . . 792 14921 98.3168564635 . . . 0.295314072481 . 0.247598210123 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2134 3.3171 . . 822 14864 98.561105875  . . . 0.318121540585 . 0.254010389157 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3171 3.4356 . . 806 14742 98.3179461237 . . . 0.323015563382 . 0.244178782967 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4356 3.5732 . . 852 14949 98.6699138254 . . . 0.268882826394 . 0.225260158794 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5732 3.7358 . . 752 14871 98.7048268891 . . . 0.224164101087 . 0.21295884884  . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7358 3.9327 . . 887 14827 98.5141997367 . . . 0.221153837138 . 0.202731510797 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9    4.9    . . 765 14713 97.095539803  . . . 0.309960362303 . 0.282007032771 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9327 4.179  . . 781 14931 98.730677391  . . . 0.229498967109 . 0.192918179748 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.179  4.5016 . . 809 14763 98.6256254354 . . . 0.22839012827  . 0.183504665121 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5016 4.9545 . . 783 14984 98.6917876815 . . . 0.24501188548  . 0.184572780747 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.9545 5.671  . . 685 14999 98.8528929787 . . . 0.248000461656 . 0.206574532483 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.671  7.1432 . . 833 14963 99.0096527517 . . . 0.243634768218 . 0.224939565698 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.1432 62.5   . . 748 12839 85.5981855982 . . . 0.230402739935 . 0.203575399108 . . . . . . . . . . . 
# 
_struct.entry_id                     6V9A 
_struct.title                        'Agrobacterium tumefaciens ADP-Glucose pyrophosphorylase-S72D' 
_struct.pdbx_descriptor              'Glucose-1-phosphate adenylyltransferase (E.C.2.7.7.27)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6V9A 
_struct_keywords.text            'Allosteric regulation, Fructose 6-phosphate, Glycogen synthesis, enzyme structure, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 1 ? 
R  N N 1 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 2 ? 
V  N N 3 ? 
W  N N 2 ? 
X  N N 3 ? 
Y  N N 3 ? 
Z  N N 2 ? 
AA N N 2 ? 
BA N N 3 ? 
CA N N 2 ? 
DA N N 3 ? 
EA N N 2 ? 
FA N N 3 ? 
GA N N 2 ? 
HA N N 3 ? 
IA N N 2 ? 
JA N N 3 ? 
KA N N 2 ? 
LA N N 3 ? 
MA N N 2 ? 
NA N N 3 ? 
OA N N 3 ? 
PA N N 2 ? 
QA N N 3 ? 
RA N N 3 ? 
SA N N 2 ? 
TA N N 3 ? 
UA N N 2 ? 
VA N N 3 ? 
WA N N 2 ? 
XA N N 3 ? 
YA N N 2 ? 
ZA N N 3 ? 
AB N N 2 ? 
BB N N 3 ? 
CB N N 2 ? 
DB N N 3 ? 
EB N N 2 ? 
FB N N 3 ? 
GB N N 2 ? 
HB N N 3 ? 
IB N N 2 ? 
JB N N 3 ? 
KB N N 4 ? 
LB N N 4 ? 
MB N N 4 ? 
NB N N 4 ? 
OB N N 4 ? 
PB N N 4 ? 
QB N N 4 ? 
RB N N 4 ? 
SB N N 4 ? 
TB N N 4 ? 
UB N N 4 ? 
VB N N 4 ? 
WB N N 4 ? 
XB N N 4 ? 
YB N N 4 ? 
ZB N N 4 ? 
AC N N 4 ? 
BC N N 4 ? 
CC N N 4 ? 
DC N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 PRO A 28  ? ARG A 31  ? PRO H 8   ARG H 11  5 ? 4  
HELX_P HELX_P2   AA2 GLY A 43  ? ASP A 51  ? GLY H 23  ASP H 31  5 ? 9  
HELX_P HELX_P3   AA3 ALA A 54  ? ALA A 57  ? ALA H 34  ALA H 37  5 ? 4  
HELX_P HELX_P4   AA4 ILE A 66  ? SER A 77  ? ILE H 46  SER H 57  1 ? 12 
HELX_P HELX_P5   AA5 ALA A 90  ? TRP A 101 ? ALA H 70  TRP H 81  1 ? 12 
HELX_P HELX_P6   AA6 ARG A 105 ? ASN A 109 ? ARG H 85  ASN H 89  5 ? 5  
HELX_P HELX_P7   AA7 GLY A 129 ? GLN A 136 ? GLY H 109 GLN H 116 1 ? 8  
HELX_P HELX_P8   AA8 ASN A 137 ? ALA A 145 ? ASN H 117 ALA H 125 1 ? 9  
HELX_P HELX_P9   AA9 ASP A 161 ? GLY A 173 ? ASP H 141 GLY H 153 1 ? 13 
HELX_P HELX_P10  AB1 MET A 186 ? GLY A 190 ? MET H 166 GLY H 170 5 ? 5  
HELX_P HELX_P11  AB2 THR A 233 ? ASP A 246 ? THR H 213 ASP H 226 1 ? 14 
HELX_P HELX_P12  AB3 ASP A 256 ? GLY A 265 ? ASP H 236 GLY H 245 1 ? 10 
HELX_P HELX_P13  AB4 PHE A 272 ? CYS A 276 ? PHE H 252 CYS H 256 1 ? 5  
HELX_P HELX_P14  AB5 THR A 292 ? LEU A 303 ? THR H 272 LEU H 283 1 ? 12 
HELX_P HELX_P15  AB6 ASP A 412 ? PHE A 420 ? ASP H 392 PHE H 400 1 ? 9  
HELX_P HELX_P16  AB7 THR A 431 ? LYS A 437 ? THR H 411 LYS H 417 1 ? 7  
HELX_P HELX_P17  AB8 PRO B 28  ? ARG B 31  ? PRO A 8   ARG A 11  5 ? 4  
HELX_P HELX_P18  AB9 GLY B 43  ? ASP B 51  ? GLY A 23  ASP A 31  5 ? 9  
HELX_P HELX_P19  AC1 ALA B 54  ? ALA B 57  ? ALA A 34  ALA A 37  5 ? 4  
HELX_P HELX_P20  AC2 ILE B 67  ? SER B 77  ? ILE A 47  SER A 57  1 ? 11 
HELX_P HELX_P21  AC3 ALA B 90  ? TRP B 101 ? ALA A 70  TRP A 81  1 ? 12 
HELX_P HELX_P22  AC4 ARG B 105 ? ASN B 109 ? ARG A 85  ASN A 89  5 ? 5  
HELX_P HELX_P23  AC5 GLY B 129 ? GLN B 136 ? GLY A 109 GLN A 116 1 ? 8  
HELX_P HELX_P24  AC6 ASN B 137 ? GLU B 142 ? ASN A 117 GLU A 122 1 ? 6  
HELX_P HELX_P25  AC7 PRO B 143 ? ALA B 145 ? PRO A 123 ALA A 125 5 ? 3  
HELX_P HELX_P26  AC8 ASP B 161 ? GLY B 173 ? ASP A 141 GLY A 153 1 ? 13 
HELX_P HELX_P27  AC9 PRO B 184 ? GLY B 190 ? PRO A 164 GLY A 170 5 ? 7  
HELX_P HELX_P28  AD1 THR B 233 ? ASP B 246 ? THR A 213 ASP A 226 1 ? 14 
HELX_P HELX_P29  AD2 ASP B 256 ? GLY B 265 ? ASP A 236 GLY A 245 1 ? 10 
HELX_P HELX_P30  AD3 PHE B 272 ? CYS B 276 ? PHE A 252 CYS A 256 1 ? 5  
HELX_P HELX_P31  AD4 THR B 292 ? ASP B 302 ? THR A 272 ASP A 282 1 ? 11 
HELX_P HELX_P32  AD5 LEU B 303 ? ASP B 305 ? LEU A 283 ASP A 285 5 ? 3  
HELX_P HELX_P33  AD6 ASP B 412 ? PHE B 420 ? ASP A 392 PHE A 400 1 ? 9  
HELX_P HELX_P34  AD7 THR B 431 ? LYS B 437 ? THR A 411 LYS A 417 1 ? 7  
HELX_P HELX_P35  AD8 PRO C 28  ? ARG C 31  ? PRO B 8   ARG B 11  5 ? 4  
HELX_P HELX_P36  AD9 GLY C 43  ? ASP C 51  ? GLY B 23  ASP B 31  5 ? 9  
HELX_P HELX_P37  AE1 ALA C 54  ? ALA C 57  ? ALA B 34  ALA B 37  5 ? 4  
HELX_P HELX_P38  AE2 ILE C 66  ? GLY C 78  ? ILE B 46  GLY B 58  1 ? 13 
HELX_P HELX_P39  AE3 ALA C 90  ? TRP C 101 ? ALA B 70  TRP B 81  1 ? 12 
HELX_P HELX_P40  AE4 ARG C 105 ? ASN C 109 ? ARG B 85  ASN B 89  5 ? 5  
HELX_P HELX_P41  AE5 GLY C 129 ? GLN C 136 ? GLY B 109 GLN B 116 1 ? 8  
HELX_P HELX_P42  AE6 ASN C 137 ? GLU C 142 ? ASN B 117 GLU B 122 1 ? 6  
HELX_P HELX_P43  AE7 PRO C 143 ? ALA C 145 ? PRO B 123 ALA B 125 5 ? 3  
HELX_P HELX_P44  AE8 ASP C 161 ? GLY C 173 ? ASP B 141 GLY B 153 1 ? 13 
HELX_P HELX_P45  AE9 MET C 186 ? THR C 189 ? MET B 166 THR B 169 5 ? 4  
HELX_P HELX_P46  AF1 THR C 233 ? ASP C 246 ? THR B 213 ASP B 226 1 ? 14 
HELX_P HELX_P47  AF2 ASP C 256 ? GLY C 265 ? ASP B 236 GLY B 245 1 ? 10 
HELX_P HELX_P48  AF3 PHE C 272 ? CYS C 276 ? PHE B 252 CYS B 256 1 ? 5  
HELX_P HELX_P49  AF4 THR C 292 ? ASP C 302 ? THR B 272 ASP B 282 1 ? 11 
HELX_P HELX_P50  AF5 LEU C 303 ? ASP C 305 ? LEU B 283 ASP B 285 5 ? 3  
HELX_P HELX_P51  AF6 ASP C 412 ? PHE C 420 ? ASP B 392 PHE B 400 1 ? 9  
HELX_P HELX_P52  AF7 THR C 431 ? LYS C 437 ? THR B 411 LYS B 417 1 ? 7  
HELX_P HELX_P53  AF8 PRO D 28  ? ARG D 31  ? PRO C 8   ARG C 11  5 ? 4  
HELX_P HELX_P54  AF9 GLY D 43  ? ASP D 51  ? GLY C 23  ASP C 31  5 ? 9  
HELX_P HELX_P55  AG1 ALA D 54  ? ALA D 57  ? ALA C 34  ALA C 37  5 ? 4  
HELX_P HELX_P56  AG2 ILE D 66  ? SER D 77  ? ILE C 46  SER C 57  1 ? 12 
HELX_P HELX_P57  AG3 ALA D 90  ? TRP D 101 ? ALA C 70  TRP C 81  1 ? 12 
HELX_P HELX_P58  AG4 ARG D 105 ? ASN D 109 ? ARG C 85  ASN C 89  5 ? 5  
HELX_P HELX_P59  AG5 GLY D 129 ? GLN D 136 ? GLY C 109 GLN C 116 1 ? 8  
HELX_P HELX_P60  AG6 ASN D 137 ? GLU D 142 ? ASN C 117 GLU C 122 1 ? 6  
HELX_P HELX_P61  AG7 ASP D 161 ? GLY D 173 ? ASP C 141 GLY C 153 1 ? 13 
HELX_P HELX_P62  AG8 MET D 186 ? GLY D 190 ? MET C 166 GLY C 170 5 ? 5  
HELX_P HELX_P63  AG9 THR D 233 ? ASP D 246 ? THR C 213 ASP C 226 1 ? 14 
HELX_P HELX_P64  AH1 ASP D 256 ? GLY D 265 ? ASP C 236 GLY C 245 1 ? 10 
HELX_P HELX_P65  AH2 PHE D 272 ? CYS D 276 ? PHE C 252 CYS C 256 1 ? 5  
HELX_P HELX_P66  AH3 THR D 292 ? ASP D 302 ? THR C 272 ASP C 282 1 ? 11 
HELX_P HELX_P67  AH4 LEU D 303 ? ASP D 305 ? LEU C 283 ASP C 285 5 ? 3  
HELX_P HELX_P68  AH5 ASP D 412 ? PHE D 420 ? ASP C 392 PHE C 400 1 ? 9  
HELX_P HELX_P69  AH6 THR D 431 ? ASP D 436 ? THR C 411 ASP C 416 1 ? 6  
HELX_P HELX_P70  AH7 PRO E 28  ? ARG E 31  ? PRO D 8   ARG D 11  5 ? 4  
HELX_P HELX_P71  AH8 GLY E 43  ? ASP E 51  ? GLY D 23  ASP D 31  5 ? 9  
HELX_P HELX_P72  AH9 ALA E 54  ? ALA E 57  ? ALA D 34  ALA D 37  5 ? 4  
HELX_P HELX_P73  AI1 ILE E 66  ? SER E 77  ? ILE D 46  SER D 57  1 ? 12 
HELX_P HELX_P74  AI2 ALA E 90  ? TRP E 101 ? ALA D 70  TRP D 81  1 ? 12 
HELX_P HELX_P75  AI3 ARG E 105 ? ASN E 109 ? ARG D 85  ASN D 89  5 ? 5  
HELX_P HELX_P76  AI4 GLY E 129 ? GLN E 136 ? GLY D 109 GLN D 116 1 ? 8  
HELX_P HELX_P77  AI5 ASN E 137 ? GLU E 142 ? ASN D 117 GLU D 122 1 ? 6  
HELX_P HELX_P78  AI6 PRO E 143 ? ALA E 145 ? PRO D 123 ALA D 125 5 ? 3  
HELX_P HELX_P79  AI7 ASP E 161 ? GLY E 173 ? ASP D 141 GLY D 153 1 ? 13 
HELX_P HELX_P80  AI8 PRO E 184 ? THR E 189 ? PRO D 164 THR D 169 1 ? 6  
HELX_P HELX_P81  AI9 THR E 233 ? ASP E 246 ? THR D 213 ASP D 226 1 ? 14 
HELX_P HELX_P82  AJ1 ASP E 256 ? GLY E 265 ? ASP D 236 GLY D 245 1 ? 10 
HELX_P HELX_P83  AJ2 PHE E 272 ? CYS E 276 ? PHE D 252 CYS D 256 1 ? 5  
HELX_P HELX_P84  AJ3 THR E 292 ? ASP E 302 ? THR D 272 ASP D 282 1 ? 11 
HELX_P HELX_P85  AJ4 LEU E 303 ? ASP E 305 ? LEU D 283 ASP D 285 5 ? 3  
HELX_P HELX_P86  AJ5 ASP E 412 ? PHE E 420 ? ASP D 392 PHE D 400 1 ? 9  
HELX_P HELX_P87  AJ6 THR E 431 ? ASP E 436 ? THR D 411 ASP D 416 1 ? 6  
HELX_P HELX_P88  AJ7 PRO F 28  ? ARG F 31  ? PRO E 8   ARG E 11  5 ? 4  
HELX_P HELX_P89  AJ8 GLY F 43  ? ASP F 51  ? GLY E 23  ASP E 31  5 ? 9  
HELX_P HELX_P90  AJ9 ALA F 54  ? ALA F 57  ? ALA E 34  ALA E 37  5 ? 4  
HELX_P HELX_P91  AK1 ILE F 67  ? SER F 77  ? ILE E 47  SER E 57  1 ? 11 
HELX_P HELX_P92  AK2 ALA F 90  ? TRP F 101 ? ALA E 70  TRP E 81  1 ? 12 
HELX_P HELX_P93  AK3 ARG F 105 ? ASN F 109 ? ARG E 85  ASN E 89  5 ? 5  
HELX_P HELX_P94  AK4 GLY F 129 ? GLN F 136 ? GLY E 109 GLN E 116 1 ? 8  
HELX_P HELX_P95  AK5 ASN F 137 ? ALA F 145 ? ASN E 117 ALA E 125 1 ? 9  
HELX_P HELX_P96  AK6 ASP F 161 ? GLY F 173 ? ASP E 141 GLY E 153 1 ? 13 
HELX_P HELX_P97  AK7 MET F 186 ? GLY F 190 ? MET E 166 GLY E 170 5 ? 5  
HELX_P HELX_P98  AK8 THR F 233 ? ASP F 246 ? THR E 213 ASP E 226 1 ? 14 
HELX_P HELX_P99  AK9 ASP F 256 ? GLY F 265 ? ASP E 236 GLY E 245 1 ? 10 
HELX_P HELX_P100 AL1 PHE F 272 ? CYS F 276 ? PHE E 252 CYS E 256 1 ? 5  
HELX_P HELX_P101 AL2 THR F 292 ? ASP F 302 ? THR E 272 ASP E 282 1 ? 11 
HELX_P HELX_P102 AL3 LEU F 303 ? ASP F 305 ? LEU E 283 ASP E 285 5 ? 3  
HELX_P HELX_P103 AL4 ASP F 412 ? PHE F 420 ? ASP E 392 PHE E 400 1 ? 9  
HELX_P HELX_P104 AL5 THR F 431 ? ASP F 436 ? THR E 411 ASP E 416 1 ? 6  
HELX_P HELX_P105 AL6 PRO G 28  ? ARG G 31  ? PRO F 8   ARG F 11  5 ? 4  
HELX_P HELX_P106 AL7 GLY G 43  ? ASP G 51  ? GLY F 23  ASP F 31  5 ? 9  
HELX_P HELX_P107 AL8 ALA G 54  ? ALA G 57  ? ALA F 34  ALA F 37  5 ? 4  
HELX_P HELX_P108 AL9 ILE G 66  ? SER G 77  ? ILE F 46  SER F 57  1 ? 12 
HELX_P HELX_P109 AM1 ALA G 90  ? TRP G 101 ? ALA F 70  TRP F 81  1 ? 12 
HELX_P HELX_P110 AM2 ARG G 105 ? ASN G 109 ? ARG F 85  ASN F 89  5 ? 5  
HELX_P HELX_P111 AM3 GLY G 129 ? GLN G 136 ? GLY F 109 GLN F 116 1 ? 8  
HELX_P HELX_P112 AM4 ASN G 137 ? GLU G 142 ? ASN F 117 GLU F 122 1 ? 6  
HELX_P HELX_P113 AM5 ASP G 161 ? GLY G 173 ? ASP F 141 GLY F 153 1 ? 13 
HELX_P HELX_P114 AM6 MET G 186 ? GLY G 190 ? MET F 166 GLY F 170 5 ? 5  
HELX_P HELX_P115 AM7 THR G 233 ? ASP G 246 ? THR F 213 ASP F 226 1 ? 14 
HELX_P HELX_P116 AM8 ASP G 256 ? GLY G 265 ? ASP F 236 GLY F 245 1 ? 10 
HELX_P HELX_P117 AM9 PHE G 272 ? CYS G 276 ? PHE F 252 CYS F 256 1 ? 5  
HELX_P HELX_P118 AN1 THR G 292 ? ASP G 302 ? THR F 272 ASP F 282 1 ? 11 
HELX_P HELX_P119 AN2 LEU G 303 ? ASP G 305 ? LEU F 283 ASP F 285 5 ? 3  
HELX_P HELX_P120 AN3 ASP G 412 ? PHE G 420 ? ASP F 392 PHE F 400 1 ? 9  
HELX_P HELX_P121 AN4 THR G 431 ? ASP G 436 ? THR F 411 ASP F 416 1 ? 6  
HELX_P HELX_P122 AN5 PRO H 28  ? ARG H 31  ? PRO G 8   ARG G 11  5 ? 4  
HELX_P HELX_P123 AN6 GLY H 43  ? ASP H 51  ? GLY G 23  ASP G 31  5 ? 9  
HELX_P HELX_P124 AN7 ALA H 54  ? ALA H 57  ? ALA G 34  ALA G 37  5 ? 4  
HELX_P HELX_P125 AN8 ILE H 67  ? SER H 77  ? ILE G 47  SER G 57  1 ? 11 
HELX_P HELX_P126 AN9 ALA H 90  ? TRP H 101 ? ALA G 70  TRP G 81  1 ? 12 
HELX_P HELX_P127 AO1 ARG H 105 ? ASN H 109 ? ARG G 85  ASN G 89  5 ? 5  
HELX_P HELX_P128 AO2 GLY H 129 ? GLN H 136 ? GLY G 109 GLN G 116 1 ? 8  
HELX_P HELX_P129 AO3 ASN H 137 ? ALA H 145 ? ASN G 117 ALA G 125 1 ? 9  
HELX_P HELX_P130 AO4 ASP H 161 ? GLY H 173 ? ASP G 141 GLY G 153 1 ? 13 
HELX_P HELX_P131 AO5 MET H 186 ? GLY H 190 ? MET G 166 GLY G 170 5 ? 5  
HELX_P HELX_P132 AO6 THR H 233 ? ASP H 246 ? THR G 213 ASP G 226 1 ? 14 
HELX_P HELX_P133 AO7 ASP H 256 ? GLY H 265 ? ASP G 236 GLY G 245 1 ? 10 
HELX_P HELX_P134 AO8 PHE H 272 ? CYS H 276 ? PHE G 252 CYS G 256 1 ? 5  
HELX_P HELX_P135 AO9 THR H 292 ? ASP H 302 ? THR G 272 ASP G 282 1 ? 11 
HELX_P HELX_P136 AP1 LEU H 303 ? ASP H 305 ? LEU G 283 ASP G 285 5 ? 3  
HELX_P HELX_P137 AP2 ASP H 412 ? PHE H 420 ? ASP G 392 PHE G 400 1 ? 9  
HELX_P HELX_P138 AP3 THR H 431 ? ASP H 436 ? THR G 411 ASP G 416 1 ? 6  
HELX_P HELX_P139 AP4 PRO I 28  ? ARG I 31  ? PRO I 8   ARG I 11  5 ? 4  
HELX_P HELX_P140 AP5 GLY I 43  ? ASP I 51  ? GLY I 23  ASP I 31  5 ? 9  
HELX_P HELX_P141 AP6 ALA I 54  ? ALA I 57  ? ALA I 34  ALA I 37  5 ? 4  
HELX_P HELX_P142 AP7 ILE I 66  ? GLY I 78  ? ILE I 46  GLY I 58  1 ? 13 
HELX_P HELX_P143 AP8 ALA I 90  ? TRP I 101 ? ALA I 70  TRP I 81  1 ? 12 
HELX_P HELX_P144 AP9 ARG I 105 ? ASN I 109 ? ARG I 85  ASN I 89  5 ? 5  
HELX_P HELX_P145 AQ1 GLY I 129 ? GLN I 136 ? GLY I 109 GLN I 116 1 ? 8  
HELX_P HELX_P146 AQ2 ASN I 137 ? GLU I 142 ? ASN I 117 GLU I 122 1 ? 6  
HELX_P HELX_P147 AQ3 TYR I 162 ? GLY I 173 ? TYR I 142 GLY I 153 1 ? 12 
HELX_P HELX_P148 AQ4 MET I 186 ? GLY I 190 ? MET I 166 GLY I 170 5 ? 5  
HELX_P HELX_P149 AQ5 THR I 233 ? ASP I 246 ? THR I 213 ASP I 226 1 ? 14 
HELX_P HELX_P150 AQ6 ASP I 256 ? GLY I 265 ? ASP I 236 GLY I 245 1 ? 10 
HELX_P HELX_P151 AQ7 PHE I 272 ? CYS I 276 ? PHE I 252 CYS I 256 1 ? 5  
HELX_P HELX_P152 AQ8 THR I 292 ? ASP I 302 ? THR I 272 ASP I 282 1 ? 11 
HELX_P HELX_P153 AQ9 LEU I 303 ? ASP I 305 ? LEU I 283 ASP I 285 5 ? 3  
HELX_P HELX_P154 AR1 ASP I 412 ? PHE I 420 ? ASP I 392 PHE I 400 1 ? 9  
HELX_P HELX_P155 AR2 THR I 431 ? ASP I 436 ? THR I 411 ASP I 416 1 ? 6  
HELX_P HELX_P156 AR3 PRO J 28  ? ARG J 31  ? PRO J 8   ARG J 11  5 ? 4  
HELX_P HELX_P157 AR4 GLY J 43  ? ASP J 51  ? GLY J 23  ASP J 31  5 ? 9  
HELX_P HELX_P158 AR5 ALA J 54  ? ALA J 57  ? ALA J 34  ALA J 37  5 ? 4  
HELX_P HELX_P159 AR6 ILE J 67  ? SER J 77  ? ILE J 47  SER J 57  1 ? 11 
HELX_P HELX_P160 AR7 ALA J 90  ? TRP J 101 ? ALA J 70  TRP J 81  1 ? 12 
HELX_P HELX_P161 AR8 ARG J 105 ? ASN J 109 ? ARG J 85  ASN J 89  5 ? 5  
HELX_P HELX_P162 AR9 GLY J 129 ? GLN J 136 ? GLY J 109 GLN J 116 1 ? 8  
HELX_P HELX_P163 AS1 ASN J 137 ? GLU J 142 ? ASN J 117 GLU J 122 1 ? 6  
HELX_P HELX_P164 AS2 PRO J 143 ? ALA J 145 ? PRO J 123 ALA J 125 5 ? 3  
HELX_P HELX_P165 AS3 ASP J 161 ? GLY J 173 ? ASP J 141 GLY J 153 1 ? 13 
HELX_P HELX_P166 AS4 MET J 186 ? GLY J 190 ? MET J 166 GLY J 170 5 ? 5  
HELX_P HELX_P167 AS5 THR J 233 ? ASP J 246 ? THR J 213 ASP J 226 1 ? 14 
HELX_P HELX_P168 AS6 ASP J 256 ? GLY J 265 ? ASP J 236 GLY J 245 1 ? 10 
HELX_P HELX_P169 AS7 PHE J 272 ? CYS J 276 ? PHE J 252 CYS J 256 1 ? 5  
HELX_P HELX_P170 AS8 THR J 292 ? ASP J 302 ? THR J 272 ASP J 282 1 ? 11 
HELX_P HELX_P171 AS9 LEU J 303 ? ASP J 305 ? LEU J 283 ASP J 285 5 ? 3  
HELX_P HELX_P172 AT1 ASP J 412 ? PHE J 420 ? ASP J 392 PHE J 400 1 ? 9  
HELX_P HELX_P173 AT2 THR J 431 ? ASP J 436 ? THR J 411 ASP J 416 1 ? 6  
HELX_P HELX_P174 AT3 PRO K 28  ? ARG K 31  ? PRO K 8   ARG K 11  5 ? 4  
HELX_P HELX_P175 AT4 GLY K 43  ? ASP K 51  ? GLY K 23  ASP K 31  5 ? 9  
HELX_P HELX_P176 AT5 ALA K 54  ? ALA K 57  ? ALA K 34  ALA K 37  5 ? 4  
HELX_P HELX_P177 AT6 ILE K 66  ? SER K 77  ? ILE K 46  SER K 57  1 ? 12 
HELX_P HELX_P178 AT7 ALA K 90  ? TRP K 101 ? ALA K 70  TRP K 81  1 ? 12 
HELX_P HELX_P179 AT8 ARG K 105 ? ASN K 109 ? ARG K 85  ASN K 89  5 ? 5  
HELX_P HELX_P180 AT9 GLY K 129 ? GLN K 136 ? GLY K 109 GLN K 116 1 ? 8  
HELX_P HELX_P181 AU1 ASN K 137 ? ALA K 145 ? ASN K 117 ALA K 125 1 ? 9  
HELX_P HELX_P182 AU2 ASP K 161 ? GLY K 173 ? ASP K 141 GLY K 153 1 ? 13 
HELX_P HELX_P183 AU3 MET K 186 ? GLY K 190 ? MET K 166 GLY K 170 5 ? 5  
HELX_P HELX_P184 AU4 THR K 233 ? ALA K 245 ? THR K 213 ALA K 225 1 ? 13 
HELX_P HELX_P185 AU5 ASP K 256 ? GLY K 265 ? ASP K 236 GLY K 245 1 ? 10 
HELX_P HELX_P186 AU6 PHE K 272 ? CYS K 276 ? PHE K 252 CYS K 256 1 ? 5  
HELX_P HELX_P187 AU7 THR K 292 ? ASP K 302 ? THR K 272 ASP K 282 1 ? 11 
HELX_P HELX_P188 AU8 LEU K 303 ? ASP K 305 ? LEU K 283 ASP K 285 5 ? 3  
HELX_P HELX_P189 AU9 ASP K 412 ? PHE K 420 ? ASP K 392 PHE K 400 1 ? 9  
HELX_P HELX_P190 AV1 THR K 431 ? ASP K 436 ? THR K 411 ASP K 416 1 ? 6  
HELX_P HELX_P191 AV2 PRO L 28  ? ARG L 31  ? PRO L 8   ARG L 11  5 ? 4  
HELX_P HELX_P192 AV3 GLY L 43  ? ASP L 51  ? GLY L 23  ASP L 31  5 ? 9  
HELX_P HELX_P193 AV4 ALA L 54  ? ALA L 57  ? ALA L 34  ALA L 37  5 ? 4  
HELX_P HELX_P194 AV5 ILE L 66  ? SER L 77  ? ILE L 46  SER L 57  1 ? 12 
HELX_P HELX_P195 AV6 ALA L 90  ? TRP L 101 ? ALA L 70  TRP L 81  1 ? 12 
HELX_P HELX_P196 AV7 ARG L 105 ? ASN L 109 ? ARG L 85  ASN L 89  5 ? 5  
HELX_P HELX_P197 AV8 GLY L 129 ? GLN L 136 ? GLY L 109 GLN L 116 1 ? 8  
HELX_P HELX_P198 AV9 ASN L 137 ? GLU L 142 ? ASN L 117 GLU L 122 1 ? 6  
HELX_P HELX_P199 AW1 ASP L 161 ? GLY L 173 ? ASP L 141 GLY L 153 1 ? 13 
HELX_P HELX_P200 AW2 GLU L 187 ? GLY L 190 ? GLU L 167 GLY L 170 5 ? 4  
HELX_P HELX_P201 AW3 THR L 233 ? ALA L 245 ? THR L 213 ALA L 225 1 ? 13 
HELX_P HELX_P202 AW4 ASP L 256 ? GLY L 265 ? ASP L 236 GLY L 245 1 ? 10 
HELX_P HELX_P203 AW5 PHE L 272 ? CYS L 276 ? PHE L 252 CYS L 256 1 ? 5  
HELX_P HELX_P204 AW6 THR L 292 ? ASP L 302 ? THR L 272 ASP L 282 1 ? 11 
HELX_P HELX_P205 AW7 LEU L 303 ? ASP L 305 ? LEU L 283 ASP L 285 5 ? 3  
HELX_P HELX_P206 AW8 ASP L 412 ? PHE L 420 ? ASP L 392 PHE L 400 1 ? 9  
HELX_P HELX_P207 AW9 THR L 431 ? LYS L 437 ? THR L 411 LYS L 417 1 ? 7  
HELX_P HELX_P208 AX1 PRO M 28  ? ARG M 31  ? PRO M 8   ARG M 11  5 ? 4  
HELX_P HELX_P209 AX2 GLY M 43  ? ASP M 51  ? GLY M 23  ASP M 31  5 ? 9  
HELX_P HELX_P210 AX3 ALA M 54  ? ALA M 57  ? ALA M 34  ALA M 37  5 ? 4  
HELX_P HELX_P211 AX4 ILE M 66  ? SER M 77  ? ILE M 46  SER M 57  1 ? 12 
HELX_P HELX_P212 AX5 ALA M 90  ? TRP M 101 ? ALA M 70  TRP M 81  1 ? 12 
HELX_P HELX_P213 AX6 ARG M 105 ? ASN M 109 ? ARG M 85  ASN M 89  5 ? 5  
HELX_P HELX_P214 AX7 GLY M 129 ? GLN M 136 ? GLY M 109 GLN M 116 1 ? 8  
HELX_P HELX_P215 AX8 ASN M 137 ? GLU M 142 ? ASN M 117 GLU M 122 1 ? 6  
HELX_P HELX_P216 AX9 ASP M 161 ? GLY M 173 ? ASP M 141 GLY M 153 1 ? 13 
HELX_P HELX_P217 AY1 MET M 186 ? GLY M 190 ? MET M 166 GLY M 170 5 ? 5  
HELX_P HELX_P218 AY2 THR M 233 ? ALA M 244 ? THR M 213 ALA M 224 1 ? 12 
HELX_P HELX_P219 AY3 ASP M 256 ? GLY M 265 ? ASP M 236 GLY M 245 1 ? 10 
HELX_P HELX_P220 AY4 PHE M 272 ? CYS M 276 ? PHE M 252 CYS M 256 1 ? 5  
HELX_P HELX_P221 AY5 THR M 292 ? ASP M 302 ? THR M 272 ASP M 282 1 ? 11 
HELX_P HELX_P222 AY6 LEU M 303 ? ASP M 305 ? LEU M 283 ASP M 285 5 ? 3  
HELX_P HELX_P223 AY7 ASP M 412 ? PHE M 420 ? ASP M 392 PHE M 400 1 ? 9  
HELX_P HELX_P224 AY8 THR M 431 ? LYS M 437 ? THR M 411 LYS M 417 1 ? 7  
HELX_P HELX_P225 AY9 PRO N 28  ? ARG N 31  ? PRO N 8   ARG N 11  5 ? 4  
HELX_P HELX_P226 AZ1 GLY N 43  ? ASP N 51  ? GLY N 23  ASP N 31  5 ? 9  
HELX_P HELX_P227 AZ2 ALA N 54  ? ALA N 57  ? ALA N 34  ALA N 37  5 ? 4  
HELX_P HELX_P228 AZ3 ILE N 66  ? SER N 77  ? ILE N 46  SER N 57  1 ? 12 
HELX_P HELX_P229 AZ4 ALA N 90  ? TRP N 101 ? ALA N 70  TRP N 81  1 ? 12 
HELX_P HELX_P230 AZ5 ARG N 105 ? ASN N 109 ? ARG N 85  ASN N 89  5 ? 5  
HELX_P HELX_P231 AZ6 GLY N 129 ? GLN N 136 ? GLY N 109 GLN N 116 1 ? 8  
HELX_P HELX_P232 AZ7 ASN N 137 ? GLU N 142 ? ASN N 117 GLU N 122 1 ? 6  
HELX_P HELX_P233 AZ8 ASP N 161 ? GLY N 173 ? ASP N 141 GLY N 153 1 ? 13 
HELX_P HELX_P234 AZ9 MET N 186 ? GLY N 190 ? MET N 166 GLY N 170 5 ? 5  
HELX_P HELX_P235 BA1 THR N 233 ? ASP N 246 ? THR N 213 ASP N 226 1 ? 14 
HELX_P HELX_P236 BA2 ASP N 256 ? GLY N 265 ? ASP N 236 GLY N 245 1 ? 10 
HELX_P HELX_P237 BA3 PHE N 272 ? CYS N 276 ? PHE N 252 CYS N 256 1 ? 5  
HELX_P HELX_P238 BA4 THR N 292 ? ASP N 302 ? THR N 272 ASP N 282 1 ? 11 
HELX_P HELX_P239 BA5 LEU N 303 ? ASP N 305 ? LEU N 283 ASP N 285 5 ? 3  
HELX_P HELX_P240 BA6 ASP N 412 ? PHE N 420 ? ASP N 392 PHE N 400 1 ? 9  
HELX_P HELX_P241 BA7 THR N 431 ? LYS N 437 ? THR N 411 LYS N 417 1 ? 7  
HELX_P HELX_P242 BA8 PRO O 28  ? ARG O 31  ? PRO O 8   ARG O 11  5 ? 4  
HELX_P HELX_P243 BA9 GLY O 43  ? ASP O 51  ? GLY O 23  ASP O 31  5 ? 9  
HELX_P HELX_P244 BB1 ALA O 54  ? ALA O 57  ? ALA O 34  ALA O 37  5 ? 4  
HELX_P HELX_P245 BB2 ILE O 67  ? SER O 77  ? ILE O 47  SER O 57  1 ? 11 
HELX_P HELX_P246 BB3 ALA O 90  ? TRP O 101 ? ALA O 70  TRP O 81  1 ? 12 
HELX_P HELX_P247 BB4 ARG O 105 ? ASN O 109 ? ARG O 85  ASN O 89  5 ? 5  
HELX_P HELX_P248 BB5 GLY O 129 ? GLN O 136 ? GLY O 109 GLN O 116 1 ? 8  
HELX_P HELX_P249 BB6 ASN O 137 ? GLU O 142 ? ASN O 117 GLU O 122 1 ? 6  
HELX_P HELX_P250 BB7 ASP O 161 ? SER O 172 ? ASP O 141 SER O 152 1 ? 12 
HELX_P HELX_P251 BB8 MET O 186 ? GLY O 190 ? MET O 166 GLY O 170 5 ? 5  
HELX_P HELX_P252 BB9 THR O 233 ? ASP O 246 ? THR O 213 ASP O 226 1 ? 14 
HELX_P HELX_P253 BC1 ASP O 256 ? GLY O 265 ? ASP O 236 GLY O 245 1 ? 10 
HELX_P HELX_P254 BC2 PHE O 272 ? CYS O 276 ? PHE O 252 CYS O 256 1 ? 5  
HELX_P HELX_P255 BC3 THR O 292 ? ASP O 302 ? THR O 272 ASP O 282 1 ? 11 
HELX_P HELX_P256 BC4 LEU O 303 ? ASP O 305 ? LEU O 283 ASP O 285 5 ? 3  
HELX_P HELX_P257 BC5 ASP O 412 ? PHE O 420 ? ASP O 392 PHE O 400 1 ? 9  
HELX_P HELX_P258 BC6 THR O 431 ? LYS O 437 ? THR O 411 LYS O 417 1 ? 7  
HELX_P HELX_P259 BC7 PRO P 28  ? ARG P 31  ? PRO P 8   ARG P 11  5 ? 4  
HELX_P HELX_P260 BC8 GLY P 43  ? ASP P 51  ? GLY P 23  ASP P 31  5 ? 9  
HELX_P HELX_P261 BC9 ALA P 54  ? ALA P 57  ? ALA P 34  ALA P 37  5 ? 4  
HELX_P HELX_P262 BD1 ILE P 67  ? SER P 77  ? ILE P 47  SER P 57  1 ? 11 
HELX_P HELX_P263 BD2 ALA P 90  ? TRP P 101 ? ALA P 70  TRP P 81  1 ? 12 
HELX_P HELX_P264 BD3 ARG P 105 ? ASN P 109 ? ARG P 85  ASN P 89  5 ? 5  
HELX_P HELX_P265 BD4 GLY P 129 ? GLN P 136 ? GLY P 109 GLN P 116 1 ? 8  
HELX_P HELX_P266 BD5 ASN P 137 ? GLU P 142 ? ASN P 117 GLU P 122 1 ? 6  
HELX_P HELX_P267 BD6 ASP P 161 ? GLY P 173 ? ASP P 141 GLY P 153 1 ? 13 
HELX_P HELX_P268 BD7 MET P 186 ? GLY P 190 ? MET P 166 GLY P 170 5 ? 5  
HELX_P HELX_P269 BD8 THR P 233 ? ASP P 246 ? THR P 213 ASP P 226 1 ? 14 
HELX_P HELX_P270 BD9 ASP P 256 ? GLY P 265 ? ASP P 236 GLY P 245 1 ? 10 
HELX_P HELX_P271 BE1 PHE P 272 ? CYS P 276 ? PHE P 252 CYS P 256 1 ? 5  
HELX_P HELX_P272 BE2 THR P 292 ? LEU P 303 ? THR P 272 LEU P 283 1 ? 12 
HELX_P HELX_P273 BE3 ASP P 412 ? PHE P 420 ? ASP P 392 PHE P 400 1 ? 9  
HELX_P HELX_P274 BE4 THR P 431 ? ASP P 436 ? THR P 411 ASP P 416 1 ? 6  
HELX_P HELX_P275 BE5 PRO Q 28  ? ARG Q 31  ? PRO Q 8   ARG Q 11  5 ? 4  
HELX_P HELX_P276 BE6 GLY Q 43  ? ASP Q 51  ? GLY Q 23  ASP Q 31  5 ? 9  
HELX_P HELX_P277 BE7 ALA Q 54  ? ALA Q 57  ? ALA Q 34  ALA Q 37  5 ? 4  
HELX_P HELX_P278 BE8 ILE Q 67  ? SER Q 77  ? ILE Q 47  SER Q 57  1 ? 11 
HELX_P HELX_P279 BE9 ALA Q 90  ? TRP Q 101 ? ALA Q 70  TRP Q 81  1 ? 12 
HELX_P HELX_P280 BF1 ARG Q 105 ? ASN Q 109 ? ARG Q 85  ASN Q 89  5 ? 5  
HELX_P HELX_P281 BF2 GLY Q 129 ? GLN Q 136 ? GLY Q 109 GLN Q 116 1 ? 8  
HELX_P HELX_P282 BF3 ASN Q 137 ? GLU Q 142 ? ASN Q 117 GLU Q 122 1 ? 6  
HELX_P HELX_P283 BF4 PRO Q 143 ? ALA Q 145 ? PRO Q 123 ALA Q 125 5 ? 3  
HELX_P HELX_P284 BF5 TYR Q 162 ? GLY Q 173 ? TYR Q 142 GLY Q 153 1 ? 12 
HELX_P HELX_P285 BF6 MET Q 186 ? GLY Q 190 ? MET Q 166 GLY Q 170 5 ? 5  
HELX_P HELX_P286 BF7 THR Q 233 ? ASP Q 246 ? THR Q 213 ASP Q 226 1 ? 14 
HELX_P HELX_P287 BF8 ASP Q 256 ? GLY Q 265 ? ASP Q 236 GLY Q 245 1 ? 10 
HELX_P HELX_P288 BF9 PHE Q 272 ? CYS Q 276 ? PHE Q 252 CYS Q 256 1 ? 5  
HELX_P HELX_P289 BG1 THR Q 292 ? ASP Q 302 ? THR Q 272 ASP Q 282 1 ? 11 
HELX_P HELX_P290 BG2 LEU Q 303 ? ASP Q 305 ? LEU Q 283 ASP Q 285 5 ? 3  
HELX_P HELX_P291 BG3 ASP Q 412 ? PHE Q 420 ? ASP Q 392 PHE Q 400 1 ? 9  
HELX_P HELX_P292 BG4 THR Q 431 ? ASP Q 436 ? THR Q 411 ASP Q 416 1 ? 6  
HELX_P HELX_P293 BG5 PRO R 28  ? ARG R 31  ? PRO R 8   ARG R 11  5 ? 4  
HELX_P HELX_P294 BG6 GLY R 43  ? ASP R 51  ? GLY R 23  ASP R 31  5 ? 9  
HELX_P HELX_P295 BG7 ALA R 54  ? ALA R 57  ? ALA R 34  ALA R 37  5 ? 4  
HELX_P HELX_P296 BG8 ILE R 66  ? SER R 77  ? ILE R 46  SER R 57  1 ? 12 
HELX_P HELX_P297 BG9 ALA R 90  ? TRP R 101 ? ALA R 70  TRP R 81  1 ? 12 
HELX_P HELX_P298 BH1 ARG R 105 ? ASN R 109 ? ARG R 85  ASN R 89  5 ? 5  
HELX_P HELX_P299 BH2 GLY R 129 ? GLN R 136 ? GLY R 109 GLN R 116 1 ? 8  
HELX_P HELX_P300 BH3 ASN R 137 ? GLU R 142 ? ASN R 117 GLU R 122 1 ? 6  
HELX_P HELX_P301 BH4 PRO R 143 ? ALA R 145 ? PRO R 123 ALA R 125 5 ? 3  
HELX_P HELX_P302 BH5 ASP R 161 ? GLY R 173 ? ASP R 141 GLY R 153 1 ? 13 
HELX_P HELX_P303 BH6 MET R 186 ? GLY R 190 ? MET R 166 GLY R 170 5 ? 5  
HELX_P HELX_P304 BH7 THR R 233 ? ALA R 245 ? THR R 213 ALA R 225 1 ? 13 
HELX_P HELX_P305 BH8 ASP R 256 ? GLY R 265 ? ASP R 236 GLY R 245 1 ? 10 
HELX_P HELX_P306 BH9 PHE R 272 ? CYS R 276 ? PHE R 252 CYS R 256 1 ? 5  
HELX_P HELX_P307 BI1 THR R 292 ? ASP R 302 ? THR R 272 ASP R 282 1 ? 11 
HELX_P HELX_P308 BI2 LEU R 303 ? ASP R 305 ? LEU R 283 ASP R 285 5 ? 3  
HELX_P HELX_P309 BI3 ASP R 412 ? PHE R 420 ? ASP R 392 PHE R 400 1 ? 9  
HELX_P HELX_P310 BI4 THR R 431 ? ASP R 436 ? THR R 411 ASP R 416 1 ? 6  
HELX_P HELX_P311 BI5 PRO S 28  ? ARG S 31  ? PRO V 8   ARG V 11  5 ? 4  
HELX_P HELX_P312 BI6 GLY S 43  ? ASP S 51  ? GLY V 23  ASP V 31  5 ? 9  
HELX_P HELX_P313 BI7 ALA S 54  ? ALA S 57  ? ALA V 34  ALA V 37  5 ? 4  
HELX_P HELX_P314 BI8 ILE S 67  ? SER S 77  ? ILE V 47  SER V 57  1 ? 11 
HELX_P HELX_P315 BI9 ALA S 90  ? TRP S 101 ? ALA V 70  TRP V 81  1 ? 12 
HELX_P HELX_P316 BJ1 ARG S 105 ? ASN S 109 ? ARG V 85  ASN V 89  5 ? 5  
HELX_P HELX_P317 BJ2 GLY S 129 ? GLN S 136 ? GLY V 109 GLN V 116 1 ? 8  
HELX_P HELX_P318 BJ3 ASN S 137 ? GLU S 142 ? ASN V 117 GLU V 122 1 ? 6  
HELX_P HELX_P319 BJ4 TYR S 162 ? GLY S 173 ? TYR V 142 GLY V 153 1 ? 12 
HELX_P HELX_P320 BJ5 MET S 186 ? GLY S 190 ? MET V 166 GLY V 170 5 ? 5  
HELX_P HELX_P321 BJ6 THR S 233 ? ASP S 246 ? THR V 213 ASP V 226 1 ? 14 
HELX_P HELX_P322 BJ7 ASP S 256 ? GLY S 265 ? ASP V 236 GLY V 245 1 ? 10 
HELX_P HELX_P323 BJ8 PHE S 272 ? CYS S 276 ? PHE V 252 CYS V 256 1 ? 5  
HELX_P HELX_P324 BJ9 THR S 292 ? ASP S 302 ? THR V 272 ASP V 282 1 ? 11 
HELX_P HELX_P325 BK1 LEU S 303 ? ASP S 305 ? LEU V 283 ASP V 285 5 ? 3  
HELX_P HELX_P326 BK2 ASP S 412 ? PHE S 420 ? ASP V 392 PHE V 400 1 ? 9  
HELX_P HELX_P327 BK3 THR S 431 ? LYS S 437 ? THR V 411 LYS V 417 1 ? 7  
HELX_P HELX_P328 BK4 PRO T 28  ? ARG T 31  ? PRO T 8   ARG T 11  5 ? 4  
HELX_P HELX_P329 BK5 GLY T 43  ? ASP T 51  ? GLY T 23  ASP T 31  5 ? 9  
HELX_P HELX_P330 BK6 ALA T 54  ? ALA T 57  ? ALA T 34  ALA T 37  5 ? 4  
HELX_P HELX_P331 BK7 ILE T 66  ? SER T 77  ? ILE T 46  SER T 57  1 ? 12 
HELX_P HELX_P332 BK8 ALA T 90  ? TRP T 101 ? ALA T 70  TRP T 81  1 ? 12 
HELX_P HELX_P333 BK9 ARG T 105 ? ASN T 109 ? ARG T 85  ASN T 89  5 ? 5  
HELX_P HELX_P334 BL1 GLY T 129 ? GLN T 136 ? GLY T 109 GLN T 116 1 ? 8  
HELX_P HELX_P335 BL2 ASN T 137 ? GLU T 142 ? ASN T 117 GLU T 122 1 ? 6  
HELX_P HELX_P336 BL3 ASP T 161 ? GLY T 173 ? ASP T 141 GLY T 153 1 ? 13 
HELX_P HELX_P337 BL4 MET T 186 ? GLY T 190 ? MET T 166 GLY T 170 5 ? 5  
HELX_P HELX_P338 BL5 THR T 233 ? ASP T 246 ? THR T 213 ASP T 226 1 ? 14 
HELX_P HELX_P339 BL6 ASP T 256 ? GLY T 265 ? ASP T 236 GLY T 245 1 ? 10 
HELX_P HELX_P340 BL7 PHE T 272 ? CYS T 276 ? PHE T 252 CYS T 256 1 ? 5  
HELX_P HELX_P341 BL8 THR T 292 ? ASP T 302 ? THR T 272 ASP T 282 1 ? 11 
HELX_P HELX_P342 BL9 LEU T 303 ? ASP T 305 ? LEU T 283 ASP T 285 5 ? 3  
HELX_P HELX_P343 BM1 ASP T 412 ? PHE T 420 ? ASP T 392 PHE T 400 1 ? 9  
HELX_P HELX_P344 BM2 THR T 431 ? ASP T 436 ? THR T 411 ASP T 416 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7  ? 
AA2 ? 7  ? 
AA3 ? 2  ? 
AA4 ? 2  ? 
AA5 ? 10 ? 
AA6 ? 6  ? 
AA7 ? 6  ? 
AA8 ? 10 ? 
AA9 ? 7  ? 
AB1 ? 2  ? 
AB2 ? 2  ? 
AB3 ? 2  ? 
AB4 ? 10 ? 
AB5 ? 6  ? 
AB6 ? 6  ? 
AB7 ? 10 ? 
AB8 ? 7  ? 
AB9 ? 2  ? 
AC1 ? 2  ? 
AC2 ? 2  ? 
AC3 ? 7  ? 
AC4 ? 7  ? 
AC5 ? 2  ? 
AC6 ? 2  ? 
AC7 ? 10 ? 
AC8 ? 6  ? 
AC9 ? 6  ? 
AD1 ? 10 ? 
AD2 ? 7  ? 
AD3 ? 7  ? 
AD4 ? 2  ? 
AD5 ? 2  ? 
AD6 ? 7  ? 
AD7 ? 7  ? 
AD8 ? 2  ? 
AD9 ? 2  ? 
AE1 ? 10 ? 
AE2 ? 6  ? 
AE3 ? 6  ? 
AE4 ? 10 ? 
AE5 ? 7  ? 
AE6 ? 7  ? 
AE7 ? 2  ? 
AE8 ? 2  ? 
AE9 ? 7  ? 
AF1 ? 7  ? 
AF2 ? 2  ? 
AF3 ? 2  ? 
AF4 ? 7  ? 
AF5 ? 7  ? 
AF6 ? 2  ? 
AF7 ? 2  ? 
AF8 ? 10 ? 
AF9 ? 6  ? 
AG1 ? 6  ? 
AG2 ? 10 ? 
AG3 ? 7  ? 
AG4 ? 2  ? 
AG5 ? 2  ? 
AG6 ? 2  ? 
AG7 ? 7  ? 
AG8 ? 2  ? 
AG9 ? 2  ? 
AH1 ? 2  ? 
AH2 ? 10 ? 
AH3 ? 6  ? 
AH4 ? 6  ? 
AH5 ? 10 ? 
AH6 ? 7  ? 
AH7 ? 7  ? 
AH8 ? 2  ? 
AH9 ? 2  ? 
AI1 ? 7  ? 
AI2 ? 2  ? 
AI3 ? 2  ? 
AI4 ? 2  ? 
AI5 ? 10 ? 
AI6 ? 6  ? 
AI7 ? 6  ? 
AI8 ? 10 ? 
AI9 ? 7  ? 
AJ1 ? 7  ? 
AJ2 ? 2  ? 
AJ3 ? 2  ? 
AJ4 ? 7  ? 
AJ5 ? 7  ? 
AJ6 ? 2  ? 
AJ7 ? 2  ? 
AJ8 ? 10 ? 
AJ9 ? 6  ? 
AK1 ? 6  ? 
AK2 ? 10 ? 
AK3 ? 7  ? 
AK4 ? 2  ? 
AK5 ? 2  ? 
AK6 ? 2  ? 
AK7 ? 7  ? 
AK8 ? 7  ? 
AK9 ? 2  ? 
AL1 ? 2  ? 
AL2 ? 10 ? 
AL3 ? 6  ? 
AL4 ? 6  ? 
AL5 ? 10 ? 
AL6 ? 7  ? 
AL7 ? 7  ? 
AL8 ? 2  ? 
AL9 ? 2  ? 
AM1 ? 7  ? 
AM2 ? 7  ? 
AM3 ? 2  ? 
AM4 ? 2  ? 
AM5 ? 10 ? 
AM6 ? 6  ? 
AM7 ? 6  ? 
AM8 ? 10 ? 
AM9 ? 7  ? 
AN1 ? 7  ? 
AN2 ? 2  ? 
AN3 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? parallel      
AA1 2 3  ? parallel      
AA1 3 4  ? parallel      
AA1 4 5  ? anti-parallel 
AA1 5 6  ? anti-parallel 
AA1 6 7  ? anti-parallel 
AA2 1 2  ? parallel      
AA2 2 3  ? parallel      
AA2 3 4  ? parallel      
AA2 4 5  ? anti-parallel 
AA2 5 6  ? anti-parallel 
AA2 6 7  ? parallel      
AA3 1 2  ? anti-parallel 
AA4 1 2  ? anti-parallel 
AA5 1 2  ? parallel      
AA5 2 3  ? parallel      
AA5 3 4  ? parallel      
AA5 4 5  ? parallel      
AA5 5 6  ? anti-parallel 
AA5 6 7  ? parallel      
AA5 7 8  ? parallel      
AA5 8 9  ? parallel      
AA5 9 10 ? parallel      
AA6 1 2  ? parallel      
AA6 2 3  ? parallel      
AA6 3 4  ? parallel      
AA6 4 5  ? parallel      
AA6 5 6  ? anti-parallel 
AA7 1 2  ? parallel      
AA7 2 3  ? parallel      
AA7 3 4  ? parallel      
AA7 4 5  ? parallel      
AA7 5 6  ? anti-parallel 
AA8 1 2  ? parallel      
AA8 2 3  ? parallel      
AA8 3 4  ? parallel      
AA8 4 5  ? parallel      
AA8 5 6  ? anti-parallel 
AA8 6 7  ? parallel      
AA8 7 8  ? parallel      
AA8 8 9  ? parallel      
AA8 9 10 ? parallel      
AA9 1 2  ? parallel      
AA9 2 3  ? parallel      
AA9 3 4  ? parallel      
AA9 4 5  ? anti-parallel 
AA9 5 6  ? anti-parallel 
AA9 6 7  ? parallel      
AB1 1 2  ? anti-parallel 
AB2 1 2  ? anti-parallel 
AB3 1 2  ? anti-parallel 
AB4 1 2  ? parallel      
AB4 2 3  ? parallel      
AB4 3 4  ? parallel      
AB4 4 5  ? parallel      
AB4 5 6  ? anti-parallel 
AB4 6 7  ? parallel      
AB4 7 8  ? parallel      
AB4 8 9  ? parallel      
AB4 9 10 ? parallel      
AB5 1 2  ? parallel      
AB5 2 3  ? parallel      
AB5 3 4  ? parallel      
AB5 4 5  ? parallel      
AB5 5 6  ? anti-parallel 
AB6 1 2  ? parallel      
AB6 2 3  ? parallel      
AB6 3 4  ? parallel      
AB6 4 5  ? parallel      
AB6 5 6  ? anti-parallel 
AB7 1 2  ? parallel      
AB7 2 3  ? parallel      
AB7 3 4  ? parallel      
AB7 4 5  ? parallel      
AB7 5 6  ? anti-parallel 
AB7 6 7  ? parallel      
AB7 7 8  ? parallel      
AB7 8 9  ? parallel      
AB7 9 10 ? parallel      
AB8 1 2  ? parallel      
AB8 2 3  ? parallel      
AB8 3 4  ? parallel      
AB8 4 5  ? anti-parallel 
AB8 5 6  ? anti-parallel 
AB8 6 7  ? parallel      
AB9 1 2  ? anti-parallel 
AC1 1 2  ? anti-parallel 
AC2 1 2  ? anti-parallel 
AC3 1 2  ? parallel      
AC3 2 3  ? parallel      
AC3 3 4  ? parallel      
AC3 4 5  ? anti-parallel 
AC3 5 6  ? anti-parallel 
AC3 6 7  ? anti-parallel 
AC4 1 2  ? parallel      
AC4 2 3  ? parallel      
AC4 3 4  ? parallel      
AC4 4 5  ? anti-parallel 
AC4 5 6  ? anti-parallel 
AC4 6 7  ? parallel      
AC5 1 2  ? anti-parallel 
AC6 1 2  ? anti-parallel 
AC7 1 2  ? parallel      
AC7 2 3  ? parallel      
AC7 3 4  ? parallel      
AC7 4 5  ? parallel      
AC7 5 6  ? anti-parallel 
AC7 6 7  ? parallel      
AC7 7 8  ? parallel      
AC7 8 9  ? parallel      
AC7 9 10 ? parallel      
AC8 1 2  ? parallel      
AC8 2 3  ? parallel      
AC8 3 4  ? parallel      
AC8 4 5  ? parallel      
AC8 5 6  ? anti-parallel 
AC9 1 2  ? parallel      
AC9 2 3  ? parallel      
AC9 3 4  ? parallel      
AC9 4 5  ? parallel      
AC9 5 6  ? anti-parallel 
AD1 1 2  ? parallel      
AD1 2 3  ? parallel      
AD1 3 4  ? parallel      
AD1 4 5  ? parallel      
AD1 5 6  ? anti-parallel 
AD1 6 7  ? parallel      
AD1 7 8  ? parallel      
AD1 8 9  ? parallel      
AD1 9 10 ? parallel      
AD2 1 2  ? parallel      
AD2 2 3  ? parallel      
AD2 3 4  ? parallel      
AD2 4 5  ? anti-parallel 
AD2 5 6  ? anti-parallel 
AD2 6 7  ? anti-parallel 
AD3 1 2  ? parallel      
AD3 2 3  ? parallel      
AD3 3 4  ? parallel      
AD3 4 5  ? anti-parallel 
AD3 5 6  ? anti-parallel 
AD3 6 7  ? parallel      
AD4 1 2  ? anti-parallel 
AD5 1 2  ? anti-parallel 
AD6 1 2  ? parallel      
AD6 2 3  ? parallel      
AD6 3 4  ? parallel      
AD6 4 5  ? anti-parallel 
AD6 5 6  ? anti-parallel 
AD6 6 7  ? anti-parallel 
AD7 1 2  ? parallel      
AD7 2 3  ? parallel      
AD7 3 4  ? parallel      
AD7 4 5  ? anti-parallel 
AD7 5 6  ? anti-parallel 
AD7 6 7  ? parallel      
AD8 1 2  ? anti-parallel 
AD9 1 2  ? anti-parallel 
AE1 1 2  ? parallel      
AE1 2 3  ? parallel      
AE1 3 4  ? parallel      
AE1 4 5  ? parallel      
AE1 5 6  ? anti-parallel 
AE1 6 7  ? parallel      
AE1 7 8  ? parallel      
AE1 8 9  ? parallel      
AE1 9 10 ? parallel      
AE2 1 2  ? parallel      
AE2 2 3  ? parallel      
AE2 3 4  ? parallel      
AE2 4 5  ? parallel      
AE2 5 6  ? anti-parallel 
AE3 1 2  ? parallel      
AE3 2 3  ? parallel      
AE3 3 4  ? parallel      
AE3 4 5  ? parallel      
AE3 5 6  ? anti-parallel 
AE4 1 2  ? parallel      
AE4 2 3  ? parallel      
AE4 3 4  ? parallel      
AE4 4 5  ? parallel      
AE4 5 6  ? anti-parallel 
AE4 6 7  ? parallel      
AE4 7 8  ? parallel      
AE4 8 9  ? parallel      
AE4 9 10 ? parallel      
AE5 1 2  ? parallel      
AE5 2 3  ? parallel      
AE5 3 4  ? parallel      
AE5 4 5  ? anti-parallel 
AE5 5 6  ? anti-parallel 
AE5 6 7  ? anti-parallel 
AE6 1 2  ? parallel      
AE6 2 3  ? parallel      
AE6 3 4  ? parallel      
AE6 4 5  ? anti-parallel 
AE6 5 6  ? anti-parallel 
AE6 6 7  ? parallel      
AE7 1 2  ? anti-parallel 
AE8 1 2  ? anti-parallel 
AE9 1 2  ? parallel      
AE9 2 3  ? parallel      
AE9 3 4  ? parallel      
AE9 4 5  ? anti-parallel 
AE9 5 6  ? anti-parallel 
AE9 6 7  ? anti-parallel 
AF1 1 2  ? parallel      
AF1 2 3  ? parallel      
AF1 3 4  ? parallel      
AF1 4 5  ? anti-parallel 
AF1 5 6  ? anti-parallel 
AF1 6 7  ? parallel      
AF2 1 2  ? anti-parallel 
AF3 1 2  ? anti-parallel 
AF4 1 2  ? parallel      
AF4 2 3  ? parallel      
AF4 3 4  ? parallel      
AF4 4 5  ? anti-parallel 
AF4 5 6  ? anti-parallel 
AF4 6 7  ? anti-parallel 
AF5 1 2  ? parallel      
AF5 2 3  ? parallel      
AF5 3 4  ? parallel      
AF5 4 5  ? anti-parallel 
AF5 5 6  ? anti-parallel 
AF5 6 7  ? parallel      
AF6 1 2  ? anti-parallel 
AF7 1 2  ? anti-parallel 
AF8 1 2  ? parallel      
AF8 2 3  ? parallel      
AF8 3 4  ? parallel      
AF8 4 5  ? parallel      
AF8 5 6  ? anti-parallel 
AF8 6 7  ? parallel      
AF8 7 8  ? parallel      
AF8 8 9  ? parallel      
AF8 9 10 ? parallel      
AF9 1 2  ? parallel      
AF9 2 3  ? parallel      
AF9 3 4  ? parallel      
AF9 4 5  ? parallel      
AF9 5 6  ? anti-parallel 
AG1 1 2  ? parallel      
AG1 2 3  ? parallel      
AG1 3 4  ? parallel      
AG1 4 5  ? parallel      
AG1 5 6  ? anti-parallel 
AG2 1 2  ? parallel      
AG2 2 3  ? parallel      
AG2 3 4  ? parallel      
AG2 4 5  ? parallel      
AG2 5 6  ? anti-parallel 
AG2 6 7  ? parallel      
AG2 7 8  ? parallel      
AG2 8 9  ? parallel      
AG2 9 10 ? parallel      
AG3 1 2  ? parallel      
AG3 2 3  ? parallel      
AG3 3 4  ? parallel      
AG3 4 5  ? anti-parallel 
AG3 5 6  ? anti-parallel 
AG3 6 7  ? parallel      
AG4 1 2  ? anti-parallel 
AG5 1 2  ? anti-parallel 
AG6 1 2  ? anti-parallel 
AG7 1 2  ? parallel      
AG7 2 3  ? parallel      
AG7 3 4  ? parallel      
AG7 4 5  ? anti-parallel 
AG7 5 6  ? anti-parallel 
AG7 6 7  ? parallel      
AG8 1 2  ? anti-parallel 
AG9 1 2  ? anti-parallel 
AH1 1 2  ? anti-parallel 
AH2 1 2  ? parallel      
AH2 2 3  ? parallel      
AH2 3 4  ? parallel      
AH2 4 5  ? parallel      
AH2 5 6  ? anti-parallel 
AH2 6 7  ? parallel      
AH2 7 8  ? parallel      
AH2 8 9  ? parallel      
AH2 9 10 ? parallel      
AH3 1 2  ? parallel      
AH3 2 3  ? parallel      
AH3 3 4  ? parallel      
AH3 4 5  ? parallel      
AH3 5 6  ? anti-parallel 
AH4 1 2  ? parallel      
AH4 2 3  ? parallel      
AH4 3 4  ? parallel      
AH4 4 5  ? parallel      
AH4 5 6  ? anti-parallel 
AH5 1 2  ? parallel      
AH5 2 3  ? parallel      
AH5 3 4  ? parallel      
AH5 4 5  ? parallel      
AH5 5 6  ? anti-parallel 
AH5 6 7  ? parallel      
AH5 7 8  ? parallel      
AH5 8 9  ? parallel      
AH5 9 10 ? parallel      
AH6 1 2  ? parallel      
AH6 2 3  ? parallel      
AH6 3 4  ? parallel      
AH6 4 5  ? anti-parallel 
AH6 5 6  ? anti-parallel 
AH6 6 7  ? anti-parallel 
AH7 1 2  ? parallel      
AH7 2 3  ? parallel      
AH7 3 4  ? parallel      
AH7 4 5  ? anti-parallel 
AH7 5 6  ? anti-parallel 
AH7 6 7  ? parallel      
AH8 1 2  ? anti-parallel 
AH9 1 2  ? anti-parallel 
AI1 1 2  ? parallel      
AI1 2 3  ? parallel      
AI1 3 4  ? parallel      
AI1 4 5  ? anti-parallel 
AI1 5 6  ? anti-parallel 
AI1 6 7  ? parallel      
AI2 1 2  ? anti-parallel 
AI3 1 2  ? anti-parallel 
AI4 1 2  ? anti-parallel 
AI5 1 2  ? parallel      
AI5 2 3  ? parallel      
AI5 3 4  ? parallel      
AI5 4 5  ? parallel      
AI5 5 6  ? anti-parallel 
AI5 6 7  ? parallel      
AI5 7 8  ? parallel      
AI5 8 9  ? parallel      
AI5 9 10 ? parallel      
AI6 1 2  ? parallel      
AI6 2 3  ? parallel      
AI6 3 4  ? parallel      
AI6 4 5  ? parallel      
AI6 5 6  ? anti-parallel 
AI7 1 2  ? parallel      
AI7 2 3  ? parallel      
AI7 3 4  ? parallel      
AI7 4 5  ? parallel      
AI7 5 6  ? anti-parallel 
AI8 1 2  ? parallel      
AI8 2 3  ? parallel      
AI8 3 4  ? parallel      
AI8 4 5  ? parallel      
AI8 5 6  ? anti-parallel 
AI8 6 7  ? parallel      
AI8 7 8  ? parallel      
AI8 8 9  ? parallel      
AI8 9 10 ? parallel      
AI9 1 2  ? parallel      
AI9 2 3  ? parallel      
AI9 3 4  ? parallel      
AI9 4 5  ? anti-parallel 
AI9 5 6  ? anti-parallel 
AI9 6 7  ? anti-parallel 
AJ1 1 2  ? parallel      
AJ1 2 3  ? parallel      
AJ1 3 4  ? parallel      
AJ1 4 5  ? anti-parallel 
AJ1 5 6  ? anti-parallel 
AJ1 6 7  ? parallel      
AJ2 1 2  ? anti-parallel 
AJ3 1 2  ? anti-parallel 
AJ4 1 2  ? parallel      
AJ4 2 3  ? parallel      
AJ4 3 4  ? parallel      
AJ4 4 5  ? anti-parallel 
AJ4 5 6  ? anti-parallel 
AJ4 6 7  ? anti-parallel 
AJ5 1 2  ? parallel      
AJ5 2 3  ? parallel      
AJ5 3 4  ? parallel      
AJ5 4 5  ? anti-parallel 
AJ5 5 6  ? anti-parallel 
AJ5 6 7  ? parallel      
AJ6 1 2  ? anti-parallel 
AJ7 1 2  ? anti-parallel 
AJ8 1 2  ? parallel      
AJ8 2 3  ? parallel      
AJ8 3 4  ? parallel      
AJ8 4 5  ? parallel      
AJ8 5 6  ? anti-parallel 
AJ8 6 7  ? parallel      
AJ8 7 8  ? parallel      
AJ8 8 9  ? parallel      
AJ8 9 10 ? parallel      
AJ9 1 2  ? parallel      
AJ9 2 3  ? parallel      
AJ9 3 4  ? parallel      
AJ9 4 5  ? parallel      
AJ9 5 6  ? anti-parallel 
AK1 1 2  ? parallel      
AK1 2 3  ? parallel      
AK1 3 4  ? parallel      
AK1 4 5  ? parallel      
AK1 5 6  ? anti-parallel 
AK2 1 2  ? parallel      
AK2 2 3  ? parallel      
AK2 3 4  ? parallel      
AK2 4 5  ? parallel      
AK2 5 6  ? anti-parallel 
AK2 6 7  ? parallel      
AK2 7 8  ? parallel      
AK2 8 9  ? parallel      
AK2 9 10 ? parallel      
AK3 1 2  ? parallel      
AK3 2 3  ? parallel      
AK3 3 4  ? parallel      
AK3 4 5  ? anti-parallel 
AK3 5 6  ? anti-parallel 
AK3 6 7  ? parallel      
AK4 1 2  ? anti-parallel 
AK5 1 2  ? anti-parallel 
AK6 1 2  ? anti-parallel 
AK7 1 2  ? parallel      
AK7 2 3  ? parallel      
AK7 3 4  ? parallel      
AK7 4 5  ? anti-parallel 
AK7 5 6  ? anti-parallel 
AK7 6 7  ? anti-parallel 
AK8 1 2  ? parallel      
AK8 2 3  ? parallel      
AK8 3 4  ? parallel      
AK8 4 5  ? anti-parallel 
AK8 5 6  ? anti-parallel 
AK8 6 7  ? parallel      
AK9 1 2  ? anti-parallel 
AL1 1 2  ? anti-parallel 
AL2 1 2  ? parallel      
AL2 2 3  ? parallel      
AL2 3 4  ? parallel      
AL2 4 5  ? parallel      
AL2 5 6  ? anti-parallel 
AL2 6 7  ? parallel      
AL2 7 8  ? parallel      
AL2 8 9  ? parallel      
AL2 9 10 ? parallel      
AL3 1 2  ? parallel      
AL3 2 3  ? parallel      
AL3 3 4  ? parallel      
AL3 4 5  ? parallel      
AL3 5 6  ? anti-parallel 
AL4 1 2  ? parallel      
AL4 2 3  ? parallel      
AL4 3 4  ? parallel      
AL4 4 5  ? parallel      
AL4 5 6  ? anti-parallel 
AL5 1 2  ? parallel      
AL5 2 3  ? parallel      
AL5 3 4  ? parallel      
AL5 4 5  ? parallel      
AL5 5 6  ? anti-parallel 
AL5 6 7  ? parallel      
AL5 7 8  ? parallel      
AL5 8 9  ? parallel      
AL5 9 10 ? parallel      
AL6 1 2  ? parallel      
AL6 2 3  ? parallel      
AL6 3 4  ? parallel      
AL6 4 5  ? anti-parallel 
AL6 5 6  ? anti-parallel 
AL6 6 7  ? anti-parallel 
AL7 1 2  ? parallel      
AL7 2 3  ? parallel      
AL7 3 4  ? parallel      
AL7 4 5  ? anti-parallel 
AL7 5 6  ? anti-parallel 
AL7 6 7  ? parallel      
AL8 1 2  ? anti-parallel 
AL9 1 2  ? anti-parallel 
AM1 1 2  ? parallel      
AM1 2 3  ? parallel      
AM1 3 4  ? parallel      
AM1 4 5  ? anti-parallel 
AM1 5 6  ? anti-parallel 
AM1 6 7  ? anti-parallel 
AM2 1 2  ? parallel      
AM2 2 3  ? parallel      
AM2 3 4  ? parallel      
AM2 4 5  ? anti-parallel 
AM2 5 6  ? anti-parallel 
AM2 6 7  ? parallel      
AM3 1 2  ? anti-parallel 
AM4 1 2  ? anti-parallel 
AM5 1 2  ? parallel      
AM5 2 3  ? parallel      
AM5 3 4  ? parallel      
AM5 4 5  ? parallel      
AM5 5 6  ? anti-parallel 
AM5 6 7  ? parallel      
AM5 7 8  ? parallel      
AM5 8 9  ? parallel      
AM5 9 10 ? parallel      
AM6 1 2  ? parallel      
AM6 2 3  ? parallel      
AM6 3 4  ? parallel      
AM6 4 5  ? parallel      
AM6 5 6  ? anti-parallel 
AM7 1 2  ? parallel      
AM7 2 3  ? parallel      
AM7 3 4  ? parallel      
AM7 4 5  ? parallel      
AM7 5 6  ? anti-parallel 
AM8 1 2  ? parallel      
AM8 2 3  ? parallel      
AM8 3 4  ? parallel      
AM8 4 5  ? parallel      
AM8 5 6  ? anti-parallel 
AM8 6 7  ? parallel      
AM8 7 8  ? parallel      
AM8 8 9  ? parallel      
AM8 9 10 ? parallel      
AM9 1 2  ? parallel      
AM9 2 3  ? parallel      
AM9 3 4  ? parallel      
AM9 4 5  ? anti-parallel 
AM9 5 6  ? anti-parallel 
AM9 6 7  ? anti-parallel 
AN1 1 2  ? parallel      
AN1 2 3  ? parallel      
AN1 3 4  ? parallel      
AN1 4 5  ? anti-parallel 
AN1 5 6  ? anti-parallel 
AN1 6 7  ? parallel      
AN2 1 2  ? anti-parallel 
AN3 1 2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  SER A 111 ? PRO A 116 ? SER H 91  PRO H 96  
AA1 2  ARG A 81  ? THR A 86  ? ARG H 61  THR H 66  
AA1 3  ALA A 33  ? ALA A 39  ? ALA H 13  ALA H 19  
AA1 4  TYR A 148 ? ALA A 153 ? TYR H 128 ALA H 133 
AA1 5  PHE A 221 ? HIS A 232 ? PHE H 201 HIS H 212 
AA1 6  GLY A 192 ? VAL A 196 ? GLY H 172 VAL H 176 
AA1 7  ILE A 202 ? GLU A 207 ? ILE H 182 GLU H 187 
AA2 1  SER A 111 ? PRO A 116 ? SER H 91  PRO H 96  
AA2 2  ARG A 81  ? THR A 86  ? ARG H 61  THR H 66  
AA2 3  ALA A 33  ? ALA A 39  ? ALA H 13  ALA H 19  
AA2 4  TYR A 148 ? ALA A 153 ? TYR H 128 ALA H 133 
AA2 5  PHE A 221 ? HIS A 232 ? PHE H 201 HIS H 212 
AA2 6  VAL A 176 ? PRO A 184 ? VAL H 156 PRO H 164 
AA2 7  ALA A 267 ? ARG A 271 ? ALA H 247 ARG H 251 
AA3 1  TYR A 59  ? PHE A 60  ? TYR H 39  PHE H 40  
AA3 2  ALA A 64  ? ARG A 65  ? ALA H 44  ARG H 45  
AA4 1  ILE A 157 ? TYR A 158 ? ILE H 137 TYR H 138 
AA4 2  TRP A 287 ? ARG A 288 ? TRP H 267 ARG H 268 
AA5 1  VAL A 402 ? ILE A 403 ? VAL H 382 ILE H 383 
AA5 2  LYS A 385 ? ILE A 386 ? LYS H 365 ILE H 366 
AA5 3  ARG A 368 ? ALA A 369 ? ARG H 348 ALA H 349 
AA5 4  ILE A 352 ? SER A 354 ? ILE H 332 SER H 334 
AA5 5  ALA A 329 ? VAL A 332 ? ALA H 309 VAL H 312 
AA5 6  VAL H 346 ? VAL H 347 ? VAL G 326 VAL G 327 
AA5 7  LEU H 362 ? LEU H 363 ? LEU G 342 LEU G 343 
AA5 8  ARG H 374 ? VAL H 380 ? ARG G 354 VAL G 360 
AA5 9  GLN H 391 ? ILE H 397 ? GLN G 371 ILE G 377 
AA5 10 ILE H 408 ? VAL H 409 ? ILE G 388 VAL G 389 
AA6 1  SER H 341 ? VAL H 343 ? SER G 321 VAL G 323 
AA6 2  ALA H 357 ? ASN H 359 ? ALA G 337 ASN G 339 
AA6 3  ARG H 374 ? VAL H 380 ? ARG G 354 VAL G 360 
AA6 4  GLN H 391 ? ILE H 397 ? GLN G 371 ILE G 377 
AA6 5  CYS H 428 ? ILE H 430 ? CYS G 408 ILE G 410 
AA6 6  ARG H 421 ? ARG H 422 ? ARG G 401 ARG G 402 
AA7 1  SER A 341 ? VAL A 343 ? SER H 321 VAL H 323 
AA7 2  ALA A 357 ? ASN A 359 ? ALA H 337 ASN H 339 
AA7 3  ARG A 374 ? VAL A 380 ? ARG H 354 VAL H 360 
AA7 4  GLN A 391 ? ILE A 397 ? GLN H 371 ILE H 377 
AA7 5  CYS A 428 ? ILE A 430 ? CYS H 408 ILE H 410 
AA7 6  ARG A 421 ? ARG A 422 ? ARG H 401 ARG H 402 
AA8 1  ILE A 408 ? VAL A 409 ? ILE H 388 VAL H 389 
AA8 2  GLN A 391 ? ILE A 397 ? GLN H 371 ILE H 377 
AA8 3  ARG A 374 ? VAL A 380 ? ARG H 354 VAL H 360 
AA8 4  LEU A 362 ? LEU A 363 ? LEU H 342 LEU H 343 
AA8 5  SER A 345 ? VAL A 347 ? SER H 325 VAL H 327 
AA8 6  ALA H 329 ? VAL H 332 ? ALA G 309 VAL G 312 
AA8 7  ILE H 352 ? SER H 354 ? ILE G 332 SER G 334 
AA8 8  ARG H 368 ? ALA H 369 ? ARG G 348 ALA G 349 
AA8 9  LYS H 385 ? ILE H 386 ? LYS G 365 ILE G 366 
AA8 10 VAL H 402 ? ILE H 403 ? VAL G 382 ILE G 383 
AA9 1  SER B 111 ? PRO B 116 ? SER A 91  PRO A 96  
AA9 2  ARG B 81  ? THR B 86  ? ARG A 61  THR A 66  
AA9 3  ALA B 33  ? LEU B 38  ? ALA A 13  LEU A 18  
AA9 4  TYR B 148 ? ALA B 153 ? TYR A 128 ALA A 133 
AA9 5  ALA B 222 ? HIS B 232 ? ALA A 202 HIS A 212 
AA9 6  VAL B 176 ? VAL B 183 ? VAL A 156 VAL A 163 
AA9 7  ALA B 267 ? ARG B 271 ? ALA A 247 ARG A 251 
AB1 1  TYR B 59  ? PHE B 60  ? TYR A 39  PHE A 40  
AB1 2  ALA B 64  ? ARG B 65  ? ALA A 44  ARG A 45  
AB2 1  ILE B 157 ? TYR B 158 ? ILE A 137 TYR A 138 
AB2 2  TRP B 287 ? ARG B 288 ? TRP A 267 ARG A 268 
AB3 1  GLY B 192 ? VAL B 196 ? GLY A 172 VAL A 176 
AB3 2  ILE B 202 ? GLU B 207 ? ILE A 182 GLU A 187 
AB4 1  VAL B 402 ? ILE B 403 ? VAL A 382 ILE A 383 
AB4 2  LYS B 385 ? ILE B 386 ? LYS A 365 ILE A 366 
AB4 3  ARG B 368 ? ALA B 369 ? ARG A 348 ALA A 349 
AB4 4  ILE B 352 ? SER B 354 ? ILE A 332 SER A 334 
AB4 5  ALA B 329 ? VAL B 332 ? ALA A 309 VAL A 312 
AB4 6  SER C 345 ? VAL C 347 ? SER B 325 VAL B 327 
AB4 7  LEU C 362 ? LEU C 363 ? LEU B 342 LEU B 343 
AB4 8  ARG C 374 ? VAL C 380 ? ARG B 354 VAL B 360 
AB4 9  GLN C 391 ? ILE C 397 ? GLN B 371 ILE B 377 
AB4 10 ILE C 408 ? VAL C 409 ? ILE B 388 VAL B 389 
AB5 1  SER C 341 ? VAL C 343 ? SER B 321 VAL B 323 
AB5 2  ALA C 357 ? ASN C 359 ? ALA B 337 ASN B 339 
AB5 3  ARG C 374 ? VAL C 380 ? ARG B 354 VAL B 360 
AB5 4  GLN C 391 ? ILE C 397 ? GLN B 371 ILE B 377 
AB5 5  CYS C 428 ? ILE C 430 ? CYS B 408 ILE B 410 
AB5 6  ARG C 421 ? ARG C 422 ? ARG B 401 ARG B 402 
AB6 1  SER B 341 ? VAL B 343 ? SER A 321 VAL A 323 
AB6 2  ALA B 357 ? ASN B 359 ? ALA A 337 ASN A 339 
AB6 3  ARG B 374 ? VAL B 380 ? ARG A 354 VAL A 360 
AB6 4  GLN B 391 ? ILE B 397 ? GLN A 371 ILE A 377 
AB6 5  CYS B 428 ? ILE B 430 ? CYS A 408 ILE A 410 
AB6 6  ARG B 421 ? ARG B 422 ? ARG A 401 ARG A 402 
AB7 1  ILE B 408 ? VAL B 409 ? ILE A 388 VAL A 389 
AB7 2  GLN B 391 ? ILE B 397 ? GLN A 371 ILE A 377 
AB7 3  ARG B 374 ? VAL B 380 ? ARG A 354 VAL A 360 
AB7 4  LEU B 362 ? LEU B 363 ? LEU A 342 LEU A 343 
AB7 5  VAL B 346 ? VAL B 347 ? VAL A 326 VAL A 327 
AB7 6  ALA C 329 ? VAL C 332 ? ALA B 309 VAL B 312 
AB7 7  ILE C 352 ? SER C 354 ? ILE B 332 SER B 334 
AB7 8  ARG C 368 ? ALA C 369 ? ARG B 348 ALA B 349 
AB7 9  LYS C 385 ? ILE C 386 ? LYS B 365 ILE B 366 
AB7 10 VAL C 402 ? ILE C 403 ? VAL B 382 ILE B 383 
AB8 1  SER C 111 ? PRO C 116 ? SER B 91  PRO B 96  
AB8 2  ARG C 81  ? THR C 86  ? ARG B 61  THR B 66  
AB8 3  ALA C 33  ? ALA C 39  ? ALA B 13  ALA B 19  
AB8 4  TYR C 148 ? ALA C 153 ? TYR B 128 ALA B 133 
AB8 5  PHE C 221 ? HIS C 232 ? PHE B 201 HIS B 212 
AB8 6  VAL C 176 ? PRO C 184 ? VAL B 156 PRO B 164 
AB8 7  ALA C 267 ? ARG C 271 ? ALA B 247 ARG B 251 
AB9 1  TYR C 59  ? PHE C 60  ? TYR B 39  PHE B 40  
AB9 2  ALA C 64  ? ARG C 65  ? ALA B 44  ARG B 45  
AC1 1  ILE C 157 ? TYR C 158 ? ILE B 137 TYR B 138 
AC1 2  TRP C 287 ? ARG C 288 ? TRP B 267 ARG B 268 
AC2 1  GLY C 192 ? VAL C 196 ? GLY B 172 VAL B 176 
AC2 2  ILE C 202 ? GLU C 207 ? ILE B 182 GLU B 187 
AC3 1  SER D 111 ? PRO D 116 ? SER C 91  PRO C 96  
AC3 2  ARG D 81  ? THR D 86  ? ARG C 61  THR C 66  
AC3 3  ALA D 33  ? LEU D 38  ? ALA C 13  LEU C 18  
AC3 4  TYR D 148 ? ALA D 153 ? TYR C 128 ALA C 133 
AC3 5  PHE D 221 ? HIS D 232 ? PHE C 201 HIS C 212 
AC3 6  GLY D 192 ? VAL D 196 ? GLY C 172 VAL C 176 
AC3 7  ILE D 202 ? GLU D 207 ? ILE C 182 GLU C 187 
AC4 1  SER D 111 ? PRO D 116 ? SER C 91  PRO C 96  
AC4 2  ARG D 81  ? THR D 86  ? ARG C 61  THR C 66  
AC4 3  ALA D 33  ? LEU D 38  ? ALA C 13  LEU C 18  
AC4 4  TYR D 148 ? ALA D 153 ? TYR C 128 ALA C 133 
AC4 5  PHE D 221 ? HIS D 232 ? PHE C 201 HIS C 212 
AC4 6  VAL D 176 ? PRO D 184 ? VAL C 156 PRO C 164 
AC4 7  ALA D 267 ? ARG D 271 ? ALA C 247 ARG C 251 
AC5 1  TYR D 59  ? PHE D 60  ? TYR C 39  PHE C 40  
AC5 2  ALA D 64  ? ARG D 65  ? ALA C 44  ARG C 45  
AC6 1  ILE D 157 ? TYR D 158 ? ILE C 137 TYR C 138 
AC6 2  TRP D 287 ? ARG D 288 ? TRP C 267 ARG C 268 
AC7 1  VAL D 402 ? ILE D 403 ? VAL C 382 ILE C 383 
AC7 2  LYS D 385 ? ILE D 386 ? LYS C 365 ILE C 366 
AC7 3  ARG D 368 ? ALA D 369 ? ARG C 348 ALA C 349 
AC7 4  ILE D 352 ? SER D 354 ? ILE C 332 SER C 334 
AC7 5  ALA D 329 ? VAL D 332 ? ALA C 309 VAL C 312 
AC7 6  SER E 345 ? VAL E 347 ? SER D 325 VAL D 327 
AC7 7  LEU E 362 ? LEU E 363 ? LEU D 342 LEU D 343 
AC7 8  ARG E 374 ? VAL E 380 ? ARG D 354 VAL D 360 
AC7 9  GLN E 391 ? ILE E 397 ? GLN D 371 ILE D 377 
AC7 10 ILE E 408 ? VAL E 409 ? ILE D 388 VAL D 389 
AC8 1  SER E 341 ? VAL E 343 ? SER D 321 VAL D 323 
AC8 2  ALA E 357 ? ASN E 359 ? ALA D 337 ASN D 339 
AC8 3  ARG E 374 ? VAL E 380 ? ARG D 354 VAL D 360 
AC8 4  GLN E 391 ? ILE E 397 ? GLN D 371 ILE D 377 
AC8 5  CYS E 428 ? ILE E 430 ? CYS D 408 ILE D 410 
AC8 6  ARG E 421 ? ARG E 422 ? ARG D 401 ARG D 402 
AC9 1  SER D 341 ? VAL D 343 ? SER C 321 VAL C 323 
AC9 2  ALA D 357 ? ASN D 359 ? ALA C 337 ASN C 339 
AC9 3  ARG D 374 ? VAL D 380 ? ARG C 354 VAL C 360 
AC9 4  GLN D 391 ? ILE D 397 ? GLN C 371 ILE C 377 
AC9 5  CYS D 428 ? ILE D 430 ? CYS C 408 ILE C 410 
AC9 6  ARG D 421 ? ARG D 422 ? ARG C 401 ARG C 402 
AD1 1  ILE D 408 ? VAL D 409 ? ILE C 388 VAL C 389 
AD1 2  GLN D 391 ? ILE D 397 ? GLN C 371 ILE C 377 
AD1 3  ARG D 374 ? VAL D 380 ? ARG C 354 VAL C 360 
AD1 4  LEU D 362 ? LEU D 363 ? LEU C 342 LEU C 343 
AD1 5  SER D 345 ? VAL D 347 ? SER C 325 VAL C 327 
AD1 6  ALA E 329 ? VAL E 332 ? ALA D 309 VAL D 312 
AD1 7  ILE E 352 ? SER E 354 ? ILE D 332 SER D 334 
AD1 8  ARG E 368 ? ALA E 369 ? ARG D 348 ALA D 349 
AD1 9  LYS E 385 ? ILE E 386 ? LYS D 365 ILE D 366 
AD1 10 VAL E 402 ? ILE E 403 ? VAL D 382 ILE D 383 
AD2 1  SER E 111 ? LEU E 115 ? SER D 91  LEU D 95  
AD2 2  ARG E 81  ? ALA E 85  ? ARG D 61  ALA D 65  
AD2 3  ALA E 33  ? LEU E 38  ? ALA D 13  LEU D 18  
AD2 4  TYR E 148 ? ALA E 153 ? TYR D 128 ALA D 133 
AD2 5  ALA E 222 ? HIS E 232 ? ALA D 202 HIS D 212 
AD2 6  GLY E 192 ? VAL E 196 ? GLY D 172 VAL D 176 
AD2 7  ILE E 202 ? GLU E 207 ? ILE D 182 GLU D 187 
AD3 1  SER E 111 ? LEU E 115 ? SER D 91  LEU D 95  
AD3 2  ARG E 81  ? ALA E 85  ? ARG D 61  ALA D 65  
AD3 3  ALA E 33  ? LEU E 38  ? ALA D 13  LEU D 18  
AD3 4  TYR E 148 ? ALA E 153 ? TYR D 128 ALA D 133 
AD3 5  ALA E 222 ? HIS E 232 ? ALA D 202 HIS D 212 
AD3 6  VAL E 176 ? VAL E 183 ? VAL D 156 VAL D 163 
AD3 7  ALA E 267 ? ARG E 271 ? ALA D 247 ARG D 251 
AD4 1  TYR E 59  ? PHE E 60  ? TYR D 39  PHE D 40  
AD4 2  ALA E 64  ? ARG E 65  ? ALA D 44  ARG D 45  
AD5 1  ILE E 157 ? TYR E 158 ? ILE D 137 TYR D 138 
AD5 2  TRP E 287 ? ARG E 288 ? TRP D 267 ARG D 268 
AD6 1  SER F 111 ? PRO F 116 ? SER E 91  PRO E 96  
AD6 2  ARG F 81  ? THR F 86  ? ARG E 61  THR E 66  
AD6 3  ALA F 33  ? LEU F 38  ? ALA E 13  LEU E 18  
AD6 4  TYR F 148 ? ALA F 153 ? TYR E 128 ALA E 133 
AD6 5  PHE F 221 ? HIS F 232 ? PHE E 201 HIS E 212 
AD6 6  GLY F 192 ? VAL F 196 ? GLY E 172 VAL E 176 
AD6 7  ILE F 202 ? GLU F 207 ? ILE E 182 GLU E 187 
AD7 1  SER F 111 ? PRO F 116 ? SER E 91  PRO E 96  
AD7 2  ARG F 81  ? THR F 86  ? ARG E 61  THR E 66  
AD7 3  ALA F 33  ? LEU F 38  ? ALA E 13  LEU E 18  
AD7 4  TYR F 148 ? ALA F 153 ? TYR E 128 ALA E 133 
AD7 5  PHE F 221 ? HIS F 232 ? PHE E 201 HIS E 212 
AD7 6  VAL F 176 ? PRO F 184 ? VAL E 156 PRO E 164 
AD7 7  ALA F 267 ? ARG F 271 ? ALA E 247 ARG E 251 
AD8 1  TYR F 59  ? PHE F 60  ? TYR E 39  PHE E 40  
AD8 2  ALA F 64  ? ARG F 65  ? ALA E 44  ARG E 45  
AD9 1  ILE F 157 ? TYR F 158 ? ILE E 137 TYR E 138 
AD9 2  TRP F 287 ? ARG F 288 ? TRP E 267 ARG E 268 
AE1 1  VAL F 402 ? ILE F 403 ? VAL E 382 ILE E 383 
AE1 2  LYS F 385 ? ILE F 386 ? LYS E 365 ILE E 366 
AE1 3  ARG F 368 ? ALA F 369 ? ARG E 348 ALA E 349 
AE1 4  ILE F 352 ? SER F 354 ? ILE E 332 SER E 334 
AE1 5  ALA F 329 ? VAL F 332 ? ALA E 309 VAL E 312 
AE1 6  SER G 345 ? VAL G 347 ? SER F 325 VAL F 327 
AE1 7  LEU G 362 ? LEU G 363 ? LEU F 342 LEU F 343 
AE1 8  ARG G 374 ? VAL G 380 ? ARG F 354 VAL F 360 
AE1 9  GLN G 391 ? ILE G 397 ? GLN F 371 ILE F 377 
AE1 10 ILE G 408 ? VAL G 409 ? ILE F 388 VAL F 389 
AE2 1  SER G 341 ? VAL G 343 ? SER F 321 VAL F 323 
AE2 2  ALA G 357 ? ASN G 359 ? ALA F 337 ASN F 339 
AE2 3  ARG G 374 ? VAL G 380 ? ARG F 354 VAL F 360 
AE2 4  GLN G 391 ? ILE G 397 ? GLN F 371 ILE F 377 
AE2 5  CYS G 428 ? ILE G 430 ? CYS F 408 ILE F 410 
AE2 6  ARG G 421 ? ARG G 422 ? ARG F 401 ARG F 402 
AE3 1  SER F 341 ? VAL F 343 ? SER E 321 VAL E 323 
AE3 2  ALA F 357 ? ASN F 359 ? ALA E 337 ASN E 339 
AE3 3  ARG F 374 ? VAL F 380 ? ARG E 354 VAL E 360 
AE3 4  GLN F 391 ? ILE F 397 ? GLN E 371 ILE E 377 
AE3 5  CYS F 428 ? ILE F 430 ? CYS E 408 ILE E 410 
AE3 6  ARG F 421 ? ARG F 422 ? ARG E 401 ARG E 402 
AE4 1  ILE F 408 ? VAL F 409 ? ILE E 388 VAL E 389 
AE4 2  GLN F 391 ? ILE F 397 ? GLN E 371 ILE E 377 
AE4 3  ARG F 374 ? VAL F 380 ? ARG E 354 VAL E 360 
AE4 4  LEU F 362 ? LEU F 363 ? LEU E 342 LEU E 343 
AE4 5  SER F 345 ? VAL F 347 ? SER E 325 VAL E 327 
AE4 6  ALA G 329 ? VAL G 332 ? ALA F 309 VAL F 312 
AE4 7  ILE G 352 ? SER G 354 ? ILE F 332 SER F 334 
AE4 8  ARG G 368 ? ALA G 369 ? ARG F 348 ALA F 349 
AE4 9  LYS G 385 ? ILE G 386 ? LYS F 365 ILE F 366 
AE4 10 VAL G 402 ? ILE G 403 ? VAL F 382 ILE F 383 
AE5 1  SER G 111 ? PRO G 116 ? SER F 91  PRO F 96  
AE5 2  ARG G 81  ? THR G 86  ? ARG F 61  THR F 66  
AE5 3  ALA G 33  ? LEU G 38  ? ALA F 13  LEU F 18  
AE5 4  TYR G 148 ? ALA G 153 ? TYR F 128 ALA F 133 
AE5 5  PHE G 221 ? HIS G 232 ? PHE F 201 HIS F 212 
AE5 6  GLY G 192 ? VAL G 196 ? GLY F 172 VAL F 176 
AE5 7  ILE G 202 ? GLU G 207 ? ILE F 182 GLU F 187 
AE6 1  SER G 111 ? PRO G 116 ? SER F 91  PRO F 96  
AE6 2  ARG G 81  ? THR G 86  ? ARG F 61  THR F 66  
AE6 3  ALA G 33  ? LEU G 38  ? ALA F 13  LEU F 18  
AE6 4  TYR G 148 ? ALA G 153 ? TYR F 128 ALA F 133 
AE6 5  PHE G 221 ? HIS G 232 ? PHE F 201 HIS F 212 
AE6 6  VAL G 176 ? PRO G 184 ? VAL F 156 PRO F 164 
AE6 7  ALA G 267 ? ARG G 271 ? ALA F 247 ARG F 251 
AE7 1  TYR G 59  ? PHE G 60  ? TYR F 39  PHE F 40  
AE7 2  ALA G 64  ? ARG G 65  ? ALA F 44  ARG F 45  
AE8 1  ILE G 157 ? TYR G 158 ? ILE F 137 TYR F 138 
AE8 2  TRP G 287 ? ARG G 288 ? TRP F 267 ARG F 268 
AE9 1  SER H 111 ? LEU H 115 ? SER G 91  LEU G 95  
AE9 2  ARG H 81  ? ALA H 85  ? ARG G 61  ALA G 65  
AE9 3  ALA H 33  ? LEU H 38  ? ALA G 13  LEU G 18  
AE9 4  TYR H 148 ? ALA H 153 ? TYR G 128 ALA G 133 
AE9 5  PHE H 221 ? HIS H 232 ? PHE G 201 HIS G 212 
AE9 6  GLY H 192 ? VAL H 196 ? GLY G 172 VAL G 176 
AE9 7  ILE H 202 ? GLU H 207 ? ILE G 182 GLU G 187 
AF1 1  SER H 111 ? LEU H 115 ? SER G 91  LEU G 95  
AF1 2  ARG H 81  ? ALA H 85  ? ARG G 61  ALA G 65  
AF1 3  ALA H 33  ? LEU H 38  ? ALA G 13  LEU G 18  
AF1 4  TYR H 148 ? ALA H 153 ? TYR G 128 ALA G 133 
AF1 5  PHE H 221 ? HIS H 232 ? PHE G 201 HIS G 212 
AF1 6  VAL H 176 ? PRO H 184 ? VAL G 156 PRO G 164 
AF1 7  ALA H 267 ? ARG H 271 ? ALA G 247 ARG G 251 
AF2 1  TYR H 59  ? PHE H 60  ? TYR G 39  PHE G 40  
AF2 2  ALA H 64  ? ARG H 65  ? ALA G 44  ARG G 45  
AF3 1  ILE H 157 ? TYR H 158 ? ILE G 137 TYR G 138 
AF3 2  TRP H 287 ? ARG H 288 ? TRP G 267 ARG G 268 
AF4 1  SER I 111 ? LEU I 115 ? SER I 91  LEU I 95  
AF4 2  ARG I 81  ? THR I 86  ? ARG I 61  THR I 66  
AF4 3  ALA I 33  ? ALA I 39  ? ALA I 13  ALA I 19  
AF4 4  TYR I 148 ? ALA I 153 ? TYR I 128 ALA I 133 
AF4 5  PHE I 221 ? HIS I 232 ? PHE I 201 HIS I 212 
AF4 6  GLY I 192 ? VAL I 196 ? GLY I 172 VAL I 176 
AF4 7  ILE I 202 ? GLU I 207 ? ILE I 182 GLU I 187 
AF5 1  SER I 111 ? LEU I 115 ? SER I 91  LEU I 95  
AF5 2  ARG I 81  ? THR I 86  ? ARG I 61  THR I 66  
AF5 3  ALA I 33  ? ALA I 39  ? ALA I 13  ALA I 19  
AF5 4  TYR I 148 ? ALA I 153 ? TYR I 128 ALA I 133 
AF5 5  PHE I 221 ? HIS I 232 ? PHE I 201 HIS I 212 
AF5 6  VAL I 176 ? PRO I 184 ? VAL I 156 PRO I 164 
AF5 7  ALA I 267 ? ARG I 271 ? ALA I 247 ARG I 251 
AF6 1  TYR I 59  ? PHE I 60  ? TYR I 39  PHE I 40  
AF6 2  ALA I 64  ? ARG I 65  ? ALA I 44  ARG I 45  
AF7 1  ILE I 157 ? TYR I 158 ? ILE I 137 TYR I 138 
AF7 2  TRP I 287 ? ARG I 288 ? TRP I 267 ARG I 268 
AF8 1  VAL I 402 ? ILE I 403 ? VAL I 382 ILE I 383 
AF8 2  LYS I 385 ? ILE I 386 ? LYS I 365 ILE I 366 
AF8 3  ARG I 368 ? ALA I 369 ? ARG I 348 ALA I 349 
AF8 4  ILE I 352 ? SER I 354 ? ILE I 332 SER I 334 
AF8 5  ALA I 329 ? VAL I 332 ? ALA I 309 VAL I 312 
AF8 6  SER J 345 ? VAL J 347 ? SER J 325 VAL J 327 
AF8 7  LEU J 362 ? LEU J 363 ? LEU J 342 LEU J 343 
AF8 8  ARG J 374 ? VAL J 380 ? ARG J 354 VAL J 360 
AF8 9  GLN J 391 ? ILE J 397 ? GLN J 371 ILE J 377 
AF8 10 ILE J 408 ? VAL J 409 ? ILE J 388 VAL J 389 
AF9 1  SER J 341 ? VAL J 343 ? SER J 321 VAL J 323 
AF9 2  ALA J 357 ? ASN J 359 ? ALA J 337 ASN J 339 
AF9 3  ARG J 374 ? VAL J 380 ? ARG J 354 VAL J 360 
AF9 4  GLN J 391 ? ILE J 397 ? GLN J 371 ILE J 377 
AF9 5  CYS J 428 ? ILE J 430 ? CYS J 408 ILE J 410 
AF9 6  ARG J 421 ? ARG J 422 ? ARG J 401 ARG J 402 
AG1 1  SER I 341 ? VAL I 343 ? SER I 321 VAL I 323 
AG1 2  ALA I 357 ? ASN I 359 ? ALA I 337 ASN I 339 
AG1 3  ARG I 374 ? VAL I 380 ? ARG I 354 VAL I 360 
AG1 4  GLN I 391 ? ILE I 397 ? GLN I 371 ILE I 377 
AG1 5  CYS I 428 ? ILE I 430 ? CYS I 408 ILE I 410 
AG1 6  ARG I 421 ? ARG I 422 ? ARG I 401 ARG I 402 
AG2 1  ILE I 408 ? VAL I 409 ? ILE I 388 VAL I 389 
AG2 2  GLN I 391 ? ILE I 397 ? GLN I 371 ILE I 377 
AG2 3  ARG I 374 ? VAL I 380 ? ARG I 354 VAL I 360 
AG2 4  LEU I 362 ? LEU I 363 ? LEU I 342 LEU I 343 
AG2 5  SER I 345 ? VAL I 347 ? SER I 325 VAL I 327 
AG2 6  ALA J 329 ? VAL J 332 ? ALA J 309 VAL J 312 
AG2 7  ILE J 352 ? SER J 354 ? ILE J 332 SER J 334 
AG2 8  ARG J 368 ? ALA J 369 ? ARG J 348 ALA J 349 
AG2 9  LYS J 385 ? ILE J 386 ? LYS J 365 ILE J 366 
AG2 10 VAL J 402 ? ILE J 403 ? VAL J 382 ILE J 383 
AG3 1  SER J 111 ? PRO J 116 ? SER J 91  PRO J 96  
AG3 2  ARG J 81  ? THR J 86  ? ARG J 61  THR J 66  
AG3 3  ALA J 33  ? ALA J 39  ? ALA J 13  ALA J 19  
AG3 4  TYR J 148 ? ALA J 153 ? TYR J 128 ALA J 133 
AG3 5  PHE J 221 ? HIS J 232 ? PHE J 201 HIS J 212 
AG3 6  VAL J 176 ? PRO J 184 ? VAL J 156 PRO J 164 
AG3 7  ALA J 267 ? ARG J 271 ? ALA J 247 ARG J 251 
AG4 1  TYR J 59  ? PHE J 60  ? TYR J 39  PHE J 40  
AG4 2  ALA J 64  ? ARG J 65  ? ALA J 44  ARG J 45  
AG5 1  ILE J 157 ? TYR J 158 ? ILE J 137 TYR J 138 
AG5 2  TRP J 287 ? ARG J 288 ? TRP J 267 ARG J 268 
AG6 1  GLY J 192 ? VAL J 196 ? GLY J 172 VAL J 176 
AG6 2  ILE J 202 ? GLU J 207 ? ILE J 182 GLU J 187 
AG7 1  SER K 111 ? PRO K 116 ? SER K 91  PRO K 96  
AG7 2  ARG K 81  ? THR K 86  ? ARG K 61  THR K 66  
AG7 3  ALA K 33  ? LEU K 38  ? ALA K 13  LEU K 18  
AG7 4  TYR K 148 ? ALA K 153 ? TYR K 128 ALA K 133 
AG7 5  PHE K 221 ? HIS K 232 ? PHE K 201 HIS K 212 
AG7 6  VAL K 176 ? PRO K 184 ? VAL K 156 PRO K 164 
AG7 7  ALA K 267 ? ARG K 271 ? ALA K 247 ARG K 251 
AG8 1  TYR K 59  ? PHE K 60  ? TYR K 39  PHE K 40  
AG8 2  ALA K 64  ? ARG K 65  ? ALA K 44  ARG K 45  
AG9 1  ILE K 157 ? TYR K 158 ? ILE K 137 TYR K 138 
AG9 2  TRP K 287 ? ARG K 288 ? TRP K 267 ARG K 268 
AH1 1  GLY K 192 ? VAL K 196 ? GLY K 172 VAL K 176 
AH1 2  ILE K 202 ? GLU K 207 ? ILE K 182 GLU K 187 
AH2 1  VAL K 402 ? ILE K 403 ? VAL K 382 ILE K 383 
AH2 2  LYS K 385 ? ILE K 386 ? LYS K 365 ILE K 366 
AH2 3  ARG K 368 ? ALA K 369 ? ARG K 348 ALA K 349 
AH2 4  ILE K 352 ? SER K 354 ? ILE K 332 SER K 334 
AH2 5  ALA K 329 ? VAL K 332 ? ALA K 309 VAL K 312 
AH2 6  VAL L 346 ? VAL L 347 ? VAL L 326 VAL L 327 
AH2 7  LEU L 362 ? LEU L 363 ? LEU L 342 LEU L 343 
AH2 8  ARG L 374 ? VAL L 380 ? ARG L 354 VAL L 360 
AH2 9  GLN L 391 ? ILE L 397 ? GLN L 371 ILE L 377 
AH2 10 ILE L 408 ? VAL L 409 ? ILE L 388 VAL L 389 
AH3 1  SER L 341 ? VAL L 343 ? SER L 321 VAL L 323 
AH3 2  ALA L 357 ? ASN L 359 ? ALA L 337 ASN L 339 
AH3 3  ARG L 374 ? VAL L 380 ? ARG L 354 VAL L 360 
AH3 4  GLN L 391 ? ILE L 397 ? GLN L 371 ILE L 377 
AH3 5  CYS L 428 ? ILE L 430 ? CYS L 408 ILE L 410 
AH3 6  ARG L 421 ? ARG L 422 ? ARG L 401 ARG L 402 
AH4 1  SER K 341 ? VAL K 343 ? SER K 321 VAL K 323 
AH4 2  ALA K 357 ? ASN K 359 ? ALA K 337 ASN K 339 
AH4 3  ARG K 374 ? VAL K 380 ? ARG K 354 VAL K 360 
AH4 4  GLN K 391 ? ILE K 397 ? GLN K 371 ILE K 377 
AH4 5  CYS K 428 ? ILE K 430 ? CYS K 408 ILE K 410 
AH4 6  ARG K 421 ? ARG K 422 ? ARG K 401 ARG K 402 
AH5 1  ILE K 408 ? VAL K 409 ? ILE K 388 VAL K 389 
AH5 2  GLN K 391 ? ILE K 397 ? GLN K 371 ILE K 377 
AH5 3  ARG K 374 ? VAL K 380 ? ARG K 354 VAL K 360 
AH5 4  LEU K 362 ? LEU K 363 ? LEU K 342 LEU K 343 
AH5 5  SER K 345 ? VAL K 347 ? SER K 325 VAL K 327 
AH5 6  ALA L 329 ? VAL L 332 ? ALA L 309 VAL L 312 
AH5 7  ILE L 352 ? SER L 354 ? ILE L 332 SER L 334 
AH5 8  ARG L 368 ? ALA L 369 ? ARG L 348 ALA L 349 
AH5 9  LYS L 385 ? ILE L 386 ? LYS L 365 ILE L 366 
AH5 10 VAL L 402 ? ILE L 403 ? VAL L 382 ILE L 383 
AH6 1  SER L 111 ? PRO L 116 ? SER L 91  PRO L 96  
AH6 2  ARG L 81  ? THR L 86  ? ARG L 61  THR L 66  
AH6 3  ALA L 33  ? ALA L 39  ? ALA L 13  ALA L 19  
AH6 4  TYR L 148 ? ALA L 153 ? TYR L 128 ALA L 133 
AH6 5  ALA L 222 ? HIS L 232 ? ALA L 202 HIS L 212 
AH6 6  GLY L 192 ? VAL L 196 ? GLY L 172 VAL L 176 
AH6 7  ILE L 202 ? GLU L 207 ? ILE L 182 GLU L 187 
AH7 1  SER L 111 ? PRO L 116 ? SER L 91  PRO L 96  
AH7 2  ARG L 81  ? THR L 86  ? ARG L 61  THR L 66  
AH7 3  ALA L 33  ? ALA L 39  ? ALA L 13  ALA L 19  
AH7 4  TYR L 148 ? ALA L 153 ? TYR L 128 ALA L 133 
AH7 5  ALA L 222 ? HIS L 232 ? ALA L 202 HIS L 212 
AH7 6  VAL L 176 ? VAL L 183 ? VAL L 156 VAL L 163 
AH7 7  ALA L 267 ? ARG L 271 ? ALA L 247 ARG L 251 
AH8 1  TYR L 59  ? PHE L 60  ? TYR L 39  PHE L 40  
AH8 2  ALA L 64  ? ARG L 65  ? ALA L 44  ARG L 45  
AH9 1  ILE L 157 ? TYR L 158 ? ILE L 137 TYR L 138 
AH9 2  TRP L 287 ? ARG L 288 ? TRP L 267 ARG L 268 
AI1 1  SER M 111 ? PRO M 116 ? SER M 91  PRO M 96  
AI1 2  ARG M 81  ? THR M 86  ? ARG M 61  THR M 66  
AI1 3  ALA M 33  ? ALA M 39  ? ALA M 13  ALA M 19  
AI1 4  TYR M 148 ? ALA M 153 ? TYR M 128 ALA M 133 
AI1 5  PHE M 221 ? HIS M 232 ? PHE M 201 HIS M 212 
AI1 6  VAL M 176 ? PRO M 184 ? VAL M 156 PRO M 164 
AI1 7  ALA M 267 ? ARG M 271 ? ALA M 247 ARG M 251 
AI2 1  TYR M 59  ? PHE M 60  ? TYR M 39  PHE M 40  
AI2 2  ALA M 64  ? ARG M 65  ? ALA M 44  ARG M 45  
AI3 1  ILE M 157 ? TYR M 158 ? ILE M 137 TYR M 138 
AI3 2  TRP M 287 ? ARG M 288 ? TRP M 267 ARG M 268 
AI4 1  GLY M 192 ? VAL M 196 ? GLY M 172 VAL M 176 
AI4 2  ILE M 202 ? GLU M 207 ? ILE M 182 GLU M 187 
AI5 1  VAL M 402 ? ILE M 403 ? VAL M 382 ILE M 383 
AI5 2  LYS M 385 ? ILE M 386 ? LYS M 365 ILE M 366 
AI5 3  ARG M 368 ? ALA M 369 ? ARG M 348 ALA M 349 
AI5 4  ILE M 352 ? SER M 354 ? ILE M 332 SER M 334 
AI5 5  ALA M 329 ? VAL M 332 ? ALA M 309 VAL M 312 
AI5 6  SER N 345 ? VAL N 347 ? SER N 325 VAL N 327 
AI5 7  LEU N 362 ? LEU N 363 ? LEU N 342 LEU N 343 
AI5 8  ARG N 374 ? VAL N 380 ? ARG N 354 VAL N 360 
AI5 9  GLN N 391 ? ILE N 397 ? GLN N 371 ILE N 377 
AI5 10 ILE N 408 ? VAL N 409 ? ILE N 388 VAL N 389 
AI6 1  SER N 341 ? VAL N 343 ? SER N 321 VAL N 323 
AI6 2  ALA N 357 ? ASN N 359 ? ALA N 337 ASN N 339 
AI6 3  ARG N 374 ? VAL N 380 ? ARG N 354 VAL N 360 
AI6 4  GLN N 391 ? ILE N 397 ? GLN N 371 ILE N 377 
AI6 5  CYS N 428 ? ILE N 430 ? CYS N 408 ILE N 410 
AI6 6  ARG N 421 ? ARG N 422 ? ARG N 401 ARG N 402 
AI7 1  SER M 341 ? VAL M 343 ? SER M 321 VAL M 323 
AI7 2  ALA M 357 ? ASN M 359 ? ALA M 337 ASN M 339 
AI7 3  ARG M 374 ? VAL M 380 ? ARG M 354 VAL M 360 
AI7 4  GLN M 391 ? ILE M 397 ? GLN M 371 ILE M 377 
AI7 5  CYS M 428 ? ILE M 430 ? CYS M 408 ILE M 410 
AI7 6  ARG M 421 ? ARG M 422 ? ARG M 401 ARG M 402 
AI8 1  ILE M 408 ? VAL M 409 ? ILE M 388 VAL M 389 
AI8 2  GLN M 391 ? ILE M 397 ? GLN M 371 ILE M 377 
AI8 3  ARG M 374 ? VAL M 380 ? ARG M 354 VAL M 360 
AI8 4  LEU M 362 ? LEU M 363 ? LEU M 342 LEU M 343 
AI8 5  SER M 345 ? VAL M 347 ? SER M 325 VAL M 327 
AI8 6  ALA N 329 ? VAL N 332 ? ALA N 309 VAL N 312 
AI8 7  ILE N 352 ? SER N 354 ? ILE N 332 SER N 334 
AI8 8  ARG N 368 ? ALA N 369 ? ARG N 348 ALA N 349 
AI8 9  LYS N 385 ? ILE N 386 ? LYS N 365 ILE N 366 
AI8 10 VAL N 402 ? ILE N 403 ? VAL N 382 ILE N 383 
AI9 1  SER N 111 ? PRO N 116 ? SER N 91  PRO N 96  
AI9 2  ARG N 81  ? THR N 86  ? ARG N 61  THR N 66  
AI9 3  ALA N 33  ? ALA N 39  ? ALA N 13  ALA N 19  
AI9 4  TYR N 148 ? ALA N 153 ? TYR N 128 ALA N 133 
AI9 5  PHE N 221 ? HIS N 232 ? PHE N 201 HIS N 212 
AI9 6  GLY N 192 ? VAL N 196 ? GLY N 172 VAL N 176 
AI9 7  ILE N 202 ? GLU N 207 ? ILE N 182 GLU N 187 
AJ1 1  SER N 111 ? PRO N 116 ? SER N 91  PRO N 96  
AJ1 2  ARG N 81  ? THR N 86  ? ARG N 61  THR N 66  
AJ1 3  ALA N 33  ? ALA N 39  ? ALA N 13  ALA N 19  
AJ1 4  TYR N 148 ? ALA N 153 ? TYR N 128 ALA N 133 
AJ1 5  PHE N 221 ? HIS N 232 ? PHE N 201 HIS N 212 
AJ1 6  VAL N 176 ? PRO N 184 ? VAL N 156 PRO N 164 
AJ1 7  ALA N 267 ? ARG N 271 ? ALA N 247 ARG N 251 
AJ2 1  TYR N 59  ? PHE N 60  ? TYR N 39  PHE N 40  
AJ2 2  ALA N 64  ? ARG N 65  ? ALA N 44  ARG N 45  
AJ3 1  ILE N 157 ? TYR N 158 ? ILE N 137 TYR N 138 
AJ3 2  TRP N 287 ? ARG N 288 ? TRP N 267 ARG N 268 
AJ4 1  SER O 111 ? LEU O 115 ? SER O 91  LEU O 95  
AJ4 2  ARG O 81  ? ALA O 85  ? ARG O 61  ALA O 65  
AJ4 3  ALA O 33  ? LEU O 38  ? ALA O 13  LEU O 18  
AJ4 4  TYR O 148 ? ALA O 153 ? TYR O 128 ALA O 133 
AJ4 5  PHE O 221 ? HIS O 232 ? PHE O 201 HIS O 212 
AJ4 6  GLY O 192 ? VAL O 196 ? GLY O 172 VAL O 176 
AJ4 7  ILE O 202 ? GLU O 207 ? ILE O 182 GLU O 187 
AJ5 1  SER O 111 ? LEU O 115 ? SER O 91  LEU O 95  
AJ5 2  ARG O 81  ? ALA O 85  ? ARG O 61  ALA O 65  
AJ5 3  ALA O 33  ? LEU O 38  ? ALA O 13  LEU O 18  
AJ5 4  TYR O 148 ? ALA O 153 ? TYR O 128 ALA O 133 
AJ5 5  PHE O 221 ? HIS O 232 ? PHE O 201 HIS O 212 
AJ5 6  VAL O 176 ? PRO O 184 ? VAL O 156 PRO O 164 
AJ5 7  ALA O 267 ? ARG O 271 ? ALA O 247 ARG O 251 
AJ6 1  TYR O 59  ? PHE O 60  ? TYR O 39  PHE O 40  
AJ6 2  ALA O 64  ? ARG O 65  ? ALA O 44  ARG O 45  
AJ7 1  ILE O 157 ? TYR O 158 ? ILE O 137 TYR O 138 
AJ7 2  TRP O 287 ? ARG O 288 ? TRP O 267 ARG O 268 
AJ8 1  VAL O 402 ? ILE O 403 ? VAL O 382 ILE O 383 
AJ8 2  LYS O 385 ? ILE O 386 ? LYS O 365 ILE O 366 
AJ8 3  ARG O 368 ? ALA O 369 ? ARG O 348 ALA O 349 
AJ8 4  ILE O 352 ? SER O 354 ? ILE O 332 SER O 334 
AJ8 5  ALA O 329 ? VAL O 332 ? ALA O 309 VAL O 312 
AJ8 6  SER P 345 ? VAL P 347 ? SER P 325 VAL P 327 
AJ8 7  LEU P 362 ? LEU P 363 ? LEU P 342 LEU P 343 
AJ8 8  ARG P 374 ? VAL P 380 ? ARG P 354 VAL P 360 
AJ8 9  GLN P 391 ? ILE P 397 ? GLN P 371 ILE P 377 
AJ8 10 ILE P 408 ? VAL P 409 ? ILE P 388 VAL P 389 
AJ9 1  SER P 341 ? VAL P 343 ? SER P 321 VAL P 323 
AJ9 2  ALA P 357 ? ASN P 359 ? ALA P 337 ASN P 339 
AJ9 3  ARG P 374 ? VAL P 380 ? ARG P 354 VAL P 360 
AJ9 4  GLN P 391 ? ILE P 397 ? GLN P 371 ILE P 377 
AJ9 5  CYS P 428 ? ILE P 430 ? CYS P 408 ILE P 410 
AJ9 6  ARG P 421 ? ARG P 422 ? ARG P 401 ARG P 402 
AK1 1  SER O 341 ? VAL O 343 ? SER O 321 VAL O 323 
AK1 2  ALA O 357 ? ASN O 359 ? ALA O 337 ASN O 339 
AK1 3  ARG O 374 ? VAL O 380 ? ARG O 354 VAL O 360 
AK1 4  GLN O 391 ? ILE O 397 ? GLN O 371 ILE O 377 
AK1 5  CYS O 428 ? ILE O 430 ? CYS O 408 ILE O 410 
AK1 6  ARG O 421 ? ARG O 422 ? ARG O 401 ARG O 402 
AK2 1  ILE O 408 ? VAL O 409 ? ILE O 388 VAL O 389 
AK2 2  GLN O 391 ? ILE O 397 ? GLN O 371 ILE O 377 
AK2 3  ARG O 374 ? VAL O 380 ? ARG O 354 VAL O 360 
AK2 4  LEU O 362 ? LEU O 363 ? LEU O 342 LEU O 343 
AK2 5  SER O 345 ? VAL O 347 ? SER O 325 VAL O 327 
AK2 6  ALA P 329 ? VAL P 332 ? ALA P 309 VAL P 312 
AK2 7  ILE P 352 ? SER P 354 ? ILE P 332 SER P 334 
AK2 8  ARG P 368 ? ALA P 369 ? ARG P 348 ALA P 349 
AK2 9  LYS P 385 ? ILE P 386 ? LYS P 365 ILE P 366 
AK2 10 VAL P 402 ? ILE P 403 ? VAL P 382 ILE P 383 
AK3 1  SER P 111 ? PRO P 116 ? SER P 91  PRO P 96  
AK3 2  ARG P 81  ? THR P 86  ? ARG P 61  THR P 66  
AK3 3  ALA P 33  ? LEU P 38  ? ALA P 13  LEU P 18  
AK3 4  TYR P 148 ? ALA P 153 ? TYR P 128 ALA P 133 
AK3 5  PHE P 221 ? HIS P 232 ? PHE P 201 HIS P 212 
AK3 6  VAL P 176 ? PRO P 184 ? VAL P 156 PRO P 164 
AK3 7  ALA P 267 ? ARG P 271 ? ALA P 247 ARG P 251 
AK4 1  TYR P 59  ? PHE P 60  ? TYR P 39  PHE P 40  
AK4 2  ALA P 64  ? ARG P 65  ? ALA P 44  ARG P 45  
AK5 1  ILE P 157 ? TYR P 158 ? ILE P 137 TYR P 138 
AK5 2  TRP P 287 ? ARG P 288 ? TRP P 267 ARG P 268 
AK6 1  GLY P 192 ? VAL P 196 ? GLY P 172 VAL P 176 
AK6 2  ILE P 202 ? GLU P 207 ? ILE P 182 GLU P 187 
AK7 1  SER Q 111 ? PRO Q 116 ? SER Q 91  PRO Q 96  
AK7 2  ARG Q 81  ? THR Q 86  ? ARG Q 61  THR Q 66  
AK7 3  ALA Q 33  ? LEU Q 38  ? ALA Q 13  LEU Q 18  
AK7 4  TYR Q 148 ? ALA Q 153 ? TYR Q 128 ALA Q 133 
AK7 5  PHE Q 221 ? HIS Q 232 ? PHE Q 201 HIS Q 212 
AK7 6  GLY Q 192 ? VAL Q 196 ? GLY Q 172 VAL Q 176 
AK7 7  ILE Q 202 ? GLU Q 207 ? ILE Q 182 GLU Q 187 
AK8 1  SER Q 111 ? PRO Q 116 ? SER Q 91  PRO Q 96  
AK8 2  ARG Q 81  ? THR Q 86  ? ARG Q 61  THR Q 66  
AK8 3  ALA Q 33  ? LEU Q 38  ? ALA Q 13  LEU Q 18  
AK8 4  TYR Q 148 ? ALA Q 153 ? TYR Q 128 ALA Q 133 
AK8 5  PHE Q 221 ? HIS Q 232 ? PHE Q 201 HIS Q 212 
AK8 6  VAL Q 176 ? PRO Q 184 ? VAL Q 156 PRO Q 164 
AK8 7  ALA Q 267 ? ARG Q 271 ? ALA Q 247 ARG Q 251 
AK9 1  TYR Q 59  ? PHE Q 60  ? TYR Q 39  PHE Q 40  
AK9 2  ALA Q 64  ? ARG Q 65  ? ALA Q 44  ARG Q 45  
AL1 1  ILE Q 157 ? TYR Q 158 ? ILE Q 137 TYR Q 138 
AL1 2  TRP Q 287 ? ARG Q 288 ? TRP Q 267 ARG Q 268 
AL2 1  VAL Q 402 ? ILE Q 403 ? VAL Q 382 ILE Q 383 
AL2 2  LYS Q 385 ? ILE Q 386 ? LYS Q 365 ILE Q 366 
AL2 3  ARG Q 368 ? ALA Q 369 ? ARG Q 348 ALA Q 349 
AL2 4  ILE Q 352 ? SER Q 354 ? ILE Q 332 SER Q 334 
AL2 5  ALA Q 329 ? VAL Q 332 ? ALA Q 309 VAL Q 312 
AL2 6  SER R 345 ? VAL R 347 ? SER R 325 VAL R 327 
AL2 7  LEU R 362 ? LEU R 363 ? LEU R 342 LEU R 343 
AL2 8  ARG R 374 ? VAL R 380 ? ARG R 354 VAL R 360 
AL2 9  GLN R 391 ? ILE R 397 ? GLN R 371 ILE R 377 
AL2 10 ILE R 408 ? VAL R 409 ? ILE R 388 VAL R 389 
AL3 1  SER R 341 ? VAL R 343 ? SER R 321 VAL R 323 
AL3 2  ALA R 357 ? ASN R 359 ? ALA R 337 ASN R 339 
AL3 3  ARG R 374 ? VAL R 380 ? ARG R 354 VAL R 360 
AL3 4  GLN R 391 ? ILE R 397 ? GLN R 371 ILE R 377 
AL3 5  CYS R 428 ? ILE R 430 ? CYS R 408 ILE R 410 
AL3 6  ARG R 421 ? ARG R 422 ? ARG R 401 ARG R 402 
AL4 1  SER Q 341 ? VAL Q 343 ? SER Q 321 VAL Q 323 
AL4 2  ALA Q 357 ? ASN Q 359 ? ALA Q 337 ASN Q 339 
AL4 3  ARG Q 374 ? VAL Q 380 ? ARG Q 354 VAL Q 360 
AL4 4  GLN Q 391 ? ILE Q 397 ? GLN Q 371 ILE Q 377 
AL4 5  CYS Q 428 ? ILE Q 430 ? CYS Q 408 ILE Q 410 
AL4 6  ARG Q 421 ? ARG Q 422 ? ARG Q 401 ARG Q 402 
AL5 1  ILE Q 408 ? VAL Q 409 ? ILE Q 388 VAL Q 389 
AL5 2  GLN Q 391 ? ILE Q 397 ? GLN Q 371 ILE Q 377 
AL5 3  ARG Q 374 ? VAL Q 380 ? ARG Q 354 VAL Q 360 
AL5 4  LEU Q 362 ? LEU Q 363 ? LEU Q 342 LEU Q 343 
AL5 5  SER Q 345 ? VAL Q 347 ? SER Q 325 VAL Q 327 
AL5 6  ALA R 329 ? VAL R 332 ? ALA R 309 VAL R 312 
AL5 7  ILE R 352 ? SER R 354 ? ILE R 332 SER R 334 
AL5 8  ARG R 368 ? ALA R 369 ? ARG R 348 ALA R 349 
AL5 9  LYS R 385 ? ILE R 386 ? LYS R 365 ILE R 366 
AL5 10 VAL R 402 ? ILE R 403 ? VAL R 382 ILE R 383 
AL6 1  SER R 111 ? PRO R 116 ? SER R 91  PRO R 96  
AL6 2  ARG R 81  ? THR R 86  ? ARG R 61  THR R 66  
AL6 3  ALA R 33  ? ALA R 39  ? ALA R 13  ALA R 19  
AL6 4  TYR R 148 ? ALA R 153 ? TYR R 128 ALA R 133 
AL6 5  PHE R 221 ? HIS R 232 ? PHE R 201 HIS R 212 
AL6 6  GLY R 192 ? VAL R 196 ? GLY R 172 VAL R 176 
AL6 7  ILE R 202 ? GLU R 207 ? ILE R 182 GLU R 187 
AL7 1  SER R 111 ? PRO R 116 ? SER R 91  PRO R 96  
AL7 2  ARG R 81  ? THR R 86  ? ARG R 61  THR R 66  
AL7 3  ALA R 33  ? ALA R 39  ? ALA R 13  ALA R 19  
AL7 4  TYR R 148 ? ALA R 153 ? TYR R 128 ALA R 133 
AL7 5  PHE R 221 ? HIS R 232 ? PHE R 201 HIS R 212 
AL7 6  VAL R 176 ? PRO R 184 ? VAL R 156 PRO R 164 
AL7 7  ALA R 267 ? ARG R 271 ? ALA R 247 ARG R 251 
AL8 1  TYR R 59  ? PHE R 60  ? TYR R 39  PHE R 40  
AL8 2  ALA R 64  ? ARG R 65  ? ALA R 44  ARG R 45  
AL9 1  ILE R 157 ? TYR R 158 ? ILE R 137 TYR R 138 
AL9 2  TRP R 287 ? ARG R 288 ? TRP R 267 ARG R 268 
AM1 1  SER S 111 ? LEU S 115 ? SER V 91  LEU V 95  
AM1 2  ARG S 81  ? THR S 86  ? ARG V 61  THR V 66  
AM1 3  ALA S 33  ? ALA S 39  ? ALA V 13  ALA V 19  
AM1 4  TYR S 148 ? ALA S 153 ? TYR V 128 ALA V 133 
AM1 5  PHE S 221 ? HIS S 232 ? PHE V 201 HIS V 212 
AM1 6  GLY S 192 ? VAL S 196 ? GLY V 172 VAL V 176 
AM1 7  ILE S 202 ? GLU S 207 ? ILE V 182 GLU V 187 
AM2 1  SER S 111 ? LEU S 115 ? SER V 91  LEU V 95  
AM2 2  ARG S 81  ? THR S 86  ? ARG V 61  THR V 66  
AM2 3  ALA S 33  ? ALA S 39  ? ALA V 13  ALA V 19  
AM2 4  TYR S 148 ? ALA S 153 ? TYR V 128 ALA V 133 
AM2 5  PHE S 221 ? HIS S 232 ? PHE V 201 HIS V 212 
AM2 6  VAL S 176 ? PRO S 184 ? VAL V 156 PRO V 164 
AM2 7  ALA S 267 ? ARG S 271 ? ALA V 247 ARG V 251 
AM3 1  TYR S 59  ? PHE S 60  ? TYR V 39  PHE V 40  
AM3 2  ALA S 64  ? ARG S 65  ? ALA V 44  ARG V 45  
AM4 1  ILE S 157 ? TYR S 158 ? ILE V 137 TYR V 138 
AM4 2  TRP S 287 ? ARG S 288 ? TRP V 267 ARG V 268 
AM5 1  VAL S 402 ? ILE S 403 ? VAL V 382 ILE V 383 
AM5 2  LYS S 385 ? ILE S 386 ? LYS V 365 ILE V 366 
AM5 3  ARG S 368 ? ALA S 369 ? ARG V 348 ALA V 349 
AM5 4  ILE S 352 ? SER S 354 ? ILE V 332 SER V 334 
AM5 5  ALA S 329 ? VAL S 332 ? ALA V 309 VAL V 312 
AM5 6  SER T 345 ? VAL T 347 ? SER T 325 VAL T 327 
AM5 7  LEU T 362 ? LEU T 363 ? LEU T 342 LEU T 343 
AM5 8  ARG T 374 ? VAL T 380 ? ARG T 354 VAL T 360 
AM5 9  GLN T 391 ? ILE T 397 ? GLN T 371 ILE T 377 
AM5 10 ILE T 408 ? VAL T 409 ? ILE T 388 VAL T 389 
AM6 1  SER T 341 ? VAL T 343 ? SER T 321 VAL T 323 
AM6 2  ALA T 357 ? ASN T 359 ? ALA T 337 ASN T 339 
AM6 3  ARG T 374 ? VAL T 380 ? ARG T 354 VAL T 360 
AM6 4  GLN T 391 ? ILE T 397 ? GLN T 371 ILE T 377 
AM6 5  CYS T 428 ? ILE T 430 ? CYS T 408 ILE T 410 
AM6 6  ARG T 421 ? ARG T 422 ? ARG T 401 ARG T 402 
AM7 1  SER S 341 ? VAL S 343 ? SER V 321 VAL V 323 
AM7 2  ALA S 357 ? ASN S 359 ? ALA V 337 ASN V 339 
AM7 3  ARG S 374 ? VAL S 380 ? ARG V 354 VAL V 360 
AM7 4  GLN S 391 ? ILE S 397 ? GLN V 371 ILE V 377 
AM7 5  CYS S 428 ? ILE S 430 ? CYS V 408 ILE V 410 
AM7 6  ARG S 421 ? ARG S 422 ? ARG V 401 ARG V 402 
AM8 1  ILE S 408 ? VAL S 409 ? ILE V 388 VAL V 389 
AM8 2  GLN S 391 ? ILE S 397 ? GLN V 371 ILE V 377 
AM8 3  ARG S 374 ? VAL S 380 ? ARG V 354 VAL V 360 
AM8 4  LEU S 362 ? LEU S 363 ? LEU V 342 LEU V 343 
AM8 5  SER S 345 ? VAL S 347 ? SER V 325 VAL V 327 
AM8 6  ALA T 329 ? VAL T 332 ? ALA T 309 VAL T 312 
AM8 7  ILE T 352 ? SER T 354 ? ILE T 332 SER T 334 
AM8 8  ARG T 368 ? ALA T 369 ? ARG T 348 ALA T 349 
AM8 9  LYS T 385 ? ILE T 386 ? LYS T 365 ILE T 366 
AM8 10 VAL T 402 ? ILE T 403 ? VAL T 382 ILE T 383 
AM9 1  SER T 111 ? PRO T 116 ? SER T 91  PRO T 96  
AM9 2  ARG T 81  ? THR T 86  ? ARG T 61  THR T 66  
AM9 3  ALA T 33  ? ALA T 39  ? ALA T 13  ALA T 19  
AM9 4  TYR T 148 ? ALA T 153 ? TYR T 128 ALA T 133 
AM9 5  PHE T 221 ? HIS T 232 ? PHE T 201 HIS T 212 
AM9 6  GLY T 192 ? VAL T 196 ? GLY T 172 VAL T 176 
AM9 7  ILE T 202 ? GLU T 207 ? ILE T 182 GLU T 187 
AN1 1  SER T 111 ? PRO T 116 ? SER T 91  PRO T 96  
AN1 2  ARG T 81  ? THR T 86  ? ARG T 61  THR T 66  
AN1 3  ALA T 33  ? ALA T 39  ? ALA T 13  ALA T 19  
AN1 4  TYR T 148 ? ALA T 153 ? TYR T 128 ALA T 133 
AN1 5  PHE T 221 ? HIS T 232 ? PHE T 201 HIS T 212 
AN1 6  VAL T 176 ? PRO T 184 ? VAL T 156 PRO T 164 
AN1 7  ALA T 267 ? ARG T 271 ? ALA T 247 ARG T 251 
AN2 1  TYR T 59  ? PHE T 60  ? TYR T 39  PHE T 40  
AN2 2  ALA T 64  ? ARG T 65  ? ALA T 44  ARG T 45  
AN3 1  ILE T 157 ? TYR T 158 ? ILE T 137 TYR T 138 
AN3 2  TRP T 287 ? ARG T 288 ? TRP T 267 ARG T 268 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  O LEU A 115 ? O LEU H 95  N VAL A 84  ? N VAL H 64  
AA1 2 3  O GLY A 83  ? O GLY H 63  N VAL A 37  ? N VAL H 17  
AA1 3 4  N TYR A 36  ? N TYR H 16  O VAL A 150 ? O VAL H 130 
AA1 4 5  N ILE A 151 ? N ILE H 131 O TYR A 229 ? O TYR H 209 
AA1 5 6  O SER A 225 ? O SER H 205 N GLY A 192 ? N GLY H 172 
AA1 6 7  N HIS A 195 ? N HIS H 175 O ASP A 204 ? O ASP H 184 
AA2 1 2  O LEU A 115 ? O LEU H 95  N VAL A 84  ? N VAL H 64  
AA2 2 3  O GLY A 83  ? O GLY H 63  N VAL A 37  ? N VAL H 17  
AA2 3 4  N TYR A 36  ? N TYR H 16  O VAL A 150 ? O VAL H 130 
AA2 4 5  N ILE A 151 ? N ILE H 131 O TYR A 229 ? O TYR H 209 
AA2 5 6  O ALA A 222 ? O ALA H 202 N VAL A 183 ? N VAL H 163 
AA2 6 7  N CYS A 180 ? N CYS H 160 O HIS A 270 ? O HIS H 250 
AA3 1 2  N PHE A 60  ? N PHE H 40  O ALA A 64  ? O ALA H 44  
AA4 1 2  N ILE A 157 ? N ILE H 137 O ARG A 288 ? O ARG H 268 
AA5 1 2  O ILE A 403 ? O ILE H 383 N LYS A 385 ? N LYS H 365 
AA5 2 3  O ILE A 386 ? O ILE H 366 N ARG A 368 ? N ARG H 348 
AA5 3 4  O ALA A 369 ? O ALA H 349 N SER A 354 ? N SER H 334 
AA5 4 5  O ILE A 353 ? O ILE H 333 N LYS A 330 ? N LYS H 310 
AA5 5 6  N ALA A 329 ? N ALA H 309 O VAL H 347 ? O VAL G 327 
AA5 6 7  N VAL H 346 ? N VAL G 326 O LEU H 363 ? O LEU G 343 
AA5 7 8  N LEU H 362 ? N LEU G 342 O VAL H 380 ? O VAL G 360 
AA5 8 9  N VAL H 379 ? N VAL G 359 O ILE H 397 ? O ILE G 377 
AA5 9 10 N GLN H 391 ? N GLN G 371 O VAL H 409 ? O VAL G 389 
AA6 1 2  N SER H 341 ? N SER G 321 O LEU H 358 ? O LEU G 338 
AA6 2 3  N ALA H 357 ? N ALA G 337 O LEU H 375 ? O LEU G 355 
AA6 3 4  N VAL H 379 ? N VAL G 359 O ILE H 397 ? O ILE G 377 
AA6 4 5  N VAL H 396 ? N VAL G 376 O ILE H 430 ? O ILE G 410 
AA6 5 6  O LEU H 429 ? O LEU G 409 N ARG H 421 ? N ARG G 401 
AA7 1 2  N VAL A 343 ? N VAL H 323 O LEU A 358 ? O LEU H 338 
AA7 2 3  N ALA A 357 ? N ALA H 337 O LEU A 375 ? O LEU H 355 
AA7 3 4  N VAL A 379 ? N VAL H 359 O ILE A 397 ? O ILE H 377 
AA7 4 5  N VAL A 396 ? N VAL H 376 O ILE A 430 ? O ILE H 410 
AA7 5 6  O LEU A 429 ? O LEU H 409 N ARG A 421 ? N ARG H 401 
AA8 1 2  O VAL A 409 ? O VAL H 389 N GLN A 391 ? N GLN H 371 
AA8 2 3  O ILE A 397 ? O ILE H 377 N VAL A 379 ? N VAL H 359 
AA8 3 4  O VAL A 380 ? O VAL H 360 N LEU A 362 ? N LEU H 342 
AA8 4 5  O LEU A 363 ? O LEU H 343 N VAL A 346 ? N VAL H 326 
AA8 5 6  N SER A 345 ? N SER H 325 O PHE H 331 ? O PHE G 311 
AA8 6 7  N LYS H 330 ? N LYS G 310 O ILE H 353 ? O ILE G 333 
AA8 7 8  N SER H 354 ? N SER G 334 O ALA H 369 ? O ALA G 349 
AA8 8 9  N ARG H 368 ? N ARG G 348 O ILE H 386 ? O ILE G 366 
AA8 9 10 N LYS H 385 ? N LYS G 365 O ILE H 403 ? O ILE G 383 
AA9 1 2  O LEU B 115 ? O LEU A 95  N VAL B 84  ? N VAL A 64  
AA9 2 3  O ALA B 85  ? O ALA A 65  N VAL B 37  ? N VAL A 17  
AA9 3 4  N MET B 34  ? N MET A 14  O VAL B 150 ? O VAL A 130 
AA9 4 5  N ILE B 151 ? N ILE A 131 O TYR B 229 ? O TYR A 209 
AA9 5 6  O ALA B 222 ? O ALA A 202 N VAL B 183 ? N VAL A 163 
AA9 6 7  N ILE B 178 ? N ILE A 158 O HIS B 270 ? O HIS A 250 
AB1 1 2  N PHE B 60  ? N PHE A 40  O ALA B 64  ? O ALA A 44  
AB2 1 2  N ILE B 157 ? N ILE A 137 O ARG B 288 ? O ARG A 268 
AB3 1 2  N VAL B 193 ? N VAL A 173 O ILE B 206 ? O ILE A 186 
AB4 1 2  O ILE B 403 ? O ILE A 383 N LYS B 385 ? N LYS A 365 
AB4 2 3  O ILE B 386 ? O ILE A 366 N ARG B 368 ? N ARG A 348 
AB4 3 4  O ALA B 369 ? O ALA A 349 N SER B 354 ? N SER A 334 
AB4 4 5  O ILE B 353 ? O ILE A 333 N LYS B 330 ? N LYS A 310 
AB4 5 6  N ALA B 329 ? N ALA A 309 O VAL C 347 ? O VAL B 327 
AB4 6 7  N VAL C 346 ? N VAL B 326 O LEU C 363 ? O LEU B 343 
AB4 7 8  N LEU C 362 ? N LEU B 342 O VAL C 380 ? O VAL B 360 
AB4 8 9  N VAL C 379 ? N VAL B 359 O ILE C 397 ? O ILE B 377 
AB4 9 10 N GLN C 391 ? N GLN B 371 O VAL C 409 ? O VAL B 389 
AB5 1 2  N SER C 341 ? N SER B 321 O LEU C 358 ? O LEU B 338 
AB5 2 3  N ASN C 359 ? N ASN B 339 O LEU C 375 ? O LEU B 355 
AB5 3 4  N VAL C 379 ? N VAL B 359 O ILE C 397 ? O ILE B 377 
AB5 4 5  N VAL C 396 ? N VAL B 376 O ILE C 430 ? O ILE B 410 
AB5 5 6  O LEU C 429 ? O LEU B 409 N ARG C 421 ? N ARG B 401 
AB6 1 2  N SER B 341 ? N SER A 321 O LEU B 358 ? O LEU A 338 
AB6 2 3  N ALA B 357 ? N ALA A 337 O LEU B 375 ? O LEU A 355 
AB6 3 4  N VAL B 379 ? N VAL A 359 O ILE B 397 ? O ILE A 377 
AB6 4 5  N VAL B 396 ? N VAL A 376 O ILE B 430 ? O ILE A 410 
AB6 5 6  O LEU B 429 ? O LEU A 409 N ARG B 421 ? N ARG A 401 
AB7 1 2  O VAL B 409 ? O VAL A 389 N GLN B 391 ? N GLN A 371 
AB7 2 3  O ILE B 397 ? O ILE A 377 N VAL B 379 ? N VAL A 359 
AB7 3 4  O VAL B 380 ? O VAL A 360 N LEU B 362 ? N LEU A 342 
AB7 4 5  O LEU B 363 ? O LEU A 343 N VAL B 346 ? N VAL A 326 
AB7 5 6  N VAL B 347 ? N VAL A 327 O ALA C 329 ? O ALA B 309 
AB7 6 7  N LYS C 330 ? N LYS B 310 O ILE C 353 ? O ILE B 333 
AB7 7 8  N SER C 354 ? N SER B 334 O ALA C 369 ? O ALA B 349 
AB7 8 9  N ARG C 368 ? N ARG B 348 O ILE C 386 ? O ILE B 366 
AB7 9 10 N LYS C 385 ? N LYS B 365 O ILE C 403 ? O ILE B 383 
AB8 1 2  O LEU C 115 ? O LEU B 95  N VAL C 84  ? N VAL B 64  
AB8 2 3  O GLY C 83  ? O GLY B 63  N VAL C 37  ? N VAL B 17  
AB8 3 4  N LEU C 38  ? N LEU B 18  O LEU C 152 ? O LEU B 132 
AB8 4 5  N ILE C 151 ? N ILE B 131 O TYR C 229 ? O TYR B 209 
AB8 5 6  O ALA C 222 ? O ALA B 202 N VAL C 183 ? N VAL B 163 
AB8 6 7  N ILE C 178 ? N ILE B 158 O HIS C 270 ? O HIS B 250 
AB9 1 2  N PHE C 60  ? N PHE B 40  O ALA C 64  ? O ALA B 44  
AC1 1 2  N ILE C 157 ? N ILE B 137 O ARG C 288 ? O ARG B 268 
AC2 1 2  N HIS C 195 ? N HIS B 175 O ILE C 203 ? O ILE B 183 
AC3 1 2  O LEU D 115 ? O LEU C 95  N VAL D 84  ? N VAL C 64  
AC3 2 3  O GLY D 83  ? O GLY C 63  N VAL D 37  ? N VAL C 17  
AC3 3 4  N TYR D 36  ? N TYR C 16  O LEU D 152 ? O LEU C 132 
AC3 4 5  N ILE D 151 ? N ILE C 131 O TYR D 229 ? O TYR C 209 
AC3 5 6  O SER D 225 ? O SER C 205 N GLY D 192 ? N GLY C 172 
AC3 6 7  N HIS D 195 ? N HIS C 175 O ILE D 203 ? O ILE C 183 
AC4 1 2  O LEU D 115 ? O LEU C 95  N VAL D 84  ? N VAL C 64  
AC4 2 3  O GLY D 83  ? O GLY C 63  N VAL D 37  ? N VAL C 17  
AC4 3 4  N TYR D 36  ? N TYR C 16  O LEU D 152 ? O LEU C 132 
AC4 4 5  N ILE D 151 ? N ILE C 131 O TYR D 229 ? O TYR C 209 
AC4 5 6  O ALA D 224 ? O ALA C 204 N LEU D 181 ? N LEU C 161 
AC4 6 7  N ILE D 178 ? N ILE C 158 O HIS D 270 ? O HIS C 250 
AC5 1 2  N PHE D 60  ? N PHE C 40  O ALA D 64  ? O ALA C 44  
AC6 1 2  N ILE D 157 ? N ILE C 137 O ARG D 288 ? O ARG C 268 
AC7 1 2  O ILE D 403 ? O ILE C 383 N LYS D 385 ? N LYS C 365 
AC7 2 3  O ILE D 386 ? O ILE C 366 N ARG D 368 ? N ARG C 348 
AC7 3 4  O ALA D 369 ? O ALA C 349 N SER D 354 ? N SER C 334 
AC7 4 5  O ILE D 353 ? O ILE C 333 N LYS D 330 ? N LYS C 310 
AC7 5 6  N ALA D 329 ? N ALA C 309 O VAL E 347 ? O VAL D 327 
AC7 6 7  N VAL E 346 ? N VAL D 326 O LEU E 363 ? O LEU D 343 
AC7 7 8  N LEU E 362 ? N LEU D 342 O VAL E 380 ? O VAL D 360 
AC7 8 9  N VAL E 379 ? N VAL D 359 O ILE E 397 ? O ILE D 377 
AC7 9 10 N GLN E 391 ? N GLN D 371 O VAL E 409 ? O VAL D 389 
AC8 1 2  N SER E 341 ? N SER D 321 O LEU E 358 ? O LEU D 338 
AC8 2 3  N ASN E 359 ? N ASN D 339 O LEU E 375 ? O LEU D 355 
AC8 3 4  N VAL E 379 ? N VAL D 359 O ILE E 397 ? O ILE D 377 
AC8 4 5  N VAL E 396 ? N VAL D 376 O ILE E 430 ? O ILE D 410 
AC8 5 6  O LEU E 429 ? O LEU D 409 N ARG E 421 ? N ARG D 401 
AC9 1 2  N SER D 341 ? N SER C 321 O LEU D 358 ? O LEU C 338 
AC9 2 3  N ALA D 357 ? N ALA C 337 O LEU D 375 ? O LEU C 355 
AC9 3 4  N VAL D 379 ? N VAL C 359 O ILE D 397 ? O ILE C 377 
AC9 4 5  N VAL D 396 ? N VAL C 376 O CYS D 428 ? O CYS C 408 
AC9 5 6  O LEU D 429 ? O LEU C 409 N ARG D 421 ? N ARG C 401 
AD1 1 2  O VAL D 409 ? O VAL C 389 N GLN D 391 ? N GLN C 371 
AD1 2 3  O ILE D 397 ? O ILE C 377 N VAL D 379 ? N VAL C 359 
AD1 3 4  O VAL D 380 ? O VAL C 360 N LEU D 362 ? N LEU C 342 
AD1 4 5  O LEU D 363 ? O LEU C 343 N VAL D 346 ? N VAL C 326 
AD1 5 6  N SER D 345 ? N SER C 325 O PHE E 331 ? O PHE D 311 
AD1 6 7  N LYS E 330 ? N LYS D 310 O ILE E 353 ? O ILE D 333 
AD1 7 8  N SER E 354 ? N SER D 334 O ALA E 369 ? O ALA D 349 
AD1 8 9  N ARG E 368 ? N ARG D 348 O ILE E 386 ? O ILE D 366 
AD1 9 10 N LYS E 385 ? N LYS D 365 O ILE E 403 ? O ILE D 383 
AD2 1 2  O LEU E 115 ? O LEU D 95  N VAL E 84  ? N VAL D 64  
AD2 2 3  O ARG E 81  ? O ARG D 61  N ALA E 35  ? N ALA D 15  
AD2 3 4  N MET E 34  ? N MET D 14  O VAL E 150 ? O VAL D 130 
AD2 4 5  N ILE E 151 ? N ILE D 131 O TYR E 229 ? O TYR D 209 
AD2 5 6  O SER E 225 ? O SER D 205 N GLY E 192 ? N GLY D 172 
AD2 6 7  N VAL E 193 ? N VAL D 173 O ILE E 206 ? O ILE D 186 
AD3 1 2  O LEU E 115 ? O LEU D 95  N VAL E 84  ? N VAL D 64  
AD3 2 3  O ARG E 81  ? O ARG D 61  N ALA E 35  ? N ALA D 15  
AD3 3 4  N MET E 34  ? N MET D 14  O VAL E 150 ? O VAL D 130 
AD3 4 5  N ILE E 151 ? N ILE D 131 O TYR E 229 ? O TYR D 209 
AD3 5 6  O ALA E 222 ? O ALA D 202 N VAL E 183 ? N VAL D 163 
AD3 6 7  N ILE E 178 ? N ILE D 158 O HIS E 270 ? O HIS D 250 
AD4 1 2  N PHE E 60  ? N PHE D 40  O ALA E 64  ? O ALA D 44  
AD5 1 2  N ILE E 157 ? N ILE D 137 O ARG E 288 ? O ARG D 268 
AD6 1 2  O LEU F 115 ? O LEU E 95  N VAL F 84  ? N VAL E 64  
AD6 2 3  O ARG F 81  ? O ARG E 61  N ALA F 35  ? N ALA E 15  
AD6 3 4  N MET F 34  ? N MET E 14  O VAL F 150 ? O VAL E 130 
AD6 4 5  N ILE F 151 ? N ILE E 131 O TYR F 229 ? O TYR E 209 
AD6 5 6  O SER F 225 ? O SER E 205 N GLY F 192 ? N GLY E 172 
AD6 6 7  N VAL F 193 ? N VAL E 173 O ILE F 206 ? O ILE E 186 
AD7 1 2  O LEU F 115 ? O LEU E 95  N VAL F 84  ? N VAL E 64  
AD7 2 3  O ARG F 81  ? O ARG E 61  N ALA F 35  ? N ALA E 15  
AD7 3 4  N MET F 34  ? N MET E 14  O VAL F 150 ? O VAL E 130 
AD7 4 5  N ILE F 151 ? N ILE E 131 O TYR F 229 ? O TYR E 209 
AD7 5 6  O ALA F 222 ? O ALA E 202 N VAL F 183 ? N VAL E 163 
AD7 6 7  N ILE F 178 ? N ILE E 158 O HIS F 270 ? O HIS E 250 
AD8 1 2  N PHE F 60  ? N PHE E 40  O ALA F 64  ? O ALA E 44  
AD9 1 2  N ILE F 157 ? N ILE E 137 O ARG F 288 ? O ARG E 268 
AE1 1 2  O ILE F 403 ? O ILE E 383 N LYS F 385 ? N LYS E 365 
AE1 2 3  O ILE F 386 ? O ILE E 366 N ARG F 368 ? N ARG E 348 
AE1 3 4  O ALA F 369 ? O ALA E 349 N SER F 354 ? N SER E 334 
AE1 4 5  O ILE F 353 ? O ILE E 333 N LYS F 330 ? N LYS E 310 
AE1 5 6  N ALA F 329 ? N ALA E 309 O VAL G 347 ? O VAL F 327 
AE1 6 7  N VAL G 346 ? N VAL F 326 O LEU G 363 ? O LEU F 343 
AE1 7 8  N LEU G 362 ? N LEU F 342 O VAL G 380 ? O VAL F 360 
AE1 8 9  N VAL G 379 ? N VAL F 359 O ILE G 397 ? O ILE F 377 
AE1 9 10 N GLN G 391 ? N GLN F 371 O VAL G 409 ? O VAL F 389 
AE2 1 2  N VAL G 343 ? N VAL F 323 O LEU G 358 ? O LEU F 338 
AE2 2 3  N ASN G 359 ? N ASN F 339 O LEU G 375 ? O LEU F 355 
AE2 3 4  N VAL G 379 ? N VAL F 359 O ILE G 397 ? O ILE F 377 
AE2 4 5  N VAL G 396 ? N VAL F 376 O ILE G 430 ? O ILE F 410 
AE2 5 6  O LEU G 429 ? O LEU F 409 N ARG G 421 ? N ARG F 401 
AE3 1 2  N VAL F 343 ? N VAL E 323 O LEU F 358 ? O LEU E 338 
AE3 2 3  N ALA F 357 ? N ALA E 337 O LEU F 375 ? O LEU E 355 
AE3 3 4  N VAL F 379 ? N VAL E 359 O ILE F 397 ? O ILE E 377 
AE3 4 5  N VAL F 396 ? N VAL E 376 O ILE F 430 ? O ILE E 410 
AE3 5 6  O LEU F 429 ? O LEU E 409 N ARG F 421 ? N ARG E 401 
AE4 1 2  O VAL F 409 ? O VAL E 389 N GLN F 391 ? N GLN E 371 
AE4 2 3  O ILE F 397 ? O ILE E 377 N VAL F 379 ? N VAL E 359 
AE4 3 4  O VAL F 380 ? O VAL E 360 N LEU F 362 ? N LEU E 342 
AE4 4 5  O LEU F 363 ? O LEU E 343 N VAL F 346 ? N VAL E 326 
AE4 5 6  N SER F 345 ? N SER E 325 O PHE G 331 ? O PHE F 311 
AE4 6 7  N LYS G 330 ? N LYS F 310 O ILE G 353 ? O ILE F 333 
AE4 7 8  N SER G 354 ? N SER F 334 O ALA G 369 ? O ALA F 349 
AE4 8 9  N ARG G 368 ? N ARG F 348 O ILE G 386 ? O ILE F 366 
AE4 9 10 N LYS G 385 ? N LYS F 365 O ILE G 403 ? O ILE F 383 
AE5 1 2  O LEU G 115 ? O LEU F 95  N VAL G 84  ? N VAL F 64  
AE5 2 3  O GLY G 83  ? O GLY F 63  N VAL G 37  ? N VAL F 17  
AE5 3 4  N MET G 34  ? N MET F 14  O TYR G 148 ? O TYR F 128 
AE5 4 5  N ILE G 151 ? N ILE F 131 O TYR G 229 ? O TYR F 209 
AE5 5 6  O SER G 225 ? O SER F 205 N GLY G 192 ? N GLY F 172 
AE5 6 7  N VAL G 193 ? N VAL F 173 O ILE G 206 ? O ILE F 186 
AE6 1 2  O LEU G 115 ? O LEU F 95  N VAL G 84  ? N VAL F 64  
AE6 2 3  O GLY G 83  ? O GLY F 63  N VAL G 37  ? N VAL F 17  
AE6 3 4  N MET G 34  ? N MET F 14  O TYR G 148 ? O TYR F 128 
AE6 4 5  N ILE G 151 ? N ILE F 131 O TYR G 229 ? O TYR F 209 
AE6 5 6  O ALA G 222 ? O ALA F 202 N VAL G 183 ? N VAL F 163 
AE6 6 7  N ILE G 178 ? N ILE F 158 O HIS G 270 ? O HIS F 250 
AE7 1 2  N PHE G 60  ? N PHE F 40  O ALA G 64  ? O ALA F 44  
AE8 1 2  N ILE G 157 ? N ILE F 137 O ARG G 288 ? O ARG F 268 
AE9 1 2  O LEU H 115 ? O LEU G 95  N VAL H 84  ? N VAL G 64  
AE9 2 3  O ALA H 85  ? O ALA G 65  N VAL H 37  ? N VAL G 17  
AE9 3 4  N LEU H 38  ? N LEU G 18  O LEU H 152 ? O LEU G 132 
AE9 4 5  N ILE H 151 ? N ILE G 131 O TYR H 229 ? O TYR G 209 
AE9 5 6  O SER H 225 ? O SER G 205 N GLY H 192 ? N GLY G 172 
AE9 6 7  N HIS H 195 ? N HIS G 175 O ILE H 203 ? O ILE G 183 
AF1 1 2  O LEU H 115 ? O LEU G 95  N VAL H 84  ? N VAL G 64  
AF1 2 3  O ALA H 85  ? O ALA G 65  N VAL H 37  ? N VAL G 17  
AF1 3 4  N LEU H 38  ? N LEU G 18  O LEU H 152 ? O LEU G 132 
AF1 4 5  N ILE H 151 ? N ILE G 131 O TYR H 229 ? O TYR G 209 
AF1 5 6  O ALA H 224 ? O ALA G 204 N LEU H 181 ? N LEU G 161 
AF1 6 7  N ILE H 178 ? N ILE G 158 O HIS H 270 ? O HIS G 250 
AF2 1 2  N PHE H 60  ? N PHE G 40  O ALA H 64  ? O ALA G 44  
AF3 1 2  N ILE H 157 ? N ILE G 137 O ARG H 288 ? O ARG G 268 
AF4 1 2  O LEU I 115 ? O LEU I 95  N VAL I 84  ? N VAL I 64  
AF4 2 3  O ARG I 81  ? O ARG I 61  N ALA I 35  ? N ALA I 15  
AF4 3 4  N LEU I 38  ? N LEU I 18  O LEU I 152 ? O LEU I 132 
AF4 4 5  N ILE I 151 ? N ILE I 131 O TYR I 229 ? O TYR I 209 
AF4 5 6  O SER I 225 ? O SER I 205 N GLY I 192 ? N GLY I 172 
AF4 6 7  N VAL I 193 ? N VAL I 173 O ILE I 206 ? O ILE I 186 
AF5 1 2  O LEU I 115 ? O LEU I 95  N VAL I 84  ? N VAL I 64  
AF5 2 3  O ARG I 81  ? O ARG I 61  N ALA I 35  ? N ALA I 15  
AF5 3 4  N LEU I 38  ? N LEU I 18  O LEU I 152 ? O LEU I 132 
AF5 4 5  N ILE I 151 ? N ILE I 131 O TYR I 229 ? O TYR I 209 
AF5 5 6  O ALA I 222 ? O ALA I 202 N VAL I 183 ? N VAL I 163 
AF5 6 7  N ILE I 178 ? N ILE I 158 O HIS I 270 ? O HIS I 250 
AF6 1 2  N PHE I 60  ? N PHE I 40  O ALA I 64  ? O ALA I 44  
AF7 1 2  N ILE I 157 ? N ILE I 137 O ARG I 288 ? O ARG I 268 
AF8 1 2  O ILE I 403 ? O ILE I 383 N LYS I 385 ? N LYS I 365 
AF8 2 3  O ILE I 386 ? O ILE I 366 N ARG I 368 ? N ARG I 348 
AF8 3 4  O ALA I 369 ? O ALA I 349 N SER I 354 ? N SER I 334 
AF8 4 5  O ILE I 353 ? O ILE I 333 N LYS I 330 ? N LYS I 310 
AF8 5 6  N ALA I 329 ? N ALA I 309 O VAL J 347 ? O VAL J 327 
AF8 6 7  N VAL J 346 ? N VAL J 326 O LEU J 363 ? O LEU J 343 
AF8 7 8  N LEU J 362 ? N LEU J 342 O VAL J 380 ? O VAL J 360 
AF8 8 9  N VAL J 379 ? N VAL J 359 O ILE J 397 ? O ILE J 377 
AF8 9 10 N GLN J 391 ? N GLN J 371 O VAL J 409 ? O VAL J 389 
AF9 1 2  N SER J 341 ? N SER J 321 O LEU J 358 ? O LEU J 338 
AF9 2 3  N ALA J 357 ? N ALA J 337 O LEU J 375 ? O LEU J 355 
AF9 3 4  N VAL J 379 ? N VAL J 359 O ILE J 397 ? O ILE J 377 
AF9 4 5  N VAL J 396 ? N VAL J 376 O ILE J 430 ? O ILE J 410 
AF9 5 6  O LEU J 429 ? O LEU J 409 N ARG J 421 ? N ARG J 401 
AG1 1 2  N SER I 341 ? N SER I 321 O LEU I 358 ? O LEU I 338 
AG1 2 3  N ALA I 357 ? N ALA I 337 O LEU I 375 ? O LEU I 355 
AG1 3 4  N VAL I 379 ? N VAL I 359 O VAL I 395 ? O VAL I 375 
AG1 4 5  N VAL I 396 ? N VAL I 376 O ILE I 430 ? O ILE I 410 
AG1 5 6  O LEU I 429 ? O LEU I 409 N ARG I 421 ? N ARG I 401 
AG2 1 2  O VAL I 409 ? O VAL I 389 N GLN I 391 ? N GLN I 371 
AG2 2 3  O VAL I 395 ? O VAL I 375 N VAL I 379 ? N VAL I 359 
AG2 3 4  O VAL I 380 ? O VAL I 360 N LEU I 362 ? N LEU I 342 
AG2 4 5  O LEU I 363 ? O LEU I 343 N VAL I 346 ? N VAL I 326 
AG2 5 6  N SER I 345 ? N SER I 325 O PHE J 331 ? O PHE J 311 
AG2 6 7  N LYS J 330 ? N LYS J 310 O ILE J 353 ? O ILE J 333 
AG2 7 8  N SER J 354 ? N SER J 334 O ALA J 369 ? O ALA J 349 
AG2 8 9  N ARG J 368 ? N ARG J 348 O ILE J 386 ? O ILE J 366 
AG2 9 10 N LYS J 385 ? N LYS J 365 O ILE J 403 ? O ILE J 383 
AG3 1 2  O LEU J 115 ? O LEU J 95  N VAL J 84  ? N VAL J 64  
AG3 2 3  O GLY J 83  ? O GLY J 63  N VAL J 37  ? N VAL J 17  
AG3 3 4  N LEU J 38  ? N LEU J 18  O LEU J 152 ? O LEU J 132 
AG3 4 5  N ILE J 151 ? N ILE J 131 O TYR J 229 ? O TYR J 209 
AG3 5 6  O ALA J 222 ? O ALA J 202 N VAL J 183 ? N VAL J 163 
AG3 6 7  N ILE J 178 ? N ILE J 158 O HIS J 270 ? O HIS J 250 
AG4 1 2  N PHE J 60  ? N PHE J 40  O ALA J 64  ? O ALA J 44  
AG5 1 2  N ILE J 157 ? N ILE J 137 O ARG J 288 ? O ARG J 268 
AG6 1 2  N VAL J 193 ? N VAL J 173 O ILE J 206 ? O ILE J 186 
AG7 1 2  O LEU K 115 ? O LEU K 95  N VAL K 84  ? N VAL K 64  
AG7 2 3  O GLY K 83  ? O GLY K 63  N VAL K 37  ? N VAL K 17  
AG7 3 4  N LEU K 38  ? N LEU K 18  O LEU K 152 ? O LEU K 132 
AG7 4 5  N ILE K 151 ? N ILE K 131 O TYR K 229 ? O TYR K 209 
AG7 5 6  O ALA K 222 ? O ALA K 202 N VAL K 183 ? N VAL K 163 
AG7 6 7  N VAL K 176 ? N VAL K 156 O VAL K 268 ? O VAL K 248 
AG8 1 2  N PHE K 60  ? N PHE K 40  O ALA K 64  ? O ALA K 44  
AG9 1 2  N ILE K 157 ? N ILE K 137 O ARG K 288 ? O ARG K 268 
AH1 1 2  N VAL K 193 ? N VAL K 173 O ILE K 206 ? O ILE K 186 
AH2 1 2  O ILE K 403 ? O ILE K 383 N LYS K 385 ? N LYS K 365 
AH2 2 3  O ILE K 386 ? O ILE K 366 N ARG K 368 ? N ARG K 348 
AH2 3 4  O ALA K 369 ? O ALA K 349 N SER K 354 ? N SER K 334 
AH2 4 5  O ILE K 353 ? O ILE K 333 N LYS K 330 ? N LYS K 310 
AH2 5 6  N ALA K 329 ? N ALA K 309 O VAL L 347 ? O VAL L 327 
AH2 6 7  N VAL L 346 ? N VAL L 326 O LEU L 363 ? O LEU L 343 
AH2 7 8  N LEU L 362 ? N LEU L 342 O VAL L 380 ? O VAL L 360 
AH2 8 9  N VAL L 379 ? N VAL L 359 O ILE L 397 ? O ILE L 377 
AH2 9 10 N GLN L 391 ? N GLN L 371 O VAL L 409 ? O VAL L 389 
AH3 1 2  N SER L 341 ? N SER L 321 O LEU L 358 ? O LEU L 338 
AH3 2 3  N ALA L 357 ? N ALA L 337 O LEU L 375 ? O LEU L 355 
AH3 3 4  N VAL L 379 ? N VAL L 359 O ILE L 397 ? O ILE L 377 
AH3 4 5  N VAL L 396 ? N VAL L 376 O ILE L 430 ? O ILE L 410 
AH3 5 6  O LEU L 429 ? O LEU L 409 N ARG L 421 ? N ARG L 401 
AH4 1 2  N SER K 341 ? N SER K 321 O LEU K 358 ? O LEU K 338 
AH4 2 3  N ALA K 357 ? N ALA K 337 O LEU K 375 ? O LEU K 355 
AH4 3 4  N VAL K 379 ? N VAL K 359 O ILE K 397 ? O ILE K 377 
AH4 4 5  N VAL K 396 ? N VAL K 376 O ILE K 430 ? O ILE K 410 
AH4 5 6  O LEU K 429 ? O LEU K 409 N ARG K 421 ? N ARG K 401 
AH5 1 2  O VAL K 409 ? O VAL K 389 N GLN K 391 ? N GLN K 371 
AH5 2 3  O ILE K 397 ? O ILE K 377 N VAL K 379 ? N VAL K 359 
AH5 3 4  O VAL K 380 ? O VAL K 360 N LEU K 362 ? N LEU K 342 
AH5 4 5  O LEU K 363 ? O LEU K 343 N VAL K 346 ? N VAL K 326 
AH5 5 6  N SER K 345 ? N SER K 325 O PHE L 331 ? O PHE L 311 
AH5 6 7  N LYS L 330 ? N LYS L 310 O ILE L 353 ? O ILE L 333 
AH5 7 8  N SER L 354 ? N SER L 334 O ALA L 369 ? O ALA L 349 
AH5 8 9  N ARG L 368 ? N ARG L 348 O ILE L 386 ? O ILE L 366 
AH5 9 10 N LYS L 385 ? N LYS L 365 O ILE L 403 ? O ILE L 383 
AH6 1 2  O LEU L 115 ? O LEU L 95  N VAL L 84  ? N VAL L 64  
AH6 2 3  O GLY L 83  ? O GLY L 63  N VAL L 37  ? N VAL L 17  
AH6 3 4  N LEU L 38  ? N LEU L 18  O LEU L 152 ? O LEU L 132 
AH6 4 5  N ILE L 151 ? N ILE L 131 O TYR L 229 ? O TYR L 209 
AH6 5 6  O SER L 225 ? O SER L 205 N GLY L 192 ? N GLY L 172 
AH6 6 7  N VAL L 193 ? N VAL L 173 O ILE L 206 ? O ILE L 186 
AH7 1 2  O LEU L 115 ? O LEU L 95  N VAL L 84  ? N VAL L 64  
AH7 2 3  O GLY L 83  ? O GLY L 63  N VAL L 37  ? N VAL L 17  
AH7 3 4  N LEU L 38  ? N LEU L 18  O LEU L 152 ? O LEU L 132 
AH7 4 5  N ILE L 151 ? N ILE L 131 O TYR L 229 ? O TYR L 209 
AH7 5 6  O ALA L 224 ? O ALA L 204 N LEU L 181 ? N LEU L 161 
AH7 6 7  N ILE L 178 ? N ILE L 158 O HIS L 270 ? O HIS L 250 
AH8 1 2  N PHE L 60  ? N PHE L 40  O ALA L 64  ? O ALA L 44  
AH9 1 2  N ILE L 157 ? N ILE L 137 O ARG L 288 ? O ARG L 268 
AI1 1 2  O LEU M 115 ? O LEU M 95  N VAL M 84  ? N VAL M 64  
AI1 2 3  O GLY M 83  ? O GLY M 63  N VAL M 37  ? N VAL M 17  
AI1 3 4  N TYR M 36  ? N TYR M 16  O LEU M 152 ? O LEU M 132 
AI1 4 5  N ILE M 151 ? N ILE M 131 O TYR M 229 ? O TYR M 209 
AI1 5 6  O ALA M 222 ? O ALA M 202 N VAL M 183 ? N VAL M 163 
AI1 6 7  N ILE M 178 ? N ILE M 158 O HIS M 270 ? O HIS M 250 
AI2 1 2  N PHE M 60  ? N PHE M 40  O ALA M 64  ? O ALA M 44  
AI3 1 2  N ILE M 157 ? N ILE M 137 O ARG M 288 ? O ARG M 268 
AI4 1 2  N VAL M 193 ? N VAL M 173 O ILE M 206 ? O ILE M 186 
AI5 1 2  O ILE M 403 ? O ILE M 383 N LYS M 385 ? N LYS M 365 
AI5 2 3  O ILE M 386 ? O ILE M 366 N ARG M 368 ? N ARG M 348 
AI5 3 4  O ALA M 369 ? O ALA M 349 N SER M 354 ? N SER M 334 
AI5 4 5  O ILE M 353 ? O ILE M 333 N LYS M 330 ? N LYS M 310 
AI5 5 6  N PHE M 331 ? N PHE M 311 O SER N 345 ? O SER N 325 
AI5 6 7  N VAL N 346 ? N VAL N 326 O LEU N 363 ? O LEU N 343 
AI5 7 8  N LEU N 362 ? N LEU N 342 O VAL N 380 ? O VAL N 360 
AI5 8 9  N VAL N 379 ? N VAL N 359 O ILE N 397 ? O ILE N 377 
AI5 9 10 N GLN N 391 ? N GLN N 371 O VAL N 409 ? O VAL N 389 
AI6 1 2  N SER N 341 ? N SER N 321 O LEU N 358 ? O LEU N 338 
AI6 2 3  N ALA N 357 ? N ALA N 337 O LEU N 375 ? O LEU N 355 
AI6 3 4  N VAL N 379 ? N VAL N 359 O ILE N 397 ? O ILE N 377 
AI6 4 5  N VAL N 396 ? N VAL N 376 O ILE N 430 ? O ILE N 410 
AI6 5 6  O LEU N 429 ? O LEU N 409 N ARG N 421 ? N ARG N 401 
AI7 1 2  N VAL M 343 ? N VAL M 323 O LEU M 358 ? O LEU M 338 
AI7 2 3  N ALA M 357 ? N ALA M 337 O LEU M 375 ? O LEU M 355 
AI7 3 4  N VAL M 379 ? N VAL M 359 O ILE M 397 ? O ILE M 377 
AI7 4 5  N VAL M 396 ? N VAL M 376 O ILE M 430 ? O ILE M 410 
AI7 5 6  O LEU M 429 ? O LEU M 409 N ARG M 421 ? N ARG M 401 
AI8 1 2  O VAL M 409 ? O VAL M 389 N GLN M 391 ? N GLN M 371 
AI8 2 3  O ILE M 397 ? O ILE M 377 N VAL M 379 ? N VAL M 359 
AI8 3 4  O VAL M 380 ? O VAL M 360 N LEU M 362 ? N LEU M 342 
AI8 4 5  O LEU M 363 ? O LEU M 343 N VAL M 346 ? N VAL M 326 
AI8 5 6  N SER M 345 ? N SER M 325 O PHE N 331 ? O PHE N 311 
AI8 6 7  N LYS N 330 ? N LYS N 310 O ILE N 353 ? O ILE N 333 
AI8 7 8  N SER N 354 ? N SER N 334 O ALA N 369 ? O ALA N 349 
AI8 8 9  N ARG N 368 ? N ARG N 348 O ILE N 386 ? O ILE N 366 
AI8 9 10 N LYS N 385 ? N LYS N 365 O ILE N 403 ? O ILE N 383 
AI9 1 2  O LEU N 115 ? O LEU N 95  N VAL N 84  ? N VAL N 64  
AI9 2 3  O GLY N 83  ? O GLY N 63  N VAL N 37  ? N VAL N 17  
AI9 3 4  N TYR N 36  ? N TYR N 16  O VAL N 150 ? O VAL N 130 
AI9 4 5  N ILE N 151 ? N ILE N 131 O TYR N 229 ? O TYR N 209 
AI9 5 6  O SER N 225 ? O SER N 205 N GLY N 192 ? N GLY N 172 
AI9 6 7  N VAL N 193 ? N VAL N 173 O ILE N 206 ? O ILE N 186 
AJ1 1 2  O LEU N 115 ? O LEU N 95  N VAL N 84  ? N VAL N 64  
AJ1 2 3  O GLY N 83  ? O GLY N 63  N VAL N 37  ? N VAL N 17  
AJ1 3 4  N TYR N 36  ? N TYR N 16  O VAL N 150 ? O VAL N 130 
AJ1 4 5  N ILE N 151 ? N ILE N 131 O TYR N 229 ? O TYR N 209 
AJ1 5 6  O ALA N 224 ? O ALA N 204 N LEU N 181 ? N LEU N 161 
AJ1 6 7  N ILE N 178 ? N ILE N 158 O HIS N 270 ? O HIS N 250 
AJ2 1 2  N PHE N 60  ? N PHE N 40  O ALA N 64  ? O ALA N 44  
AJ3 1 2  N ILE N 157 ? N ILE N 137 O ARG N 288 ? O ARG N 268 
AJ4 1 2  O LEU O 115 ? O LEU O 95  N VAL O 84  ? N VAL O 64  
AJ4 2 3  O GLY O 83  ? O GLY O 63  N VAL O 37  ? N VAL O 17  
AJ4 3 4  N LEU O 38  ? N LEU O 18  O LEU O 152 ? O LEU O 132 
AJ4 4 5  N ILE O 151 ? N ILE O 131 O TYR O 229 ? O TYR O 209 
AJ4 5 6  O SER O 225 ? O SER O 205 N GLY O 192 ? N GLY O 172 
AJ4 6 7  N VAL O 193 ? N VAL O 173 O ILE O 206 ? O ILE O 186 
AJ5 1 2  O LEU O 115 ? O LEU O 95  N VAL O 84  ? N VAL O 64  
AJ5 2 3  O GLY O 83  ? O GLY O 63  N VAL O 37  ? N VAL O 17  
AJ5 3 4  N LEU O 38  ? N LEU O 18  O LEU O 152 ? O LEU O 132 
AJ5 4 5  N ILE O 151 ? N ILE O 131 O TYR O 229 ? O TYR O 209 
AJ5 5 6  O ALA O 224 ? O ALA O 204 N LEU O 181 ? N LEU O 161 
AJ5 6 7  N ILE O 178 ? N ILE O 158 O HIS O 270 ? O HIS O 250 
AJ6 1 2  N PHE O 60  ? N PHE O 40  O ALA O 64  ? O ALA O 44  
AJ7 1 2  N ILE O 157 ? N ILE O 137 O ARG O 288 ? O ARG O 268 
AJ8 1 2  O ILE O 403 ? O ILE O 383 N LYS O 385 ? N LYS O 365 
AJ8 2 3  O ILE O 386 ? O ILE O 366 N ARG O 368 ? N ARG O 348 
AJ8 3 4  O ALA O 369 ? O ALA O 349 N SER O 354 ? N SER O 334 
AJ8 4 5  O ILE O 353 ? O ILE O 333 N LYS O 330 ? N LYS O 310 
AJ8 5 6  N ALA O 329 ? N ALA O 309 O VAL P 347 ? O VAL P 327 
AJ8 6 7  N VAL P 346 ? N VAL P 326 O LEU P 363 ? O LEU P 343 
AJ8 7 8  N LEU P 362 ? N LEU P 342 O VAL P 380 ? O VAL P 360 
AJ8 8 9  N VAL P 379 ? N VAL P 359 O ILE P 397 ? O ILE P 377 
AJ8 9 10 N GLN P 391 ? N GLN P 371 O VAL P 409 ? O VAL P 389 
AJ9 1 2  N SER P 341 ? N SER P 321 O LEU P 358 ? O LEU P 338 
AJ9 2 3  N ALA P 357 ? N ALA P 337 O LEU P 375 ? O LEU P 355 
AJ9 3 4  N VAL P 379 ? N VAL P 359 O ILE P 397 ? O ILE P 377 
AJ9 4 5  N VAL P 396 ? N VAL P 376 O ILE P 430 ? O ILE P 410 
AJ9 5 6  O LEU P 429 ? O LEU P 409 N ARG P 421 ? N ARG P 401 
AK1 1 2  N SER O 341 ? N SER O 321 O LEU O 358 ? O LEU O 338 
AK1 2 3  N ALA O 357 ? N ALA O 337 O LEU O 375 ? O LEU O 355 
AK1 3 4  N VAL O 379 ? N VAL O 359 O VAL O 395 ? O VAL O 375 
AK1 4 5  N VAL O 396 ? N VAL O 376 O ILE O 430 ? O ILE O 410 
AK1 5 6  O LEU O 429 ? O LEU O 409 N ARG O 421 ? N ARG O 401 
AK2 1 2  O VAL O 409 ? O VAL O 389 N GLN O 391 ? N GLN O 371 
AK2 2 3  O VAL O 395 ? O VAL O 375 N VAL O 379 ? N VAL O 359 
AK2 3 4  O VAL O 380 ? O VAL O 360 N LEU O 362 ? N LEU O 342 
AK2 4 5  O LEU O 363 ? O LEU O 343 N VAL O 346 ? N VAL O 326 
AK2 5 6  N VAL O 347 ? N VAL O 327 O ALA P 329 ? O ALA P 309 
AK2 6 7  N LYS P 330 ? N LYS P 310 O ILE P 353 ? O ILE P 333 
AK2 7 8  N SER P 354 ? N SER P 334 O ALA P 369 ? O ALA P 349 
AK2 8 9  N ARG P 368 ? N ARG P 348 O ILE P 386 ? O ILE P 366 
AK2 9 10 N LYS P 385 ? N LYS P 365 O ILE P 403 ? O ILE P 383 
AK3 1 2  O LEU P 115 ? O LEU P 95  N VAL P 84  ? N VAL P 64  
AK3 2 3  O GLY P 83  ? O GLY P 63  N VAL P 37  ? N VAL P 17  
AK3 3 4  N TYR P 36  ? N TYR P 16  O VAL P 150 ? O VAL P 130 
AK3 4 5  N ILE P 151 ? N ILE P 131 O TYR P 229 ? O TYR P 209 
AK3 5 6  O ALA P 224 ? O ALA P 204 N LEU P 181 ? N LEU P 161 
AK3 6 7  N ILE P 178 ? N ILE P 158 O HIS P 270 ? O HIS P 250 
AK4 1 2  N PHE P 60  ? N PHE P 40  O ALA P 64  ? O ALA P 44  
AK5 1 2  N ILE P 157 ? N ILE P 137 O ARG P 288 ? O ARG P 268 
AK6 1 2  N HIS P 195 ? N HIS P 175 O ILE P 203 ? O ILE P 183 
AK7 1 2  O LEU Q 115 ? O LEU Q 95  N VAL Q 84  ? N VAL Q 64  
AK7 2 3  O GLY Q 83  ? O GLY Q 63  N VAL Q 37  ? N VAL Q 17  
AK7 3 4  N LEU Q 38  ? N LEU Q 18  O LEU Q 152 ? O LEU Q 132 
AK7 4 5  N ILE Q 151 ? N ILE Q 131 O TYR Q 229 ? O TYR Q 209 
AK7 5 6  O SER Q 225 ? O SER Q 205 N GLY Q 192 ? N GLY Q 172 
AK7 6 7  N HIS Q 195 ? N HIS Q 175 O ILE Q 203 ? O ILE Q 183 
AK8 1 2  O LEU Q 115 ? O LEU Q 95  N VAL Q 84  ? N VAL Q 64  
AK8 2 3  O GLY Q 83  ? O GLY Q 63  N VAL Q 37  ? N VAL Q 17  
AK8 3 4  N LEU Q 38  ? N LEU Q 18  O LEU Q 152 ? O LEU Q 132 
AK8 4 5  N ILE Q 151 ? N ILE Q 131 O TYR Q 229 ? O TYR Q 209 
AK8 5 6  O ALA Q 224 ? O ALA Q 204 N LEU Q 181 ? N LEU Q 161 
AK8 6 7  N ILE Q 178 ? N ILE Q 158 O HIS Q 270 ? O HIS Q 250 
AK9 1 2  N PHE Q 60  ? N PHE Q 40  O ALA Q 64  ? O ALA Q 44  
AL1 1 2  N ILE Q 157 ? N ILE Q 137 O ARG Q 288 ? O ARG Q 268 
AL2 1 2  O ILE Q 403 ? O ILE Q 383 N LYS Q 385 ? N LYS Q 365 
AL2 2 3  O ILE Q 386 ? O ILE Q 366 N ARG Q 368 ? N ARG Q 348 
AL2 3 4  O ALA Q 369 ? O ALA Q 349 N SER Q 354 ? N SER Q 334 
AL2 4 5  O ILE Q 353 ? O ILE Q 333 N LYS Q 330 ? N LYS Q 310 
AL2 5 6  N PHE Q 331 ? N PHE Q 311 O SER R 345 ? O SER R 325 
AL2 6 7  N VAL R 346 ? N VAL R 326 O LEU R 363 ? O LEU R 343 
AL2 7 8  N LEU R 362 ? N LEU R 342 O VAL R 380 ? O VAL R 360 
AL2 8 9  N VAL R 379 ? N VAL R 359 O VAL R 395 ? O VAL R 375 
AL2 9 10 N GLN R 391 ? N GLN R 371 O VAL R 409 ? O VAL R 389 
AL3 1 2  N SER R 341 ? N SER R 321 O LEU R 358 ? O LEU R 338 
AL3 2 3  N ALA R 357 ? N ALA R 337 O LEU R 375 ? O LEU R 355 
AL3 3 4  N VAL R 379 ? N VAL R 359 O VAL R 395 ? O VAL R 375 
AL3 4 5  N VAL R 396 ? N VAL R 376 O ILE R 430 ? O ILE R 410 
AL3 5 6  O LEU R 429 ? O LEU R 409 N ARG R 421 ? N ARG R 401 
AL4 1 2  N VAL Q 343 ? N VAL Q 323 O LEU Q 358 ? O LEU Q 338 
AL4 2 3  N ALA Q 357 ? N ALA Q 337 O LEU Q 375 ? O LEU Q 355 
AL4 3 4  N VAL Q 379 ? N VAL Q 359 O ILE Q 397 ? O ILE Q 377 
AL4 4 5  N VAL Q 396 ? N VAL Q 376 O ILE Q 430 ? O ILE Q 410 
AL4 5 6  O LEU Q 429 ? O LEU Q 409 N ARG Q 421 ? N ARG Q 401 
AL5 1 2  O VAL Q 409 ? O VAL Q 389 N GLN Q 391 ? N GLN Q 371 
AL5 2 3  O ILE Q 397 ? O ILE Q 377 N VAL Q 379 ? N VAL Q 359 
AL5 3 4  O VAL Q 380 ? O VAL Q 360 N LEU Q 362 ? N LEU Q 342 
AL5 4 5  O LEU Q 363 ? O LEU Q 343 N VAL Q 346 ? N VAL Q 326 
AL5 5 6  N SER Q 345 ? N SER Q 325 O PHE R 331 ? O PHE R 311 
AL5 6 7  N LYS R 330 ? N LYS R 310 O ILE R 353 ? O ILE R 333 
AL5 7 8  N SER R 354 ? N SER R 334 O ALA R 369 ? O ALA R 349 
AL5 8 9  N ARG R 368 ? N ARG R 348 O ILE R 386 ? O ILE R 366 
AL5 9 10 N LYS R 385 ? N LYS R 365 O ILE R 403 ? O ILE R 383 
AL6 1 2  O LEU R 115 ? O LEU R 95  N VAL R 84  ? N VAL R 64  
AL6 2 3  O GLY R 83  ? O GLY R 63  N VAL R 37  ? N VAL R 17  
AL6 3 4  N TYR R 36  ? N TYR R 16  O LEU R 152 ? O LEU R 132 
AL6 4 5  N ILE R 151 ? N ILE R 131 O TYR R 229 ? O TYR R 209 
AL6 5 6  O SER R 225 ? O SER R 205 N GLY R 192 ? N GLY R 172 
AL6 6 7  N VAL R 193 ? N VAL R 173 O ILE R 206 ? O ILE R 186 
AL7 1 2  O LEU R 115 ? O LEU R 95  N VAL R 84  ? N VAL R 64  
AL7 2 3  O GLY R 83  ? O GLY R 63  N VAL R 37  ? N VAL R 17  
AL7 3 4  N TYR R 36  ? N TYR R 16  O LEU R 152 ? O LEU R 132 
AL7 4 5  N ILE R 151 ? N ILE R 131 O TYR R 229 ? O TYR R 209 
AL7 5 6  O ALA R 224 ? O ALA R 204 N LEU R 181 ? N LEU R 161 
AL7 6 7  N ILE R 178 ? N ILE R 158 O HIS R 270 ? O HIS R 250 
AL8 1 2  N PHE R 60  ? N PHE R 40  O ALA R 64  ? O ALA R 44  
AL9 1 2  N ILE R 157 ? N ILE R 137 O ARG R 288 ? O ARG R 268 
AM1 1 2  O ASP S 113 ? O ASP V 93  N VAL S 84  ? N VAL V 64  
AM1 2 3  O ALA S 85  ? O ALA V 65  N ALA S 39  ? N ALA V 19  
AM1 3 4  N LEU S 38  ? N LEU V 18  O LEU S 152 ? O LEU V 132 
AM1 4 5  N ILE S 151 ? N ILE V 131 O TYR S 229 ? O TYR V 209 
AM1 5 6  O SER S 225 ? O SER V 205 N GLY S 192 ? N GLY V 172 
AM1 6 7  N HIS S 195 ? N HIS V 175 O ILE S 203 ? O ILE V 183 
AM2 1 2  O ASP S 113 ? O ASP V 93  N VAL S 84  ? N VAL V 64  
AM2 2 3  O ALA S 85  ? O ALA V 65  N ALA S 39  ? N ALA V 19  
AM2 3 4  N LEU S 38  ? N LEU V 18  O LEU S 152 ? O LEU V 132 
AM2 4 5  N ILE S 151 ? N ILE V 131 O TYR S 229 ? O TYR V 209 
AM2 5 6  O ILE S 228 ? O ILE V 208 N GLY S 179 ? N GLY V 159 
AM2 6 7  N ILE S 178 ? N ILE V 158 O HIS S 270 ? O HIS V 250 
AM3 1 2  N PHE S 60  ? N PHE V 40  O ALA S 64  ? O ALA V 44  
AM4 1 2  N ILE S 157 ? N ILE V 137 O ARG S 288 ? O ARG V 268 
AM5 1 2  O ILE S 403 ? O ILE V 383 N LYS S 385 ? N LYS V 365 
AM5 2 3  O ILE S 386 ? O ILE V 366 N ARG S 368 ? N ARG V 348 
AM5 3 4  O ALA S 369 ? O ALA V 349 N SER S 354 ? N SER V 334 
AM5 4 5  O ILE S 353 ? O ILE V 333 N LYS S 330 ? N LYS V 310 
AM5 5 6  N PHE S 331 ? N PHE V 311 O SER T 345 ? O SER T 325 
AM5 6 7  N VAL T 346 ? N VAL T 326 O LEU T 363 ? O LEU T 343 
AM5 7 8  N LEU T 362 ? N LEU T 342 O VAL T 380 ? O VAL T 360 
AM5 8 9  N VAL T 379 ? N VAL T 359 O ILE T 397 ? O ILE T 377 
AM5 9 10 N GLN T 391 ? N GLN T 371 O VAL T 409 ? O VAL T 389 
AM6 1 2  N SER T 341 ? N SER T 321 O LEU T 358 ? O LEU T 338 
AM6 2 3  N ALA T 357 ? N ALA T 337 O LEU T 375 ? O LEU T 355 
AM6 3 4  N VAL T 379 ? N VAL T 359 O ILE T 397 ? O ILE T 377 
AM6 4 5  N VAL T 396 ? N VAL T 376 O CYS T 428 ? O CYS T 408 
AM6 5 6  O LEU T 429 ? O LEU T 409 N ARG T 421 ? N ARG T 401 
AM7 1 2  N SER S 341 ? N SER V 321 O LEU S 358 ? O LEU V 338 
AM7 2 3  N ALA S 357 ? N ALA V 337 O LEU S 375 ? O LEU V 355 
AM7 3 4  N VAL S 379 ? N VAL V 359 O ILE S 397 ? O ILE V 377 
AM7 4 5  N VAL S 396 ? N VAL V 376 O ILE S 430 ? O ILE V 410 
AM7 5 6  O LEU S 429 ? O LEU V 409 N ARG S 421 ? N ARG V 401 
AM8 1 2  O VAL S 409 ? O VAL V 389 N GLN S 391 ? N GLN V 371 
AM8 2 3  O ILE S 397 ? O ILE V 377 N VAL S 379 ? N VAL V 359 
AM8 3 4  O VAL S 380 ? O VAL V 360 N LEU S 362 ? N LEU V 342 
AM8 4 5  O LEU S 363 ? O LEU V 343 N VAL S 346 ? N VAL V 326 
AM8 5 6  N SER S 345 ? N SER V 325 O PHE T 331 ? O PHE T 311 
AM8 6 7  N LYS T 330 ? N LYS T 310 O ILE T 353 ? O ILE T 333 
AM8 7 8  N SER T 354 ? N SER T 334 O ALA T 369 ? O ALA T 349 
AM8 8 9  N ARG T 368 ? N ARG T 348 O ILE T 386 ? O ILE T 366 
AM8 9 10 N LYS T 385 ? N LYS T 365 O ILE T 403 ? O ILE T 383 
AM9 1 2  O LEU T 115 ? O LEU T 95  N VAL T 84  ? N VAL T 64  
AM9 2 3  O ARG T 81  ? O ARG T 61  N ALA T 35  ? N ALA T 15  
AM9 3 4  N LEU T 38  ? N LEU T 18  O LEU T 152 ? O LEU T 132 
AM9 4 5  N ILE T 151 ? N ILE T 131 O TYR T 229 ? O TYR T 209 
AM9 5 6  O SER T 225 ? O SER T 205 N GLY T 192 ? N GLY T 172 
AM9 6 7  N HIS T 195 ? N HIS T 175 O ILE T 203 ? O ILE T 183 
AN1 1 2  O LEU T 115 ? O LEU T 95  N VAL T 84  ? N VAL T 64  
AN1 2 3  O ARG T 81  ? O ARG T 61  N ALA T 35  ? N ALA T 15  
AN1 3 4  N LEU T 38  ? N LEU T 18  O LEU T 152 ? O LEU T 132 
AN1 4 5  N ILE T 151 ? N ILE T 131 O TYR T 229 ? O TYR T 209 
AN1 5 6  O ALA T 224 ? O ALA T 204 N LEU T 181 ? N LEU T 161 
AN1 6 7  N ILE T 178 ? N ILE T 158 O HIS T 270 ? O HIS T 250 
AN2 1 2  N PHE T 60  ? N PHE T 40  O ALA T 64  ? O ALA T 44  
AN3 1 2  N ILE T 157 ? N ILE T 137 O ARG T 288 ? O ARG T 268 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software H CIT 501 ? 5  'binding site for residue CIT H 501' 
AC2 Software H GOL 502 ? 6  'binding site for residue GOL H 502' 
AC3 Software A CIT 501 ? 5  'binding site for residue CIT A 501' 
AC4 Software A GOL 502 ? 6  'binding site for residue GOL A 502' 
AC5 Software A GOL 503 ? 4  'binding site for residue GOL A 503' 
AC6 Software B CIT 501 ? 9  'binding site for residue CIT B 501' 
AC7 Software C CIT 501 ? 8  'binding site for residue CIT C 501' 
AC8 Software C GOL 502 ? 5  'binding site for residue GOL C 502' 
AC9 Software D CIT 501 ? 6  'binding site for residue CIT D 501' 
AD1 Software D GOL 502 ? 5  'binding site for residue GOL D 502' 
AD2 Software E CIT 501 ? 6  'binding site for residue CIT E 501' 
AD3 Software E GOL 502 ? 5  'binding site for residue GOL E 502' 
AD4 Software F CIT 501 ? 5  'binding site for residue CIT F 501' 
AD5 Software F GOL 502 ? 6  'binding site for residue GOL F 502' 
AD6 Software G CIT 501 ? 7  'binding site for residue CIT G 501' 
AD7 Software G GOL 502 ? 5  'binding site for residue GOL G 502' 
AD8 Software I CIT 501 ? 7  'binding site for residue CIT I 501' 
AD9 Software I GOL 502 ? 3  'binding site for residue GOL I 502' 
AE1 Software J CIT 501 ? 7  'binding site for residue CIT J 501' 
AE2 Software J GOL 502 ? 5  'binding site for residue GOL J 502' 
AE3 Software J GOL 503 ? 6  'binding site for residue GOL J 503' 
AE4 Software K CIT 501 ? 5  'binding site for residue CIT K 501' 
AE5 Software K GOL 502 ? 6  'binding site for residue GOL K 502' 
AE6 Software K GOL 503 ? 10 'binding site for residue GOL K 503' 
AE7 Software L CIT 501 ? 9  'binding site for residue CIT L 501' 
AE8 Software L GOL 502 ? 3  'binding site for residue GOL L 502' 
AE9 Software M CIT 501 ? 6  'binding site for residue CIT M 501' 
AF1 Software M GOL 502 ? 3  'binding site for residue GOL M 502' 
AF2 Software N CIT 501 ? 6  'binding site for residue CIT N 501' 
AF3 Software N GOL 502 ? 6  'binding site for residue GOL N 502' 
AF4 Software O CIT 501 ? 6  'binding site for residue CIT O 501' 
AF5 Software O GOL 502 ? 6  'binding site for residue GOL O 502' 
AF6 Software P CIT 501 ? 8  'binding site for residue CIT P 501' 
AF7 Software P GOL 502 ? 6  'binding site for residue GOL P 502' 
AF8 Software Q CIT 501 ? 8  'binding site for residue CIT Q 501' 
AF9 Software Q GOL 502 ? 6  'binding site for residue GOL Q 502' 
AG1 Software R CIT 501 ? 6  'binding site for residue CIT R 501' 
AG2 Software R GOL 502 ? 5  'binding site for residue GOL R 502' 
AG3 Software V CIT 501 ? 6  'binding site for residue CIT V 501' 
AG4 Software V GOL 502 ? 4  'binding site for residue GOL V 502' 
AG5 Software T CIT 501 ? 6  'binding site for residue CIT T 501' 
AG6 Software T GOL 502 ? 6  'binding site for residue GOL T 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  HIS A  333 ? HIS H 313 . ? 1_555 ? 
2   AC1 5  SER A  354 ? SER H 334 . ? 1_555 ? 
3   AC1 5  ASN A  370 ? ASN H 350 . ? 1_555 ? 
4   AC1 5  SER A  371 ? SER H 351 . ? 1_555 ? 
5   AC1 5  ARG A  388 ? ARG H 368 . ? 1_555 ? 
6   AC2 6  PRO A  308 ? PRO H 288 . ? 1_555 ? 
7   AC2 6  ASP A  311 ? ASP H 291 . ? 1_555 ? 
8   AC2 6  TYR A  313 ? TYR H 293 . ? 1_555 ? 
9   AC2 6  HOH KB .   ? HOH H 623 . ? 1_555 ? 
10  AC2 6  HOH KB .   ? HOH H 640 . ? 1_555 ? 
11  AC2 6  HOH KB .   ? HOH H 692 . ? 1_555 ? 
12  AC3 5  HIS B  333 ? HIS A 313 . ? 1_555 ? 
13  AC3 5  SER B  354 ? SER A 334 . ? 1_555 ? 
14  AC3 5  ASN B  370 ? ASN A 350 . ? 1_555 ? 
15  AC3 5  SER B  371 ? SER A 351 . ? 1_555 ? 
16  AC3 5  ARG B  388 ? ARG A 368 . ? 1_555 ? 
17  AC4 6  PHE B  281 ? PHE A 261 . ? 1_555 ? 
18  AC4 6  ASP B  311 ? ASP A 291 . ? 1_555 ? 
19  AC4 6  TYR B  313 ? TYR A 293 . ? 1_555 ? 
20  AC4 6  HOH LB .   ? HOH A 623 . ? 1_555 ? 
21  AC4 6  HOH LB .   ? HOH A 631 . ? 1_555 ? 
22  AC4 6  HOH LB .   ? HOH A 683 . ? 1_555 ? 
23  AC5 4  ILE B  352 ? ILE A 332 . ? 1_555 ? 
24  AC5 4  HOH LB .   ? HOH A 698 . ? 1_555 ? 
25  AC5 4  ASP C  311 ? ASP B 291 . ? 1_555 ? 
26  AC5 4  HOH MB .   ? HOH B 620 . ? 1_555 ? 
27  AC6 9  HIS C  333 ? HIS B 313 . ? 1_555 ? 
28  AC6 9  SER C  354 ? SER B 334 . ? 1_555 ? 
29  AC6 9  ASN C  370 ? ASN B 350 . ? 1_555 ? 
30  AC6 9  SER C  371 ? SER B 351 . ? 1_555 ? 
31  AC6 9  ARG C  388 ? ARG B 368 . ? 1_555 ? 
32  AC6 9  HOH MB .   ? HOH B 610 . ? 1_555 ? 
33  AC6 9  HOH MB .   ? HOH B 614 . ? 1_555 ? 
34  AC6 9  HOH MB .   ? HOH B 618 . ? 1_555 ? 
35  AC6 9  HOH MB .   ? HOH B 647 . ? 1_555 ? 
36  AC7 8  HIS D  333 ? HIS C 313 . ? 1_555 ? 
37  AC7 8  ARG D  338 ? ARG C 318 . ? 1_555 ? 
38  AC7 8  SER D  354 ? SER C 334 . ? 1_555 ? 
39  AC7 8  ASN D  370 ? ASN C 350 . ? 1_555 ? 
40  AC7 8  SER D  371 ? SER C 351 . ? 1_555 ? 
41  AC7 8  ARG D  388 ? ARG C 368 . ? 1_555 ? 
42  AC7 8  HOH NB .   ? HOH C 717 . ? 1_555 ? 
43  AC7 8  HOH NB .   ? HOH C 753 . ? 1_555 ? 
44  AC8 5  PRO D  308 ? PRO C 288 . ? 1_555 ? 
45  AC8 5  ASP D  311 ? ASP C 291 . ? 1_555 ? 
46  AC8 5  TYR D  313 ? TYR C 293 . ? 1_555 ? 
47  AC8 5  HOH NB .   ? HOH C 626 . ? 1_555 ? 
48  AC8 5  HOH NB .   ? HOH C 645 . ? 1_555 ? 
49  AC9 6  HIS E  333 ? HIS D 313 . ? 1_555 ? 
50  AC9 6  SER E  354 ? SER D 334 . ? 1_555 ? 
51  AC9 6  ASN E  370 ? ASN D 350 . ? 1_555 ? 
52  AC9 6  SER E  371 ? SER D 351 . ? 1_555 ? 
53  AC9 6  ARG E  388 ? ARG D 368 . ? 1_555 ? 
54  AC9 6  HOH OB .   ? HOH D 755 . ? 1_555 ? 
55  AD1 5  ASP E  311 ? ASP D 291 . ? 1_555 ? 
56  AD1 5  TYR E  313 ? TYR D 293 . ? 1_555 ? 
57  AD1 5  HOH OB .   ? HOH D 653 . ? 1_555 ? 
58  AD1 5  HOH OB .   ? HOH D 659 . ? 1_555 ? 
59  AD1 5  HOH OB .   ? HOH D 660 . ? 1_555 ? 
60  AD2 6  HIS F  333 ? HIS E 313 . ? 1_555 ? 
61  AD2 6  ARG F  338 ? ARG E 318 . ? 1_555 ? 
62  AD2 6  SER F  354 ? SER E 334 . ? 1_555 ? 
63  AD2 6  ASN F  370 ? ASN E 350 . ? 1_555 ? 
64  AD2 6  SER F  371 ? SER E 351 . ? 1_555 ? 
65  AD2 6  ARG F  388 ? ARG E 368 . ? 1_555 ? 
66  AD3 5  ASP F  311 ? ASP E 291 . ? 1_555 ? 
67  AD3 5  TYR F  313 ? TYR E 293 . ? 1_555 ? 
68  AD3 5  HOH PB .   ? HOH E 606 . ? 1_555 ? 
69  AD3 5  HOH PB .   ? HOH E 618 . ? 1_555 ? 
70  AD3 5  HOH PB .   ? HOH E 636 . ? 1_555 ? 
71  AD4 5  HIS G  333 ? HIS F 313 . ? 1_555 ? 
72  AD4 5  SER G  354 ? SER F 334 . ? 1_555 ? 
73  AD4 5  ASN G  370 ? ASN F 350 . ? 1_555 ? 
74  AD4 5  SER G  371 ? SER F 351 . ? 1_555 ? 
75  AD4 5  ARG G  388 ? ARG F 368 . ? 1_555 ? 
76  AD5 6  PHE G  281 ? PHE F 261 . ? 1_555 ? 
77  AD5 6  ASP G  311 ? ASP F 291 . ? 1_555 ? 
78  AD5 6  TYR G  313 ? TYR F 293 . ? 1_555 ? 
79  AD5 6  HOH QB .   ? HOH F 630 . ? 1_555 ? 
80  AD5 6  HOH QB .   ? HOH F 632 . ? 1_555 ? 
81  AD5 6  HOH QB .   ? HOH F 634 . ? 1_555 ? 
82  AD6 7  HIS H  333 ? HIS G 313 . ? 1_555 ? 
83  AD6 7  SER H  354 ? SER G 334 . ? 1_555 ? 
84  AD6 7  ASN H  370 ? ASN G 350 . ? 1_555 ? 
85  AD6 7  SER H  371 ? SER G 351 . ? 1_555 ? 
86  AD6 7  ARG H  388 ? ARG G 368 . ? 1_555 ? 
87  AD6 7  HOH RB .   ? HOH G 630 . ? 1_555 ? 
88  AD6 7  HOH RB .   ? HOH G 704 . ? 1_555 ? 
89  AD7 5  PHE H  281 ? PHE G 261 . ? 1_555 ? 
90  AD7 5  ASP H  311 ? ASP G 291 . ? 1_555 ? 
91  AD7 5  TYR H  313 ? TYR G 293 . ? 1_555 ? 
92  AD7 5  HOH RB .   ? HOH G 634 . ? 1_555 ? 
93  AD7 5  HOH RB .   ? HOH G 663 . ? 1_555 ? 
94  AD8 7  HIS I  333 ? HIS I 313 . ? 1_555 ? 
95  AD8 7  ARG I  338 ? ARG I 318 . ? 1_555 ? 
96  AD8 7  SER I  354 ? SER I 334 . ? 1_555 ? 
97  AD8 7  ASN I  370 ? ASN I 350 . ? 1_555 ? 
98  AD8 7  SER I  371 ? SER I 351 . ? 1_555 ? 
99  AD8 7  ARG I  388 ? ARG I 368 . ? 1_555 ? 
100 AD8 7  HOH SB .   ? HOH I 616 . ? 1_555 ? 
101 AD9 3  ASP I  311 ? ASP I 291 . ? 1_555 ? 
102 AD9 3  HOH SB .   ? HOH I 647 . ? 1_555 ? 
103 AD9 3  HOH SB .   ? HOH I 670 . ? 1_555 ? 
104 AE1 7  HIS J  333 ? HIS J 313 . ? 1_555 ? 
105 AE1 7  SER J  354 ? SER J 334 . ? 1_555 ? 
106 AE1 7  ASN J  370 ? ASN J 350 . ? 1_555 ? 
107 AE1 7  SER J  371 ? SER J 351 . ? 1_555 ? 
108 AE1 7  ARG J  388 ? ARG J 368 . ? 1_555 ? 
109 AE1 7  HOH TB .   ? HOH J 657 . ? 1_555 ? 
110 AE1 7  HOH TB .   ? HOH J 712 . ? 1_555 ? 
111 AE2 5  LYS I  330 ? LYS I 310 . ? 1_555 ? 
112 AE2 5  ILE I  352 ? ILE I 332 . ? 1_555 ? 
113 AE2 5  ASP J  311 ? ASP J 291 . ? 1_555 ? 
114 AE2 5  HOH TB .   ? HOH J 608 . ? 1_555 ? 
115 AE2 5  HOH TB .   ? HOH J 664 . ? 1_555 ? 
116 AE3 6  ALA J  417 ? ALA J 397 . ? 1_555 ? 
117 AE3 6  LYS J  418 ? LYS J 398 . ? 1_555 ? 
118 AE3 6  PHE J  420 ? PHE J 400 . ? 1_555 ? 
119 AE3 6  ARG J  421 ? ARG J 401 . ? 1_555 ? 
120 AE3 6  ARG J  422 ? ARG J 402 . ? 1_555 ? 
121 AE3 6  HOH TB .   ? HOH J 690 . ? 1_555 ? 
122 AE4 5  HIS K  333 ? HIS K 313 . ? 1_555 ? 
123 AE4 5  SER K  354 ? SER K 334 . ? 1_555 ? 
124 AE4 5  ASN K  370 ? ASN K 350 . ? 1_555 ? 
125 AE4 5  SER K  371 ? SER K 351 . ? 1_555 ? 
126 AE4 5  ARG K  388 ? ARG K 368 . ? 1_555 ? 
127 AE5 6  PHE K  281 ? PHE K 261 . ? 1_555 ? 
128 AE5 6  ASP K  311 ? ASP K 291 . ? 1_555 ? 
129 AE5 6  TYR K  313 ? TYR K 293 . ? 1_555 ? 
130 AE5 6  HOH UB .   ? HOH K 629 . ? 1_555 ? 
131 AE5 6  HOH UB .   ? HOH K 652 . ? 1_555 ? 
132 AE5 6  LYS L  330 ? LYS L 310 . ? 1_555 ? 
133 AE6 10 VAL K  193 ? VAL K 173 . ? 1_555 ? 
134 AE6 10 MET K  194 ? MET K 174 . ? 1_555 ? 
135 AE6 10 HIS K  195 ? HIS K 175 . ? 1_555 ? 
136 AE6 10 VAL K  196 ? VAL K 176 . ? 1_555 ? 
137 AE6 10 PRO K  213 ? PRO K 193 . ? 1_555 ? 
138 AE6 10 GLY K  214 ? GLY K 194 . ? 1_555 ? 
139 AE6 10 ILE K  215 ? ILE K 195 . ? 1_555 ? 
140 AE6 10 PRO K  216 ? PRO K 196 . ? 1_555 ? 
141 AE6 10 ALA K  222 ? ALA K 202 . ? 1_555 ? 
142 AE6 10 LEU K  223 ? LEU K 203 . ? 1_555 ? 
143 AE7 9  HIS L  333 ? HIS L 313 . ? 1_555 ? 
144 AE7 9  ARG L  338 ? ARG L 318 . ? 1_555 ? 
145 AE7 9  SER L  354 ? SER L 334 . ? 1_555 ? 
146 AE7 9  ASN L  370 ? ASN L 350 . ? 1_555 ? 
147 AE7 9  SER L  371 ? SER L 351 . ? 1_555 ? 
148 AE7 9  ARG L  388 ? ARG L 368 . ? 1_555 ? 
149 AE7 9  HOH VB .   ? HOH L 640 . ? 1_555 ? 
150 AE7 9  HOH VB .   ? HOH L 692 . ? 1_555 ? 
151 AE7 9  HOH VB .   ? HOH L 706 . ? 1_555 ? 
152 AE8 3  ASP L  311 ? ASP L 291 . ? 1_555 ? 
153 AE8 3  HOH VB .   ? HOH L 644 . ? 1_555 ? 
154 AE8 3  HOH VB .   ? HOH L 647 . ? 1_555 ? 
155 AE9 6  HIS M  333 ? HIS M 313 . ? 1_555 ? 
156 AE9 6  SER M  354 ? SER M 334 . ? 1_555 ? 
157 AE9 6  ASN M  370 ? ASN M 350 . ? 1_555 ? 
158 AE9 6  SER M  371 ? SER M 351 . ? 1_555 ? 
159 AE9 6  ARG M  388 ? ARG M 368 . ? 1_555 ? 
160 AE9 6  HOH WB .   ? HOH M 656 . ? 1_555 ? 
161 AF1 3  ASP M  311 ? ASP M 291 . ? 1_555 ? 
162 AF1 3  HOH WB .   ? HOH M 621 . ? 1_555 ? 
163 AF1 3  ILE N  352 ? ILE N 332 . ? 1_555 ? 
164 AF2 6  HIS N  333 ? HIS N 313 . ? 1_555 ? 
165 AF2 6  ARG N  338 ? ARG N 318 . ? 1_555 ? 
166 AF2 6  SER N  354 ? SER N 334 . ? 1_555 ? 
167 AF2 6  ASN N  370 ? ASN N 350 . ? 1_555 ? 
168 AF2 6  SER N  371 ? SER N 351 . ? 1_555 ? 
169 AF2 6  ARG N  388 ? ARG N 368 . ? 1_555 ? 
170 AF3 6  PHE N  281 ? PHE N 261 . ? 1_555 ? 
171 AF3 6  ASP N  311 ? ASP N 291 . ? 1_555 ? 
172 AF3 6  TYR N  313 ? TYR N 293 . ? 1_555 ? 
173 AF3 6  HOH XB .   ? HOH N 606 . ? 1_555 ? 
174 AF3 6  HOH XB .   ? HOH N 637 . ? 1_555 ? 
175 AF3 6  HOH XB .   ? HOH N 666 . ? 1_555 ? 
176 AF4 6  HIS O  333 ? HIS O 313 . ? 1_555 ? 
177 AF4 6  ARG O  338 ? ARG O 318 . ? 1_555 ? 
178 AF4 6  SER O  354 ? SER O 334 . ? 1_555 ? 
179 AF4 6  ASN O  370 ? ASN O 350 . ? 1_555 ? 
180 AF4 6  SER O  371 ? SER O 351 . ? 1_555 ? 
181 AF4 6  ARG O  388 ? ARG O 368 . ? 1_555 ? 
182 AF5 6  ASP O  311 ? ASP O 291 . ? 1_555 ? 
183 AF5 6  TYR O  313 ? TYR O 293 . ? 1_555 ? 
184 AF5 6  HOH YB .   ? HOH O 610 . ? 1_555 ? 
185 AF5 6  HOH YB .   ? HOH O 623 . ? 1_555 ? 
186 AF5 6  HOH YB .   ? HOH O 634 . ? 1_555 ? 
187 AF5 6  HOH YB .   ? HOH O 686 . ? 1_555 ? 
188 AF6 8  HIS P  333 ? HIS P 313 . ? 1_555 ? 
189 AF6 8  SER P  354 ? SER P 334 . ? 1_555 ? 
190 AF6 8  ASN P  370 ? ASN P 350 . ? 1_555 ? 
191 AF6 8  SER P  371 ? SER P 351 . ? 1_555 ? 
192 AF6 8  ARG P  388 ? ARG P 368 . ? 1_555 ? 
193 AF6 8  HOH ZB .   ? HOH P 618 . ? 1_555 ? 
194 AF6 8  HOH ZB .   ? HOH P 681 . ? 1_555 ? 
195 AF6 8  HOH ZB .   ? HOH P 707 . ? 1_555 ? 
196 AF7 6  PRO P  308 ? PRO P 288 . ? 1_555 ? 
197 AF7 6  ASP P  311 ? ASP P 291 . ? 1_555 ? 
198 AF7 6  TYR P  313 ? TYR P 293 . ? 1_555 ? 
199 AF7 6  HOH ZB .   ? HOH P 614 . ? 1_555 ? 
200 AF7 6  HOH ZB .   ? HOH P 660 . ? 1_555 ? 
201 AF7 6  HOH ZB .   ? HOH P 704 . ? 1_555 ? 
202 AF8 8  HIS Q  333 ? HIS Q 313 . ? 1_555 ? 
203 AF8 8  SER Q  354 ? SER Q 334 . ? 1_555 ? 
204 AF8 8  ASN Q  370 ? ASN Q 350 . ? 1_555 ? 
205 AF8 8  SER Q  371 ? SER Q 351 . ? 1_555 ? 
206 AF8 8  ARG Q  388 ? ARG Q 368 . ? 1_555 ? 
207 AF8 8  HOH AC .   ? HOH Q 735 . ? 1_555 ? 
208 AF8 8  HOH AC .   ? HOH Q 744 . ? 1_555 ? 
209 AF8 8  HOH AC .   ? HOH Q 748 . ? 1_555 ? 
210 AF9 6  PHE Q  281 ? PHE Q 261 . ? 1_555 ? 
211 AF9 6  ASP Q  311 ? ASP Q 291 . ? 1_555 ? 
212 AF9 6  TYR Q  313 ? TYR Q 293 . ? 1_555 ? 
213 AF9 6  HOH AC .   ? HOH Q 635 . ? 1_555 ? 
214 AF9 6  HOH AC .   ? HOH Q 643 . ? 1_555 ? 
215 AF9 6  HOH AC .   ? HOH Q 674 . ? 1_555 ? 
216 AG1 6  HIS R  333 ? HIS R 313 . ? 1_555 ? 
217 AG1 6  SER R  354 ? SER R 334 . ? 1_555 ? 
218 AG1 6  ASN R  370 ? ASN R 350 . ? 1_555 ? 
219 AG1 6  SER R  371 ? SER R 351 . ? 1_555 ? 
220 AG1 6  ARG R  388 ? ARG R 368 . ? 1_555 ? 
221 AG1 6  HOH BC .   ? HOH R 617 . ? 1_555 ? 
222 AG2 5  PHE R  281 ? PHE R 261 . ? 1_555 ? 
223 AG2 5  ASP R  311 ? ASP R 291 . ? 1_555 ? 
224 AG2 5  HOH BC .   ? HOH R 634 . ? 1_555 ? 
225 AG2 5  HOH BC .   ? HOH R 664 . ? 1_555 ? 
226 AG2 5  HOH BC .   ? HOH R 670 . ? 1_555 ? 
227 AG3 6  HIS S  333 ? HIS V 313 . ? 1_555 ? 
228 AG3 6  SER S  354 ? SER V 334 . ? 1_555 ? 
229 AG3 6  ASN S  370 ? ASN V 350 . ? 1_555 ? 
230 AG3 6  SER S  371 ? SER V 351 . ? 1_555 ? 
231 AG3 6  ARG S  388 ? ARG V 368 . ? 1_555 ? 
232 AG3 6  HOH CC .   ? HOH V 708 . ? 1_555 ? 
233 AG4 4  ASP S  311 ? ASP V 291 . ? 1_555 ? 
234 AG4 4  TYR S  313 ? TYR V 293 . ? 1_555 ? 
235 AG4 4  HOH CC .   ? HOH V 606 . ? 1_555 ? 
236 AG4 4  HOH CC .   ? HOH V 682 . ? 1_555 ? 
237 AG5 6  HIS T  333 ? HIS T 313 . ? 1_555 ? 
238 AG5 6  SER T  354 ? SER T 334 . ? 1_555 ? 
239 AG5 6  ASN T  370 ? ASN T 350 . ? 1_555 ? 
240 AG5 6  SER T  371 ? SER T 351 . ? 1_555 ? 
241 AG5 6  ARG T  388 ? ARG T 368 . ? 1_555 ? 
242 AG5 6  HOH DC .   ? HOH T 723 . ? 1_555 ? 
243 AG6 6  PRO T  308 ? PRO T 288 . ? 1_555 ? 
244 AG6 6  ASP T  311 ? ASP T 291 . ? 1_555 ? 
245 AG6 6  TYR T  313 ? TYR T 293 . ? 1_555 ? 
246 AG6 6  HOH DC .   ? HOH T 619 . ? 1_555 ? 
247 AG6 6  HOH DC .   ? HOH T 632 . ? 1_555 ? 
248 AG6 6  HOH DC .   ? HOH T 672 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6V9A 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.010842 
_atom_sites.fract_transf_matrix[1][2]   0.000004 
_atom_sites.fract_transf_matrix[1][3]   0.002352 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007072 
_atom_sites.fract_transf_matrix[2][3]   0.002351 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004706 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C ? ? 3.54356 2.42580 25.62398 1.50364  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N ? ? 4.01032 2.96436 19.97189 1.75589  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O ? ? 4.49882 3.47563 15.80542 1.70748  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S ? ? 9.55732 6.39887 1.23737  29.19336 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . VAL A  1 26  ? 46.76525  37.44306   30.75269  1.000 61.88878  ? 6   VAL H N   1 
ATOM   2     C CA  . VAL A  1 26  ? 46.11224  37.07503   32.00865  1.000 64.36899  ? 6   VAL H CA  1 
ATOM   3     C C   . VAL A  1 26  ? 44.60656  36.75854   31.75440  1.000 67.85455  ? 6   VAL H C   1 
ATOM   4     O O   . VAL A  1 26  ? 44.12961  35.68015   32.13455  1.000 77.66396  ? 6   VAL H O   1 
ATOM   5     C CB  . VAL A  1 26  ? 46.38079  38.17598   33.11520  1.000 65.58697  ? 6   VAL H CB  1 
ATOM   6     C CG1 . VAL A  1 26  ? 45.25856  38.28503   34.18416  1.000 59.12483  ? 6   VAL H CG1 1 
ATOM   7     C CG2 . VAL A  1 26  ? 47.70840  37.85360   33.79726  1.000 66.66971  ? 6   VAL H CG2 1 
ATOM   8     N N   . GLN A  1 27  ? 43.90144  37.60416   31.00078  1.000 66.31065  ? 7   GLN H N   1 
ATOM   9     C CA  . GLN A  1 27  ? 42.48864  37.33261   30.72278  1.000 58.38619  ? 7   GLN H CA  1 
ATOM   10    C C   . GLN A  1 27  ? 42.34493  36.15484   29.76062  1.000 50.81029  ? 7   GLN H C   1 
ATOM   11    O O   . GLN A  1 27  ? 43.15733  36.00244   28.83857  1.000 51.50233  ? 7   GLN H O   1 
ATOM   12    C CB  . GLN A  1 27  ? 41.80064  38.56274   30.12737  1.000 54.87207  ? 7   GLN H CB  1 
ATOM   13    C CG  . GLN A  1 27  ? 41.71744  39.75527   31.06039  1.000 54.08552  ? 7   GLN H CG  1 
ATOM   14    C CD  . GLN A  1 27  ? 41.26681  41.00779   30.35221  1.000 56.24141  ? 7   GLN H CD  1 
ATOM   15    O OE1 . GLN A  1 27  ? 41.46755  42.11827   30.84539  1.000 68.61631  ? 7   GLN H OE1 1 
ATOM   16    N NE2 . GLN A  1 27  ? 40.63847  40.83958   29.19586  1.000 45.63549  ? 7   GLN H NE2 1 
ATOM   17    N N   . PRO A  1 28  ? 41.35335  35.29404   29.96541  1.000 40.40370  ? 8   PRO H N   1 
ATOM   18    C CA  . PRO A  1 28  ? 41.11441  34.21754   29.00517  1.000 42.27783  ? 8   PRO H CA  1 
ATOM   19    C C   . PRO A  1 28  ? 40.71534  34.77763   27.64869  1.000 38.13483  ? 8   PRO H C   1 
ATOM   20    O O   . PRO A  1 28  ? 39.96993  35.75457   27.55137  1.000 44.48282  ? 8   PRO H O   1 
ATOM   21    C CB  . PRO A  1 28  ? 39.97225  33.41808   29.64551  1.000 41.24604  ? 8   PRO H CB  1 
ATOM   22    C CG  . PRO A  1 28  ? 39.31129  34.38073   30.57381  1.000 48.45215  ? 8   PRO H CG  1 
ATOM   23    C CD  . PRO A  1 28  ? 40.41330  35.25317   31.09407  1.000 47.15326  ? 8   PRO H CD  1 
ATOM   24    N N   . LEU A  1 29  ? 41.22195  34.14365   26.59331  1.000 36.10644  ? 9   LEU H N   1 
ATOM   25    C CA  . LEU A  1 29  ? 41.00422  34.64137   25.24193  1.000 36.45151  ? 9   LEU H CA  1 
ATOM   26    C C   . LEU A  1 29  ? 39.59023  34.39086   24.73467  1.000 33.22529  ? 9   LEU H C   1 
ATOM   27    O O   . LEU A  1 29  ? 39.14964  35.08258   23.81047  1.000 34.51467  ? 9   LEU H O   1 
ATOM   28    C CB  . LEU A  1 29  ? 42.01669  34.00910   24.28569  1.000 36.38450  ? 9   LEU H CB  1 
ATOM   29    C CG  . LEU A  1 29  ? 43.48265  34.23407   24.66155  1.000 39.36675  ? 9   LEU H CG  1 
ATOM   30    C CD1 . LEU A  1 29  ? 44.38946  33.41409   23.76179  1.000 39.52273  ? 9   LEU H CD1 1 
ATOM   31    C CD2 . LEU A  1 29  ? 43.84471  35.71100   24.58591  1.000 37.02765  ? 9   LEU H CD2 1 
ATOM   32    N N   . ALA A  1 30  ? 38.87112  33.42492   25.30751  1.000 35.44303  ? 10  ALA H N   1 
ATOM   33    C CA  . ALA A  1 30  ? 37.50193  33.17342   24.87093  1.000 33.68697  ? 10  ALA H CA  1 
ATOM   34    C C   . ALA A  1 30  ? 36.58561  34.36436   25.12537  1.000 26.92077  ? 10  ALA H C   1 
ATOM   35    O O   . ALA A  1 30  ? 35.56042  34.49234   24.45063  1.000 37.05892  ? 10  ALA H O   1 
ATOM   36    C CB  . ALA A  1 30  ? 36.94511  31.92759   25.56134  1.000 27.44754  ? 10  ALA H CB  1 
ATOM   37    N N   . ARG A  1 31  ? 36.92802  35.23535   26.08012  1.000 27.64846  ? 11  ARG H N   1 
ATOM   38    C CA  . ARG A  1 31  ? 36.14380  36.45196   26.29023  1.000 28.54933  ? 11  ARG H CA  1 
ATOM   39    C C   . ARG A  1 31  ? 36.04822  37.28082   25.02027  1.000 29.42269  ? 11  ARG H C   1 
ATOM   40    O O   . ARG A  1 31  ? 35.06307  37.99666   24.81985  1.000 30.96491  ? 11  ARG H O   1 
ATOM   41    C CB  . ARG A  1 31  ? 36.75607  37.31240   27.39753  1.000 28.64487  ? 11  ARG H CB  1 
ATOM   42    C CG  . ARG A  1 31  ? 36.51638  36.84782   28.82146  1.000 28.90327  ? 11  ARG H CG  1 
ATOM   43    C CD  . ARG A  1 31  ? 36.92036  37.95280   29.78437  1.000 30.07534  ? 11  ARG H CD  1 
ATOM   44    N NE  . ARG A  1 31  ? 37.17827  37.47008   31.13608  1.000 35.49293  ? 11  ARG H NE  1 
ATOM   45    C CZ  . ARG A  1 31  ? 37.71637  38.21233   32.09809  1.000 32.17827  ? 11  ARG H CZ  1 
ATOM   46    N NH1 . ARG A  1 31  ? 38.05468  39.46995   31.85293  1.000 43.02490  ? 11  ARG H NH1 1 
ATOM   47    N NH2 . ARG A  1 31  ? 37.92165  37.70190   33.30422  1.000 33.03695  ? 11  ARG H NH2 1 
ATOM   48    N N   . ASP A  1 32  ? 37.05533  37.19220   24.15083  1.000 30.58697  ? 12  ASP H N   1 
ATOM   49    C CA  . ASP A  1 32  ? 37.16704  38.04335   22.97350  1.000 41.69215  ? 12  ASP H CA  1 
ATOM   50    C C   . ASP A  1 32  ? 37.01035  37.25802   21.67809  1.000 37.28763  ? 12  ASP H C   1 
ATOM   51    O O   . ASP A  1 32  ? 37.52744  37.66328   20.63402  1.000 35.42467  ? 12  ASP H O   1 
ATOM   52    C CB  . ASP A  1 32  ? 38.50249  38.78129   22.98433  1.000 41.44815  ? 12  ASP H CB  1 
ATOM   53    C CG  . ASP A  1 32  ? 38.57557  39.81712   24.07948  1.000 54.67948  ? 12  ASP H CG  1 
ATOM   54    O OD1 . ASP A  1 32  ? 37.79191  40.78693   24.02062  1.000 58.26807  ? 12  ASP H OD1 1 
ATOM   55    O OD2 . ASP A  1 32  ? 39.40750  39.66133   24.99927  1.000 63.17433  ? 12  ASP H OD2 1 
ATOM   56    N N   . ALA A  1 33  ? 36.30212  36.13657   21.73077  1.000 31.19150  ? 13  ALA H N   1 
ATOM   57    C CA  . ALA A  1 33  ? 36.19379  35.24610   20.59043  1.000 34.33682  ? 13  ALA H CA  1 
ATOM   58    C C   . ALA A  1 33  ? 34.72949  35.01261   20.26080  1.000 35.48871  ? 13  ALA H C   1 
ATOM   59    O O   . ALA A  1 33  ? 33.85785  35.08070   21.13258  1.000 32.65536  ? 13  ALA H O   1 
ATOM   60    C CB  . ALA A  1 33  ? 36.89992  33.91197   20.85444  1.000 32.73017  ? 13  ALA H CB  1 
ATOM   61    N N   . MET A  1 34  ? 34.46674  34.75842   18.98349  1.000 25.70333  ? 14  MET H N   1 
ATOM   62    C CA  . MET A  1 34  ? 33.13158  34.42687   18.51211  1.000 30.91219  ? 14  MET H CA  1 
ATOM   63    C C   . MET A  1 34  ? 33.19613  33.09410   17.78612  1.000 33.50134  ? 14  MET H C   1 
ATOM   64    O O   . MET A  1 34  ? 33.99566  32.92559   16.85987  1.000 48.36340  ? 14  MET H O   1 
ATOM   65    C CB  . MET A  1 34  ? 32.57302  35.51190   17.59433  1.000 25.37365  ? 14  MET H CB  1 
ATOM   66    C CG  . MET A  1 34  ? 31.29424  35.10676   16.88296  1.000 37.65460  ? 14  MET H CG  1 
ATOM   67    S SD  . MET A  1 34  ? 30.69655  36.40484   15.78615  1.000 33.60370  ? 14  MET H SD  1 
ATOM   68    C CE  . MET A  1 34  ? 28.95774  35.99760   15.62783  1.000 27.65548  ? 14  MET H CE  1 
ATOM   69    N N   . ALA A  1 35  ? 32.36730  32.15205   18.21877  1.000 33.15394  ? 15  ALA H N   1 
ATOM   70    C CA  . ALA A  1 35  ? 32.25086  30.86701   17.55113  1.000 23.95345  ? 15  ALA H CA  1 
ATOM   71    C C   . ALA A  1 35  ? 31.26518  30.99093   16.40182  1.000 27.54134  ? 15  ALA H C   1 
ATOM   72    O O   . ALA A  1 35  ? 30.16060  31.51274   16.57730  1.000 40.92278  ? 15  ALA H O   1 
ATOM   73    C CB  . ALA A  1 35  ? 31.79265  29.79282   18.53680  1.000 23.30113  ? 15  ALA H CB  1 
ATOM   74    N N   . TYR A  1 36  ? 31.67197  30.53724   15.21929  1.000 24.55087  ? 16  TYR H N   1 
ATOM   75    C CA  . TYR A  1 36  ? 30.81471  30.54951   14.03920  1.000 25.45887  ? 16  TYR H CA  1 
ATOM   76    C C   . TYR A  1 36  ? 30.66298  29.11828   13.54993  1.000 36.94588  ? 16  TYR H C   1 
ATOM   77    O O   . TYR A  1 36  ? 31.58952  28.55301   12.95957  1.000 25.45312  ? 16  TYR H O   1 
ATOM   78    C CB  . TYR A  1 36  ? 31.38065  31.44676   12.94682  1.000 25.88788  ? 16  TYR H CB  1 
ATOM   79    C CG  . TYR A  1 36  ? 30.33140  31.95435   11.98909  1.000 38.34604  ? 16  TYR H CG  1 
ATOM   80    C CD1 . TYR A  1 36  ? 29.80857  33.23582   12.11371  1.000 34.80641  ? 16  TYR H CD1 1 
ATOM   81    C CD2 . TYR A  1 36  ? 29.86205  31.15225   10.95676  1.000 42.09855  ? 16  TYR H CD2 1 
ATOM   82    C CE1 . TYR A  1 36  ? 28.84082  33.70170   11.23490  1.000 36.58038  ? 16  TYR H CE1 1 
ATOM   83    C CE2 . TYR A  1 36  ? 28.89964  31.60889   10.07482  1.000 41.26721  ? 16  TYR H CE2 1 
ATOM   84    C CZ  . TYR A  1 36  ? 28.39246  32.88088   10.21656  1.000 34.84028  ? 16  TYR H CZ  1 
ATOM   85    O OH  . TYR A  1 36  ? 27.43598  33.32276   9.33093   1.000 41.16405  ? 16  TYR H OH  1 
ATOM   86    N N   . VAL A  1 37  ? 29.50195  28.53767   13.79194  1.000 38.72951  ? 17  VAL H N   1 
ATOM   87    C CA  . VAL A  1 37  ? 29.24970  27.15096   13.43858  1.000 25.95923  ? 17  VAL H CA  1 
ATOM   88    C C   . VAL A  1 37  ? 28.65645  27.09334   12.03716  1.000 31.78798  ? 17  VAL H C   1 
ATOM   89    O O   . VAL A  1 37  ? 27.75138  27.86643   11.69753  1.000 33.77267  ? 17  VAL H O   1 
ATOM   90    C CB  . VAL A  1 37  ? 28.31792  26.48846   14.46411  1.000 27.04818  ? 17  VAL H CB  1 
ATOM   91    C CG1 . VAL A  1 37  ? 28.35459  24.99783   14.27949  1.000 23.39789  ? 17  VAL H CG1 1 
ATOM   92    C CG2 . VAL A  1 37  ? 28.74411  26.84335   15.87493  1.000 22.81097  ? 17  VAL H CG2 1 
ATOM   93    N N   . LEU A  1 38  ? 29.17617  26.18503   11.21598  1.000 29.63245  ? 18  LEU H N   1 
ATOM   94    C CA  . LEU A  1 38  ? 28.65148  25.94817   9.87587   1.000 26.89938  ? 18  LEU H CA  1 
ATOM   95    C C   . LEU A  1 38  ? 27.77680  24.69979   9.92969   1.000 37.48637  ? 18  LEU H C   1 
ATOM   96    O O   . LEU A  1 38  ? 28.27768  23.58535   10.11743  1.000 30.45680  ? 18  LEU H O   1 
ATOM   97    C CB  . LEU A  1 38  ? 29.77452  25.80164   8.85126   1.000 27.69368  ? 18  LEU H CB  1 
ATOM   98    C CG  . LEU A  1 38  ? 30.97484  26.74263   8.97504   1.000 32.04670  ? 18  LEU H CG  1 
ATOM   99    C CD1 . LEU A  1 38  ? 32.13970  26.23779   8.14507   1.000 32.73153  ? 18  LEU H CD1 1 
ATOM   100   C CD2 . LEU A  1 38  ? 30.59244  28.16120   8.55709   1.000 30.73813  ? 18  LEU H CD2 1 
ATOM   101   N N   . ALA A  1 39  ? 26.47121  24.89167   9.77696   1.000 30.49068  ? 19  ALA H N   1 
ATOM   102   C CA  . ALA A  1 39  ? 25.49945  23.81709   9.88868   1.000 25.92125  ? 19  ALA H CA  1 
ATOM   103   C C   . ALA A  1 39  ? 24.60165  23.78636   8.66788   1.000 26.95032  ? 19  ALA H C   1 
ATOM   104   O O   . ALA A  1 39  ? 23.39453  23.54456   8.76528   1.000 30.67410  ? 19  ALA H O   1 
ATOM   105   C CB  . ALA A  1 39  ? 24.67630  23.95432   11.16585  1.000 24.89827  ? 19  ALA H CB  1 
ATOM   106   N N   . GLY A  1 40  ? 25.18260  24.02869   7.49439   1.000 28.49994  ? 20  GLY H N   1 
ATOM   107   C CA  . GLY A  1 40  ? 24.45225  23.93177   6.24555   1.000 36.81473  ? 20  GLY H CA  1 
ATOM   108   C C   . GLY A  1 40  ? 24.66291  22.59393   5.56852   1.000 45.27609  ? 20  GLY H C   1 
ATOM   109   O O   . GLY A  1 40  ? 24.02732  22.29269   4.55293   1.000 43.95529  ? 20  GLY H O   1 
ATOM   110   N N   . GLY A  1 41  ? 25.55620  21.78314   6.13644   1.000 50.84057  ? 21  GLY H N   1 
ATOM   111   C CA  . GLY A  1 41  ? 25.89066  20.48284   5.58852   1.000 56.91163  ? 21  GLY H CA  1 
ATOM   112   C C   . GLY A  1 41  ? 24.69872  19.56081   5.44132   1.000 52.61769  ? 21  GLY H C   1 
ATOM   113   O O   . GLY A  1 41  ? 23.95148  19.32937   6.39790   1.000 41.77825  ? 21  GLY H O   1 
ATOM   114   N N   . ARG A  1 42  ? 24.51843  19.02168   4.23736   1.000 57.44577  ? 22  ARG H N   1 
ATOM   115   C CA  . ARG A  1 42  ? 23.33780  18.22600   3.93834   1.000 61.05875  ? 22  ARG H CA  1 
ATOM   116   C C   . ARG A  1 42  ? 23.43796  16.79482   4.45188   1.000 55.70064  ? 22  ARG H C   1 
ATOM   117   O O   . ARG A  1 42  ? 22.40021  16.17899   4.71725   1.000 58.00969  ? 22  ARG H O   1 
ATOM   118   C CB  . ARG A  1 42  ? 23.08637  18.22638   2.42816   1.000 65.31443  ? 22  ARG H CB  1 
ATOM   119   N N   . GLY A  1 43  ? 24.65036  16.25995   4.60643   1.000 51.60430  ? 23  GLY H N   1 
ATOM   120   C CA  . GLY A  1 43  ? 24.83832  14.88644   5.03787   1.000 45.08326  ? 23  GLY H CA  1 
ATOM   121   C C   . GLY A  1 43  ? 24.23291  13.88623   4.07556   1.000 49.05195  ? 23  GLY H C   1 
ATOM   122   O O   . GLY A  1 43  ? 23.44912  13.01823   4.47546   1.000 43.71125  ? 23  GLY H O   1 
ATOM   123   N N   . SER A  1 44  ? 24.60312  13.99752   2.79622   1.000 51.69175  ? 24  SER H N   1 
ATOM   124   C CA  . SER A  1 44  ? 23.93542  13.22281   1.75453   1.000 48.34451  ? 24  SER H CA  1 
ATOM   125   C C   . SER A  1 44  ? 24.16675  11.72620   1.91459   1.000 47.66155  ? 24  SER H C   1 
ATOM   126   O O   . SER A  1 44  ? 23.30921  10.92301   1.52681   1.000 44.37249  ? 24  SER H O   1 
ATOM   127   C CB  . SER A  1 44  ? 24.40833  13.68681   0.37700   1.000 46.74470  ? 24  SER H CB  1 
ATOM   128   O OG  . SER A  1 44  ? 25.82188  13.64229   0.28925   1.000 57.35080  ? 24  SER H OG  1 
ATOM   129   N N   . ARG A  1 45  ? 25.30868  11.32695   2.47564   1.000 41.19449  ? 25  ARG H N   1 
ATOM   130   C CA  . ARG A  1 45  ? 25.57512  9.90653    2.65514   1.000 48.01428  ? 25  ARG H CA  1 
ATOM   131   C C   . ARG A  1 45  ? 24.69660  9.27513    3.72791   1.000 39.77944  ? 25  ARG H C   1 
ATOM   132   O O   . ARG A  1 45  ? 24.64491  8.04608    3.81052   1.000 41.10472  ? 25  ARG H O   1 
ATOM   133   C CB  . ARG A  1 45  ? 27.05263  9.69641    2.98993   1.000 45.67833  ? 25  ARG H CB  1 
ATOM   134   C CG  . ARG A  1 45  ? 27.96749  9.63672    1.77426   1.000 44.74757  ? 25  ARG H CG  1 
ATOM   135   C CD  . ARG A  1 45  ? 28.87051  8.41920    1.84613   1.000 55.43548  ? 25  ARG H CD  1 
ATOM   136   N NE  . ARG A  1 45  ? 28.08120  7.20846    1.61573   1.000 71.88784  ? 25  ARG H NE  1 
ATOM   137   C CZ  . ARG A  1 45  ? 28.43834  5.96795    1.94725   1.000 73.54973  ? 25  ARG H CZ  1 
ATOM   138   N NH1 . ARG A  1 45  ? 29.60687  5.74521    2.53043   1.000 74.96716  ? 25  ARG H NH1 1 
ATOM   139   N NH2 . ARG A  1 45  ? 27.62656  4.94187    1.68215   1.000 74.22949  ? 25  ARG H NH2 1 
ATOM   140   N N   . LEU A  1 46  ? 24.02279  10.07753   4.55590   1.000 36.36201  ? 26  LEU H N   1 
ATOM   141   C CA  . LEU A  1 46  ? 23.03757  9.54929    5.49289   1.000 36.35275  ? 26  LEU H CA  1 
ATOM   142   C C   . LEU A  1 46  ? 21.72478  9.18440    4.81305   1.000 43.81298  ? 26  LEU H C   1 
ATOM   143   O O   . LEU A  1 46  ? 20.84453  8.60851    5.46654   1.000 34.57953  ? 26  LEU H O   1 
ATOM   144   C CB  . LEU A  1 46  ? 22.78955  10.56149   6.61287   1.000 33.76809  ? 26  LEU H CB  1 
ATOM   145   C CG  . LEU A  1 46  ? 24.00592  10.74694   7.52508   1.000 37.89696  ? 26  LEU H CG  1 
ATOM   146   C CD1 . LEU A  1 46  ? 23.73397  11.79329   8.58462   1.000 29.75988  ? 26  LEU H CD1 1 
ATOM   147   C CD2 . LEU A  1 46  ? 24.42773  9.41611    8.16768   1.000 31.36248  ? 26  LEU H CD2 1 
ATOM   148   N N   . LYS A  1 47  ? 21.58495  9.51300    3.52841   1.000 36.24197  ? 27  LYS H N   1 
ATOM   149   C CA  . LYS A  1 47  ? 20.47065  9.11138    2.65997   1.000 37.68558  ? 27  LYS H CA  1 
ATOM   150   C C   . LYS A  1 47  ? 19.16454  9.58238    3.29681   1.000 36.92485  ? 27  LYS H C   1 
ATOM   151   O O   . LYS A  1 47  ? 19.07216  10.76332   3.66721   1.000 45.58503  ? 27  LYS H O   1 
ATOM   152   C CB  . LYS A  1 47  ? 20.58027  7.61970    2.36400   1.000 42.22044  ? 27  LYS H CB  1 
ATOM   153   C CG  . LYS A  1 47  ? 21.99783  7.19936    1.96077   1.000 39.49240  ? 27  LYS H CG  1 
ATOM   154   C CD  . LYS A  1 47  ? 22.08108  6.72368    0.51138   1.000 44.35196  ? 27  LYS H CD  1 
ATOM   155   C CE  . LYS A  1 47  ? 23.52160  6.76639    -0.00639  1.000 54.40987  ? 27  LYS H CE  1 
ATOM   156   N NZ  . LYS A  1 47  ? 23.60852  7.27675    -1.40857  1.000 57.53807  ? 27  LYS H NZ  1 
ATOM   157   N N   . GLU A  1 48  ? 18.14813  8.72571    3.44231   1.000 37.47429  ? 28  GLU H N   1 
ATOM   158   C CA  . GLU A  1 48  ? 16.82593  9.19617    3.84876   1.000 40.36820  ? 28  GLU H CA  1 
ATOM   159   C C   . GLU A  1 48  ? 16.81921  9.84013    5.23280   1.000 39.99611  ? 28  GLU H C   1 
ATOM   160   O O   . GLU A  1 48  ? 15.92007  10.63951   5.52856   1.000 35.24569  ? 28  GLU H O   1 
ATOM   161   C CB  . GLU A  1 48  ? 15.82141  8.03990    3.81203   1.000 38.90656  ? 28  GLU H CB  1 
ATOM   162   C CG  . GLU A  1 48  ? 15.31533  7.68677    2.41686   1.000 40.47405  ? 28  GLU H CG  1 
ATOM   163   C CD  . GLU A  1 48  ? 16.24496  6.74051    1.68151   1.000 42.56291  ? 28  GLU H CD  1 
ATOM   164   O OE1 . GLU A  1 48  ? 17.28443  6.36569    2.26206   1.000 46.66509  ? 28  GLU H OE1 1 
ATOM   165   O OE2 . GLU A  1 48  ? 15.93936  6.37155    0.52521   1.000 45.77754  ? 28  GLU H OE2 1 
ATOM   166   N N   . LEU A  1 49  ? 17.79969  9.51839    6.08223   1.000 34.20524  ? 29  LEU H N   1 
ATOM   167   C CA  . LEU A  1 49  ? 17.84001  10.07439   7.43009   1.000 36.89207  ? 29  LEU H CA  1 
ATOM   168   C C   . LEU A  1 49  ? 17.98007  11.59228   7.41947   1.000 42.48970  ? 29  LEU H C   1 
ATOM   169   O O   . LEU A  1 49  ? 17.63319  12.24703   8.40980   1.000 34.03332  ? 29  LEU H O   1 
ATOM   170   C CB  . LEU A  1 49  ? 18.98799  9.43276    8.21783   1.000 35.57972  ? 29  LEU H CB  1 
ATOM   171   C CG  . LEU A  1 49  ? 19.08161  9.65504    9.73131   1.000 38.91295  ? 29  LEU H CG  1 
ATOM   172   C CD1 . LEU A  1 49  ? 17.80047  9.23881    10.44070  1.000 45.56509  ? 29  LEU H CD1 1 
ATOM   173   C CD2 . LEU A  1 49  ? 20.27395  8.89456    10.29467  1.000 35.04861  ? 29  LEU H CD2 1 
ATOM   174   N N   . THR A  1 50  ? 18.47779  12.16550   6.32329   1.000 37.26717  ? 30  THR H N   1 
ATOM   175   C CA  . THR A  1 50  ? 18.59586  13.61141   6.18487   1.000 42.73854  ? 30  THR H CA  1 
ATOM   176   C C   . THR A  1 50  ? 17.73745  14.14717   5.04261   1.000 45.07078  ? 30  THR H C   1 
ATOM   177   O O   . THR A  1 50  ? 17.97620  15.25826   4.56060   1.000 47.08140  ? 30  THR H O   1 
ATOM   178   C CB  . THR A  1 50  ? 20.05904  14.01800   5.98997   1.000 35.80198  ? 30  THR H CB  1 
ATOM   179   O OG1 . THR A  1 50  ? 20.59628  13.36453   4.83325   1.000 33.15723  ? 30  THR H OG1 1 
ATOM   180   C CG2 . THR A  1 50  ? 20.88309  13.63713   7.21433   1.000 30.48625  ? 30  THR H CG2 1 
ATOM   181   N N   . ASP A  1 51  ? 16.73952  13.37764   4.59912   1.000 51.77847  ? 31  ASP H N   1 
ATOM   182   C CA  . ASP A  1 51  ? 15.83684  13.86529   3.55991   1.000 54.55538  ? 31  ASP H CA  1 
ATOM   183   C C   . ASP A  1 51  ? 15.08129  15.10403   4.02148   1.000 52.97172  ? 31  ASP H C   1 
ATOM   184   O O   . ASP A  1 51  ? 14.85843  16.03193   3.23618   1.000 55.07418  ? 31  ASP H O   1 
ATOM   185   C CB  . ASP A  1 51  ? 14.84789  12.77059   3.15936   1.000 51.06299  ? 31  ASP H CB  1 
ATOM   186   C CG  . ASP A  1 51  ? 15.36953  11.88718   2.04561   1.000 53.61282  ? 31  ASP H CG  1 
ATOM   187   O OD1 . ASP A  1 51  ? 16.46709  12.17154   1.52046   1.000 56.66210  ? 31  ASP H OD1 1 
ATOM   188   O OD2 . ASP A  1 51  ? 14.67760  10.90787   1.69546   1.000 54.27678  ? 31  ASP H OD2 1 
ATOM   189   N N   . ARG A  1 52  ? 14.67730  15.13461   5.29113   1.000 49.31481  ? 32  ARG H N   1 
ATOM   190   C CA  . ARG A  1 52  ? 13.84714  16.20214   5.83018   1.000 46.22110  ? 32  ARG H CA  1 
ATOM   191   C C   . ARG A  1 52  ? 14.58441  17.10266   6.81377   1.000 39.40713  ? 32  ARG H C   1 
ATOM   192   O O   . ARG A  1 52  ? 13.97624  18.03298   7.35527   1.000 37.09762  ? 32  ARG H O   1 
ATOM   193   C CB  . ARG A  1 52  ? 12.60884  15.60121   6.50489   1.000 48.57574  ? 32  ARG H CB  1 
ATOM   194   C CG  . ARG A  1 52  ? 12.86280  14.23840   7.12983   1.000 64.91421  ? 32  ARG H CG  1 
ATOM   195   C CD  . ARG A  1 52  ? 11.57708  13.60038   7.64522   1.000 71.83532  ? 32  ARG H CD  1 
ATOM   196   N NE  . ARG A  1 52  ? 11.80475  12.87451   8.89359   1.000 71.76579  ? 32  ARG H NE  1 
ATOM   197   C CZ  . ARG A  1 52  ? 10.84425  12.33534   9.63959   1.000 60.60381  ? 32  ARG H CZ  1 
ATOM   198   N NH1 . ARG A  1 52  ? 9.57362   12.42580   9.26645   1.000 56.84640  ? 32  ARG H NH1 1 
ATOM   199   N NH2 . ARG A  1 52  ? 11.15738  11.70294   10.76215  1.000 47.38997  ? 32  ARG H NH2 1 
ATOM   200   N N   . ARG A  1 53  ? 15.87169  16.86177   7.05436   1.000 35.24310  ? 33  ARG H N   1 
ATOM   201   C CA  . ARG A  1 53  ? 16.62763  17.63811   8.02551   1.000 39.82309  ? 33  ARG H CA  1 
ATOM   202   C C   . ARG A  1 53  ? 18.09992  17.62983   7.64507   1.000 38.88741  ? 33  ARG H C   1 
ATOM   203   O O   . ARG A  1 53  ? 18.61472  16.64427   7.11268   1.000 44.78414  ? 33  ARG H O   1 
ATOM   204   C CB  . ARG A  1 53  ? 16.45882  17.08352   9.44462   1.000 38.79527  ? 33  ARG H CB  1 
ATOM   205   C CG  . ARG A  1 53  ? 16.95204  15.65115   9.59710   1.000 36.28109  ? 33  ARG H CG  1 
ATOM   206   C CD  . ARG A  1 53  ? 16.74954  15.13129   11.00894  1.000 38.74232  ? 33  ARG H CD  1 
ATOM   207   N NE  . ARG A  1 53  ? 15.39819  14.61475   11.21119  1.000 46.14042  ? 33  ARG H NE  1 
ATOM   208   C CZ  . ARG A  1 53  ? 15.04362  13.34409   11.03425  1.000 43.39571  ? 33  ARG H CZ  1 
ATOM   209   N NH1 . ARG A  1 53  ? 15.93751  12.44065   10.64354  1.000 37.69872  ? 33  ARG H NH1 1 
ATOM   210   N NH2 . ARG A  1 53  ? 13.78843  12.97461   11.24504  1.000 44.80935  ? 33  ARG H NH2 1 
ATOM   211   N N   . ALA A  1 54  ? 18.77384  18.73793   7.92860   1.000 31.16183  ? 34  ALA H N   1 
ATOM   212   C CA  . ALA A  1 54  ? 20.21600  18.78484   7.76159   1.000 29.74608  ? 34  ALA H CA  1 
ATOM   213   C C   . ALA A  1 54  ? 20.89648  17.92253   8.81831   1.000 28.12712  ? 34  ALA H C   1 
ATOM   214   O O   . ALA A  1 54  ? 20.37451  17.72287   9.91925   1.000 27.02455  ? 34  ALA H O   1 
ATOM   215   C CB  . ALA A  1 54  ? 20.72184  20.22314   7.85751   1.000 32.45834  ? 34  ALA H CB  1 
ATOM   216   N N   . LYS A  1 55  ? 22.07857  17.41556   8.46818   1.000 28.01622  ? 35  LYS H N   1 
ATOM   217   C CA  . LYS A  1 55  ? 22.86212  16.57473   9.37288   1.000 34.53846  ? 35  LYS H CA  1 
ATOM   218   C C   . LYS A  1 55  ? 23.03985  17.15923   10.77215  1.000 31.28783  ? 35  LYS H C   1 
ATOM   219   O O   . LYS A  1 55  ? 22.85752  16.41448   11.74921  1.000 26.97190  ? 35  LYS H O   1 
ATOM   220   C CB  . LYS A  1 55  ? 24.21296  16.27046   8.70687   1.000 40.35611  ? 35  LYS H CB  1 
ATOM   221   C CG  . LYS A  1 55  ? 24.92446  15.04678   9.25679   1.000 31.09870  ? 35  LYS H CG  1 
ATOM   222   C CD  . LYS A  1 55  ? 26.40014  15.07787   8.90114   1.000 35.38200  ? 35  LYS H CD  1 
ATOM   223   C CE  . LYS A  1 55  ? 27.15666  13.92650   9.53273   1.000 31.75401  ? 35  LYS H CE  1 
ATOM   224   N NZ  . LYS A  1 55  ? 28.62890  14.15795   9.50118   1.000 29.86021  ? 35  LYS H NZ  1 
ATOM   225   N N   . PRO A  1 56  ? 23.37874  18.44054   10.95531  1.000 31.15859  ? 36  PRO H N   1 
ATOM   226   C CA  . PRO A  1 56  ? 23.52094  18.95969   12.32786  1.000 24.62009  ? 36  PRO H CA  1 
ATOM   227   C C   . PRO A  1 56  ? 22.27595  18.79750   13.18317  1.000 24.23917  ? 36  PRO H C   1 
ATOM   228   O O   . PRO A  1 56  ? 22.38444  18.77557   14.41423  1.000 23.58486  ? 36  PRO H O   1 
ATOM   229   C CB  . PRO A  1 56  ? 23.85812  20.44149   12.10595  1.000 24.50610  ? 36  PRO H CB  1 
ATOM   230   C CG  . PRO A  1 56  ? 24.53072  20.45964   10.78332  1.000 25.42665  ? 36  PRO H CG  1 
ATOM   231   C CD  . PRO A  1 56  ? 23.80484  19.44012   9.95723   1.000 31.90699  ? 36  PRO H CD  1 
ATOM   232   N N   . ALA A  1 57  ? 21.09895  18.67620   12.58262  1.000 24.80444  ? 37  ALA H N   1 
ATOM   233   C CA  . ALA A  1 57  ? 19.87641  18.48290   13.34820  1.000 28.24953  ? 37  ALA H CA  1 
ATOM   234   C C   . ALA A  1 57  ? 19.56256  17.01287   13.60293  1.000 24.96118  ? 37  ALA H C   1 
ATOM   235   O O   . ALA A  1 57  ? 18.51202  16.70745   14.17996  1.000 31.42786  ? 37  ALA H O   1 
ATOM   236   C CB  . ALA A  1 57  ? 18.69737  19.15802   12.63326  1.000 25.36021  ? 37  ALA H CB  1 
ATOM   237   N N   . VAL A  1 58  ? 20.44225  16.09686   13.19502  1.000 26.79269  ? 38  VAL H N   1 
ATOM   238   C CA  . VAL A  1 58  ? 20.18467  14.67613   13.39714  1.000 25.59416  ? 38  VAL H CA  1 
ATOM   239   C C   . VAL A  1 58  ? 20.30042  14.35723   14.87957  1.000 24.96262  ? 38  VAL H C   1 
ATOM   240   O O   . VAL A  1 58  ? 21.25998  14.76594   15.54252  1.000 24.36013  ? 38  VAL H O   1 
ATOM   241   C CB  . VAL A  1 58  ? 21.15204  13.82204   12.56340  1.000 26.56871  ? 38  VAL H CB  1 
ATOM   242   C CG1 . VAL A  1 58  ? 21.03570  12.36165   12.95703  1.000 41.58234  ? 38  VAL H CG1 1 
ATOM   243   C CG2 . VAL A  1 58  ? 20.86678  13.98503   11.07751  1.000 27.12941  ? 38  VAL H CG2 1 
ATOM   244   N N   . TYR A  1 59  ? 19.31189  13.64074   15.41317  1.000 27.40450  ? 39  TYR H N   1 
ATOM   245   C CA  . TYR A  1 59  ? 19.37363  13.20702   16.80078  1.000 24.94566  ? 39  TYR H CA  1 
ATOM   246   C C   . TYR A  1 59  ? 20.56977  12.28302   17.01306  1.000 32.57934  ? 39  TYR H C   1 
ATOM   247   O O   . TYR A  1 59  ? 21.06454  11.64150   16.08247  1.000 25.48277  ? 39  TYR H O   1 
ATOM   248   C CB  . TYR A  1 59  ? 18.09061  12.48548   17.19293  1.000 25.54955  ? 39  TYR H CB  1 
ATOM   249   C CG  . TYR A  1 59  ? 16.83188  13.27233   16.93548  1.000 32.08630  ? 39  TYR H CG  1 
ATOM   250   C CD1 . TYR A  1 59  ? 15.99252  12.94118   15.88042  1.000 48.10580  ? 39  TYR H CD1 1 
ATOM   251   C CD2 . TYR A  1 59  ? 16.46405  14.32733   17.76238  1.000 34.00515  ? 39  TYR H CD2 1 
ATOM   252   C CE1 . TYR A  1 59  ? 14.82966  13.65071   15.64029  1.000 58.48385  ? 39  TYR H CE1 1 
ATOM   253   C CE2 . TYR A  1 59  ? 15.30207  15.04392   17.53093  1.000 39.87448  ? 39  TYR H CE2 1 
ATOM   254   C CZ  . TYR A  1 59  ? 14.49005  14.70105   16.46921  1.000 53.78680  ? 39  TYR H CZ  1 
ATOM   255   O OH  . TYR A  1 59  ? 13.33306  15.40777   16.23194  1.000 61.54515  ? 39  TYR H OH  1 
ATOM   256   N N   . PHE A  1 60  ? 21.04341  12.22430   18.25977  1.000 28.60649  ? 40  PHE H N   1 
ATOM   257   C CA  . PHE A  1 60  ? 22.16392  11.35180   18.58731  1.000 24.87226  ? 40  PHE H CA  1 
ATOM   258   C C   . PHE A  1 60  ? 22.16559  11.01543   20.06852  1.000 24.88978  ? 40  PHE H C   1 
ATOM   259   O O   . PHE A  1 60  ? 22.02849  11.90140   20.91262  1.000 24.44063  ? 40  PHE H O   1 
ATOM   260   C CB  . PHE A  1 60  ? 23.51183  11.98157   18.23184  1.000 26.92287  ? 40  PHE H CB  1 
ATOM   261   C CG  . PHE A  1 60  ? 24.68198  11.16312   18.69928  1.000 31.53869  ? 40  PHE H CG  1 
ATOM   262   C CD1 . PHE A  1 60  ? 24.97972  9.95193    18.08863  1.000 29.50751  ? 40  PHE H CD1 1 
ATOM   263   C CD2 . PHE A  1 60  ? 25.45518  11.57471   19.77384  1.000 31.38512  ? 40  PHE H CD2 1 
ATOM   264   C CE1 . PHE A  1 60  ? 26.04577  9.17687    18.52464  1.000 34.26507  ? 40  PHE H CE1 1 
ATOM   265   C CE2 . PHE A  1 60  ? 26.52365  10.80662   20.21256  1.000 31.43625  ? 40  PHE H CE2 1 
ATOM   266   C CZ  . PHE A  1 60  ? 26.81751  9.60613    19.58727  1.000 35.18300  ? 40  PHE H CZ  1 
ATOM   267   N N   . GLY A  1 61  ? 22.34361  9.73252    20.36808  1.000 34.62011  ? 41  GLY H N   1 
ATOM   268   C CA  . GLY A  1 61  ? 22.72526  9.26766    21.68063  1.000 27.75183  ? 41  GLY H CA  1 
ATOM   269   C C   . GLY A  1 61  ? 21.70162  9.42834    22.77175  1.000 34.05388  ? 41  GLY H C   1 
ATOM   270   O O   . GLY A  1 61  ? 22.06153  9.33549    23.94831  1.000 40.17182  ? 41  GLY H O   1 
ATOM   271   N N   A GLY A  1 62  ? 20.43773  9.66989    22.41748  0.579 33.65455  ? 42  GLY H N   1 
ATOM   272   N N   B GLY A  1 62  ? 20.43687  9.66825    22.43796  0.421 33.62570  ? 42  GLY H N   1 
ATOM   273   C CA  A GLY A  1 62  ? 19.39774  9.94846    23.39025  0.579 33.96380  ? 42  GLY H CA  1 
ATOM   274   C CA  B GLY A  1 62  ? 19.41499  9.71053    23.46535  0.421 33.91438  ? 42  GLY H CA  1 
ATOM   275   C C   A GLY A  1 62  ? 19.79169  11.13595   24.23494  0.579 32.76928  ? 42  GLY H C   1 
ATOM   276   C C   B GLY A  1 62  ? 18.50562  10.92285   23.46278  0.421 34.50890  ? 42  GLY H C   1 
ATOM   277   O O   A GLY A  1 62  ? 19.30691  11.32194   25.35482  0.579 40.50165  ? 42  GLY H O   1 
ATOM   278   O O   B GLY A  1 62  ? 17.29322  10.78095   23.65215  0.421 35.35872  ? 42  GLY H O   1 
ATOM   279   N N   A LYS A  1 63  ? 20.68429  11.95073   23.68060  0.579 25.62623  ? 43  LYS H N   1 
ATOM   280   N N   B LYS A  1 63  ? 19.05900  12.11848   23.25086  0.421 30.02831  ? 43  LYS H N   1 
ATOM   281   C CA  A LYS A  1 63  ? 21.42726  12.95610   24.42005  0.579 29.13511  ? 43  LYS H CA  1 
ATOM   282   C CA  B LYS A  1 63  ? 18.24566  13.32519   23.36363  0.421 32.40090  ? 43  LYS H CA  1 
ATOM   283   C C   A LYS A  1 63  ? 21.13612  14.36349   23.93814  0.579 25.17275  ? 43  LYS H C   1 
ATOM   284   C C   B LYS A  1 63  ? 18.77356  14.48537   22.52633  0.421 32.44485  ? 43  LYS H C   1 
ATOM   285   O O   A LYS A  1 63  ? 20.80338  15.23401   24.74833  0.579 28.09896  ? 43  LYS H O   1 
ATOM   286   O O   B LYS A  1 63  ? 18.00792  15.12834   21.80135  0.421 35.43069  ? 43  LYS H O   1 
ATOM   287   C CB  A LYS A  1 63  ? 22.93375  12.67239   24.30247  0.579 29.41004  ? 43  LYS H CB  1 
ATOM   288   C CB  B LYS A  1 63  ? 18.14909  13.74899   24.83049  0.421 29.47102  ? 43  LYS H CB  1 
ATOM   289   C CG  A LYS A  1 63  ? 23.81416  13.64669   25.06251  0.579 24.16713  ? 43  LYS H CG  1 
ATOM   290   C CG  B LYS A  1 63  ? 17.37483  15.03582   25.06260  0.421 37.78759  ? 43  LYS H CG  1 
ATOM   291   C CD  A LYS A  1 63  ? 23.70156  13.41411   26.55070  0.579 24.79076  ? 43  LYS H CD  1 
ATOM   292   C CD  B LYS A  1 63  ? 16.63389  15.01590   26.39497  0.421 31.67581  ? 43  LYS H CD  1 
ATOM   293   C CE  A LYS A  1 63  ? 24.88676  13.99322   27.28401  0.579 24.87856  ? 43  LYS H CE  1 
ATOM   294   C CE  B LYS A  1 63  ? 17.58927  14.92314   27.57118  0.421 25.91908  ? 43  LYS H CE  1 
ATOM   295   N NZ  A LYS A  1 63  ? 24.47625  14.43819   28.64302  0.579 25.33994  ? 43  LYS H NZ  1 
ATOM   296   N NZ  B LYS A  1 63  ? 17.87161  13.51896   27.97670  0.421 32.33485  ? 43  LYS H NZ  1 
ATOM   297   N N   A ALA A  1 64  ? 21.24682  14.60198   22.64047  0.579 25.62860  ? 44  ALA H N   1 
ATOM   298   N N   B ALA A  1 64  ? 20.07082  14.76638   22.62342  0.421 23.67128  ? 44  ALA H N   1 
ATOM   299   C CA  A ALA A  1 64  ? 21.12841  15.92703   22.04264  0.579 26.31849  ? 44  ALA H CA  1 
ATOM   300   C CA  B ALA A  1 64  ? 20.64342  15.94858   21.99602  0.421 26.03597  ? 44  ALA H CA  1 
ATOM   301   C C   A ALA A  1 64  ? 21.08108  15.74199   20.53084  0.579 29.08897  ? 44  ALA H C   1 
ATOM   302   C C   B ALA A  1 64  ? 20.69003  15.78954   20.47557  0.421 28.36969  ? 44  ALA H C   1 
ATOM   303   O O   A ALA A  1 64  ? 20.99549  14.61398   20.02941  0.579 23.45304  ? 44  ALA H O   1 
ATOM   304   O O   B ALA A  1 64  ? 20.33364  14.74906   19.91213  0.421 24.63194  ? 44  ALA H O   1 
ATOM   305   C CB  A ALA A  1 64  ? 22.29049  16.82719   22.46160  0.579 22.55340  ? 44  ALA H CB  1 
ATOM   306   C CB  B ALA A  1 64  ? 22.03899  16.21824   22.55328  0.421 22.78533  ? 44  ALA H CB  1 
ATOM   307   N N   . ARG A  1 65  ? 21.13447  16.84988   19.80403  1.000 22.70995  ? 45  ARG H N   1 
ATOM   308   C CA  . ARG A  1 65  ? 21.35661  16.83223   18.36934  1.000 26.00472  ? 45  ARG H CA  1 
ATOM   309   C C   . ARG A  1 65  ? 22.84488  17.04169   18.10756  1.000 26.74591  ? 45  ARG H C   1 
ATOM   310   O O   . ARG A  1 65  ? 23.58440  17.51802   18.97358  1.000 24.08750  ? 45  ARG H O   1 
ATOM   311   C CB  . ARG A  1 65  ? 20.51346  17.89851   17.66197  1.000 22.97485  ? 45  ARG H CB  1 
ATOM   312   C CG  . ARG A  1 65  ? 19.03815  17.53723   17.54348  1.000 31.34166  ? 45  ARG H CG  1 
ATOM   313   C CD  . ARG A  1 65  ? 18.22761  18.69347   16.96755  1.000 33.26017  ? 45  ARG H CD  1 
ATOM   314   N NE  . ARG A  1 65  ? 16.80200  18.58519   17.27109  1.000 24.22497  ? 45  ARG H NE  1 
ATOM   315   C CZ  . ARG A  1 65  ? 15.86657  18.27347   16.37802  1.000 26.76413  ? 45  ARG H CZ  1 
ATOM   316   N NH1 . ARG A  1 65  ? 16.20493  18.02190   15.12097  1.000 25.37543  ? 45  ARG H NH1 1 
ATOM   317   N NH2 . ARG A  1 65  ? 14.59012  18.20871   16.74293  1.000 25.67745  ? 45  ARG H NH2 1 
ATOM   318   N N   . ILE A  1 66  ? 23.28639  16.64919   16.90826  1.000 24.22360  ? 46  ILE H N   1 
ATOM   319   C CA  . ILE A  1 66  ? 24.70867  16.71033   16.58022  1.000 23.15781  ? 46  ILE H CA  1 
ATOM   320   C C   . ILE A  1 66  ? 25.24152  18.12818   16.75091  1.000 26.18120  ? 46  ILE H C   1 
ATOM   321   O O   . ILE A  1 66  ? 26.35111  18.33447   17.25809  1.000 24.97090  ? 46  ILE H O   1 
ATOM   322   C CB  . ILE A  1 66  ? 24.95089  16.18784   15.15317  1.000 36.25025  ? 46  ILE H CB  1 
ATOM   323   C CG1 . ILE A  1 66  ? 24.48692  14.73819   15.02134  1.000 28.04417  ? 46  ILE H CG1 1 
ATOM   324   C CG2 . ILE A  1 66  ? 26.41906  16.29483   14.78703  1.000 24.16216  ? 46  ILE H CG2 1 
ATOM   325   C CD1 . ILE A  1 66  ? 24.72443  14.16251   13.64252  1.000 29.37025  ? 46  ILE H CD1 1 
ATOM   326   N N   . ILE A  1 67  ? 24.45770  19.12781   16.34308  1.000 22.61317  ? 47  ILE H N   1 
ATOM   327   C CA  . ILE A  1 67  ? 24.90889  20.51130   16.45649  1.000 23.87766  ? 47  ILE H CA  1 
ATOM   328   C C   . ILE A  1 67  ? 25.19615  20.87318   17.91193  1.000 25.71268  ? 47  ILE H C   1 
ATOM   329   O O   . ILE A  1 67  ? 26.05635  21.71644   18.19123  1.000 31.70820  ? 47  ILE H O   1 
ATOM   330   C CB  . ILE A  1 67  ? 23.86519  21.45220   15.81088  1.000 29.58972  ? 47  ILE H CB  1 
ATOM   331   C CG1 . ILE A  1 67  ? 24.39775  22.87700   15.69746  1.000 32.66433  ? 47  ILE H CG1 1 
ATOM   332   C CG2 . ILE A  1 67  ? 22.58036  21.48694   16.61797  1.000 22.24975  ? 47  ILE H CG2 1 
ATOM   333   C CD1 . ILE A  1 67  ? 25.80033  22.93490   15.24447  1.000 29.49199  ? 47  ILE H CD1 1 
ATOM   334   N N   . ASP A  1 68  ? 24.52628  20.21238   18.86196  1.000 24.03236  ? 48  ASP H N   1 
ATOM   335   C CA  . ASP A  1 68  ? 24.65173  20.59572   20.26583  1.000 23.19914  ? 48  ASP H CA  1 
ATOM   336   C C   . ASP A  1 68  ? 26.05008  20.37030   20.82534  1.000 24.00917  ? 48  ASP H C   1 
ATOM   337   O O   . ASP A  1 68  ? 26.37126  20.91607   21.88404  1.000 26.24951  ? 48  ASP H O   1 
ATOM   338   C CB  . ASP A  1 68  ? 23.63740  19.83803   21.12054  1.000 21.63724  ? 48  ASP H CB  1 
ATOM   339   C CG  . ASP A  1 68  ? 22.21866  20.30347   20.88528  1.000 24.29359  ? 48  ASP H CG  1 
ATOM   340   O OD1 . ASP A  1 68  ? 22.02250  21.49068   20.54428  1.000 26.54137  ? 48  ASP H OD1 1 
ATOM   341   O OD2 . ASP A  1 68  ? 21.28988  19.48859   21.05415  1.000 23.08548  ? 48  ASP H OD2 1 
ATOM   342   N N   . PHE A  1 69  ? 26.89340  19.59055   20.15272  1.000 27.28391  ? 49  PHE H N   1 
ATOM   343   C CA  . PHE A  1 69  ? 28.21885  19.34952   20.70745  1.000 23.55388  ? 49  PHE H CA  1 
ATOM   344   C C   . PHE A  1 69  ? 29.14534  20.53291   20.45344  1.000 26.82657  ? 49  PHE H C   1 
ATOM   345   O O   . PHE A  1 69  ? 29.76194  21.05540   21.38907  1.000 23.92266  ? 49  PHE H O   1 
ATOM   346   C CB  . PHE A  1 69  ? 28.78457  18.04068   20.14827  1.000 22.77904  ? 49  PHE H CB  1 
ATOM   347   C CG  . PHE A  1 69  ? 28.14779  16.82430   20.75961  1.000 22.94383  ? 49  PHE H CG  1 
ATOM   348   C CD1 . PHE A  1 69  ? 28.71183  16.21220   21.86273  1.000 23.33678  ? 49  PHE H CD1 1 
ATOM   349   C CD2 . PHE A  1 69  ? 26.94351  16.34161   20.27455  1.000 22.84764  ? 49  PHE H CD2 1 
ATOM   350   C CE1 . PHE A  1 69  ? 28.10674  15.11807   22.44663  1.000 23.62523  ? 49  PHE H CE1 1 
ATOM   351   C CE2 . PHE A  1 69  ? 26.33041  15.24610   20.85722  1.000 23.11619  ? 49  PHE H CE2 1 
ATOM   352   C CZ  . PHE A  1 69  ? 26.91138  14.63585   21.94273  1.000 23.49455  ? 49  PHE H CZ  1 
ATOM   353   N N   . ALA A  1 70  ? 29.23384  20.98713   19.20210  1.000 22.34077  ? 50  ALA H N   1 
ATOM   354   C CA  . ALA A  1 70  ? 30.05115  22.15787   18.90870  1.000 24.48053  ? 50  ALA H CA  1 
ATOM   355   C C   . ALA A  1 70  ? 29.53803  23.38598   19.65411  1.000 29.29172  ? 50  ALA H C   1 
ATOM   356   O O   . ALA A  1 70  ? 30.32695  24.20462   20.13859  1.000 26.54643  ? 50  ALA H O   1 
ATOM   357   C CB  . ALA A  1 70  ? 30.08376  22.41174   17.40180  1.000 22.98712  ? 50  ALA H CB  1 
ATOM   358   N N   . LEU A  1 71  ? 28.21793  23.52806   19.76915  1.000 21.66409  ? 51  LEU H N   1 
ATOM   359   C CA  . LEU A  1 71  ? 27.68085  24.65144   20.52601  1.000 28.94780  ? 51  LEU H CA  1 
ATOM   360   C C   . LEU A  1 71  ? 28.06664  24.54939   21.99421  1.000 34.62041  ? 51  LEU H C   1 
ATOM   361   O O   . LEU A  1 71  ? 28.37829  25.56017   22.63488  1.000 22.40215  ? 51  LEU H O   1 
ATOM   362   C CB  . LEU A  1 71  ? 26.16451  24.71355   20.37107  1.000 21.21584  ? 51  LEU H CB  1 
ATOM   363   C CG  . LEU A  1 71  ? 25.64211  24.97382   18.95937  1.000 30.63894  ? 51  LEU H CG  1 
ATOM   364   C CD1 . LEU A  1 71  ? 24.12837  24.84210   18.92978  1.000 25.24192  ? 51  LEU H CD1 1 
ATOM   365   C CD2 . LEU A  1 71  ? 26.08032  26.34841   18.48184  1.000 27.32832  ? 51  LEU H CD2 1 
ATOM   366   N N   . SER A  1 72  ? 28.06929  23.33227   22.54091  1.000 21.58429  ? 52  SER H N   1 
ATOM   367   C CA  . SER A  1 72  ? 28.37430  23.17449   23.95683  1.000 21.85090  ? 52  SER H CA  1 
ATOM   368   C C   . SER A  1 72  ? 29.86056  23.36890   24.21188  1.000 30.20969  ? 52  SER H C   1 
ATOM   369   O O   . SER A  1 72  ? 30.25014  23.95635   25.23057  1.000 22.62160  ? 52  SER H O   1 
ATOM   370   C CB  . SER A  1 72  ? 27.91926  21.80026   24.44360  1.000 22.01996  ? 52  SER H CB  1 
ATOM   371   O OG  . SER A  1 72  ? 26.51856  21.76754   24.63946  1.000 21.82465  ? 52  SER H OG  1 
ATOM   372   N N   . ASN A  1 73  ? 30.70554  22.87411   23.29811  1.000 22.60640  ? 53  ASN H N   1 
ATOM   373   C CA  . ASN A  1 73  ? 32.13652  23.14149   23.39350  1.000 23.14715  ? 53  ASN H CA  1 
ATOM   374   C C   . ASN A  1 73  ? 32.40548  24.64155   23.42710  1.000 27.04002  ? 53  ASN H C   1 
ATOM   375   O O   . ASN A  1 73  ? 33.19824  25.11906   24.24620  1.000 23.64994  ? 53  ASN H O   1 
ATOM   376   C CB  . ASN A  1 73  ? 32.87800  22.48532   22.22805  1.000 25.92795  ? 53  ASN H CB  1 
ATOM   377   C CG  . ASN A  1 73  ? 32.83694  20.96458   22.28351  1.000 23.77179  ? 53  ASN H CG  1 
ATOM   378   O OD1 . ASN A  1 73  ? 32.69099  20.37043   23.35099  1.000 26.76619  ? 53  ASN H OD1 1 
ATOM   379   N ND2 . ASN A  1 73  ? 32.97674  20.32982   21.12785  1.000 23.96511  ? 53  ASN H ND2 1 
ATOM   380   N N   . ALA A  1 74  ? 31.73153  25.40269   22.56117  1.000 22.68930  ? 54  ALA H N   1 
ATOM   381   C CA  . ALA A  1 74  ? 31.85008  26.85838   22.59588  1.000 29.12608  ? 54  ALA H CA  1 
ATOM   382   C C   . ALA A  1 74  ? 31.42143  27.41076   23.94811  1.000 35.42313  ? 54  ALA H C   1 
ATOM   383   O O   . ALA A  1 74  ? 32.14584  28.19889   24.56948  1.000 33.08185  ? 54  ALA H O   1 
ATOM   384   C CB  . ALA A  1 74  ? 31.01401  27.48236   21.47890  1.000 22.37890  ? 54  ALA H CB  1 
ATOM   385   N N   . LEU A  1 75  ? 30.24009  27.00018   24.41709  1.000 26.01164  ? 55  LEU H N   1 
ATOM   386   C CA  . LEU A  1 75  ? 29.71693  27.47763   25.69261  1.000 25.84969  ? 55  LEU H CA  1 
ATOM   387   C C   . LEU A  1 75  ? 30.68782  27.18398   26.82685  1.000 24.99832  ? 55  LEU H C   1 
ATOM   388   O O   . LEU A  1 75  ? 31.11355  28.09267   27.55034  1.000 25.27052  ? 55  LEU H O   1 
ATOM   389   C CB  . LEU A  1 75  ? 28.35748  26.83213   25.96505  1.000 28.65422  ? 55  LEU H CB  1 
ATOM   390   C CG  . LEU A  1 75  ? 27.66534  27.18549   27.27886  1.000 29.74253  ? 55  LEU H CG  1 
ATOM   391   C CD1 . LEU A  1 75  ? 27.32989  28.66424   27.31153  1.000 33.89256  ? 55  LEU H CD1 1 
ATOM   392   C CD2 . LEU A  1 75  ? 26.41705  26.35092   27.45781  1.000 25.45520  ? 55  LEU H CD2 1 
ATOM   393   N N   . ASN A  1 76  ? 31.06210  25.90887   26.98372  1.000 26.96676  ? 56  ASN H N   1 
ATOM   394   C CA  . ASN A  1 76  ? 31.93674  25.51251   28.08162  1.000 24.23417  ? 56  ASN H CA  1 
ATOM   395   C C   . ASN A  1 76  ? 33.32987  26.11353   27.94504  1.000 24.84603  ? 56  ASN H C   1 
ATOM   396   O O   . ASN A  1 76  ? 34.02601  26.28697   28.94879  1.000 25.71940  ? 56  ASN H O   1 
ATOM   397   C CB  . ASN A  1 76  ? 32.03903  23.98370   28.16278  1.000 24.98232  ? 56  ASN H CB  1 
ATOM   398   C CG  . ASN A  1 76  ? 30.68820  23.30903   28.32455  1.000 31.77339  ? 56  ASN H CG  1 
ATOM   399   O OD1 . ASN A  1 76  ? 29.72414  23.92156   28.78689  1.000 32.39585  ? 56  ASN H OD1 1 
ATOM   400   N ND2 . ASN A  1 76  ? 30.61884  22.03119   27.95873  1.000 26.55845  ? 56  ASN H ND2 1 
ATOM   401   N N   . SER A  1 77  ? 33.76423  26.41802   26.72641  1.000 24.58949  ? 57  SER H N   1 
ATOM   402   C CA  . SER A  1 77  ? 35.05891  27.05987   26.54526  1.000 31.46798  ? 57  SER H CA  1 
ATOM   403   C C   . SER A  1 77  ? 35.03126  28.53863   26.89409  1.000 29.46048  ? 57  SER H C   1 
ATOM   404   O O   . SER A  1 77  ? 36.07921  29.18755   26.83658  1.000 31.13221  ? 57  SER H O   1 
ATOM   405   C CB  . SER A  1 77  ? 35.55341  26.87856   25.10665  1.000 31.27231  ? 57  SER H CB  1 
ATOM   406   O OG  . SER A  1 77  ? 35.70475  25.50092   24.78752  1.000 29.36850  ? 57  SER H OG  1 
ATOM   407   N N   . GLY A  1 78  ? 33.87137  29.08393   27.25450  1.000 29.70225  ? 58  GLY H N   1 
ATOM   408   C CA  . GLY A  1 78  ? 33.77022  30.47858   27.62678  1.000 25.15208  ? 58  GLY H CA  1 
ATOM   409   C C   . GLY A  1 78  ? 33.49011  31.43542   26.48979  1.000 27.04692  ? 58  GLY H C   1 
ATOM   410   O O   . GLY A  1 78  ? 33.53637  32.65003   26.70578  1.000 30.08262  ? 58  GLY H O   1 
ATOM   411   N N   . ILE A  1 79  ? 33.20454  30.93685   25.28874  1.000 24.25823  ? 59  ILE H N   1 
ATOM   412   C CA  . ILE A  1 79  ? 32.84755  31.79812   24.16316  1.000 30.14132  ? 59  ILE H CA  1 
ATOM   413   C C   . ILE A  1 79  ? 31.36928  32.15474   24.28674  1.000 33.80858  ? 59  ILE H C   1 
ATOM   414   O O   . ILE A  1 79  ? 30.50122  31.28936   24.15791  1.000 39.89228  ? 59  ILE H O   1 
ATOM   415   C CB  . ILE A  1 79  ? 33.13828  31.12379   22.82037  1.000 24.17011  ? 59  ILE H CB  1 
ATOM   416   C CG1 . ILE A  1 79  ? 34.62477  30.80027   22.69543  1.000 24.54853  ? 59  ILE H CG1 1 
ATOM   417   C CG2 . ILE A  1 79  ? 32.69065  32.01717   21.67436  1.000 31.28634  ? 59  ILE H CG2 1 
ATOM   418   C CD1 . ILE A  1 79  ? 34.96833  30.07142   21.41350  1.000 25.47882  ? 59  ILE H CD1 1 
ATOM   419   N N   . ARG A  1 80  ? 31.08059  33.43452   24.51600  1.000 37.32150  ? 60  ARG H N   1 
ATOM   420   C CA  . ARG A  1 80  ? 29.72300  33.89803   24.77010  1.000 39.50935  ? 60  ARG H CA  1 
ATOM   421   C C   . ARG A  1 80  ? 29.02298  34.44172   23.52870  1.000 34.66109  ? 60  ARG H C   1 
ATOM   422   O O   . ARG A  1 80  ? 27.84454  34.80875   23.61338  1.000 28.92729  ? 60  ARG H O   1 
ATOM   423   C CB  . ARG A  1 80  ? 29.73453  34.96964   25.86629  1.000 46.09276  ? 60  ARG H CB  1 
ATOM   424   C CG  . ARG A  1 80  ? 30.53304  34.57816   27.10713  1.000 55.66076  ? 60  ARG H CG  1 
ATOM   425   C CD  . ARG A  1 80  ? 29.68417  34.64701   28.37493  1.000 63.68586  ? 60  ARG H CD  1 
ATOM   426   N NE  . ARG A  1 80  ? 28.63236  33.63057   28.40754  1.000 64.36060  ? 60  ARG H NE  1 
ATOM   427   C CZ  . ARG A  1 80  ? 28.76353  32.43146   28.96847  1.000 61.72979  ? 60  ARG H CZ  1 
ATOM   428   N NH1 . ARG A  1 80  ? 29.90703  32.08456   29.54526  1.000 59.34867  ? 60  ARG H NH1 1 
ATOM   429   N NH2 . ARG A  1 80  ? 27.74952  31.57741   28.95371  1.000 60.48845  ? 60  ARG H NH2 1 
ATOM   430   N N   . ARG A  1 81  ? 29.71096  34.51205   22.38791  1.000 26.83016  ? 61  ARG H N   1 
ATOM   431   C CA  . ARG A  1 81  ? 29.11291  34.94900   21.13106  1.000 24.55787  ? 61  ARG H CA  1 
ATOM   432   C C   . ARG A  1 81  ? 29.16749  33.79377   20.14143  1.000 26.32791  ? 61  ARG H C   1 
ATOM   433   O O   . ARG A  1 81  ? 30.24617  33.25894   19.86236  1.000 23.22694  ? 61  ARG H O   1 
ATOM   434   C CB  . ARG A  1 81  ? 29.82228  36.18288   20.56778  1.000 24.01494  ? 61  ARG H CB  1 
ATOM   435   C CG  . ARG A  1 81  ? 29.74192  37.40666   21.48030  1.000 27.65107  ? 61  ARG H CG  1 
ATOM   436   C CD  . ARG A  1 81  ? 29.93591  38.69711   20.69887  1.000 25.15022  ? 61  ARG H CD  1 
ATOM   437   N NE  . ARG A  1 81  ? 29.98272  39.85696   21.58453  1.000 33.75223  ? 61  ARG H NE  1 
ATOM   438   C CZ  . ARG A  1 81  ? 28.91371  40.54347   21.97326  1.000 31.67620  ? 61  ARG H CZ  1 
ATOM   439   N NH1 . ARG A  1 81  ? 27.70880  40.19434   21.54713  1.000 36.90020  ? 61  ARG H NH1 1 
ATOM   440   N NH2 . ARG A  1 81  ? 29.04940  41.58069   22.78588  1.000 30.23050  ? 61  ARG H NH2 1 
ATOM   441   N N   . ILE A  1 82  ? 28.00774  33.41537   19.61231  1.000 23.52492  ? 62  ILE H N   1 
ATOM   442   C CA  . ILE A  1 82  ? 27.88263  32.26096   18.73470  1.000 31.19604  ? 62  ILE H CA  1 
ATOM   443   C C   . ILE A  1 82  ? 27.05153  32.65869   17.52554  1.000 22.94759  ? 62  ILE H C   1 
ATOM   444   O O   . ILE A  1 82  ? 25.96663  33.22822   17.67629  1.000 29.88528  ? 62  ILE H O   1 
ATOM   445   C CB  . ILE A  1 82  ? 27.23708  31.06322   19.45737  1.000 24.57659  ? 62  ILE H CB  1 
ATOM   446   C CG1 . ILE A  1 82  ? 28.13720  30.57753   20.59453  1.000 21.98185  ? 62  ILE H CG1 1 
ATOM   447   C CG2 . ILE A  1 82  ? 26.93207  29.94178   18.47384  1.000 22.02836  ? 62  ILE H CG2 1 
ATOM   448   C CD1 . ILE A  1 82  ? 27.61292  29.33881   21.31100  1.000 29.73562  ? 62  ILE H CD1 1 
ATOM   449   N N   . GLY A  1 83  ? 27.56409  32.37047   16.33829  1.000 23.34727  ? 63  GLY H N   1 
ATOM   450   C CA  . GLY A  1 83  ? 26.78960  32.46080   15.10872  1.000 23.82795  ? 63  GLY H CA  1 
ATOM   451   C C   . GLY A  1 83  ? 26.66648  31.08245   14.48854  1.000 28.11935  ? 63  GLY H C   1 
ATOM   452   O O   . GLY A  1 83  ? 27.59345  30.27573   14.57149  1.000 31.60083  ? 63  GLY H O   1 
ATOM   453   N N   . VAL A  1 84  ? 25.51019  30.80943   13.88728  1.000 27.06069  ? 64  VAL H N   1 
ATOM   454   C CA  . VAL A  1 84  ? 25.24222  29.52740   13.24387  1.000 24.05009  ? 64  VAL H CA  1 
ATOM   455   C C   . VAL A  1 84  ? 24.72350  29.80847   11.84234  1.000 29.93977  ? 64  VAL H C   1 
ATOM   456   O O   . VAL A  1 84  ? 23.71606  30.50739   11.67924  1.000 36.61974  ? 64  VAL H O   1 
ATOM   457   C CB  . VAL A  1 84  ? 24.22643  28.67738   14.02815  1.000 26.01785  ? 64  VAL H CB  1 
ATOM   458   C CG1 . VAL A  1 84  ? 23.97713  27.34670   13.31250  1.000 35.93743  ? 64  VAL H CG1 1 
ATOM   459   C CG2 . VAL A  1 84  ? 24.70464  28.44237   15.45256  1.000 24.71427  ? 64  VAL H CG2 1 
ATOM   460   N N   . ALA A  1 85  ? 25.40546  29.27297   10.83556  1.000 26.57835  ? 65  ALA H N   1 
ATOM   461   C CA  . ALA A  1 85  ? 24.96412  29.38222   9.45222   1.000 26.82583  ? 65  ALA H CA  1 
ATOM   462   C C   . ALA A  1 85  ? 24.20203  28.11809   9.08242   1.000 33.60619  ? 65  ALA H C   1 
ATOM   463   O O   . ALA A  1 85  ? 24.71180  27.00777   9.26615   1.000 28.32608  ? 65  ALA H O   1 
ATOM   464   C CB  . ALA A  1 85  ? 26.14836  29.57964   8.50753   1.000 27.76183  ? 65  ALA H CB  1 
ATOM   465   N N   . THR A  1 86  ? 22.98019  28.28561   8.58926   1.000 27.89954  ? 66  THR H N   1 
ATOM   466   C CA  . THR A  1 86  ? 22.18973  27.17347   8.09436   1.000 37.35763  ? 66  THR H CA  1 
ATOM   467   C C   . THR A  1 86  ? 21.94267  27.35642   6.60247   1.000 45.19023  ? 66  THR H C   1 
ATOM   468   O O   . THR A  1 86  ? 22.17851  28.42563   6.02836   1.000 42.70801  ? 66  THR H O   1 
ATOM   469   C CB  . THR A  1 86  ? 20.86163  27.03132   8.85169   1.000 34.43411  ? 66  THR H CB  1 
ATOM   470   O OG1 . THR A  1 86  ? 19.99791  28.11426   8.49552   1.000 39.33008  ? 66  THR H OG1 1 
ATOM   471   C CG2 . THR A  1 86  ? 21.08723  27.02776   10.35167  1.000 28.36517  ? 66  THR H CG2 1 
ATOM   472   N N   . GLN A  1 87  ? 21.51774  26.26597   5.97237   1.000 49.31323  ? 67  GLN H N   1 
ATOM   473   C CA  . GLN A  1 87  ? 21.28064  26.25756   4.53628   1.000 46.07323  ? 67  GLN H CA  1 
ATOM   474   C C   . GLN A  1 87  ? 20.23542  25.20714   4.18561   1.000 47.78757  ? 67  GLN H C   1 
ATOM   475   O O   . GLN A  1 87  ? 19.03516  25.50282   4.15556   1.000 42.61574  ? 67  GLN H O   1 
ATOM   476   C CB  . GLN A  1 87  ? 22.58112  25.98382   3.77935   1.000 46.37749  ? 67  GLN H CB  1 
ATOM   477   C CG  . GLN A  1 87  ? 22.47150  26.06810   2.26803   1.000 59.96703  ? 67  GLN H CG  1 
ATOM   478   C CD  . GLN A  1 87  ? 23.01506  27.38123   1.74132   1.000 69.03332  ? 67  GLN H CD  1 
ATOM   479   O OE1 . GLN A  1 87  ? 22.44554  28.44658   1.98356   1.000 68.70485  ? 67  GLN H OE1 1 
ATOM   480   N NE2 . GLN A  1 87  ? 24.13821  27.31412   1.03508   1.000 71.88775  ? 67  GLN H NE2 1 
ATOM   481   N N   . TYR A  1 88  ? 20.68640  23.98063   3.93471   1.000 46.69610  ? 68  TYR H N   1 
ATOM   482   C CA  . TYR A  1 88  ? 19.78660  22.89846   3.55639   1.000 41.50053  ? 68  TYR H CA  1 
ATOM   483   C C   . TYR A  1 88  ? 18.78503  22.60070   4.66782   1.000 35.06313  ? 68  TYR H C   1 
ATOM   484   O O   . TYR A  1 88  ? 19.15989  22.49963   5.84171   1.000 30.72370  ? 68  TYR H O   1 
ATOM   485   C CB  . TYR A  1 88  ? 20.60200  21.65241   3.22678   1.000 45.29182  ? 68  TYR H CB  1 
ATOM   486   C CG  . TYR A  1 88  ? 19.77062  20.42319   2.96729   1.000 47.55883  ? 68  TYR H CG  1 
ATOM   487   C CD1 . TYR A  1 88  ? 19.61469  19.44738   3.94278   1.000 45.38854  ? 68  TYR H CD1 1 
ATOM   488   C CD2 . TYR A  1 88  ? 19.14320  20.23804   1.74375   1.000 48.76129  ? 68  TYR H CD2 1 
ATOM   489   C CE1 . TYR A  1 88  ? 18.85863  18.32121   3.70470   1.000 56.42198  ? 68  TYR H CE1 1 
ATOM   490   C CE2 . TYR A  1 88  ? 18.38604  19.12212   1.49495   1.000 50.45867  ? 68  TYR H CE2 1 
ATOM   491   C CZ  . TYR A  1 88  ? 18.24468  18.16472   2.47740   1.000 57.63251  ? 68  TYR H CZ  1 
ATOM   492   O OH  . TYR A  1 88  ? 17.48747  17.04584   2.22657   1.000 64.10015  ? 68  TYR H OH  1 
ATOM   493   N N   . LYS A  1 89  ? 17.51204  22.45013   4.27497   1.000 40.79473  ? 69  LYS H N   1 
ATOM   494   C CA  . LYS A  1 89  ? 16.36496  22.15453   5.13536   1.000 45.19384  ? 69  LYS H CA  1 
ATOM   495   C C   . LYS A  1 89  ? 16.63244  22.40344   6.61386   1.000 47.19349  ? 69  LYS H C   1 
ATOM   496   O O   . LYS A  1 89  ? 16.89346  21.46491   7.37496   1.000 44.28065  ? 69  LYS H O   1 
ATOM   497   C CB  . LYS A  1 89  ? 15.90854  20.70892   4.91989   1.000 48.27207  ? 69  LYS H CB  1 
ATOM   498   C CG  . LYS A  1 89  ? 14.81607  20.59525   3.86764   1.000 54.82622  ? 69  LYS H CG  1 
ATOM   499   C CD  . LYS A  1 89  ? 14.57866  19.16549   3.43352   1.000 51.39899  ? 69  LYS H CD  1 
ATOM   500   C CE  . LYS A  1 89  ? 13.25887  19.04848   2.68438   1.000 56.18195  ? 69  LYS H CE  1 
ATOM   501   N NZ  . LYS A  1 89  ? 13.44696  18.91250   1.21131   1.000 55.77888  ? 69  LYS H NZ  1 
ATOM   502   N N   . ALA A  1 90  ? 16.57776  23.66945   7.02143   1.000 40.06184  ? 70  ALA H N   1 
ATOM   503   C CA  . ALA A  1 90  ? 16.97185  24.07772   8.36137   1.000 40.44699  ? 70  ALA H CA  1 
ATOM   504   C C   . ALA A  1 90  ? 15.79894  24.23065   9.31598   1.000 39.89711  ? 70  ALA H C   1 
ATOM   505   O O   . ALA A  1 90  ? 16.01494  24.59277   10.47681  1.000 38.36894  ? 70  ALA H O   1 
ATOM   506   C CB  . ALA A  1 90  ? 17.74888  25.39603   8.29954   1.000 43.14531  ? 70  ALA H CB  1 
ATOM   507   N N   . HIS A  1 91  ? 14.57194  23.95263   8.86443   1.000 46.03068  ? 71  HIS H N   1 
ATOM   508   C CA  . HIS A  1 91  ? 13.39647  24.25433   9.67653   1.000 41.34036  ? 71  HIS H CA  1 
ATOM   509   C C   . HIS A  1 91  ? 13.47898  23.59538   11.04689  1.000 36.95634  ? 71  HIS H C   1 
ATOM   510   O O   . HIS A  1 91  ? 13.31039  24.25950   12.07603  1.000 34.26035  ? 71  HIS H O   1 
ATOM   511   C CB  . HIS A  1 91  ? 12.12218  23.82056   8.95774   1.000 49.32024  ? 71  HIS H CB  1 
ATOM   512   C CG  . HIS A  1 91  ? 10.88143  24.08528   9.75062   1.000 56.59454  ? 71  HIS H CG  1 
ATOM   513   N ND1 . HIS A  1 91  ? 10.40472  25.35853   9.98117   1.000 56.34556  ? 71  HIS H ND1 1 
ATOM   514   C CD2 . HIS A  1 91  ? 10.04303  23.24524   10.40223  1.000 55.79662  ? 71  HIS H CD2 1 
ATOM   515   C CE1 . HIS A  1 91  ? 9.31330   25.28958   10.72211  1.000 58.96469  ? 71  HIS H CE1 1 
ATOM   516   N NE2 . HIS A  1 91  ? 9.07320   24.01885   10.99276  1.000 58.29061  ? 71  HIS H NE2 1 
ATOM   517   N N   . ASP A  1 92  ? 13.72067  22.28201   11.07885  1.000 44.96632  ? 72  ASP H N   1 
ATOM   518   C CA  . ASP A  1 92  ? 13.94115  21.60186   12.35085  1.000 41.54519  ? 72  ASP H CA  1 
ATOM   519   C C   . ASP A  1 92  ? 15.11438  22.22444   13.09114  1.000 34.48833  ? 72  ASP H C   1 
ATOM   520   O O   . ASP A  1 92  ? 15.04140  22.48458   14.29760  1.000 37.00185  ? 72  ASP H O   1 
ATOM   521   C CB  . ASP A  1 92  ? 14.19466  20.10936   12.11885  1.000 42.04569  ? 72  ASP H CB  1 
ATOM   522   C CG  . ASP A  1 92  ? 12.95475  19.36635   11.66479  1.000 57.34226  ? 72  ASP H CG  1 
ATOM   523   O OD1 . ASP A  1 92  ? 11.89841  19.51702   12.31295  1.000 61.83878  ? 72  ASP H OD1 1 
ATOM   524   O OD2 . ASP A  1 92  ? 13.03824  18.62444   10.66111  1.000 64.85098  ? 72  ASP H OD2 1 
ATOM   525   N N   . LEU A  1 93  ? 16.20622  22.47584   12.36784  1.000 33.55582  ? 73  LEU H N   1 
ATOM   526   C CA  . LEU A  1 93  ? 17.42398  22.99152   12.97805  1.000 30.85099  ? 73  LEU H CA  1 
ATOM   527   C C   . LEU A  1 93  ? 17.16946  24.33559   13.64625  1.000 30.73862  ? 73  LEU H C   1 
ATOM   528   O O   . LEU A  1 93  ? 17.39188  24.49913   14.85184  1.000 25.90596  ? 73  LEU H O   1 
ATOM   529   C CB  . LEU A  1 93  ? 18.51522  23.10553   11.91323  1.000 25.57965  ? 73  LEU H CB  1 
ATOM   530   C CG  . LEU A  1 93  ? 19.92029  23.47864   12.38300  1.000 24.77869  ? 73  LEU H CG  1 
ATOM   531   C CD1 . LEU A  1 93  ? 20.35956  22.58896   13.54064  1.000 29.76702  ? 73  LEU H CD1 1 
ATOM   532   C CD2 . LEU A  1 93  ? 20.90019  23.39362   11.22614  1.000 25.29918  ? 73  LEU H CD2 1 
ATOM   533   N N   . ILE A  1 94  ? 16.67409  25.30418   12.87252  1.000 28.46511  ? 74  ILE H N   1 
ATOM   534   C CA  . ILE A  1 94  ? 16.43300  26.64540   13.40087  1.000 29.41880  ? 74  ILE H CA  1 
ATOM   535   C C   . ILE A  1 94  ? 15.49398  26.58555   14.59815  1.000 32.12721  ? 74  ILE H C   1 
ATOM   536   O O   . ILE A  1 94  ? 15.75031  27.20001   15.64226  1.000 25.26889  ? 74  ILE H O   1 
ATOM   537   C CB  . ILE A  1 94  ? 15.88208  27.56253   12.29469  1.000 29.71366  ? 74  ILE H CB  1 
ATOM   538   C CG1 . ILE A  1 94  ? 16.98133  27.89324   11.28028  1.000 32.91304  ? 74  ILE H CG1 1 
ATOM   539   C CG2 . ILE A  1 94  ? 15.31980  28.83884   12.89961  1.000 27.28289  ? 74  ILE H CG2 1 
ATOM   540   C CD1 . ILE A  1 94  ? 16.45961  28.43598   9.95733   1.000 35.05577  ? 74  ILE H CD1 1 
ATOM   541   N N   . ARG A  1 95  ? 14.39908  25.82851   14.46697  1.000 31.12057  ? 75  ARG H N   1 
ATOM   542   C CA  . ARG A  1 95  ? 13.44384  25.69503   15.56219  1.000 30.38209  ? 75  ARG H CA  1 
ATOM   543   C C   . ARG A  1 95  ? 14.09793  25.09618   16.80279  1.000 36.77331  ? 75  ARG H C   1 
ATOM   544   O O   . ARG A  1 95  ? 13.77945  25.48837   17.93111  1.000 31.70798  ? 75  ARG H O   1 
ATOM   545   C CB  . ARG A  1 95  ? 12.25677  24.84326   15.11609  1.000 29.08433  ? 75  ARG H CB  1 
ATOM   546   C CG  . ARG A  1 95  ? 11.08665  24.87972   16.07749  1.000 38.58060  ? 75  ARG H CG  1 
ATOM   547   C CD  . ARG A  1 95  ? 10.28015  23.58789   16.07525  1.000 51.07579  ? 75  ARG H CD  1 
ATOM   548   N NE  . ARG A  1 95  ? 10.22186  22.93667   14.76748  1.000 63.94109  ? 75  ARG H NE  1 
ATOM   549   C CZ  . ARG A  1 95  ? 10.84801  21.79972   14.47378  1.000 71.67411  ? 75  ARG H CZ  1 
ATOM   550   N NH1 . ARG A  1 95  ? 10.73045  21.26794   13.26136  1.000 71.01198  ? 75  ARG H NH1 1 
ATOM   551   N NH2 . ARG A  1 95  ? 11.59937  21.19832   15.39124  1.000 67.25001  ? 75  ARG H NH2 1 
ATOM   552   N N   . HIS A  1 96  ? 15.01918  24.14726   16.61512  1.000 28.08288  ? 76  HIS H N   1 
ATOM   553   C CA  . HIS A  1 96  ? 15.74436  23.58547   17.75115  1.000 29.79642  ? 76  HIS H CA  1 
ATOM   554   C C   . HIS A  1 96  ? 16.65343  24.62712   18.39237  1.000 27.87365  ? 76  HIS H C   1 
ATOM   555   O O   . HIS A  1 96  ? 16.75985  24.69740   19.62223  1.000 23.70782  ? 76  HIS H O   1 
ATOM   556   C CB  . HIS A  1 96  ? 16.54643  22.36425   17.29758  1.000 28.95569  ? 76  HIS H CB  1 
ATOM   557   C CG  . HIS A  1 96  ? 17.56445  21.89196   18.28881  1.000 26.00107  ? 76  HIS H CG  1 
ATOM   558   N ND1 . HIS A  1 96  ? 17.28172  20.94871   19.25350  1.000 23.25384  ? 76  HIS H ND1 1 
ATOM   559   C CD2 . HIS A  1 96  ? 18.87337  22.20754   18.44379  1.000 29.39590  ? 76  HIS H CD2 1 
ATOM   560   C CE1 . HIS A  1 96  ? 18.36822  20.71166   19.96767  1.000 22.72703  ? 76  HIS H CE1 1 
ATOM   561   N NE2 . HIS A  1 96  ? 19.34896  21.46117   19.49620  1.000 25.71792  ? 76  HIS H NE2 1 
ATOM   562   N N   . LEU A  1 97  ? 17.31897  25.44473   17.57723  1.000 29.21762  ? 77  LEU H N   1 
ATOM   563   C CA  . LEU A  1 97  ? 18.17625  26.48603   18.13109  1.000 29.63818  ? 77  LEU H CA  1 
ATOM   564   C C   . LEU A  1 97  ? 17.34934  27.56887   18.81649  1.000 28.84825  ? 77  LEU H C   1 
ATOM   565   O O   . LEU A  1 97  ? 17.74276  28.08676   19.86944  1.000 28.64444  ? 77  LEU H O   1 
ATOM   566   C CB  . LEU A  1 97  ? 19.04710  27.08152   17.02686  1.000 30.63821  ? 77  LEU H CB  1 
ATOM   567   C CG  . LEU A  1 97  ? 19.91110  26.11422   16.22283  1.000 22.95548  ? 77  LEU H CG  1 
ATOM   568   C CD1 . LEU A  1 97  ? 20.28154  26.72535   14.87899  1.000 23.96347  ? 77  LEU H CD1 1 
ATOM   569   C CD2 . LEU A  1 97  ? 21.15015  25.74099   17.00603  1.000 22.30005  ? 77  LEU H CD2 1 
ATOM   570   N N   . GLN A  1 98  ? 16.19122  27.90666   18.24205  1.000 26.93266  ? 78  GLN H N   1 
ATOM   571   C CA  . GLN A  1 98  ? 15.31030  28.90264   18.85021  1.000 31.35156  ? 78  GLN H CA  1 
ATOM   572   C C   . GLN A  1 98  ? 14.87609  28.49176   20.25251  1.000 30.69100  ? 78  GLN H C   1 
ATOM   573   O O   . GLN A  1 98  ? 14.85164  29.31906   21.17064  1.000 28.69870  ? 78  GLN H O   1 
ATOM   574   C CB  . GLN A  1 98  ? 14.07364  29.11295   17.97302  1.000 25.98992  ? 78  GLN H CB  1 
ATOM   575   C CG  . GLN A  1 98  ? 14.23228  30.12646   16.86342  1.000 39.58490  ? 78  GLN H CG  1 
ATOM   576   C CD  . GLN A  1 98  ? 13.27464  29.86892   15.72118  1.000 43.42505  ? 78  GLN H CD  1 
ATOM   577   O OE1 . GLN A  1 98  ? 12.50986  28.90330   15.74306  1.000 48.91827  ? 78  GLN H OE1 1 
ATOM   578   N NE2 . GLN A  1 98  ? 13.28971  30.74959   14.72797  1.000 38.14175  ? 78  GLN H NE2 1 
ATOM   579   N N   . ARG A  1 99  ? 14.50380  27.22640   20.43004  1.000 27.99052  ? 79  ARG H N   1 
ATOM   580   C CA  . ARG A  1 99  ? 13.93010  26.76443   21.68448  1.000 33.86060  ? 79  ARG H CA  1 
ATOM   581   C C   . ARG A  1 99  ? 14.97807  26.25597   22.66435  1.000 32.20861  ? 79  ARG H C   1 
ATOM   582   O O   . ARG A  1 99  ? 14.69366  26.17241   23.86457  1.000 40.94711  ? 79  ARG H O   1 
ATOM   583   C CB  . ARG A  1 99  ? 12.89973  25.65584   21.42289  1.000 42.63790  ? 79  ARG H CB  1 
ATOM   584   C CG  . ARG A  1 99  ? 11.89682  25.95533   20.29824  1.000 53.02541  ? 79  ARG H CG  1 
ATOM   585   C CD  . ARG A  1 99  ? 10.99488  24.74619   19.98950  1.000 53.28192  ? 79  ARG H CD  1 
ATOM   586   N NE  . ARG A  1 99  ? 11.69766  23.71864   19.21382  1.000 63.71108  ? 79  ARG H NE  1 
ATOM   587   C CZ  . ARG A  1 99  ? 11.43080  22.41243   19.26217  1.000 60.18692  ? 79  ARG H CZ  1 
ATOM   588   N NH1 . ARG A  1 99  ? 10.45913  21.96426   20.04678  1.000 60.46495  ? 79  ARG H NH1 1 
ATOM   589   N NH2 . ARG A  1 99  ? 12.12852  21.55183   18.53028  1.000 44.98184  ? 79  ARG H NH2 1 
ATOM   590   N N   . GLY A  1 100 ? 16.17628  25.92429   22.18728  1.000 30.45546  ? 80  GLY H N   1 
ATOM   591   C CA  . GLY A  1 100 ? 17.20583  25.36542   23.04122  1.000 26.46965  ? 80  GLY H CA  1 
ATOM   592   C C   . GLY A  1 100 ? 18.24912  26.36605   23.50503  1.000 25.01482  ? 80  GLY H C   1 
ATOM   593   O O   . GLY A  1 100 ? 18.62749  26.37545   24.67883  1.000 22.83121  ? 80  GLY H O   1 
ATOM   594   N N   . TRP A  1 101 ? 18.71165  27.21953   22.59706  1.000 22.56343  ? 81  TRP H N   1 
ATOM   595   C CA  . TRP A  1 101 ? 19.83556  28.11372   22.85997  1.000 28.53446  ? 81  TRP H CA  1 
ATOM   596   C C   . TRP A  1 101 ? 19.32828  29.54954   22.97911  1.000 24.65615  ? 81  TRP H C   1 
ATOM   597   O O   . TRP A  1 101 ? 19.67295  30.43216   22.18933  1.000 26.10969  ? 81  TRP H O   1 
ATOM   598   C CB  . TRP A  1 101 ? 20.88971  27.94222   21.75935  1.000 25.35913  ? 81  TRP H CB  1 
ATOM   599   C CG  . TRP A  1 101 ? 21.51201  26.56238   21.80814  1.000 28.96414  ? 81  TRP H CG  1 
ATOM   600   C CD1 . TRP A  1 101 ? 21.03956  25.42417   21.22025  1.000 21.59932  ? 81  TRP H CD1 1 
ATOM   601   C CD2 . TRP A  1 101 ? 22.68957  26.18022   22.52891  1.000 22.38170  ? 81  TRP H CD2 1 
ATOM   602   N NE1 . TRP A  1 101 ? 21.86363  24.36147   21.51199  1.000 22.37392  ? 81  TRP H NE1 1 
ATOM   603   C CE2 . TRP A  1 101 ? 22.88114  24.79960   22.31773  1.000 25.81585  ? 81  TRP H CE2 1 
ATOM   604   C CE3 . TRP A  1 101 ? 23.60497  26.87442   23.32472  1.000 23.98761  ? 81  TRP H CE3 1 
ATOM   605   C CZ2 . TRP A  1 101 ? 23.94903  24.10008   22.87757  1.000 26.14168  ? 81  TRP H CZ2 1 
ATOM   606   C CZ3 . TRP A  1 101 ? 24.65957  26.18400   23.87648  1.000 25.70858  ? 81  TRP H CZ3 1 
ATOM   607   C CH2 . TRP A  1 101 ? 24.82778  24.80969   23.64914  1.000 27.03700  ? 81  TRP H CH2 1 
ATOM   608   N N   . ASP A  1 102 ? 18.51783  29.77843   24.01610  1.000 23.24353  ? 82  ASP H N   1 
ATOM   609   C CA  . ASP A  1 102 ? 17.75952  31.01294   24.18686  1.000 27.31727  ? 82  ASP H CA  1 
ATOM   610   C C   . ASP A  1 102 ? 18.11719  31.75901   25.46895  1.000 26.83301  ? 82  ASP H C   1 
ATOM   611   O O   . ASP A  1 102 ? 17.30852  32.55116   25.95303  1.000 26.68223  ? 82  ASP H O   1 
ATOM   612   C CB  . ASP A  1 102 ? 16.25790  30.71891   24.17357  1.000 28.64169  ? 82  ASP H CB  1 
ATOM   613   C CG  . ASP A  1 102 ? 15.81563  29.87575   25.36870  1.000 32.44749  ? 82  ASP H CG  1 
ATOM   614   O OD1 . ASP A  1 102 ? 16.68363  29.31091   26.06874  1.000 37.04726  ? 82  ASP H OD1 1 
ATOM   615   O OD2 . ASP A  1 102 ? 14.59482  29.78056   25.61079  1.000 36.33000  ? 82  ASP H OD2 1 
ATOM   616   N N   . PHE A  1 103 ? 19.30192  31.52516   26.03657  1.000 29.79717  ? 83  PHE H N   1 
ATOM   617   C CA  . PHE A  1 103 ? 19.67029  32.08740   27.33181  1.000 24.26229  ? 83  PHE H CA  1 
ATOM   618   C C   . PHE A  1 103 ? 20.82704  33.08051   27.23332  1.000 25.87014  ? 83  PHE H C   1 
ATOM   619   O O   . PHE A  1 103 ? 21.48693  33.36667   28.23868  1.000 26.27225  ? 83  PHE H O   1 
ATOM   620   C CB  . PHE A  1 103 ? 20.01091  30.96580   28.31573  1.000 24.26974  ? 83  PHE H CB  1 
ATOM   621   C CG  . PHE A  1 103 ? 21.03111  29.99211   27.79399  1.000 23.49478  ? 83  PHE H CG  1 
ATOM   622   C CD1 . PHE A  1 103 ? 22.36914  30.13236   28.11701  1.000 23.33615  ? 83  PHE H CD1 1 
ATOM   623   C CD2 . PHE A  1 103 ? 20.64999  28.93493   26.97710  1.000 24.44858  ? 83  PHE H CD2 1 
ATOM   624   C CE1 . PHE A  1 103 ? 23.31185  29.23534   27.63842  1.000 22.81728  ? 83  PHE H CE1 1 
ATOM   625   C CE2 . PHE A  1 103 ? 21.58718  28.03723   26.49601  1.000 22.53903  ? 83  PHE H CE2 1 
ATOM   626   C CZ  . PHE A  1 103 ? 22.91749  28.18733   26.82587  1.000 22.59755  ? 83  PHE H CZ  1 
ATOM   627   N N   . PHE A  1 104 ? 21.08318  33.61049   26.04440  1.000 23.79363  ? 84  PHE H N   1 
ATOM   628   C CA  . PHE A  1 104 ? 22.10900  34.61979   25.83556  1.000 23.80563  ? 84  PHE H CA  1 
ATOM   629   C C   . PHE A  1 104 ? 21.44929  35.99272   25.83405  1.000 35.25411  ? 84  PHE H C   1 
ATOM   630   O O   . PHE A  1 104 ? 20.37821  36.17633   25.24795  1.000 44.52128  ? 84  PHE H O   1 
ATOM   631   C CB  . PHE A  1 104 ? 22.85642  34.39388   24.51563  1.000 28.92285  ? 84  PHE H CB  1 
ATOM   632   C CG  . PHE A  1 104 ? 23.63465  33.10047   24.45707  1.000 34.49642  ? 84  PHE H CG  1 
ATOM   633   C CD1 . PHE A  1 104 ? 22.98628  31.87191   24.51214  1.000 37.97571  ? 84  PHE H CD1 1 
ATOM   634   C CD2 . PHE A  1 104 ? 25.01397  33.11452   24.32837  1.000 40.52657  ? 84  PHE H CD2 1 
ATOM   635   C CE1 . PHE A  1 104 ? 23.69825  30.68653   24.45742  1.000 45.82508  ? 84  PHE H CE1 1 
ATOM   636   C CE2 . PHE A  1 104 ? 25.73472  31.92892   24.26869  1.000 45.70958  ? 84  PHE H CE2 1 
ATOM   637   C CZ  . PHE A  1 104 ? 25.07514  30.71455   24.33476  1.000 46.24082  ? 84  PHE H CZ  1 
ATOM   638   N N   . ARG A  1 105 ? 22.07762  36.95043   26.50911  1.000 30.70086  ? 85  ARG H N   1 
ATOM   639   C CA  . ARG A  1 105 ? 21.55346  38.30660   26.57619  1.000 26.19596  ? 85  ARG H CA  1 
ATOM   640   C C   . ARG A  1 105 ? 22.60346  39.28874   26.07916  1.000 32.02937  ? 85  ARG H C   1 
ATOM   641   O O   . ARG A  1 105 ? 23.74452  39.27331   26.56684  1.000 25.78331  ? 85  ARG H O   1 
ATOM   642   C CB  . ARG A  1 105 ? 21.12970  38.67927   28.00028  1.000 26.65431  ? 85  ARG H CB  1 
ATOM   643   C CG  . ARG A  1 105 ? 19.81256  38.06173   28.43230  1.000 27.33730  ? 85  ARG H CG  1 
ATOM   644   C CD  . ARG A  1 105 ? 18.66777  38.46612   27.50184  1.000 32.16355  ? 85  ARG H CD  1 
ATOM   645   N NE  . ARG A  1 105 ? 18.30182  39.87384   27.63885  1.000 28.40343  ? 85  ARG H NE  1 
ATOM   646   C CZ  . ARG A  1 105 ? 17.07462  40.34744   27.44816  1.000 34.19775  ? 85  ARG H CZ  1 
ATOM   647   N NH1 . ARG A  1 105 ? 16.09092  39.52515   27.10816  1.000 29.33495  ? 85  ARG H NH1 1 
ATOM   648   N NH2 . ARG A  1 105 ? 16.82777  41.64518   27.59908  1.000 30.72069  ? 85  ARG H NH2 1 
ATOM   649   N N   . PRO A  1 106 ? 22.26565  40.15589   25.12560  1.000 34.94296  ? 86  PRO H N   1 
ATOM   650   C CA  . PRO A  1 106 ? 23.27506  41.08933   24.60781  1.000 26.44783  ? 86  PRO H CA  1 
ATOM   651   C C   . PRO A  1 106 ? 23.80913  42.03694   25.66497  1.000 27.15204  ? 86  PRO H C   1 
ATOM   652   O O   . PRO A  1 106 ? 24.99208  42.39400   25.62138  1.000 27.20340  ? 86  PRO H O   1 
ATOM   653   C CB  . PRO A  1 106 ? 22.52175  41.83708   23.49841  1.000 26.95996  ? 86  PRO H CB  1 
ATOM   654   C CG  . PRO A  1 106 ? 21.37529  40.93784   23.13478  1.000 39.85693  ? 86  PRO H CG  1 
ATOM   655   C CD  . PRO A  1 106 ? 20.97493  40.29346   24.43259  1.000 31.25270  ? 86  PRO H CD  1 
ATOM   656   N N   . GLU A  1 107 ? 22.98452  42.45200   26.62573  1.000 27.85600  ? 87  GLU H N   1 
ATOM   657   C CA  . GLU A  1 107 ? 23.49073  43.38339   27.62341  1.000 33.51142  ? 87  GLU H CA  1 
ATOM   658   C C   . GLU A  1 107 ? 24.48482  42.73126   28.57771  1.000 38.57114  ? 87  GLU H C   1 
ATOM   659   O O   . GLU A  1 107 ? 25.11932  43.44637   29.35865  1.000 29.24261  ? 87  GLU H O   1 
ATOM   660   C CB  . GLU A  1 107 ? 22.33555  44.02197   28.39832  1.000 32.85187  ? 87  GLU H CB  1 
ATOM   661   C CG  . GLU A  1 107 ? 21.42626  43.06072   29.11965  1.000 40.45116  ? 87  GLU H CG  1 
ATOM   662   C CD  . GLU A  1 107 ? 20.20516  42.68540   28.30540  1.000 29.54964  ? 87  GLU H CD  1 
ATOM   663   O OE1 . GLU A  1 107 ? 20.34541  41.85834   27.39075  1.000 28.57811  ? 87  GLU H OE1 1 
ATOM   664   O OE2 . GLU A  1 107 ? 19.10929  43.22004   28.57813  1.000 30.54777  ? 87  GLU H OE2 1 
ATOM   665   N N   . ARG A  1 108 ? 24.64188  41.40490   28.52326  1.000 35.42435  ? 88  ARG H N   1 
ATOM   666   C CA  . ARG A  1 108 ? 25.72423  40.69761   29.19791  1.000 27.40806  ? 88  ARG H CA  1 
ATOM   667   C C   . ARG A  1 108 ? 26.85071  40.31671   28.24030  1.000 30.49221  ? 88  ARG H C   1 
ATOM   668   O O   . ARG A  1 108 ? 27.65183  39.43101   28.56143  1.000 29.56449  ? 88  ARG H O   1 
ATOM   669   C CB  . ARG A  1 108 ? 25.19682  39.43825   29.88880  1.000 27.11551  ? 88  ARG H CB  1 
ATOM   670   C CG  . ARG A  1 108 ? 24.13333  39.68297   30.92946  1.000 27.97118  ? 88  ARG H CG  1 
ATOM   671   C CD  . ARG A  1 108 ? 23.93479  38.44612   31.79816  1.000 33.97092  ? 88  ARG H CD  1 
ATOM   672   N NE  . ARG A  1 108 ? 23.43487  37.29001   31.05012  1.000 29.72652  ? 88  ARG H NE  1 
ATOM   673   C CZ  . ARG A  1 108 ? 22.15724  36.91388   31.02471  1.000 31.82094  ? 88  ARG H CZ  1 
ATOM   674   N NH1 . ARG A  1 108 ? 21.24136  37.60450   31.69749  1.000 28.12303  ? 88  ARG H NH1 1 
ATOM   675   N NH2 . ARG A  1 108 ? 21.79133  35.84781   30.32385  1.000 26.31438  ? 88  ARG H NH2 1 
ATOM   676   N N   . ASN A  1 109 ? 26.90223  40.94523   27.06125  1.000 26.65186  ? 89  ASN H N   1 
ATOM   677   C CA  . ASN A  1 109 ? 27.90130  40.64454   26.02958  1.000 28.29768  ? 89  ASN H CA  1 
ATOM   678   C C   . ASN A  1 109 ? 27.81008  39.19341   25.55278  1.000 25.32824  ? 89  ASN H C   1 
ATOM   679   O O   . ASN A  1 109 ? 28.82107  38.53610   25.30439  1.000 29.32988  ? 89  ASN H O   1 
ATOM   680   C CB  . ASN A  1 109 ? 29.30910  40.97222   26.52250  1.000 32.34214  ? 89  ASN H CB  1 
ATOM   681   C CG  . ASN A  1 109 ? 29.56293  42.46245   26.57678  1.000 38.45928  ? 89  ASN H CG  1 
ATOM   682   O OD1 . ASN A  1 109 ? 30.11119  42.97068   27.55373  1.000 40.89607  ? 89  ASN H OD1 1 
ATOM   683   N ND2 . ASN A  1 109 ? 29.15621  43.17442   25.53133  1.000 40.49117  ? 89  ASN H ND2 1 
ATOM   684   N N   . GLU A  1 110 ? 26.58620  38.68579   25.43057  1.000 32.17743  ? 90  GLU H N   1 
ATOM   685   C CA  . GLU A  1 110 ? 26.31758  37.36986   24.86408  1.000 29.76697  ? 90  GLU H CA  1 
ATOM   686   C C   . GLU A  1 110 ? 25.38212  37.52479   23.67462  1.000 24.73971  ? 90  GLU H C   1 
ATOM   687   O O   . GLU A  1 110 ? 24.47677  38.35881   23.69750  1.000 33.33784  ? 90  GLU H O   1 
ATOM   688   C CB  . GLU A  1 110 ? 25.68465  36.42579   25.89725  1.000 25.53260  ? 90  GLU H CB  1 
ATOM   689   C CG  . GLU A  1 110 ? 26.07155  36.70702   27.34206  1.000 37.76929  ? 90  GLU H CG  1 
ATOM   690   C CD  . GLU A  1 110 ? 25.18045  35.97803   28.33347  1.000 40.49660  ? 90  GLU H CD  1 
ATOM   691   O OE1 . GLU A  1 110 ? 23.95665  35.90286   28.09533  1.000 36.55283  ? 90  GLU H OE1 1 
ATOM   692   O OE2 . GLU A  1 110 ? 25.70626  35.48056   29.35031  1.000 41.95459  ? 90  GLU H OE2 1 
ATOM   693   N N   . SER A  1 111 ? 25.59681  36.72150   22.63603  1.000 25.72637  ? 91  SER H N   1 
ATOM   694   C CA  . SER A  1 111 ? 24.71791  36.75876   21.47579  1.000 27.05250  ? 91  SER H CA  1 
ATOM   695   C C   . SER A  1 111 ? 24.67383  35.38143   20.83580  1.000 24.35877  ? 91  SER H C   1 
ATOM   696   O O   . SER A  1 111 ? 25.65664  34.63517   20.86000  1.000 28.63040  ? 91  SER H O   1 
ATOM   697   C CB  . SER A  1 111 ? 25.15681  37.81563   20.44847  1.000 26.16800  ? 91  SER H CB  1 
ATOM   698   O OG  . SER A  1 111 ? 26.56002  37.80121   20.23532  1.000 30.37200  ? 91  SER H OG  1 
ATOM   699   N N   . PHE A  1 112 ? 23.51010  35.04793   20.27959  1.000 26.78724  ? 92  PHE H N   1 
ATOM   700   C CA  . PHE A  1 112 ? 23.31084  33.79030   19.56181  1.000 26.04281  ? 92  PHE H CA  1 
ATOM   701   C C   . PHE A  1 112 ? 22.54063  34.11832   18.28617  1.000 27.70957  ? 92  PHE H C   1 
ATOM   702   O O   . PHE A  1 112 ? 21.31663  34.27494   18.31054  1.000 26.38623  ? 92  PHE H O   1 
ATOM   703   C CB  . PHE A  1 112 ? 22.57583  32.76052   20.41167  1.000 27.16580  ? 92  PHE H CB  1 
ATOM   704   C CG  . PHE A  1 112 ? 22.73843  31.34681   19.91682  1.000 23.53399  ? 92  PHE H CG  1 
ATOM   705   C CD1 . PHE A  1 112 ? 22.10085  30.92328   18.75658  1.000 22.43736  ? 92  PHE H CD1 1 
ATOM   706   C CD2 . PHE A  1 112 ? 23.54267  30.44918   20.60185  1.000 22.22011  ? 92  PHE H CD2 1 
ATOM   707   C CE1 . PHE A  1 112 ? 22.25683  29.62033   18.29229  1.000 26.25834  ? 92  PHE H CE1 1 
ATOM   708   C CE2 . PHE A  1 112 ? 23.70790  29.15088   20.14757  1.000 25.19762  ? 92  PHE H CE2 1 
ATOM   709   C CZ  . PHE A  1 112 ? 23.06241  28.73278   18.99068  1.000 22.52779  ? 92  PHE H CZ  1 
ATOM   710   N N   . ASP A  1 113 ? 23.25792  34.20643   17.17301  1.000 23.69067  ? 93  ASP H N   1 
ATOM   711   C CA  . ASP A  1 113 ? 22.67043  34.59336   15.90185  1.000 24.43613  ? 93  ASP H CA  1 
ATOM   712   C C   . ASP A  1 113 ? 22.44636  33.36569   15.03225  1.000 34.70733  ? 93  ASP H C   1 
ATOM   713   O O   . ASP A  1 113 ? 23.37579  32.58500   14.79345  1.000 38.27804  ? 93  ASP H O   1 
ATOM   714   C CB  . ASP A  1 113 ? 23.56518  35.60992   15.19679  1.000 25.02925  ? 93  ASP H CB  1 
ATOM   715   C CG  . ASP A  1 113 ? 23.68078  36.90192   15.98153  1.000 29.20867  ? 93  ASP H CG  1 
ATOM   716   O OD1 . ASP A  1 113 ? 24.75800  37.18274   16.54788  1.000 29.43273  ? 93  ASP H OD1 1 
ATOM   717   O OD2 . ASP A  1 113 ? 22.66827  37.61668   16.06677  1.000 25.74792  ? 93  ASP H OD2 1 
ATOM   718   N N   . ILE A  1 114 ? 21.20782  33.19376   14.58002  1.000 34.58692  ? 94  ILE H N   1 
ATOM   719   C CA  . ILE A  1 114 ? 20.83515  32.13907   13.64536  1.000 32.82587  ? 94  ILE H CA  1 
ATOM   720   C C   . ILE A  1 114 ? 20.75386  32.77182   12.26619  1.000 37.31438  ? 94  ILE H C   1 
ATOM   721   O O   . ILE A  1 114 ? 19.94162  33.67742   12.04448  1.000 41.26166  ? 94  ILE H O   1 
ATOM   722   C CB  . ILE A  1 114 ? 19.50050  31.48740   14.03762  1.000 36.95066  ? 94  ILE H CB  1 
ATOM   723   C CG1 . ILE A  1 114 ? 19.58054  30.91525   15.45552  1.000 30.95316  ? 94  ILE H CG1 1 
ATOM   724   C CG2 . ILE A  1 114 ? 19.11799  30.40794   13.03490  1.000 39.22288  ? 94  ILE H CG2 1 
ATOM   725   C CD1 . ILE A  1 114 ? 18.26904  30.33785   15.94626  1.000 26.60821  ? 94  ILE H CD1 1 
ATOM   726   N N   . LEU A  1 115 ? 21.58665  32.30005   11.33444  1.000 37.12795  ? 95  LEU H N   1 
ATOM   727   C CA  . LEU A  1 115 ? 21.86326  33.01401   10.08581  1.000 33.31138  ? 95  LEU H CA  1 
ATOM   728   C C   . LEU A  1 115 ? 21.62043  32.13715   8.86363   1.000 32.55905  ? 95  LEU H C   1 
ATOM   729   O O   . LEU A  1 115 ? 22.56971  31.64130   8.24156   1.000 30.55593  ? 95  LEU H O   1 
ATOM   730   C CB  . LEU A  1 115 ? 23.29783  33.54220   10.08145  1.000 27.71456  ? 95  LEU H CB  1 
ATOM   731   C CG  . LEU A  1 115 ? 23.68837  34.35198   11.31521  1.000 26.90146  ? 95  LEU H CG  1 
ATOM   732   C CD1 . LEU A  1 115 ? 25.19645  34.36141   11.49485  1.000 29.11368  ? 95  LEU H CD1 1 
ATOM   733   C CD2 . LEU A  1 115 ? 23.14536  35.76544   11.19913  1.000 29.84825  ? 95  LEU H CD2 1 
ATOM   734   N N   . PRO A  1 116 ? 20.36504  31.95923   8.46487   1.000 36.69201  ? 96  PRO H N   1 
ATOM   735   C CA  . PRO A  1 116 ? 20.07849  31.22535   7.23176   1.000 40.61623  ? 96  PRO H CA  1 
ATOM   736   C C   . PRO A  1 116 ? 20.28893  32.10581   6.01089   1.000 51.05371  ? 96  PRO H C   1 
ATOM   737   O O   . PRO A  1 116 ? 20.24739  33.33594   6.07834   1.000 58.65122  ? 96  PRO H O   1 
ATOM   738   C CB  . PRO A  1 116 ? 18.59824  30.83800   7.37070   1.000 30.59216  ? 96  PRO H CB  1 
ATOM   739   C CG  . PRO A  1 116 ? 18.10308  31.50880   8.64748   1.000 38.36824  ? 96  PRO H CG  1 
ATOM   740   C CD  . PRO A  1 116 ? 19.14027  32.49869   9.07275   1.000 37.40112  ? 96  PRO H CD  1 
ATOM   741   N N   . ALA A  1 117 ? 20.52003  31.44757   4.87973   1.000 63.78498  ? 97  ALA H N   1 
ATOM   742   C CA  . ALA A  1 117 ? 20.55144  32.15556   3.60866   1.000 67.66026  ? 97  ALA H CA  1 
ATOM   743   C C   . ALA A  1 117 ? 19.13181  32.55954   3.23811   1.000 72.96983  ? 97  ALA H C   1 
ATOM   744   O O   . ALA A  1 117 ? 18.23735  31.71053   3.16544   1.000 80.33066  ? 97  ALA H O   1 
ATOM   745   C CB  . ALA A  1 117 ? 21.17084  31.28178   2.52329   1.000 65.57400  ? 97  ALA H CB  1 
ATOM   746   N N   . SER A  1 118 ? 18.91583  33.85327   3.02596   1.000 76.84431  ? 98  SER H N   1 
ATOM   747   C CA  . SER A  1 118 ? 17.57881  34.36020   2.75907   1.000 90.69760  ? 98  SER H CA  1 
ATOM   748   C C   . SER A  1 118 ? 17.68529  35.65687   1.96654   1.000 95.06750  ? 98  SER H C   1 
ATOM   749   O O   . SER A  1 118 ? 18.77495  36.08475   1.57227   1.000 92.63587  ? 98  SER H O   1 
ATOM   750   C CB  . SER A  1 118 ? 16.80278  34.57101   4.06620   1.000 86.15397  ? 98  SER H CB  1 
ATOM   751   O OG  . SER A  1 118 ? 17.45623  35.50483   4.91424   1.000 78.07141  ? 98  SER H OG  1 
ATOM   752   N N   . GLN A  1 119 ? 16.53114  36.27497   1.72536   1.000 100.91013 ? 99  GLN H N   1 
ATOM   753   C CA  . GLN A  1 119 ? 16.47128  37.64204   1.21688   1.000 103.56475 ? 99  GLN H CA  1 
ATOM   754   C C   . GLN A  1 119 ? 16.71573  38.57664   2.39541   1.000 109.29021 ? 99  GLN H C   1 
ATOM   755   O O   . GLN A  1 119 ? 15.80804  38.85908   3.18211   1.000 109.50276 ? 99  GLN H O   1 
ATOM   756   C CB  . GLN A  1 119 ? 15.12866  37.91562   0.55042   1.000 102.77104 ? 99  GLN H CB  1 
ATOM   757   N N   . ARG A  1 120 ? 17.95768  39.04159   2.52686   1.000 110.66897 ? 100 ARG H N   1 
ATOM   758   C CA  . ARG A  1 120 ? 18.38269  39.89172   3.63223   1.000 107.28122 ? 100 ARG H CA  1 
ATOM   759   C C   . ARG A  1 120 ? 19.34303  40.95559   3.11500   1.000 106.24911 ? 100 ARG H C   1 
ATOM   760   O O   . ARG A  1 120 ? 19.04982  42.15613   3.16006   1.000 100.94043 ? 100 ARG H O   1 
ATOM   761   C CB  . ARG A  1 120 ? 19.04867  39.04776   4.72541   1.000 99.95823  ? 100 ARG H CB  1 
ATOM   762   C CG  . ARG A  1 120 ? 19.94413  39.83612   5.67150   1.000 94.92824  ? 100 ARG H CG  1 
ATOM   763   C CD  . ARG A  1 120 ? 20.31702  39.03739   6.91368   1.000 86.26405  ? 100 ARG H CD  1 
ATOM   764   N NE  . ARG A  1 120 ? 21.76318  38.88490   7.07419   1.000 75.14947  ? 100 ARG H NE  1 
ATOM   765   C CZ  . ARG A  1 120 ? 22.59636  39.87335   7.38759   1.000 75.36524  ? 100 ARG H CZ  1 
ATOM   766   N NH1 . ARG A  1 120 ? 23.89207  39.62654   7.51490   1.000 69.23919  ? 100 ARG H NH1 1 
ATOM   767   N NH2 . ARG A  1 120 ? 22.14029  41.10737   7.57288   1.000 81.01727  ? 100 ARG H NH2 1 
ATOM   768   N N   . VAL A  1 121 ? 20.49570  40.50443   2.62500   1.000 108.70331 ? 101 VAL H N   1 
ATOM   769   C CA  . VAL A  1 121 ? 21.49389  41.37541   2.01570   1.000 109.55981 ? 101 VAL H CA  1 
ATOM   770   C C   . VAL A  1 121 ? 21.68131  41.09197   0.53181   1.000 111.36455 ? 101 VAL H C   1 
ATOM   771   O O   . VAL A  1 121 ? 22.39812  41.84741   -0.14473  1.000 112.20421 ? 101 VAL H O   1 
ATOM   772   C CB  . VAL A  1 121 ? 22.84694  41.27607   2.75780   1.000 100.36307 ? 101 VAL H CB  1 
ATOM   773   C CG1 . VAL A  1 121 ? 23.60832  40.02139   2.33552   1.000 92.84935  ? 101 VAL H CG1 1 
ATOM   774   C CG2 . VAL A  1 121 ? 23.68511  42.54263   2.56291   1.000 95.06901  ? 101 VAL H CG2 1 
ATOM   775   N N   . SER A  1 122 ? 21.04761  40.04706   0.00054   1.000 110.19076 ? 102 SER H N   1 
ATOM   776   C CA  . SER A  1 122 ? 21.16027  39.66273   -1.39913  1.000 105.78496 ? 102 SER H CA  1 
ATOM   777   C C   . SER A  1 122 ? 20.01933  38.70926   -1.72567  1.000 107.60035 ? 102 SER H C   1 
ATOM   778   O O   . SER A  1 122 ? 19.46875  38.04935   -0.83964  1.000 108.92989 ? 102 SER H O   1 
ATOM   779   C CB  . SER A  1 122 ? 22.51752  39.01131   -1.69340  1.000 96.52097  ? 102 SER H CB  1 
ATOM   780   O OG  . SER A  1 122 ? 22.83737  38.03745   -0.71175  1.000 83.87368  ? 102 SER H OG  1 
ATOM   781   N N   . GLU A  1 123 ? 19.66662  38.64921   -3.01243  1.000 106.83374 ? 103 GLU H N   1 
ATOM   782   C CA  . GLU A  1 123 ? 18.61827  37.74431   -3.47528  1.000 106.22740 ? 103 GLU H CA  1 
ATOM   783   C C   . GLU A  1 123 ? 18.99455  36.29870   -3.17348  1.000 107.51401 ? 103 GLU H C   1 
ATOM   784   O O   . GLU A  1 123 ? 18.41315  35.68151   -2.27457  1.000 113.14482 ? 103 GLU H O   1 
ATOM   785   C CB  . GLU A  1 123 ? 18.36319  37.93350   -4.97260  1.000 106.76762 ? 103 GLU H CB  1 
ATOM   786   N N   . THR A  1 124 ? 19.96176  35.76215   -3.92609  1.000 105.04426 ? 104 THR H N   1 
ATOM   787   C CA  . THR A  1 124 ? 20.60735  34.47090   -3.67847  1.000 104.78032 ? 104 THR H CA  1 
ATOM   788   C C   . THR A  1 124 ? 19.67350  33.39385   -3.13174  1.000 104.10962 ? 104 THR H C   1 
ATOM   789   O O   . THR A  1 124 ? 19.24739  32.49960   -3.87081  1.000 103.09082 ? 104 THR H O   1 
ATOM   790   C CB  . THR A  1 124 ? 21.79151  34.64132   -2.71534  1.000 100.61798 ? 104 THR H CB  1 
ATOM   791   O OG1 . THR A  1 124 ? 21.34644  35.23255   -1.48507  1.000 96.60094  ? 104 THR H OG1 1 
ATOM   792   C CG2 . THR A  1 124 ? 22.87430  35.51873   -3.33915  1.000 100.33653 ? 104 THR H CG2 1 
ATOM   793   N N   . GLN A  1 125 ? 19.36507  33.47544   -1.83362  1.000 99.61012  ? 105 GLN H N   1 
ATOM   794   C CA  . GLN A  1 125 ? 18.60642  32.46576   -1.09470  1.000 92.96789  ? 105 GLN H CA  1 
ATOM   795   C C   . GLN A  1 125 ? 19.36045  31.14170   -0.99810  1.000 88.26322  ? 105 GLN H C   1 
ATOM   796   O O   . GLN A  1 125 ? 18.75007  30.09401   -0.75495  1.000 93.87612  ? 105 GLN H O   1 
ATOM   797   C CB  . GLN A  1 125 ? 17.21129  32.24693   -1.69941  1.000 92.64857  ? 105 GLN H CB  1 
ATOM   798   N N   . TRP A  1 126 ? 20.68252  31.18165   -1.17749  1.000 78.97255  ? 106 TRP H N   1 
ATOM   799   C CA  . TRP A  1 126 ? 21.54611  30.01436   -1.02587  1.000 75.63240  ? 106 TRP H CA  1 
ATOM   800   C C   . TRP A  1 126 ? 23.01114  30.44934   -0.96378  1.000 65.00007  ? 106 TRP H C   1 
ATOM   801   O O   . TRP A  1 126 ? 23.52815  31.03691   -1.91810  1.000 70.66921  ? 106 TRP H O   1 
ATOM   802   C CB  . TRP A  1 126 ? 21.31280  29.02366   -2.17702  1.000 83.62933  ? 106 TRP H CB  1 
ATOM   803   C CG  . TRP A  1 126 ? 21.35089  27.56708   -1.77265  1.000 88.30955  ? 106 TRP H CG  1 
ATOM   804   C CD1 . TRP A  1 126 ? 22.42474  26.88585   -1.28817  1.000 86.15483  ? 106 TRP H CD1 1 
ATOM   805   C CD2 . TRP A  1 126 ? 20.27303  26.61653   -1.83938  1.000 95.70264  ? 106 TRP H CD2 1 
ATOM   806   N NE1 . TRP A  1 126 ? 22.08764  25.57846   -1.03159  1.000 88.11932  ? 106 TRP H NE1 1 
ATOM   807   C CE2 . TRP A  1 126 ? 20.77317  25.38525   -1.36498  1.000 92.17915  ? 106 TRP H CE2 1 
ATOM   808   C CE3 . TRP A  1 126 ? 18.93704  26.68777   -2.24983  1.000 100.86980 ? 106 TRP H CE3 1 
ATOM   809   C CZ2 . TRP A  1 126 ? 19.98598  24.23548   -1.28910  1.000 92.17979  ? 106 TRP H CZ2 1 
ATOM   810   C CZ3 . TRP A  1 126 ? 18.15526  25.54130   -2.17351  1.000 101.45345 ? 106 TRP H CZ3 1 
ATOM   811   C CH2 . TRP A  1 126 ? 18.68405  24.33324   -1.69703  1.000 96.18322  ? 106 TRP H CH2 1 
ATOM   812   N N   . TYR A  1 127 ? 23.68276  30.18789   0.15909   1.000 59.27193  ? 107 TYR H N   1 
ATOM   813   C CA  . TYR A  1 127 ? 25.10594  30.49087   0.26280   1.000 55.94082  ? 107 TYR H CA  1 
ATOM   814   C C   . TYR A  1 127 ? 25.89089  29.71308   -0.78746  1.000 55.16108  ? 107 TYR H C   1 
ATOM   815   O O   . TYR A  1 127 ? 25.55628  28.57559   -1.12962  1.000 48.21737  ? 107 TYR H O   1 
ATOM   816   C CB  . TYR A  1 127 ? 25.65044  30.12956   1.64752   1.000 50.78343  ? 107 TYR H CB  1 
ATOM   817   C CG  . TYR A  1 127 ? 25.11387  30.92230   2.82084   1.000 55.75674  ? 107 TYR H CG  1 
ATOM   818   C CD1 . TYR A  1 127 ? 25.13711  32.31023   2.82894   1.000 57.98953  ? 107 TYR H CD1 1 
ATOM   819   C CD2 . TYR A  1 127 ? 24.61497  30.27141   3.94095   1.000 52.30069  ? 107 TYR H CD2 1 
ATOM   820   C CE1 . TYR A  1 127 ? 24.65826  33.02383   3.91589   1.000 55.35557  ? 107 TYR H CE1 1 
ATOM   821   C CE2 . TYR A  1 127 ? 24.13527  30.97408   5.02491   1.000 48.69447  ? 107 TYR H CE2 1 
ATOM   822   C CZ  . TYR A  1 127 ? 24.15849  32.34681   5.00952   1.000 53.21022  ? 107 TYR H CZ  1 
ATOM   823   O OH  . TYR A  1 127 ? 23.67836  33.04161   6.09516   1.000 60.27886  ? 107 TYR H OH  1 
ATOM   824   N N   . GLU A  1 128 ? 26.96169  30.33071   -1.28517  1.000 52.34229  ? 108 GLU H N   1 
ATOM   825   C CA  . GLU A  1 128 ? 27.80951  29.68883   -2.28188  1.000 52.24941  ? 108 GLU H CA  1 
ATOM   826   C C   . GLU A  1 128 ? 28.82102  28.72612   -1.67368  1.000 50.56839  ? 108 GLU H C   1 
ATOM   827   O O   . GLU A  1 128 ? 29.49203  28.00628   -2.42205  1.000 49.72374  ? 108 GLU H O   1 
ATOM   828   C CB  . GLU A  1 128 ? 28.54445  30.74641   -3.10882  1.000 60.65009  ? 108 GLU H CB  1 
ATOM   829   C CG  . GLU A  1 128 ? 27.69142  31.39674   -4.18842  1.000 70.75615  ? 108 GLU H CG  1 
ATOM   830   C CD  . GLU A  1 128 ? 27.24650  30.41213   -5.25582  1.000 78.35575  ? 108 GLU H CD  1 
ATOM   831   O OE1 . GLU A  1 128 ? 28.10566  29.67583   -5.78643  1.000 80.43069  ? 108 GLU H OE1 1 
ATOM   832   O OE2 . GLU A  1 128 ? 26.03674  30.37616   -5.56595  1.000 83.83560  ? 108 GLU H OE2 1 
ATOM   833   N N   . GLY A  1 129 ? 28.94544  28.69153   -0.35386  1.000 42.87861  ? 109 GLY H N   1 
ATOM   834   C CA  . GLY A  1 129 ? 29.88487  27.79185   0.28204   1.000 40.21996  ? 109 GLY H CA  1 
ATOM   835   C C   . GLY A  1 129 ? 30.11639  28.19171   1.72239   1.000 42.85561  ? 109 GLY H C   1 
ATOM   836   O O   . GLY A  1 129 ? 29.53057  29.15355   2.22985   1.000 50.70327  ? 109 GLY H O   1 
ATOM   837   N N   . THR A  1 130 ? 31.00279  27.43012   2.37407   1.000 43.80589  ? 110 THR H N   1 
ATOM   838   C CA  . THR A  1 130 ? 31.25789  27.63216   3.79885   1.000 43.22910  ? 110 THR H CA  1 
ATOM   839   C C   . THR A  1 130 ? 31.91305  28.97963   4.07660   1.000 46.82194  ? 110 THR H C   1 
ATOM   840   O O   . THR A  1 130 ? 31.65421  29.58541   5.12358   1.000 48.38458  ? 110 THR H O   1 
ATOM   841   C CB  . THR A  1 130 ? 32.12831  26.50073   4.35338   1.000 45.20071  ? 110 THR H CB  1 
ATOM   842   O OG1 . THR A  1 130 ? 33.34898  26.41312   3.60691   1.000 48.95571  ? 110 THR H OG1 1 
ATOM   843   C CG2 . THR A  1 130 ? 31.39062  25.17322   4.27135   1.000 37.78908  ? 110 THR H CG2 1 
ATOM   844   N N   . ALA A  1 131 ? 32.76403  29.46034   3.16561   1.000 41.99908  ? 111 ALA H N   1 
ATOM   845   C CA  . ALA A  1 131 ? 33.35311  30.78441   3.33793   1.000 44.69453  ? 111 ALA H CA  1 
ATOM   846   C C   . ALA A  1 131 ? 32.32775  31.88234   3.07393   1.000 44.31751  ? 111 ALA H C   1 
ATOM   847   O O   . ALA A  1 131 ? 32.27157  32.87842   3.80361   1.000 41.59494  ? 111 ALA H O   1 
ATOM   848   C CB  . ALA A  1 131 ? 34.56566  30.94268   2.42050   1.000 42.16650  ? 111 ALA H CB  1 
ATOM   849   N N   . ASP A  1 132 ? 31.50510  31.71577   2.03649   1.000 46.00416  ? 112 ASP H N   1 
ATOM   850   C CA  . ASP A  1 132 ? 30.46466  32.69679   1.74729   1.000 41.23608  ? 112 ASP H CA  1 
ATOM   851   C C   . ASP A  1 132 ? 29.44338  32.77978   2.87334   1.000 39.89162  ? 112 ASP H C   1 
ATOM   852   O O   . ASP A  1 132 ? 28.83957  33.83632   3.08706   1.000 48.07675  ? 112 ASP H O   1 
ATOM   853   C CB  . ASP A  1 132 ? 29.78117  32.35038   0.42369   1.000 44.02352  ? 112 ASP H CB  1 
ATOM   854   C CG  . ASP A  1 132 ? 28.89939  33.46630   -0.08922  1.000 48.95052  ? 112 ASP H CG  1 
ATOM   855   O OD1 . ASP A  1 132 ? 29.35813  34.62724   -0.10955  1.000 55.05101  ? 112 ASP H OD1 1 
ATOM   856   O OD2 . ASP A  1 132 ? 27.75244  33.17989   -0.49084  1.000 51.62168  ? 112 ASP H OD2 1 
ATOM   857   N N   . ALA A  1 133 ? 29.23744  31.68410   3.60533   1.000 41.19448  ? 113 ALA H N   1 
ATOM   858   C CA  . ALA A  1 133 ? 28.32603  31.70871   4.74244   1.000 38.65996  ? 113 ALA H CA  1 
ATOM   859   C C   . ALA A  1 133 ? 28.84523  32.58263   5.87555   1.000 39.36533  ? 113 ALA H C   1 
ATOM   860   O O   . ALA A  1 133 ? 28.04723  33.06257   6.68908   1.000 42.75327  ? 113 ALA H O   1 
ATOM   861   C CB  . ALA A  1 133 ? 28.07474  30.28505   5.24029   1.000 38.60425  ? 113 ALA H CB  1 
ATOM   862   N N   . VAL A  1 134 ? 30.15559  32.79313   5.95633   1.000 37.78671  ? 114 VAL H N   1 
ATOM   863   C CA  . VAL A  1 134 ? 30.70817  33.79799   6.86231   1.000 43.81772  ? 114 VAL H CA  1 
ATOM   864   C C   . VAL A  1 134 ? 30.74462  35.17025   6.20397   1.000 45.95169  ? 114 VAL H C   1 
ATOM   865   O O   . VAL A  1 134 ? 30.45403  36.18283   6.84666   1.000 43.31704  ? 114 VAL H O   1 
ATOM   866   C CB  . VAL A  1 134 ? 32.11027  33.36779   7.33453   1.000 39.95692  ? 114 VAL H CB  1 
ATOM   867   C CG1 . VAL A  1 134 ? 32.54862  34.20480   8.53423   1.000 31.34495  ? 114 VAL H CG1 1 
ATOM   868   C CG2 . VAL A  1 134 ? 32.08601  31.90578   7.70763   1.000 34.72856  ? 114 VAL H CG2 1 
ATOM   869   N N   . TYR A  1 135 ? 31.09759  35.20037   4.91934   1.000 42.30742  ? 115 TYR H N   1 
ATOM   870   C CA  . TYR A  1 135 ? 31.27806  36.46476   4.21937   1.000 47.63763  ? 115 TYR H CA  1 
ATOM   871   C C   . TYR A  1 135 ? 29.98362  37.26441   4.17258   1.000 43.26243  ? 115 TYR H C   1 
ATOM   872   O O   . TYR A  1 135 ? 29.97898  38.47465   4.42538   1.000 44.82386  ? 115 TYR H O   1 
ATOM   873   C CB  . TYR A  1 135 ? 31.79512  36.19590   2.80878   1.000 48.87351  ? 115 TYR H CB  1 
ATOM   874   C CG  . TYR A  1 135 ? 31.84996  37.42780   1.94815   1.000 46.51094  ? 115 TYR H CG  1 
ATOM   875   C CD1 . TYR A  1 135 ? 32.82216  38.39305   2.15787   1.000 47.26515  ? 115 TYR H CD1 1 
ATOM   876   C CD2 . TYR A  1 135 ? 30.92681  37.63017   0.92964   1.000 49.46861  ? 115 TYR H CD2 1 
ATOM   877   C CE1 . TYR A  1 135 ? 32.88143  39.52299   1.37714   1.000 52.58055  ? 115 TYR H CE1 1 
ATOM   878   C CE2 . TYR A  1 135 ? 30.97743  38.76584   0.13819   1.000 53.10559  ? 115 TYR H CE2 1 
ATOM   879   C CZ  . TYR A  1 135 ? 31.96084  39.70918   0.37169   1.000 55.07891  ? 115 TYR H CZ  1 
ATOM   880   O OH  . TYR A  1 135 ? 32.03904  40.84711   -0.39596  1.000 64.92117  ? 115 TYR H OH  1 
ATOM   881   N N   A GLN A  1 136 ? 28.86805  36.59689   3.86342   0.627 43.73290  ? 116 GLN H N   1 
ATOM   882   N N   B GLN A  1 136 ? 28.86960  36.60289   3.85495   0.373 43.75585  ? 116 GLN H N   1 
ATOM   883   C CA  A GLN A  1 136 ? 27.59489  37.29224   3.70854   0.627 47.59290  ? 116 GLN H CA  1 
ATOM   884   C CA  B GLN A  1 136 ? 27.60331  37.30825   3.70171   0.373 47.21576  ? 116 GLN H CA  1 
ATOM   885   C C   A GLN A  1 136 ? 27.08970  37.89633   5.01407   0.627 45.97068  ? 116 GLN H C   1 
ATOM   886   C C   B GLN A  1 136 ? 27.06647  37.86645   5.01528   0.373 45.81603  ? 116 GLN H C   1 
ATOM   887   O O   A GLN A  1 136 ? 26.17436  38.72681   4.98113   0.627 48.61103  ? 116 GLN H O   1 
ATOM   888   O O   B GLN A  1 136 ? 26.10000  38.63660   4.98683   0.373 48.54598  ? 116 GLN H O   1 
ATOM   889   C CB  A GLN A  1 136 ? 26.53981  36.34037   3.13586   0.627 48.86056  ? 116 GLN H CB  1 
ATOM   890   C CB  B GLN A  1 136 ? 26.56144  36.38405   3.06579   0.373 48.56402  ? 116 GLN H CB  1 
ATOM   891   C CG  A GLN A  1 136 ? 26.81853  35.86191   1.71306   0.627 49.04191  ? 116 GLN H CG  1 
ATOM   892   C CG  B GLN A  1 136 ? 25.68052  37.07203   2.03299   0.373 52.46164  ? 116 GLN H CG  1 
ATOM   893   C CD  A GLN A  1 136 ? 26.95964  37.00334   0.72393   0.627 52.78280  ? 116 GLN H CD  1 
ATOM   894   C CD  B GLN A  1 136 ? 24.42895  36.28073   1.70124   0.373 54.52292  ? 116 GLN H CD  1 
ATOM   895   O OE1 A GLN A  1 136 ? 26.23522  37.99651   0.79625   0.627 56.01350  ? 116 GLN H OE1 1 
ATOM   896   O OE1 B GLN A  1 136 ? 23.30985  36.76750   1.86998   0.373 58.73534  ? 116 GLN H OE1 1 
ATOM   897   N NE2 A GLN A  1 136 ? 27.89764  36.86735   -0.20697  0.627 53.46692  ? 116 GLN H NE2 1 
ATOM   898   N NE2 B GLN A  1 136 ? 24.61195  35.05799   1.21809   0.373 52.12003  ? 116 GLN H NE2 1 
ATOM   899   N N   . ASN A  1 137 ? 27.66194  37.50922   6.15394   1.000 42.65048  ? 117 ASN H N   1 
ATOM   900   C CA  . ASN A  1 137 ? 27.22642  37.99771   7.45795   1.000 45.04972  ? 117 ASN H CA  1 
ATOM   901   C C   . ASN A  1 137 ? 28.34128  38.75340   8.18622   1.000 46.13987  ? 117 ASN H C   1 
ATOM   902   O O   . ASN A  1 137 ? 28.38924  38.75785   9.41876   1.000 40.34513  ? 117 ASN H O   1 
ATOM   903   C CB  . ASN A  1 137 ? 26.69874  36.84641   8.32085   1.000 39.69965  ? 117 ASN H CB  1 
ATOM   904   C CG  . ASN A  1 137 ? 25.54669  36.09449   7.66351   1.000 41.00873  ? 117 ASN H CG  1 
ATOM   905   O OD1 . ASN A  1 137 ? 24.47618  36.65882   7.42707   1.000 43.90726  ? 117 ASN H OD1 1 
ATOM   906   N ND2 . ASN A  1 137 ? 25.76011  34.81236   7.37651   1.000 39.23046  ? 117 ASN H ND2 1 
ATOM   907   N N   . ILE A  1 138 ? 29.25742  39.38062   7.43354   1.000 57.81616  ? 118 ILE H N   1 
ATOM   908   C CA  . ILE A  1 138 ? 30.20367  40.33380   8.02449   1.000 54.63055  ? 118 ILE H CA  1 
ATOM   909   C C   . ILE A  1 138 ? 29.47206  41.38577   8.84254   1.000 46.06405  ? 118 ILE H C   1 
ATOM   910   O O   . ILE A  1 138 ? 29.96370  41.84388   9.88305   1.000 43.22262  ? 118 ILE H O   1 
ATOM   911   C CB  . ILE A  1 138 ? 31.06373  41.00566   6.93055   1.000 63.33796  ? 118 ILE H CB  1 
ATOM   912   C CG1 . ILE A  1 138 ? 32.15942  41.91046   7.49822   1.000 61.84141  ? 118 ILE H CG1 1 
ATOM   913   C CG2 . ILE A  1 138 ? 30.29604  41.86457   6.05086   1.000 60.59936  ? 118 ILE H CG2 1 
ATOM   914   C CD1 . ILE A  1 138 ? 33.42326  41.14109   7.97542   1.000 66.99767  ? 118 ILE H CD1 1 
ATOM   915   N N   . ASP A  1 139 ? 28.31611  41.83124   8.35115   1.000 46.72410  ? 119 ASP H N   1 
ATOM   916   C CA  . ASP A  1 139 ? 27.59614  42.91146   8.99765   1.000 49.02892  ? 119 ASP H CA  1 
ATOM   917   C C   . ASP A  1 139 ? 27.02569  42.48170   10.33371  1.000 47.24474  ? 119 ASP H C   1 
ATOM   918   O O   . ASP A  1 139 ? 26.67132  43.34175   11.14185  1.000 48.72654  ? 119 ASP H O   1 
ATOM   919   C CB  . ASP A  1 139 ? 26.48777  43.43447   8.07970   1.000 52.94956  ? 119 ASP H CB  1 
ATOM   920   C CG  . ASP A  1 139 ? 25.49826  42.36051   7.67846   1.000 55.70158  ? 119 ASP H CG  1 
ATOM   921   O OD1 . ASP A  1 139 ? 25.81633  41.16493   7.84178   1.000 54.80097  ? 119 ASP H OD1 1 
ATOM   922   O OD2 . ASP A  1 139 ? 24.39937  42.71390   7.19792   1.000 59.80576  ? 119 ASP H OD2 1 
ATOM   923   N N   . ILE A  1 140 ? 26.93650  41.17419   10.58250  1.000 47.56140  ? 120 ILE H N   1 
ATOM   924   C CA  . ILE A  1 140 ? 26.53351  40.69974   11.89917  1.000 42.69747  ? 120 ILE H CA  1 
ATOM   925   C C   . ILE A  1 140 ? 27.71456  40.71288   12.86140  1.000 40.38551  ? 120 ILE H C   1 
ATOM   926   O O   . ILE A  1 140 ? 27.56964  41.09904   14.02600  1.000 41.12450  ? 120 ILE H O   1 
ATOM   927   C CB  . ILE A  1 140 ? 25.90795  39.29874   11.79230  1.000 46.94216  ? 120 ILE H CB  1 
ATOM   928   C CG1 . ILE A  1 140 ? 24.74503  39.30528   10.80132  1.000 50.21695  ? 120 ILE H CG1 1 
ATOM   929   C CG2 . ILE A  1 140 ? 25.43598  38.83101   13.15412  1.000 39.79439  ? 120 ILE H CG2 1 
ATOM   930   C CD1 . ILE A  1 140 ? 23.56809  40.13695   11.25649  1.000 47.05420  ? 120 ILE H CD1 1 
ATOM   931   N N   . ILE A  1 141 ? 28.89893  40.31428   12.39273  1.000 38.76209  ? 121 ILE H N   1 
ATOM   932   C CA  . ILE A  1 141 ? 30.01720  40.08163   13.30228  1.000 38.45821  ? 121 ILE H CA  1 
ATOM   933   C C   . ILE A  1 141 ? 30.70132  41.38387   13.68703  1.000 38.27965  ? 121 ILE H C   1 
ATOM   934   O O   . ILE A  1 141 ? 30.99574  41.61915   14.86255  1.000 44.63600  ? 121 ILE H O   1 
ATOM   935   C CB  . ILE A  1 141 ? 31.01765  39.08876   12.68205  1.000 34.75906  ? 121 ILE H CB  1 
ATOM   936   C CG1 . ILE A  1 141 ? 30.28751  37.79686   12.29810  1.000 39.65364  ? 121 ILE H CG1 1 
ATOM   937   C CG2 . ILE A  1 141 ? 32.16189  38.82619   13.64139  1.000 33.10784  ? 121 ILE H CG2 1 
ATOM   938   C CD1 . ILE A  1 141 ? 31.14044  36.76968   11.58316  1.000 33.69833  ? 121 ILE H CD1 1 
ATOM   939   N N   . GLU A  1 142 ? 30.97635  42.23808   12.70734  1.000 44.99690  ? 122 GLU H N   1 
ATOM   940   C CA  . GLU A  1 142 ? 31.74563  43.45498   12.96654  1.000 50.94059  ? 122 GLU H CA  1 
ATOM   941   C C   . GLU A  1 142 ? 31.19076  44.32844   14.08739  1.000 49.30970  ? 122 GLU H C   1 
ATOM   942   O O   . GLU A  1 142 ? 32.00320  44.87431   14.85221  1.000 51.73813  ? 122 GLU H O   1 
ATOM   943   C CB  . GLU A  1 142 ? 31.88954  44.26457   11.66744  1.000 54.89161  ? 122 GLU H CB  1 
ATOM   944   C CG  . GLU A  1 142 ? 33.23826  44.06627   10.98253  1.000 58.06748  ? 122 GLU H CG  1 
ATOM   945   C CD  . GLU A  1 142 ? 33.28107  44.63216   9.57346   1.000 66.07837  ? 122 GLU H CD  1 
ATOM   946   O OE1 . GLU A  1 142 ? 32.36042  45.39181   9.20677   1.000 68.68162  ? 122 GLU H OE1 1 
ATOM   947   O OE2 . GLU A  1 142 ? 34.22994  44.30171   8.82700   1.000 71.21175  ? 122 GLU H OE2 1 
ATOM   948   N N   . PRO A  1 143 ? 29.87467  44.51369   14.25495  1.000 53.35731  ? 123 PRO H N   1 
ATOM   949   C CA  . PRO A  1 143 ? 29.41168  45.29273   15.41846  1.000 55.45009  ? 123 PRO H CA  1 
ATOM   950   C C   . PRO A  1 143 ? 29.81972  44.69291   16.75263  1.000 54.50361  ? 123 PRO H C   1 
ATOM   951   O O   . PRO A  1 143 ? 30.02762  45.43927   17.71599  1.000 55.80987  ? 123 PRO H O   1 
ATOM   952   C CB  . PRO A  1 143 ? 27.88630  45.30853   15.24728  1.000 56.11656  ? 123 PRO H CB  1 
ATOM   953   C CG  . PRO A  1 143 ? 27.67826  45.15585   13.79741  1.000 62.05047  ? 123 PRO H CG  1 
ATOM   954   C CD  . PRO A  1 143 ? 28.76170  44.21471   13.33762  1.000 59.09774  ? 123 PRO H CD  1 
ATOM   955   N N   . TYR A  1 144 ? 29.93595  43.36431   16.83823  1.000 41.12831  ? 124 TYR H N   1 
ATOM   956   C CA  . TYR A  1 144 ? 30.46049  42.74036   18.05015  1.000 47.92428  ? 124 TYR H CA  1 
ATOM   957   C C   . TYR A  1 144 ? 31.95299  42.99006   18.19996  1.000 38.71677  ? 124 TYR H C   1 
ATOM   958   O O   . TYR A  1 144 ? 32.47373  42.99755   19.32209  1.000 38.39698  ? 124 TYR H O   1 
ATOM   959   C CB  . TYR A  1 144 ? 30.17975  41.23482   18.03967  1.000 38.36701  ? 124 TYR H CB  1 
ATOM   960   C CG  . TYR A  1 144 ? 28.71430  40.88620   17.90348  1.000 40.68149  ? 124 TYR H CG  1 
ATOM   961   C CD1 . TYR A  1 144 ? 28.29544  39.80909   17.12956  1.000 35.78522  ? 124 TYR H CD1 1 
ATOM   962   C CD2 . TYR A  1 144 ? 27.74723  41.64167   18.55198  1.000 39.40924  ? 124 TYR H CD2 1 
ATOM   963   C CE1 . TYR A  1 144 ? 26.94459  39.49296   17.00801  1.000 36.80068  ? 124 TYR H CE1 1 
ATOM   964   C CE2 . TYR A  1 144 ? 26.40562  41.33778   18.43820  1.000 40.52360  ? 124 TYR H CE2 1 
ATOM   965   C CZ  . TYR A  1 144 ? 26.00500  40.26581   17.66768  1.000 41.90758  ? 124 TYR H CZ  1 
ATOM   966   O OH  . TYR A  1 144 ? 24.66106  39.98253   17.56706  1.000 44.44653  ? 124 TYR H OH  1 
ATOM   967   N N   . ALA A  1 145 ? 32.64983  43.20032   17.08882  1.000 39.11071  ? 125 ALA H N   1 
ATOM   968   C CA  . ALA A  1 145 ? 34.09618  43.36796   17.04337  1.000 39.46187  ? 125 ALA H CA  1 
ATOM   969   C C   . ALA A  1 145 ? 34.80657  42.32948   17.90402  1.000 37.54258  ? 125 ALA H C   1 
ATOM   970   O O   . ALA A  1 145 ? 35.59241  42.69812   18.78498  1.000 40.98405  ? 125 ALA H O   1 
ATOM   971   C CB  . ALA A  1 145 ? 34.48207  44.77860   17.49458  1.000 43.49102  ? 125 ALA H CB  1 
ATOM   972   N N   . PRO A  1 146 ? 34.56431  41.03576   17.70343  1.000 34.63091  ? 126 PRO H N   1 
ATOM   973   C CA  . PRO A  1 146 ? 35.33645  40.04629   18.45316  1.000 33.67034  ? 126 PRO H CA  1 
ATOM   974   C C   . PRO A  1 146 ? 36.77827  40.08536   17.98789  1.000 34.69050  ? 126 PRO H C   1 
ATOM   975   O O   . PRO A  1 146 ? 37.07307  40.40660   16.83392  1.000 37.62375  ? 126 PRO H O   1 
ATOM   976   C CB  . PRO A  1 146 ? 34.66009  38.71422   18.10507  1.000 35.90298  ? 126 PRO H CB  1 
ATOM   977   C CG  . PRO A  1 146 ? 34.10418  38.92923   16.74529  1.000 40.88326  ? 126 PRO H CG  1 
ATOM   978   C CD  . PRO A  1 146 ? 33.75013  40.40823   16.64579  1.000 33.86575  ? 126 PRO H CD  1 
ATOM   979   N N   . GLU A  1 147 ? 37.68924  39.79600   18.91369  1.000 39.52103  ? 127 GLU H N   1 
ATOM   980   C CA  . GLU A  1 147 ? 39.09400  39.73822   18.53434  1.000 40.01260  ? 127 GLU H CA  1 
ATOM   981   C C   . GLU A  1 147 ? 39.42153  38.46937   17.75331  1.000 41.21189  ? 127 GLU H C   1 
ATOM   982   O O   . GLU A  1 147 ? 40.32186  38.48646   16.90616  1.000 42.23106  ? 127 GLU H O   1 
ATOM   983   C CB  . GLU A  1 147 ? 39.98156  39.84446   19.77507  1.000 37.61744  ? 127 GLU H CB  1 
ATOM   984   C CG  . GLU A  1 147 ? 41.44957  40.06659   19.46169  1.000 54.76698  ? 127 GLU H CG  1 
ATOM   985   C CD  . GLU A  1 147 ? 41.76121  41.50499   19.07521  1.000 66.34372  ? 127 GLU H CD  1 
ATOM   986   O OE1 . GLU A  1 147 ? 40.90829  42.38815   19.31595  1.000 67.89059  ? 127 GLU H OE1 1 
ATOM   987   O OE2 . GLU A  1 147 ? 42.86167  41.75191   18.53258  1.000 66.44633  ? 127 GLU H OE2 1 
ATOM   988   N N   . TYR A  1 148 ? 38.70339  37.37370   17.99766  1.000 33.55751  ? 128 TYR H N   1 
ATOM   989   C CA  . TYR A  1 148 ? 39.02842  36.10245   17.36312  1.000 41.36917  ? 128 TYR H CA  1 
ATOM   990   C C   . TYR A  1 148 ? 37.76818  35.41859   16.85216  1.000 38.17264  ? 128 TYR H C   1 
ATOM   991   O O   . TYR A  1 148 ? 36.67839  35.57941   17.40698  1.000 44.03506  ? 128 TYR H O   1 
ATOM   992   C CB  . TYR A  1 148 ? 39.76931  35.15938   18.32290  1.000 29.45300  ? 128 TYR H CB  1 
ATOM   993   C CG  . TYR A  1 148 ? 40.82737  35.84499   19.15012  1.000 31.36191  ? 128 TYR H CG  1 
ATOM   994   C CD1 . TYR A  1 148 ? 42.02618  36.25325   18.58218  1.000 33.30033  ? 128 TYR H CD1 1 
ATOM   995   C CD2 . TYR A  1 148 ? 40.62854  36.08392   20.50126  1.000 31.60533  ? 128 TYR H CD2 1 
ATOM   996   C CE1 . TYR A  1 148 ? 42.99716  36.88678   19.33970  1.000 35.45977  ? 128 TYR H CE1 1 
ATOM   997   C CE2 . TYR A  1 148 ? 41.59108  36.71566   21.26493  1.000 37.01125  ? 128 TYR H CE2 1 
ATOM   998   C CZ  . TYR A  1 148 ? 42.77111  37.11472   20.68154  1.000 36.64222  ? 128 TYR H CZ  1 
ATOM   999   O OH  . TYR A  1 148 ? 43.72189  37.73897   21.45230  1.000 42.49988  ? 128 TYR H OH  1 
ATOM   1000  N N   . MET A  1 149 ? 37.93817  34.64692   15.78412  1.000 31.17211  ? 129 MET H N   1 
ATOM   1001  C CA  . MET A  1 149 ? 36.87396  33.84779   15.20070  1.000 34.69102  ? 129 MET H CA  1 
ATOM   1002  C C   . MET A  1 149 ? 37.22435  32.37271   15.33597  1.000 32.11302  ? 129 MET H C   1 
ATOM   1003  O O   . MET A  1 149 ? 38.31327  31.94848   14.93418  1.000 32.88001  ? 129 MET H O   1 
ATOM   1004  C CB  . MET A  1 149 ? 36.66517  34.20832   13.72931  1.000 32.93228  ? 129 MET H CB  1 
ATOM   1005  C CG  . MET A  1 149 ? 36.19970  35.63154   13.50873  1.000 33.26415  ? 129 MET H CG  1 
ATOM   1006  S SD  . MET A  1 149 ? 34.58689  35.94817   14.24058  1.000 38.17207  ? 129 MET H SD  1 
ATOM   1007  C CE  . MET A  1 149 ? 33.56805  34.76588   13.36095  1.000 47.27190  ? 129 MET H CE  1 
ATOM   1008  N N   . VAL A  1 150 ? 36.30742  31.60113   15.90140  1.000 24.10763  ? 130 VAL H N   1 
ATOM   1009  C CA  . VAL A  1 150 ? 36.43355  30.15337   15.99767  1.000 31.25898  ? 130 VAL H CA  1 
ATOM   1010  C C   . VAL A  1 150 ? 35.41669  29.57272   15.02673  1.000 30.18883  ? 130 VAL H C   1 
ATOM   1011  O O   . VAL A  1 150 ? 34.21527  29.54623   15.31839  1.000 34.17650  ? 130 VAL H O   1 
ATOM   1012  C CB  . VAL A  1 150 ? 36.20263  29.64632   17.42480  1.000 30.51304  ? 130 VAL H CB  1 
ATOM   1013  C CG1 . VAL A  1 150 ? 36.42181  28.14373   17.48768  1.000 27.34201  ? 130 VAL H CG1 1 
ATOM   1014  C CG2 . VAL A  1 150 ? 37.12245  30.36977   18.39497  1.000 26.74348  ? 130 VAL H CG2 1 
ATOM   1015  N N   . ILE A  1 151 ? 35.88897  29.13271   13.86224  1.000 25.91352  ? 131 ILE H N   1 
ATOM   1016  C CA  . ILE A  1 151 ? 35.02668  28.56390   12.83227  1.000 24.79468  ? 131 ILE H CA  1 
ATOM   1017  C C   . ILE A  1 151 ? 34.88797  27.07219   13.10935  1.000 31.70333  ? 131 ILE H C   1 
ATOM   1018  O O   . ILE A  1 151 ? 35.88959  26.35010   13.16734  1.000 29.17502  ? 131 ILE H O   1 
ATOM   1019  C CB  . ILE A  1 151 ? 35.59442  28.81656   11.42702  1.000 24.39754  ? 131 ILE H CB  1 
ATOM   1020  C CG1 . ILE A  1 151 ? 35.81291  30.31510   11.18877  1.000 33.71997  ? 131 ILE H CG1 1 
ATOM   1021  C CG2 . ILE A  1 151 ? 34.67402  28.22495   10.36560  1.000 25.65880  ? 131 ILE H CG2 1 
ATOM   1022  C CD1 . ILE A  1 151 ? 34.58623  31.16453   11.44588  1.000 30.77661  ? 131 ILE H CD1 1 
ATOM   1023  N N   . LEU A  1 152 ? 33.65156  26.60624   13.27755  1.000 33.62864  ? 132 LEU H N   1 
ATOM   1024  C CA  . LEU A  1 152 ? 33.38695  25.24043   13.70621  1.000 26.88496  ? 132 LEU H CA  1 
ATOM   1025  C C   . LEU A  1 152 ? 32.51877  24.51084   12.69537  1.000 27.65220  ? 132 LEU H C   1 
ATOM   1026  O O   . LEU A  1 152 ? 31.60554  25.09756   12.10686  1.000 31.33169  ? 132 LEU H O   1 
ATOM   1027  C CB  . LEU A  1 152 ? 32.69379  25.20883   15.07463  1.000 20.71452  ? 132 LEU H CB  1 
ATOM   1028  C CG  . LEU A  1 152 ? 33.48151  25.76565   16.26047  1.000 27.81434  ? 132 LEU H CG  1 
ATOM   1029  C CD1 . LEU A  1 152 ? 32.66303  25.64458   17.53967  1.000 27.32919  ? 132 LEU H CD1 1 
ATOM   1030  C CD2 . LEU A  1 152 ? 34.81232  25.05437   16.40710  1.000 20.88480  ? 132 LEU H CD2 1 
ATOM   1031  N N   . ALA A  1 153 ? 32.80824  23.22399   12.51216  1.000 36.72618  ? 133 ALA H N   1 
ATOM   1032  C CA  . ALA A  1 153 ? 31.91175  22.32624   11.79813  1.000 34.92254  ? 133 ALA H CA  1 
ATOM   1033  C C   . ALA A  1 153 ? 30.84283  21.82022   12.75697  1.000 31.37801  ? 133 ALA H C   1 
ATOM   1034  O O   . ALA A  1 153 ? 31.15315  21.36955   13.86366  1.000 30.62176  ? 133 ALA H O   1 
ATOM   1035  C CB  . ALA A  1 153 ? 32.68654  21.15294   11.20011  1.000 22.94900  ? 133 ALA H CB  1 
ATOM   1036  N N   . GLY A  1 154 ? 29.58533  21.89326   12.33896  1.000 36.35512  ? 134 GLY H N   1 
ATOM   1037  C CA  . GLY A  1 154 ? 28.48561  21.53969   13.20846  1.000 31.01739  ? 134 GLY H CA  1 
ATOM   1038  C C   . GLY A  1 154 ? 27.95093  20.13382   13.05736  1.000 29.15701  ? 134 GLY H C   1 
ATOM   1039  O O   . GLY A  1 154 ? 26.87874  19.83932   13.59999  1.000 24.06890  ? 134 GLY H O   1 
ATOM   1040  N N   . ASP A  1 155 ? 28.64966  19.25427   12.34414  1.000 23.70254  ? 135 ASP H N   1 
ATOM   1041  C CA  . ASP A  1 155 ? 28.15022  17.90608   12.10122  1.000 30.43719  ? 135 ASP H CA  1 
ATOM   1042  C C   . ASP A  1 155 ? 29.09768  16.83068   12.63193  1.000 31.74491  ? 135 ASP H C   1 
ATOM   1043  O O   . ASP A  1 155 ? 29.15324  15.72582   12.09016  1.000 47.70338  ? 135 ASP H O   1 
ATOM   1044  C CB  . ASP A  1 155 ? 27.86112  17.69107   10.61483  1.000 33.99786  ? 135 ASP H CB  1 
ATOM   1045  C CG  . ASP A  1 155 ? 29.12173  17.59887   9.77029   1.000 39.04359  ? 135 ASP H CG  1 
ATOM   1046  O OD1 . ASP A  1 155 ? 30.16936  18.13579   10.18675  1.000 40.59560  ? 135 ASP H OD1 1 
ATOM   1047  O OD2 . ASP A  1 155 ? 29.06708  16.97713   8.68747   1.000 39.80161  ? 135 ASP H OD2 1 
ATOM   1048  N N   . HIS A  1 156 ? 29.82217  17.12933   13.71229  1.000 27.27849  ? 136 HIS H N   1 
ATOM   1049  C CA  . HIS A  1 156 ? 30.67775  16.15557   14.37606  1.000 28.13263  ? 136 HIS H CA  1 
ATOM   1050  C C   . HIS A  1 156 ? 30.38439  16.12295   15.86994  1.000 26.54812  ? 136 HIS H C   1 
ATOM   1051  O O   . HIS A  1 156 ? 29.98961  17.12464   16.47056  1.000 27.56004  ? 136 HIS H O   1 
ATOM   1052  C CB  . HIS A  1 156 ? 32.17448  16.44791   14.15117  1.000 25.93528  ? 136 HIS H CB  1 
ATOM   1053  C CG  . HIS A  1 156 ? 32.53706  16.67787   12.71747  1.000 28.19701  ? 136 HIS H CG  1 
ATOM   1054  N ND1 . HIS A  1 156 ? 33.41533  17.66313   12.31826  1.000 31.81544  ? 136 HIS H ND1 1 
ATOM   1055  C CD2 . HIS A  1 156 ? 32.13175  16.05238   11.58516  1.000 31.11182  ? 136 HIS H CD2 1 
ATOM   1056  C CE1 . HIS A  1 156 ? 33.53966  17.63108   11.00228  1.000 37.66848  ? 136 HIS H CE1 1 
ATOM   1057  N NE2 . HIS A  1 156 ? 32.77126  16.66320   10.53316  1.000 35.24733  ? 136 HIS H NE2 1 
ATOM   1058  N N   . ILE A  1 157 ? 30.58730  14.95219   16.46234  1.000 28.27924  ? 137 ILE H N   1 
ATOM   1059  C CA  . ILE A  1 157 ? 30.34702  14.72026   17.88070  1.000 28.93254  ? 137 ILE H CA  1 
ATOM   1060  C C   . ILE A  1 157 ? 31.70768  14.60237   18.55047  1.000 34.55992  ? 137 ILE H C   1 
ATOM   1061  O O   . ILE A  1 157 ? 32.46288  13.65967   18.27813  1.000 26.34514  ? 137 ILE H O   1 
ATOM   1062  C CB  . ILE A  1 157 ? 29.49806  13.46535   18.10693  1.000 28.26675  ? 137 ILE H CB  1 
ATOM   1063  C CG1 . ILE A  1 157 ? 28.21070  13.55429   17.28701  1.000 27.39071  ? 137 ILE H CG1 1 
ATOM   1064  C CG2 . ILE A  1 157 ? 29.20027  13.27820   19.59090  1.000 27.07886  ? 137 ILE H CG2 1 
ATOM   1065  C CD1 . ILE A  1 157 ? 27.66613  12.20659   16.85852  1.000 35.36298  ? 137 ILE H CD1 1 
ATOM   1066  N N   . TYR A  1 158 ? 32.03030  15.56101   19.41337  1.000 27.46226  ? 138 TYR H N   1 
ATOM   1067  C CA  . TYR A  1 158 ? 33.34015  15.60571   20.05435  1.000 31.34817  ? 138 TYR H CA  1 
ATOM   1068  C C   . TYR A  1 158 ? 33.28692  16.63626   21.17189  1.000 29.76774  ? 138 TYR H C   1 
ATOM   1069  O O   . TYR A  1 158 ? 32.36726  17.45430   21.24559  1.000 31.30604  ? 138 TYR H O   1 
ATOM   1070  C CB  . TYR A  1 158 ? 34.45232  15.94664   19.05620  1.000 25.02626  ? 138 TYR H CB  1 
ATOM   1071  C CG  . TYR A  1 158 ? 34.36121  17.35693   18.54580  1.000 23.62854  ? 138 TYR H CG  1 
ATOM   1072  C CD1 . TYR A  1 158 ? 33.39427  17.71554   17.62162  1.000 22.79852  ? 138 TYR H CD1 1 
ATOM   1073  C CD2 . TYR A  1 158 ? 35.22008  18.34248   19.01236  1.000 33.90468  ? 138 TYR H CD2 1 
ATOM   1074  C CE1 . TYR A  1 158 ? 33.28811  19.02077   17.16759  1.000 37.31398  ? 138 TYR H CE1 1 
ATOM   1075  C CE2 . TYR A  1 158 ? 35.12291  19.64514   18.56355  1.000 27.14508  ? 138 TYR H CE2 1 
ATOM   1076  C CZ  . TYR A  1 158 ? 34.15555  19.97697   17.64187  1.000 21.72528  ? 138 TYR H CZ  1 
ATOM   1077  O OH  . TYR A  1 158 ? 34.05886  21.26906   17.18324  1.000 39.47199  ? 138 TYR H OH  1 
ATOM   1078  N N   . LYS A  1 159 ? 34.29181  16.58975   22.04109  1.000 29.65721  ? 139 LYS H N   1 
ATOM   1079  C CA  . LYS A  1 159 ? 34.39158  17.50535   23.16661  1.000 25.74443  ? 139 LYS H CA  1 
ATOM   1080  C C   . LYS A  1 159 ? 35.77428  18.13445   23.15791  1.000 31.72936  ? 139 LYS H C   1 
ATOM   1081  O O   . LYS A  1 159 ? 36.77550  17.42262   23.04144  1.000 27.54904  ? 139 LYS H O   1 
ATOM   1082  C CB  . LYS A  1 159 ? 34.12452  16.78421   24.48635  1.000 27.32038  ? 139 LYS H CB  1 
ATOM   1083  C CG  . LYS A  1 159 ? 32.65201  16.48666   24.71777  1.000 27.17891  ? 139 LYS H CG  1 
ATOM   1084  C CD  . LYS A  1 159 ? 32.42897  15.87724   26.08619  1.000 29.07852  ? 139 LYS H CD  1 
ATOM   1085  C CE  . LYS A  1 159 ? 33.04783  14.49926   26.14536  1.000 30.84752  ? 139 LYS H CE  1 
ATOM   1086  N NZ  . LYS A  1 159 ? 32.40890  13.62198   27.15869  1.000 41.04175  ? 139 LYS H NZ  1 
ATOM   1087  N N   . MET A  1 160 ? 35.83233  19.46263   23.28516  1.000 25.33499  ? 140 MET H N   1 
ATOM   1088  C CA  . MET A  1 160 ? 37.07415  20.17109   22.99953  1.000 31.98345  ? 140 MET H CA  1 
ATOM   1089  C C   . MET A  1 160 ? 37.06263  21.54260   23.66036  1.000 38.74441  ? 140 MET H C   1 
ATOM   1090  O O   . MET A  1 160 ? 36.09955  22.30144   23.50485  1.000 30.51100  ? 140 MET H O   1 
ATOM   1091  C CB  . MET A  1 160 ? 37.26576  20.30435   21.48421  1.000 33.40814  ? 140 MET H CB  1 
ATOM   1092  C CG  . MET A  1 160 ? 38.58634  20.91241   21.04988  1.000 37.65244  ? 140 MET H CG  1 
ATOM   1093  S SD  . MET A  1 160 ? 38.85203  20.65486   19.28700  1.000 44.77610  ? 140 MET H SD  1 
ATOM   1094  C CE  . MET A  1 160 ? 40.46325  21.40664   19.05673  1.000 51.24634  ? 140 MET H CE  1 
ATOM   1095  N N   . ASP A  1 161 ? 38.14259  21.85834   24.37879  1.000 37.72050  ? 141 ASP H N   1 
ATOM   1096  C CA  . ASP A  1 161 ? 38.29735  23.13825   25.07097  1.000 31.06095  ? 141 ASP H CA  1 
ATOM   1097  C C   . ASP A  1 161 ? 38.99879  24.10512   24.12325  1.000 31.22678  ? 141 ASP H C   1 
ATOM   1098  O O   . ASP A  1 161 ? 40.22613  24.09147   23.99792  1.000 33.01925  ? 141 ASP H O   1 
ATOM   1099  C CB  . ASP A  1 161 ? 39.07877  22.95325   26.36821  1.000 29.61208  ? 141 ASP H CB  1 
ATOM   1100  C CG  . ASP A  1 161 ? 39.07029  24.19841   27.24618  1.000 41.32986  ? 141 ASP H CG  1 
ATOM   1101  O OD1 . ASP A  1 161 ? 38.87554  25.31890   26.72572  1.000 29.09822  ? 141 ASP H OD1 1 
ATOM   1102  O OD2 . ASP A  1 161 ? 39.26072  24.05127   28.47318  1.000 48.34847  ? 141 ASP H OD2 1 
ATOM   1103  N N   . TYR A  1 162 ? 38.21818  24.96602   23.46783  1.000 32.22635  ? 142 TYR H N   1 
ATOM   1104  C CA  . TYR A  1 162 ? 38.76466  25.84149   22.43884  1.000 32.67747  ? 142 TYR H CA  1 
ATOM   1105  C C   . TYR A  1 162 ? 39.75035  26.86720   22.98336  1.000 33.42337  ? 142 TYR H C   1 
ATOM   1106  O O   . TYR A  1 162 ? 40.44568  27.50319   22.18621  1.000 38.54589  ? 142 TYR H O   1 
ATOM   1107  C CB  . TYR A  1 162 ? 37.63399  26.56158   21.69953  1.000 31.73821  ? 142 TYR H CB  1 
ATOM   1108  C CG  . TYR A  1 162 ? 36.66562  25.63711   20.99866  1.000 35.37436  ? 142 TYR H CG  1 
ATOM   1109  C CD1 . TYR A  1 162 ? 35.29307  25.81466   21.11994  1.000 30.00744  ? 142 TYR H CD1 1 
ATOM   1110  C CD2 . TYR A  1 162 ? 37.12356  24.58332   20.21777  1.000 31.74277  ? 142 TYR H CD2 1 
ATOM   1111  C CE1 . TYR A  1 162 ? 34.40764  24.97392   20.47788  1.000 29.56049  ? 142 TYR H CE1 1 
ATOM   1112  C CE2 . TYR A  1 162 ? 36.24520  23.73669   19.57986  1.000 31.36236  ? 142 TYR H CE2 1 
ATOM   1113  C CZ  . TYR A  1 162 ? 34.88905  23.93341   19.71307  1.000 36.45582  ? 142 TYR H CZ  1 
ATOM   1114  O OH  . TYR A  1 162 ? 34.01663  23.08041   19.07307  1.000 33.76086  ? 142 TYR H OH  1 
ATOM   1115  N N   . GLU A  1 163 ? 39.83332  27.04742   24.30552  1.000 36.77944  ? 143 GLU H N   1 
ATOM   1116  C CA  . GLU A  1 163 ? 40.77782  28.02008   24.84751  1.000 36.74804  ? 143 GLU H CA  1 
ATOM   1117  C C   . GLU A  1 163 ? 42.21355  27.61016   24.56276  1.000 45.38229  ? 143 GLU H C   1 
ATOM   1118  O O   . GLU A  1 163 ? 43.08526  28.47453   24.41699  1.000 40.96304  ? 143 GLU H O   1 
ATOM   1119  C CB  . GLU A  1 163 ? 40.55869  28.20548   26.35083  1.000 33.99258  ? 143 GLU H CB  1 
ATOM   1120  C CG  . GLU A  1 163 ? 41.50617  29.20764   27.01724  1.000 35.41760  ? 143 GLU H CG  1 
ATOM   1121  C CD  . GLU A  1 163 ? 41.15590  30.66488   26.72879  1.000 34.60189  ? 143 GLU H CD  1 
ATOM   1122  O OE1 . GLU A  1 163 ? 42.07960  31.50556   26.69436  1.000 38.10006  ? 143 GLU H OE1 1 
ATOM   1123  O OE2 . GLU A  1 163 ? 39.96689  30.97887   26.53735  1.000 33.43826  ? 143 GLU H OE2 1 
ATOM   1124  N N   . TYR A  1 164 ? 42.47808  26.30479   24.46173  1.000 37.79787  ? 144 TYR H N   1 
ATOM   1125  C CA  . TYR A  1 164 ? 43.82092  25.85453   24.10991  1.000 37.26729  ? 144 TYR H CA  1 
ATOM   1126  C C   . TYR A  1 164 ? 44.19916  26.31788   22.70999  1.000 42.03642  ? 144 TYR H C   1 
ATOM   1127  O O   . TYR A  1 164 ? 45.28009  26.88574   22.50080  1.000 43.54965  ? 144 TYR H O   1 
ATOM   1128  C CB  . TYR A  1 164 ? 43.91187  24.33703   24.21513  1.000 37.46136  ? 144 TYR H CB  1 
ATOM   1129  C CG  . TYR A  1 164 ? 44.02794  23.82912   25.62956  1.000 48.20425  ? 144 TYR H CG  1 
ATOM   1130  C CD1 . TYR A  1 164 ? 42.90899  23.73485   26.44778  1.000 50.11900  ? 144 TYR H CD1 1 
ATOM   1131  C CD2 . TYR A  1 164 ? 45.25572  23.43512   26.14793  1.000 51.03573  ? 144 TYR H CD2 1 
ATOM   1132  C CE1 . TYR A  1 164 ? 43.00927  23.26615   27.74671  1.000 50.80798  ? 144 TYR H CE1 1 
ATOM   1133  C CE2 . TYR A  1 164 ? 45.36675  22.96279   27.44634  1.000 56.13050  ? 144 TYR H CE2 1 
ATOM   1134  C CZ  . TYR A  1 164 ? 44.23991  22.88139   28.24070  1.000 59.71740  ? 144 TYR H CZ  1 
ATOM   1135  O OH  . TYR A  1 164 ? 44.34381  22.41277   29.53120  1.000 67.32756  ? 144 TYR H OH  1 
ATOM   1136  N N   . MET A  1 165 ? 43.31418  26.08683   21.73566  1.000 36.87894  ? 145 MET H N   1 
ATOM   1137  C CA  . MET A  1 165 ? 43.55955  26.57682   20.38224  1.000 45.05839  ? 145 MET H CA  1 
ATOM   1138  C C   . MET A  1 165 ? 43.80386  28.07994   20.37518  1.000 45.18176  ? 145 MET H C   1 
ATOM   1139  O O   . MET A  1 165 ? 44.70901  28.56690   19.68613  1.000 42.30774  ? 145 MET H O   1 
ATOM   1140  C CB  . MET A  1 165 ? 42.38084  26.22863   19.47278  1.000 43.20939  ? 145 MET H CB  1 
ATOM   1141  C CG  . MET A  1 165 ? 42.60394  24.99866   18.62415  1.000 48.90706  ? 145 MET H CG  1 
ATOM   1142  S SD  . MET A  1 165 ? 41.23094  24.62932   17.52132  1.000 54.71931  ? 145 MET H SD  1 
ATOM   1143  C CE  . MET A  1 165 ? 41.85511  25.25312   15.96481  1.000 45.18887  ? 145 MET H CE  1 
ATOM   1144  N N   . LEU A  1 166 ? 43.01320  28.82862   21.14851  1.000 36.69392  ? 146 LEU H N   1 
ATOM   1145  C CA  . LEU A  1 166 ? 43.14300  30.28250   21.16510  1.000 36.94042  ? 146 LEU H CA  1 
ATOM   1146  C C   . LEU A  1 166 ? 44.53516  30.71993   21.60674  1.000 38.36138  ? 146 LEU H C   1 
ATOM   1147  O O   . LEU A  1 166 ? 45.12775  31.62437   21.00297  1.000 39.19864  ? 146 LEU H O   1 
ATOM   1148  C CB  . LEU A  1 166 ? 42.07383  30.88532   22.07268  1.000 40.32138  ? 146 LEU H CB  1 
ATOM   1149  C CG  . LEU A  1 166 ? 40.63909  30.69455   21.58256  1.000 34.46839  ? 146 LEU H CG  1 
ATOM   1150  C CD1 . LEU A  1 166 ? 39.66069  31.28530   22.57284  1.000 33.45078  ? 146 LEU H CD1 1 
ATOM   1151  C CD2 . LEU A  1 166 ? 40.45927  31.32682   20.20974  1.000 36.61385  ? 146 LEU H CD2 1 
ATOM   1152  N N   . GLN A  1 167 ? 45.07084  30.10116   22.66395  1.000 38.74603  ? 147 GLN H N   1 
ATOM   1153  C CA  . GLN A  1 167 ? 46.42257  30.43573   23.09669  1.000 47.51616  ? 147 GLN H CA  1 
ATOM   1154  C C   . GLN A  1 167 ? 47.43924  30.09363   22.01547  1.000 48.52133  ? 147 GLN H C   1 
ATOM   1155  O O   . GLN A  1 167 ? 48.25872  30.93614   21.63541  1.000 53.10805  ? 147 GLN H O   1 
ATOM   1156  C CB  . GLN A  1 167 ? 46.77343  29.71936   24.39983  1.000 46.80166  ? 147 GLN H CB  1 
ATOM   1157  C CG  . GLN A  1 167 ? 45.63525  29.62609   25.38281  1.000 46.53984  ? 147 GLN H CG  1 
ATOM   1158  C CD  . GLN A  1 167 ? 45.76950  30.59668   26.54118  1.000 57.05326  ? 147 GLN H CD  1 
ATOM   1159  O OE1 . GLN A  1 167 ? 46.17989  31.74514   26.36182  1.000 66.56118  ? 147 GLN H OE1 1 
ATOM   1160  N NE2 . GLN A  1 167 ? 45.40880  30.14261   27.73823  1.000 57.67736  ? 147 GLN H NE2 1 
ATOM   1161  N N   . GLN A  1 168 ? 47.39772  28.85598   21.50589  1.000 46.75863  ? 148 GLN H N   1 
ATOM   1162  C CA  . GLN A  1 168 ? 48.33779  28.45909   20.46038  1.000 44.61133  ? 148 GLN H CA  1 
ATOM   1163  C C   . GLN A  1 168 ? 48.30568  29.43774   19.30068  1.000 47.78945  ? 148 GLN H C   1 
ATOM   1164  O O   . GLN A  1 168 ? 49.35822  29.87511   18.82693  1.000 52.54113  ? 148 GLN H O   1 
ATOM   1165  C CB  . GLN A  1 168 ? 48.03812  27.04600   19.94958  1.000 41.89341  ? 148 GLN H CB  1 
ATOM   1166  C CG  . GLN A  1 168 ? 48.52622  26.82594   18.50457  1.000 44.49657  ? 148 GLN H CG  1 
ATOM   1167  C CD  . GLN A  1 168 ? 48.57043  25.35972   18.09238  1.000 53.70546  ? 148 GLN H CD  1 
ATOM   1168  O OE1 . GLN A  1 168 ? 48.78231  25.03747   16.91592  1.000 51.54056  ? 148 GLN H OE1 1 
ATOM   1169  N NE2 . GLN A  1 168 ? 48.35598  24.46366   19.05749  1.000 48.34522  ? 148 GLN H NE2 1 
ATOM   1170  N N   . HIS A  1 169 ? 47.10748  29.82285   18.85475  1.000 41.83609  ? 149 HIS H N   1 
ATOM   1171  C CA  . HIS A  1 169 ? 47.00006  30.69828   17.68977  1.000 41.99156  ? 149 HIS H CA  1 
ATOM   1172  C C   . HIS A  1 169 ? 47.77318  31.99630   17.89056  1.000 48.70381  ? 149 HIS H C   1 
ATOM   1173  O O   . HIS A  1 169 ? 48.54280  32.40974   17.01523  1.000 59.70608  ? 149 HIS H O   1 
ATOM   1174  C CB  . HIS A  1 169 ? 45.53672  30.99140   17.37742  1.000 42.79940  ? 149 HIS H CB  1 
ATOM   1175  C CG  . HIS A  1 169 ? 45.34587  31.88798   16.19330  1.000 45.23933  ? 149 HIS H CG  1 
ATOM   1176  N ND1 . HIS A  1 169 ? 45.48305  31.44690   14.89384  1.000 41.06204  ? 149 HIS H ND1 1 
ATOM   1177  C CD2 . HIS A  1 169 ? 45.03378  33.20450   16.11358  1.000 41.69187  ? 149 HIS H CD2 1 
ATOM   1178  C CE1 . HIS A  1 169 ? 45.25855  32.45180   14.06559  1.000 46.06668  ? 149 HIS H CE1 1 
ATOM   1179  N NE2 . HIS A  1 169 ? 44.98137  33.52839   14.78023  1.000 40.91749  ? 149 HIS H NE2 1 
ATOM   1180  N N   . VAL A  1 170 ? 47.59443  32.65255   19.03927  1.000 46.69705  ? 150 VAL H N   1 
ATOM   1181  C CA  . VAL A  1 170 ? 48.25764  33.93806   19.23012  1.000 50.34893  ? 150 VAL H CA  1 
ATOM   1182  C C   . VAL A  1 170 ? 49.71155  33.74137   19.64594  1.000 55.65132  ? 150 VAL H C   1 
ATOM   1183  O O   . VAL A  1 170 ? 50.59981  34.48382   19.20821  1.000 63.87904  ? 150 VAL H O   1 
ATOM   1184  C CB  . VAL A  1 170 ? 47.47990  34.79686   20.24489  1.000 49.05404  ? 150 VAL H CB  1 
ATOM   1185  C CG1 . VAL A  1 170 ? 48.32934  35.94940   20.74486  1.000 43.94213  ? 150 VAL H CG1 1 
ATOM   1186  C CG2 . VAL A  1 170 ? 46.20106  35.31668   19.62255  1.000 54.65294  ? 150 VAL H CG2 1 
ATOM   1187  N N   . ASP A  1 171 ? 49.99405  32.72783   20.47275  1.000 52.56202  ? 151 ASP H N   1 
ATOM   1188  C CA  . ASP A  1 171 ? 51.37700  32.43478   20.83481  1.000 55.34901  ? 151 ASP H CA  1 
ATOM   1189  C C   . ASP A  1 171 ? 52.18036  32.02157   19.60650  1.000 53.03916  ? 151 ASP H C   1 
ATOM   1190  O O   . ASP A  1 171 ? 53.36746  32.34640   19.49046  1.000 55.27437  ? 151 ASP H O   1 
ATOM   1191  C CB  . ASP A  1 171 ? 51.43452  31.33767   21.90440  1.000 54.63350  ? 151 ASP H CB  1 
ATOM   1192  C CG  . ASP A  1 171 ? 50.97467  31.82460   23.27190  1.000 55.75058  ? 151 ASP H CG  1 
ATOM   1193  O OD1 . ASP A  1 171 ? 50.69227  33.03391   23.41918  1.000 53.10674  ? 151 ASP H OD1 1 
ATOM   1194  O OD2 . ASP A  1 171 ? 50.89136  30.99060   24.20236  1.000 55.51205  ? 151 ASP H OD2 1 
ATOM   1195  N N   . SER A  1 172 ? 51.54902  31.31655   18.67559  1.000 57.92534  ? 152 SER H N   1 
ATOM   1196  C CA  . SER A  1 172 ? 52.19482  30.96570   17.42097  1.000 53.67014  ? 152 SER H CA  1 
ATOM   1197  C C   . SER A  1 172 ? 52.34544  32.13422   16.44765  1.000 50.86695  ? 152 SER H C   1 
ATOM   1198  O O   . SER A  1 172 ? 53.13258  32.02647   15.50414  1.000 53.63128  ? 152 SER H O   1 
ATOM   1199  C CB  . SER A  1 172 ? 51.40469  29.84316   16.74059  1.000 51.76481  ? 152 SER H CB  1 
ATOM   1200  O OG  . SER A  1 172 ? 51.47659  29.97461   15.33686  1.000 72.24582  ? 152 SER H OG  1 
ATOM   1201  N N   . GLY A  1 173 ? 51.60314  33.22415   16.62573  1.000 54.30054  ? 153 GLY H N   1 
ATOM   1202  C CA  . GLY A  1 173 ? 51.54191  34.23660   15.58574  1.000 48.23877  ? 153 GLY H CA  1 
ATOM   1203  C C   . GLY A  1 173 ? 50.92579  33.77322   14.28073  1.000 48.67429  ? 153 GLY H C   1 
ATOM   1204  O O   . GLY A  1 173 ? 51.07691  34.44596   13.25478  1.000 49.77839  ? 153 GLY H O   1 
ATOM   1205  N N   . ALA A  1 174 ? 50.22892  32.63841   14.28726  1.000 46.65887  ? 154 ALA H N   1 
ATOM   1206  C CA  . ALA A  1 174 ? 49.70101  32.07194   13.05344  1.000 48.90571  ? 154 ALA H CA  1 
ATOM   1207  C C   . ALA A  1 174 ? 48.70444  33.01180   12.38745  1.000 55.01475  ? 154 ALA H C   1 
ATOM   1208  O O   . ALA A  1 174 ? 48.11560  33.89564   13.01597  1.000 68.42471  ? 154 ALA H O   1 
ATOM   1209  C CB  . ALA A  1 174 ? 49.00501  30.73620   13.31224  1.000 45.77019  ? 154 ALA H CB  1 
ATOM   1210  N N   . ASP A  1 175 ? 48.50864  32.79630   11.08723  1.000 48.51442  ? 155 ASP H N   1 
ATOM   1211  C CA  . ASP A  1 175 ? 47.36723  33.39452   10.41064  1.000 45.03022  ? 155 ASP H CA  1 
ATOM   1212  C C   . ASP A  1 175 ? 46.11746  32.52564   10.51079  1.000 50.26124  ? 155 ASP H C   1 
ATOM   1213  O O   . ASP A  1 175 ? 45.00622  33.06497   10.51401  1.000 49.79800  ? 155 ASP H O   1 
ATOM   1214  C CB  . ASP A  1 175 ? 47.69609  33.68100   8.94189   1.000 46.14132  ? 155 ASP H CB  1 
ATOM   1215  C CG  . ASP A  1 175 ? 48.98007  34.46255   8.77973   1.000 51.78684  ? 155 ASP H CG  1 
ATOM   1216  O OD1 . ASP A  1 175 ? 50.00566  33.84799   8.42441   1.000 52.88010  ? 155 ASP H OD1 1 
ATOM   1217  O OD2 . ASP A  1 175 ? 48.96749  35.68879   9.03136   1.000 48.27825  ? 155 ASP H OD2 1 
ATOM   1218  N N   . VAL A  1 176 ? 46.25906  31.20307   10.60735  1.000 43.15297  ? 156 VAL H N   1 
ATOM   1219  C CA  . VAL A  1 176 ? 45.13277  30.36733   11.01906  1.000 41.67109  ? 156 VAL H CA  1 
ATOM   1220  C C   . VAL A  1 176 ? 45.65436  29.09558   11.67337  1.000 49.89487  ? 156 VAL H C   1 
ATOM   1221  O O   . VAL A  1 176 ? 46.58704  28.44803   11.18043  1.000 47.25428  ? 156 VAL H O   1 
ATOM   1222  C CB  . VAL A  1 176 ? 44.17441  30.04088   9.85492   1.000 41.17904  ? 156 VAL H CB  1 
ATOM   1223  C CG1 . VAL A  1 176 ? 44.87860  29.25615   8.76243   1.000 50.61481  ? 156 VAL H CG1 1 
ATOM   1224  C CG2 . VAL A  1 176 ? 42.96770  29.27333   10.37920  1.000 46.60109  ? 156 VAL H CG2 1 
ATOM   1225  N N   . THR A  1 177 ? 45.03227  28.75849   12.79719  1.000 46.18657  ? 157 THR H N   1 
ATOM   1226  C CA  . THR A  1 177 ? 45.25443  27.52238   13.52712  1.000 46.58174  ? 157 THR H CA  1 
ATOM   1227  C C   . THR A  1 177 ? 44.16348  26.53434   13.13019  1.000 49.96193  ? 157 THR H C   1 
ATOM   1228  O O   . THR A  1 177 ? 42.99409  26.91532   13.01915  1.000 49.45997  ? 157 THR H O   1 
ATOM   1229  C CB  . THR A  1 177 ? 45.22990  27.80559   15.02898  1.000 39.99911  ? 157 THR H CB  1 
ATOM   1230  O OG1 . THR A  1 177 ? 46.37867  28.58660   15.37346  1.000 41.14597  ? 157 THR H OG1 1 
ATOM   1231  C CG2 . THR A  1 177 ? 45.23216  26.52455   15.83716  1.000 50.48182  ? 157 THR H CG2 1 
ATOM   1232  N N   . ILE A  1 178 ? 44.54013  25.27801   12.89654  1.000 39.79537  ? 158 ILE H N   1 
ATOM   1233  C CA  . ILE A  1 178 ? 43.63157  24.29076   12.32341  1.000 41.40275  ? 158 ILE H CA  1 
ATOM   1234  C C   . ILE A  1 178 ? 43.58810  23.06521   13.22666  1.000 43.95188  ? 158 ILE H C   1 
ATOM   1235  O O   . ILE A  1 178 ? 44.61246  22.40275   13.43009  1.000 47.10971  ? 158 ILE H O   1 
ATOM   1236  C CB  . ILE A  1 178 ? 44.05338  23.89168   10.89854  1.000 48.22591  ? 158 ILE H CB  1 
ATOM   1237  C CG1 . ILE A  1 178 ? 44.11543  25.13024   10.00287  1.000 43.89155  ? 158 ILE H CG1 1 
ATOM   1238  C CG2 . ILE A  1 178 ? 43.10456  22.84011   10.33100  1.000 39.42480  ? 158 ILE H CG2 1 
ATOM   1239  C CD1 . ILE A  1 178 ? 44.59926  24.84627   8.60699   1.000 43.76141  ? 158 ILE H CD1 1 
ATOM   1240  N N   . GLY A  1 179 ? 42.40672  22.75643   13.75357  1.000 42.19463  ? 159 GLY H N   1 
ATOM   1241  C CA  . GLY A  1 179 ? 42.25052  21.55228   14.55402  1.000 46.05320  ? 159 GLY H CA  1 
ATOM   1242  C C   . GLY A  1 179 ? 42.39549  20.30620   13.69572  1.000 37.97954  ? 159 GLY H C   1 
ATOM   1243  O O   . GLY A  1 179 ? 41.75656  20.18020   12.64403  1.000 37.78461  ? 159 GLY H O   1 
ATOM   1244  N N   . CYS A  1 180 ? 43.23321  19.37331   14.14802  1.000 39.80713  ? 160 CYS H N   1 
ATOM   1245  C CA  . CYS A  1 180 ? 43.57112  18.17477   13.39152  1.000 47.81610  ? 160 CYS H CA  1 
ATOM   1246  C C   . CYS A  1 180 ? 43.49134  16.94155   14.27855  1.000 39.38009  ? 160 CYS H C   1 
ATOM   1247  O O   . CYS A  1 180 ? 43.98538  16.94804   15.41031  1.000 41.29199  ? 160 CYS H O   1 
ATOM   1248  C CB  . CYS A  1 180 ? 44.98583  18.26497   12.80320  1.000 50.69492  ? 160 CYS H CB  1 
ATOM   1249  S SG  . CYS A  1 180 ? 45.20443  19.48956   11.49946  1.000 50.97327  ? 160 CYS H SG  1 
ATOM   1250  N N   . LEU A  1 181 ? 42.88121  15.88047   13.75446  1.000 39.28927  ? 161 LEU H N   1 
ATOM   1251  C CA  . LEU A  1 181 ? 42.96333  14.57472   14.39190  1.000 42.74377  ? 161 LEU H CA  1 
ATOM   1252  C C   . LEU A  1 181 ? 44.26997  13.89167   14.01241  1.000 40.91602  ? 161 LEU H C   1 
ATOM   1253  O O   . LEU A  1 181 ? 44.73137  13.99328   12.87403  1.000 41.48401  ? 161 LEU H O   1 
ATOM   1254  C CB  . LEU A  1 181 ? 41.79092  13.68349   13.98186  1.000 41.65679  ? 161 LEU H CB  1 
ATOM   1255  C CG  . LEU A  1 181 ? 40.36795  14.15345   14.26395  1.000 45.24009  ? 161 LEU H CG  1 
ATOM   1256  C CD1 . LEU A  1 181 ? 39.40668  13.37017   13.38754  1.000 37.71151  ? 161 LEU H CD1 1 
ATOM   1257  C CD2 . LEU A  1 181 ? 40.02082  13.98791   15.74012  1.000 37.39869  ? 161 LEU H CD2 1 
ATOM   1258  N N   . GLU A  1 182 ? 44.86457  13.19178   14.97652  1.000 48.48307  ? 162 GLU H N   1 
ATOM   1259  C CA  . GLU A  1 182 ? 46.04528  12.36417   14.73654  1.000 44.02366  ? 162 GLU H CA  1 
ATOM   1260  C C   . GLU A  1 182 ? 45.56065  10.94434   14.46512  1.000 49.17229  ? 162 GLU H C   1 
ATOM   1261  O O   . GLU A  1 182 ? 45.16523  10.22205   15.38483  1.000 43.26850  ? 162 GLU H O   1 
ATOM   1262  C CB  . GLU A  1 182 ? 46.99464  12.42255   15.92751  1.000 45.46066  ? 162 GLU H CB  1 
ATOM   1263  C CG  . GLU A  1 182 ? 48.37230  11.81750   15.67651  1.000 51.08410  ? 162 GLU H CG  1 
ATOM   1264  C CD  . GLU A  1 182 ? 49.42514  12.38262   16.61177  1.000 56.13090  ? 162 GLU H CD  1 
ATOM   1265  O OE1 . GLU A  1 182 ? 49.29782  13.56044   17.00822  1.000 64.07340  ? 162 GLU H OE1 1 
ATOM   1266  O OE2 . GLU A  1 182 ? 50.36784  11.64623   16.96837  1.000 60.58731  ? 162 GLU H OE2 1 
ATOM   1267  N N   . VAL A  1 183 ? 45.59261  10.53652   13.20116  1.000 46.43541  ? 163 VAL H N   1 
ATOM   1268  C CA  . VAL A  1 183 ? 44.94097  9.30762    12.76215  1.000 45.25493  ? 163 VAL H CA  1 
ATOM   1269  C C   . VAL A  1 183 ? 45.94351  8.45331    11.98876  1.000 51.71966  ? 163 VAL H C   1 
ATOM   1270  O O   . VAL A  1 183 ? 46.82459  9.00139    11.30517  1.000 55.11630  ? 163 VAL H O   1 
ATOM   1271  C CB  . VAL A  1 183 ? 43.69523  9.63527    11.92054  1.000 54.01352  ? 163 VAL H CB  1 
ATOM   1272  C CG1 . VAL A  1 183 ? 44.09133  10.05616   10.51433  1.000 62.56221  ? 163 VAL H CG1 1 
ATOM   1273  C CG2 . VAL A  1 183 ? 42.73634  8.47244    11.89625  1.000 55.70687  ? 163 VAL H CG2 1 
ATOM   1274  N N   . PRO A  1 184 ? 45.90586  7.12630    12.12006  1.000 51.89751  ? 164 PRO H N   1 
ATOM   1275  C CA  . PRO A  1 184 ? 46.70296  6.27934    11.22785  1.000 46.44937  ? 164 PRO H CA  1 
ATOM   1276  C C   . PRO A  1 184 ? 46.43824  6.60799    9.76359   1.000 46.40767  ? 164 PRO H C   1 
ATOM   1277  O O   . PRO A  1 184 ? 45.33143  6.98763    9.37845   1.000 49.23146  ? 164 PRO H O   1 
ATOM   1278  C CB  . PRO A  1 184 ? 46.24196  4.86149    11.58306  1.000 51.02875  ? 164 PRO H CB  1 
ATOM   1279  C CG  . PRO A  1 184 ? 45.86916  4.95438    13.02285  1.000 50.85549  ? 164 PRO H CG  1 
ATOM   1280  C CD  . PRO A  1 184 ? 45.39629  6.37506    13.28098  1.000 51.22413  ? 164 PRO H CD  1 
ATOM   1281  N N   . ARG A  1 185 ? 47.47648  6.43507    8.94371   1.000 47.44388  ? 165 ARG H N   1 
ATOM   1282  C CA  . ARG A  1 185 ? 47.49187  7.04936    7.61907   1.000 47.53366  ? 165 ARG H CA  1 
ATOM   1283  C C   . ARG A  1 185 ? 46.38042  6.52486    6.71913   1.000 48.91022  ? 165 ARG H C   1 
ATOM   1284  O O   . ARG A  1 185 ? 45.72625  7.30827    6.02323   1.000 55.15660  ? 165 ARG H O   1 
ATOM   1285  C CB  . ARG A  1 185 ? 48.85574  6.84270    6.96914   1.000 51.37405  ? 165 ARG H CB  1 
ATOM   1286  C CG  . ARG A  1 185 ? 49.91613  7.69085    7.61060   1.000 55.52280  ? 165 ARG H CG  1 
ATOM   1287  C CD  . ARG A  1 185 ? 51.23816  7.58586    6.90283   1.000 58.09175  ? 165 ARG H CD  1 
ATOM   1288  N NE  . ARG A  1 185 ? 51.16259  7.16137    5.51431   1.000 56.40860  ? 165 ARG H NE  1 
ATOM   1289  C CZ  . ARG A  1 185 ? 52.15265  7.34376    4.65018   1.000 63.36655  ? 165 ARG H CZ  1 
ATOM   1290  N NH1 . ARG A  1 185 ? 53.27450  7.93665    5.04451   1.000 66.81561  ? 165 ARG H NH1 1 
ATOM   1291  N NH2 . ARG A  1 185 ? 52.02742  6.93557    3.40052   1.000 64.29090  ? 165 ARG H NH2 1 
ATOM   1292  N N   . MET A  1 186 ? 46.15185  5.21080    6.70397   1.000 47.74241  ? 166 MET H N   1 
ATOM   1293  C CA  . MET A  1 186 ? 45.14404  4.68037    5.78921   1.000 51.07227  ? 166 MET H CA  1 
ATOM   1294  C C   . MET A  1 186 ? 43.75143  5.23458    6.08820   1.000 54.09744  ? 166 MET H C   1 
ATOM   1295  O O   . MET A  1 186 ? 42.93800  5.39223    5.17049   1.000 59.42145  ? 166 MET H O   1 
ATOM   1296  C CB  . MET A  1 186 ? 45.13372  3.15533    5.84022   1.000 56.97464  ? 166 MET H CB  1 
ATOM   1297  C CG  . MET A  1 186 ? 43.89457  2.51395    5.24177   1.000 62.43159  ? 166 MET H CG  1 
ATOM   1298  S SD  . MET A  1 186 ? 44.26897  0.89184    4.56280   1.000 62.48678  ? 166 MET H SD  1 
ATOM   1299  C CE  . MET A  1 186 ? 44.21248  1.21792    2.80534   1.000 57.17296  ? 166 MET H CE  1 
ATOM   1300  N N   . GLU A  1 187 ? 43.46134  5.55532    7.35131   1.000 46.84796  ? 167 GLU H N   1 
ATOM   1301  C CA  . GLU A  1 187 ? 42.17321  6.16239    7.66883   1.000 53.07037  ? 167 GLU H CA  1 
ATOM   1302  C C   . GLU A  1 187 ? 42.11705  7.64259    7.31851   1.000 58.94277  ? 167 GLU H C   1 
ATOM   1303  O O   . GLU A  1 187 ? 41.01671  8.19230    7.19689   1.000 62.27368  ? 167 GLU H O   1 
ATOM   1304  C CB  . GLU A  1 187 ? 41.83580  5.98304    9.14947   1.000 58.04932  ? 167 GLU H CB  1 
ATOM   1305  C CG  . GLU A  1 187 ? 42.05934  4.57835    9.67993   1.000 75.20903  ? 167 GLU H CG  1 
ATOM   1306  C CD  . GLU A  1 187 ? 42.31696  4.57077    11.17158  1.000 77.59998  ? 167 GLU H CD  1 
ATOM   1307  O OE1 . GLU A  1 187 ? 41.75530  3.71124    11.88173  1.000 73.34674  ? 167 GLU H OE1 1 
ATOM   1308  O OE2 . GLU A  1 187 ? 43.07134  5.44433    11.63436  1.000 75.73995  ? 167 GLU H OE2 1 
ATOM   1309  N N   . ALA A  1 188 ? 43.26519  8.30331    7.15932   1.000 49.30404  ? 168 ALA H N   1 
ATOM   1310  C CA  . ALA A  1 188 ? 43.25133  9.68042    6.68230   1.000 53.73398  ? 168 ALA H CA  1 
ATOM   1311  C C   . ALA A  1 188 ? 42.86810  9.78354    5.21393   1.000 56.95383  ? 168 ALA H C   1 
ATOM   1312  O O   . ALA A  1 188 ? 42.76498  10.90434   4.69828   1.000 54.41358  ? 168 ALA H O   1 
ATOM   1313  C CB  . ALA A  1 188 ? 44.61426  10.33896   6.90884   1.000 44.37046  ? 168 ALA H CB  1 
ATOM   1314  N N   . THR A  1 189 ? 42.64618  8.64778    4.54326   1.000 50.99685  ? 169 THR H N   1 
ATOM   1315  C CA  . THR A  1 189 ? 42.31775  8.63992    3.12252   1.000 46.84448  ? 169 THR H CA  1 
ATOM   1316  C C   . THR A  1 189 ? 41.03756  9.40506    2.81627   1.000 52.54925  ? 169 THR H C   1 
ATOM   1317  O O   . THR A  1 189 ? 40.86905  9.87763    1.68818   1.000 73.98484  ? 169 THR H O   1 
ATOM   1318  C CB  . THR A  1 189 ? 42.20011  7.19351    2.62603   1.000 46.62630  ? 169 THR H CB  1 
ATOM   1319  O OG1 . THR A  1 189 ? 42.48161  7.14104    1.22341   1.000 61.61225  ? 169 THR H OG1 1 
ATOM   1320  C CG2 . THR A  1 189 ? 40.80545  6.63378    2.88237   1.000 45.28318  ? 169 THR H CG2 1 
ATOM   1321  N N   . GLY A  1 190 ? 40.14322  9.54889    3.79074   1.000 43.15402  ? 170 GLY H N   1 
ATOM   1322  C CA  . GLY A  1 190 ? 38.88766  10.23678   3.60195   1.000 43.87669  ? 170 GLY H CA  1 
ATOM   1323  C C   . GLY A  1 190 ? 38.85805  11.68391   4.03926   1.000 41.46102  ? 170 GLY H C   1 
ATOM   1324  O O   . GLY A  1 190 ? 37.83170  12.34407   3.85777   1.000 41.98736  ? 170 GLY H O   1 
ATOM   1325  N N   . PHE A  1 191 ? 39.95061  12.20651   4.58830   1.000 46.50581  ? 171 PHE H N   1 
ATOM   1326  C CA  . PHE A  1 191 ? 39.98139  13.54597   5.15671   1.000 43.26845  ? 171 PHE H CA  1 
ATOM   1327  C C   . PHE A  1 191 ? 40.80082  14.50233   4.30136   1.000 46.01185  ? 171 PHE H C   1 
ATOM   1328  O O   . PHE A  1 191 ? 41.68045  14.10298   3.53190   1.000 43.26108  ? 171 PHE H O   1 
ATOM   1329  C CB  . PHE A  1 191 ? 40.58030  13.54139   6.56686   1.000 51.22281  ? 171 PHE H CB  1 
ATOM   1330  C CG  . PHE A  1 191 ? 39.73590  12.85540   7.59490   1.000 52.07886  ? 171 PHE H CG  1 
ATOM   1331  C CD1 . PHE A  1 191 ? 39.69618  11.47674   7.66641   1.000 40.43753  ? 171 PHE H CD1 1 
ATOM   1332  C CD2 . PHE A  1 191 ? 39.00424  13.59450   8.51253   1.000 51.37581  ? 171 PHE H CD2 1 
ATOM   1333  C CE1 . PHE A  1 191 ? 38.93073  10.84143   8.61974   1.000 44.38463  ? 171 PHE H CE1 1 
ATOM   1334  C CE2 . PHE A  1 191 ? 38.23700  12.96507   9.47030   1.000 43.88360  ? 171 PHE H CE2 1 
ATOM   1335  C CZ  . PHE A  1 191 ? 38.19943  11.58265   9.52061   1.000 45.76457  ? 171 PHE H CZ  1 
ATOM   1336  N N   . GLY A  1 192 ? 40.51358  15.78885   4.46710   1.000 44.18058  ? 172 GLY H N   1 
ATOM   1337  C CA  . GLY A  1 192 ? 41.47371  16.78564   4.05635   1.000 41.65839  ? 172 GLY H CA  1 
ATOM   1338  C C   . GLY A  1 192 ? 42.64681  16.66647   5.00271   1.000 42.14810  ? 172 GLY H C   1 
ATOM   1339  O O   . GLY A  1 192 ? 42.45620  16.69996   6.22177   1.000 41.31994  ? 172 GLY H O   1 
ATOM   1340  N N   . VAL A  1 193 ? 43.85428  16.48954   4.47116   1.000 43.19236  ? 173 VAL H N   1 
ATOM   1341  C CA  . VAL A  1 193 ? 45.01770  16.11981   5.26807   1.000 43.75611  ? 173 VAL H CA  1 
ATOM   1342  C C   . VAL A  1 193 ? 46.05081  17.23178   5.18017   1.000 47.23031  ? 173 VAL H C   1 
ATOM   1343  O O   . VAL A  1 193 ? 46.33810  17.73512   4.08775   1.000 51.93060  ? 173 VAL H O   1 
ATOM   1344  C CB  . VAL A  1 193 ? 45.60171  14.77013   4.80633   1.000 44.66511  ? 173 VAL H CB  1 
ATOM   1345  C CG1 . VAL A  1 193 ? 46.85405  14.41035   5.60000   1.000 45.36543  ? 173 VAL H CG1 1 
ATOM   1346  C CG2 . VAL A  1 193 ? 44.55015  13.69125   4.95919   1.000 44.06548  ? 173 VAL H CG2 1 
ATOM   1347  N N   . MET A  1 194 ? 46.60211  17.61332   6.33105   1.000 50.29163  ? 174 MET H N   1 
ATOM   1348  C CA  . MET A  1 194 ? 47.59747  18.67340   6.42375   1.000 54.45632  ? 174 MET H CA  1 
ATOM   1349  C C   . MET A  1 194 ? 48.98808  18.05247   6.50109   1.000 62.49732  ? 174 MET H C   1 
ATOM   1350  O O   . MET A  1 194 ? 49.28222  17.29870   7.43714   1.000 65.08424  ? 174 MET H O   1 
ATOM   1351  C CB  . MET A  1 194 ? 47.33638  19.55024   7.65052   1.000 56.35417  ? 174 MET H CB  1 
ATOM   1352  C CG  . MET A  1 194 ? 45.94920  20.17940   7.69091   1.000 55.12489  ? 174 MET H CG  1 
ATOM   1353  S SD  . MET A  1 194 ? 45.74448  21.45906   6.43771   1.000 53.08409  ? 174 MET H SD  1 
ATOM   1354  C CE  . MET A  1 194 ? 43.99243  21.79022   6.56709   1.000 51.19923  ? 174 MET H CE  1 
ATOM   1355  N N   . HIS A  1 195 ? 49.83529  18.35605   5.51540   1.000 61.41822  ? 175 HIS H N   1 
ATOM   1356  C CA  . HIS A  1 195 ? 51.23938  17.97404   5.59113   1.000 55.24802  ? 175 HIS H CA  1 
ATOM   1357  C C   . HIS A  1 195 ? 51.97885  19.00195   6.43798   1.000 56.69209  ? 175 HIS H C   1 
ATOM   1358  O O   . HIS A  1 195 ? 51.89142  20.20777   6.19051   1.000 51.51812  ? 175 HIS H O   1 
ATOM   1359  C CB  . HIS A  1 195 ? 51.86856  17.86476   4.19930   1.000 54.02532  ? 175 HIS H CB  1 
ATOM   1360  C CG  . HIS A  1 195 ? 53.28531  17.36215   4.20806   1.000 54.65757  ? 175 HIS H CG  1 
ATOM   1361  N ND1 . HIS A  1 195 ? 53.86296  16.73602   3.12355   1.000 56.47642  ? 175 HIS H ND1 1 
ATOM   1362  C CD2 . HIS A  1 195 ? 54.23862  17.39220   5.17021   1.000 57.56602  ? 175 HIS H CD2 1 
ATOM   1363  C CE1 . HIS A  1 195 ? 55.10572  16.39704   3.42065   1.000 55.77348  ? 175 HIS H CE1 1 
ATOM   1364  N NE2 . HIS A  1 195 ? 55.35905  16.78631   4.65643   1.000 57.84362  ? 175 HIS H NE2 1 
ATOM   1365  N N   . VAL A  1 196 ? 52.71064  18.51254   7.43565   1.000 57.47575  ? 176 VAL H N   1 
ATOM   1366  C CA  . VAL A  1 196 ? 53.26954  19.33471   8.49511   1.000 55.19872  ? 176 VAL H CA  1 
ATOM   1367  C C   . VAL A  1 196 ? 54.77487  19.11947   8.55635   1.000 58.63352  ? 176 VAL H C   1 
ATOM   1368  O O   . VAL A  1 196 ? 55.30637  18.12010   8.06616   1.000 60.46145  ? 176 VAL H O   1 
ATOM   1369  C CB  . VAL A  1 196 ? 52.61035  19.01374   9.84973   1.000 58.30853  ? 176 VAL H CB  1 
ATOM   1370  C CG1 . VAL A  1 196 ? 51.10727  18.91317   9.67816   1.000 56.87992  ? 176 VAL H CG1 1 
ATOM   1371  C CG2 . VAL A  1 196 ? 53.16005  17.71255   10.41229  1.000 52.16726  ? 176 VAL H CG2 1 
ATOM   1372  N N   . ASN A  1 197 ? 55.46442  20.07898   9.15553   1.000 51.62884  ? 177 ASN H N   1 
ATOM   1373  C CA  . ASN A  1 197 ? 56.89053  19.94252   9.38201   1.000 53.11346  ? 177 ASN H CA  1 
ATOM   1374  C C   . ASN A  1 197 ? 57.12937  19.52608   10.83273  1.000 61.00881  ? 177 ASN H C   1 
ATOM   1375  O O   . ASN A  1 197 ? 56.22244  19.02333   11.50433  1.000 68.94372  ? 177 ASN H O   1 
ATOM   1376  C CB  . ASN A  1 197 ? 57.60716  21.24488   9.01135   1.000 55.91297  ? 177 ASN H CB  1 
ATOM   1377  C CG  . ASN A  1 197 ? 57.01460  22.45767   9.70198   1.000 66.03807  ? 177 ASN H CG  1 
ATOM   1378  O OD1 . ASN A  1 197 ? 56.75240  22.44469   10.90862  1.000 67.36483  ? 177 ASN H OD1 1 
ATOM   1379  N ND2 . ASN A  1 197 ? 56.80461  23.51920   8.93644   1.000 66.13972  ? 177 ASN H ND2 1 
ATOM   1380  N N   . GLU A  1 198 ? 58.34659  19.75055   11.32995  1.000 58.53447  ? 178 GLU H N   1 
ATOM   1381  C CA  . GLU A  1 198 ? 58.71249  19.23314   12.64298  1.000 58.20617  ? 178 GLU H CA  1 
ATOM   1382  C C   . GLU A  1 198 ? 58.03266  19.99559   13.77358  1.000 53.47286  ? 178 GLU H C   1 
ATOM   1383  O O   . GLU A  1 198 ? 57.80119  19.42771   14.84605  1.000 55.86496  ? 178 GLU H O   1 
ATOM   1384  C CB  . GLU A  1 198 ? 60.23254  19.26474   12.80619  1.000 60.24746  ? 178 GLU H CB  1 
ATOM   1385  C CG  . GLU A  1 198 ? 60.93667  17.98479   12.34770  1.000 66.39407  ? 178 GLU H CG  1 
ATOM   1386  C CD  . GLU A  1 198 ? 61.14936  17.91552   10.83898  1.000 71.66558  ? 178 GLU H CD  1 
ATOM   1387  O OE1 . GLU A  1 198 ? 62.24548  17.48979   10.41587  1.000 72.38995  ? 178 GLU H OE1 1 
ATOM   1388  O OE2 . GLU A  1 198 ? 60.22604  18.27187   10.07445  1.000 74.34706  ? 178 GLU H OE2 1 
ATOM   1389  N N   . LYS A  1 199 ? 57.70252  21.26924   13.56251  1.000 55.92849  ? 179 LYS H N   1 
ATOM   1390  C CA  . LYS A  1 199 ? 57.06107  22.08860   14.58511  1.000 59.41340  ? 179 LYS H CA  1 
ATOM   1391  C C   . LYS A  1 199 ? 55.59901  22.37961   14.24845  1.000 55.28911  ? 179 LYS H C   1 
ATOM   1392  O O   . LYS A  1 199 ? 55.06059  23.42713   14.61853  1.000 52.14846  ? 179 LYS H O   1 
ATOM   1393  C CB  . LYS A  1 199 ? 57.84653  23.38098   14.79683  1.000 61.37627  ? 179 LYS H CB  1 
ATOM   1394  C CG  . LYS A  1 199 ? 59.22485  23.16541   15.42844  1.000 64.17354  ? 179 LYS H CG  1 
ATOM   1395  C CD  . LYS A  1 199 ? 59.12440  22.51939   16.80997  1.000 68.56807  ? 179 LYS H CD  1 
ATOM   1396  C CE  . LYS A  1 199 ? 60.50425  22.23519   17.39758  1.000 72.67345  ? 179 LYS H CE  1 
ATOM   1397  N NZ  . LYS A  1 199 ? 60.48041  21.09949   18.36510  1.000 78.26300  ? 179 LYS H NZ  1 
ATOM   1398  N N   . ASP A  1 200 ? 54.96039  21.45838   13.52519  1.000 50.28939  ? 180 ASP H N   1 
ATOM   1399  C CA  . ASP A  1 200 ? 53.51977  21.43660   13.27232  1.000 50.04232  ? 180 ASP H CA  1 
ATOM   1400  C C   . ASP A  1 200 ? 53.03268  22.61878   12.43462  1.000 56.77727  ? 180 ASP H C   1 
ATOM   1401  O O   . ASP A  1 200 ? 51.82724  22.88387   12.37503  1.000 53.41885  ? 180 ASP H O   1 
ATOM   1402  C CB  . ASP A  1 200 ? 52.72617  21.34942   14.58263  1.000 47.43173  ? 180 ASP H CB  1 
ATOM   1403  C CG  . ASP A  1 200 ? 52.38205  19.91342   14.95693  1.000 60.16999  ? 180 ASP H CG  1 
ATOM   1404  O OD1 . ASP A  1 200 ? 52.36873  19.05592   14.04669  1.000 62.83901  ? 180 ASP H OD1 1 
ATOM   1405  O OD2 . ASP A  1 200 ? 52.10917  19.63987   16.14740  1.000 59.86888  ? 180 ASP H OD2 1 
ATOM   1406  N N   . GLU A  1 201 ? 53.93231  23.33643   11.76907  1.000 56.24395  ? 181 GLU H N   1 
ATOM   1407  C CA  . GLU A  1 201 ? 53.50648  24.27762   10.74404  1.000 52.91800  ? 181 GLU H CA  1 
ATOM   1408  C C   . GLU A  1 201 ? 53.14191  23.50966   9.47767   1.000 49.29416  ? 181 GLU H C   1 
ATOM   1409  O O   . GLU A  1 201 ? 53.82823  22.55953   9.08660   1.000 50.05870  ? 181 GLU H O   1 
ATOM   1410  C CB  . GLU A  1 201 ? 54.60006  25.30856   10.45503  1.000 50.83283  ? 181 GLU H CB  1 
ATOM   1411  C CG  . GLU A  1 201 ? 55.49573  25.63162   11.64460  1.000 61.59372  ? 181 GLU H CG  1 
ATOM   1412  C CD  . GLU A  1 201 ? 56.64433  26.56400   11.28310  1.000 69.01443  ? 181 GLU H CD  1 
ATOM   1413  O OE1 . GLU A  1 201 ? 57.18145  27.22602   12.19778  1.000 66.12494  ? 181 GLU H OE1 1 
ATOM   1414  O OE2 . GLU A  1 201 ? 57.01550  26.62919   10.08844  1.000 71.96759  ? 181 GLU H OE2 1 
ATOM   1415  N N   . ILE A  1 202 ? 52.04752  23.91728   8.84747   1.000 48.40821  ? 182 ILE H N   1 
ATOM   1416  C CA  . ILE A  1 202 ? 51.48942  23.20036   7.70834   1.000 48.19039  ? 182 ILE H CA  1 
ATOM   1417  C C   . ILE A  1 202 ? 52.20934  23.65052   6.44731   1.000 52.09987  ? 182 ILE H C   1 
ATOM   1418  O O   . ILE A  1 202 ? 52.22492  24.84315   6.12312   1.000 49.82437  ? 182 ILE H O   1 
ATOM   1419  C CB  . ILE A  1 202 ? 49.97696  23.43543   7.59467   1.000 48.70797  ? 182 ILE H CB  1 
ATOM   1420  C CG1 . ILE A  1 202 ? 49.27152  22.93740   8.85661   1.000 45.53810  ? 182 ILE H CG1 1 
ATOM   1421  C CG2 . ILE A  1 202 ? 49.42234  22.74815   6.35685   1.000 53.74474  ? 182 ILE H CG2 1 
ATOM   1422  C CD1 . ILE A  1 202 ? 48.02785  23.71941   9.20551   1.000 51.46816  ? 182 ILE H CD1 1 
ATOM   1423  N N   . ILE A  1 203 ? 52.80549  22.69309   5.73133   1.000 54.23889  ? 183 ILE H N   1 
ATOM   1424  C CA  . ILE A  1 203 ? 53.51016  22.99313   4.48861   1.000 51.61098  ? 183 ILE H CA  1 
ATOM   1425  C C   . ILE A  1 203 ? 52.70564  22.62607   3.24975   1.000 51.34652  ? 183 ILE H C   1 
ATOM   1426  O O   . ILE A  1 203 ? 53.09562  23.01632   2.13681   1.000 52.37093  ? 183 ILE H O   1 
ATOM   1427  C CB  . ILE A  1 203 ? 54.88830  22.29710   4.44487   1.000 58.57139  ? 183 ILE H CB  1 
ATOM   1428  C CG1 . ILE A  1 203 ? 54.76766  20.88277   3.87119   1.000 56.58477  ? 183 ILE H CG1 1 
ATOM   1429  C CG2 . ILE A  1 203 ? 55.51144  22.26556   5.83302   1.000 61.22050  ? 183 ILE H CG2 1 
ATOM   1430  C CD1 . ILE A  1 203 ? 56.09277  20.29325   3.44768   1.000 54.45598  ? 183 ILE H CD1 1 
ATOM   1431  N N   . ASP A  1 204 ? 51.59912  21.90380   3.40060   1.000 54.89212  ? 184 ASP H N   1 
ATOM   1432  C CA  . ASP A  1 204 ? 50.77866  21.50755   2.26426   1.000 60.64374  ? 184 ASP H CA  1 
ATOM   1433  C C   . ASP A  1 204 ? 49.48455  20.90293   2.78638   1.000 59.70122  ? 184 ASP H C   1 
ATOM   1434  O O   . ASP A  1 204 ? 49.40493  20.45622   3.93466   1.000 62.75012  ? 184 ASP H O   1 
ATOM   1435  C CB  . ASP A  1 204 ? 51.51099  20.51148   1.35625   1.000 56.50392  ? 184 ASP H CB  1 
ATOM   1436  C CG  . ASP A  1 204 ? 50.82385  20.32770   0.01665   1.000 66.61076  ? 184 ASP H CG  1 
ATOM   1437  O OD1 . ASP A  1 204 ? 50.14467  21.27167   -0.43932  1.000 70.90167  ? 184 ASP H OD1 1 
ATOM   1438  O OD2 . ASP A  1 204 ? 50.96020  19.23800   -0.57955  1.000 76.20306  ? 184 ASP H OD2 1 
ATOM   1439  N N   . PHE A  1 205 ? 48.47180  20.89437   1.92154   1.000 52.20461  ? 185 PHE H N   1 
ATOM   1440  C CA  . PHE A  1 205 ? 47.17534  20.31458   2.23687   1.000 53.89095  ? 185 PHE H CA  1 
ATOM   1441  C C   . PHE A  1 205 ? 46.65517  19.56430   1.01997   1.000 49.90324  ? 185 PHE H C   1 
ATOM   1442  O O   . PHE A  1 205 ? 46.71807  20.07476   -0.10271  1.000 50.67729  ? 185 PHE H O   1 
ATOM   1443  C CB  . PHE A  1 205 ? 46.17173  21.39177   2.66042   1.000 58.87650  ? 185 PHE H CB  1 
ATOM   1444  C CG  . PHE A  1 205 ? 44.74892  20.97265   2.49178   1.000 57.73575  ? 185 PHE H CG  1 
ATOM   1445  C CD1 . PHE A  1 205 ? 44.19381  20.02646   3.33278   1.000 49.05544  ? 185 PHE H CD1 1 
ATOM   1446  C CD2 . PHE A  1 205 ? 43.97371  21.49850   1.47500   1.000 61.74965  ? 185 PHE H CD2 1 
ATOM   1447  C CE1 . PHE A  1 205 ? 42.89113  19.63275   3.17800   1.000 44.55279  ? 185 PHE H CE1 1 
ATOM   1448  C CE2 . PHE A  1 205 ? 42.66362  21.09531   1.31098   1.000 63.18685  ? 185 PHE H CE2 1 
ATOM   1449  C CZ  . PHE A  1 205 ? 42.12253  20.16121   2.16489   1.000 47.06175  ? 185 PHE H CZ  1 
ATOM   1450  N N   . ILE A  1 206 ? 46.14208  18.35791   1.24410   1.000 46.42424  ? 186 ILE H N   1 
ATOM   1451  C CA  . ILE A  1 206 ? 45.66491  17.49338   0.17304   1.000 47.05891  ? 186 ILE H CA  1 
ATOM   1452  C C   . ILE A  1 206 ? 44.24116  17.07086   0.50242   1.000 45.53892  ? 186 ILE H C   1 
ATOM   1453  O O   . ILE A  1 206 ? 43.94475  16.70788   1.64663   1.000 46.06654  ? 186 ILE H O   1 
ATOM   1454  C CB  . ILE A  1 206 ? 46.57079  16.25932   -0.02863  1.000 53.63100  ? 186 ILE H CB  1 
ATOM   1455  C CG1 . ILE A  1 206 ? 48.03515  16.67609   -0.20146  1.000 55.30680  ? 186 ILE H CG1 1 
ATOM   1456  C CG2 . ILE A  1 206 ? 46.13607  15.46874   -1.25516  1.000 48.18399  ? 186 ILE H CG2 1 
ATOM   1457  C CD1 . ILE A  1 206 ? 48.81655  16.77439   1.09256   1.000 59.25117  ? 186 ILE H CD1 1 
ATOM   1458  N N   . GLU A  1 207 ? 43.35924  17.13976   -0.49141  1.000 45.51684  ? 187 GLU H N   1 
ATOM   1459  C CA  . GLU A  1 207 ? 41.97534  16.70730   -0.33655  1.000 53.21449  ? 187 GLU H CA  1 
ATOM   1460  C C   . GLU A  1 207 ? 41.90812  15.21115   -0.61567  1.000 59.08070  ? 187 GLU H C   1 
ATOM   1461  O O   . GLU A  1 207 ? 42.06177  14.78001   -1.76384  1.000 45.84261  ? 187 GLU H O   1 
ATOM   1462  C CB  . GLU A  1 207 ? 41.05344  17.48253   -1.27326  1.000 54.62648  ? 187 GLU H CB  1 
ATOM   1463  C CG  . GLU A  1 207 ? 39.59251  17.06701   -1.18613  1.000 57.03122  ? 187 GLU H CG  1 
ATOM   1464  C CD  . GLU A  1 207 ? 38.95097  17.46174   0.13152   1.000 66.25383  ? 187 GLU H CD  1 
ATOM   1465  O OE1 . GLU A  1 207 ? 39.42202  18.43972   0.75274   1.000 69.33785  ? 187 GLU H OE1 1 
ATOM   1466  O OE2 . GLU A  1 207 ? 37.97599  16.79668   0.54563   1.000 65.04319  ? 187 GLU H OE2 1 
ATOM   1467  N N   . LYS A  1 208 ? 41.68122  14.42389   0.43541   1.000 44.29683  ? 188 LYS H N   1 
ATOM   1468  C CA  . LYS A  1 208 ? 41.59749  12.97182   0.34025   1.000 51.99321  ? 188 LYS H CA  1 
ATOM   1469  C C   . LYS A  1 208 ? 42.80571  12.39415   -0.38850  1.000 49.29516  ? 188 LYS H C   1 
ATOM   1470  O O   . LYS A  1 208 ? 42.66231  11.86456   -1.49806  1.000 46.72995  ? 188 LYS H O   1 
ATOM   1471  C CB  . LYS A  1 208 ? 40.30816  12.55568   -0.36991  1.000 54.84759  ? 188 LYS H CB  1 
ATOM   1472  C CG  . LYS A  1 208 ? 39.04808  13.22850   0.15029   1.000 55.13743  ? 188 LYS H CG  1 
ATOM   1473  C CD  . LYS A  1 208 ? 37.80816  12.57292   -0.43614  1.000 54.24761  ? 188 LYS H CD  1 
ATOM   1474  C CE  . LYS A  1 208 ? 36.67399  13.56631   -0.58717  1.000 54.44288  ? 188 LYS H CE  1 
ATOM   1475  N NZ  . LYS A  1 208 ? 36.24597  14.12668   0.72596   1.000 60.64250  ? 188 LYS H NZ  1 
ATOM   1476  N N   . PRO A  1 209 ? 44.00626  12.48428   0.18265   1.000 51.71271  ? 189 PRO H N   1 
ATOM   1477  C CA  . PRO A  1 209 ? 45.18209  11.91421   -0.48954  1.000 47.73428  ? 189 PRO H CA  1 
ATOM   1478  C C   . PRO A  1 209 ? 45.08731  10.39842   -0.55538  1.000 56.78584  ? 189 PRO H C   1 
ATOM   1479  O O   . PRO A  1 209 ? 44.70949  9.74251    0.41990   1.000 47.55434  ? 189 PRO H O   1 
ATOM   1480  C CB  . PRO A  1 209 ? 46.35134  12.36998   0.39232   1.000 47.94082  ? 189 PRO H CB  1 
ATOM   1481  C CG  . PRO A  1 209 ? 45.73153  12.59523   1.73580   1.000 52.67897  ? 189 PRO H CG  1 
ATOM   1482  C CD  . PRO A  1 209 ? 44.36312  13.13529   1.45531   1.000 51.55334  ? 189 PRO H CD  1 
ATOM   1483  N N   . ALA A  1 210 ? 45.42525  9.84350    -1.72297  1.000 49.19467  ? 190 ALA H N   1 
ATOM   1484  C CA  . ALA A  1 210 ? 45.45123  8.38853    -1.85352  1.000 51.51252  ? 190 ALA H CA  1 
ATOM   1485  C C   . ALA A  1 210 ? 46.43263  7.78106    -0.86995  1.000 59.86031  ? 190 ALA H C   1 
ATOM   1486  O O   . ALA A  1 210 ? 46.18327  6.70334    -0.31397  1.000 71.22467  ? 190 ALA H O   1 
ATOM   1487  C CB  . ALA A  1 210 ? 45.79748  7.98933    -3.28809  1.000 53.25784  ? 190 ALA H CB  1 
ATOM   1488  N N   . ASP A  1 211 ? 47.55557  8.45816    -0.62922  1.000 61.84879  ? 191 ASP H N   1 
ATOM   1489  C CA  . ASP A  1 211 ? 48.51133  8.05683    0.40905   1.000 61.01222  ? 191 ASP H CA  1 
ATOM   1490  C C   . ASP A  1 211 ? 48.88128  9.28534    1.22632   1.000 51.69566  ? 191 ASP H C   1 
ATOM   1491  O O   . ASP A  1 211 ? 49.75941  10.06335   0.81717   1.000 50.82533  ? 191 ASP H O   1 
ATOM   1492  C CB  . ASP A  1 211 ? 49.75408  7.39020    -0.17920  1.000 59.16635  ? 191 ASP H CB  1 
ATOM   1493  C CG  . ASP A  1 211 ? 50.68894  6.89581    0.89612   1.000 61.57800  ? 191 ASP H CG  1 
ATOM   1494  O OD1 . ASP A  1 211 ? 50.15879  6.35055    1.88517   1.000 73.31848  ? 191 ASP H OD1 1 
ATOM   1495  O OD2 . ASP A  1 211 ? 51.92615  6.99875    0.75590   1.000 59.86913  ? 191 ASP H OD2 1 
ATOM   1496  N N   . PRO A  1 212 ? 48.27630  9.45963    2.39400   1.000 49.14124  ? 192 PRO H N   1 
ATOM   1497  C CA  . PRO A  1 212 ? 48.39570  10.71890   3.12688   1.000 54.46028  ? 192 PRO H CA  1 
ATOM   1498  C C   . PRO A  1 212 ? 49.81512  10.96982   3.59807   1.000 58.17726  ? 192 PRO H C   1 
ATOM   1499  O O   . PRO A  1 212 ? 50.50942  10.04255   4.04013   1.000 49.99486  ? 192 PRO H O   1 
ATOM   1500  C CB  . PRO A  1 212 ? 47.44413  10.52540   4.31760   1.000 56.06712  ? 192 PRO H CB  1 
ATOM   1501  C CG  . PRO A  1 212 ? 46.48789  9.46862    3.87811   1.000 47.93355  ? 192 PRO H CG  1 
ATOM   1502  C CD  . PRO A  1 212 ? 47.28951  8.55550    3.00242   1.000 49.40107  ? 192 PRO H CD  1 
ATOM   1503  N N   . PRO A  1 213 ? 50.27467  12.21930   3.52239   1.000 49.46654  ? 193 PRO H N   1 
ATOM   1504  C CA  . PRO A  1 213 ? 51.58328  12.56887   4.09019   1.000 50.26016  ? 193 PRO H CA  1 
ATOM   1505  C C   . PRO A  1 213 ? 51.62151  12.28299   5.58275   1.000 50.53453  ? 193 PRO H C   1 
ATOM   1506  O O   . PRO A  1 213 ? 50.74556  12.70911   6.33909   1.000 53.23338  ? 193 PRO H O   1 
ATOM   1507  C CB  . PRO A  1 213 ? 51.70534  14.07138   3.80578   1.000 63.85270  ? 193 PRO H CB  1 
ATOM   1508  C CG  . PRO A  1 213 ? 50.71395  14.34970   2.73094   1.000 61.64414  ? 193 PRO H CG  1 
ATOM   1509  C CD  . PRO A  1 213 ? 49.59751  13.37841   2.92131   1.000 48.94303  ? 193 PRO H CD  1 
ATOM   1510  N N   . GLY A  1 214 ? 52.64192  11.55124   6.00305   1.000 50.69459  ? 194 GLY H N   1 
ATOM   1511  C CA  . GLY A  1 214 ? 52.76629  11.21647   7.40005   1.000 55.31022  ? 194 GLY H CA  1 
ATOM   1512  C C   . GLY A  1 214 ? 53.34024  12.35537   8.21031   1.000 50.47242  ? 194 GLY H C   1 
ATOM   1513  O O   . GLY A  1 214 ? 53.93589  13.28865   7.68114   1.000 50.99908  ? 194 GLY H O   1 
ATOM   1514  N N   . ILE A  1 215 ? 53.14008  12.27685   9.51745   1.000 49.96580  ? 195 ILE H N   1 
ATOM   1515  C CA  . ILE A  1 215 ? 53.75243  13.26297   10.41392  1.000 50.12675  ? 195 ILE H CA  1 
ATOM   1516  C C   . ILE A  1 215 ? 55.24906  12.99557   10.48952  1.000 51.63267  ? 195 ILE H C   1 
ATOM   1517  O O   . ILE A  1 215 ? 55.65587  11.82449   10.59369  1.000 52.26310  ? 195 ILE H O   1 
ATOM   1518  C CB  . ILE A  1 215 ? 53.10962  13.19315   11.80094  1.000 55.19317  ? 195 ILE H CB  1 
ATOM   1519  C CG1 . ILE A  1 215 ? 51.59916  13.42436   11.71612  1.000 47.77922  ? 195 ILE H CG1 1 
ATOM   1520  C CG2 . ILE A  1 215 ? 53.74766  14.20621   12.74472  1.000 51.88785  ? 195 ILE H CG2 1 
ATOM   1521  C CD1 . ILE A  1 215 ? 50.90759  13.27926   13.04740  1.000 46.93142  ? 195 ILE H CD1 1 
ATOM   1522  N N   . PRO A  1 216 ? 56.10084  14.01775   10.42152  1.000 57.50984  ? 196 PRO H N   1 
ATOM   1523  C CA  . PRO A  1 216 ? 57.54209  13.78132   10.57361  1.000 58.00017  ? 196 PRO H CA  1 
ATOM   1524  C C   . PRO A  1 216 ? 57.85089  13.16808   11.93187  1.000 54.03638  ? 196 PRO H C   1 
ATOM   1525  O O   . PRO A  1 216 ? 57.40632  13.65976   12.97023  1.000 53.33734  ? 196 PRO H O   1 
ATOM   1526  C CB  . PRO A  1 216 ? 58.14692  15.18348   10.43429  1.000 59.46079  ? 196 PRO H CB  1 
ATOM   1527  C CG  . PRO A  1 216 ? 57.12558  15.96347   9.66730   1.000 54.88269  ? 196 PRO H CG  1 
ATOM   1528  C CD  . PRO A  1 216 ? 55.80168  15.42614   10.10958  1.000 51.90659  ? 196 PRO H CD  1 
ATOM   1529  N N   . GLY A  1 217 ? 58.60671  12.07098   11.91828  1.000 61.86563  ? 197 GLY H N   1 
ATOM   1530  C CA  . GLY A  1 217 ? 59.03225  11.40549   13.12602  1.000 64.56002  ? 197 GLY H CA  1 
ATOM   1531  C C   . GLY A  1 217 ? 58.18156  10.21694   13.53728  1.000 56.51862  ? 197 GLY H C   1 
ATOM   1532  O O   . GLY A  1 217 ? 58.69455  9.30859    14.19635  1.000 68.80331  ? 197 GLY H O   1 
ATOM   1533  N N   . ASN A  1 218 ? 56.88406  10.21649   13.19865  1.000 54.43603  ? 198 ASN H N   1 
ATOM   1534  C CA  . ASN A  1 218 ? 56.01998  9.03513    13.33859  1.000 59.66112  ? 198 ASN H CA  1 
ATOM   1535  C C   . ASN A  1 218 ? 55.20798  8.92844    12.04723  1.000 58.34381  ? 198 ASN H C   1 
ATOM   1536  O O   . ASN A  1 218 ? 54.03821  9.31616    11.98520  1.000 52.50700  ? 198 ASN H O   1 
ATOM   1537  C CB  . ASN A  1 218 ? 55.12417  9.09238    14.58920  1.000 57.50319  ? 198 ASN H CB  1 
ATOM   1538  C CG  . ASN A  1 218 ? 54.38637  10.40256   14.72476  1.000 66.97949  ? 198 ASN H CG  1 
ATOM   1539  O OD1 . ASN A  1 218 ? 54.53884  11.30148   13.89902  1.000 71.65275  ? 198 ASN H OD1 1 
ATOM   1540  N ND2 . ASN A  1 218 ? 53.57138  10.51789   15.77030  1.000 66.55659  ? 198 ASN H ND2 1 
ATOM   1541  N N   . GLU A  1 219 ? 55.84427  8.37215    11.01636  1.000 60.78423  ? 199 GLU H N   1 
ATOM   1542  C CA  . GLU A  1 219 ? 55.27141  8.28801    9.67819   1.000 60.50019  ? 199 GLU H CA  1 
ATOM   1543  C C   . GLU A  1 219 ? 54.05187  7.38155    9.63103   1.000 55.67598  ? 199 GLU H C   1 
ATOM   1544  O O   . GLU A  1 219 ? 53.48849  7.16759    8.55790   1.000 52.06021  ? 199 GLU H O   1 
ATOM   1545  C CB  . GLU A  1 219 ? 56.32405  7.78816    8.68038   1.000 62.77486  ? 199 GLU H CB  1 
ATOM   1546  C CG  . GLU A  1 219 ? 56.17489  8.34684    7.27282   1.000 60.99032  ? 199 GLU H CG  1 
ATOM   1547  C CD  . GLU A  1 219 ? 56.45706  9.83200    7.20398   1.000 62.52837  ? 199 GLU H CD  1 
ATOM   1548  O OE1 . GLU A  1 219 ? 55.74895  10.54267   6.45538   1.000 58.87127  ? 199 GLU H OE1 1 
ATOM   1549  O OE2 . GLU A  1 219 ? 57.39139  10.28628   7.89845   1.000 66.93208  ? 199 GLU H OE2 1 
ATOM   1550  N N   . GLY A  1 220 ? 53.65058  6.82158    10.76636  1.000 51.91874  ? 200 GLY H N   1 
ATOM   1551  C CA  . GLY A  1 220 ? 52.46262  6.00187    10.77812  1.000 51.22670  ? 200 GLY H CA  1 
ATOM   1552  C C   . GLY A  1 220 ? 51.16787  6.75266    10.93617  1.000 52.92150  ? 200 GLY H C   1 
ATOM   1553  O O   . GLY A  1 220 ? 50.09763  6.14535    10.85085  1.000 49.18845  ? 200 GLY H O   1 
ATOM   1554  N N   . PHE A  1 221 ? 51.22974  8.06338    11.15665  1.000 49.24511  ? 201 PHE H N   1 
ATOM   1555  C CA  . PHE A  1 221 ? 50.05147  8.85978    11.45433  1.000 52.38379  ? 201 PHE H CA  1 
ATOM   1556  C C   . PHE A  1 221 ? 50.01295  10.09333   10.56762  1.000 47.57373  ? 201 PHE H C   1 
ATOM   1557  O O   . PHE A  1 221 ? 51.04991  10.61003   10.14305  1.000 48.38793  ? 201 PHE H O   1 
ATOM   1558  C CB  . PHE A  1 221 ? 50.03019  9.27565    12.92636  1.000 54.79900  ? 201 PHE H CB  1 
ATOM   1559  C CG  . PHE A  1 221 ? 49.87093  8.12385    13.87233  1.000 53.63032  ? 201 PHE H CG  1 
ATOM   1560  C CD1 . PHE A  1 221 ? 50.98031  7.54013    14.46600  1.000 58.53892  ? 201 PHE H CD1 1 
ATOM   1561  C CD2 . PHE A  1 221 ? 48.61179  7.62767    14.17210  1.000 46.83126  ? 201 PHE H CD2 1 
ATOM   1562  C CE1 . PHE A  1 221 ? 50.83643  6.47470    15.33751  1.000 66.96817  ? 201 PHE H CE1 1 
ATOM   1563  C CE2 . PHE A  1 221 ? 48.45816  6.56743    15.04366  1.000 55.70409  ? 201 PHE H CE2 1 
ATOM   1564  C CZ  . PHE A  1 221 ? 49.57198  5.98734    15.62790  1.000 65.18295  ? 201 PHE H CZ  1 
ATOM   1565  N N   . ALA A  1 222 ? 48.79764  10.55626   10.29398  1.000 46.46381  ? 202 ALA H N   1 
ATOM   1566  C CA  . ALA A  1 222 ? 48.57024  11.75193   9.50112   1.000 49.94747  ? 202 ALA H CA  1 
ATOM   1567  C C   . ALA A  1 222 ? 47.64690  12.69103   10.26382  1.000 50.50065  ? 202 ALA H C   1 
ATOM   1568  O O   . ALA A  1 222 ? 46.82561  12.25492   11.07509  1.000 56.10987  ? 202 ALA H O   1 
ATOM   1569  C CB  . ALA A  1 222 ? 47.96797  11.41133   8.13007   1.000 46.10644  ? 202 ALA H CB  1 
ATOM   1570  N N   . LEU A  1 223 ? 47.79726  13.98787   10.00518  1.000 44.69866  ? 203 LEU H N   1 
ATOM   1571  C CA  . LEU A  1 223 ? 46.95989  15.00612   10.62676  1.000 43.58278  ? 203 LEU H CA  1 
ATOM   1572  C C   . LEU A  1 223 ? 45.75451  15.26045   9.72775   1.000 46.22421  ? 203 LEU H C   1 
ATOM   1573  O O   . LEU A  1 223 ? 45.87633  15.89532   8.67565   1.000 53.87774  ? 203 LEU H O   1 
ATOM   1574  C CB  . LEU A  1 223 ? 47.75498  16.28432   10.87845  1.000 46.03627  ? 203 LEU H CB  1 
ATOM   1575  C CG  . LEU A  1 223 ? 48.77867  16.19255   12.01257  1.000 44.55826  ? 203 LEU H CG  1 
ATOM   1576  C CD1 . LEU A  1 223 ? 49.36896  17.55768   12.31250  1.000 46.43053  ? 203 LEU H CD1 1 
ATOM   1577  C CD2 . LEU A  1 223 ? 48.14494  15.61259   13.25699  1.000 43.83855  ? 203 LEU H CD2 1 
ATOM   1578  N N   . ALA A  1 224 ? 44.59402  14.75684   10.14035  1.000 41.88320  ? 204 ALA H N   1 
ATOM   1579  C CA  . ALA A  1 224 ? 43.36251  14.88772   9.37381   1.000 41.16171  ? 204 ALA H CA  1 
ATOM   1580  C C   . ALA A  1 224 ? 42.58511  16.10455   9.85993   1.000 41.30910  ? 204 ALA H C   1 
ATOM   1581  O O   . ALA A  1 224 ? 42.42498  16.30104   11.06896  1.000 39.55100  ? 204 ALA H O   1 
ATOM   1582  C CB  . ALA A  1 224 ? 42.51275  13.62273   9.50852   1.000 40.86733  ? 204 ALA H CB  1 
ATOM   1583  N N   . SER A  1 225 ? 42.09250  16.91030   8.91980   1.000 39.90030  ? 205 SER H N   1 
ATOM   1584  C CA  . SER A  1 225 ? 41.47633  18.18563   9.26823   1.000 39.05904  ? 205 SER H CA  1 
ATOM   1585  C C   . SER A  1 225 ? 40.09304  17.98458   9.87634   1.000 39.90157  ? 205 SER H C   1 
ATOM   1586  O O   . SER A  1 225 ? 39.26049  17.25251   9.33267   1.000 37.66629  ? 205 SER H O   1 
ATOM   1587  C CB  . SER A  1 225 ? 41.37781  19.09225   8.04175   1.000 39.32875  ? 205 SER H CB  1 
ATOM   1588  O OG  . SER A  1 225 ? 40.94480  20.39003   8.41620   1.000 38.67485  ? 205 SER H OG  1 
ATOM   1589  N N   . MET A  1 226 ? 39.84977  18.65623   10.99912  1.000 49.00867  ? 206 MET H N   1 
ATOM   1590  C CA  . MET A  1 226 ? 38.55942  18.65075   11.67255  1.000 44.87315  ? 206 MET H CA  1 
ATOM   1591  C C   . MET A  1 226 ? 37.61498  19.72612   11.15395  1.000 41.74470  ? 206 MET H C   1 
ATOM   1592  O O   . MET A  1 226 ? 36.46623  19.79549   11.60536  1.000 34.36035  ? 206 MET H O   1 
ATOM   1593  C CB  . MET A  1 226 ? 38.75653  18.84046   13.17766  1.000 42.54823  ? 206 MET H CB  1 
ATOM   1594  C CG  . MET A  1 226 ? 39.72558  17.86507   13.78993  1.000 44.73138  ? 206 MET H CG  1 
ATOM   1595  S SD  . MET A  1 226 ? 39.47843  17.73048   15.55956  1.000 58.49227  ? 206 MET H SD  1 
ATOM   1596  C CE  . MET A  1 226 ? 40.02221  19.33655   16.10778  1.000 62.72652  ? 206 MET H CE  1 
ATOM   1597  N N   . GLY A  1 227 ? 38.06010  20.55976   10.22024  1.000 43.36102  ? 207 GLY H N   1 
ATOM   1598  C CA  . GLY A  1 227 ? 37.24137  21.68719   9.81528   1.000 44.40975  ? 207 GLY H CA  1 
ATOM   1599  C C   . GLY A  1 227 ? 37.01211  22.67927   10.93000  1.000 39.90902  ? 207 GLY H C   1 
ATOM   1600  O O   . GLY A  1 227 ? 35.92635  23.26128   11.02079  1.000 36.56856  ? 207 GLY H O   1 
ATOM   1601  N N   . ILE A  1 228 ? 38.00570  22.86152   11.80030  1.000 36.19447  ? 208 ILE H N   1 
ATOM   1602  C CA  . ILE A  1 228 ? 37.96496  23.80305   12.91422  1.000 34.34656  ? 208 ILE H CA  1 
ATOM   1603  C C   . ILE A  1 228 ? 39.09692  24.79778   12.70619  1.000 41.13212  ? 208 ILE H C   1 
ATOM   1604  O O   . ILE A  1 228 ? 40.26673  24.40322   12.62669  1.000 36.20310  ? 208 ILE H O   1 
ATOM   1605  C CB  . ILE A  1 228 ? 38.10724  23.09663   14.27329  1.000 34.07730  ? 208 ILE H CB  1 
ATOM   1606  C CG1 . ILE A  1 228 ? 36.84415  22.30673   14.61934  1.000 34.30893  ? 208 ILE H CG1 1 
ATOM   1607  C CG2 . ILE A  1 228 ? 38.40827  24.09807   15.37383  1.000 33.88052  ? 208 ILE H CG2 1 
ATOM   1608  C CD1 . ILE A  1 228 ? 36.99701  21.46663   15.86612  1.000 33.05868  ? 208 ILE H CD1 1 
ATOM   1609  N N   . TYR A  1 229 ? 38.75768  26.08267   12.63019  1.000 37.30575  ? 209 TYR H N   1 
ATOM   1610  C CA  . TYR A  1 229 ? 39.73579  27.11124   12.31088  1.000 37.85606  ? 209 TYR H CA  1 
ATOM   1611  C C   . TYR A  1 229 ? 39.63688  28.26604   13.29284  1.000 44.01979  ? 209 TYR H C   1 
ATOM   1612  O O   . TYR A  1 229 ? 38.53921  28.66384   13.69811  1.000 37.79327  ? 209 TYR H O   1 
ATOM   1613  C CB  . TYR A  1 229 ? 39.54237  27.63901   10.89189  1.000 36.33511  ? 209 TYR H CB  1 
ATOM   1614  C CG  . TYR A  1 229 ? 39.22195  26.57617   9.86873   1.000 45.49984  ? 209 TYR H CG  1 
ATOM   1615  C CD1 . TYR A  1 229 ? 40.17404  25.63512   9.48707   1.000 40.38181  ? 209 TYR H CD1 1 
ATOM   1616  C CD2 . TYR A  1 229 ? 37.96525  26.51246   9.28286   1.000 42.46476  ? 209 TYR H CD2 1 
ATOM   1617  C CE1 . TYR A  1 229 ? 39.87903  24.66373   8.54559   1.000 40.77342  ? 209 TYR H CE1 1 
ATOM   1618  C CE2 . TYR A  1 229 ? 37.66108  25.54317   8.34900   1.000 38.56746  ? 209 TYR H CE2 1 
ATOM   1619  C CZ  . TYR A  1 229 ? 38.62030  24.62526   7.98163   1.000 43.48777  ? 209 TYR H CZ  1 
ATOM   1620  O OH  . TYR A  1 229 ? 38.31028  23.66813   7.04721   1.000 48.41356  ? 209 TYR H OH  1 
ATOM   1621  N N   . VAL A  1 230 ? 40.79370  28.81005   13.65627  1.000 47.47686  ? 210 VAL H N   1 
ATOM   1622  C CA  . VAL A  1 230 ? 40.88619  29.98552   14.50950  1.000 43.95312  ? 210 VAL H CA  1 
ATOM   1623  C C   . VAL A  1 230 ? 41.64425  31.05424   13.73655  1.000 52.03065  ? 210 VAL H C   1 
ATOM   1624  O O   . VAL A  1 230 ? 42.79803  30.84277   13.34184  1.000 55.32797  ? 210 VAL H O   1 
ATOM   1625  C CB  . VAL A  1 230 ? 41.57744  29.67248   15.84592  1.000 42.38208  ? 210 VAL H CB  1 
ATOM   1626  C CG1 . VAL A  1 230 ? 41.83797  30.94815   16.62196  1.000 36.69123  ? 210 VAL H CG1 1 
ATOM   1627  C CG2 . VAL A  1 230 ? 40.73028  28.71532   16.66747  1.000 46.87491  ? 210 VAL H CG2 1 
ATOM   1628  N N   . PHE A  1 231 ? 40.99057  32.18741   13.50310  1.000 51.44335  ? 211 PHE H N   1 
ATOM   1629  C CA  . PHE A  1 231 ? 41.61272  33.35237   12.89893  1.000 38.22390  ? 211 PHE H CA  1 
ATOM   1630  C C   . PHE A  1 231 ? 41.54241  34.52328   13.86561  1.000 38.08207  ? 211 PHE H C   1 
ATOM   1631  O O   . PHE A  1 231 ? 40.70902  34.55536   14.77594  1.000 44.12565  ? 211 PHE H O   1 
ATOM   1632  C CB  . PHE A  1 231 ? 40.91710  33.78082   11.59879  1.000 38.23836  ? 211 PHE H CB  1 
ATOM   1633  C CG  . PHE A  1 231 ? 40.73246  32.68464   10.59328  1.000 41.22678  ? 211 PHE H CG  1 
ATOM   1634  C CD1 . PHE A  1 231 ? 39.69161  31.77982   10.71442  1.000 40.23969  ? 211 PHE H CD1 1 
ATOM   1635  C CD2 . PHE A  1 231 ? 41.56876  32.59293   9.49329   1.000 39.51953  ? 211 PHE H CD2 1 
ATOM   1636  C CE1 . PHE A  1 231 ? 39.50924  30.78721   9.77468   1.000 40.35699  ? 211 PHE H CE1 1 
ATOM   1637  C CE2 . PHE A  1 231 ? 41.38601  31.60732   8.54521   1.000 39.59487  ? 211 PHE H CE2 1 
ATOM   1638  C CZ  . PHE A  1 231 ? 40.35995  30.69459   8.69076   1.000 38.43770  ? 211 PHE H CZ  1 
ATOM   1639  N N   . HIS A  1 232 ? 42.42106  35.49632   13.65136  1.000 40.93922  ? 212 HIS H N   1 
ATOM   1640  C CA  . HIS A  1 232 ? 42.11095  36.85247   14.07300  1.000 39.29161  ? 212 HIS H CA  1 
ATOM   1641  C C   . HIS A  1 232 ? 40.97446  37.36711   13.20652  1.000 38.70709  ? 212 HIS H C   1 
ATOM   1642  O O   . HIS A  1 232 ? 40.96915  37.16624   11.98845  1.000 41.48069  ? 212 HIS H O   1 
ATOM   1643  C CB  . HIS A  1 232 ? 43.32817  37.76323   13.94721  1.000 42.46577  ? 212 HIS H CB  1 
ATOM   1644  C CG  . HIS A  1 232 ? 44.42370  37.43644   14.90959  1.000 44.37162  ? 212 HIS H CG  1 
ATOM   1645  N ND1 . HIS A  1 232 ? 44.63962  38.15691   16.06477  1.000 47.94339  ? 212 HIS H ND1 1 
ATOM   1646  C CD2 . HIS A  1 232 ? 45.37091  36.47174   14.88466  1.000 42.25075  ? 212 HIS H CD2 1 
ATOM   1647  C CE1 . HIS A  1 232 ? 45.66663  37.64084   16.71596  1.000 44.43573  ? 212 HIS H CE1 1 
ATOM   1648  N NE2 . HIS A  1 232 ? 46.13020  36.61937   16.01955  1.000 48.12922  ? 212 HIS H NE2 1 
ATOM   1649  N N   . THR A  1 233 ? 39.98461  37.99692   13.84094  1.000 37.69911  ? 213 THR H N   1 
ATOM   1650  C CA  . THR A  1 233 ? 38.79871  38.39747   13.09493  1.000 40.31140  ? 213 THR H CA  1 
ATOM   1651  C C   . THR A  1 233 ? 39.16364  39.31994   11.93784  1.000 38.78787  ? 213 THR H C   1 
ATOM   1652  O O   . THR A  1 233 ? 38.64659  39.16132   10.82823  1.000 43.98601  ? 213 THR H O   1 
ATOM   1653  C CB  . THR A  1 233 ? 37.77904  39.05975   14.02300  1.000 42.51462  ? 213 THR H CB  1 
ATOM   1654  O OG1 . THR A  1 233 ? 37.59782  38.25323   15.19428  1.000 35.35195  ? 213 THR H OG1 1 
ATOM   1655  C CG2 . THR A  1 233 ? 36.43756  39.20441   13.31701  1.000 35.06497  ? 213 THR H CG2 1 
ATOM   1656  N N   . LYS A  1 234 ? 40.08939  40.25536   12.15786  1.000 39.49239  ? 214 LYS H N   1 
ATOM   1657  C CA  . LYS A  1 234 ? 40.42554  41.20338   11.09848  1.000 50.19069  ? 214 LYS H CA  1 
ATOM   1658  C C   . LYS A  1 234 ? 41.06313  40.50312   9.90147   1.000 48.26957  ? 214 LYS H C   1 
ATOM   1659  O O   . LYS A  1 234 ? 40.75792  40.83033   8.74794   1.000 47.12565  ? 214 LYS H O   1 
ATOM   1660  C CB  . LYS A  1 234 ? 41.34072  42.30280   11.64163  1.000 47.46495  ? 214 LYS H CB  1 
ATOM   1661  C CG  . LYS A  1 234 ? 42.42154  41.81635   12.59994  1.000 66.07764  ? 214 LYS H CG  1 
ATOM   1662  C CD  . LYS A  1 234 ? 43.72664  41.48234   11.87593  1.000 69.90315  ? 214 LYS H CD  1 
ATOM   1663  C CE  . LYS A  1 234 ? 44.71718  40.78774   12.80238  1.000 62.37121  ? 214 LYS H CE  1 
ATOM   1664  N NZ  . LYS A  1 234 ? 45.85826  40.17981   12.05951  1.000 62.34167  ? 214 LYS H NZ  1 
ATOM   1665  N N   . PHE A  1 235 ? 41.94428  39.53399   10.14865  1.000 47.71217  ? 215 PHE H N   1 
ATOM   1666  C CA  . PHE A  1 235 ? 42.57313  38.82680   9.03798   1.000 43.82000  ? 215 PHE H CA  1 
ATOM   1667  C C   . PHE A  1 235 ? 41.56965  37.94047   8.31210   1.000 45.40006  ? 215 PHE H C   1 
ATOM   1668  O O   . PHE A  1 235 ? 41.61784  37.82033   7.08129   1.000 57.11215  ? 215 PHE H O   1 
ATOM   1669  C CB  . PHE A  1 235 ? 43.76256  38.00836   9.54148   1.000 43.50029  ? 215 PHE H CB  1 
ATOM   1670  C CG  . PHE A  1 235 ? 44.39352  37.13114   8.49090   1.000 45.33896  ? 215 PHE H CG  1 
ATOM   1671  C CD1 . PHE A  1 235 ? 43.87820  35.87054   8.20810   1.000 49.19047  ? 215 PHE H CD1 1 
ATOM   1672  C CD2 . PHE A  1 235 ? 45.50524  37.56530   7.78861   1.000 46.03878  ? 215 PHE H CD2 1 
ATOM   1673  C CE1 . PHE A  1 235 ? 44.45448  35.06799   7.24436   1.000 44.21777  ? 215 PHE H CE1 1 
ATOM   1674  C CE2 . PHE A  1 235 ? 46.08916  36.76316   6.82366   1.000 49.02851  ? 215 PHE H CE2 1 
ATOM   1675  C CZ  . PHE A  1 235 ? 45.55973  35.51118   6.55172   1.000 48.99323  ? 215 PHE H CZ  1 
ATOM   1676  N N   . LEU A  1 236 ? 40.65976  37.30660   9.05407   1.000 40.42417  ? 216 LEU H N   1 
ATOM   1677  C CA  . LEU A  1 236 ? 39.65909  36.46274   8.41508   1.000 44.10929  ? 216 LEU H CA  1 
ATOM   1678  C C   . LEU A  1 236 ? 38.75869  37.27718   7.49413   1.000 45.48891  ? 216 LEU H C   1 
ATOM   1679  O O   . LEU A  1 236 ? 38.50265  36.86740   6.35591   1.000 40.73508  ? 216 LEU H O   1 
ATOM   1680  C CB  . LEU A  1 236 ? 38.82207  35.72965   9.46097   1.000 40.17209  ? 216 LEU H CB  1 
ATOM   1681  C CG  . LEU A  1 236 ? 37.65224  34.92286   8.88122   1.000 40.59197  ? 216 LEU H CG  1 
ATOM   1682  C CD1 . LEU A  1 236 ? 38.13790  33.94814   7.81086   1.000 37.78068  ? 216 LEU H CD1 1 
ATOM   1683  C CD2 . LEU A  1 236 ? 36.87622  34.19179   9.96656   1.000 35.60564  ? 216 LEU H CD2 1 
ATOM   1684  N N   . MET A  1 237 ? 38.27155  38.44032   7.95503   1.000 46.10132  ? 217 MET H N   1 
ATOM   1685  C CA  . MET A  1 237 ? 37.33819  39.18885   7.11551   1.000 48.44895  ? 217 MET H CA  1 
ATOM   1686  C C   . MET A  1 237 ? 38.03384  39.68907   5.85568   1.000 43.37031  ? 217 MET H C   1 
ATOM   1687  O O   . MET A  1 237 ? 37.41906  39.73396   4.78505   1.000 48.00873  ? 217 MET H O   1 
ATOM   1688  C CB  . MET A  1 237 ? 36.68147  40.34719   7.88398   1.000 58.73587  ? 217 MET H CB  1 
ATOM   1689  C CG  . MET A  1 237 ? 36.20551  40.00259   9.33705   1.000 61.10548  ? 217 MET H CG  1 
ATOM   1690  S SD  . MET A  1 237 ? 35.69281  38.29459   9.78940   1.000 82.01991  ? 217 MET H SD  1 
ATOM   1691  C CE  . MET A  1 237 ? 33.94452  38.11009   9.60063   1.000 77.36297  ? 217 MET H CE  1 
ATOM   1692  N N   . GLU A  1 238 ? 39.32741  40.02127   5.94394   1.000 45.56437  ? 218 GLU H N   1 
ATOM   1693  C CA  . GLU A  1 238 ? 40.08692  40.31502   4.72983   1.000 52.43078  ? 218 GLU H CA  1 
ATOM   1694  C C   . GLU A  1 238 ? 40.15434  39.09201   3.82057   1.000 53.66591  ? 218 GLU H C   1 
ATOM   1695  O O   . GLU A  1 238 ? 39.83062  39.16468   2.62646   1.000 46.43123  ? 218 GLU H O   1 
ATOM   1696  C CB  . GLU A  1 238 ? 41.49665  40.79057   5.08044   1.000 53.52383  ? 218 GLU H CB  1 
ATOM   1697  N N   . ALA A  1 239 ? 40.57381  37.95249   4.37827   1.000 51.51977  ? 219 ALA H N   1 
ATOM   1698  C CA  . ALA A  1 239 ? 40.67644  36.73102   3.58911   1.000 45.05626  ? 219 ALA H CA  1 
ATOM   1699  C C   . ALA A  1 239 ? 39.33690  36.35533   2.97029   1.000 51.30295  ? 219 ALA H C   1 
ATOM   1700  O O   . ALA A  1 239 ? 39.28870  35.83828   1.85026   1.000 58.40592  ? 219 ALA H O   1 
ATOM   1701  C CB  . ALA A  1 239 ? 41.21404  35.58950   4.45460   1.000 44.82048  ? 219 ALA H CB  1 
ATOM   1702  N N   . LEU A  1 240 ? 38.23473  36.61520   3.67462   1.000 51.96435  ? 220 LEU H N   1 
ATOM   1703  C CA  . LEU A  1 240 ? 36.92109  36.33566   3.09355   1.000 44.91091  ? 220 LEU H CA  1 
ATOM   1704  C C   . LEU A  1 240 ? 36.61566  37.25789   1.91761   1.000 51.63095  ? 220 LEU H C   1 
ATOM   1705  O O   . LEU A  1 240 ? 36.01079  36.82406   0.92780   1.000 43.61201  ? 220 LEU H O   1 
ATOM   1706  C CB  . LEU A  1 240 ? 35.84049  36.44552   4.16017   1.000 39.04817  ? 220 LEU H CB  1 
ATOM   1707  C CG  . LEU A  1 240 ? 35.86379  35.33092   5.20309   1.000 40.95653  ? 220 LEU H CG  1 
ATOM   1708  C CD1 . LEU A  1 240 ? 34.90413  35.65636   6.33588   1.000 36.57365  ? 220 LEU H CD1 1 
ATOM   1709  C CD2 . LEU A  1 240 ? 35.54017  33.97149   4.54555   1.000 38.48988  ? 220 LEU H CD2 1 
ATOM   1710  N N   . ARG A  1 241 ? 37.02018  38.53444   2.01351   1.000 47.04948  ? 221 ARG H N   1 
ATOM   1711  C CA  . ARG A  1 241 ? 36.72975  39.49337   0.95574   1.000 43.48625  ? 221 ARG H CA  1 
ATOM   1712  C C   . ARG A  1 241 ? 37.59526  39.25194   -0.27645  1.000 47.15407  ? 221 ARG H C   1 
ATOM   1713  O O   . ARG A  1 241 ? 37.12412  39.38459   -1.40862  1.000 55.74758  ? 221 ARG H O   1 
ATOM   1714  C CB  . ARG A  1 241 ? 36.88124  40.92544   1.44250   1.000 57.94863  ? 221 ARG H CB  1 
ATOM   1715  C CG  . ARG A  1 241 ? 35.52796  41.47729   1.81606   1.000 59.90747  ? 221 ARG H CG  1 
ATOM   1716  C CD  . ARG A  1 241 ? 35.52810  42.82787   2.53021   1.000 55.03850  ? 221 ARG H CD  1 
ATOM   1717  N NE  . ARG A  1 241 ? 36.30313  42.81257   3.75012   1.000 60.26098  ? 221 ARG H NE  1 
ATOM   1718  C CZ  . ARG A  1 241 ? 35.81793  43.11920   4.93965   1.000 64.20974  ? 221 ARG H CZ  1 
ATOM   1719  N NH1 . ARG A  1 241 ? 34.56006  43.51864   5.05079   1.000 51.26361  ? 221 ARG H NH1 1 
ATOM   1720  N NH2 . ARG A  1 241 ? 36.63115  43.06318   5.98985   1.000 67.69807  ? 221 ARG H NH2 1 
ATOM   1721  N N   . ARG A  1 242 ? 38.86994  38.91247   -0.07856  1.000 45.84672  ? 222 ARG H N   1 
ATOM   1722  C CA  . ARG A  1 242 ? 39.69378  38.48133   -1.20478  1.000 51.60609  ? 222 ARG H CA  1 
ATOM   1723  C C   . ARG A  1 242 ? 39.08763  37.25057   -1.85702  1.000 57.93318  ? 222 ARG H C   1 
ATOM   1724  O O   . ARG A  1 242 ? 39.01201  37.16479   -3.08786  1.000 60.11565  ? 222 ARG H O   1 
ATOM   1725  C CB  . ARG A  1 242 ? 41.13080  38.18561   -0.74602  1.000 59.56257  ? 222 ARG H CB  1 
ATOM   1726  C CG  . ARG A  1 242 ? 41.87280  37.24167   -1.70781  1.000 68.98730  ? 222 ARG H CG  1 
ATOM   1727  C CD  . ARG A  1 242 ? 42.94239  36.40473   -1.02951  1.000 76.54458  ? 222 ARG H CD  1 
ATOM   1728  N NE  . ARG A  1 242 ? 43.69261  37.20561   -0.06834  1.000 82.39671  ? 222 ARG H NE  1 
ATOM   1729  C CZ  . ARG A  1 242 ? 43.92692  36.84945   1.19128   1.000 81.12911  ? 222 ARG H CZ  1 
ATOM   1730  N NH1 . ARG A  1 242 ? 44.61530  37.65382   1.98967   1.000 81.35615  ? 222 ARG H NH1 1 
ATOM   1731  N NH2 . ARG A  1 242 ? 43.47278  35.69234   1.65476   1.000 75.59871  ? 222 ARG H NH2 1 
ATOM   1732  N N   . ASP A  1 243 ? 38.63726  36.29409   -1.03953  1.000 59.38924  ? 223 ASP H N   1 
ATOM   1733  C CA  . ASP A  1 243 ? 37.99379  35.09280   -1.56107  1.000 54.16935  ? 223 ASP H CA  1 
ATOM   1734  C C   . ASP A  1 243 ? 36.74166  35.43294   -2.35763  1.000 52.05602  ? 223 ASP H C   1 
ATOM   1735  O O   . ASP A  1 243 ? 36.48902  34.83180   -3.40756  1.000 54.44971  ? 223 ASP H O   1 
ATOM   1736  C CB  . ASP A  1 243 ? 37.65865  34.14404   -0.41125  1.000 58.15198  ? 223 ASP H CB  1 
ATOM   1737  C CG  . ASP A  1 243 ? 37.06346  32.82509   -0.88666  1.000 60.57492  ? 223 ASP H CG  1 
ATOM   1738  O OD1 . ASP A  1 243 ? 35.82295  32.74051   -1.03738  1.000 58.44480  ? 223 ASP H OD1 1 
ATOM   1739  O OD2 . ASP A  1 243 ? 37.84389  31.87498   -1.11866  1.000 55.41491  ? 223 ASP H OD2 1 
ATOM   1740  N N   . ALA A  1 244 ? 35.94456  36.39450   -1.87985  1.000 43.94072  ? 224 ALA H N   1 
ATOM   1741  C CA  . ALA A  1 244 ? 34.70176  36.73133   -2.56499  1.000 43.78617  ? 224 ALA H CA  1 
ATOM   1742  C C   . ALA A  1 244 ? 34.93971  37.40146   -3.90992  1.000 46.85903  ? 224 ALA H C   1 
ATOM   1743  O O   . ALA A  1 244 ? 34.06027  37.34678   -4.77770  1.000 50.21085  ? 224 ALA H O   1 
ATOM   1744  C CB  . ALA A  1 244 ? 33.83901  37.63037   -1.68468  1.000 43.39020  ? 224 ALA H CB  1 
ATOM   1745  N N   . ALA A  1 245 ? 36.09926  38.02984   -4.10047  1.000 58.80447  ? 225 ALA H N   1 
ATOM   1746  C CA  . ALA A  1 245 ? 36.43768  38.67179   -5.36477  1.000 55.68531  ? 225 ALA H CA  1 
ATOM   1747  C C   . ALA A  1 245 ? 37.17724  37.73773   -6.30989  1.000 58.00253  ? 225 ALA H C   1 
ATOM   1748  O O   . ALA A  1 245 ? 37.43804  38.11753   -7.45660  1.000 62.40209  ? 225 ALA H O   1 
ATOM   1749  C CB  . ALA A  1 245 ? 37.28204  39.92444   -5.13092  1.000 50.27953  ? 225 ALA H CB  1 
ATOM   1750  N N   . ASP A  1 246 ? 37.46302  36.52256   -5.87202  1.000 63.61103  ? 226 ASP H N   1 
ATOM   1751  C CA  . ASP A  1 246 ? 38.23288  35.59744   -6.67428  1.000 58.11012  ? 226 ASP H CA  1 
ATOM   1752  C C   . ASP A  1 246 ? 37.28168  34.63745   -7.36739  1.000 54.79779  ? 226 ASP H C   1 
ATOM   1753  O O   . ASP A  1 246 ? 36.50146  33.94665   -6.69315  1.000 53.17997  ? 226 ASP H O   1 
ATOM   1754  C CB  . ASP A  1 246 ? 39.23109  34.83592   -5.80506  1.000 57.22989  ? 226 ASP H CB  1 
ATOM   1755  C CG  . ASP A  1 246 ? 40.02281  33.78522   -6.58803  1.000 64.21884  ? 226 ASP H CG  1 
ATOM   1756  O OD1 . ASP A  1 246 ? 41.26023  33.70051   -6.41935  1.000 65.93958  ? 226 ASP H OD1 1 
ATOM   1757  O OD2 . ASP A  1 246 ? 39.41828  33.03528   -7.36553  1.000 79.10245  ? 226 ASP H OD2 1 
ATOM   1758  N N   . PRO A  1 247 ? 37.31807  34.55534   -8.70002  1.000 56.32359  ? 227 PRO H N   1 
ATOM   1759  C CA  . PRO A  1 247 ? 36.47599  33.58145   -9.40128  1.000 56.13383  ? 227 PRO H CA  1 
ATOM   1760  C C   . PRO A  1 247 ? 37.04343  32.16530   -9.40704  1.000 61.11074  ? 227 PRO H C   1 
ATOM   1761  O O   . PRO A  1 247 ? 36.27198  31.22276   -9.63238  1.000 65.24451  ? 227 PRO H O   1 
ATOM   1762  C CB  . PRO A  1 247 ? 36.38300  34.15194   -10.82845 1.000 63.99280  ? 227 PRO H CB  1 
ATOM   1763  C CG  . PRO A  1 247 ? 37.03947  35.54105   -10.75771 1.000 61.65744  ? 227 PRO H CG  1 
ATOM   1764  C CD  . PRO A  1 247 ? 38.00121  35.46982   -9.62538  1.000 58.38201  ? 227 PRO H CD  1 
ATOM   1765  N N   . THR A  1 248 ? 38.34944  31.97448   -9.15951  1.000 58.36859  ? 228 THR H N   1 
ATOM   1766  C CA  . THR A  1 248 ? 38.90053  30.61960   -9.07100  1.000 64.98707  ? 228 THR H CA  1 
ATOM   1767  C C   . THR A  1 248 ? 38.51744  29.92298   -7.76986  1.000 64.73360  ? 228 THR H C   1 
ATOM   1768  O O   . THR A  1 248 ? 38.76545  28.71995   -7.63435  1.000 68.97725  ? 228 THR H O   1 
ATOM   1769  C CB  . THR A  1 248 ? 40.43822  30.61695   -9.21074  1.000 72.70176  ? 228 THR H CB  1 
ATOM   1770  O OG1 . THR A  1 248 ? 40.86836  29.32699   -9.66166  1.000 76.41507  ? 228 THR H OG1 1 
ATOM   1771  C CG2 . THR A  1 248 ? 41.14394  30.88722   -7.86924  1.000 68.94004  ? 228 THR H CG2 1 
ATOM   1772  N N   . SER A  1 249 ? 37.89812  30.63475   -6.83163  1.000 58.18784  ? 229 SER H N   1 
ATOM   1773  C CA  . SER A  1 249 ? 37.58961  30.08611   -5.51857  1.000 56.29735  ? 229 SER H CA  1 
ATOM   1774  C C   . SER A  1 249 ? 36.17248  29.52397   -5.47840  1.000 57.92331  ? 229 SER H C   1 
ATOM   1775  O O   . SER A  1 249 ? 35.21342  30.20898   -5.85081  1.000 58.68334  ? 229 SER H O   1 
ATOM   1776  C CB  . SER A  1 249 ? 37.76140  31.16044   -4.44491  1.000 54.33804  ? 229 SER H CB  1 
ATOM   1777  O OG  . SER A  1 249 ? 37.62190  30.61539   -3.14791  1.000 55.23649  ? 229 SER H OG  1 
ATOM   1778  N N   . SER A  1 250 ? 36.04840  28.27832   -5.01296  1.000 48.55178  ? 230 SER H N   1 
ATOM   1779  C CA  . SER A  1 250 ? 34.75875  27.64227   -4.77013  1.000 54.71321  ? 230 SER H CA  1 
ATOM   1780  C C   . SER A  1 250 ? 34.12024  28.08417   -3.45772  1.000 56.53608  ? 230 SER H C   1 
ATOM   1781  O O   . SER A  1 250 ? 33.14635  27.46173   -3.01850  1.000 54.06107  ? 230 SER H O   1 
ATOM   1782  C CB  . SER A  1 250 ? 34.90793  26.12022   -4.77973  1.000 53.77179  ? 230 SER H CB  1 
ATOM   1783  O OG  . SER A  1 250 ? 33.63732  25.49621   -4.80727  1.000 64.35004  ? 230 SER H OG  1 
ATOM   1784  N N   . ARG A  1 251 ? 34.65915  29.13051   -2.82615  1.000 59.52028  ? 231 ARG H N   1 
ATOM   1785  C CA  . ARG A  1 251 ? 34.06471  29.75725   -1.64287  1.000 55.43789  ? 231 ARG H CA  1 
ATOM   1786  C C   . ARG A  1 251 ? 33.87564  28.75359   -0.50404  1.000 55.74176  ? 231 ARG H C   1 
ATOM   1787  O O   . ARG A  1 251 ? 32.81656  28.68197   0.12108   1.000 51.23578  ? 231 ARG H O   1 
ATOM   1788  C CB  . ARG A  1 251 ? 32.73972  30.44329   -1.99400  1.000 53.01265  ? 231 ARG H CB  1 
ATOM   1789  C CG  . ARG A  1 251 ? 32.71567  31.14304   -3.35199  1.000 50.16436  ? 231 ARG H CG  1 
ATOM   1790  C CD  . ARG A  1 251 ? 33.52950  32.42901   -3.33400  1.000 56.78961  ? 231 ARG H CD  1 
ATOM   1791  N NE  . ARG A  1 251 ? 33.23937  33.23940   -2.15168  1.000 58.58272  ? 231 ARG H NE  1 
ATOM   1792  C CZ  . ARG A  1 251 ? 32.14800  33.98334   -1.99761  1.000 50.54237  ? 231 ARG H CZ  1 
ATOM   1793  N NH1 . ARG A  1 251 ? 31.23096  34.03662   -2.95590  1.000 49.28301  ? 231 ARG H NH1 1 
ATOM   1794  N NH2 . ARG A  1 251 ? 31.97421  34.67635   -0.88006  1.000 48.19708  ? 231 ARG H NH2 1 
ATOM   1795  N N   . ASP A  1 252 ? 34.92194  27.97654   -0.22719  1.000 53.97391  ? 232 ASP H N   1 
ATOM   1796  C CA  . ASP A  1 252 ? 34.87641  26.98500   0.83767   1.000 51.90484  ? 232 ASP H CA  1 
ATOM   1797  C C   . ASP A  1 252 ? 36.14839  27.07657   1.67069   1.000 48.37867  ? 232 ASP H C   1 
ATOM   1798  O O   . ASP A  1 252 ? 37.24644  27.21800   1.12626   1.000 48.26135  ? 232 ASP H O   1 
ATOM   1799  C CB  . ASP A  1 252 ? 34.69276  25.56770   0.26746   1.000 56.90517  ? 232 ASP H CB  1 
ATOM   1800  C CG  . ASP A  1 252 ? 34.77702  24.49283   1.33419   1.000 57.26675  ? 232 ASP H CG  1 
ATOM   1801  O OD1 . ASP A  1 252 ? 35.87882  23.93996   1.53242   1.000 56.78449  ? 232 ASP H OD1 1 
ATOM   1802  O OD2 . ASP A  1 252 ? 33.74493  24.21342   1.98550   1.000 59.67607  ? 232 ASP H OD2 1 
ATOM   1803  N N   . PHE A  1 253 ? 35.98818  26.99034   2.99514   1.000 41.65783  ? 233 PHE H N   1 
ATOM   1804  C CA  . PHE A  1 253 ? 37.11335  27.18529   3.90871   1.000 40.68012  ? 233 PHE H CA  1 
ATOM   1805  C C   . PHE A  1 253 ? 38.23662  26.18744   3.64677   1.000 44.66711  ? 233 PHE H C   1 
ATOM   1806  O O   . PHE A  1 253 ? 39.40573  26.57002   3.52778   1.000 52.05299  ? 233 PHE H O   1 
ATOM   1807  C CB  . PHE A  1 253 ? 36.63467  27.07163   5.35554   1.000 39.78178  ? 233 PHE H CB  1 
ATOM   1808  C CG  . PHE A  1 253 ? 36.26462  28.38559   5.97378   1.000 43.50558  ? 233 PHE H CG  1 
ATOM   1809  C CD1 . PHE A  1 253 ? 37.23515  29.21875   6.50889   1.000 49.28762  ? 233 PHE H CD1 1 
ATOM   1810  C CD2 . PHE A  1 253 ? 34.94514  28.79394   6.00689   1.000 41.22383  ? 233 PHE H CD2 1 
ATOM   1811  C CE1 . PHE A  1 253 ? 36.88808  30.43254   7.07560   1.000 47.21016  ? 233 PHE H CE1 1 
ATOM   1812  C CE2 . PHE A  1 253 ? 34.59235  30.00124   6.56721   1.000 38.39416  ? 233 PHE H CE2 1 
ATOM   1813  C CZ  . PHE A  1 253 ? 35.56109  30.82281   7.10147   1.000 41.23244  ? 233 PHE H CZ  1 
ATOM   1814  N N   . GLY A  1 254 ? 37.90392  24.89702   3.57066   1.000 49.98144  ? 234 GLY H N   1 
ATOM   1815  C CA  . GLY A  1 254 ? 38.93807  23.88025   3.47633   1.000 44.56193  ? 234 GLY H CA  1 
ATOM   1816  C C   . GLY A  1 254 ? 39.61466  23.81485   2.12316   1.000 44.77697  ? 234 GLY H C   1 
ATOM   1817  O O   . GLY A  1 254 ? 40.78029  23.41666   2.02981   1.000 48.03386  ? 234 GLY H O   1 
ATOM   1818  N N   . LYS A  1 255 ? 38.90474  24.19943   1.06214   1.000 43.39975  ? 235 LYS H N   1 
ATOM   1819  C CA  . LYS A  1 255 ? 39.43367  24.11570   -0.29174  1.000 54.22822  ? 235 LYS H CA  1 
ATOM   1820  C C   . LYS A  1 255 ? 40.03407  25.41954   -0.79900  1.000 61.51231  ? 235 LYS H C   1 
ATOM   1821  O O   . LYS A  1 255 ? 40.79625  25.39127   -1.77127  1.000 57.86622  ? 235 LYS H O   1 
ATOM   1822  C CB  . LYS A  1 255 ? 38.32916  23.67763   -1.26274  1.000 59.76238  ? 235 LYS H CB  1 
ATOM   1823  C CG  . LYS A  1 255 ? 37.97785  22.19929   -1.18109  1.000 64.32480  ? 235 LYS H CG  1 
ATOM   1824  C CD  . LYS A  1 255 ? 36.63515  21.92026   -1.83739  1.000 67.88689  ? 235 LYS H CD  1 
ATOM   1825  C CE  . LYS A  1 255 ? 36.46289  22.70535   -3.14210  1.000 72.13418  ? 235 LYS H CE  1 
ATOM   1826  N NZ  . LYS A  1 255 ? 37.44825  22.33254   -4.20855  1.000 66.90064  ? 235 LYS H NZ  1 
ATOM   1827  N N   . ASP A  1 256 ? 39.71813  26.55442   -0.17689  1.000 56.62547  ? 236 ASP H N   1 
ATOM   1828  C CA  . ASP A  1 256 ? 40.11684  27.83225   -0.75665  1.000 55.89937  ? 236 ASP H CA  1 
ATOM   1829  C C   . ASP A  1 256 ? 40.75966  28.76468   0.26166   1.000 51.01434  ? 236 ASP H C   1 
ATOM   1830  O O   . ASP A  1 256 ? 41.83228  29.31901   0.00342   1.000 48.20721  ? 236 ASP H O   1 
ATOM   1831  C CB  . ASP A  1 256 ? 38.91110  28.51494   -1.40485  1.000 49.81460  ? 236 ASP H CB  1 
ATOM   1832  C CG  . ASP A  1 256 ? 38.21774  27.62986   -2.43501  1.000 53.15410  ? 236 ASP H CG  1 
ATOM   1833  O OD1 . ASP A  1 256 ? 37.29580  26.87250   -2.05789  1.000 49.81427  ? 236 ASP H OD1 1 
ATOM   1834  O OD2 . ASP A  1 256 ? 38.60542  27.68061   -3.62216  1.000 48.57889  ? 236 ASP H OD2 1 
ATOM   1835  N N   . ILE A  1 257 ? 40.11289  28.95254   1.41301   1.000 50.28136  ? 237 ILE H N   1 
ATOM   1836  C CA  . ILE A  1 257 ? 40.65347  29.85452   2.42610   1.000 52.76615  ? 237 ILE H CA  1 
ATOM   1837  C C   . ILE A  1 257 ? 41.97026  29.31427   2.96778   1.000 45.87528  ? 237 ILE H C   1 
ATOM   1838  O O   . ILE A  1 257 ? 43.01965  29.95533   2.84570   1.000 49.99385  ? 237 ILE H O   1 
ATOM   1839  C CB  . ILE A  1 257 ? 39.63257  30.08229   3.55380   1.000 51.58067  ? 237 ILE H CB  1 
ATOM   1840  C CG1 . ILE A  1 257 ? 38.29205  30.51396   2.96492   1.000 49.79382  ? 237 ILE H CG1 1 
ATOM   1841  C CG2 . ILE A  1 257 ? 40.14127  31.14149   4.52050   1.000 44.04224  ? 237 ILE H CG2 1 
ATOM   1842  C CD1 . ILE A  1 257 ? 38.34076  31.86622   2.29902   1.000 47.96163  ? 237 ILE H CD1 1 
ATOM   1843  N N   . ILE A  1 258 ? 41.93399  28.12538   3.57346   1.000 44.93223  ? 238 ILE H N   1 
ATOM   1844  C CA  . ILE A  1 258 ? 43.15567  27.55187   4.14313   1.000 49.78124  ? 238 ILE H CA  1 
ATOM   1845  C C   . ILE A  1 258 ? 44.22389  27.31049   3.08400   1.000 54.24493  ? 238 ILE H C   1 
ATOM   1846  O O   . ILE A  1 258 ? 45.38845  27.67369   3.32231   1.000 55.76631  ? 238 ILE H O   1 
ATOM   1847  C CB  . ILE A  1 258 ? 42.82555  26.27684   4.94539   1.000 44.09644  ? 238 ILE H CB  1 
ATOM   1848  C CG1 . ILE A  1 258 ? 42.42695  26.61757   6.38514   1.000 53.35727  ? 238 ILE H CG1 1 
ATOM   1849  C CG2 . ILE A  1 258 ? 44.03925  25.37256   4.98208   1.000 44.92933  ? 238 ILE H CG2 1 
ATOM   1850  C CD1 . ILE A  1 258 ? 41.10816  27.34782   6.53059   1.000 48.30827  ? 238 ILE H CD1 1 
ATOM   1851  N N   . PRO A  1 259 ? 43.92288  26.71337   1.91930   1.000 55.00483  ? 239 PRO H N   1 
ATOM   1852  C CA  . PRO A  1 259 ? 44.99042  26.50364   0.92524   1.000 54.58658  ? 239 PRO H CA  1 
ATOM   1853  C C   . PRO A  1 259 ? 45.71260  27.77616   0.51790   1.000 50.75617  ? 239 PRO H C   1 
ATOM   1854  O O   . PRO A  1 259 ? 46.92516  27.74194   0.27500   1.000 60.91494  ? 239 PRO H O   1 
ATOM   1855  C CB  . PRO A  1 259 ? 44.23749  25.86278   -0.24625  1.000 53.47186  ? 239 PRO H CB  1 
ATOM   1856  C CG  . PRO A  1 259 ? 43.15609  25.10015   0.42368   1.000 53.19484  ? 239 PRO H CG  1 
ATOM   1857  C CD  . PRO A  1 259 ? 42.68458  26.01925   1.51537   1.000 50.43563  ? 239 PRO H CD  1 
ATOM   1858  N N   . TYR A  1 260 ? 45.00938  28.90469   0.43720   1.000 52.05685  ? 240 TYR H N   1 
ATOM   1859  C CA  . TYR A  1 260 ? 45.69557  30.16921   0.19652   1.000 51.88296  ? 240 TYR H CA  1 
ATOM   1860  C C   . TYR A  1 260 ? 46.68679  30.46825   1.31621   1.000 52.05478  ? 240 TYR H C   1 
ATOM   1861  O O   . TYR A  1 260 ? 47.84829  30.80604   1.06026   1.000 53.61392  ? 240 TYR H O   1 
ATOM   1862  C CB  . TYR A  1 260 ? 44.67742  31.30191   0.05491   1.000 51.50840  ? 240 TYR H CB  1 
ATOM   1863  C CG  . TYR A  1 260 ? 45.26782  32.59738   -0.46280  1.000 59.64657  ? 240 TYR H CG  1 
ATOM   1864  C CD1 . TYR A  1 260 ? 45.59903  33.62803   0.40820   1.000 54.19547  ? 240 TYR H CD1 1 
ATOM   1865  C CD2 . TYR A  1 260 ? 45.48846  32.79255   -1.82371  1.000 64.39044  ? 240 TYR H CD2 1 
ATOM   1866  C CE1 . TYR A  1 260 ? 46.14025  34.81174   -0.05812  1.000 60.25981  ? 240 TYR H CE1 1 
ATOM   1867  C CE2 . TYR A  1 260 ? 46.02642  33.97882   -2.30112  1.000 59.78292  ? 240 TYR H CE2 1 
ATOM   1868  C CZ  . TYR A  1 260 ? 46.35068  34.98453   -1.41265  1.000 63.22692  ? 240 TYR H CZ  1 
ATOM   1869  O OH  . TYR A  1 260 ? 46.88675  36.16731   -1.87514  1.000 62.82698  ? 240 TYR H OH  1 
ATOM   1870  N N   . ILE A  1 261 ? 46.25266  30.30543   2.56865   1.000 50.55110  ? 241 ILE H N   1 
ATOM   1871  C CA  . ILE A  1 261 ? 47.06098  30.73064   3.70893   1.000 50.69980  ? 241 ILE H CA  1 
ATOM   1872  C C   . ILE A  1 261 ? 48.31304  29.87011   3.84311   1.000 51.57462  ? 241 ILE H C   1 
ATOM   1873  O O   . ILE A  1 261 ? 49.41458  30.38821   4.05574   1.000 52.85169  ? 241 ILE H O   1 
ATOM   1874  C CB  . ILE A  1 261 ? 46.22098  30.71025   4.99817   1.000 48.92348  ? 241 ILE H CB  1 
ATOM   1875  C CG1 . ILE A  1 261 ? 45.07325  31.71226   4.90020   1.000 48.32139  ? 241 ILE H CG1 1 
ATOM   1876  C CG2 . ILE A  1 261 ? 47.08817  31.01538   6.21064   1.000 49.14847  ? 241 ILE H CG2 1 
ATOM   1877  C CD1 . ILE A  1 261 ? 44.20021  31.75466   6.13628   1.000 54.27203  ? 241 ILE H CD1 1 
ATOM   1878  N N   . VAL A  1 262 ? 48.16925  28.54666   3.73599   1.000 53.57808  ? 242 VAL H N   1 
ATOM   1879  C CA  . VAL A  1 262 ? 49.33781  27.67900   3.87693   1.000 60.27009  ? 242 VAL H CA  1 
ATOM   1880  C C   . VAL A  1 262 ? 50.40106  28.05624   2.85298   1.000 65.83307  ? 242 VAL H C   1 
ATOM   1881  O O   . VAL A  1 262 ? 51.60202  28.06089   3.15306   1.000 70.38378  ? 242 VAL H O   1 
ATOM   1882  C CB  . VAL A  1 262 ? 48.93355  26.19483   3.76859   1.000 62.96123  ? 242 VAL H CB  1 
ATOM   1883  C CG1 . VAL A  1 262 ? 48.04098  25.96663   2.57450   1.000 62.08266  ? 242 VAL H CG1 1 
ATOM   1884  C CG2 . VAL A  1 262 ? 50.16957  25.30823   3.67620   1.000 59.14424  ? 242 VAL H CG2 1 
ATOM   1885  N N   . GLU A  1 263 ? 49.97444  28.42862   1.64553   1.000 66.07158  ? 243 GLU H N   1 
ATOM   1886  C CA  . GLU A  1 263 ? 50.91665  28.86906   0.62328   1.000 69.01334  ? 243 GLU H CA  1 
ATOM   1887  C C   . GLU A  1 263 ? 51.60899  30.16696   1.03133   1.000 76.16939  ? 243 GLU H C   1 
ATOM   1888  O O   . GLU A  1 263 ? 52.83000  30.20228   1.22525   1.000 83.37896  ? 243 GLU H O   1 
ATOM   1889  C CB  . GLU A  1 263 ? 50.19054  29.04184   -0.71319  1.000 71.39730  ? 243 GLU H CB  1 
ATOM   1890  C CG  . GLU A  1 263 ? 50.35874  27.88402   -1.68290  1.000 74.56384  ? 243 GLU H CG  1 
ATOM   1891  C CD  . GLU A  1 263 ? 50.32450  28.33060   -3.13673  1.000 79.69409  ? 243 GLU H CD  1 
ATOM   1892  O OE1 . GLU A  1 263 ? 49.50285  27.79378   -3.91025  1.000 79.20710  ? 243 GLU H OE1 1 
ATOM   1893  O OE2 . GLU A  1 263 ? 51.12217  29.21744   -3.50776  1.000 83.34812  ? 243 GLU H OE2 1 
ATOM   1894  N N   . HIS A  1 264 ? 50.83703  31.24742   1.18030   1.000 66.70221  ? 244 HIS H N   1 
ATOM   1895  C CA  . HIS A  1 264 ? 51.40234  32.58834   1.27959   1.000 69.63382  ? 244 HIS H CA  1 
ATOM   1896  C C   . HIS A  1 264 ? 51.54719  33.10598   2.70576   1.000 68.20393  ? 244 HIS H C   1 
ATOM   1897  O O   . HIS A  1 264 ? 52.26699  34.09016   2.91454   1.000 70.69137  ? 244 HIS H O   1 
ATOM   1898  C CB  . HIS A  1 264 ? 50.55209  33.58213   0.47592   1.000 75.25332  ? 244 HIS H CB  1 
ATOM   1899  C CG  . HIS A  1 264 ? 50.22082  33.11816   -0.91041  1.000 85.17916  ? 244 HIS H CG  1 
ATOM   1900  N ND1 . HIS A  1 264 ? 50.97454  32.18180   -1.58601  1.000 87.12192  ? 244 HIS H ND1 1 
ATOM   1901  C CD2 . HIS A  1 264 ? 49.21993  33.47071   -1.75167  1.000 85.27320  ? 244 HIS H CD2 1 
ATOM   1902  C CE1 . HIS A  1 264 ? 50.44939  31.97394   -2.78048  1.000 85.26463  ? 244 HIS H CE1 1 
ATOM   1903  N NE2 . HIS A  1 264 ? 49.38437  32.74447   -2.90678  1.000 87.69951  ? 244 HIS H NE2 1 
ATOM   1904  N N   . GLY A  1 265 ? 50.88968  32.48722   3.68314   1.000 55.75124  ? 245 GLY H N   1 
ATOM   1905  C CA  . GLY A  1 265 ? 51.00082  32.93294   5.05996   1.000 56.19461  ? 245 GLY H CA  1 
ATOM   1906  C C   . GLY A  1 265 ? 51.51797  31.85357   5.98887   1.000 54.67278  ? 245 GLY H C   1 
ATOM   1907  O O   . GLY A  1 265 ? 52.20542  30.92889   5.54502   1.000 55.35909  ? 245 GLY H O   1 
ATOM   1908  N N   . LYS A  1 266 ? 51.20058  31.95579   7.27797   1.000 53.53064  ? 246 LYS H N   1 
ATOM   1909  C CA  . LYS A  1 266 ? 51.57156  30.94428   8.25936   1.000 53.60903  ? 246 LYS H CA  1 
ATOM   1910  C C   . LYS A  1 266 ? 50.31448  30.22567   8.73600   1.000 51.19355  ? 246 LYS H C   1 
ATOM   1911  O O   . LYS A  1 266 ? 49.38003  30.86250   9.23434   1.000 55.19925  ? 246 LYS H O   1 
ATOM   1912  C CB  . LYS A  1 266 ? 52.31907  31.55608   9.44422   1.000 53.52716  ? 246 LYS H CB  1 
ATOM   1913  C CG  . LYS A  1 266 ? 53.11415  30.51752   10.22721  1.000 58.31634  ? 246 LYS H CG  1 
ATOM   1914  C CD  . LYS A  1 266 ? 53.48530  30.98044   11.62646  1.000 61.75564  ? 246 LYS H CD  1 
ATOM   1915  C CE  . LYS A  1 266 ? 54.39345  29.95755   12.30270  1.000 61.52070  ? 246 LYS H CE  1 
ATOM   1916  N NZ  . LYS A  1 266 ? 54.59814  30.23946   13.75097  1.000 61.97105  ? 246 LYS H NZ  1 
ATOM   1917  N N   . ALA A  1 267 ? 50.29770  28.90338   8.58255   1.000 50.41985  ? 247 ALA H N   1 
ATOM   1918  C CA  . ALA A  1 267 ? 49.19355  28.06202   9.02375   1.000 49.11474  ? 247 ALA H CA  1 
ATOM   1919  C C   . ALA A  1 267 ? 49.75007  26.95603   9.90761   1.000 57.12658  ? 247 ALA H C   1 
ATOM   1920  O O   . ALA A  1 267 ? 50.65767  26.22719   9.49401   1.000 60.61136  ? 247 ALA H O   1 
ATOM   1921  C CB  . ALA A  1 267 ? 48.43358  27.47125   7.83127   1.000 48.21208  ? 247 ALA H CB  1 
ATOM   1922  N N   . VAL A  1 268 ? 49.21218  26.83711   11.12144  1.000 55.39903  ? 248 VAL H N   1 
ATOM   1923  C CA  . VAL A  1 268 ? 49.71941  25.90755   12.12313  1.000 51.61889  ? 248 VAL H CA  1 
ATOM   1924  C C   . VAL A  1 268 ? 48.62568  24.90931   12.48402  1.000 55.55556  ? 248 VAL H C   1 
ATOM   1925  O O   . VAL A  1 268 ? 47.43082  25.22436   12.45643  1.000 51.84962  ? 248 VAL H O   1 
ATOM   1926  C CB  . VAL A  1 268 ? 50.22377  26.65448   13.38003  1.000 56.15724  ? 248 VAL H CB  1 
ATOM   1927  C CG1 . VAL A  1 268 ? 51.03197  25.73077   14.27574  1.000 58.44579  ? 248 VAL H CG1 1 
ATOM   1928  C CG2 . VAL A  1 268 ? 51.06504  27.85136   12.97596  1.000 63.50275  ? 248 VAL H CG2 1 
ATOM   1929  N N   . ALA A  1 269 ? 49.04640  23.69346   12.82321  1.000 45.34203  ? 249 ALA H N   1 
ATOM   1930  C CA  . ALA A  1 269 ? 48.13872  22.62401   13.20743  1.000 51.19829  ? 249 ALA H CA  1 
ATOM   1931  C C   . ALA A  1 269 ? 48.04076  22.52422   14.72505  1.000 48.44293  ? 249 ALA H C   1 
ATOM   1932  O O   . ALA A  1 269 ? 49.04673  22.62331   15.43550  1.000 44.14311  ? 249 ALA H O   1 
ATOM   1933  C CB  . ALA A  1 269 ? 48.59840  21.28316   12.62815  1.000 52.02391  ? 249 ALA H CB  1 
ATOM   1934  N N   . HIS A  1 270 ? 46.81869  22.33585   15.21319  1.000 41.66821  ? 250 HIS H N   1 
ATOM   1935  C CA  . HIS A  1 270 ? 46.55334  22.03655   16.61224  1.000 40.88419  ? 250 HIS H CA  1 
ATOM   1936  C C   . HIS A  1 270 ? 45.92246  20.65491   16.67527  1.000 39.96340  ? 250 HIS H C   1 
ATOM   1937  O O   . HIS A  1 270 ? 44.93416  20.38883   15.98509  1.000 43.42387  ? 250 HIS H O   1 
ATOM   1938  C CB  . HIS A  1 270 ? 45.63531  23.09437   17.24694  1.000 47.85568  ? 250 HIS H CB  1 
ATOM   1939  C CG  . HIS A  1 270 ? 45.23633  22.79218   18.66099  1.000 40.68764  ? 250 HIS H CG  1 
ATOM   1940  N ND1 . HIS A  1 270 ? 45.96575  23.21942   19.74952  1.000 39.79637  ? 250 HIS H ND1 1 
ATOM   1941  C CD2 . HIS A  1 270 ? 44.17419  22.11816   19.16388  1.000 37.89539  ? 250 HIS H CD2 1 
ATOM   1942  C CE1 . HIS A  1 270 ? 45.37605  22.81621   20.86058  1.000 38.91641  ? 250 HIS H CE1 1 
ATOM   1943  N NE2 . HIS A  1 270 ? 44.28562  22.14720   20.53299  1.000 37.70747  ? 250 HIS H NE2 1 
ATOM   1944  N N   . ARG A  1 271 ? 46.50131  19.77512   17.47990  1.000 40.23666  ? 251 ARG H N   1 
ATOM   1945  C CA  . ARG A  1 271 ? 46.06806  18.38570   17.51807  1.000 44.27980  ? 251 ARG H CA  1 
ATOM   1946  C C   . ARG A  1 271 ? 44.95547  18.19026   18.53778  1.000 39.23775  ? 251 ARG H C   1 
ATOM   1947  O O   . ARG A  1 271 ? 45.01415  18.71260   19.65480  1.000 41.31288  ? 251 ARG H O   1 
ATOM   1948  C CB  . ARG A  1 271 ? 47.24910  17.46561   17.82718  1.000 40.78467  ? 251 ARG H CB  1 
ATOM   1949  C CG  . ARG A  1 271 ? 48.44470  17.75919   16.94087  1.000 46.10296  ? 251 ARG H CG  1 
ATOM   1950  C CD  . ARG A  1 271 ? 49.57286  16.76989   17.10969  1.000 43.66433  ? 251 ARG H CD  1 
ATOM   1951  N NE  . ARG A  1 271 ? 50.49827  16.87146   15.98508  1.000 51.47077  ? 251 ARG H NE  1 
ATOM   1952  C CZ  . ARG A  1 271 ? 51.74729  16.42046   15.99515  1.000 49.30829  ? 251 ARG H CZ  1 
ATOM   1953  N NH1 . ARG A  1 271 ? 52.23488  15.83696   17.07937  1.000 49.97357  ? 251 ARG H NH1 1 
ATOM   1954  N NH2 . ARG A  1 271 ? 52.51252  16.56220   14.92275  1.000 48.08390  ? 251 ARG H NH2 1 
ATOM   1955  N N   . PHE A  1 272 ? 43.94465  17.41991   18.13483  1.000 37.22420  ? 252 PHE H N   1 
ATOM   1956  C CA  . PHE A  1 272 ? 42.74392  17.23509   18.94265  1.000 35.85431  ? 252 PHE H CA  1 
ATOM   1957  C C   . PHE A  1 272 ? 43.06708  16.71399   20.33963  1.000 36.25182  ? 252 PHE H C   1 
ATOM   1958  O O   . PHE A  1 272 ? 42.38820  17.07483   21.30666  1.000 35.06438  ? 252 PHE H O   1 
ATOM   1959  C CB  . PHE A  1 272 ? 41.79575  16.29310   18.19218  1.000 40.01363  ? 252 PHE H CB  1 
ATOM   1960  C CG  . PHE A  1 272 ? 40.54388  15.93030   18.94243  1.000 42.13069  ? 252 PHE H CG  1 
ATOM   1961  C CD1 . PHE A  1 272 ? 39.62708  16.89527   19.30498  1.000 33.14247  ? 252 PHE H CD1 1 
ATOM   1962  C CD2 . PHE A  1 272 ? 40.26534  14.60353   19.24120  1.000 51.31636  ? 252 PHE H CD2 1 
ATOM   1963  C CE1 . PHE A  1 272 ? 38.47103  16.55185   19.98084  1.000 33.68122  ? 252 PHE H CE1 1 
ATOM   1964  C CE2 . PHE A  1 272 ? 39.10830  14.25554   19.91251  1.000 47.32178  ? 252 PHE H CE2 1 
ATOM   1965  C CZ  . PHE A  1 272 ? 38.21119  15.23503   20.28122  1.000 41.43793  ? 252 PHE H CZ  1 
ATOM   1966  N N   . ALA A  1 273 ? 44.10970  15.89227   20.47464  1.000 44.96852  ? 253 ALA H N   1 
ATOM   1967  C CA  . ALA A  1 273 ? 44.44113  15.32090   21.77631  1.000 50.10369  ? 253 ALA H CA  1 
ATOM   1968  C C   . ALA A  1 273 ? 45.02188  16.35002   22.73748  1.000 42.68526  ? 253 ALA H C   1 
ATOM   1969  O O   . ALA A  1 273 ? 45.01208  16.12049   23.95099  1.000 41.91811  ? 253 ALA H O   1 
ATOM   1970  C CB  . ALA A  1 273 ? 45.41945  14.15458   21.61253  1.000 38.04870  ? 253 ALA H CB  1 
ATOM   1971  N N   . ASP A  1 274 ? 45.52877  17.47388   22.23110  1.000 40.44105  ? 254 ASP H N   1 
ATOM   1972  C CA  . ASP A  1 274 ? 46.03469  18.50481   23.12845  1.000 45.94170  ? 254 ASP H CA  1 
ATOM   1973  C C   . ASP A  1 274 ? 44.91272  19.15996   23.92689  1.000 41.26667  ? 254 ASP H C   1 
ATOM   1974  O O   . ASP A  1 274 ? 45.11286  19.51462   25.09493  1.000 39.57328  ? 254 ASP H O   1 
ATOM   1975  C CB  . ASP A  1 274 ? 46.80374  19.56202   22.33599  1.000 49.52139  ? 254 ASP H CB  1 
ATOM   1976  C CG  . ASP A  1 274 ? 48.24805  19.17534   22.09769  1.000 53.82345  ? 254 ASP H CG  1 
ATOM   1977  O OD1 . ASP A  1 274 ? 48.84457  18.52440   22.98130  1.000 57.62131  ? 254 ASP H OD1 1 
ATOM   1978  O OD2 . ASP A  1 274 ? 48.78813  19.52359   21.02728  1.000 56.10083  ? 254 ASP H OD2 1 
ATOM   1979  N N   . SER A  1 275 ? 43.72924  19.31166   23.32661  1.000 44.13876  ? 255 SER H N   1 
ATOM   1980  C CA  . SER A  1 275 ? 42.65187  20.09852   23.91246  1.000 40.34228  ? 255 SER H CA  1 
ATOM   1981  C C   . SER A  1 275 ? 41.34731  19.33494   24.10428  1.000 35.72212  ? 255 SER H C   1 
ATOM   1982  O O   . SER A  1 275 ? 40.39775  19.89695   24.66697  1.000 33.33491  ? 255 SER H O   1 
ATOM   1983  C CB  . SER A  1 275 ? 42.37420  21.32950   23.04458  1.000 35.43372  ? 255 SER H CB  1 
ATOM   1984  O OG  . SER A  1 275 ? 42.00295  20.92382   21.74066  1.000 43.82396  ? 255 SER H OG  1 
ATOM   1985  N N   . CYS A  1 276 ? 41.26557  18.08523   23.64791  1.000 34.84829  ? 256 CYS H N   1 
ATOM   1986  C CA  . CYS A  1 276 ? 40.04866  17.30388   23.83131  1.000 33.78043  ? 256 CYS H CA  1 
ATOM   1987  C C   . CYS A  1 276 ? 39.77269  17.10455   25.31519  1.000 32.43776  ? 256 CYS H C   1 
ATOM   1988  O O   . CYS A  1 276 ? 40.68346  16.83037   26.10306  1.000 33.21212  ? 256 CYS H O   1 
ATOM   1989  C CB  . CYS A  1 276 ? 40.16680  15.95074   23.12883  1.000 33.27932  ? 256 CYS H CB  1 
ATOM   1990  S SG  . CYS A  1 276 ? 39.06499  14.67588   23.77959  1.000 42.05824  ? 256 CYS H SG  1 
ATOM   1991  N N   . VAL A  1 277 ? 38.51064  17.25388   25.69897  1.000 32.69517  ? 257 VAL H N   1 
ATOM   1992  C CA  . VAL A  1 277 ? 38.09083  17.08174   27.08438  1.000 38.80796  ? 257 VAL H CA  1 
ATOM   1993  C C   . VAL A  1 277 ? 37.53569  15.67176   27.22142  1.000 44.26843  ? 257 VAL H C   1 
ATOM   1994  O O   . VAL A  1 277 ? 36.45237  15.37086   26.70764  1.000 54.70988  ? 257 VAL H O   1 
ATOM   1995  C CB  . VAL A  1 277 ? 37.05774  18.14002   27.49170  1.000 34.83384  ? 257 VAL H CB  1 
ATOM   1996  C CG1 . VAL A  1 277 ? 36.78901  18.08511   28.99263  1.000 33.57098  ? 257 VAL H CG1 1 
ATOM   1997  C CG2 . VAL A  1 277 ? 37.54360  19.52585   27.09020  1.000 32.08105  ? 257 VAL H CG2 1 
ATOM   1998  N N   . ARG A  1 278 ? 38.27584  14.80648   27.90595  1.000 40.55345  ? 258 ARG H N   1 
ATOM   1999  C CA  . ARG A  1 278 ? 37.84082  13.43832   28.17284  1.000 41.09225  ? 258 ARG H CA  1 
ATOM   2000  C C   . ARG A  1 278 ? 37.37531  13.32655   29.61552  1.000 33.73974  ? 258 ARG H C   1 
ATOM   2001  O O   . ARG A  1 278 ? 38.06257  13.79760   30.52726  1.000 36.76935  ? 258 ARG H O   1 
ATOM   2002  C CB  . ARG A  1 278 ? 38.96285  12.42871   27.92686  1.000 35.11276  ? 258 ARG H CB  1 
ATOM   2003  C CG  . ARG A  1 278 ? 39.57635  12.47074   26.54598  1.000 39.20845  ? 258 ARG H CG  1 
ATOM   2004  C CD  . ARG A  1 278 ? 40.91349  11.76714   26.55099  1.000 44.54641  ? 258 ARG H CD  1 
ATOM   2005  N NE  . ARG A  1 278 ? 40.86172  10.54671   27.34914  1.000 55.60604  ? 258 ARG H NE  1 
ATOM   2006  C CZ  . ARG A  1 278 ? 41.82969  10.15234   28.16974  1.000 63.87318  ? 258 ARG H CZ  1 
ATOM   2007  N NH1 . ARG A  1 278 ? 42.92307  10.89027   28.30135  1.000 69.22759  ? 258 ARG H NH1 1 
ATOM   2008  N NH2 . ARG A  1 278 ? 41.70589  9.02489    28.86059  1.000 57.52655  ? 258 ARG H NH2 1 
ATOM   2009  N N   . SER A  1 279 ? 36.22348  12.69105   29.82335  1.000 33.31682  ? 259 SER H N   1 
ATOM   2010  C CA  . SER A  1 279 ? 35.84334  12.34042   31.18248  1.000 40.10667  ? 259 SER H CA  1 
ATOM   2011  C C   . SER A  1 279 ? 36.73137  11.19731   31.67894  1.000 30.61867  ? 259 SER H C   1 
ATOM   2012  O O   . SER A  1 279 ? 37.48091  10.58325   30.91395  1.000 34.25193  ? 259 SER H O   1 
ATOM   2013  C CB  . SER A  1 279 ? 34.36180  11.96408   31.25547  1.000 40.28010  ? 259 SER H CB  1 
ATOM   2014  O OG  . SER A  1 279 ? 34.17144  10.56262   31.27646  1.000 40.86238  ? 259 SER H OG  1 
ATOM   2015  N N   . ASP A  1 280 ? 36.66344  10.93086   32.98688  1.000 30.88323  ? 260 ASP H N   1 
ATOM   2016  C CA  . ASP A  1 280 ? 37.45219  9.85080    33.57777  1.000 38.05158  ? 260 ASP H CA  1 
ATOM   2017  C C   . ASP A  1 280 ? 37.09421  8.48305    33.00478  1.000 42.66063  ? 260 ASP H C   1 
ATOM   2018  O O   . ASP A  1 280 ? 37.88667  7.54161    33.12591  1.000 40.52767  ? 260 ASP H O   1 
ATOM   2019  C CB  . ASP A  1 280 ? 37.26142  9.82701    35.09502  1.000 47.18830  ? 260 ASP H CB  1 
ATOM   2020  C CG  . ASP A  1 280 ? 38.06173  10.90019   35.80368  1.000 55.90454  ? 260 ASP H CG  1 
ATOM   2021  O OD1 . ASP A  1 280 ? 39.08514  11.35240   35.24608  1.000 56.46108  ? 260 ASP H OD1 1 
ATOM   2022  O OD2 . ASP A  1 280 ? 37.66403  11.28908   36.92270  1.000 57.68384  ? 260 ASP H OD2 1 
ATOM   2023  N N   . PHE A  1 281 ? 35.92510  8.35182    32.38205  1.000 30.51720  ? 261 PHE H N   1 
ATOM   2024  C CA  . PHE A  1 281 ? 35.44604  7.07360    31.88255  1.000 37.80623  ? 261 PHE H CA  1 
ATOM   2025  C C   . PHE A  1 281 ? 35.57362  6.95897    30.37199  1.000 41.50877  ? 261 PHE H C   1 
ATOM   2026  O O   . PHE A  1 281 ? 34.96348  6.07005    29.76799  1.000 34.65037  ? 261 PHE H O   1 
ATOM   2027  C CB  . PHE A  1 281 ? 34.00075  6.85728    32.32356  1.000 34.79394  ? 261 PHE H CB  1 
ATOM   2028  C CG  . PHE A  1 281 ? 33.78449  7.09635    33.78785  1.000 44.39159  ? 261 PHE H CG  1 
ATOM   2029  C CD1 . PHE A  1 281 ? 33.46604  8.35880    34.25859  1.000 42.29868  ? 261 PHE H CD1 1 
ATOM   2030  C CD2 . PHE A  1 281 ? 33.92655  6.06273    34.69796  1.000 47.07664  ? 261 PHE H CD2 1 
ATOM   2031  C CE1 . PHE A  1 281 ? 33.27791  8.58334    35.60800  1.000 44.82714  ? 261 PHE H CE1 1 
ATOM   2032  C CE2 . PHE A  1 281 ? 33.73762  6.28078    36.04846  1.000 49.92744  ? 261 PHE H CE2 1 
ATOM   2033  C CZ  . PHE A  1 281 ? 33.41290  7.54475    36.50428  1.000 46.30307  ? 261 PHE H CZ  1 
ATOM   2034  N N   . GLU A  1 282 ? 36.36013  7.83390    29.75301  1.000 41.02912  ? 262 GLU H N   1 
ATOM   2035  C CA  . GLU A  1 282 ? 36.62179  7.79057    28.31980  1.000 39.80928  ? 262 GLU H CA  1 
ATOM   2036  C C   . GLU A  1 282 ? 38.08939  7.42817    28.12118  1.000 43.11659  ? 262 GLU H C   1 
ATOM   2037  O O   . GLU A  1 282 ? 38.98120  8.21539    28.45687  1.000 44.35155  ? 262 GLU H O   1 
ATOM   2038  C CB  . GLU A  1 282 ? 36.26178  9.12202    27.66518  1.000 33.21029  ? 262 GLU H CB  1 
ATOM   2039  C CG  . GLU A  1 282 ? 34.76033  9.39117    27.67379  1.000 35.49035  ? 262 GLU H CG  1 
ATOM   2040  C CD  . GLU A  1 282 ? 34.40593  10.83298   27.34976  1.000 40.92228  ? 262 GLU H CD  1 
ATOM   2041  O OE1 . GLU A  1 282 ? 35.24689  11.72713   27.58214  1.000 43.34859  ? 262 GLU H OE1 1 
ATOM   2042  O OE2 . GLU A  1 282 ? 33.27929  11.07031   26.86787  1.000 35.96367  ? 262 GLU H OE2 1 
ATOM   2043  N N   . HIS A  1 283 ? 38.33207  6.22982    27.58116  1.000 40.84169  ? 263 HIS H N   1 
ATOM   2044  C CA  . HIS A  1 283 ? 39.67876  5.68242    27.45280  1.000 48.27038  ? 263 HIS H CA  1 
ATOM   2045  C C   . HIS A  1 283 ? 40.50227  6.35589    26.36119  1.000 51.32571  ? 263 HIS H C   1 
ATOM   2046  O O   . HIS A  1 283 ? 41.69605  6.05984    26.24148  1.000 47.52060  ? 263 HIS H O   1 
ATOM   2047  C CB  . HIS A  1 283 ? 39.60532  4.17522    27.17580  1.000 39.83067  ? 263 HIS H CB  1 
ATOM   2048  C CG  . HIS A  1 283 ? 39.34291  3.83534    25.73975  1.000 42.00882  ? 263 HIS H CG  1 
ATOM   2049  N ND1 . HIS A  1 283 ? 38.09583  3.95011    25.16201  1.000 46.76319  ? 263 HIS H ND1 1 
ATOM   2050  C CD2 . HIS A  1 283 ? 40.16891  3.38973    24.76355  1.000 45.44035  ? 263 HIS H CD2 1 
ATOM   2051  C CE1 . HIS A  1 283 ? 38.16549  3.58988    23.89259  1.000 46.01838  ? 263 HIS H CE1 1 
ATOM   2052  N NE2 . HIS A  1 283 ? 39.41163  3.24191    23.62637  1.000 47.23634  ? 263 HIS H NE2 1 
ATOM   2053  N N   . GLU A  1 284 ? 39.90703  7.24884    25.57483  1.000 50.44919  ? 264 GLU H N   1 
ATOM   2054  C CA  . GLU A  1 284 ? 40.56334  7.80184    24.39964  1.000 52.46237  ? 264 GLU H CA  1 
ATOM   2055  C C   . GLU A  1 284 ? 39.85592  9.09323    24.03311  1.000 38.98024  ? 264 GLU H C   1 
ATOM   2056  O O   . GLU A  1 284 ? 38.68258  9.26296    24.38041  1.000 35.14485  ? 264 GLU H O   1 
ATOM   2057  C CB  . GLU A  1 284 ? 40.50450  6.81243    23.22753  1.000 54.50123  ? 264 GLU H CB  1 
ATOM   2058  C CG  . GLU A  1 284 ? 41.77599  6.69503    22.41500  1.000 63.90785  ? 264 GLU H CG  1 
ATOM   2059  C CD  . GLU A  1 284 ? 41.57865  5.83359    21.18370  1.000 63.27509  ? 264 GLU H CD  1 
ATOM   2060  O OE1 . GLU A  1 284 ? 42.54888  5.65539    20.41318  1.000 62.92400  ? 264 GLU H OE1 1 
ATOM   2061  O OE2 . GLU A  1 284 ? 40.44015  5.35104    20.98472  1.000 49.36630  ? 264 GLU H OE2 1 
ATOM   2062  N N   . PRO A  1 285 ? 40.53229  10.02462   23.35873  1.000 39.59205  ? 265 PRO H N   1 
ATOM   2063  C CA  . PRO A  1 285 ? 39.82312  11.19291   22.82175  1.000 38.16353  ? 265 PRO H CA  1 
ATOM   2064  C C   . PRO A  1 285 ? 38.75158  10.74356   21.84309  1.000 32.06104  ? 265 PRO H C   1 
ATOM   2065  O O   . PRO A  1 285 ? 38.98837  9.88789    20.98798  1.000 48.48548  ? 265 PRO H O   1 
ATOM   2066  C CB  . PRO A  1 285 ? 40.93079  11.99784   22.13075  1.000 42.31225  ? 265 PRO H CB  1 
ATOM   2067  C CG  . PRO A  1 285 ? 42.17724  11.58700   22.82484  1.000 43.99669  ? 265 PRO H CG  1 
ATOM   2068  C CD  . PRO A  1 285 ? 41.98732  10.12793   23.14963  1.000 41.35004  ? 265 PRO H CD  1 
ATOM   2069  N N   . TYR A  1 286 ? 37.56010  11.31326   21.98589  1.000 34.38330  ? 266 TYR H N   1 
ATOM   2070  C CA  . TYR A  1 286 ? 36.38209  10.85967   21.26025  1.000 30.30360  ? 266 TYR H CA  1 
ATOM   2071  C C   . TYR A  1 286 ? 36.01841  11.88288   20.19503  1.000 30.13473  ? 266 TYR H C   1 
ATOM   2072  O O   . TYR A  1 286 ? 35.68210  13.02648   20.51617  1.000 34.88471  ? 266 TYR H O   1 
ATOM   2073  C CB  . TYR A  1 286 ? 35.21618  10.62681   22.22368  1.000 30.41011  ? 266 TYR H CB  1 
ATOM   2074  C CG  . TYR A  1 286 ? 33.95024  10.08572   21.58783  1.000 29.79169  ? 266 TYR H CG  1 
ATOM   2075  C CD1 . TYR A  1 286 ? 33.09886  10.92046   20.87830  1.000 28.17505  ? 266 TYR H CD1 1 
ATOM   2076  C CD2 . TYR A  1 286 ? 33.59461  8.74511    21.71779  1.000 29.52720  ? 266 TYR H CD2 1 
ATOM   2077  C CE1 . TYR A  1 286 ? 31.93847  10.44496   20.30706  1.000 31.74146  ? 266 TYR H CE1 1 
ATOM   2078  C CE2 . TYR A  1 286 ? 32.42872  8.25435    21.14091  1.000 32.68054  ? 266 TYR H CE2 1 
ATOM   2079  C CZ  . TYR A  1 286 ? 31.60336  9.11582    20.44196  1.000 32.88376  ? 266 TYR H CZ  1 
ATOM   2080  O OH  . TYR A  1 286 ? 30.44118  8.66293    19.86573  1.000 27.28155  ? 266 TYR H OH  1 
ATOM   2081  N N   . TRP A  1 287 ? 36.08230  11.46625   18.93367  1.000 30.53491  ? 267 TRP H N   1 
ATOM   2082  C CA  . TRP A  1 287 ? 35.58769  12.26198   17.81717  1.000 32.78656  ? 267 TRP H CA  1 
ATOM   2083  C C   . TRP A  1 287 ? 34.95373  11.32597   16.80112  1.000 31.76118  ? 267 TRP H C   1 
ATOM   2084  O O   . TRP A  1 287 ? 35.57257  10.33707   16.39768  1.000 37.41272  ? 267 TRP H O   1 
ATOM   2085  C CB  . TRP A  1 287 ? 36.71139  13.07504   17.16046  1.000 31.35352  ? 267 TRP H CB  1 
ATOM   2086  C CG  . TRP A  1 287 ? 36.24515  13.93437   16.02311  1.000 32.72205  ? 267 TRP H CG  1 
ATOM   2087  C CD1 . TRP A  1 287 ? 35.93367  15.26958   16.07424  1.000 31.08270  ? 267 TRP H CD1 1 
ATOM   2088  C CD2 . TRP A  1 287 ? 36.04251  13.52864   14.66406  1.000 31.76903  ? 267 TRP H CD2 1 
ATOM   2089  N NE1 . TRP A  1 287 ? 35.54969  15.71317   14.83132  1.000 31.29388  ? 267 TRP H NE1 1 
ATOM   2090  C CE2 . TRP A  1 287 ? 35.60573  14.66528   13.94910  1.000 37.77673  ? 267 TRP H CE2 1 
ATOM   2091  C CE3 . TRP A  1 287 ? 36.18999  12.31723   13.98001  1.000 40.12860  ? 267 TRP H CE3 1 
ATOM   2092  C CZ2 . TRP A  1 287 ? 35.31055  14.62205   12.58835  1.000 32.15213  ? 267 TRP H CZ2 1 
ATOM   2093  C CZ3 . TRP A  1 287 ? 35.89724  12.27733   12.62672  1.000 33.98689  ? 267 TRP H CZ3 1 
ATOM   2094  C CH2 . TRP A  1 287 ? 35.46840  13.42518   11.94567  1.000 36.88424  ? 267 TRP H CH2 1 
ATOM   2095  N N   . ARG A  1 288 ? 33.73220  11.64642   16.38321  1.000 30.05103  ? 268 ARG H N   1 
ATOM   2096  C CA  . ARG A  1 288 ? 32.99417  10.86360   15.40278  1.000 29.78906  ? 268 ARG H CA  1 
ATOM   2097  C C   . ARG A  1 288 ? 32.30315  11.81274   14.43972  1.000 39.30132  ? 268 ARG H C   1 
ATOM   2098  O O   . ARG A  1 288 ? 31.82838  12.87768   14.84807  1.000 38.36602  ? 268 ARG H O   1 
ATOM   2099  C CB  . ARG A  1 288 ? 31.95040  9.95547    16.07156  1.000 29.06891  ? 268 ARG H CB  1 
ATOM   2100  C CG  . ARG A  1 288 ? 32.52700  9.01734    17.11873  1.000 31.09410  ? 268 ARG H CG  1 
ATOM   2101  C CD  . ARG A  1 288 ? 32.78754  7.63688    16.53270  1.000 29.86727  ? 268 ARG H CD  1 
ATOM   2102  N NE  . ARG A  1 288 ? 33.11456  6.65042    17.55938  1.000 32.57303  ? 268 ARG H NE  1 
ATOM   2103  C CZ  . ARG A  1 288 ? 34.25153  6.62730    18.24646  1.000 38.86692  ? 268 ARG H CZ  1 
ATOM   2104  N NH1 . ARG A  1 288 ? 35.18968  7.53357    18.01359  1.000 66.86510  ? 268 ARG H NH1 1 
ATOM   2105  N NH2 . ARG A  1 288 ? 34.45316  5.68736    19.16010  1.000 30.60289  ? 268 ARG H NH2 1 
ATOM   2106  N N   . ASP A  1 289 ? 32.24530  11.42654   13.16246  1.000 34.35509  ? 269 ASP H N   1 
ATOM   2107  C CA  . ASP A  1 289 ? 31.54062  12.22003   12.16508  1.000 34.36103  ? 269 ASP H CA  1 
ATOM   2108  C C   . ASP A  1 289 ? 30.21630  11.61196   11.72997  1.000 30.20540  ? 269 ASP H C   1 
ATOM   2109  O O   . ASP A  1 289 ? 29.45297  12.28940   11.03457  1.000 30.83898  ? 269 ASP H O   1 
ATOM   2110  C CB  . ASP A  1 289 ? 32.42489  12.45090   10.93085  1.000 40.37960  ? 269 ASP H CB  1 
ATOM   2111  C CG  . ASP A  1 289 ? 32.50138  11.24243   10.03175  1.000 47.55799  ? 269 ASP H CG  1 
ATOM   2112  O OD1 . ASP A  1 289 ? 32.55385  10.10903   10.55183  1.000 57.44177  ? 269 ASP H OD1 1 
ATOM   2113  O OD2 . ASP A  1 289 ? 32.51953  11.42903   8.79863   1.000 50.03055  ? 269 ASP H OD2 1 
ATOM   2114  N N   . VAL A  1 290 ? 29.91430  10.37976   12.15571  1.000 30.07346  ? 270 VAL H N   1 
ATOM   2115  C CA  . VAL A  1 290 ? 28.69327  9.63465    11.83750  1.000 30.25245  ? 270 VAL H CA  1 
ATOM   2116  C C   . VAL A  1 290 ? 28.19438  9.95884    10.43317  1.000 30.04764  ? 270 VAL H C   1 
ATOM   2117  O O   . VAL A  1 290 ? 27.02088  10.29191   10.24077  1.000 37.40357  ? 270 VAL H O   1 
ATOM   2118  C CB  . VAL A  1 290 ? 27.58361  9.88098    12.88658  1.000 34.96809  ? 270 VAL H CB  1 
ATOM   2119  C CG1 . VAL A  1 290 ? 27.85962  9.08442    14.15577  1.000 28.08724  ? 270 VAL H CG1 1 
ATOM   2120  C CG2 . VAL A  1 290 ? 27.38641  11.37194   13.20946  1.000 27.99971  ? 270 VAL H CG2 1 
ATOM   2121  N N   . GLY A  1 291 ? 29.08020  9.85585    9.44276   1.000 31.05258  ? 271 GLY H N   1 
ATOM   2122  C CA  . GLY A  1 291 ? 28.76464  10.27672   8.08928   1.000 36.02551  ? 271 GLY H CA  1 
ATOM   2123  C C   . GLY A  1 291 ? 28.00348  9.27763    7.24615   1.000 36.18106  ? 271 GLY H C   1 
ATOM   2124  O O   . GLY A  1 291 ? 27.54827  9.63646    6.15700   1.000 41.07158  ? 271 GLY H O   1 
ATOM   2125  N N   . THR A  1 292 ? 27.86511  8.03674    7.70746   1.000 36.88149  ? 272 THR H N   1 
ATOM   2126  C CA  . THR A  1 292 ? 27.10390  7.01563    7.00155   1.000 34.64488  ? 272 THR H CA  1 
ATOM   2127  C C   . THR A  1 292 ? 26.07637  6.40836    7.94479   1.000 36.50268  ? 272 THR H C   1 
ATOM   2128  O O   . THR A  1 292 ? 26.15509  6.56106    9.16837   1.000 36.87911  ? 272 THR H O   1 
ATOM   2129  C CB  . THR A  1 292 ? 28.00279  5.90132    6.44658   1.000 34.01342  ? 272 THR H CB  1 
ATOM   2130  O OG1 . THR A  1 292 ? 28.55609  5.14892    7.53121   1.000 44.76347  ? 272 THR H OG1 1 
ATOM   2131  C CG2 . THR A  1 292 ? 29.13194  6.48625    5.62142   1.000 35.28513  ? 272 THR H CG2 1 
ATOM   2132  N N   . ILE A  1 293 ? 25.09609  5.71933    7.35753   1.000 32.10377  ? 273 ILE H N   1 
ATOM   2133  C CA  . ILE A  1 293 ? 24.12178  4.99659    8.17130   1.000 35.29570  ? 273 ILE H CA  1 
ATOM   2134  C C   . ILE A  1 293 ? 24.83526  4.04974    9.12300   1.000 33.28583  ? 273 ILE H C   1 
ATOM   2135  O O   . ILE A  1 293 ? 24.51370  3.98582    10.31540  1.000 38.32621  ? 273 ILE H O   1 
ATOM   2136  C CB  . ILE A  1 293 ? 23.12039  4.24630    7.27549   1.000 41.03033  ? 273 ILE H CB  1 
ATOM   2137  C CG1 . ILE A  1 293 ? 22.29631  5.24350    6.45878   1.000 42.20347  ? 273 ILE H CG1 1 
ATOM   2138  C CG2 . ILE A  1 293 ? 22.21840  3.34950    8.11670   1.000 32.69850  ? 273 ILE H CG2 1 
ATOM   2139  C CD1 . ILE A  1 293 ? 21.30613  4.58885    5.54006   1.000 47.19825  ? 273 ILE H CD1 1 
ATOM   2140  N N   . ASP A  1 294 ? 25.84122  3.32900    8.61872   1.000 32.31324  ? 274 ASP H N   1 
ATOM   2141  C CA  . ASP A  1 294 ? 26.59806  2.40222    9.45702   1.000 38.96256  ? 274 ASP H CA  1 
ATOM   2142  C C   . ASP A  1 294 ? 27.29447  3.12436    10.59975  1.000 41.92751  ? 274 ASP H C   1 
ATOM   2143  O O   . ASP A  1 294 ? 27.18949  2.71296    11.76170  1.000 31.04167  ? 274 ASP H O   1 
ATOM   2144  C CB  . ASP A  1 294 ? 27.62590  1.64620    8.61749   1.000 43.39156  ? 274 ASP H CB  1 
ATOM   2145  C CG  . ASP A  1 294 ? 27.05340  0.40246    7.99315   1.000 54.71225  ? 274 ASP H CG  1 
ATOM   2146  O OD1 . ASP A  1 294 ? 26.02704  -0.09373   8.50670   1.000 62.05145  ? 274 ASP H OD1 1 
ATOM   2147  O OD2 . ASP A  1 294 ? 27.62435  -0.07799   6.99099   1.000 65.47586  ? 274 ASP H OD2 1 
ATOM   2148  N N   . ALA A  1 295 ? 28.03545  4.19099    10.28053  1.000 31.69532  ? 275 ALA H N   1 
ATOM   2149  C CA  . ALA A  1 295 ? 28.74975  4.93501    11.31110  1.000 35.41190  ? 275 ALA H CA  1 
ATOM   2150  C C   . ALA A  1 295 ? 27.78346  5.55858    12.30863  1.000 31.19006  ? 275 ALA H C   1 
ATOM   2151  O O   . ALA A  1 295 ? 28.05820  5.58955    13.51366  1.000 37.89573  ? 275 ALA H O   1 
ATOM   2152  C CB  . ALA A  1 295 ? 29.62801  6.01002    10.66781  1.000 37.74735  ? 275 ALA H CB  1 
ATOM   2153  N N   . TYR A  1 296 ? 26.64543  6.06111    11.82289  1.000 32.89241  ? 276 TYR H N   1 
ATOM   2154  C CA  . TYR A  1 296 ? 25.63678  6.62376    12.71528  1.000 31.76366  ? 276 TYR H CA  1 
ATOM   2155  C C   . TYR A  1 296 ? 25.05723  5.55112    13.63092  1.000 30.35715  ? 276 TYR H C   1 
ATOM   2156  O O   . TYR A  1 296 ? 24.96992  5.73724    14.85053  1.000 27.56609  ? 276 TYR H O   1 
ATOM   2157  C CB  . TYR A  1 296 ? 24.52980  7.29196    11.89702  1.000 29.74345  ? 276 TYR H CB  1 
ATOM   2158  C CG  . TYR A  1 296 ? 23.38069  7.81230    12.73120  1.000 29.95359  ? 276 TYR H CG  1 
ATOM   2159  C CD1 . TYR A  1 296 ? 23.47952  9.02084    13.41092  1.000 29.49964  ? 276 TYR H CD1 1 
ATOM   2160  C CD2 . TYR A  1 296 ? 22.20068  7.09404    12.84208  1.000 27.51101  ? 276 TYR H CD2 1 
ATOM   2161  C CE1 . TYR A  1 296 ? 22.43192  9.49946    14.17638  1.000 26.38865  ? 276 TYR H CE1 1 
ATOM   2162  C CE2 . TYR A  1 296 ? 21.14877  7.56446    13.60184  1.000 31.23695  ? 276 TYR H CE2 1 
ATOM   2163  C CZ  . TYR A  1 296 ? 21.26921  8.76979    14.26582  1.000 28.12259  ? 276 TYR H CZ  1 
ATOM   2164  O OH  . TYR A  1 296 ? 20.22352  9.23359    15.02718  1.000 27.75823  ? 276 TYR H OH  1 
ATOM   2165  N N   . TRP A  1 297 ? 24.64609  4.42049    13.05300  1.000 28.78814  ? 277 TRP H N   1 
ATOM   2166  C CA  . TRP A  1 297 ? 24.16289  3.31277    13.86257  1.000 28.62977  ? 277 TRP H CA  1 
ATOM   2167  C C   . TRP A  1 297 ? 25.24012  2.83650    14.82138  1.000 30.63493  ? 277 TRP H C   1 
ATOM   2168  O O   . TRP A  1 297 ? 24.96826  2.56836    15.99627  1.000 29.46636  ? 277 TRP H O   1 
ATOM   2169  C CB  . TRP A  1 297 ? 23.72300  2.16836    12.95848  1.000 29.44671  ? 277 TRP H CB  1 
ATOM   2170  C CG  . TRP A  1 297 ? 23.33711  0.93957    13.68136  1.000 35.00039  ? 277 TRP H CG  1 
ATOM   2171  C CD1 . TRP A  1 297 ? 22.09024  0.61492    14.13058  1.000 30.93197  ? 277 TRP H CD1 1 
ATOM   2172  C CD2 . TRP A  1 297 ? 24.19358  -0.15137   14.03999  1.000 30.06850  ? 277 TRP H CD2 1 
ATOM   2173  N NE1 . TRP A  1 297 ? 22.11616  -0.61334   14.74122  1.000 35.22040  ? 277 TRP H NE1 1 
ATOM   2174  C CE2 . TRP A  1 297 ? 23.39555  -1.10433   14.70272  1.000 32.11602  ? 277 TRP H CE2 1 
ATOM   2175  C CE3 . TRP A  1 297 ? 25.55540  -0.41581   13.86253  1.000 30.73154  ? 277 TRP H CE3 1 
ATOM   2176  C CZ2 . TRP A  1 297 ? 23.91266  -2.30565   15.19072  1.000 32.61464  ? 277 TRP H CZ2 1 
ATOM   2177  C CZ3 . TRP A  1 297 ? 26.07096  -1.61401   14.34996  1.000 34.40411  ? 277 TRP H CZ3 1 
ATOM   2178  C CH2 . TRP A  1 297 ? 25.24842  -2.54083   15.00624  1.000 32.56716  ? 277 TRP H CH2 1 
ATOM   2179  N N   . GLN A  1 298 ? 26.47242  2.73516    14.33379  1.000 30.78788  ? 278 GLN H N   1 
ATOM   2180  C CA  . GLN A  1 298 ? 27.59035  2.29830    15.16986  1.000 31.41574  ? 278 GLN H CA  1 
ATOM   2181  C C   . GLN A  1 298 ? 27.75311  3.16686    16.41082  1.000 34.47877  ? 278 GLN H C   1 
ATOM   2182  O O   . GLN A  1 298 ? 27.81195  2.64978    17.53440  1.000 32.76025  ? 278 GLN H O   1 
ATOM   2183  C CB  . GLN A  1 298 ? 28.86831  2.31756    14.33473  1.000 30.54972  ? 278 GLN H CB  1 
ATOM   2184  C CG  . GLN A  1 298 ? 30.00017  1.46850    14.84060  1.000 35.96572  ? 278 GLN H CG  1 
ATOM   2185  C CD  . GLN A  1 298 ? 29.65024  0.00512    14.96273  1.000 43.17468  ? 278 GLN H CD  1 
ATOM   2186  O OE1 . GLN A  1 298 ? 29.09786  -0.45252   15.96338  1.000 54.98488  ? 278 GLN H OE1 1 
ATOM   2187  N NE2 . GLN A  1 298 ? 29.96001  -0.74093   13.92021  1.000 39.56923  ? 278 GLN H NE2 1 
ATOM   2188  N N   . ALA A  1 299 ? 27.82935  4.48868    16.23278  1.000 28.39819  ? 279 ALA H N   1 
ATOM   2189  C CA  . ALA A  1 299 ? 28.14501  5.34884    17.36814  1.000 36.62889  ? 279 ALA H CA  1 
ATOM   2190  C C   . ALA A  1 299 ? 27.00728  5.37615    18.38547  1.000 27.16067  ? 279 ALA H C   1 
ATOM   2191  O O   . ALA A  1 299 ? 27.24960  5.46937    19.59459  1.000 26.67924  ? 279 ALA H O   1 
ATOM   2192  C CB  . ALA A  1 299 ? 28.48331  6.76232    16.89796  1.000 27.72572  ? 279 ALA H CB  1 
ATOM   2193  N N   . ASN A  1 300 ? 25.76196  5.29033    17.91627  1.000 26.71212  ? 280 ASN H N   1 
ATOM   2194  C CA  . ASN A  1 300 ? 24.62617  5.21459    18.83005  1.000 26.06524  ? 280 ASN H CA  1 
ATOM   2195  C C   . ASN A  1 300 ? 24.61754  3.89610    19.59346  1.000 34.85497  ? 280 ASN H C   1 
ATOM   2196  O O   . ASN A  1 300 ? 24.47363  3.87606    20.82295  1.000 25.87348  ? 280 ASN H O   1 
ATOM   2197  C CB  . ASN A  1 300 ? 23.32405  5.39241    18.04804  1.000 27.73158  ? 280 ASN H CB  1 
ATOM   2198  C CG  . ASN A  1 300 ? 23.07397  6.83594    17.67324  1.000 37.90950  ? 280 ASN H CG  1 
ATOM   2199  O OD1 . ASN A  1 300 ? 23.19935  7.22743    16.51062  1.000 37.24707  ? 280 ASN H OD1 1 
ATOM   2200  N ND2 . ASN A  1 300 ? 22.73477  7.64272    18.66646  1.000 25.01501  ? 280 ASN H ND2 1 
ATOM   2201  N N   . ILE A  1 301 ? 24.79119  2.78183    18.87875  1.000 26.92180  ? 281 ILE H N   1 
ATOM   2202  C CA  . ILE A  1 301 ? 24.65624  1.47533    19.51271  1.000 27.20073  ? 281 ILE H CA  1 
ATOM   2203  C C   . ILE A  1 301 ? 25.79900  1.21267    20.49250  1.000 27.41557  ? 281 ILE H C   1 
ATOM   2204  O O   . ILE A  1 301 ? 25.60467  0.54550    21.51325  1.000 27.37846  ? 281 ILE H O   1 
ATOM   2205  C CB  . ILE A  1 301 ? 24.54805  0.38575    18.42756  1.000 28.82302  ? 281 ILE H CB  1 
ATOM   2206  C CG1 . ILE A  1 301 ? 23.66761  -0.76331   18.91471  1.000 33.08944  ? 281 ILE H CG1 1 
ATOM   2207  C CG2 . ILE A  1 301 ? 25.92254  -0.07917   17.95972  1.000 28.86433  ? 281 ILE H CG2 1 
ATOM   2208  C CD1 . ILE A  1 301 ? 22.18926  -0.44445   18.82851  1.000 39.67757  ? 281 ILE H CD1 1 
ATOM   2209  N N   . ASP A  1 302 ? 26.99198  1.75029    20.22204  1.000 27.71979  ? 282 ASP H N   1 
ATOM   2210  C CA  . ASP A  1 302 ? 28.10900  1.62006    21.14956  1.000 28.01093  ? 282 ASP H CA  1 
ATOM   2211  C C   . ASP A  1 302 ? 27.80131  2.20859    22.51955  1.000 27.33914  ? 282 ASP H C   1 
ATOM   2212  O O   . ASP A  1 302 ? 28.41830  1.80098    23.50744  1.000 28.24688  ? 282 ASP H O   1 
ATOM   2213  C CB  . ASP A  1 302 ? 29.35062  2.30512    20.57466  1.000 38.58713  ? 282 ASP H CB  1 
ATOM   2214  C CG  . ASP A  1 302 ? 29.92392  1.57877    19.37288  1.000 43.26395  ? 282 ASP H CG  1 
ATOM   2215  O OD1 . ASP A  1 302 ? 29.48233  0.44954    19.08257  1.000 48.33767  ? 282 ASP H OD1 1 
ATOM   2216  O OD2 . ASP A  1 302 ? 30.82036  2.14464    18.71429  1.000 47.87338  ? 282 ASP H OD2 1 
ATOM   2217  N N   . LEU A  1 303 ? 26.87865  3.17278    22.60572  1.000 28.22348  ? 283 LEU H N   1 
ATOM   2218  C CA  . LEU A  1 303 ? 26.51788  3.73319    23.90393  1.000 26.03285  ? 283 LEU H CA  1 
ATOM   2219  C C   . LEU A  1 303 ? 25.82106  2.72088    24.80349  1.000 28.94795  ? 283 LEU H C   1 
ATOM   2220  O O   . LEU A  1 303 ? 25.70328  2.95967    26.00979  1.000 25.78497  ? 283 LEU H O   1 
ATOM   2221  C CB  . LEU A  1 303 ? 25.62747  4.95852    23.72451  1.000 25.35095  ? 283 LEU H CB  1 
ATOM   2222  C CG  . LEU A  1 303 ? 26.31668  6.18883    23.13248  1.000 27.75540  ? 283 LEU H CG  1 
ATOM   2223  C CD1 . LEU A  1 303 ? 25.28922  7.23975    22.81981  1.000 24.80203  ? 283 LEU H CD1 1 
ATOM   2224  C CD2 . LEU A  1 303 ? 27.37437  6.74864    24.07820  1.000 25.50295  ? 283 LEU H CD2 1 
ATOM   2225  N N   . THR A  1 304 ? 25.34936  1.60404    24.25608  1.000 29.19218  ? 284 THR H N   1 
ATOM   2226  C CA  . THR A  1 304 ? 24.80124  0.55893    25.10721  1.000 27.86495  ? 284 THR H CA  1 
ATOM   2227  C C   . THR A  1 304 ? 25.87981  -0.35360   25.67786  1.000 27.21344  ? 284 THR H C   1 
ATOM   2228  O O   . THR A  1 304 ? 25.54570  -1.30530   26.38907  1.000 27.59874  ? 284 THR H O   1 
ATOM   2229  C CB  . THR A  1 304 ? 23.75784  -0.26312   24.34031  1.000 28.36565  ? 284 THR H CB  1 
ATOM   2230  O OG1 . THR A  1 304 ? 24.40411  -1.11279   23.38474  1.000 28.04977  ? 284 THR H OG1 1 
ATOM   2231  C CG2 . THR A  1 304 ? 22.78663  0.65770    23.61895  1.000 27.93947  ? 284 THR H CG2 1 
ATOM   2232  N N   . ASP A  1 305 ? 27.15291  -0.07847   25.39896  1.000 27.62540  ? 285 ASP H N   1 
ATOM   2233  C CA  . ASP A  1 305 ? 28.24250  -0.88060   25.93914  1.000 34.81356  ? 285 ASP H CA  1 
ATOM   2234  C C   . ASP A  1 305 ? 28.32204  -0.73877   27.45412  1.000 34.89352  ? 285 ASP H C   1 
ATOM   2235  O O   . ASP A  1 305 ? 27.90263  0.27034    28.03219  1.000 32.86144  ? 285 ASP H O   1 
ATOM   2236  C CB  . ASP A  1 305 ? 29.58450  -0.45959   25.33520  1.000 37.07258  ? 285 ASP H CB  1 
ATOM   2237  C CG  . ASP A  1 305 ? 29.77167  -0.93328   23.90131  1.000 44.11291  ? 285 ASP H CG  1 
ATOM   2238  O OD1 . ASP A  1 305 ? 29.02191  -1.82892   23.44499  1.000 38.05785  ? 285 ASP H OD1 1 
ATOM   2239  O OD2 . ASP A  1 305 ? 30.69030  -0.40480   23.23378  1.000 41.66742  ? 285 ASP H OD2 1 
ATOM   2240  N N   . VAL A  1 306 ? 28.88158  -1.76798   28.09497  1.000 33.05991  ? 286 VAL H N   1 
ATOM   2241  C CA  . VAL A  1 306 ? 29.16757  -1.69318   29.52615  1.000 31.30614  ? 286 VAL H CA  1 
ATOM   2242  C C   . VAL A  1 306 ? 30.08932  -0.51560   29.81994  1.000 29.20857  ? 286 VAL H C   1 
ATOM   2243  O O   . VAL A  1 306 ? 29.81495  0.30489    30.70227  1.000 38.01021  ? 286 VAL H O   1 
ATOM   2244  C CB  . VAL A  1 306 ? 29.76786  -3.01977   30.02157  1.000 34.41404  ? 286 VAL H CB  1 
ATOM   2245  C CG1 . VAL A  1 306 ? 30.33139  -2.85017   31.42234  1.000 35.21836  ? 286 VAL H CG1 1 
ATOM   2246  C CG2 . VAL A  1 306 ? 28.71081  -4.11467   29.99763  1.000 37.37175  ? 286 VAL H CG2 1 
ATOM   2247  N N   . VAL A  1 307 ? 31.18789  -0.41108   29.07810  1.000 29.89200  ? 287 VAL H N   1 
ATOM   2248  C CA  . VAL A  1 307 ? 32.09205  0.73431    29.15788  1.000 30.20834  ? 287 VAL H CA  1 
ATOM   2249  C C   . VAL A  1 307 ? 32.08961  1.45683    27.81464  1.000 29.42149  ? 287 VAL H C   1 
ATOM   2250  O O   . VAL A  1 307 ? 32.87268  1.10428    26.92334  1.000 35.50266  ? 287 VAL H O   1 
ATOM   2251  C CB  . VAL A  1 307 ? 33.51342  0.29682    29.54434  1.000 30.90865  ? 287 VAL H CB  1 
ATOM   2252  C CG1 . VAL A  1 307 ? 34.37941  1.50804    29.83128  1.000 34.33861  ? 287 VAL H CG1 1 
ATOM   2253  C CG2 . VAL A  1 307 ? 33.47660  -0.62368   30.74188  1.000 31.41962  ? 287 VAL H CG2 1 
ATOM   2254  N N   . PRO A  1 308 ? 31.24462  2.46466    27.62150  1.000 33.94997  ? 288 PRO H N   1 
ATOM   2255  C CA  . PRO A  1 308 ? 31.16977  3.12985    26.31365  1.000 28.94103  ? 288 PRO H CA  1 
ATOM   2256  C C   . PRO A  1 308 ? 32.32599  4.09134    26.06492  1.000 33.56322  ? 288 PRO H C   1 
ATOM   2257  O O   . PRO A  1 308 ? 32.94842  4.61248    26.99389  1.000 28.81168  ? 288 PRO H O   1 
ATOM   2258  C CB  . PRO A  1 308 ? 29.83488  3.88167    26.37794  1.000 27.26949  ? 288 PRO H CB  1 
ATOM   2259  C CG  . PRO A  1 308 ? 29.56882  4.07643    27.82734  1.000 31.81760  ? 288 PRO H CG  1 
ATOM   2260  C CD  . PRO A  1 308 ? 30.20346  2.92728    28.55617  1.000 27.79259  ? 288 PRO H CD  1 
ATOM   2261  N N   . ASP A  1 309 ? 32.60656  4.32211    24.77460  1.000 28.79578  ? 289 ASP H N   1 
ATOM   2262  C CA  . ASP A  1 309 ? 33.66205  5.26316    24.39974  1.000 30.96048  ? 289 ASP H CA  1 
ATOM   2263  C C   . ASP A  1 309 ? 33.28527  6.69570    24.75608  1.000 32.52966  ? 289 ASP H C   1 
ATOM   2264  O O   . ASP A  1 309 ? 34.14790  7.49021    25.14502  1.000 37.40383  ? 289 ASP H O   1 
ATOM   2265  C CB  . ASP A  1 309 ? 33.96934  5.17112    22.90414  1.000 31.40961  ? 289 ASP H CB  1 
ATOM   2266  C CG  . ASP A  1 309 ? 34.38492  3.78591    22.47479  1.000 37.35999  ? 289 ASP H CG  1 
ATOM   2267  O OD1 . ASP A  1 309 ? 33.82135  3.29252    21.47619  1.000 37.95167  ? 289 ASP H OD1 1 
ATOM   2268  O OD2 . ASP A  1 309 ? 35.27054  3.19437    23.12749  1.000 36.29177  ? 289 ASP H OD2 1 
ATOM   2269  N N   . LEU A  1 310 ? 32.01535  7.05400    24.59721  1.000 28.09466  ? 290 LEU H N   1 
ATOM   2270  C CA  . LEU A  1 310 ? 31.50124  8.34796    25.02765  1.000 29.03951  ? 290 LEU H CA  1 
ATOM   2271  C C   . LEU A  1 310 ? 30.71735  8.14445    26.31376  1.000 27.65200  ? 290 LEU H C   1 
ATOM   2272  O O   . LEU A  1 310 ? 29.76815  7.35023    26.34841  1.000 35.88233  ? 290 LEU H O   1 
ATOM   2273  C CB  . LEU A  1 310 ? 30.61664  8.97773    23.95043  1.000 26.58374  ? 290 LEU H CB  1 
ATOM   2274  C CG  . LEU A  1 310 ? 30.00641  10.35343   24.25249  1.000 27.42312  ? 290 LEU H CG  1 
ATOM   2275  C CD1 . LEU A  1 310 ? 31.07599  11.43072   24.43014  1.000 26.47732  ? 290 LEU H CD1 1 
ATOM   2276  C CD2 . LEU A  1 310 ? 29.01165  10.75577   23.16904  1.000 25.64763  ? 290 LEU H CD2 1 
ATOM   2277  N N   . ASP A  1 311 ? 31.11671  8.84119    27.37143  1.000 26.73771  ? 291 ASP H N   1 
ATOM   2278  C CA  . ASP A  1 311 ? 30.35074  8.81759    28.61407  1.000 26.38773  ? 291 ASP H CA  1 
ATOM   2279  C C   . ASP A  1 311 ? 29.38030  9.98790    28.57042  1.000 33.84068  ? 291 ASP H C   1 
ATOM   2280  O O   . ASP A  1 311 ? 29.76039  11.13831   28.81263  1.000 30.67607  ? 291 ASP H O   1 
ATOM   2281  C CB  . ASP A  1 311 ? 31.27664  8.87620    29.82500  1.000 26.98949  ? 291 ASP H CB  1 
ATOM   2282  C CG  . ASP A  1 311 ? 30.57740  9.37741    31.07922  1.000 28.37602  ? 291 ASP H CG  1 
ATOM   2283  O OD1 . ASP A  1 311 ? 29.38569  9.05155    31.25692  1.000 34.06443  ? 291 ASP H OD1 1 
ATOM   2284  O OD2 . ASP A  1 311 ? 31.24468  10.02407   31.91928  1.000 39.63468  ? 291 ASP H OD2 1 
ATOM   2285  N N   . ILE A  1 312 ? 28.11221  9.67284    28.28382  1.000 28.89039  ? 292 ILE H N   1 
ATOM   2286  C CA  . ILE A  1 312 ? 27.05185  10.67470   28.28352  1.000 24.65018  ? 292 ILE H CA  1 
ATOM   2287  C C   . ILE A  1 312 ? 26.54706  10.99287   29.67731  1.000 31.81976  ? 292 ILE H C   1 
ATOM   2288  O O   . ILE A  1 312 ? 25.61718  11.79572   29.81142  1.000 29.62670  ? 292 ILE H O   1 
ATOM   2289  C CB  . ILE A  1 312 ? 25.86984  10.20227   27.40955  1.000 24.22237  ? 292 ILE H CB  1 
ATOM   2290  C CG1 . ILE A  1 312 ? 25.23559  8.94779    28.01665  1.000 30.60614  ? 292 ILE H CG1 1 
ATOM   2291  C CG2 . ILE A  1 312 ? 26.32463  9.95497    25.97615  1.000 24.41522  ? 292 ILE H CG2 1 
ATOM   2292  C CD1 . ILE A  1 312 ? 24.00698  8.44763    27.26407  1.000 23.85045  ? 292 ILE H CD1 1 
ATOM   2293  N N   . TYR A  1 313 ? 27.12994  10.39361   30.71462  1.000 24.95053  ? 293 TYR H N   1 
ATOM   2294  C CA  . TYR A  1 313 ? 26.78837  10.71669   32.09205  1.000 36.45780  ? 293 TYR H CA  1 
ATOM   2295  C C   . TYR A  1 313 ? 27.79506  11.66771   32.71986  1.000 30.73797  ? 293 TYR H C   1 
ATOM   2296  O O   . TYR A  1 313 ? 27.72215  11.93385   33.92428  1.000 39.35670  ? 293 TYR H O   1 
ATOM   2297  C CB  . TYR A  1 313 ? 26.65660  9.43209    32.91681  1.000 25.25589  ? 293 TYR H CB  1 
ATOM   2298  C CG  . TYR A  1 313 ? 25.49635  8.59094    32.43698  1.000 34.25243  ? 293 TYR H CG  1 
ATOM   2299  C CD1 . TYR A  1 313 ? 25.69699  7.50679    31.58320  1.000 32.34174  ? 293 TYR H CD1 1 
ATOM   2300  C CD2 . TYR A  1 313 ? 24.19380  8.90533    32.80233  1.000 26.80787  ? 293 TYR H CD2 1 
ATOM   2301  C CE1 . TYR A  1 313 ? 24.63066  6.75055    31.12160  1.000 35.40024  ? 293 TYR H CE1 1 
ATOM   2302  C CE2 . TYR A  1 313 ? 23.12042  8.15390    32.35024  1.000 33.10426  ? 293 TYR H CE2 1 
ATOM   2303  C CZ  . TYR A  1 313 ? 23.34387  7.07988    31.50886  1.000 36.72720  ? 293 TYR H CZ  1 
ATOM   2304  O OH  . TYR A  1 313 ? 22.27892  6.33767    31.05395  1.000 30.37834  ? 293 TYR H OH  1 
ATOM   2305  N N   . ASP A  1 314 ? 28.72788  12.18708   31.92659  1.000 28.52944  ? 294 ASP H N   1 
ATOM   2306  C CA  . ASP A  1 314 ? 29.67559  13.17279   32.41965  1.000 26.30702  ? 294 ASP H CA  1 
ATOM   2307  C C   . ASP A  1 314 ? 28.96830  14.49494   32.69494  1.000 31.98974  ? 294 ASP H C   1 
ATOM   2308  O O   . ASP A  1 314 ? 28.11846  14.93902   31.91653  1.000 31.47115  ? 294 ASP H O   1 
ATOM   2309  C CB  . ASP A  1 314 ? 30.79345  13.38478   31.40066  1.000 32.64967  ? 294 ASP H CB  1 
ATOM   2310  C CG  . ASP A  1 314 ? 31.70399  14.54468   31.76651  1.000 40.73052  ? 294 ASP H CG  1 
ATOM   2311  O OD1 . ASP A  1 314 ? 32.20660  14.59597   32.91285  1.000 42.56637  ? 294 ASP H OD1 1 
ATOM   2312  O OD2 . ASP A  1 314 ? 31.87857  15.43372   30.90492  1.000 44.45283  ? 294 ASP H OD2 1 
ATOM   2313  N N   . LYS A  1 315 ? 29.31152  15.12091   33.82011  1.000 28.91855  ? 295 LYS H N   1 
ATOM   2314  C CA  . LYS A  1 315 ? 28.78978  16.43572   34.15967  1.000 38.34668  ? 295 LYS H CA  1 
ATOM   2315  C C   . LYS A  1 315 ? 29.86290  17.51415   34.15921  1.000 36.14293  ? 295 LYS H C   1 
ATOM   2316  O O   . LYS A  1 315 ? 29.53467  18.69582   34.31895  1.000 44.91555  ? 295 LYS H O   1 
ATOM   2317  C CB  . LYS A  1 315 ? 28.08257  16.39387   35.52220  1.000 41.24031  ? 295 LYS H CB  1 
ATOM   2318  C CG  . LYS A  1 315 ? 26.81541  15.55377   35.51491  1.000 31.54463  ? 295 LYS H CG  1 
ATOM   2319  C CD  . LYS A  1 315 ? 26.37289  15.18169   36.91350  1.000 40.27215  ? 295 LYS H CD  1 
ATOM   2320  C CE  . LYS A  1 315 ? 25.33851  16.15530   37.43637  1.000 54.27893  ? 295 LYS H CE  1 
ATOM   2321  N NZ  . LYS A  1 315 ? 24.08702  15.44793   37.83679  1.000 60.26963  ? 295 LYS H NZ  1 
ATOM   2322  N N   . SER A  1 316 ? 31.12984  17.14527   33.96312  1.000 31.69995  ? 296 SER H N   1 
ATOM   2323  C CA  . SER A  1 316 ? 32.20835  18.12790   33.95766  1.000 35.87008  ? 296 SER H CA  1 
ATOM   2324  C C   . SER A  1 316 ? 32.24600  18.95428   32.67268  1.000 32.74599  ? 296 SER H C   1 
ATOM   2325  O O   . SER A  1 316 ? 32.61677  20.13124   32.71482  1.000 33.43629  ? 296 SER H O   1 
ATOM   2326  C CB  . SER A  1 316 ? 33.55212  17.43067   34.17378  1.000 29.29350  ? 296 SER H CB  1 
ATOM   2327  O OG  . SER A  1 316 ? 33.94506  16.73441   33.00434  1.000 35.17881  ? 296 SER H OG  1 
ATOM   2328  N N   . TRP A  1 317 ? 31.88678  18.36912   31.52933  1.000 29.39088  ? 297 TRP H N   1 
ATOM   2329  C CA  . TRP A  1 317 ? 31.82299  19.08237   30.25101  1.000 27.61961  ? 297 TRP H CA  1 
ATOM   2330  C C   . TRP A  1 317 ? 30.45884  18.78879   29.64331  1.000 26.75701  ? 297 TRP H C   1 
ATOM   2331  O O   . TRP A  1 317 ? 30.33775  17.98727   28.70896  1.000 26.43506  ? 297 TRP H O   1 
ATOM   2332  C CB  . TRP A  1 317 ? 32.96465  18.66258   29.32207  1.000 28.04044  ? 297 TRP H CB  1 
ATOM   2333  C CG  . TRP A  1 317 ? 33.21224  19.58637   28.14997  1.000 28.32999  ? 297 TRP H CG  1 
ATOM   2334  C CD1 . TRP A  1 317 ? 32.74776  19.43305   26.87517  1.000 27.82266  ? 297 TRP H CD1 1 
ATOM   2335  C CD2 . TRP A  1 317 ? 34.01188  20.77859   28.14218  1.000 28.96977  ? 297 TRP H CD2 1 
ATOM   2336  N NE1 . TRP A  1 317 ? 33.19401  20.46129   26.07975  1.000 28.26425  ? 297 TRP H NE1 1 
ATOM   2337  C CE2 . TRP A  1 317 ? 33.97507  21.29804   26.83126  1.000 28.96553  ? 297 TRP H CE2 1 
ATOM   2338  C CE3 . TRP A  1 317 ? 34.75010  21.45711   29.11504  1.000 29.73199  ? 297 TRP H CE3 1 
ATOM   2339  C CZ2 . TRP A  1 317 ? 34.64640  22.46471   26.46834  1.000 29.67988  ? 297 TRP H CZ2 1 
ATOM   2340  C CZ3 . TRP A  1 317 ? 35.41856  22.62184   28.75186  1.000 33.95544  ? 297 TRP H CZ3 1 
ATOM   2341  C CH2 . TRP A  1 317 ? 35.35941  23.11291   27.44095  1.000 30.40791  ? 297 TRP H CH2 1 
ATOM   2342  N N   . PRO A  1 318 ? 29.40816  19.42312   30.14948  1.000 26.47216  ? 298 PRO H N   1 
ATOM   2343  C CA  . PRO A  1 318 ? 28.04958  19.00796   29.79614  1.000 25.74851  ? 298 PRO H CA  1 
ATOM   2344  C C   . PRO A  1 318 ? 27.62257  19.50024   28.42310  1.000 28.96948  ? 298 PRO H C   1 
ATOM   2345  O O   . PRO A  1 318 ? 28.07988  20.53219   27.92731  1.000 26.97718  ? 298 PRO H O   1 
ATOM   2346  C CB  . PRO A  1 318 ? 27.19942  19.64908   30.89501  1.000 25.75400  ? 298 PRO H CB  1 
ATOM   2347  C CG  . PRO A  1 318 ? 27.96316  20.88849   31.23486  1.000 34.45426  ? 298 PRO H CG  1 
ATOM   2348  C CD  . PRO A  1 318 ? 29.41767  20.53836   31.10663  1.000 26.92497  ? 298 PRO H CD  1 
ATOM   2349  N N   . ILE A  1 319 ? 26.72200  18.73663   27.81474  1.000 25.48221  ? 299 ILE H N   1 
ATOM   2350  C CA  . ILE A  1 319 ? 26.20166  19.02084   26.48485  1.000 24.79091  ? 299 ILE H CA  1 
ATOM   2351  C C   . ILE A  1 319 ? 24.81190  19.61575   26.67313  1.000 24.51176  ? 299 ILE H C   1 
ATOM   2352  O O   . ILE A  1 319 ? 23.85711  18.90530   27.00199  1.000 25.21155  ? 299 ILE H O   1 
ATOM   2353  C CB  . ILE A  1 319 ? 26.15675  17.76583   25.61051  1.000 24.54584  ? 299 ILE H CB  1 
ATOM   2354  C CG1 . ILE A  1 319 ? 27.53031  17.08955   25.55382  1.000 29.47990  ? 299 ILE H CG1 1 
ATOM   2355  C CG2 . ILE A  1 319 ? 25.65980  18.11617   24.21134  1.000 24.49861  ? 299 ILE H CG2 1 
ATOM   2356  C CD1 . ILE A  1 319 ? 28.61515  17.94747   24.95467  1.000 25.50106  ? 299 ILE H CD1 1 
ATOM   2357  N N   . TRP A  1 320 ? 24.69160  20.92231   26.46920  1.000 24.80084  ? 300 TRP H N   1 
ATOM   2358  C CA  . TRP A  1 320 ? 23.38725  21.55958   26.54949  1.000 24.68014  ? 300 TRP H CA  1 
ATOM   2359  C C   . TRP A  1 320 ? 22.57712  21.22856   25.30051  1.000 33.19383  ? 300 TRP H C   1 
ATOM   2360  O O   . TRP A  1 320 ? 23.12690  20.97607   24.22338  1.000 26.14631  ? 300 TRP H O   1 
ATOM   2361  C CB  . TRP A  1 320 ? 23.53811  23.07131   26.71599  1.000 25.20996  ? 300 TRP H CB  1 
ATOM   2362  C CG  . TRP A  1 320 ? 22.23594  23.81551   26.82084  1.000 25.99500  ? 300 TRP H CG  1 
ATOM   2363  C CD1 . TRP A  1 320 ? 21.61640  24.51548   25.82915  1.000 25.40205  ? 300 TRP H CD1 1 
ATOM   2364  C CD2 . TRP A  1 320 ? 21.40059  23.94076   27.98086  1.000 25.26294  ? 300 TRP H CD2 1 
ATOM   2365  N NE1 . TRP A  1 320 ? 20.44908  25.06347   26.29429  1.000 25.51737  ? 300 TRP H NE1 1 
ATOM   2366  C CE2 . TRP A  1 320 ? 20.29184  24.72689   27.61174  1.000 25.43661  ? 300 TRP H CE2 1 
ATOM   2367  C CE3 . TRP A  1 320 ? 21.48225  23.46303   29.29282  1.000 25.73299  ? 300 TRP H CE3 1 
ATOM   2368  C CZ2 . TRP A  1 320 ? 19.26770  25.04720   28.50481  1.000 25.59819  ? 300 TRP H CZ2 1 
ATOM   2369  C CZ3 . TRP A  1 320 ? 20.46521  23.78197   30.18223  1.000 28.43400  ? 300 TRP H CZ3 1 
ATOM   2370  C CH2 . TRP A  1 320 ? 19.37229  24.56734   29.78241  1.000 29.70835  ? 300 TRP H CH2 1 
ATOM   2371  N N   . THR A  1 321 ? 21.25655  21.21540   25.45787  1.000 30.04789  ? 301 THR H N   1 
ATOM   2372  C CA  . THR A  1 321 ? 20.35388  20.83560   24.38109  1.000 27.09198  ? 301 THR H CA  1 
ATOM   2373  C C   . THR A  1 321 ? 18.97412  21.39108   24.70353  1.000 24.09447  ? 301 THR H C   1 
ATOM   2374  O O   . THR A  1 321 ? 18.74217  21.93512   25.78146  1.000 24.23351  ? 301 THR H O   1 
ATOM   2375  C CB  . THR A  1 321 ? 20.30251  19.31271   24.20234  1.000 27.88901  ? 301 THR H CB  1 
ATOM   2376  O OG1 . THR A  1 321 ? 19.66370  19.00290   22.95880  1.000 23.76112  ? 301 THR H OG1 1 
ATOM   2377  C CG2 . THR A  1 321 ? 19.52285  18.65762   25.34322  1.000 23.40320  ? 301 THR H CG2 1 
ATOM   2378  N N   . TYR A  1 322 ? 18.06102  21.26222   23.74692  1.000 24.09649  ? 302 TYR H N   1 
ATOM   2379  C CA  . TYR A  1 322 ? 16.65234  21.51191   24.02457  1.000 24.18631  ? 302 TYR H CA  1 
ATOM   2380  C C   . TYR A  1 322 ? 16.06317  20.29424   24.72261  1.000 23.82239  ? 302 TYR H C   1 
ATOM   2381  O O   . TYR A  1 322 ? 16.08958  19.18725   24.17642  1.000 28.21821  ? 302 TYR H O   1 
ATOM   2382  C CB  . TYR A  1 322 ? 15.87607  21.80665   22.74700  1.000 24.45331  ? 302 TYR H CB  1 
ATOM   2383  C CG  . TYR A  1 322 ? 14.40212  22.01139   23.01227  1.000 32.50925  ? 302 TYR H CG  1 
ATOM   2384  C CD1 . TYR A  1 322 ? 13.96835  23.03738   23.84193  1.000 25.00449  ? 302 TYR H CD1 1 
ATOM   2385  C CD2 . TYR A  1 322 ? 13.44571  21.17041   22.45459  1.000 24.60829  ? 302 TYR H CD2 1 
ATOM   2386  C CE1 . TYR A  1 322 ? 12.63021  23.23311   24.09730  1.000 25.30788  ? 302 TYR H CE1 1 
ATOM   2387  C CE2 . TYR A  1 322 ? 12.09558  21.36084   22.70815  1.000 25.92571  ? 302 TYR H CE2 1 
ATOM   2388  C CZ  . TYR A  1 322 ? 11.69827  22.39332   23.52957  1.000 29.16461  ? 302 TYR H CZ  1 
ATOM   2389  O OH  . TYR A  1 322 ? 10.36533  22.59100   23.79163  1.000 32.74882  ? 302 TYR H OH  1 
ATOM   2390  N N   . ALA A  1 323 ? 15.53578  20.49470   25.92591  1.000 25.19274  ? 303 ALA H N   1 
ATOM   2391  C CA  . ALA A  1 323 ? 14.93592  19.41491   26.69554  1.000 28.88100  ? 303 ALA H CA  1 
ATOM   2392  C C   . ALA A  1 323 ? 13.61643  19.89016   27.27408  1.000 30.69398  ? 303 ALA H C   1 
ATOM   2393  O O   . ALA A  1 323 ? 13.53406  20.99309   27.82301  1.000 41.21004  ? 303 ALA H O   1 
ATOM   2394  C CB  . ALA A  1 323 ? 15.86021  18.94541   27.82388  1.000 32.60270  ? 303 ALA H CB  1 
ATOM   2395  N N   . GLU A  1 324 ? 12.59246  19.06186   27.14170  1.000 24.96067  ? 304 GLU H N   1 
ATOM   2396  C CA  . GLU A  1 324 ? 11.29359  19.31764   27.73862  1.000 26.61365  ? 304 GLU H CA  1 
ATOM   2397  C C   . GLU A  1 324 ? 11.12961  18.45818   28.98234  1.000 28.09030  ? 304 GLU H C   1 
ATOM   2398  O O   . GLU A  1 324 ? 11.78738  17.42760   29.14198  1.000 29.30643  ? 304 GLU H O   1 
ATOM   2399  C CB  . GLU A  1 324 ? 10.16826  19.02840   26.73889  1.000 32.48808  ? 304 GLU H CB  1 
ATOM   2400  C CG  . GLU A  1 324 ? 9.94876   20.13790   25.72275  1.000 32.09974  ? 304 GLU H CG  1 
ATOM   2401  C CD  . GLU A  1 324 ? 8.82611   19.83215   24.73914  1.000 41.70797  ? 304 GLU H CD  1 
ATOM   2402  O OE1 . GLU A  1 324 ? 8.32621   18.68712   24.73077  1.000 37.60802  ? 304 GLU H OE1 1 
ATOM   2403  O OE2 . GLU A  1 324 ? 8.44518   20.74068   23.96751  1.000 45.12217  ? 304 GLU H OE2 1 
ATOM   2404  N N   . ILE A  1 325 ? 10.25777  18.90665   29.88316  1.000 32.90900  ? 305 ILE H N   1 
ATOM   2405  C CA  . ILE A  1 325 ? 9.91051   18.07029   31.02381  1.000 33.34658  ? 305 ILE H CA  1 
ATOM   2406  C C   . ILE A  1 325 ? 9.20377   16.82817   30.50926  1.000 29.57028  ? 305 ILE H C   1 
ATOM   2407  O O   . ILE A  1 325 ? 8.13211   16.91559   29.89955  1.000 30.19818  ? 305 ILE H O   1 
ATOM   2408  C CB  . ILE A  1 325 ? 9.03995   18.83491   32.01769  1.000 32.53697  ? 305 ILE H CB  1 
ATOM   2409  C CG1 . ILE A  1 325 ? 9.80296   20.02592   32.58193  1.000 33.36177  ? 305 ILE H CG1 1 
ATOM   2410  C CG2 . ILE A  1 325 ? 8.58481   17.92491   33.13878  1.000 32.32164  ? 305 ILE H CG2 1 
ATOM   2411  C CD1 . ILE A  1 325 ? 8.89199   21.08472   33.10222  1.000 32.39119  ? 305 ILE H CD1 1 
ATOM   2412  N N   . THR A  1 326 ? 9.80700   15.66574   30.73717  1.000 33.41698  ? 306 THR H N   1 
ATOM   2413  C CA  . THR A  1 326 ? 9.25295   14.43499   30.20870  1.000 35.67616  ? 306 THR H CA  1 
ATOM   2414  C C   . THR A  1 326 ? 8.94252   13.45694   31.33242  1.000 29.33442  ? 306 THR H C   1 
ATOM   2415  O O   . THR A  1 326 ? 9.72479   13.33314   32.27992  1.000 28.62786  ? 306 THR H O   1 
ATOM   2416  C CB  . THR A  1 326 ? 10.21914  13.76379   29.22398  1.000 40.36859  ? 306 THR H CB  1 
ATOM   2417  O OG1 . THR A  1 326 ? 11.37564  13.30966   29.93282  1.000 40.77822  ? 306 THR H OG1 1 
ATOM   2418  C CG2 . THR A  1 326 ? 10.64404  14.73165   28.13675  1.000 41.73530  ? 306 THR H CG2 1 
ATOM   2419  N N   . PRO A  1 327 ? 7.82358   12.74642   31.25348  1.000 29.48952  ? 307 PRO H N   1 
ATOM   2420  C CA  . PRO A  1 327 ? 7.55680   11.66989   32.21105  1.000 33.94073  ? 307 PRO H CA  1 
ATOM   2421  C C   . PRO A  1 327 ? 8.61655   10.58834   32.10813  1.000 28.82367  ? 307 PRO H C   1 
ATOM   2422  O O   . PRO A  1 327 ? 9.31104   10.47919   31.08675  1.000 28.08865  ? 307 PRO H O   1 
ATOM   2423  C CB  . PRO A  1 327 ? 6.17680   11.14608   31.78226  1.000 34.37332  ? 307 PRO H CB  1 
ATOM   2424  C CG  . PRO A  1 327 ? 6.02113   11.59005   30.36699  1.000 30.39519  ? 307 PRO H CG  1 
ATOM   2425  C CD  . PRO A  1 327 ? 6.74290   12.89646   30.26787  1.000 31.47480  ? 307 PRO H CD  1 
ATOM   2426  N N   . PRO A  1 328 ? 8.78226   9.77491    33.14397  1.000 28.94450  ? 308 PRO H N   1 
ATOM   2427  C CA  . PRO A  1 328 ? 9.84164   8.75960    33.12172  1.000 32.73617  ? 308 PRO H CA  1 
ATOM   2428  C C   . PRO A  1 328 ? 9.48066   7.59797    32.20698  1.000 33.26038  ? 308 PRO H C   1 
ATOM   2429  O O   . PRO A  1 328 ? 8.38754   7.51793    31.63994  1.000 30.42182  ? 308 PRO H O   1 
ATOM   2430  C CB  . PRO A  1 328 ? 9.95162   8.31795    34.58333  1.000 28.62504  ? 308 PRO H CB  1 
ATOM   2431  C CG  . PRO A  1 328 ? 8.62958   8.66013    35.18325  1.000 36.39227  ? 308 PRO H CG  1 
ATOM   2432  C CD  . PRO A  1 328 ? 8.06832   9.82370    34.43104  1.000 37.58053  ? 308 PRO H CD  1 
ATOM   2433  N N   . ALA A  1 329 ? 10.44440  6.69560    32.04831  1.000 27.51833  ? 309 ALA H N   1 
ATOM   2434  C CA  . ALA A  1 329 ? 10.20064  5.47599    31.29499  1.000 29.81566  ? 309 ALA H CA  1 
ATOM   2435  C C   . ALA A  1 329 ? 9.37880   4.50048    32.12629  1.000 35.68147  ? 309 ALA H C   1 
ATOM   2436  O O   . ALA A  1 329 ? 9.39835   4.52839    33.36070  1.000 39.28075  ? 309 ALA H O   1 
ATOM   2437  C CB  . ALA A  1 329 ? 11.51850  4.82501    30.87106  1.000 26.75444  ? 309 ALA H CB  1 
ATOM   2438  N N   . LYS A  1 330 ? 8.65373   3.62744    31.43291  1.000 36.42352  ? 310 LYS H N   1 
ATOM   2439  C CA  . LYS A  1 330 ? 7.73650   2.69476    32.07110  1.000 29.75501  ? 310 LYS H CA  1 
ATOM   2440  C C   . LYS A  1 330 ? 7.81710   1.35387    31.35922  1.000 29.80662  ? 310 LYS H C   1 
ATOM   2441  O O   . LYS A  1 330 ? 7.78829   1.29716    30.12565  1.000 38.20578  ? 310 LYS H O   1 
ATOM   2442  C CB  . LYS A  1 330 ? 6.30116   3.23689    32.03995  1.000 30.67951  ? 310 LYS H CB  1 
ATOM   2443  C CG  . LYS A  1 330 ? 5.23359   2.29523    32.58393  1.000 34.32016  ? 310 LYS H CG  1 
ATOM   2444  C CD  . LYS A  1 330 ? 3.84036   2.91329    32.43751  1.000 32.83642  ? 310 LYS H CD  1 
ATOM   2445  C CE  . LYS A  1 330 ? 2.84821   2.29442    33.40996  1.000 35.18783  ? 310 LYS H CE  1 
ATOM   2446  N NZ  . LYS A  1 330 ? 3.21573   2.57453    34.82094  1.000 36.99824  ? 310 LYS H NZ  1 
ATOM   2447  N N   . PHE A  1 331 ? 7.92521   0.28187    32.13523  1.000 37.52522  ? 311 PHE H N   1 
ATOM   2448  C CA  . PHE A  1 331 ? 7.89720   -1.08142   31.62127  1.000 30.57356  ? 311 PHE H CA  1 
ATOM   2449  C C   . PHE A  1 331 ? 6.70329   -1.79534   32.23878  1.000 31.86542  ? 311 PHE H C   1 
ATOM   2450  O O   . PHE A  1 331 ? 6.48952   -1.69835   33.44986  1.000 33.79278  ? 311 PHE H O   1 
ATOM   2451  C CB  . PHE A  1 331 ? 9.20250   -1.81681   31.95527  1.000 35.16245  ? 311 PHE H CB  1 
ATOM   2452  C CG  . PHE A  1 331 ? 10.44263  -1.06969   31.54595  1.000 28.95459  ? 311 PHE H CG  1 
ATOM   2453  C CD1 . PHE A  1 331 ? 11.03479  -1.30631   30.31438  1.000 31.96360  ? 311 PHE H CD1 1 
ATOM   2454  C CD2 . PHE A  1 331 ? 11.01231  -0.13063   32.38662  1.000 28.54993  ? 311 PHE H CD2 1 
ATOM   2455  C CE1 . PHE A  1 331 ? 12.17523  -0.61845   29.92987  1.000 27.44628  ? 311 PHE H CE1 1 
ATOM   2456  C CE2 . PHE A  1 331 ? 12.14587  0.55690    32.00693  1.000 27.61883  ? 311 PHE H CE2 1 
ATOM   2457  C CZ  . PHE A  1 331 ? 12.72711  0.31240    30.77642  1.000 27.07107  ? 311 PHE H CZ  1 
ATOM   2458  N N   . VAL A  1 332 ? 5.91785   -2.50194   31.42162  1.000 39.49304  ? 312 VAL H N   1 
ATOM   2459  C CA  . VAL A  1 332 ? 4.70464   -3.15048   31.91445  1.000 42.50293  ? 312 VAL H CA  1 
ATOM   2460  C C   . VAL A  1 332 ? 4.53389   -4.53286   31.28839  1.000 34.46205  ? 312 VAL H C   1 
ATOM   2461  O O   . VAL A  1 332 ? 5.03371   -4.80482   30.19206  1.000 33.90630  ? 312 VAL H O   1 
ATOM   2462  C CB  . VAL A  1 332 ? 3.44628   -2.28256   31.66673  1.000 49.45526  ? 312 VAL H CB  1 
ATOM   2463  C CG1 . VAL A  1 332 ? 3.30540   -1.23075   32.75457  1.000 47.92820  ? 312 VAL H CG1 1 
ATOM   2464  C CG2 . VAL A  1 332 ? 3.49635   -1.62268   30.29615  1.000 49.60156  ? 312 VAL H CG2 1 
ATOM   2465  N N   . HIS A  1 333 ? 3.79542   -5.39407   32.00866  1.000 35.72883  ? 313 HIS H N   1 
ATOM   2466  C CA  . HIS A  1 333 ? 3.50179   -6.79841   31.70985  1.000 36.66841  ? 313 HIS H CA  1 
ATOM   2467  C C   . HIS A  1 333 ? 4.70242   -7.70977   31.92969  1.000 36.29155  ? 313 HIS H C   1 
ATOM   2468  O O   . HIS A  1 333 ? 5.83723   -7.36906   31.59374  1.000 35.93940  ? 313 HIS H O   1 
ATOM   2469  C CB  . HIS A  1 333 ? 2.94814   -6.96299   30.29460  1.000 39.67063  ? 313 HIS H CB  1 
ATOM   2470  C CG  . HIS A  1 333 ? 1.82459   -6.02719   30.00364  1.000 51.61700  ? 313 HIS H CG  1 
ATOM   2471  N ND1 . HIS A  1 333 ? 2.03182   -4.74315   29.55140  1.000 54.65350  ? 313 HIS H ND1 1 
ATOM   2472  C CD2 . HIS A  1 333 ? 0.48794   -6.16074   30.16463  1.000 49.06891  ? 313 HIS H CD2 1 
ATOM   2473  C CE1 . HIS A  1 333 ? 0.86818   -4.13527   29.42236  1.000 52.44828  ? 313 HIS H CE1 1 
ATOM   2474  N NE2 . HIS A  1 333 ? -0.08480  -4.97251   29.78731  1.000 50.25077  ? 313 HIS H NE2 1 
ATOM   2475  N N   . ASP A  1 334 ? 4.42321   -8.88550   32.48788  1.000 37.46002  ? 314 ASP H N   1 
ATOM   2476  C CA  . ASP A  1 334 ? 5.44250   -9.82463   32.93065  1.000 44.08760  ? 314 ASP H CA  1 
ATOM   2477  C C   . ASP A  1 334 ? 4.80983   -11.19539  33.07945  1.000 40.61394  ? 314 ASP H C   1 
ATOM   2478  O O   . ASP A  1 334 ? 4.53394   -11.63361  34.20019  1.000 40.00418  ? 314 ASP H O   1 
ATOM   2479  C CB  . ASP A  1 334 ? 6.02971   -9.34415   34.25591  1.000 44.02650  ? 314 ASP H CB  1 
ATOM   2480  C CG  . ASP A  1 334 ? 7.17890   -10.20488  34.74536  1.000 46.82171  ? 314 ASP H CG  1 
ATOM   2481  O OD1 . ASP A  1 334 ? 7.92547   -10.75508  33.90776  1.000 48.80530  ? 314 ASP H OD1 1 
ATOM   2482  O OD2 . ASP A  1 334 ? 7.34483   -10.31153  35.98189  1.000 52.93117  ? 314 ASP H OD2 1 
ATOM   2483  N N   . ASP A  1 335 ? 4.53934   -11.88406  31.97963  1.000 39.91272  ? 315 ASP H N   1 
ATOM   2484  C CA  . ASP A  1 335 ? 3.69171   -13.07125  32.03068  1.000 41.52425  ? 315 ASP H CA  1 
ATOM   2485  C C   . ASP A  1 335 ? 4.42221   -14.22000  31.34476  1.000 49.20403  ? 315 ASP H C   1 
ATOM   2486  O O   . ASP A  1 335 ? 5.63246   -14.16402  31.10458  1.000 50.18450  ? 315 ASP H O   1 
ATOM   2487  C CB  . ASP A  1 335 ? 2.31780   -12.74942  31.41473  1.000 41.81227  ? 315 ASP H CB  1 
ATOM   2488  C CG  . ASP A  1 335 ? 2.35362   -12.72086  29.90045  1.000 43.18639  ? 315 ASP H CG  1 
ATOM   2489  O OD1 . ASP A  1 335 ? 3.44146   -12.87460  29.31122  1.000 56.72485  ? 315 ASP H OD1 1 
ATOM   2490  O OD2 . ASP A  1 335 ? 1.29687   -12.54584  29.27077  1.000 60.30516  ? 315 ASP H OD2 1 
ATOM   2491  N N   . GLU A  1 336 ? 3.67549   -15.27442  31.02514  1.000 57.20320  ? 316 GLU H N   1 
ATOM   2492  C CA  . GLU A  1 336 ? 4.24505   -16.40524  30.30941  1.000 57.76115  ? 316 GLU H CA  1 
ATOM   2493  C C   . GLU A  1 336 ? 4.54052   -16.06911  28.85478  1.000 51.38371  ? 316 GLU H C   1 
ATOM   2494  O O   . GLU A  1 336 ? 5.41213   -16.69786  28.24421  1.000 53.49168  ? 316 GLU H O   1 
ATOM   2495  C CB  . GLU A  1 336 ? 3.28467   -17.58766  30.38121  1.000 62.94555  ? 316 GLU H CB  1 
ATOM   2496  C CG  . GLU A  1 336 ? 2.46881   -17.71245  31.67758  1.000 70.20015  ? 316 GLU H CG  1 
ATOM   2497  C CD  . GLU A  1 336 ? 3.29845   -17.73445  32.96161  1.000 76.02591  ? 316 GLU H CD  1 
ATOM   2498  O OE1 . GLU A  1 336 ? 2.70054   -17.95701  34.03742  1.000 77.40831  ? 316 GLU H OE1 1 
ATOM   2499  O OE2 . GLU A  1 336 ? 4.53639   -17.57069  32.91410  1.000 74.15497  ? 316 GLU H OE2 1 
ATOM   2500  N N   . ASP A  1 337 ? 3.81605   -15.10507  28.28248  1.000 42.61874  ? 317 ASP H N   1 
ATOM   2501  C CA  . ASP A  1 337 ? 3.86293   -14.79247  26.85876  1.000 47.12518  ? 317 ASP H CA  1 
ATOM   2502  C C   . ASP A  1 337 ? 4.56233   -13.48033  26.53174  1.000 45.85854  ? 317 ASP H C   1 
ATOM   2503  O O   . ASP A  1 337 ? 5.14986   -13.36541  25.45445  1.000 50.45188  ? 317 ASP H O   1 
ATOM   2504  C CB  . ASP A  1 337 ? 2.43583   -14.74844  26.29875  1.000 57.32179  ? 317 ASP H CB  1 
ATOM   2505  C CG  . ASP A  1 337 ? 1.64908   -16.00518  26.63760  1.000 58.90180  ? 317 ASP H CG  1 
ATOM   2506  O OD1 . ASP A  1 337 ? 2.20633   -17.10958  26.46450  1.000 52.81485  ? 317 ASP H OD1 1 
ATOM   2507  O OD2 . ASP A  1 337 ? 0.49475   -15.88955  27.11178  1.000 53.61117  ? 317 ASP H OD2 1 
ATOM   2508  N N   . ARG A  1 338 ? 4.51479   -12.49320  27.43092  1.000 41.85008  ? 318 ARG H N   1 
ATOM   2509  C CA  . ARG A  1 338 ? 5.08030   -11.17470  27.18266  1.000 39.80145  ? 318 ARG H CA  1 
ATOM   2510  C C   . ARG A  1 338 ? 5.69980   -10.61042  28.45393  1.000 40.29799  ? 318 ARG H C   1 
ATOM   2511  O O   . ARG A  1 338 ? 5.30636   -10.95573  29.57217  1.000 43.98360  ? 318 ARG H O   1 
ATOM   2512  C CB  . ARG A  1 338 ? 4.01820   -10.19669  26.65565  1.000 46.34543  ? 318 ARG H CB  1 
ATOM   2513  C CG  . ARG A  1 338 ? 2.83976   -10.00482  27.59994  1.000 52.28904  ? 318 ARG H CG  1 
ATOM   2514  C CD  . ARG A  1 338 ? 1.74541   -9.16586   26.96368  1.000 53.25744  ? 318 ARG H CD  1 
ATOM   2515  N NE  . ARG A  1 338 ? 0.63016   -8.94478   27.87923  1.000 50.66939  ? 318 ARG H NE  1 
ATOM   2516  C CZ  . ARG A  1 338 ? -0.43151  -8.19897   27.59476  1.000 43.91851  ? 318 ARG H CZ  1 
ATOM   2517  N NH1 . ARG A  1 338 ? -0.52467  -7.59613   26.41755  1.000 39.77317  ? 318 ARG H NH1 1 
ATOM   2518  N NH2 . ARG A  1 338 ? -1.39822  -8.05342   28.49008  1.000 44.07183  ? 318 ARG H NH2 1 
ATOM   2519  N N   . ARG A  1 339 ? 6.67021   -9.71916   28.26056  1.000 45.00432  ? 319 ARG H N   1 
ATOM   2520  C CA  . ARG A  1 339 ? 7.31858   -9.00836   29.35456  1.000 34.49351  ? 319 ARG H CA  1 
ATOM   2521  C C   . ARG A  1 339 ? 7.89124   -7.71292   28.80152  1.000 38.28263  ? 319 ARG H C   1 
ATOM   2522  O O   . ARG A  1 339 ? 8.62004   -7.73466   27.80511  1.000 32.50373  ? 319 ARG H O   1 
ATOM   2523  C CB  . ARG A  1 339 ? 8.42519   -9.85340   29.99086  1.000 37.21207  ? 319 ARG H CB  1 
ATOM   2524  C CG  . ARG A  1 339 ? 9.22505   -9.12512   31.05683  1.000 39.49475  ? 319 ARG H CG  1 
ATOM   2525  C CD  . ARG A  1 339 ? 10.58085  -9.77642   31.27491  1.000 42.50230  ? 319 ARG H CD  1 
ATOM   2526  N NE  . ARG A  1 339 ? 10.47224  -11.05489  31.97041  1.000 47.97430  ? 319 ARG H NE  1 
ATOM   2527  C CZ  . ARG A  1 339 ? 11.45060  -11.95313  32.03018  1.000 52.35084  ? 319 ARG H CZ  1 
ATOM   2528  N NH1 . ARG A  1 339 ? 12.61142  -11.71123  31.43352  1.000 55.82609  ? 319 ARG H NH1 1 
ATOM   2529  N NH2 . ARG A  1 339 ? 11.27200  -13.08982  32.68899  1.000 46.01475  ? 319 ARG H NH2 1 
ATOM   2530  N N   . GLY A  1 340 ? 7.54539   -6.59272   29.42915  1.000 32.83893  ? 320 GLY H N   1 
ATOM   2531  C CA  . GLY A  1 340 ? 8.13370   -5.32433   29.05066  1.000 40.12035  ? 320 GLY H CA  1 
ATOM   2532  C C   . GLY A  1 340 ? 9.42792   -5.08213   29.79797  1.000 36.57804  ? 320 GLY H C   1 
ATOM   2533  O O   . GLY A  1 340 ? 9.40909   -4.82928   31.00605  1.000 39.42282  ? 320 GLY H O   1 
ATOM   2534  N N   . SER A  1 341 ? 10.56104  -5.16784   29.10563  1.000 31.51756  ? 321 SER H N   1 
ATOM   2535  C CA  . SER A  1 341 ? 11.84094  -4.99483   29.77724  1.000 30.82777  ? 321 SER H CA  1 
ATOM   2536  C C   . SER A  1 341 ? 12.90082  -4.59429   28.76539  1.000 28.53249  ? 321 SER H C   1 
ATOM   2537  O O   . SER A  1 341 ? 12.73658  -4.77063   27.55606  1.000 28.49986  ? 321 SER H O   1 
ATOM   2538  C CB  . SER A  1 341 ? 12.26804  -6.27125   30.51059  1.000 30.69598  ? 321 SER H CB  1 
ATOM   2539  O OG  . SER A  1 341 ? 12.58524  -7.29312   29.58368  1.000 36.94631  ? 321 SER H OG  1 
ATOM   2540  N N   . ALA A  1 342 ? 14.00076  -4.06434   29.28816  1.000 27.88130  ? 322 ALA H N   1 
ATOM   2541  C CA  . ALA A  1 342 ? 15.14371  -3.66636   28.48602  1.000 27.08370  ? 322 ALA H CA  1 
ATOM   2542  C C   . ALA A  1 342 ? 16.40864  -4.26354   29.07754  1.000 27.03309  ? 322 ALA H C   1 
ATOM   2543  O O   . ALA A  1 342 ? 16.59801  -4.26595   30.29597  1.000 27.27110  ? 322 ALA H O   1 
ATOM   2544  C CB  . ALA A  1 342 ? 15.27071  -2.13980   28.40768  1.000 28.92322  ? 322 ALA H CB  1 
ATOM   2545  N N   . VAL A  1 343 ? 17.27093  -4.76150   28.20210  1.000 27.91044  ? 323 VAL H N   1 
ATOM   2546  C CA  . VAL A  1 343 ? 18.54111  -5.36609   28.57677  1.000 33.18975  ? 323 VAL H CA  1 
ATOM   2547  C C   . VAL A  1 343 ? 19.62772  -4.76489   27.69910  1.000 29.57062  ? 323 VAL H C   1 
ATOM   2548  O O   . VAL A  1 343 ? 19.43138  -4.60107   26.48918  1.000 26.03289  ? 323 VAL H O   1 
ATOM   2549  C CB  . VAL A  1 343 ? 18.50001  -6.89665   28.41068  1.000 27.76750  ? 323 VAL H CB  1 
ATOM   2550  C CG1 . VAL A  1 343 ? 19.89351  -7.46095   28.46019  1.000 40.08441  ? 323 VAL H CG1 1 
ATOM   2551  C CG2 . VAL A  1 343 ? 17.62480  -7.51158   29.47718  1.000 28.57204  ? 323 VAL H CG2 1 
ATOM   2552  N N   . SER A  1 344 ? 20.77151  -4.44062   28.30882  1.000 25.95640  ? 324 SER H N   1 
ATOM   2553  C CA  . SER A  1 344 ? 21.89949  -3.83662   27.59899  1.000 25.41558  ? 324 SER H CA  1 
ATOM   2554  C C   . SER A  1 344 ? 21.42973  -2.67452   26.73109  1.000 25.04973  ? 324 SER H C   1 
ATOM   2555  O O   . SER A  1 344 ? 21.81944  -2.53744   25.57224  1.000 27.80582  ? 324 SER H O   1 
ATOM   2556  C CB  . SER A  1 344 ? 22.64780  -4.87767   26.76384  1.000 25.77583  ? 324 SER H CB  1 
ATOM   2557  O OG  . SER A  1 344 ? 22.95657  -6.02631   27.54073  1.000 26.47832  ? 324 SER H OG  1 
ATOM   2558  N N   . SER A  1 345 ? 20.55741  -1.83932   27.28868  1.000 24.67212  ? 325 SER H N   1 
ATOM   2559  C CA  . SER A  1 345 ? 19.87647  -0.83930   26.48543  1.000 26.26649  ? 325 SER H CA  1 
ATOM   2560  C C   . SER A  1 345 ? 19.88838  0.51022    27.18909  1.000 23.95682  ? 325 SER H C   1 
ATOM   2561  O O   . SER A  1 345 ? 20.03243  0.60806    28.40942  1.000 24.06567  ? 325 SER H O   1 
ATOM   2562  C CB  . SER A  1 345 ? 18.43371  -1.25804   26.17476  1.000 27.30949  ? 325 SER H CB  1 
ATOM   2563  O OG  . SER A  1 345 ? 18.41071  -2.40954   25.34318  1.000 32.85624  ? 325 SER H OG  1 
ATOM   2564  N N   . VAL A  1 346 ? 19.73328  1.55194    26.38230  1.000 23.61721  ? 326 VAL H N   1 
ATOM   2565  C CA  . VAL A  1 346 ? 19.59430  2.92320    26.84298  1.000 23.37337  ? 326 VAL H CA  1 
ATOM   2566  C C   . VAL A  1 346 ? 18.17568  3.36787    26.50870  1.000 27.39110  ? 326 VAL H C   1 
ATOM   2567  O O   . VAL A  1 346 ? 17.76294  3.31461    25.34372  1.000 32.51428  ? 326 VAL H O   1 
ATOM   2568  C CB  . VAL A  1 346 ? 20.63945  3.83436    26.18573  1.000 28.36083  ? 326 VAL H CB  1 
ATOM   2569  C CG1 . VAL A  1 346 ? 20.36721  5.26127    26.52233  1.000 22.84148  ? 326 VAL H CG1 1 
ATOM   2570  C CG2 . VAL A  1 346 ? 22.04304  3.44267    26.63720  1.000 26.23086  ? 326 VAL H CG2 1 
ATOM   2571  N N   . VAL A  1 347 ? 17.41924  3.78998    27.52165  1.000 23.82858  ? 327 VAL H N   1 
ATOM   2572  C CA  . VAL A  1 347 ? 16.00476  4.11227    27.35048  1.000 24.21341  ? 327 VAL H CA  1 
ATOM   2573  C C   . VAL A  1 347 ? 15.75893  5.52425    27.86896  1.000 24.19691  ? 327 VAL H C   1 
ATOM   2574  O O   . VAL A  1 347 ? 16.06929  5.82857    29.02646  1.000 24.23706  ? 327 VAL H O   1 
ATOM   2575  C CB  . VAL A  1 347 ? 15.08855  3.10865    28.07122  1.000 28.03928  ? 327 VAL H CB  1 
ATOM   2576  C CG1 . VAL A  1 347 ? 13.63254  3.55485    27.97290  1.000 25.33132  ? 327 VAL H CG1 1 
ATOM   2577  C CG2 . VAL A  1 347 ? 15.27131  1.72087    27.49499  1.000 24.96951  ? 327 VAL H CG2 1 
ATOM   2578  N N   . SER A  1 348 ? 15.20042  6.37810    27.01569  1.000 24.24353  ? 328 SER H N   1 
ATOM   2579  C CA  . SER A  1 348 ? 14.89536  7.75039    27.38504  1.000 29.18975  ? 328 SER H CA  1 
ATOM   2580  C C   . SER A  1 348 ? 13.55050  7.83631    28.10106  1.000 32.61817  ? 328 SER H C   1 
ATOM   2581  O O   . SER A  1 348 ? 12.78076  6.87347    28.16678  1.000 26.66838  ? 328 SER H O   1 
ATOM   2582  C CB  . SER A  1 348 ? 14.86869  8.65386    26.15272  1.000 27.78205  ? 328 SER H CB  1 
ATOM   2583  O OG  . SER A  1 348 ? 16.16615  8.89699    25.65791  1.000 23.77912  ? 328 SER H OG  1 
ATOM   2584  N N   . GLY A  1 349 ? 13.26704  9.02328    28.62934  1.000 25.28026  ? 329 GLY H N   1 
ATOM   2585  C CA  . GLY A  1 349 ? 11.98214  9.27749    29.24128  1.000 26.03777  ? 329 GLY H CA  1 
ATOM   2586  C C   . GLY A  1 349 ? 10.85141  9.18380    28.23536  1.000 27.90175  ? 329 GLY H C   1 
ATOM   2587  O O   . GLY A  1 349 ? 11.04248  9.05661    27.02622  1.000 26.22143  ? 329 GLY H O   1 
ATOM   2588  N N   . ASP A  1 350 ? 9.63241   9.23678    28.77004  1.000 30.94273  ? 330 ASP H N   1 
ATOM   2589  C CA  . ASP A  1 350 ? 8.41555   9.13524    27.96762  1.000 27.95511  ? 330 ASP H CA  1 
ATOM   2590  C C   . ASP A  1 350 ? 8.44884   7.91907    27.04493  1.000 27.76918  ? 330 ASP H C   1 
ATOM   2591  O O   . ASP A  1 350 ? 7.88690   7.93035    25.94997  1.000 28.05187  ? 330 ASP H O   1 
ATOM   2592  C CB  . ASP A  1 350 ? 8.16861   10.41795   27.17073  1.000 30.29956  ? 330 ASP H CB  1 
ATOM   2593  C CG  . ASP A  1 350 ? 6.73614   10.53264   26.69402  1.000 35.44536  ? 330 ASP H CG  1 
ATOM   2594  O OD1 . ASP A  1 350 ? 6.51693   10.94942   25.53838  1.000 46.62813  ? 330 ASP H OD1 1 
ATOM   2595  O OD2 . ASP A  1 350 ? 5.82790   10.17953   27.47420  1.000 39.60177  ? 330 ASP H OD2 1 
ATOM   2596  N N   . CYS A  1 351 ? 9.12137   6.86019    27.47528  1.000 27.38705  ? 331 CYS H N   1 
ATOM   2597  C CA  . CYS A  1 351 ? 9.09767   5.58496    26.77990  1.000 31.24729  ? 331 CYS H CA  1 
ATOM   2598  C C   . CYS A  1 351 ? 8.25781   4.61324    27.59303  1.000 30.95896  ? 331 CYS H C   1 
ATOM   2599  O O   . CYS A  1 351 ? 8.50957   4.42084    28.78617  1.000 39.90764  ? 331 CYS H O   1 
ATOM   2600  C CB  . CYS A  1 351 ? 10.51186  5.03743    26.57474  1.000 31.61782  ? 331 CYS H CB  1 
ATOM   2601  S SG  . CYS A  1 351 ? 11.47993  5.90965    25.32137  1.000 25.86247  ? 331 CYS H SG  1 
ATOM   2602  N N   . ILE A  1 352 ? 7.24504   4.03289    26.96126  1.000 31.46916  ? 332 ILE H N   1 
ATOM   2603  C CA  . ILE A  1 352 ? 6.40147   3.02339    27.58755  1.000 33.21017  ? 332 ILE H CA  1 
ATOM   2604  C C   . ILE A  1 352 ? 6.68254   1.70954    26.87736  1.000 37.41793  ? 332 ILE H C   1 
ATOM   2605  O O   . ILE A  1 352 ? 6.26671   1.51414    25.72878  1.000 40.46863  ? 332 ILE H O   1 
ATOM   2606  C CB  . ILE A  1 352 ? 4.91238   3.38915    27.51988  1.000 41.90817  ? 332 ILE H CB  1 
ATOM   2607  C CG1 . ILE A  1 352 ? 4.67501   4.76506    28.14232  1.000 34.81524  ? 332 ILE H CG1 1 
ATOM   2608  C CG2 . ILE A  1 352 ? 4.06299   2.32720    28.22904  1.000 31.76238  ? 332 ILE H CG2 1 
ATOM   2609  C CD1 . ILE A  1 352 ? 3.22224   5.05765    28.41659  1.000 39.53658  ? 332 ILE H CD1 1 
ATOM   2610  N N   . ILE A  1 353 ? 7.40187   0.81686    27.55002  1.000 47.36224  ? 333 ILE H N   1 
ATOM   2611  C CA  . ILE A  1 353 ? 7.77978   -0.47986   26.99954  1.000 29.50673  ? 333 ILE H CA  1 
ATOM   2612  C C   . ILE A  1 353 ? 6.75244   -1.48430   27.50746  1.000 39.08664  ? 333 ILE H C   1 
ATOM   2613  O O   . ILE A  1 353 ? 6.85763   -1.98996   28.62991  1.000 40.98243  ? 333 ILE H O   1 
ATOM   2614  C CB  . ILE A  1 353 ? 9.20690   -0.86483   27.39435  1.000 28.75441  ? 333 ILE H CB  1 
ATOM   2615  C CG1 . ILE A  1 353 ? 10.14441  0.33583    27.22439  1.000 27.78236  ? 333 ILE H CG1 1 
ATOM   2616  C CG2 . ILE A  1 353 ? 9.69446   -2.04175   26.56788  1.000 28.78723  ? 333 ILE H CG2 1 
ATOM   2617  C CD1 . ILE A  1 353 ? 10.25338  0.82357    25.80016  1.000 27.43779  ? 333 ILE H CD1 1 
ATOM   2618  N N   . SER A  1 354 ? 5.75799   -1.78163   26.67201  1.000 42.41084  ? 334 SER H N   1 
ATOM   2619  C CA  . SER A  1 354 ? 4.57390   -2.54801   27.06238  1.000 44.34397  ? 334 SER H CA  1 
ATOM   2620  C C   . SER A  1 354 ? 4.64711   -3.93599   26.43449  1.000 37.32010  ? 334 SER H C   1 
ATOM   2621  O O   . SER A  1 354 ? 4.36066   -4.09900   25.24803  1.000 33.32765  ? 334 SER H O   1 
ATOM   2622  C CB  . SER A  1 354 ? 3.30180   -1.81263   26.63341  1.000 47.11901  ? 334 SER H CB  1 
ATOM   2623  O OG  . SER A  1 354 ? 2.14948   -2.31650   27.29223  1.000 44.53875  ? 334 SER H OG  1 
ATOM   2624  N N   . GLY A  1 355 ? 5.01843   -4.93865   27.22937  1.000 41.58161  ? 335 GLY H N   1 
ATOM   2625  C CA  . GLY A  1 355 ? 5.09378   -6.29249   26.70978  1.000 34.32972  ? 335 GLY H CA  1 
ATOM   2626  C C   . GLY A  1 355 ? 6.12512   -6.50176   25.62260  1.000 38.92793  ? 335 GLY H C   1 
ATOM   2627  O O   . GLY A  1 355 ? 6.08348   -7.52054   24.92772  1.000 33.79854  ? 335 GLY H O   1 
ATOM   2628  N N   . ALA A  1 356 ? 7.05516   -5.56188   25.46255  1.000 32.02347  ? 336 ALA H N   1 
ATOM   2629  C CA  . ALA A  1 356 ? 8.07508   -5.59903   24.42482  1.000 31.28705  ? 336 ALA H CA  1 
ATOM   2630  C C   . ALA A  1 356 ? 9.42890   -5.94352   25.03326  1.000 30.64574  ? 336 ALA H C   1 
ATOM   2631  O O   . ALA A  1 356 ? 9.72680   -5.57273   26.17213  1.000 34.89741  ? 336 ALA H O   1 
ATOM   2632  C CB  . ALA A  1 356 ? 8.16967   -4.25126   23.70167  1.000 30.53059  ? 336 ALA H CB  1 
ATOM   2633  N N   . ALA A  1 357 ? 10.25615  -6.63846   24.26073  1.000 30.51313  ? 337 ALA H N   1 
ATOM   2634  C CA  . ALA A  1 357 ? 11.58005  -7.05165   24.70668  1.000 30.05427  ? 337 ALA H CA  1 
ATOM   2635  C C   . ALA A  1 357 ? 12.63882  -6.25004   23.96415  1.000 29.04359  ? 337 ALA H C   1 
ATOM   2636  O O   . ALA A  1 357 ? 12.63620  -6.20965   22.73066  1.000 29.02521  ? 337 ALA H O   1 
ATOM   2637  C CB  . ALA A  1 357 ? 11.79859  -8.55135   24.48454  1.000 30.86881  ? 337 ALA H CB  1 
ATOM   2638  N N   . LEU A  1 358 ? 13.53908  -5.61754   24.71395  1.000 29.48503  ? 338 LEU H N   1 
ATOM   2639  C CA  . LEU A  1 358 ? 14.59482  -4.78576   24.15078  1.000 32.86802  ? 338 LEU H CA  1 
ATOM   2640  C C   . LEU A  1 358 ? 15.94764  -5.36088   24.53725  1.000 27.23286  ? 338 LEU H C   1 
ATOM   2641  O O   . LEU A  1 358 ? 16.19320  -5.63914   25.71573  1.000 27.36555  ? 338 LEU H O   1 
ATOM   2642  C CB  . LEU A  1 358 ? 14.50892  -3.34380   24.65724  1.000 28.78171  ? 338 LEU H CB  1 
ATOM   2643  C CG  . LEU A  1 358 ? 13.16027  -2.62393   24.65924  1.000 36.43276  ? 338 LEU H CG  1 
ATOM   2644  C CD1 . LEU A  1 358 ? 13.33981  -1.13928   24.96413  1.000 28.93480  ? 338 LEU H CD1 1 
ATOM   2645  C CD2 . LEU A  1 358 ? 12.43352  -2.81651   23.34173  1.000 29.77064  ? 338 LEU H CD2 1 
ATOM   2646  N N   . ASN A  1 359 ? 16.82515  -5.52030   23.55302  1.000 27.02063  ? 339 ASN H N   1 
ATOM   2647  C CA  . ASN A  1 359 ? 18.20020  -5.91353   23.81709  1.000 26.86052  ? 339 ASN H CA  1 
ATOM   2648  C C   . ASN A  1 359 ? 19.14072  -5.12033   22.92858  1.000 29.36207  ? 339 ASN H C   1 
ATOM   2649  O O   . ASN A  1 359 ? 18.94084  -5.04964   21.71344  1.000 36.08513  ? 339 ASN H O   1 
ATOM   2650  C CB  . ASN A  1 359 ? 18.42332  -7.40627   23.58820  1.000 30.51781  ? 339 ASN H CB  1 
ATOM   2651  C CG  . ASN A  1 359 ? 19.82462  -7.82968   23.94544  1.000 40.26124  ? 339 ASN H CG  1 
ATOM   2652  O OD1 . ASN A  1 359 ? 20.39914  -7.33098   24.91167  1.000 44.87948  ? 339 ASN H OD1 1 
ATOM   2653  N ND2 . ASN A  1 359 ? 20.38692  -8.74534   23.17273  1.000 44.93135  ? 339 ASN H ND2 1 
ATOM   2654  N N   . ARG A  1 360 ? 20.17709  -4.55456   23.54299  1.000 33.46814  ? 340 ARG H N   1 
ATOM   2655  C CA  . ARG A  1 360 ? 21.19142  -3.76777   22.85019  1.000 26.58564  ? 340 ARG H CA  1 
ATOM   2656  C C   . ARG A  1 360 ? 20.55562  -2.75314   21.90779  1.000 24.90595  ? 340 ARG H C   1 
ATOM   2657  O O   . ARG A  1 360 ? 20.88500  -2.67093   20.72562  1.000 24.92925  ? 340 ARG H O   1 
ATOM   2658  C CB  . ARG A  1 360 ? 22.18048  -4.66776   22.10589  1.000 25.59592  ? 340 ARG H CB  1 
ATOM   2659  C CG  . ARG A  1 360 ? 23.50217  -3.96812   21.84804  1.000 35.70239  ? 340 ARG H CG  1 
ATOM   2660  C CD  . ARG A  1 360 ? 24.59483  -4.91078   21.39668  1.000 45.09326  ? 340 ARG H CD  1 
ATOM   2661  N NE  . ARG A  1 360 ? 25.74965  -4.17685   20.87944  1.000 42.42884  ? 340 ARG H NE  1 
ATOM   2662  C CZ  . ARG A  1 360 ? 26.05833  -4.08954   19.58954  1.000 45.40419  ? 340 ARG H CZ  1 
ATOM   2663  N NH1 . ARG A  1 360 ? 25.29959  -4.69541   18.68546  1.000 37.71538  ? 340 ARG H NH1 1 
ATOM   2664  N NH2 . ARG A  1 360 ? 27.12415  -3.40070   19.20298  1.000 48.74046  ? 340 ARG H NH2 1 
ATOM   2665  N N   . SER A  1 361 ? 19.62696  -1.96951   22.44405  1.000 36.37426  ? 341 SER H N   1 
ATOM   2666  C CA  . SER A  1 361 ? 18.96559  -0.92522   21.67692  1.000 32.88649  ? 341 SER H CA  1 
ATOM   2667  C C   . SER A  1 361 ? 19.11091  0.40622    22.39821  1.000 27.80772  ? 341 SER H C   1 
ATOM   2668  O O   . SER A  1 361 ? 19.33258  0.45847    23.60931  1.000 28.83583  ? 341 SER H O   1 
ATOM   2669  C CB  . SER A  1 361 ? 17.47845  -1.25154   21.44758  1.000 35.29651  ? 341 SER H CB  1 
ATOM   2670  O OG  . SER A  1 361 ? 17.32431  -2.43975   20.67467  1.000 34.16817  ? 341 SER H OG  1 
ATOM   2671  N N   . LEU A  1 362 ? 18.99471  1.49095    21.63352  1.000 26.97079  ? 342 LEU H N   1 
ATOM   2672  C CA  . LEU A  1 362 ? 18.95685  2.83974    22.18199  1.000 23.45187  ? 342 LEU H CA  1 
ATOM   2673  C C   . LEU A  1 362 ? 17.67347  3.51779    21.72660  1.000 23.68368  ? 342 LEU H C   1 
ATOM   2674  O O   . LEU A  1 362 ? 17.38014  3.56081    20.52611  1.000 28.69796  ? 342 LEU H O   1 
ATOM   2675  C CB  . LEU A  1 362 ? 20.18572  3.65002    21.75677  1.000 23.09506  ? 342 LEU H CB  1 
ATOM   2676  C CG  . LEU A  1 362 ? 20.31005  5.06884    22.32481  1.000 32.98043  ? 342 LEU H CG  1 
ATOM   2677  C CD1 . LEU A  1 362 ? 21.75742  5.37814    22.69377  1.000 36.43702  ? 342 LEU H CD1 1 
ATOM   2678  C CD2 . LEU A  1 362 ? 19.81043  6.09023    21.32927  1.000 28.53651  ? 342 LEU H CD2 1 
ATOM   2679  N N   . LEU A  1 363 ? 16.90844  4.03372    22.68567  1.000 23.76520  ? 343 LEU H N   1 
ATOM   2680  C CA  . LEU A  1 363 ? 15.62712  4.67607    22.42321  1.000 24.12510  ? 343 LEU H CA  1 
ATOM   2681  C C   . LEU A  1 363 ? 15.68609  6.13307    22.85599  1.000 25.21274  ? 343 LEU H C   1 
ATOM   2682  O O   . LEU A  1 363 ? 16.07234  6.43006    23.99340  1.000 29.94022  ? 343 LEU H O   1 
ATOM   2683  C CB  . LEU A  1 363 ? 14.48766  3.96654    23.16208  1.000 24.62541  ? 343 LEU H CB  1 
ATOM   2684  C CG  . LEU A  1 363 ? 13.84162  2.73096    22.52461  1.000 31.48553  ? 343 LEU H CG  1 
ATOM   2685  C CD1 . LEU A  1 363 ? 14.84083  1.58962    22.34189  1.000 28.01168  ? 343 LEU H CD1 1 
ATOM   2686  C CD2 . LEU A  1 363 ? 12.66465  2.27705    23.36879  1.000 25.73399  ? 343 LEU H CD2 1 
ATOM   2687  N N   . PHE A  1 364 ? 15.29993  7.03229    21.95192  1.000 24.11818  ? 344 PHE H N   1 
ATOM   2688  C CA  . PHE A  1 364 ? 15.07753  8.43143    22.28484  1.000 24.19229  ? 344 PHE H CA  1 
ATOM   2689  C C   . PHE A  1 364 ? 13.71699  8.58367    22.96975  1.000 29.72374  ? 344 PHE H C   1 
ATOM   2690  O O   . PHE A  1 364 ? 12.99038  7.60821    23.18259  1.000 25.03114  ? 344 PHE H O   1 
ATOM   2691  C CB  . PHE A  1 364 ? 15.16527  9.29829    21.03039  1.000 26.35361  ? 344 PHE H CB  1 
ATOM   2692  C CG  . PHE A  1 364 ? 16.54078  9.35485    20.41390  1.000 33.13526  ? 344 PHE H CG  1 
ATOM   2693  C CD1 . PHE A  1 364 ? 17.06509  8.26160    19.73950  1.000 35.36629  ? 344 PHE H CD1 1 
ATOM   2694  C CD2 . PHE A  1 364 ? 17.30762  10.50639   20.50371  1.000 26.25223  ? 344 PHE H CD2 1 
ATOM   2695  C CE1 . PHE A  1 364 ? 18.32433  8.31025    19.16809  1.000 30.51677  ? 344 PHE H CE1 1 
ATOM   2696  C CE2 . PHE A  1 364 ? 18.57432  10.56189   19.93866  1.000 25.68827  ? 344 PHE H CE2 1 
ATOM   2697  C CZ  . PHE A  1 364 ? 19.08097  9.46069    19.26769  1.000 33.49922  ? 344 PHE H CZ  1 
ATOM   2698  N N   A THR A  1 365 ? 13.35995  9.82648    23.29063  0.412 24.96560  ? 345 THR H N   1 
ATOM   2699  N N   B THR A  1 365 ? 13.36322  9.81989    23.32386  0.588 24.96238  ? 345 THR H N   1 
ATOM   2700  C CA  A THR A  1 365 ? 12.12558  10.11717   24.00977  0.412 25.58351  ? 345 THR H CA  1 
ATOM   2701  C CA  B THR A  1 365 ? 12.12849  10.05160   24.06274  0.588 25.57477  ? 345 THR H CA  1 
ATOM   2702  C C   A THR A  1 365 ? 10.89260  9.77861    23.17357  0.412 28.81105  ? 345 THR H C   1 
ATOM   2703  C C   B THR A  1 365 ? 10.90130  9.78204    23.19850  0.588 29.05529  ? 345 THR H C   1 
ATOM   2704  O O   A THR A  1 365 ? 10.88699  9.91419    21.94752  0.412 28.36327  ? 345 THR H O   1 
ATOM   2705  O O   B THR A  1 365 ? 10.90948  9.97300    21.97919  0.588 28.89973  ? 345 THR H O   1 
ATOM   2706  C CB  A THR A  1 365 ? 12.08518  11.59611   24.40032  0.412 26.90768  ? 345 THR H CB  1 
ATOM   2707  C CB  B THR A  1 365 ? 12.05891  11.48613   24.58990  0.588 26.02926  ? 345 THR H CB  1 
ATOM   2708  O OG1 A THR A  1 365 ? 13.41591  12.05514   24.66973  0.412 33.65061  ? 345 THR H OG1 1 
ATOM   2709  O OG1 B THR A  1 365 ? 12.19191  12.40845   23.50010  0.588 30.19378  ? 345 THR H OG1 1 
ATOM   2710  C CG2 A THR A  1 365 ? 11.22038  11.81602   25.62971  0.412 26.34088  ? 345 THR H CG2 1 
ATOM   2711  C CG2 B THR A  1 365 ? 13.15054  11.74066   25.62291  0.588 29.08702  ? 345 THR H CG2 1 
ATOM   2712  N N   . GLY A  1 366 ? 9.83508   9.33508    23.85213  1.000 28.68541  ? 346 GLY H N   1 
ATOM   2713  C CA  . GLY A  1 366 ? 8.54477   9.17710    23.21096  1.000 29.93411  ? 346 GLY H CA  1 
ATOM   2714  C C   . GLY A  1 366 ? 8.27288   7.84737    22.54574  1.000 37.69791  ? 346 GLY H C   1 
ATOM   2715  O O   . GLY A  1 366 ? 7.25084   7.72104    21.85994  1.000 42.70751  ? 346 GLY H O   1 
ATOM   2716  N N   . VAL A  1 367 ? 9.13255   6.85205    22.72138  1.000 27.18753  ? 347 VAL H N   1 
ATOM   2717  C CA  . VAL A  1 367 ? 8.92649   5.57357    22.04953  1.000 37.67398  ? 347 VAL H CA  1 
ATOM   2718  C C   . VAL A  1 367 ? 7.80922   4.80526    22.74262  1.000 39.32072  ? 347 VAL H C   1 
ATOM   2719  O O   . VAL A  1 367 ? 7.69172   4.80856    23.97527  1.000 41.51152  ? 347 VAL H O   1 
ATOM   2720  C CB  . VAL A  1 367 ? 10.22955  4.75703    22.01046  1.000 35.48374  ? 347 VAL H CB  1 
ATOM   2721  C CG1 . VAL A  1 367 ? 9.99930   3.43355    21.29459  1.000 27.05665  ? 347 VAL H CG1 1 
ATOM   2722  C CG2 . VAL A  1 367 ? 11.32386  5.55124    21.31985  1.000 36.21102  ? 347 VAL H CG2 1 
ATOM   2723  N N   . ARG A  1 368 ? 6.97202   4.15665    21.93972  1.000 33.37183  ? 348 ARG H N   1 
ATOM   2724  C CA  . ARG A  1 368 ? 5.87998   3.31433    22.41553  1.000 37.42078  ? 348 ARG H CA  1 
ATOM   2725  C C   . ARG A  1 368 ? 6.06268   1.94974    21.76005  1.000 48.83534  ? 348 ARG H C   1 
ATOM   2726  O O   . ARG A  1 368 ? 5.79818   1.79064    20.56371  1.000 48.27483  ? 348 ARG H O   1 
ATOM   2727  C CB  . ARG A  1 368 ? 4.52092   3.92307    22.07396  1.000 43.37653  ? 348 ARG H CB  1 
ATOM   2728  C CG  . ARG A  1 368 ? 4.20045   5.21948    22.80768  1.000 30.87303  ? 348 ARG H CG  1 
ATOM   2729  C CD  . ARG A  1 368 ? 3.87078   4.97202    24.26904  1.000 37.91924  ? 348 ARG H CD  1 
ATOM   2730  N NE  . ARG A  1 368 ? 3.45657   6.19516    24.95192  1.000 39.96004  ? 348 ARG H NE  1 
ATOM   2731  C CZ  . ARG A  1 368 ? 4.29996   7.10008    25.43587  1.000 38.47653  ? 348 ARG H CZ  1 
ATOM   2732  N NH1 . ARG A  1 368 ? 3.83482   8.18278    26.04347  1.000 31.18743  ? 348 ARG H NH1 1 
ATOM   2733  N NH2 . ARG A  1 368 ? 5.60844   6.92531    25.30520  1.000 32.81985  ? 348 ARG H NH2 1 
ATOM   2734  N N   . ALA A  1 369 ? 6.53839   0.97723    22.53390  1.000 38.84445  ? 349 ALA H N   1 
ATOM   2735  C CA  . ALA A  1 369 ? 6.72478   -0.38816   22.06651  1.000 30.04339  ? 349 ALA H CA  1 
ATOM   2736  C C   . ALA A  1 369 ? 5.69867   -1.27836   22.75146  1.000 33.23662  ? 349 ALA H C   1 
ATOM   2737  O O   . ALA A  1 369 ? 5.52065   -1.19918   23.97219  1.000 36.28208  ? 349 ALA H O   1 
ATOM   2738  C CB  . ALA A  1 369 ? 8.14714   -0.87479   22.34647  1.000 29.20467  ? 349 ALA H CB  1 
ATOM   2739  N N   . ASN A  1 370 ? 5.02258   -2.11378   21.97035  1.000 31.92663  ? 350 ASN H N   1 
ATOM   2740  C CA  . ASN A  1 370 ? 3.82977   -2.80833   22.43564  1.000 34.95654  ? 350 ASN H CA  1 
ATOM   2741  C C   . ASN A  1 370 ? 4.03465   -4.32372   22.44495  1.000 40.04743  ? 350 ASN H C   1 
ATOM   2742  O O   . ASN A  1 370 ? 5.09609   -4.84230   22.08284  1.000 33.05044  ? 350 ASN H O   1 
ATOM   2743  C CB  . ASN A  1 370 ? 2.61816   -2.41086   21.59064  1.000 40.82934  ? 350 ASN H CB  1 
ATOM   2744  C CG  . ASN A  1 370 ? 2.28829   -0.94403   21.72180  1.000 45.52867  ? 350 ASN H CG  1 
ATOM   2745  O OD1 . ASN A  1 370 ? 1.75605   -0.50671   22.74238  1.000 35.94050  ? 350 ASN H OD1 1 
ATOM   2746  N ND2 . ASN A  1 370 ? 2.59546   -0.17344   20.68734  1.000 51.53097  ? 350 ASN H ND2 1 
ATOM   2747  N N   . SER A  1 371 ? 2.98732   -5.02660   22.87697  1.000 38.23735  ? 351 SER H N   1 
ATOM   2748  C CA  . SER A  1 371 ? 3.11457   -6.40859   23.32283  1.000 41.41722  ? 351 SER H CA  1 
ATOM   2749  C C   . SER A  1 371 ? 3.71031   -7.30614   22.24699  1.000 35.49515  ? 351 SER H C   1 
ATOM   2750  O O   . SER A  1 371 ? 3.38785   -7.18867   21.06401  1.000 38.50225  ? 351 SER H O   1 
ATOM   2751  C CB  . SER A  1 371 ? 1.74916   -6.94708   23.74741  1.000 40.46601  ? 351 SER H CB  1 
ATOM   2752  O OG  . SER A  1 371 ? 1.43063   -6.52536   25.06116  1.000 40.16793  ? 351 SER H OG  1 
ATOM   2753  N N   . TYR A  1 372 ? 4.60251   -8.19779   22.67525  1.000 35.30041  ? 352 TYR H N   1 
ATOM   2754  C CA  . TYR A  1 372 ? 5.18765   -9.27126   21.87666  1.000 37.93603  ? 352 TYR H CA  1 
ATOM   2755  C C   . TYR A  1 372 ? 6.15007   -8.77477   20.80970  1.000 34.57424  ? 352 TYR H C   1 
ATOM   2756  O O   . TYR A  1 372 ? 6.63838   -9.57860   20.00990  1.000 34.83333  ? 352 TYR H O   1 
ATOM   2757  C CB  . TYR A  1 372 ? 4.10777   -10.14590  21.23091  1.000 37.45080  ? 352 TYR H CB  1 
ATOM   2758  C CG  . TYR A  1 372 ? 3.05473   -10.59567  22.21055  1.000 38.20988  ? 352 TYR H CG  1 
ATOM   2759  C CD1 . TYR A  1 372 ? 3.35504   -11.51863  23.20288  1.000 38.63344  ? 352 TYR H CD1 1 
ATOM   2760  C CD2 . TYR A  1 372 ? 1.76551   -10.08920  22.15435  1.000 38.99067  ? 352 TYR H CD2 1 
ATOM   2761  C CE1 . TYR A  1 372 ? 2.39926   -11.92771  24.10357  1.000 39.80113  ? 352 TYR H CE1 1 
ATOM   2762  C CE2 . TYR A  1 372 ? 0.80191   -10.49072  23.05009  1.000 40.16381  ? 352 TYR H CE2 1 
ATOM   2763  C CZ  . TYR A  1 372 ? 1.12265   -11.41178  24.02235  1.000 41.37045  ? 352 TYR H CZ  1 
ATOM   2764  O OH  . TYR A  1 372 ? 0.16359   -11.81881  24.91847  1.000 44.76242  ? 352 TYR H OH  1 
ATOM   2765  N N   . SER A  1 373 ? 6.45463   -7.48359   20.77956  1.000 37.01803  ? 353 SER H N   1 
ATOM   2766  C CA  . SER A  1 373 ? 7.47825   -6.99222   19.87369  1.000 35.03227  ? 353 SER H CA  1 
ATOM   2767  C C   . SER A  1 373 ? 8.86864   -7.19484   20.47210  1.000 31.78638  ? 353 SER H C   1 
ATOM   2768  O O   . SER A  1 373 ? 9.04733   -7.22458   21.69390  1.000 31.59974  ? 353 SER H O   1 
ATOM   2769  C CB  . SER A  1 373 ? 7.24578   -5.51842   19.54280  1.000 37.72268  ? 353 SER H CB  1 
ATOM   2770  O OG  . SER A  1 373 ? 7.21449   -4.72897   20.71280  1.000 42.72839  ? 353 SER H OG  1 
ATOM   2771  N N   . ARG A  1 374 ? 9.85377   -7.35717   19.58952  1.000 31.39113  ? 354 ARG H N   1 
ATOM   2772  C CA  . ARG A  1 374 ? 11.24054  -7.60317   19.96750  1.000 30.72692  ? 354 ARG H CA  1 
ATOM   2773  C C   . ARG A  1 374 ? 12.14009  -6.65216   19.19061  1.000 35.90231  ? 354 ARG H C   1 
ATOM   2774  O O   . ARG A  1 374 ? 12.03143  -6.55523   17.96377  1.000 38.40114  ? 354 ARG H O   1 
ATOM   2775  C CB  . ARG A  1 374 ? 11.65566  -9.05578   19.67677  1.000 39.82948  ? 354 ARG H CB  1 
ATOM   2776  C CG  . ARG A  1 374 ? 10.72349  -10.14014  20.21870  1.000 44.64386  ? 354 ARG H CG  1 
ATOM   2777  C CD  . ARG A  1 374 ? 11.22222  -10.70354  21.54737  1.000 53.77605  ? 354 ARG H CD  1 
ATOM   2778  N NE  . ARG A  1 374 ? 10.26889  -11.63159  22.16148  1.000 59.86526  ? 354 ARG H NE  1 
ATOM   2779  C CZ  . ARG A  1 374 ? 9.11583   -11.27005  22.72250  1.000 61.73375  ? 354 ARG H CZ  1 
ATOM   2780  N NH1 . ARG A  1 374 ? 8.75523   -9.99266   22.75513  1.000 68.55214  ? 354 ARG H NH1 1 
ATOM   2781  N NH2 . ARG A  1 374 ? 8.31954   -12.18763  23.25785  1.000 55.14823  ? 354 ARG H NH2 1 
ATOM   2782  N N   . LEU A  1 375 ? 13.03233  -5.95991   19.89268  1.000 32.70530  ? 355 LEU H N   1 
ATOM   2783  C CA  . LEU A  1 375 ? 14.00011  -5.06832   19.26143  1.000 31.93039  ? 355 LEU H CA  1 
ATOM   2784  C C   . LEU A  1 375 ? 15.40801  -5.48214   19.66569  1.000 27.73270  ? 355 LEU H C   1 
ATOM   2785  O O   . LEU A  1 375 ? 15.68151  -5.68070   20.85423  1.000 27.60499  ? 355 LEU H O   1 
ATOM   2786  C CB  . LEU A  1 375 ? 13.75685  -3.60868   19.65267  1.000 27.46725  ? 355 LEU H CB  1 
ATOM   2787  C CG  . LEU A  1 375 ? 12.40209  -2.98355   19.34159  1.000 43.49908  ? 355 LEU H CG  1 
ATOM   2788  C CD1 . LEU A  1 375 ? 12.43353  -1.52545   19.72704  1.000 38.40620  ? 355 LEU H CD1 1 
ATOM   2789  C CD2 . LEU A  1 375 ? 12.07593  -3.13289   17.87176  1.000 56.48720  ? 355 LEU H CD2 1 
ATOM   2790  N N   . GLU A  1 376 ? 16.30050  -5.59689   18.68394  1.000 27.64467  ? 356 GLU H N   1 
ATOM   2791  C CA  . GLU A  1 376 ? 17.69578  -5.91702   18.95506  1.000 27.36845  ? 356 GLU H CA  1 
ATOM   2792  C C   . GLU A  1 376 ? 18.60271  -5.10301   18.04074  1.000 26.88453  ? 356 GLU H C   1 
ATOM   2793  O O   . GLU A  1 376 ? 18.31406  -4.94903   16.85128  1.000 30.59213  ? 356 GLU H O   1 
ATOM   2794  C CB  . GLU A  1 376 ? 17.97046  -7.41350   18.77984  1.000 35.86193  ? 356 GLU H CB  1 
ATOM   2795  C CG  . GLU A  1 376 ? 19.39839  -7.80526   19.09552  1.000 39.65834  ? 356 GLU H CG  1 
ATOM   2796  C CD  . GLU A  1 376 ? 19.55657  -9.29037   19.31104  1.000 48.31084  ? 356 GLU H CD  1 
ATOM   2797  O OE1 . GLU A  1 376 ? 20.44613  -9.88976   18.67331  1.000 54.53109  ? 356 GLU H OE1 1 
ATOM   2798  O OE2 . GLU A  1 376 ? 18.79690  -9.85466   20.12512  1.000 53.50989  ? 356 GLU H OE2 1 
ATOM   2799  N N   . ASN A  1 377 ? 19.70158  -4.59553   18.60184  1.000 33.53596  ? 357 ASN H N   1 
ATOM   2800  C CA  . ASN A  1 377 ? 20.58804  -3.67573   17.89232  1.000 25.86084  ? 357 ASN H CA  1 
ATOM   2801  C C   . ASN A  1 377 ? 19.79391  -2.62052   17.13641  1.000 25.69853  ? 357 ASN H C   1 
ATOM   2802  O O   . ASN A  1 377 ? 20.08323  -2.31603   15.97932  1.000 28.30762  ? 357 ASN H O   1 
ATOM   2803  C CB  . ASN A  1 377 ? 21.53556  -4.40619   16.93883  1.000 36.78453  ? 357 ASN H CB  1 
ATOM   2804  C CG  . ASN A  1 377 ? 22.23906  -5.57702   17.58592  1.000 37.32347  ? 357 ASN H CG  1 
ATOM   2805  O OD1 . ASN A  1 377 ? 22.05904  -5.84976   18.77329  1.000 44.16343  ? 357 ASN H OD1 1 
ATOM   2806  N ND2 . ASN A  1 377 ? 23.07711  -6.26065   16.81094  1.000 37.21546  ? 357 ASN H ND2 1 
ATOM   2807  N N   . ALA A  1 378 ? 18.77660  -2.06753   17.79148  1.000 25.53259  ? 358 ALA H N   1 
ATOM   2808  C CA  . ALA A  1 378 ? 17.94036  -1.04031   17.18515  1.000 36.08677  ? 358 ALA H CA  1 
ATOM   2809  C C   . ALA A  1 378 ? 18.32757  0.32694    17.72926  1.000 30.33471  ? 358 ALA H C   1 
ATOM   2810  O O   . ALA A  1 378 ? 18.47605  0.49796    18.94259  1.000 24.51567  ? 358 ALA H O   1 
ATOM   2811  C CB  . ALA A  1 378 ? 16.45380  -1.29779   17.44043  1.000 26.21010  ? 358 ALA H CB  1 
ATOM   2812  N N   . VAL A  1 379 ? 18.50001  1.28985    16.83510  1.000 37.21631  ? 359 VAL H N   1 
ATOM   2813  C CA  . VAL A  1 379 ? 18.55926  2.69825    17.20363  1.000 24.45536  ? 359 VAL H CA  1 
ATOM   2814  C C   . VAL A  1 379 ? 17.20208  3.29908    16.87820  1.000 24.66286  ? 359 VAL H C   1 
ATOM   2815  O O   . VAL A  1 379 ? 16.79818  3.34540    15.71088  1.000 25.09360  ? 359 VAL H O   1 
ATOM   2816  C CB  . VAL A  1 379 ? 19.69013  3.43252    16.47483  1.000 30.58543  ? 359 VAL H CB  1 
ATOM   2817  C CG1 . VAL A  1 379 ? 19.66866  4.92675    16.82924  1.000 23.86552  ? 359 VAL H CG1 1 
ATOM   2818  C CG2 . VAL A  1 379 ? 21.02887  2.80464    16.82905  1.000 23.95531  ? 359 VAL H CG2 1 
ATOM   2819  N N   . VAL A  1 380 ? 16.48193  3.72946    17.90899  1.000 24.57426  ? 360 VAL H N   1 
ATOM   2820  C CA  . VAL A  1 380 ? 15.07906  4.11688    17.79018  1.000 25.03696  ? 360 VAL H CA  1 
ATOM   2821  C C   . VAL A  1 380 ? 14.96893  5.60935    18.09175  1.000 28.27249  ? 360 VAL H C   1 
ATOM   2822  O O   . VAL A  1 380 ? 15.12459  6.03153    19.24219  1.000 31.74199  ? 360 VAL H O   1 
ATOM   2823  C CB  . VAL A  1 380 ? 14.18524  3.29564    18.72695  1.000 25.32448  ? 360 VAL H CB  1 
ATOM   2824  C CG1 . VAL A  1 380 ? 12.73263  3.66870    18.53961  1.000 25.94815  ? 360 VAL H CG1 1 
ATOM   2825  C CG2 . VAL A  1 380 ? 14.40293  1.80471    18.48389  1.000 27.05453  ? 360 VAL H CG2 1 
ATOM   2826  N N   . LEU A  1 381 ? 14.69880  6.40415    17.06301  1.000 28.66694  ? 361 LEU H N   1 
ATOM   2827  C CA  . LEU A  1 381 ? 14.61366  7.85587    17.18166  1.000 25.16040  ? 361 LEU H CA  1 
ATOM   2828  C C   . LEU A  1 381 ? 13.30084  8.24779    17.86414  1.000 25.57703  ? 361 LEU H C   1 
ATOM   2829  O O   . LEU A  1 381 ? 12.45084  7.39345    18.13090  1.000 30.64174  ? 361 LEU H O   1 
ATOM   2830  C CB  . LEU A  1 381 ? 14.76778  8.47403    15.79060  1.000 25.49995  ? 361 LEU H CB  1 
ATOM   2831  C CG  . LEU A  1 381 ? 16.18977  8.92506    15.42724  1.000 27.73273  ? 361 LEU H CG  1 
ATOM   2832  C CD1 . LEU A  1 381 ? 17.21276  7.83279    15.68799  1.000 24.66509  ? 361 LEU H CD1 1 
ATOM   2833  C CD2 . LEU A  1 381 ? 16.26600  9.37022    13.97359  1.000 29.94499  ? 361 LEU H CD2 1 
ATOM   2834  N N   . PRO A  1 382 ? 13.10476  9.53139    18.19123  1.000 32.54754  ? 362 PRO H N   1 
ATOM   2835  C CA  . PRO A  1 382 ? 11.96234  9.89456    19.04259  1.000 33.15303  ? 362 PRO H CA  1 
ATOM   2836  C C   . PRO A  1 382 ? 10.60514  9.55012    18.44409  1.000 35.32130  ? 362 PRO H C   1 
ATOM   2837  O O   . PRO A  1 382 ? 10.40935  9.55130    17.22583  1.000 31.06372  ? 362 PRO H O   1 
ATOM   2838  C CB  . PRO A  1 382 ? 12.11381  11.41318   19.21083  1.000 28.37359  ? 362 PRO H CB  1 
ATOM   2839  C CG  . PRO A  1 382 ? 13.55459  11.66733   19.01619  1.000 32.24922  ? 362 PRO H CG  1 
ATOM   2840  C CD  . PRO A  1 382 ? 14.00911  10.68302   17.99186  1.000 25.45133  ? 362 PRO H CD  1 
ATOM   2841  N N   . SER A  1 383 ? 9.66528   9.24500    19.34334  1.000 30.06798  ? 363 SER H N   1 
ATOM   2842  C CA  . SER A  1 383 ? 8.23598   9.12959    19.06431  1.000 33.56128  ? 363 SER H CA  1 
ATOM   2843  C C   . SER A  1 383 ? 7.88586   7.93426    18.18119  1.000 28.87542  ? 363 SER H C   1 
ATOM   2844  O O   . SER A  1 383 ? 6.77546   7.86434    17.64796  1.000 33.48154  ? 363 SER H O   1 
ATOM   2845  C CB  . SER A  1 383 ? 7.68936   10.42725   18.45553  1.000 36.59277  ? 363 SER H CB  1 
ATOM   2846  O OG  . SER A  1 383 ? 7.68639   11.46572   19.42464  1.000 39.61198  ? 363 SER H OG  1 
ATOM   2847  N N   . VAL A  1 384 ? 8.79273   6.96880    18.03977  1.000 27.99133  ? 364 VAL H N   1 
ATOM   2848  C CA  . VAL A  1 384 ? 8.51419   5.79864    17.21968  1.000 29.95043  ? 364 VAL H CA  1 
ATOM   2849  C C   . VAL A  1 384 ? 7.47283   4.92054    17.90282  1.000 32.35566  ? 364 VAL H C   1 
ATOM   2850  O O   . VAL A  1 384 ? 7.45072   4.78605    19.13321  1.000 33.21579  ? 364 VAL H O   1 
ATOM   2851  C CB  . VAL A  1 384 ? 9.81262   5.02360    16.94405  1.000 30.28587  ? 364 VAL H CB  1 
ATOM   2852  C CG1 . VAL A  1 384 ? 9.51750   3.62416    16.41487  1.000 28.16849  ? 364 VAL H CG1 1 
ATOM   2853  C CG2 . VAL A  1 384 ? 10.66947  5.79397    15.96288  1.000 27.40946  ? 364 VAL H CG2 1 
ATOM   2854  N N   . LYS A  1 385 ? 6.58790   4.33377    17.10501  1.000 29.85802  ? 365 LYS H N   1 
ATOM   2855  C CA  . LYS A  1 385 ? 5.61273   3.36839    17.58047  1.000 30.60322  ? 365 LYS H CA  1 
ATOM   2856  C C   . LYS A  1 385 ? 5.99035   1.99183    17.04543  1.000 36.03403  ? 365 LYS H C   1 
ATOM   2857  O O   . LYS A  1 385 ? 6.18322   1.82462    15.83652  1.000 41.60475  ? 365 LYS H O   1 
ATOM   2858  C CB  . LYS A  1 385 ? 4.20473   3.75376    17.11955  1.000 47.14556  ? 365 LYS H CB  1 
ATOM   2859  C CG  . LYS A  1 385 ? 3.09686   2.84082    17.62318  1.000 55.58320  ? 365 LYS H CG  1 
ATOM   2860  C CD  . LYS A  1 385 ? 1.89649   3.65164    18.10233  1.000 50.63206  ? 365 LYS H CD  1 
ATOM   2861  C CE  . LYS A  1 385 ? 0.89054   3.88809    16.97338  1.000 49.49279  ? 365 LYS H CE  1 
ATOM   2862  N NZ  . LYS A  1 385 ? -0.17274  2.84117    16.95937  1.000 55.70776  ? 365 LYS H NZ  1 
ATOM   2863  N N   . ILE A  1 386 ? 6.12315   1.02067    17.94320  1.000 42.55428  ? 366 ILE H N   1 
ATOM   2864  C CA  . ILE A  1 386 ? 6.42623   -0.35795   17.57766  1.000 39.93861  ? 366 ILE H CA  1 
ATOM   2865  C C   . ILE A  1 386 ? 5.15916   -1.17727   17.77580  1.000 40.57916  ? 366 ILE H C   1 
ATOM   2866  O O   . ILE A  1 386 ? 4.73416   -1.42472   18.91208  1.000 44.58122  ? 366 ILE H O   1 
ATOM   2867  C CB  . ILE A  1 386 ? 7.58754   -0.93550   18.39830  1.000 36.38861  ? 366 ILE H CB  1 
ATOM   2868  C CG1 . ILE A  1 386 ? 8.82063   -0.03876   18.28609  1.000 28.97437  ? 366 ILE H CG1 1 
ATOM   2869  C CG2 . ILE A  1 386 ? 7.90087   -2.34471   17.93306  1.000 30.41946  ? 366 ILE H CG2 1 
ATOM   2870  C CD1 . ILE A  1 386 ? 9.48376   -0.07786   16.92549  1.000 29.05227  ? 366 ILE H CD1 1 
ATOM   2871  N N   . GLY A  1 387 ? 4.55910   -1.60574   16.66854  1.000 32.87150  ? 367 GLY H N   1 
ATOM   2872  C CA  . GLY A  1 387 ? 3.34811   -2.38669   16.74514  1.000 34.13752  ? 367 GLY H CA  1 
ATOM   2873  C C   . GLY A  1 387 ? 3.57427   -3.75778   17.35069  1.000 34.37202  ? 367 GLY H C   1 
ATOM   2874  O O   . GLY A  1 387 ? 4.68110   -4.29659   17.37100  1.000 33.70531  ? 367 GLY H O   1 
ATOM   2875  N N   . ARG A  1 388 ? 2.48259   -4.32409   17.85353  1.000 38.72945  ? 368 ARG H N   1 
ATOM   2876  C CA  . ARG A  1 388 ? 2.50834   -5.64499   18.46097  1.000 36.20416  ? 368 ARG H CA  1 
ATOM   2877  C C   . ARG A  1 388 ? 3.20079   -6.66257   17.55646  1.000 38.05978  ? 368 ARG H C   1 
ATOM   2878  O O   . ARG A  1 388 ? 3.12673   -6.58889   16.32527  1.000 36.37584  ? 368 ARG H O   1 
ATOM   2879  C CB  . ARG A  1 388 ? 1.07894   -6.09546   18.76347  1.000 40.55792  ? 368 ARG H CB  1 
ATOM   2880  C CG  . ARG A  1 388 ? 0.36678   -5.33666   19.86163  1.000 37.61240  ? 368 ARG H CG  1 
ATOM   2881  C CD  . ARG A  1 388 ? -0.45533  -6.32220   20.66593  1.000 40.20061  ? 368 ARG H CD  1 
ATOM   2882  N NE  . ARG A  1 388 ? -1.06132  -5.75086   21.86129  1.000 42.98664  ? 368 ARG H NE  1 
ATOM   2883  C CZ  . ARG A  1 388 ? -1.79342  -6.45943   22.71364  1.000 51.94852  ? 368 ARG H CZ  1 
ATOM   2884  N NH1 . ARG A  1 388 ? -1.98342  -7.75218   22.49900  1.000 47.19710  ? 368 ARG H NH1 1 
ATOM   2885  N NH2 . ARG A  1 388 ? -2.32931  -5.88862   23.77767  1.000 56.91831  ? 368 ARG H NH2 1 
ATOM   2886  N N   . HIS A  1 389 ? 3.90318   -7.60284   18.19008  1.000 35.92154  ? 369 HIS H N   1 
ATOM   2887  C CA  . HIS A  1 389 ? 4.57265   -8.73331   17.55074  1.000 38.56270  ? 369 HIS H CA  1 
ATOM   2888  C C   . HIS A  1 389 ? 5.59330   -8.37073   16.47387  1.000 35.41012  ? 369 HIS H C   1 
ATOM   2889  O O   . HIS A  1 389 ? 6.14397   -9.27231   15.83457  1.000 44.53614  ? 369 HIS H O   1 
ATOM   2890  C CB  . HIS A  1 389 ? 3.55715   -9.71078   16.94089  1.000 38.82598  ? 369 HIS H CB  1 
ATOM   2891  C CG  . HIS A  1 389 ? 2.33967   -9.94785   17.78071  1.000 50.72067  ? 369 HIS H CG  1 
ATOM   2892  N ND1 . HIS A  1 389 ? 2.18229   -11.07682  18.55638  1.000 46.08171  ? 369 HIS H ND1 1 
ATOM   2893  C CD2 . HIS A  1 389 ? 1.20178   -9.22902   17.92890  1.000 54.45480  ? 369 HIS H CD2 1 
ATOM   2894  C CE1 . HIS A  1 389 ? 1.01265   -11.02860  19.16812  1.000 47.41296  ? 369 HIS H CE1 1 
ATOM   2895  N NE2 . HIS A  1 389 ? 0.39787   -9.91762   18.80505  1.000 54.09485  ? 369 HIS H NE2 1 
ATOM   2896  N N   . ALA A  1 390 ? 5.88253   -7.08834   16.26930  1.000 34.47482  ? 370 ALA H N   1 
ATOM   2897  C CA  . ALA A  1 390 ? 6.94217   -6.71802   15.33723  1.000 39.97737  ? 370 ALA H CA  1 
ATOM   2898  C C   . ALA A  1 390 ? 8.29966   -7.14050   15.89007  1.000 39.47169  ? 370 ALA H C   1 
ATOM   2899  O O   . ALA A  1 390 ? 8.53112   -7.10860   17.09965  1.000 36.87339  ? 370 ALA H O   1 
ATOM   2900  C CB  . ALA A  1 390 ? 6.92467   -5.21439   15.07485  1.000 33.04227  ? 370 ALA H CB  1 
ATOM   2901  N N   . GLN A  1 391 ? 9.19716   -7.56535   15.00389  1.000 32.86802  ? 371 GLN H N   1 
ATOM   2902  C CA  . GLN A  1 391 ? 10.53147  -7.99919   15.41151  1.000 32.24810  ? 371 GLN H CA  1 
ATOM   2903  C C   . GLN A  1 391 ? 11.56002  -7.40283   14.46392  1.000 31.62730  ? 371 GLN H C   1 
ATOM   2904  O O   . GLN A  1 391 ? 11.51609  -7.65708   13.25636  1.000 32.20361  ? 371 GLN H O   1 
ATOM   2905  C CB  . GLN A  1 391 ? 10.62883  -9.53036   15.46044  1.000 33.17107  ? 371 GLN H CB  1 
ATOM   2906  C CG  . GLN A  1 391 ? 9.48699   -10.18914  16.23836  1.000 35.29951  ? 371 GLN H CG  1 
ATOM   2907  C CD  . GLN A  1 391 ? 9.67981   -11.67974  16.42660  1.000 52.18442  ? 371 GLN H CD  1 
ATOM   2908  O OE1 . GLN A  1 391 ? 8.83814   -12.36067  17.01813  1.000 63.29972  ? 371 GLN H OE1 1 
ATOM   2909  N NE2 . GLN A  1 391 ? 10.80335  -12.19332  15.94261  1.000 47.57435  ? 371 GLN H NE2 1 
ATOM   2910  N N   . LEU A  1 392 ? 12.48220  -6.61330   15.01691  1.000 30.55627  ? 372 LEU H N   1 
ATOM   2911  C CA  . LEU A  1 392 ? 13.39210  -5.76983   14.24855  1.000 29.92737  ? 372 LEU H CA  1 
ATOM   2912  C C   . LEU A  1 392 ? 14.80682  -5.93259   14.78601  1.000 29.27399  ? 372 LEU H C   1 
ATOM   2913  O O   . LEU A  1 392 ? 15.01887  -5.87196   16.00156  1.000 28.81528  ? 372 LEU H O   1 
ATOM   2914  C CB  . LEU A  1 392 ? 12.97331  -4.29551   14.33703  1.000 30.95953  ? 372 LEU H CB  1 
ATOM   2915  C CG  . LEU A  1 392 ? 11.61777  -3.83457   13.79168  1.000 37.36818  ? 372 LEU H CG  1 
ATOM   2916  C CD1 . LEU A  1 392 ? 10.45405  -4.26928   14.67635  1.000 39.90040  ? 372 LEU H CD1 1 
ATOM   2917  C CD2 . LEU A  1 392 ? 11.62830  -2.32488   13.66951  1.000 44.66971  ? 372 LEU H CD2 1 
ATOM   2918  N N   . SER A  1 393 ? 15.77557  -6.11537   13.89322  1.000 29.31879  ? 373 SER H N   1 
ATOM   2919  C CA  . SER A  1 393 ? 17.16517  -6.27333   14.30865  1.000 28.84344  ? 373 SER H CA  1 
ATOM   2920  C C   . SER A  1 393 ? 18.08613  -5.56754   13.32403  1.000 33.96350  ? 373 SER H C   1 
ATOM   2921  O O   . SER A  1 393 ? 17.86595  -5.62285   12.11132  1.000 31.98158  ? 373 SER H O   1 
ATOM   2922  C CB  . SER A  1 393 ? 17.54812  -7.76209   14.43567  1.000 31.00308  ? 373 SER H CB  1 
ATOM   2923  O OG  . SER A  1 393 ? 16.53057  -8.49470   15.10326  1.000 44.51253  ? 373 SER H OG  1 
ATOM   2924  N N   . ASN A  1 394 ? 19.11705  -4.90493   13.85927  1.000 45.21424  ? 374 ASN H N   1 
ATOM   2925  C CA  . ASN A  1 394 ? 20.10877  -4.16815   13.06889  1.000 40.97661  ? 374 ASN H CA  1 
ATOM   2926  C C   . ASN A  1 394 ? 19.43570  -3.03302   12.28731  1.000 36.32041  ? 374 ASN H C   1 
ATOM   2927  O O   . ASN A  1 394 ? 19.36936  -3.01424   11.05504  1.000 31.92192  ? 374 ASN H O   1 
ATOM   2928  C CB  . ASN A  1 394 ? 20.87430  -5.12151   12.14357  1.000 34.51736  ? 374 ASN H CB  1 
ATOM   2929  C CG  . ASN A  1 394 ? 21.89505  -5.95522   12.88879  1.000 38.34650  ? 374 ASN H CG  1 
ATOM   2930  O OD1 . ASN A  1 394 ? 22.42671  -6.92434   12.35472  1.000 53.07955  ? 374 ASN H OD1 1 
ATOM   2931  N ND2 . ASN A  1 394 ? 22.17308  -5.58358   14.12724  1.000 38.27673  ? 374 ASN H ND2 1 
ATOM   2932  N N   . VAL A  1 395 ? 18.96292  -2.05815   13.05502  1.000 34.42906  ? 375 VAL H N   1 
ATOM   2933  C CA  . VAL A  1 395 ? 17.92453  -1.14968   12.59389  1.000 27.82972  ? 375 VAL H CA  1 
ATOM   2934  C C   . VAL A  1 395 ? 18.19250  0.26040    13.10410  1.000 26.27655  ? 375 VAL H C   1 
ATOM   2935  O O   . VAL A  1 395 ? 18.60786  0.45274    14.25161  1.000 25.71096  ? 375 VAL H O   1 
ATOM   2936  C CB  . VAL A  1 395 ? 16.54759  -1.66192   13.06195  1.000 36.60449  ? 375 VAL H CB  1 
ATOM   2937  C CG1 . VAL A  1 395 ? 15.59768  -0.53763   13.21225  1.000 45.08239  ? 375 VAL H CG1 1 
ATOM   2938  C CG2 . VAL A  1 395 ? 16.00238  -2.69192   12.07678  1.000 42.18261  ? 375 VAL H CG2 1 
ATOM   2939  N N   . VAL A  1 396 ? 17.96296  1.24408    12.23926  1.000 30.87937  ? 376 VAL H N   1 
ATOM   2940  C CA  . VAL A  1 396 ? 17.81789  2.64293    12.62564  1.000 28.17986  ? 376 VAL H CA  1 
ATOM   2941  C C   . VAL A  1 396 ? 16.40713  3.05706    12.23419  1.000 26.49248  ? 376 VAL H C   1 
ATOM   2942  O O   . VAL A  1 396 ? 16.07558  3.08343    11.04045  1.000 27.11534  ? 376 VAL H O   1 
ATOM   2943  C CB  . VAL A  1 396 ? 18.85639  3.54284    11.94503  1.000 29.32652  ? 376 VAL H CB  1 
ATOM   2944  C CG1 . VAL A  1 396 ? 18.56280  5.00012    12.25315  1.000 25.64556  ? 376 VAL H CG1 1 
ATOM   2945  C CG2 . VAL A  1 396 ? 20.26623  3.16007    12.37721  1.000 32.63026  ? 376 VAL H CG2 1 
ATOM   2946  N N   . ILE A  1 397 ? 15.56454  3.35601    13.22155  1.000 26.33488  ? 377 ILE H N   1 
ATOM   2947  C CA  . ILE A  1 397 ? 14.19835  3.80179    12.95267  1.000 26.89809  ? 377 ILE H CA  1 
ATOM   2948  C C   . ILE A  1 397 ? 14.15137  5.32075    13.03978  1.000 26.72373  ? 377 ILE H C   1 
ATOM   2949  O O   . ILE A  1 397 ? 14.47635  5.90717    14.07897  1.000 26.17079  ? 377 ILE H O   1 
ATOM   2950  C CB  . ILE A  1 397 ? 13.17522  3.17434    13.91060  1.000 27.68246  ? 377 ILE H CB  1 
ATOM   2951  C CG1 . ILE A  1 397 ? 13.27761  1.65641    13.90413  1.000 27.31850  ? 377 ILE H CG1 1 
ATOM   2952  C CG2 . ILE A  1 397 ? 11.77814  3.54733    13.46857  1.000 27.84576  ? 377 ILE H CG2 1 
ATOM   2953  C CD1 . ILE A  1 397 ? 12.32381  0.97874    14.84987  1.000 27.60764  ? 377 ILE H CD1 1 
ATOM   2954  N N   . ASP A  1 398 ? 13.72235  5.94500    11.95111  1.000 27.31185  ? 378 ASP H N   1 
ATOM   2955  C CA  . ASP A  1 398 ? 13.59211  7.38625    11.85709  1.000 35.65838  ? 378 ASP H CA  1 
ATOM   2956  C C   . ASP A  1 398 ? 12.52758  7.90733    12.82401  1.000 37.41516  ? 378 ASP H C   1 
ATOM   2957  O O   . ASP A  1 398 ? 11.66178  7.16665    13.30387  1.000 27.72063  ? 378 ASP H O   1 
ATOM   2958  C CB  . ASP A  1 398 ? 13.24697  7.76767    10.41604  1.000 37.69227  ? 378 ASP H CB  1 
ATOM   2959  C CG  . ASP A  1 398 ? 13.16569  9.25502    10.20874  1.000 44.20290  ? 378 ASP H CG  1 
ATOM   2960  O OD1 . ASP A  1 398 ? 12.18522  9.69937    9.57443   1.000 45.86062  ? 378 ASP H OD1 1 
ATOM   2961  O OD2 . ASP A  1 398 ? 14.07074  9.97458    10.69200  1.000 43.75986  ? 378 ASP H OD2 1 
ATOM   2962  N N   . HIS A  1 399 ? 12.61267  9.20873    13.10268  1.000 27.41934  ? 379 HIS H N   1 
ATOM   2963  C CA  . HIS A  1 399 ? 11.69066  9.90315    13.99631  1.000 27.61745  ? 379 HIS H CA  1 
ATOM   2964  C C   . HIS A  1 399 ? 10.23406  9.62593    13.63715  1.000 28.51910  ? 379 HIS H C   1 
ATOM   2965  O O   . HIS A  1 399 ? 9.84751   9.68005    12.46689  1.000 36.99844  ? 379 HIS H O   1 
ATOM   2966  C CB  . HIS A  1 399 ? 11.98182  11.40876   13.92339  1.000 27.71489  ? 379 HIS H CB  1 
ATOM   2967  C CG  . HIS A  1 399 ? 11.09874  12.25310   14.78756  1.000 28.04491  ? 379 HIS H CG  1 
ATOM   2968  N ND1 . HIS A  1 399 ? 11.58413  12.98899   15.84746  1.000 39.14211  ? 379 HIS H ND1 1 
ATOM   2969  C CD2 . HIS A  1 399 ? 9.76900   12.50304   14.73460  1.000 34.54562  ? 379 HIS H CD2 1 
ATOM   2970  C CE1 . HIS A  1 399 ? 10.58951  13.64288   16.42013  1.000 35.63905  ? 379 HIS H CE1 1 
ATOM   2971  N NE2 . HIS A  1 399 ? 9.47690   13.36457   15.76422  1.000 43.59003  ? 379 HIS H NE2 1 
ATOM   2972  N N   . GLY A  1 400 ? 9.42739   9.32182    14.65543  1.000 28.61213  ? 380 GLY H N   1 
ATOM   2973  C CA  . GLY A  1 400 ? 7.98290   9.25903    14.51337  1.000 29.58268  ? 380 GLY H CA  1 
ATOM   2974  C C   . GLY A  1 400 ? 7.43945   8.14569    13.64039  1.000 38.32727  ? 380 GLY H C   1 
ATOM   2975  O O   . GLY A  1 400 ? 6.22457   8.10413    13.40789  1.000 33.53760  ? 380 GLY H O   1 
ATOM   2976  N N   . VAL A  1 401 ? 8.29036   7.24134    13.15234  1.000 36.22688  ? 381 VAL H N   1 
ATOM   2977  C CA  . VAL A  1 401 ? 7.82447   6.14407    12.31448  1.000 39.48037  ? 381 VAL H CA  1 
ATOM   2978  C C   . VAL A  1 401 ? 6.89524   5.23080    13.10584  1.000 40.76300  ? 381 VAL H C   1 
ATOM   2979  O O   . VAL A  1 401 ? 7.14942   4.90655    14.27353  1.000 41.03140  ? 381 VAL H O   1 
ATOM   2980  C CB  . VAL A  1 401 ? 9.03063   5.36792    11.76000  1.000 34.96395  ? 381 VAL H CB  1 
ATOM   2981  C CG1 . VAL A  1 401 ? 8.60050   4.01380    11.21838  1.000 38.70073  ? 381 VAL H CG1 1 
ATOM   2982  C CG2 . VAL A  1 401 ? 9.73720   6.18552    10.69181  1.000 29.90496  ? 381 VAL H CG2 1 
ATOM   2983  N N   . VAL A  1 402 ? 5.80331   4.81617    12.47062  1.000 38.71535  ? 382 VAL H N   1 
ATOM   2984  C CA  . VAL A  1 402 ? 4.86144   3.86668    13.05161  1.000 33.08002  ? 382 VAL H CA  1 
ATOM   2985  C C   . VAL A  1 402 ? 5.13808   2.51707    12.39833  1.000 37.18416  ? 382 VAL H C   1 
ATOM   2986  O O   . VAL A  1 402 ? 4.76826   2.28258    11.24391  1.000 43.28573  ? 382 VAL H O   1 
ATOM   2987  C CB  . VAL A  1 402 ? 3.41123   4.31069    12.85056  1.000 33.67628  ? 382 VAL H CB  1 
ATOM   2988  C CG1 . VAL A  1 402 ? 2.45154   3.28982    13.45314  1.000 37.59215  ? 382 VAL H CG1 1 
ATOM   2989  C CG2 . VAL A  1 402 ? 3.18752   5.67583    13.46104  1.000 33.54347  ? 382 VAL H CG2 1 
ATOM   2990  N N   . ILE A  1 403 ? 5.80208   1.62562    13.12801  1.000 32.07467  ? 383 ILE H N   1 
ATOM   2991  C CA  . ILE A  1 403 ? 6.09784   0.29617    12.59951  1.000 40.70374  ? 383 ILE H CA  1 
ATOM   2992  C C   . ILE A  1 403 ? 4.83928   -0.55829   12.67547  1.000 40.77758  ? 383 ILE H C   1 
ATOM   2993  O O   . ILE A  1 403 ? 4.30266   -0.77293   13.77068  1.000 49.93819  ? 383 ILE H O   1 
ATOM   2994  C CB  . ILE A  1 403 ? 7.27148   -0.35651   13.34396  1.000 36.47017  ? 383 ILE H CB  1 
ATOM   2995  C CG1 . ILE A  1 403 ? 8.48655   0.56361    13.30929  1.000 30.39257  ? 383 ILE H CG1 1 
ATOM   2996  C CG2 . ILE A  1 403 ? 7.60033   -1.70154   12.74118  1.000 43.20986  ? 383 ILE H CG2 1 
ATOM   2997  C CD1 . ILE A  1 403 ? 9.28726   0.44604    12.03114  1.000 30.41929  ? 383 ILE H CD1 1 
ATOM   2998  N N   . PRO A  1 404 ? 4.34321   -1.06703   11.54799  1.000 34.54541  ? 384 PRO H N   1 
ATOM   2999  C CA  . PRO A  1 404 ? 3.09166   -1.83025   11.57394  1.000 37.37123  ? 384 PRO H CA  1 
ATOM   3000  C C   . PRO A  1 404 ? 3.23945   -3.10281   12.38908  1.000 35.97462  ? 384 PRO H C   1 
ATOM   3001  O O   . PRO A  1 404 ? 4.33013   -3.66396   12.51322  1.000 35.13454  ? 384 PRO H O   1 
ATOM   3002  C CB  . PRO A  1 404 ? 2.82618   -2.14709   10.09647  1.000 36.81879  ? 384 PRO H CB  1 
ATOM   3003  C CG  . PRO A  1 404 ? 3.85108   -1.38988   9.30815   1.000 36.07518  ? 384 PRO H CG  1 
ATOM   3004  C CD  . PRO A  1 404 ? 4.98801   -1.10146   10.22680  1.000 34.63056  ? 384 PRO H CD  1 
ATOM   3005  N N   . GLU A  1 405 ? 2.11667   -3.55575   12.93995  1.000 37.53790  ? 385 GLU H N   1 
ATOM   3006  C CA  . GLU A  1 405 ? 2.10608   -4.77104   13.74082  1.000 39.42857  ? 385 GLU H CA  1 
ATOM   3007  C C   . GLU A  1 405 ? 2.65383   -5.95056   12.94349  1.000 37.45502  ? 385 GLU H C   1 
ATOM   3008  O O   . GLU A  1 405 ? 2.40977   -6.08027   11.74181  1.000 38.19247  ? 385 GLU H O   1 
ATOM   3009  C CB  . GLU A  1 405 ? 0.68299   -5.06607   14.22052  1.000 38.84596  ? 385 GLU H CB  1 
ATOM   3010  C CG  . GLU A  1 405 ? 0.09994   -3.98569   15.12014  1.000 39.34527  ? 385 GLU H CG  1 
ATOM   3011  C CD  . GLU A  1 405 ? -1.36786  -4.21098   15.43539  1.000 48.75748  ? 385 GLU H CD  1 
ATOM   3012  O OE1 . GLU A  1 405 ? -2.12188  -4.60234   14.52065  1.000 51.27778  ? 385 GLU H OE1 1 
ATOM   3013  O OE2 . GLU A  1 405 ? -1.77074  -3.99807   16.59949  1.000 50.74658  ? 385 GLU H OE2 1 
ATOM   3014  N N   . GLY A  1 406 ? 3.42309   -6.79982   13.61734  1.000 37.01897  ? 386 GLY H N   1 
ATOM   3015  C CA  . GLY A  1 406 ? 3.93035   -8.00669   12.99743  1.000 37.85593  ? 386 GLY H CA  1 
ATOM   3016  C C   . GLY A  1 406 ? 5.00574   -7.81811   11.95184  1.000 36.93771  ? 386 GLY H C   1 
ATOM   3017  O O   . GLY A  1 406 ? 5.37608   -8.79312   11.29083  1.000 42.69686  ? 386 GLY H O   1 
ATOM   3018  N N   . LEU A  1 407 ? 5.51643   -6.60344   11.76697  1.000 35.93095  ? 387 LEU H N   1 
ATOM   3019  C CA  . LEU A  1 407 ? 6.60534   -6.40448   10.81877  1.000 40.86048  ? 387 LEU H CA  1 
ATOM   3020  C C   . LEU A  1 407 ? 7.84260   -7.17836   11.26159  1.000 39.21450  ? 387 LEU H C   1 
ATOM   3021  O O   . LEU A  1 407 ? 8.13981   -7.28326   12.45444  1.000 45.36720  ? 387 LEU H O   1 
ATOM   3022  C CB  . LEU A  1 407 ? 6.93469   -4.91675   10.67827  1.000 34.50745  ? 387 LEU H CB  1 
ATOM   3023  C CG  . LEU A  1 407 ? 7.94797   -4.56672   9.58168   1.000 39.09714  ? 387 LEU H CG  1 
ATOM   3024  C CD1 . LEU A  1 407 ? 7.47385   -5.05902   8.22250   1.000 35.40939  ? 387 LEU H CD1 1 
ATOM   3025  C CD2 . LEU A  1 407 ? 8.22450   -3.07182   9.52664   1.000 34.30428  ? 387 LEU H CD2 1 
ATOM   3026  N N   . ILE A  1 408 ? 8.55970   -7.73848   10.29171  1.000 35.12092  ? 388 ILE H N   1 
ATOM   3027  C CA  . ILE A  1 408 ? 9.77233   -8.50479   10.55453  1.000 34.74475  ? 388 ILE H CA  1 
ATOM   3028  C C   . ILE A  1 408 ? 10.89052  -7.91112   9.71744   1.000 34.15329  ? 388 ILE H C   1 
ATOM   3029  O O   . ILE A  1 408 ? 10.78990  -7.86004   8.48594   1.000 34.79189  ? 388 ILE H O   1 
ATOM   3030  C CB  . ILE A  1 408 ? 9.59691   -10.00050  10.23975  1.000 40.25123  ? 388 ILE H CB  1 
ATOM   3031  C CG1 . ILE A  1 408 ? 8.39707   -10.55710  10.99829  1.000 36.74525  ? 388 ILE H CG1 1 
ATOM   3032  C CG2 . ILE A  1 408 ? 10.86163  -10.77517  10.59187  1.000 35.65883  ? 388 ILE H CG2 1 
ATOM   3033  C CD1 . ILE A  1 408 ? 8.59268   -10.65015  12.49736  1.000 36.09044  ? 388 ILE H CD1 1 
ATOM   3034  N N   . VAL A  1 409 ? 11.94655  -7.45902   10.38236  1.000 33.04004  ? 389 VAL H N   1 
ATOM   3035  C CA  . VAL A  1 409 ? 13.10222  -6.85525   9.73573   1.000 33.81724  ? 389 VAL H CA  1 
ATOM   3036  C C   . VAL A  1 409 ? 14.35530  -7.49345   10.31552  1.000 41.68738  ? 389 VAL H C   1 
ATOM   3037  O O   . VAL A  1 409 ? 14.40685  -7.83347   11.50128  1.000 51.91656  ? 389 VAL H O   1 
ATOM   3038  C CB  . VAL A  1 409 ? 13.12570  -5.31917   9.92353   1.000 31.54944  ? 389 VAL H CB  1 
ATOM   3039  C CG1 . VAL A  1 409 ? 14.32237  -4.70198   9.20964   1.000 31.10494  ? 389 VAL H CG1 1 
ATOM   3040  C CG2 . VAL A  1 409 ? 11.82943  -4.70495   9.41685   1.000 32.10071  ? 389 VAL H CG2 1 
ATOM   3041  N N   . GLY A  1 410 ? 15.37071  -7.65738   9.47072   1.000 35.60606  ? 390 GLY H N   1 
ATOM   3042  C CA  . GLY A  1 410 ? 16.61738  -8.26202   9.88329   1.000 32.95649  ? 390 GLY H CA  1 
ATOM   3043  C C   . GLY A  1 410 ? 16.66281  -9.76273   9.72868   1.000 43.82487  ? 390 GLY H C   1 
ATOM   3044  O O   . GLY A  1 410 ? 17.65404  -10.38553  10.13378  1.000 46.53969  ? 390 GLY H O   1 
ATOM   3045  N N   . GLU A  1 411 ? 15.62194  -10.36146  9.16054   1.000 45.56052  ? 391 GLU H N   1 
ATOM   3046  C CA  . GLU A  1 411 ? 15.55517  -11.79795  8.94942   1.000 46.66874  ? 391 GLU H CA  1 
ATOM   3047  C C   . GLU A  1 411 ? 15.89006  -12.20290  7.52120   1.000 49.91356  ? 391 GLU H C   1 
ATOM   3048  O O   . GLU A  1 411 ? 16.61493  -13.17886  7.31730   1.000 50.48644  ? 391 GLU H O   1 
ATOM   3049  C CB  . GLU A  1 411 ? 14.16304  -12.30581  9.31334   1.000 45.20715  ? 391 GLU H CB  1 
ATOM   3050  C CG  . GLU A  1 411 ? 13.88446  -13.72775  8.91897   1.000 52.04565  ? 391 GLU H CG  1 
ATOM   3051  C CD  . GLU A  1 411 ? 12.41024  -13.95017  8.72254   1.000 52.36093  ? 391 GLU H CD  1 
ATOM   3052  O OE1 . GLU A  1 411 ? 11.73608  -14.27168  9.72235   1.000 52.83525  ? 391 GLU H OE1 1 
ATOM   3053  O OE2 . GLU A  1 411 ? 11.92702  -13.79851  7.58037   1.000 47.59968  ? 391 GLU H OE2 1 
ATOM   3054  N N   . ASP A  1 412 ? 15.38591  -11.47260  6.53210   1.000 50.24541  ? 392 ASP H N   1 
ATOM   3055  C CA  . ASP A  1 412 ? 15.63986  -11.77101  5.12024   1.000 44.72742  ? 392 ASP H CA  1 
ATOM   3056  C C   . ASP A  1 412 ? 16.26070  -10.54985  4.46312   1.000 45.02161  ? 392 ASP H C   1 
ATOM   3057  O O   . ASP A  1 412 ? 15.55157  -9.55421   4.21683   1.000 43.73660  ? 392 ASP H O   1 
ATOM   3058  C CB  . ASP A  1 412 ? 14.34322  -12.16984  4.41291   1.000 43.56943  ? 392 ASP H CB  1 
ATOM   3059  C CG  . ASP A  1 412 ? 14.51428  -12.36883  2.90523   1.000 48.30487  ? 392 ASP H CG  1 
ATOM   3060  O OD1 . ASP A  1 412 ? 15.65828  -12.35820  2.39585   1.000 49.59332  ? 392 ASP H OD1 1 
ATOM   3061  O OD2 . ASP A  1 412 ? 13.48238  -12.55043  2.22578   1.000 50.24260  ? 392 ASP H OD2 1 
ATOM   3062  N N   . PRO A  1 413 ? 17.55453  -10.58571  4.13661   1.000 54.64859  ? 393 PRO H N   1 
ATOM   3063  C CA  . PRO A  1 413 ? 18.20704  -9.37512   3.60573   1.000 50.63714  ? 393 PRO H CA  1 
ATOM   3064  C C   . PRO A  1 413 ? 17.61652  -8.88178   2.29404   1.000 50.64128  ? 393 PRO H C   1 
ATOM   3065  O O   . PRO A  1 413 ? 17.43053  -7.66912   2.13011   1.000 47.30061  ? 393 PRO H O   1 
ATOM   3066  C CB  . PRO A  1 413 ? 19.67099  -9.81484   3.44387   1.000 48.70342  ? 393 PRO H CB  1 
ATOM   3067  C CG  . PRO A  1 413 ? 19.82275  -11.01525  4.33213   1.000 49.02908  ? 393 PRO H CG  1 
ATOM   3068  C CD  . PRO A  1 413 ? 18.49847  -11.70367  4.29409   1.000 50.26159  ? 393 PRO H CD  1 
ATOM   3069  N N   . GLU A  1 414 ? 17.32147  -9.78046   1.34859   1.000 50.18320  ? 394 GLU H N   1 
ATOM   3070  C CA  . GLU A  1 414 ? 16.81814  -9.32117   0.05595   1.000 52.95995  ? 394 GLU H CA  1 
ATOM   3071  C C   . GLU A  1 414 ? 15.45404  -8.65969   0.19509   1.000 52.91639  ? 394 GLU H C   1 
ATOM   3072  O O   . GLU A  1 414 ? 15.19385  -7.63299   -0.44290  1.000 64.32804  ? 394 GLU H O   1 
ATOM   3073  C CB  . GLU A  1 414 ? 16.75372  -10.47025  -0.95110  1.000 54.65752  ? 394 GLU H CB  1 
ATOM   3074  C CG  . GLU A  1 414 ? 17.02484  -9.97959   -2.36995  1.000 63.70120  ? 394 GLU H CG  1 
ATOM   3075  C CD  . GLU A  1 414 ? 16.36382  -10.81497  -3.44779  1.000 74.72580  ? 394 GLU H CD  1 
ATOM   3076  O OE1 . GLU A  1 414 ? 16.99005  -11.00295  -4.51171  1.000 79.88474  ? 394 GLU H OE1 1 
ATOM   3077  O OE2 . GLU A  1 414 ? 15.22062  -11.27529  -3.24254  1.000 81.22856  ? 394 GLU H OE2 1 
ATOM   3078  N N   . LEU A  1 415 ? 14.57350  -9.22857   1.02478   1.000 51.67975  ? 395 LEU H N   1 
ATOM   3079  C CA  . LEU A  1 415 ? 13.29784  -8.57720   1.28843   1.000 51.48312  ? 395 LEU H CA  1 
ATOM   3080  C C   . LEU A  1 415 ? 13.54505  -7.24072   1.98290   1.000 55.90025  ? 395 LEU H C   1 
ATOM   3081  O O   . LEU A  1 415 ? 13.05964  -6.19759   1.52880   1.000 51.35108  ? 395 LEU H O   1 
ATOM   3082  C CB  . LEU A  1 415 ? 12.38186  -9.51328   2.10385   1.000 53.06826  ? 395 LEU H CB  1 
ATOM   3083  C CG  . LEU A  1 415 ? 10.85563  -9.30243   2.18934   1.000 54.45411  ? 395 LEU H CG  1 
ATOM   3084  C CD1 . LEU A  1 415 ? 10.11602  -10.33105  2.98800   1.000 60.87834  ? 395 LEU H CD1 1 
ATOM   3085  C CD2 . LEU A  1 415 ? 10.62830  -8.08865   2.92485   1.000 56.66668  ? 395 LEU H CD2 1 
ATOM   3086  N N   . ASP A  1 416 ? 14.33980  -7.24709   3.05964   1.000 46.45314  ? 396 ASP H N   1 
ATOM   3087  C CA  . ASP A  1 416 ? 14.62551  -6.00513   3.77395   1.000 53.34726  ? 396 ASP H CA  1 
ATOM   3088  C C   . ASP A  1 416 ? 15.17710  -4.95080   2.82322   1.000 48.07864  ? 396 ASP H C   1 
ATOM   3089  O O   . ASP A  1 416 ? 14.70708  -3.80989   2.80747   1.000 42.33900  ? 396 ASP H O   1 
ATOM   3090  C CB  . ASP A  1 416 ? 15.59825  -6.25977   4.93310   1.000 50.14028  ? 396 ASP H CB  1 
ATOM   3091  C CG  . ASP A  1 416 ? 14.98208  -7.09140   6.04573   1.000 54.94418  ? 396 ASP H CG  1 
ATOM   3092  O OD1 . ASP A  1 416 ? 13.75200  -7.31589   6.01405   1.000 59.35738  ? 396 ASP H OD1 1 
ATOM   3093  O OD2 . ASP A  1 416 ? 15.72891  -7.52846   6.94818   1.000 46.03741  ? 396 ASP H OD2 1 
ATOM   3094  N N   . ALA A  1 417 ? 16.13148  -5.33757   1.97388   1.000 53.30034  ? 397 ALA H N   1 
ATOM   3095  C CA  . ALA A  1 417 ? 16.74479  -4.37944   1.06072   1.000 48.38350  ? 397 ALA H CA  1 
ATOM   3096  C C   . ALA A  1 417 ? 15.76069  -3.87267   0.01378   1.000 52.33146  ? 397 ALA H C   1 
ATOM   3097  O O   . ALA A  1 417 ? 15.90575  -2.74587   -0.47283  1.000 58.18555  ? 397 ALA H O   1 
ATOM   3098  C CB  . ALA A  1 417 ? 17.95966  -5.00742   0.38250   1.000 50.13478  ? 397 ALA H CB  1 
ATOM   3099  N N   . LYS A  1 418 ? 14.76582  -4.67923   -0.35685  1.000 55.88474  ? 398 LYS H N   1 
ATOM   3100  C CA  . LYS A  1 418 ? 13.74628  -4.18528   -1.27700  1.000 63.23387  ? 398 LYS H CA  1 
ATOM   3101  C C   . LYS A  1 418 ? 12.83220  -3.18142   -0.58489  1.000 63.57724  ? 398 LYS H C   1 
ATOM   3102  O O   . LYS A  1 418 ? 12.58754  -2.08919   -1.11003  1.000 68.50722  ? 398 LYS H O   1 
ATOM   3103  C CB  . LYS A  1 418 ? 12.94157  -5.34619   -1.86450  1.000 52.25779  ? 398 LYS H CB  1 
ATOM   3104  N N   . ARG A  1 419 ? 12.32852  -3.51793   0.60724   1.000 46.71717  ? 399 ARG H N   1 
ATOM   3105  C CA  . ARG A  1 419 ? 11.44988  -2.56894   1.28496   1.000 48.70033  ? 399 ARG H CA  1 
ATOM   3106  C C   . ARG A  1 419 ? 12.21371  -1.38062   1.83499   1.000 47.74469  ? 399 ARG H C   1 
ATOM   3107  O O   . ARG A  1 419 ? 11.64823  -0.28650   1.94662   1.000 44.54478  ? 399 ARG H O   1 
ATOM   3108  C CB  . ARG A  1 419 ? 10.68783  -3.19763   2.44628   1.000 47.94595  ? 399 ARG H CB  1 
ATOM   3109  C CG  . ARG A  1 419 ? 9.69249   -4.24544   2.10359   1.000 53.97891  ? 399 ARG H CG  1 
ATOM   3110  C CD  . ARG A  1 419 ? 9.50148   -5.13444   3.30474   1.000 49.32644  ? 399 ARG H CD  1 
ATOM   3111  N NE  . ARG A  1 419 ? 8.24578   -5.88688   3.30481   1.000 61.95312  ? 399 ARG H NE  1 
ATOM   3112  C CZ  . ARG A  1 419 ? 7.81899   -6.59970   4.34069   1.000 68.15007  ? 399 ARG H CZ  1 
ATOM   3113  N NH1 . ARG A  1 419 ? 8.59157   -6.69479   5.41280   1.000 67.28743  ? 399 ARG H NH1 1 
ATOM   3114  N NH2 . ARG A  1 419 ? 6.69209   -7.29900   4.26728   1.000 62.38794  ? 399 ARG H NH2 1 
ATOM   3115  N N   . PHE A  1 420 ? 13.48077  -1.56231   2.19517   1.000 50.71376  ? 400 PHE H N   1 
ATOM   3116  C CA  . PHE A  1 420 ? 14.17534  -0.58836   3.01875   1.000 52.55119  ? 400 PHE H CA  1 
ATOM   3117  C C   . PHE A  1 420 ? 15.53355  -0.23546   2.43254   1.000 52.42838  ? 400 PHE H C   1 
ATOM   3118  O O   . PHE A  1 420 ? 16.04320  -0.88594   1.51752   1.000 57.99958  ? 400 PHE H O   1 
ATOM   3119  C CB  . PHE A  1 420 ? 14.32823  -1.10313   4.45606   1.000 49.98786  ? 400 PHE H CB  1 
ATOM   3120  C CG  . PHE A  1 420 ? 13.01911  -1.37129   5.12979   1.000 42.73459  ? 400 PHE H CG  1 
ATOM   3121  C CD1 . PHE A  1 420 ? 12.12570  -0.33833   5.35159   1.000 38.25155  ? 400 PHE H CD1 1 
ATOM   3122  C CD2 . PHE A  1 420 ? 12.67310  -2.64948   5.52880   1.000 39.70162  ? 400 PHE H CD2 1 
ATOM   3123  C CE1 . PHE A  1 420 ? 10.91279  -0.57527   5.96056   1.000 40.02567  ? 400 PHE H CE1 1 
ATOM   3124  C CE2 . PHE A  1 420 ? 11.46106  -2.89130   6.14190   1.000 40.33745  ? 400 PHE H CE2 1 
ATOM   3125  C CZ  . PHE A  1 420 ? 10.58022  -1.85650   6.35681   1.000 39.80936  ? 400 PHE H CZ  1 
ATOM   3126  N N   . ARG A  1 421 ? 16.09553  0.83715    2.97770   1.000 45.14375  ? 401 ARG H N   1 
ATOM   3127  C CA  . ARG A  1 421 ? 17.45639  1.28534    2.70394   1.000 41.82047  ? 401 ARG H CA  1 
ATOM   3128  C C   . ARG A  1 421 ? 18.38633  0.44625    3.56631   1.000 38.15882  ? 401 ARG H C   1 
ATOM   3129  O O   . ARG A  1 421 ? 18.53044  0.69356    4.76477   1.000 37.55839  ? 401 ARG H O   1 
ATOM   3130  C CB  . ARG A  1 421 ? 17.58603  2.77348    3.01542   1.000 47.95338  ? 401 ARG H CB  1 
ATOM   3131  C CG  . ARG A  1 421 ? 19.00965  3.29117    3.17542   1.000 49.06181  ? 401 ARG H CG  1 
ATOM   3132  C CD  . ARG A  1 421 ? 19.73333  3.34554    1.84862   1.000 41.08395  ? 401 ARG H CD  1 
ATOM   3133  N NE  . ARG A  1 421 ? 19.19582  4.40313    1.00904   1.000 41.80259  ? 401 ARG H NE  1 
ATOM   3134  C CZ  . ARG A  1 421 ? 19.32226  4.44521    -0.31160  1.000 49.90556  ? 401 ARG H CZ  1 
ATOM   3135  N NH1 . ARG A  1 421 ? 19.96731  3.47683    -0.94906  1.000 56.83366  ? 401 ARG H NH1 1 
ATOM   3136  N NH2 . ARG A  1 421 ? 18.79882  5.45505    -0.99334  1.000 45.40035  ? 401 ARG H NH2 1 
ATOM   3137  N N   . ARG A  1 422 ? 19.00817  -0.56289   2.96628   1.000 39.90471  ? 402 ARG H N   1 
ATOM   3138  C CA  . ARG A  1 422 ? 19.77196  -1.55608   3.70784   1.000 44.58311  ? 402 ARG H CA  1 
ATOM   3139  C C   . ARG A  1 422 ? 21.25879  -1.37131   3.44738   1.000 40.77329  ? 402 ARG H C   1 
ATOM   3140  O O   . ARG A  1 422 ? 21.68689  -1.27891   2.29238   1.000 44.49835  ? 402 ARG H O   1 
ATOM   3141  C CB  . ARG A  1 422 ? 19.34101  -2.97675   3.34323   1.000 42.57457  ? 402 ARG H CB  1 
ATOM   3142  C CG  . ARG A  1 422 ? 20.20323  -4.05080   4.00102   1.000 47.02825  ? 402 ARG H CG  1 
ATOM   3143  C CD  . ARG A  1 422 ? 19.50501  -5.40509   4.03095   1.000 47.74747  ? 402 ARG H CD  1 
ATOM   3144  N NE  . ARG A  1 422 ? 20.09123  -6.31019   5.01850   1.000 54.35522  ? 402 ARG H NE  1 
ATOM   3145  C CZ  . ARG A  1 422 ? 21.22023  -6.98598   4.82969   1.000 42.58983  ? 402 ARG H CZ  1 
ATOM   3146  N NH1 . ARG A  1 422 ? 21.89450  -6.85001   3.69803   1.000 43.33679  ? 402 ARG H NH1 1 
ATOM   3147  N NH2 . ARG A  1 422 ? 21.67990  -7.79086   5.77549   1.000 49.97953  ? 402 ARG H NH2 1 
ATOM   3148  N N   . THR A  1 423 ? 22.03923  -1.31772   4.52004   1.000 39.03896  ? 403 THR H N   1 
ATOM   3149  C CA  . THR A  1 423 ? 23.47137  -1.13216   4.38147   1.000 49.11381  ? 403 THR H CA  1 
ATOM   3150  C C   . THR A  1 423 ? 24.11024  -2.43004   3.89251   1.000 51.47433  ? 403 THR H C   1 
ATOM   3151  O O   . THR A  1 423 ? 23.47459  -3.48636   3.83694   1.000 52.90848  ? 403 THR H O   1 
ATOM   3152  C CB  . THR A  1 423 ? 24.08585  -0.69869   5.71320   1.000 51.60243  ? 403 THR H CB  1 
ATOM   3153  O OG1 . THR A  1 423 ? 25.33587  -0.02987   5.48469   1.000 62.69733  ? 403 THR H OG1 1 
ATOM   3154  C CG2 . THR A  1 423 ? 24.33810  -1.88716   6.51882   1.000 39.64782  ? 403 THR H CG2 1 
ATOM   3155  N N   . GLU A  1 424 ? 25.37612  -2.32757   3.47822   1.000 56.66981  ? 404 GLU H N   1 
ATOM   3156  C CA  . GLU A  1 424 ? 26.12753  -3.50255   3.05078   1.000 55.72941  ? 404 GLU H CA  1 
ATOM   3157  C C   . GLU A  1 424 ? 26.34841  -4.45867   4.21679   1.000 53.45018  ? 404 GLU H C   1 
ATOM   3158  O O   . GLU A  1 424 ? 26.41566  -5.68377   4.03590   1.000 44.51518  ? 404 GLU H O   1 
ATOM   3159  C CB  . GLU A  1 424 ? 27.46456  -3.08739   2.43545   1.000 65.38855  ? 404 GLU H CB  1 
ATOM   3160  C CG  . GLU A  1 424 ? 27.43647  -1.87615   1.50073   1.000 75.33259  ? 404 GLU H CG  1 
ATOM   3161  C CD  . GLU A  1 424 ? 27.33683  -0.53495   2.21432   1.000 79.08120  ? 404 GLU H CD  1 
ATOM   3162  O OE1 . GLU A  1 424 ? 28.37105  0.15523    2.35025   1.000 81.01693  ? 404 GLU H OE1 1 
ATOM   3163  O OE2 . GLU A  1 424 ? 26.22096  -0.16696   2.63440   1.000 77.78221  ? 404 GLU H OE2 1 
ATOM   3164  N N   . SER A  1 425 ? 26.43243  -3.91338   5.42667   1.000 45.31494  ? 405 SER H N   1 
ATOM   3165  C CA  . SER A  1 425 ? 26.66569  -4.67041   6.64794   1.000 45.99017  ? 405 SER H CA  1 
ATOM   3166  C C   . SER A  1 425 ? 25.38137  -5.10528   7.36695   1.000 48.31636  ? 405 SER H C   1 
ATOM   3167  O O   . SER A  1 425 ? 25.47635  -5.62671   8.48079   1.000 52.50085  ? 405 SER H O   1 
ATOM   3168  C CB  . SER A  1 425 ? 27.53606  -3.84871   7.60735   1.000 47.09504  ? 405 SER H CB  1 
ATOM   3169  O OG  . SER A  1 425 ? 26.94628  -2.60314   7.94724   1.000 48.46049  ? 405 SER H OG  1 
ATOM   3170  N N   . GLY A  1 426 ? 24.19320  -4.89581   6.78582   1.000 43.32571  ? 406 GLY H N   1 
ATOM   3171  C CA  . GLY A  1 426 ? 22.96088  -5.40603   7.36615   1.000 50.06296  ? 406 GLY H CA  1 
ATOM   3172  C C   . GLY A  1 426 ? 22.05320  -4.41910   8.09076   1.000 40.43527  ? 406 GLY H C   1 
ATOM   3173  O O   . GLY A  1 426 ? 20.92381  -4.79026   8.43574   1.000 38.90581  ? 406 GLY H O   1 
ATOM   3174  N N   . ILE A  1 427 ? 22.50332  -3.18807   8.33540   1.000 39.73961  ? 407 ILE H N   1 
ATOM   3175  C CA  . ILE A  1 427 ? 21.67041  -2.16978   8.97359   1.000 37.23058  ? 407 ILE H CA  1 
ATOM   3176  C C   . ILE A  1 427 ? 20.60694  -1.67872   8.00317   1.000 37.84057  ? 407 ILE H C   1 
ATOM   3177  O O   . ILE A  1 427 ? 20.91024  -1.33257   6.85361   1.000 37.05204  ? 407 ILE H O   1 
ATOM   3178  C CB  . ILE A  1 427 ? 22.52932  -0.99176   9.45041   1.000 37.20800  ? 407 ILE H CB  1 
ATOM   3179  C CG1 . ILE A  1 427 ? 23.61719  -1.46664   10.40976  1.000 38.30796  ? 407 ILE H CG1 1 
ATOM   3180  C CG2 . ILE A  1 427 ? 21.65396  0.09070    10.10203  1.000 36.17998  ? 407 ILE H CG2 1 
ATOM   3181  C CD1 . ILE A  1 427 ? 23.09726  -2.32042   11.53207  1.000 41.49517  ? 407 ILE H CD1 1 
ATOM   3182  N N   . CYS A  1 428 ? 19.35976  -1.61509   8.47348   1.000 43.86084  ? 408 CYS H N   1 
ATOM   3183  C CA  . CYS A  1 428 ? 18.24114  -1.05958   7.71554   1.000 35.69395  ? 408 CYS H CA  1 
ATOM   3184  C C   . CYS A  1 428 ? 17.79982  0.24531    8.36511   1.000 39.27043  ? 408 CYS H C   1 
ATOM   3185  O O   . CYS A  1 428 ? 17.45207  0.26787    9.55062   1.000 41.10377  ? 408 CYS H O   1 
ATOM   3186  C CB  . CYS A  1 428 ? 17.06357  -2.03443   7.65262   1.000 45.68090  ? 408 CYS H CB  1 
ATOM   3187  S SG  . CYS A  1 428 ? 17.33258  -3.47728   6.59983   1.000 37.95050  ? 408 CYS H SG  1 
ATOM   3188  N N   . LEU A  1 429 ? 17.83594  1.32767    7.59746   1.000 34.69694  ? 409 LEU H N   1 
ATOM   3189  C CA  . LEU A  1 429 ? 17.21968  2.58015    7.99982   1.000 34.09956  ? 409 LEU H CA  1 
ATOM   3190  C C   . LEU A  1 429 ? 15.76640  2.56688    7.54687   1.000 34.15683  ? 409 LEU H C   1 
ATOM   3191  O O   . LEU A  1 429 ? 15.48355  2.29471    6.37725   1.000 35.02406  ? 409 LEU H O   1 
ATOM   3192  C CB  . LEU A  1 429 ? 17.96646  3.76779    7.39106   1.000 35.72225  ? 409 LEU H CB  1 
ATOM   3193  C CG  . LEU A  1 429 ? 17.12767  5.02075    7.15777   1.000 34.64446  ? 409 LEU H CG  1 
ATOM   3194  C CD1 . LEU A  1 429 ? 16.82175  5.68626    8.49081   1.000 33.88311  ? 409 LEU H CD1 1 
ATOM   3195  C CD2 . LEU A  1 429 ? 17.85031  5.97511    6.22158   1.000 36.13455  ? 409 LEU H CD2 1 
ATOM   3196  N N   . ILE A  1 430 ? 14.84816  2.85726    8.46621   1.000 33.57613  ? 410 ILE H N   1 
ATOM   3197  C CA  . ILE A  1 430 ? 13.41645  2.72726    8.20836   1.000 33.93878  ? 410 ILE H CA  1 
ATOM   3198  C C   . ILE A  1 430 ? 12.73780  4.08136    8.38936   1.000 36.66754  ? 410 ILE H C   1 
ATOM   3199  O O   . ILE A  1 430 ? 12.70601  4.62092    9.50278   1.000 32.97393  ? 410 ILE H O   1 
ATOM   3200  C CB  . ILE A  1 430 ? 12.77578  1.67574    9.12383   1.000 34.60709  ? 410 ILE H CB  1 
ATOM   3201  C CG1 . ILE A  1 430 ? 13.52339  0.34440    8.99477   1.000 36.71440  ? 410 ILE H CG1 1 
ATOM   3202  C CG2 . ILE A  1 430 ? 11.29538  1.53230    8.79959   1.000 37.47988  ? 410 ILE H CG2 1 
ATOM   3203  C CD1 . ILE A  1 430 ? 12.84975  -0.81382   9.69006   1.000 48.45847  ? 410 ILE H CD1 1 
ATOM   3204  N N   . THR A  1 431 ? 12.18299  4.61803    7.30154   1.000 34.49506  ? 411 THR H N   1 
ATOM   3205  C CA  A THR A  1 431 ? 11.40599  5.84795    7.31908   0.075 35.78096  ? 411 THR H CA  1 
ATOM   3206  C CA  B THR A  1 431 ? 11.40172  5.84564    7.34045   0.925 36.33973  ? 411 THR H CA  1 
ATOM   3207  C C   . THR A  1 431 ? 9.92687   5.53514    7.12300   1.000 38.08138  ? 411 THR H C   1 
ATOM   3208  O O   . THR A  1 431 ? 9.55591   4.47312    6.61789   1.000 43.75147  ? 411 THR H O   1 
ATOM   3209  C CB  A THR A  1 431 ? 11.87667  6.81545    6.22572   0.075 36.58903  ? 411 THR H CB  1 
ATOM   3210  C CB  B THR A  1 431 ? 11.86420  6.86057    6.28325   0.925 38.06780  ? 411 THR H CB  1 
ATOM   3211  O OG1 A THR A  1 431 ? 12.94594  6.21754    5.48247   0.075 36.71397  ? 411 THR H OG1 1 
ATOM   3212  O OG1 B THR A  1 431 ? 11.82616  6.26361    4.97877   0.925 36.91993  ? 411 THR H OG1 1 
ATOM   3213  C CG2 A THR A  1 431 ? 12.35861  8.12221    6.83270   0.075 35.31804  ? 411 THR H CG2 1 
ATOM   3214  C CG2 B THR A  1 431 ? 13.27027  7.36380    6.58338   0.925 35.20687  ? 411 THR H CG2 1 
ATOM   3215  N N   . GLN A  1 432 ? 9.08075   6.48756    7.52051   1.000 41.88731  ? 412 GLN H N   1 
ATOM   3216  C CA  . GLN A  1 432 ? 7.64378   6.32310    7.33437   1.000 41.53048  ? 412 GLN H CA  1 
ATOM   3217  C C   . GLN A  1 432 ? 7.28383   6.25396    5.86057   1.000 48.92809  ? 412 GLN H C   1 
ATOM   3218  O O   . GLN A  1 432 ? 6.27061   5.64557    5.49319   1.000 51.32221  ? 412 GLN H O   1 
ATOM   3219  C CB  . GLN A  1 432 ? 6.89045   7.46893    8.01189   1.000 43.24189  ? 412 GLN H CB  1 
ATOM   3220  C CG  . GLN A  1 432 ? 5.38148   7.35747    7.92221   1.000 45.61413  ? 412 GLN H CG  1 
ATOM   3221  C CD  . GLN A  1 432 ? 4.82142   6.36746    8.92187   1.000 50.11357  ? 412 GLN H CD  1 
ATOM   3222  O OE1 . GLN A  1 432 ? 5.16749   6.39937    10.10272  1.000 52.19390  ? 412 GLN H OE1 1 
ATOM   3223  N NE2 . GLN A  1 432 ? 3.94975   5.47616    8.45181   1.000 48.86174  ? 412 GLN H NE2 1 
ATOM   3224  N N   . SER A  1 433 ? 8.09726   6.87194    5.00231   1.000 46.74598  ? 413 SER H N   1 
ATOM   3225  C CA  . SER A  1 433 ? 7.82064   6.83206    3.57321   1.000 44.43059  ? 413 SER H CA  1 
ATOM   3226  C C   . SER A  1 433 ? 7.91279   5.41257    3.03727   1.000 49.04809  ? 413 SER H C   1 
ATOM   3227  O O   . SER A  1 433 ? 7.17312   5.04724    2.11648   1.000 47.02976  ? 413 SER H O   1 
ATOM   3228  C CB  . SER A  1 433 ? 8.78268   7.76134    2.82875   1.000 44.38316  ? 413 SER H CB  1 
ATOM   3229  O OG  . SER A  1 433 ? 9.11007   7.25867    1.54678   1.000 51.58149  ? 413 SER H OG  1 
ATOM   3230  N N   . MET A  1 434 ? 8.78958   4.59142    3.61552   1.000 52.75822  ? 414 MET H N   1 
ATOM   3231  C CA  . MET A  1 434 ? 8.91908   3.21022    3.16965   1.000 41.40062  ? 414 MET H CA  1 
ATOM   3232  C C   . MET A  1 434 ? 7.82295   2.33220    3.76084   1.000 47.70423  ? 414 MET H C   1 
ATOM   3233  O O   . MET A  1 434 ? 7.30954   1.43864    3.08038   1.000 55.40584  ? 414 MET H O   1 
ATOM   3234  C CB  . MET A  1 434 ? 10.30217  2.68941    3.54725   1.000 40.31198  ? 414 MET H CB  1 
ATOM   3235  C CG  . MET A  1 434 ? 11.40909  3.56097    2.98856   1.000 39.71670  ? 414 MET H CG  1 
ATOM   3236  S SD  . MET A  1 434 ? 12.71688  3.74626    4.19460   1.000 41.40043  ? 414 MET H SD  1 
ATOM   3237  C CE  . MET A  1 434 ? 13.79969  2.44796    3.71539   1.000 42.08052  ? 414 MET H CE  1 
ATOM   3238  N N   . ILE A  1 435 ? 7.46221   2.57390    5.02330   1.000 44.25039  ? 415 ILE H N   1 
ATOM   3239  C CA  . ILE A  1 435 ? 6.35231   1.84928    5.63517   1.000 43.22941  ? 415 ILE H CA  1 
ATOM   3240  C C   . ILE A  1 435 ? 5.06590   2.08940    4.85630   1.000 47.43309  ? 415 ILE H C   1 
ATOM   3241  O O   . ILE A  1 435 ? 4.27529   1.16468    4.62767   1.000 50.26000  ? 415 ILE H O   1 
ATOM   3242  C CB  . ILE A  1 435 ? 6.20351   2.26487    7.10920   1.000 40.05156  ? 415 ILE H CB  1 
ATOM   3243  C CG1 . ILE A  1 435 ? 7.43954   1.84510    7.91419   1.000 43.26637  ? 415 ILE H CG1 1 
ATOM   3244  C CG2 . ILE A  1 435 ? 4.93120   1.69101    7.70680   1.000 41.56013  ? 415 ILE H CG2 1 
ATOM   3245  C CD1 . ILE A  1 435 ? 7.60581   0.35143    8.05819   1.000 44.95080  ? 415 ILE H CD1 1 
ATOM   3246  N N   . ASP A  1 436 ? 4.84607   3.33530    4.42494   1.000 44.19026  ? 416 ASP H N   1 
ATOM   3247  C CA  . ASP A  1 436 ? 3.62422   3.69585    3.71542   1.000 52.02226  ? 416 ASP H CA  1 
ATOM   3248  C C   . ASP A  1 436 ? 3.45380   2.92874    2.41086   1.000 49.65336  ? 416 ASP H C   1 
ATOM   3249  O O   . ASP A  1 436 ? 2.31997   2.76439    1.95074   1.000 58.03156  ? 416 ASP H O   1 
ATOM   3250  C CB  . ASP A  1 436 ? 3.60678   5.20079    3.43325   1.000 51.00397  ? 416 ASP H CB  1 
ATOM   3251  C CG  . ASP A  1 436 ? 3.26164   6.02299    4.66235   1.000 45.87708  ? 416 ASP H CG  1 
ATOM   3252  O OD1 . ASP A  1 436 ? 2.58333   5.49468    5.56993   1.000 44.79129  ? 416 ASP H OD1 1 
ATOM   3253  O OD2 . ASP A  1 436 ? 3.67254   7.19992    4.72062   1.000 46.24897  ? 416 ASP H OD2 1 
ATOM   3254  N N   . LYS A  1 437 ? 4.54389   2.44517    1.81316   1.000 49.72487  ? 417 LYS H N   1 
ATOM   3255  C CA  . LYS A  1 437 ? 4.49908   1.76274    0.52632   1.000 53.89694  ? 417 LYS H CA  1 
ATOM   3256  C C   . LYS A  1 437 ? 4.41588   0.24679    0.65107   1.000 53.37602  ? 417 LYS H C   1 
ATOM   3257  O O   . LYS A  1 437 ? 4.69884   -0.45300   -0.32554  1.000 60.57943  ? 417 LYS H O   1 
ATOM   3258  C CB  . LYS A  1 437 ? 5.73500   2.11633    -0.30484  1.000 51.63788  ? 417 LYS H CB  1 
ATOM   3259  C CG  . LYS A  1 437 ? 6.03904   3.59355    -0.41780  1.000 58.65000  ? 417 LYS H CG  1 
ATOM   3260  C CD  . LYS A  1 437 ? 7.39275   3.81057    -1.07882  1.000 61.01741  ? 417 LYS H CD  1 
ATOM   3261  C CE  . LYS A  1 437 ? 7.53065   5.22577    -1.61583  1.000 64.36226  ? 417 LYS H CE  1 
ATOM   3262  N NZ  . LYS A  1 437 ? 8.13631   5.24137    -2.97987  1.000 71.59595  ? 417 LYS H NZ  1 
ATOM   3263  N N   . LEU A  1 438 ? 4.03846   -0.28056   1.81028   1.000 61.40149  ? 418 LEU H N   1 
ATOM   3264  C CA  . LEU A  1 438 ? 4.32855   -1.67113   2.13513   1.000 67.45236  ? 418 LEU H CA  1 
ATOM   3265  C C   . LEU A  1 438 ? 3.13685   -2.59560   1.92288   1.000 69.51381  ? 418 LEU H C   1 
ATOM   3266  O O   . LEU A  1 438 ? 1.98966   -2.23465   2.20400   1.000 66.91155  ? 418 LEU H O   1 
ATOM   3267  C CB  . LEU A  1 438 ? 4.81587   -1.79730   3.58046   1.000 65.79170  ? 418 LEU H CB  1 
ATOM   3268  C CG  . LEU A  1 438 ? 6.28144   -1.41149   3.77261   1.000 61.34196  ? 418 LEU H CG  1 
ATOM   3269  C CD1 . LEU A  1 438 ? 6.79667   -1.86572   5.12975   1.000 56.88437  ? 418 LEU H CD1 1 
ATOM   3270  C CD2 . LEU A  1 438 ? 7.10242   -2.00263   2.65118   1.000 60.41801  ? 418 LEU H CD2 1 
ATOM   3271  N N   . ASP A  1 439 ? 3.43741   -3.79716   1.42100   1.000 79.83501  ? 419 ASP H N   1 
ATOM   3272  C CA  . ASP A  1 439 ? 2.53452   -4.94326   1.38994   1.000 89.38238  ? 419 ASP H CA  1 
ATOM   3273  C C   . ASP A  1 439 ? 3.26344   -6.16362   1.94790   1.000 95.90351  ? 419 ASP H C   1 
ATOM   3274  O O   . ASP A  1 439 ? 3.49209   -6.25677   3.15925   1.000 92.40879  ? 419 ASP H O   1 
ATOM   3275  C CB  . ASP A  1 439 ? 2.04438   -5.22512   -0.03318  1.000 93.77992  ? 419 ASP H CB  1 
ATOM   3276  C CG  . ASP A  1 439 ? 0.80592   -4.43427   -0.39419  1.000 98.68190  ? 419 ASP H CG  1 
ATOM   3277  O OD1 . ASP A  1 439 ? 0.05435   -4.04865   0.52696   1.000 98.51890  ? 419 ASP H OD1 1 
ATOM   3278  O OD2 . ASP A  1 439 ? 0.57933   -4.21129   -1.60343  1.000 101.28881 ? 419 ASP H OD2 1 
ATOM   3279  N N   . LEU A  1 440 ? 3.63883   -7.09786   1.07180   1.000 103.41134 ? 420 LEU H N   1 
ATOM   3280  C CA  . LEU A  1 440 ? 4.50759   -8.21980   1.44404   1.000 95.84465  ? 420 LEU H CA  1 
ATOM   3281  C C   . LEU A  1 440 ? 5.91983   -7.99362   0.89960   1.000 91.04057  ? 420 LEU H C   1 
ATOM   3282  O O   . LEU A  1 440 ? 6.35244   -8.66360   -0.04254  1.000 91.32529  ? 420 LEU H O   1 
ATOM   3283  C CB  . LEU A  1 440 ? 3.94607   -9.55110   0.92285   1.000 95.59474  ? 420 LEU H CB  1 
ATOM   3284  C CG  . LEU A  1 440 ? 4.20778   -10.84696  1.70971   1.000 83.46733  ? 420 LEU H CG  1 
ATOM   3285  C CD1 . LEU A  1 440 ? 3.39481   -11.99835  1.13391   1.000 84.86681  ? 420 LEU H CD1 1 
ATOM   3286  C CD2 . LEU A  1 440 ? 5.68682   -11.21890  1.75750   1.000 74.82343  ? 420 LEU H CD2 1 
ATOM   3287  N N   . VAL B  1 26  ? -63.69044 -42.84494  74.84216  1.000 69.53526  ? 6   VAL A N   1 
ATOM   3288  C CA  . VAL B  1 26  ? -62.81763 -42.64058  75.99583  1.000 63.57025  ? 6   VAL A CA  1 
ATOM   3289  C C   . VAL B  1 26  ? -61.40066 -42.29930  75.54264  1.000 61.16731  ? 6   VAL A C   1 
ATOM   3290  O O   . VAL B  1 26  ? -60.84237 -41.27586  75.93984  1.000 59.23062  ? 6   VAL A O   1 
ATOM   3291  C CB  . VAL B  1 26  ? -62.80624 -43.87759  76.92561  1.000 57.88796  ? 6   VAL A CB  1 
ATOM   3292  C CG1 . VAL B  1 26  ? -61.64503 -43.80069  77.90666  1.000 50.27923  ? 6   VAL A CG1 1 
ATOM   3293  C CG2 . VAL B  1 26  ? -64.12272 -43.99776  77.67874  1.000 57.77407  ? 6   VAL A CG2 1 
ATOM   3294  N N   . GLN B  1 27  ? -60.81985 -43.16031  74.70922  1.000 60.19462  ? 7   GLN A N   1 
ATOM   3295  C CA  . GLN B  1 27  ? -59.44727 -42.92637  74.28240  1.000 53.83501  ? 7   GLN A CA  1 
ATOM   3296  C C   . GLN B  1 27  ? -59.39692 -41.80896  73.24386  1.000 51.85651  ? 7   GLN A C   1 
ATOM   3297  O O   . GLN B  1 27  ? -60.26217 -41.73697  72.36579  1.000 54.95367  ? 7   GLN A O   1 
ATOM   3298  C CB  . GLN B  1 27  ? -58.83540 -44.19647  73.69786  1.000 51.29906  ? 7   GLN A CB  1 
ATOM   3299  C CG  . GLN B  1 27  ? -59.09175 -45.43940  74.52431  1.000 62.07050  ? 7   GLN A CG  1 
ATOM   3300  C CD  . GLN B  1 27  ? -58.57967 -46.69427  73.85159  1.000 62.05910  ? 7   GLN A CD  1 
ATOM   3301  O OE1 . GLN B  1 27  ? -57.90840 -46.62932  72.82072  1.000 57.77852  ? 7   GLN A OE1 1 
ATOM   3302  N NE2 . GLN B  1 27  ? -58.89429 -47.84777  74.43211  1.000 59.33085  ? 7   GLN A NE2 1 
ATOM   3303  N N   . PRO B  1 28  ? -58.40269 -40.92647  73.33005  1.000 35.16887  ? 8   PRO A N   1 
ATOM   3304  C CA  . PRO B  1 28  ? -58.24192 -39.89759  72.29912  1.000 34.11172  ? 8   PRO A CA  1 
ATOM   3305  C C   . PRO B  1 28  ? -57.96749 -40.52733  70.94328  1.000 35.16198  ? 8   PRO A C   1 
ATOM   3306  O O   . PRO B  1 28  ? -57.31731 -41.56933  70.83335  1.000 40.53439  ? 8   PRO A O   1 
ATOM   3307  C CB  . PRO B  1 28  ? -57.04186 -39.07673  72.79221  1.000 34.13756  ? 8   PRO A CB  1 
ATOM   3308  C CG  . PRO B  1 28  ? -56.33916 -39.96037  73.78813  1.000 33.43232  ? 8   PRO A CG  1 
ATOM   3309  C CD  . PRO B  1 28  ? -57.41057 -40.80310  74.41054  1.000 32.34571  ? 8   PRO A CD  1 
ATOM   3310  N N   . LEU B  1 29  ? -58.47686 -39.87622  69.89933  1.000 31.74800  ? 9   LEU A N   1 
ATOM   3311  C CA  . LEU B  1 29  ? -58.33927 -40.42315  68.55454  1.000 37.76756  ? 9   LEU A CA  1 
ATOM   3312  C C   . LEU B  1 29  ? -56.92863 -40.24107  67.99992  1.000 39.83629  ? 9   LEU A C   1 
ATOM   3313  O O   . LEU B  1 29  ? -56.49960 -41.02010  67.13947  1.000 37.50220  ? 9   LEU A O   1 
ATOM   3314  C CB  . LEU B  1 29  ? -59.37146 -39.78133  67.63144  1.000 32.50751  ? 9   LEU A CB  1 
ATOM   3315  C CG  . LEU B  1 29  ? -60.80677 -40.18615  67.97306  1.000 43.67746  ? 9   LEU A CG  1 
ATOM   3316  C CD1 . LEU B  1 29  ? -61.81228 -39.28982  67.27839  1.000 42.68351  ? 9   LEU A CD1 1 
ATOM   3317  C CD2 . LEU B  1 29  ? -61.04088 -41.64332  67.60684  1.000 41.88828  ? 9   LEU A CD2 1 
ATOM   3318  N N   . ALA B  1 30  ? -56.19006 -39.23633  68.47929  1.000 31.45233  ? 10  ALA A N   1 
ATOM   3319  C CA  . ALA B  1 30  ? -54.83281 -39.01141  67.98728  1.000 31.53550  ? 10  ALA A CA  1 
ATOM   3320  C C   . ALA B  1 30  ? -53.90978 -40.19970  68.24014  1.000 29.81388  ? 10  ALA A C   1 
ATOM   3321  O O   . ALA B  1 30  ? -52.87579 -40.31806  67.57201  1.000 25.88555  ? 10  ALA A O   1 
ATOM   3322  C CB  . ALA B  1 30  ? -54.24250 -37.75480  68.62655  1.000 26.49380  ? 10  ALA A CB  1 
ATOM   3323  N N   . ARG B  1 31  ? -54.25643 -41.07842  69.18689  1.000 31.75399  ? 11  ARG A N   1 
ATOM   3324  C CA  . ARG B  1 31  ? -53.42633 -42.24976  69.44842  1.000 36.22649  ? 11  ARG A CA  1 
ATOM   3325  C C   . ARG B  1 31  ? -53.28094 -43.11151  68.20775  1.000 30.23190  ? 11  ARG A C   1 
ATOM   3326  O O   . ARG B  1 31  ? -52.29094 -43.83128  68.06157  1.000 30.77591  ? 11  ARG A O   1 
ATOM   3327  C CB  . ARG B  1 31  ? -54.02058 -43.08357  70.58397  1.000 33.31419  ? 11  ARG A CB  1 
ATOM   3328  C CG  . ARG B  1 31  ? -53.74749 -42.54095  71.96906  1.000 30.85238  ? 11  ARG A CG  1 
ATOM   3329  C CD  . ARG B  1 31  ? -53.98475 -43.61863  73.01312  1.000 40.47918  ? 11  ARG A CD  1 
ATOM   3330  N NE  . ARG B  1 31  ? -54.32653 -43.04769  74.31125  1.000 43.16711  ? 11  ARG A NE  1 
ATOM   3331  C CZ  . ARG B  1 31  ? -54.85136 -43.73352  75.32040  1.000 38.99178  ? 11  ARG A CZ  1 
ATOM   3332  N NH1 . ARG B  1 31  ? -55.10180 -45.03449  75.19175  1.000 31.65102  ? 11  ARG A NH1 1 
ATOM   3333  N NH2 . ARG B  1 31  ? -55.12640 -43.11482  76.46229  1.000 31.61732  ? 11  ARG A NH2 1 
ATOM   3334  N N   . ASP B  1 32  ? -54.25583 -43.05123  67.30681  1.000 31.65738  ? 12  ASP A N   1 
ATOM   3335  C CA  . ASP B  1 32  ? -54.30199 -43.92765  66.14428  1.000 40.43810  ? 12  ASP A CA  1 
ATOM   3336  C C   . ASP B  1 32  ? -54.16560 -43.14784  64.84860  1.000 39.00800  ? 12  ASP A C   1 
ATOM   3337  O O   . ASP B  1 32  ? -54.44464 -43.68604  63.77297  1.000 38.19752  ? 12  ASP A O   1 
ATOM   3338  C CB  . ASP B  1 32  ? -55.58489 -44.77870  66.13331  1.000 50.14168  ? 12  ASP A CB  1 
ATOM   3339  C CG  . ASP B  1 32  ? -55.88469 -45.40413  67.48929  1.000 58.88191  ? 12  ASP A CG  1 
ATOM   3340  O OD1 . ASP B  1 32  ? -57.01866 -45.29020  68.02752  1.000 65.66483  ? 12  ASP A OD1 1 
ATOM   3341  O OD2 . ASP B  1 32  ? -54.93829 -46.00943  68.02262  1.000 57.85279  ? 12  ASP A OD2 1 
ATOM   3342  N N   . ALA B  1 33  ? -53.67944 -41.91633  64.92345  1.000 36.97163  ? 13  ALA A N   1 
ATOM   3343  C CA  . ALA B  1 33  ? -53.55710 -41.06061  63.76001  1.000 27.17889  ? 13  ALA A CA  1 
ATOM   3344  C C   . ALA B  1 33  ? -52.09280 -40.90570  63.37827  1.000 26.76529  ? 13  ALA A C   1 
ATOM   3345  O O   . ALA B  1 33  ? -51.19911 -41.00024  64.22457  1.000 25.23055  ? 13  ALA A O   1 
ATOM   3346  C CB  . ALA B  1 33  ? -54.18154 -39.68863  64.02733  1.000 38.24786  ? 13  ALA A CB  1 
ATOM   3347  N N   . MET B  1 34  ? -51.85746 -40.68655  62.08811  1.000 26.22822  ? 14  MET A N   1 
ATOM   3348  C CA  . MET B  1 34  ? -50.54830 -40.31639  61.57276  1.000 31.75730  ? 14  MET A CA  1 
ATOM   3349  C C   . MET B  1 34  ? -50.66841 -38.96460  60.88920  1.000 34.78720  ? 14  MET A C   1 
ATOM   3350  O O   . MET B  1 34  ? -51.55733 -38.76152  60.05660  1.000 42.34556  ? 14  MET A O   1 
ATOM   3351  C CB  . MET B  1 34  ? -50.01047 -41.36065  60.59003  1.000 27.94817  ? 14  MET A CB  1 
ATOM   3352  C CG  . MET B  1 34  ? -48.63466 -41.03217  60.01035  1.000 31.11694  ? 14  MET A CG  1 
ATOM   3353  S SD  . MET B  1 34  ? -48.02625 -42.30825  58.87400  1.000 41.33567  ? 14  MET A SD  1 
ATOM   3354  C CE  . MET B  1 34  ? -46.39024 -41.68754  58.46516  1.000 25.70129  ? 14  MET A CE  1 
ATOM   3355  N N   . ALA B  1 35  ? -49.79110 -38.04242  61.25045  1.000 29.89561  ? 15  ALA A N   1 
ATOM   3356  C CA  . ALA B  1 35  ? -49.69918 -36.77210  60.55397  1.000 33.88804  ? 15  ALA A CA  1 
ATOM   3357  C C   . ALA B  1 35  ? -48.78315 -36.93629  59.35413  1.000 29.93517  ? 15  ALA A C   1 
ATOM   3358  O O   . ALA B  1 35  ? -47.73965 -37.58709  59.44022  1.000 35.95222  ? 15  ALA A O   1 
ATOM   3359  C CB  . ALA B  1 35  ? -49.17168 -35.67535  61.47926  1.000 23.43903  ? 15  ALA A CB  1 
ATOM   3360  N N   . TYR B  1 36  ? -49.18924 -36.36782  58.22578  1.000 25.18358  ? 16  TYR A N   1 
ATOM   3361  C CA  . TYR B  1 36  ? -48.38211 -36.39714  57.00752  1.000 30.66237  ? 16  TYR A CA  1 
ATOM   3362  C C   . TYR B  1 36  ? -48.27936 -34.97303  56.46717  1.000 35.78038  ? 16  TYR A C   1 
ATOM   3363  O O   . TYR B  1 36  ? -49.23245 -34.44798  55.88088  1.000 28.01766  ? 16  TYR A O   1 
ATOM   3364  C CB  . TYR B  1 36  ? -48.97772 -37.34351  55.98344  1.000 26.88587  ? 16  TYR A CB  1 
ATOM   3365  C CG  . TYR B  1 36  ? -47.96535 -37.88489  55.00829  1.000 36.64127  ? 16  TYR A CG  1 
ATOM   3366  C CD1 . TYR B  1 36  ? -47.45420 -37.07886  54.00499  1.000 37.96092  ? 16  TYR A CD1 1 
ATOM   3367  C CD2 . TYR B  1 36  ? -47.53480 -39.20787  55.07612  1.000 30.35172  ? 16  TYR A CD2 1 
ATOM   3368  C CE1 . TYR B  1 36  ? -46.53235 -37.55635  53.10379  1.000 38.99906  ? 16  TYR A CE1 1 
ATOM   3369  C CE2 . TYR B  1 36  ? -46.60787 -39.69821  54.17463  1.000 28.37565  ? 16  TYR A CE2 1 
ATOM   3370  C CZ  . TYR B  1 36  ? -46.10949 -38.86378  53.18929  1.000 40.17531  ? 16  TYR A CZ  1 
ATOM   3371  O OH  . TYR B  1 36  ? -45.18844 -39.32694  52.27869  1.000 38.41210  ? 16  TYR A OH  1 
ATOM   3372  N N   . VAL B  1 37  ? -47.12250 -34.35794  56.65720  1.000 33.50400  ? 17  VAL A N   1 
ATOM   3373  C CA  . VAL B  1 37  ? -46.90727 -32.96580  56.29124  1.000 27.33339  ? 17  VAL A CA  1 
ATOM   3374  C C   . VAL B  1 37  ? -46.26010 -32.91336  54.91729  1.000 35.38516  ? 17  VAL A C   1 
ATOM   3375  O O   . VAL B  1 37  ? -45.24486 -33.58012  54.66816  1.000 33.22629  ? 17  VAL A O   1 
ATOM   3376  C CB  . VAL B  1 37  ? -46.03871 -32.26211  57.34673  1.000 27.00069  ? 17  VAL A CB  1 
ATOM   3377  C CG1 . VAL B  1 37  ? -45.82074 -30.81956  56.97422  1.000 28.76815  ? 17  VAL A CG1 1 
ATOM   3378  C CG2 . VAL B  1 37  ? -46.68297 -32.35552  58.72897  1.000 23.37327  ? 17  VAL A CG2 1 
ATOM   3379  N N   . LEU B  1 38  ? -46.85104 -32.13040  54.01192  1.000 31.94740  ? 18  LEU A N   1 
ATOM   3380  C CA  . LEU B  1 38  ? -46.28390 -31.91068  52.68128  1.000 27.76464  ? 18  LEU A CA  1 
ATOM   3381  C C   . LEU B  1 38  ? -45.46225 -30.62520  52.74009  1.000 33.17837  ? 18  LEU A C   1 
ATOM   3382  O O   . LEU B  1 38  ? -46.01859 -29.52495  52.83150  1.000 30.98206  ? 18  LEU A O   1 
ATOM   3383  C CB  . LEU B  1 38  ? -47.37115 -31.84378  51.61519  1.000 29.08410  ? 18  LEU A CB  1 
ATOM   3384  C CG  . LEU B  1 38  ? -48.40111 -32.97044  51.66306  1.000 39.09653  ? 18  LEU A CG  1 
ATOM   3385  C CD1 . LEU B  1 38  ? -49.78124 -32.45478  51.29332  1.000 31.69589  ? 18  LEU A CD1 1 
ATOM   3386  C CD2 . LEU B  1 38  ? -47.98661 -34.13318  50.76032  1.000 34.85326  ? 18  LEU A CD2 1 
ATOM   3387  N N   . ALA B  1 39  ? -44.14184 -30.77317  52.70904  1.000 32.57109  ? 19  ALA A N   1 
ATOM   3388  C CA  . ALA B  1 39  ? -43.19217 -29.67308  52.81366  1.000 27.22323  ? 19  ALA A CA  1 
ATOM   3389  C C   . ALA B  1 39  ? -42.29421 -29.62521  51.58909  1.000 28.45992  ? 19  ALA A C   1 
ATOM   3390  O O   . ALA B  1 39  ? -41.08287 -29.41110  51.68588  1.000 35.09201  ? 19  ALA A O   1 
ATOM   3391  C CB  . ALA B  1 39  ? -42.35243 -29.78657  54.08419  1.000 26.09182  ? 19  ALA A CB  1 
ATOM   3392  N N   . GLY B  1 40  ? -42.87897 -29.83060  50.41525  1.000 29.68235  ? 20  GLY A N   1 
ATOM   3393  C CA  . GLY B  1 40  ? -42.10329 -29.83672  49.19366  1.000 41.87720  ? 20  GLY A CA  1 
ATOM   3394  C C   . GLY B  1 40  ? -42.34897 -28.61415  48.34370  1.000 41.33787  ? 20  GLY A C   1 
ATOM   3395  O O   . GLY B  1 40  ? -41.72669 -28.44334  47.29103  1.000 44.15607  ? 20  GLY A O   1 
ATOM   3396  N N   . GLY B  1 41  ? -43.25240 -27.75303  48.80321  1.000 47.49027  ? 21  GLY A N   1 
ATOM   3397  C CA  . GLY B  1 41  ? -43.60688 -26.57714  48.03150  1.000 49.95579  ? 21  GLY A CA  1 
ATOM   3398  C C   . GLY B  1 41  ? -42.44996 -25.59875  47.92569  1.000 49.18837  ? 21  GLY A C   1 
ATOM   3399  O O   . GLY B  1 41  ? -41.71926 -25.35405  48.88802  1.000 40.35111  ? 21  GLY A O   1 
ATOM   3400  N N   . ARG B  1 42  ? -42.29843 -25.02515  46.73030  1.000 56.90546  ? 22  ARG A N   1 
ATOM   3401  C CA  . ARG B  1 42  ? -41.21673 -24.08089  46.47248  1.000 54.32486  ? 22  ARG A CA  1 
ATOM   3402  C C   . ARG B  1 42  ? -41.36860 -22.82464  47.31540  1.000 43.98192  ? 22  ARG A C   1 
ATOM   3403  O O   . ARG B  1 42  ? -40.51764 -22.51572  48.15690  1.000 50.36599  ? 22  ARG A O   1 
ATOM   3404  C CB  . ARG B  1 42  ? -41.18228 -23.72111  44.98467  1.000 53.50653  ? 22  ARG A CB  1 
ATOM   3405  N N   . GLY B  1 43  ? -42.46158 -22.09563  47.10811  1.000 43.98576  ? 23  GLY A N   1 
ATOM   3406  C CA  . GLY B  1 43  ? -42.60582 -20.75580  47.63924  1.000 35.86795  ? 23  GLY A CA  1 
ATOM   3407  C C   . GLY B  1 43  ? -41.94807 -19.77130  46.69797  1.000 38.07090  ? 23  GLY A C   1 
ATOM   3408  O O   . GLY B  1 43  ? -41.12618 -18.94928  47.11322  1.000 39.12139  ? 23  GLY A O   1 
ATOM   3409  N N   . SER B  1 44  ? -42.29990 -19.86341  45.41141  1.000 37.66583  ? 24  SER A N   1 
ATOM   3410  C CA  . SER B  1 44  ? -41.60359 -19.08699  44.39198  1.000 44.90370  ? 24  SER A CA  1 
ATOM   3411  C C   . SER B  1 44  ? -41.91656 -17.60029  44.49853  1.000 50.60648  ? 24  SER A C   1 
ATOM   3412  O O   . SER B  1 44  ? -41.10688 -16.76651  44.07487  1.000 53.27166  ? 24  SER A O   1 
ATOM   3413  C CB  . SER B  1 44  ? -41.95483 -19.61525  42.99833  1.000 50.94914  ? 24  SER A CB  1 
ATOM   3414  O OG  . SER B  1 44  ? -43.35699 -19.68956  42.80444  1.000 56.05933  ? 24  SER A OG  1 
ATOM   3415  N N   . ARG B  1 45  ? -43.07188 -17.24575  45.06347  1.000 47.69293  ? 25  ARG A N   1 
ATOM   3416  C CA  . ARG B  1 45  ? -43.38948 -15.83926  45.26782  1.000 45.15607  ? 25  ARG A CA  1 
ATOM   3417  C C   . ARG B  1 45  ? -42.48109 -15.17982  46.29616  1.000 41.17876  ? 25  ARG A C   1 
ATOM   3418  O O   . ARG B  1 45  ? -42.43527 -13.94780  46.35424  1.000 41.70207  ? 25  ARG A O   1 
ATOM   3419  C CB  . ARG B  1 45  ? -44.85556 -15.68587  45.68069  1.000 42.92844  ? 25  ARG A CB  1 
ATOM   3420  C CG  . ARG B  1 45  ? -45.79394 -15.35892  44.52314  1.000 49.27614  ? 25  ARG A CG  1 
ATOM   3421  C CD  . ARG B  1 45  ? -45.39719 -14.05957  43.83560  1.000 63.97116  ? 25  ARG A CD  1 
ATOM   3422  N NE  . ARG B  1 45  ? -46.20932 -12.92155  44.26823  1.000 66.10625  ? 25  ARG A NE  1 
ATOM   3423  C CZ  . ARG B  1 45  ? -45.71920 -11.81605  44.82430  1.000 69.91597  ? 25  ARG A CZ  1 
ATOM   3424  N NH1 . ARG B  1 45  ? -44.41304 -11.68896  45.01799  1.000 73.32807  ? 25  ARG A NH1 1 
ATOM   3425  N NH2 . ARG B  1 45  ? -46.53468 -10.83088  45.18071  1.000 68.33308  ? 25  ARG A NH2 1 
ATOM   3426  N N   . LEU B  1 46  ? -41.76345 -15.95815  47.10336  1.000 39.10920  ? 26  LEU A N   1 
ATOM   3427  C CA  . LEU B  1 46  ? -40.75263 -15.39956  47.99215  1.000 43.50566  ? 26  LEU A CA  1 
ATOM   3428  C C   . LEU B  1 46  ? -39.42757 -15.15397  47.28287  1.000 39.49221  ? 26  LEU A C   1 
ATOM   3429  O O   . LEU B  1 46  ? -38.47605 -14.69202  47.92318  1.000 38.32772  ? 26  LEU A O   1 
ATOM   3430  C CB  . LEU B  1 46  ? -40.54916 -16.32434  49.19369  1.000 42.89035  ? 26  LEU A CB  1 
ATOM   3431  C CG  . LEU B  1 46  ? -41.75443 -16.38621  50.13132  1.000 33.95785  ? 26  LEU A CG  1 
ATOM   3432  C CD1 . LEU B  1 46  ? -41.73612 -17.66383  50.95271  1.000 32.46225  ? 26  LEU A CD1 1 
ATOM   3433  C CD2 . LEU B  1 46  ? -41.79931 -15.15890  51.03828  1.000 33.84883  ? 26  LEU A CD2 1 
ATOM   3434  N N   . LYS B  1 47  ? -39.35686 -15.46347  45.98562  1.000 39.82156  ? 27  LYS A N   1 
ATOM   3435  C CA  . LYS B  1 47  ? -38.23172 -15.17081  45.08569  1.000 41.63914  ? 27  LYS A CA  1 
ATOM   3436  C C   . LYS B  1 47  ? -36.92282 -15.58627  45.76130  1.000 41.16664  ? 27  LYS A C   1 
ATOM   3437  O O   . LYS B  1 47  ? -36.81841 -16.73624  46.20865  1.000 58.36133  ? 27  LYS A O   1 
ATOM   3438  C CB  . LYS B  1 47  ? -38.33058 -13.71588  44.65421  1.000 44.14057  ? 27  LYS A CB  1 
ATOM   3439  C CG  . LYS B  1 47  ? -39.77337 -13.24531  44.45131  1.000 48.27113  ? 27  LYS A CG  1 
ATOM   3440  C CD  . LYS B  1 47  ? -40.00308 -12.63403  43.06594  1.000 54.89078  ? 27  LYS A CD  1 
ATOM   3441  C CE  . LYS B  1 47  ? -41.49223 -12.58406  42.71299  1.000 57.77589  ? 27  LYS A CE  1 
ATOM   3442  N NZ  . LYS B  1 47  ? -41.79718 -13.19802  41.38596  1.000 60.93646  ? 27  LYS A NZ  1 
ATOM   3443  N N   . GLU B  1 48  ? -35.92527 -14.70282  45.86669  1.000 43.42688  ? 28  GLU A N   1 
ATOM   3444  C CA  . GLU B  1 48  ? -34.59150 -15.10722  46.30532  1.000 46.13146  ? 28  GLU A CA  1 
ATOM   3445  C C   . GLU B  1 48  ? -34.60474 -15.77032  47.67717  1.000 40.09946  ? 28  GLU A C   1 
ATOM   3446  O O   . GLU B  1 48  ? -33.71966 -16.57982  47.98245  1.000 39.88356  ? 28  GLU A O   1 
ATOM   3447  C CB  . GLU B  1 48  ? -33.65599 -13.89489  46.33287  1.000 48.45971  ? 28  GLU A CB  1 
ATOM   3448  C CG  . GLU B  1 48  ? -33.14745 -13.44153  44.97994  1.000 48.04515  ? 28  GLU A CG  1 
ATOM   3449  C CD  . GLU B  1 48  ? -34.18335 -12.66315  44.20150  1.000 50.27037  ? 28  GLU A CD  1 
ATOM   3450  O OE1 . GLU B  1 48  ? -34.02626 -12.52590  42.96757  1.000 48.94698  ? 28  GLU A OE1 1 
ATOM   3451  O OE2 . GLU B  1 48  ? -35.15850 -12.19407  44.82585  1.000 53.66566  ? 28  GLU A OE2 1 
ATOM   3452  N N   . LEU B  1 49  ? -35.59025 -15.44486  48.51486  1.000 38.68911  ? 29  LEU A N   1 
ATOM   3453  C CA  . LEU B  1 49  ? -35.64600 -16.01428  49.85548  1.000 38.62421  ? 29  LEU A CA  1 
ATOM   3454  C C   . LEU B  1 49  ? -35.82346 -17.52788  49.83532  1.000 45.31184  ? 29  LEU A C   1 
ATOM   3455  O O   . LEU B  1 49  ? -35.54017 -18.18756  50.84183  1.000 43.07247  ? 29  LEU A O   1 
ATOM   3456  C CB  . LEU B  1 49  ? -36.77422 -15.35651  50.65085  1.000 36.97853  ? 29  LEU A CB  1 
ATOM   3457  C CG  . LEU B  1 49  ? -36.73927 -15.51891  52.17094  1.000 38.55009  ? 29  LEU A CG  1 
ATOM   3458  C CD1 . LEU B  1 49  ? -35.46657 -14.91617  52.75119  1.000 39.95654  ? 29  LEU A CD1 1 
ATOM   3459  C CD2 . LEU B  1 49  ? -37.97373 -14.88716  52.79293  1.000 33.68317  ? 29  LEU A CD2 1 
ATOM   3460  N N   . THR B  1 50  ? -36.27700 -18.09609  48.71569  1.000 42.47343  ? 30  THR A N   1 
ATOM   3461  C CA  . THR B  1 50  ? -36.41409 -19.54224  48.58572  1.000 44.75727  ? 30  THR A CA  1 
ATOM   3462  C C   . THR B  1 50  ? -35.56597 -20.09895  47.44664  1.000 44.97528  ? 30  THR A C   1 
ATOM   3463  O O   . THR B  1 50  ? -35.80668 -21.22129  46.99006  1.000 41.46177  ? 30  THR A O   1 
ATOM   3464  C CB  . THR B  1 50  ? -37.88151 -19.93462  48.39700  1.000 45.06941  ? 30  THR A CB  1 
ATOM   3465  O OG1 . THR B  1 50  ? -38.47128 -19.12346  47.37139  1.000 43.24254  ? 30  THR A OG1 1 
ATOM   3466  C CG2 . THR B  1 50  ? -38.65034 -19.74792  49.70708  1.000 33.53899  ? 30  THR A CG2 1 
ATOM   3467  N N   . ASP B  1 51  ? -34.57210 -19.33735  46.98080  1.000 49.67156  ? 31  ASP A N   1 
ATOM   3468  C CA  . ASP B  1 51  ? -33.68461 -19.83947  45.93598  1.000 53.37668  ? 31  ASP A CA  1 
ATOM   3469  C C   . ASP B  1 51  ? -32.84597 -21.01722  46.42049  1.000 52.14791  ? 31  ASP A C   1 
ATOM   3470  O O   . ASP B  1 51  ? -32.52134 -21.91087  45.62978  1.000 57.64535  ? 31  ASP A O   1 
ATOM   3471  C CB  . ASP B  1 51  ? -32.76944 -18.71960  45.43514  1.000 45.08141  ? 31  ASP A CB  1 
ATOM   3472  C CG  . ASP B  1 51  ? -33.37627 -17.93795  44.29079  1.000 46.79850  ? 31  ASP A CG  1 
ATOM   3473  O OD1 . ASP B  1 51  ? -34.42236 -18.36957  43.76306  1.000 46.93135  ? 31  ASP A OD1 1 
ATOM   3474  O OD2 . ASP B  1 51  ? -32.80371 -16.89400  43.91627  1.000 49.45612  ? 31  ASP A OD2 1 
ATOM   3475  N N   . ARG B  1 52  ? -32.48925 -21.03803  47.70613  1.000 45.50337  ? 32  ARG A N   1 
ATOM   3476  C CA  . ARG B  1 52  ? -31.59683 -22.04597  48.25831  1.000 46.53619  ? 32  ARG A CA  1 
ATOM   3477  C C   . ARG B  1 52  ? -32.26165 -22.92519  49.30753  1.000 46.61579  ? 32  ARG A C   1 
ATOM   3478  O O   . ARG B  1 52  ? -31.58898 -23.78780  49.88654  1.000 50.05782  ? 32  ARG A O   1 
ATOM   3479  C CB  . ARG B  1 52  ? -30.35765 -21.36850  48.86408  1.000 46.71259  ? 32  ARG A CB  1 
ATOM   3480  C CG  . ARG B  1 52  ? -29.77323 -20.26382  47.97734  1.000 56.13633  ? 32  ARG A CG  1 
ATOM   3481  C CD  . ARG B  1 52  ? -28.53247 -19.58739  48.58386  1.000 60.84907  ? 32  ARG A CD  1 
ATOM   3482  N NE  . ARG B  1 52  ? -28.61636 -19.36395  50.03148  1.000 68.82635  ? 32  ARG A NE  1 
ATOM   3483  C CZ  . ARG B  1 52  ? -29.52369 -18.59885  50.64059  1.000 68.48057  ? 32  ARG A CZ  1 
ATOM   3484  N NH1 . ARG B  1 52  ? -30.44779 -17.95258  49.93563  1.000 71.79714  ? 32  ARG A NH1 1 
ATOM   3485  N NH2 . ARG B  1 52  ? -29.50046 -18.46908  51.96397  1.000 51.98900  ? 32  ARG A NH2 1 
ATOM   3486  N N   A ARG B  1 53  ? -33.55615 -22.74105  49.56233  0.534 42.97977  ? 33  ARG A N   1 
ATOM   3487  N N   B ARG B  1 53  ? -33.55100 -22.73254  49.57634  0.466 42.82061  ? 33  ARG A N   1 
ATOM   3488  C CA  A ARG B  1 53  ? -34.27066 -23.51802  50.56493  0.534 38.05272  ? 33  ARG A CA  1 
ATOM   3489  C CA  B ARG B  1 53  ? -34.26171 -23.55750  50.54248  0.466 38.04669  ? 33  ARG A CA  1 
ATOM   3490  C C   A ARG B  1 53  ? -35.75112 -23.53151  50.21232  0.534 39.11026  ? 33  ARG A C   1 
ATOM   3491  C C   B ARG B  1 53  ? -35.74523 -23.53737  50.20849  0.466 39.05544  ? 33  ARG A C   1 
ATOM   3492  O O   A ARG B  1 53  ? -36.27911 -22.54137  49.69883  0.534 42.89744  ? 33  ARG A O   1 
ATOM   3493  O O   B ARG B  1 53  ? -36.26860 -22.53985  49.70448  0.466 42.56254  ? 33  ARG A O   1 
ATOM   3494  C CB  A ARG B  1 53  ? -34.06573 -22.93592  51.97148  0.534 38.40038  ? 33  ARG A CB  1 
ATOM   3495  C CB  B ARG B  1 53  ? -34.03015 -23.07504  51.98266  0.466 37.40941  ? 33  ARG A CB  1 
ATOM   3496  C CG  A ARG B  1 53  ? -34.45443 -21.45866  52.08626  0.534 41.24630  ? 33  ARG A CG  1 
ATOM   3497  C CG  B ARG B  1 53  ? -34.61732 -21.69623  52.28686  0.466 41.03909  ? 33  ARG A CG  1 
ATOM   3498  C CD  A ARG B  1 53  ? -34.37025 -20.94906  53.51840  0.534 38.29007  ? 33  ARG A CD  1 
ATOM   3499  C CD  B ARG B  1 53  ? -33.94022 -21.03764  53.48385  0.466 39.44243  ? 33  ARG A CD  1 
ATOM   3500  N NE  A ARG B  1 53  ? -33.06243 -20.37155  53.81322  0.534 37.28882  ? 33  ARG A NE  1 
ATOM   3501  N NE  B ARG B  1 53  ? -32.49879 -20.90501  53.29051  0.466 40.07294  ? 33  ARG A NE  1 
ATOM   3502  C CZ  A ARG B  1 53  ? -32.74335 -19.09651  53.61869  0.534 33.98904  ? 33  ARG A CZ  1 
ATOM   3503  C CZ  B ARG B  1 53  ? -31.58971 -21.63039  53.93452  0.466 38.38327  ? 33  ARG A CZ  1 
ATOM   3504  N NH1 A ARG B  1 53  ? -33.63694 -18.24613  53.13011  0.534 33.70904  ? 33  ARG A NH1 1 
ATOM   3505  N NH1 B ARG B  1 53  ? -31.97181 -22.53860  54.82257  0.466 31.40398  ? 33  ARG A NH1 1 
ATOM   3506  N NH2 A ARG B  1 53  ? -31.52699 -18.67051  53.91758  0.534 34.42140  ? 33  ARG A NH2 1 
ATOM   3507  N NH2 B ARG B  1 53  ? -30.29947 -21.44534  53.69121  0.466 37.15870  ? 33  ARG A NH2 1 
ATOM   3508  N N   . ALA B  1 54  ? -36.41240 -24.65291  50.49029  1.000 31.96890  ? 34  ALA A N   1 
ATOM   3509  C CA  . ALA B  1 54  ? -37.85965 -24.71566  50.34780  1.000 31.45535  ? 34  ALA A CA  1 
ATOM   3510  C C   . ALA B  1 54  ? -38.53756 -23.84945  51.40893  1.000 35.50796  ? 34  ALA A C   1 
ATOM   3511  O O   . ALA B  1 54  ? -38.02284 -23.66700  52.51590  1.000 40.28846  ? 34  ALA A O   1 
ATOM   3512  C CB  . ALA B  1 54  ? -38.35094 -26.15647  50.46382  1.000 30.84090  ? 34  ALA A CB  1 
ATOM   3513  N N   . LYS B  1 55  ? -39.70660 -23.31592  51.05621  1.000 30.45888  ? 35  LYS A N   1 
ATOM   3514  C CA  . LYS B  1 55  ? -40.45563 -22.45519  51.97021  1.000 29.65787  ? 35  LYS A CA  1 
ATOM   3515  C C   . LYS B  1 55  ? -40.65692 -23.03252  53.36883  1.000 31.36035  ? 35  LYS A C   1 
ATOM   3516  O O   . LYS B  1 55  ? -40.47755 -22.28027  54.34072  1.000 27.69498  ? 35  LYS A O   1 
ATOM   3517  C CB  . LYS B  1 55  ? -41.81388 -22.10243  51.34690  1.000 40.67231  ? 35  LYS A CB  1 
ATOM   3518  C CG  . LYS B  1 55  ? -42.60787 -21.05635  52.12526  1.000 35.97112  ? 35  LYS A CG  1 
ATOM   3519  C CD  . LYS B  1 55  ? -44.07119 -21.11448  51.73514  1.000 35.73438  ? 35  LYS A CD  1 
ATOM   3520  C CE  . LYS B  1 55  ? -44.87772 -20.03479  52.41511  1.000 32.48944  ? 35  LYS A CE  1 
ATOM   3521  N NZ  . LYS B  1 55  ? -46.31242 -20.11265  52.03573  1.000 30.30287  ? 35  LYS A NZ  1 
ATOM   3522  N N   . PRO B  1 56  ? -41.02606 -24.30454  53.55826  1.000 31.00947  ? 36  PRO A N   1 
ATOM   3523  C CA  . PRO B  1 56  ? -41.19475 -24.80755  54.93367  1.000 26.29315  ? 36  PRO A CA  1 
ATOM   3524  C C   . PRO B  1 56  ? -39.94591 -24.67944  55.78681  1.000 27.61465  ? 36  PRO A C   1 
ATOM   3525  O O   . PRO B  1 56  ? -40.04936 -24.71462  57.02054  1.000 25.08073  ? 36  PRO A O   1 
ATOM   3526  C CB  . PRO B  1 56  ? -41.58205 -26.27905  54.72598  1.000 29.23793  ? 36  PRO A CB  1 
ATOM   3527  C CG  . PRO B  1 56  ? -42.19323 -26.30417  53.36323  1.000 27.14870  ? 36  PRO A CG  1 
ATOM   3528  C CD  . PRO B  1 56  ? -41.40235 -25.32444  52.56046  1.000 28.12416  ? 36  PRO A CD  1 
ATOM   3529  N N   . ALA B  1 57  ? -38.77514 -24.51866  55.17626  1.000 27.47919  ? 37  ALA A N   1 
ATOM   3530  C CA  . ALA B  1 57  ? -37.52901 -24.36119  55.90997  1.000 32.81306  ? 37  ALA A CA  1 
ATOM   3531  C C   . ALA B  1 57  ? -37.17689 -22.90044  56.16905  1.000 32.00479  ? 37  ALA A C   1 
ATOM   3532  O O   . ALA B  1 57  ? -36.15760 -22.62468  56.81175  1.000 29.10377  ? 37  ALA A O   1 
ATOM   3533  C CB  . ALA B  1 57  ? -36.38600 -25.04939  55.15273  1.000 27.51241  ? 37  ALA A CB  1 
ATOM   3534  N N   . VAL B  1 58  ? -37.99651 -21.96345  55.69731  1.000 34.23783  ? 38  VAL A N   1 
ATOM   3535  C CA  . VAL B  1 58  ? -37.71366 -20.54416  55.88793  1.000 30.84709  ? 38  VAL A CA  1 
ATOM   3536  C C   . VAL B  1 58  ? -37.80780 -20.19411  57.37003  1.000 27.38906  ? 38  VAL A C   1 
ATOM   3537  O O   . VAL B  1 58  ? -38.76727 -20.56215  58.05367  1.000 30.05495  ? 38  VAL A O   1 
ATOM   3538  C CB  . VAL B  1 58  ? -38.67772 -19.69899  55.04326  1.000 28.81103  ? 38  VAL A CB  1 
ATOM   3539  C CG1 . VAL B  1 58  ? -38.76270 -18.29194  55.58274  1.000 43.80903  ? 38  VAL A CG1 1 
ATOM   3540  C CG2 . VAL B  1 58  ? -38.23992 -19.68923  53.58048  1.000 30.08170  ? 38  VAL A CG2 1 
ATOM   3541  N N   . TYR B  1 59  ? -36.79832 -19.49703  57.88194  1.000 31.31790  ? 39  TYR A N   1 
ATOM   3542  C CA  . TYR B  1 59  ? -36.81993 -19.05359  59.26887  1.000 27.84456  ? 39  TYR A CA  1 
ATOM   3543  C C   . TYR B  1 59  ? -38.02757 -18.15124  59.52785  1.000 40.51471  ? 39  TYR A C   1 
ATOM   3544  O O   . TYR B  1 59  ? -38.54331 -17.49478  58.61926  1.000 28.76580  ? 39  TYR A O   1 
ATOM   3545  C CB  . TYR B  1 59  ? -35.53089 -18.30472  59.58822  1.000 35.08050  ? 39  TYR A CB  1 
ATOM   3546  C CG  . TYR B  1 59  ? -34.29032 -19.15534  59.48334  1.000 41.99736  ? 39  TYR A CG  1 
ATOM   3547  C CD1 . TYR B  1 59  ? -33.51758 -19.15081  58.32846  1.000 50.97628  ? 39  TYR A CD1 1 
ATOM   3548  C CD2 . TYR B  1 59  ? -33.88055 -19.94952  60.54621  1.000 41.94857  ? 39  TYR A CD2 1 
ATOM   3549  C CE1 . TYR B  1 59  ? -32.37460 -19.92246  58.22895  1.000 56.33801  ? 39  TYR A CE1 1 
ATOM   3550  C CE2 . TYR B  1 59  ? -32.74142 -20.72321  60.45981  1.000 44.83843  ? 39  TYR A CE2 1 
ATOM   3551  C CZ  . TYR B  1 59  ? -31.99102 -20.70705  59.29870  1.000 54.10284  ? 39  TYR A CZ  1 
ATOM   3552  O OH  . TYR B  1 59  ? -30.85418 -21.47773  59.20770  1.000 54.00236  ? 39  TYR A OH  1 
ATOM   3553  N N   . PHE B  1 60  ? -38.48609 -18.12301  60.78314  1.000 35.28649  ? 40  PHE A N   1 
ATOM   3554  C CA  . PHE B  1 60  ? -39.58905 -17.24395  61.14857  1.000 30.78844  ? 40  PHE A CA  1 
ATOM   3555  C C   . PHE B  1 60  ? -39.52810 -16.88254  62.62706  1.000 30.67413  ? 40  PHE A C   1 
ATOM   3556  O O   . PHE B  1 60  ? -39.30804 -17.74486  63.47725  1.000 28.30166  ? 40  PHE A O   1 
ATOM   3557  C CB  . PHE B  1 60  ? -40.96035 -17.86650  60.85740  1.000 26.46422  ? 40  PHE A CB  1 
ATOM   3558  C CG  . PHE B  1 60  ? -42.09928 -17.03807  61.38280  1.000 35.03322  ? 40  PHE A CG  1 
ATOM   3559  C CD1 . PHE B  1 60  ? -42.45714 -15.85993  60.74927  1.000 33.77070  ? 40  PHE A CD1 1 
ATOM   3560  C CD2 . PHE B  1 60  ? -42.77579 -17.40593  62.53238  1.000 30.53147  ? 40  PHE A CD2 1 
ATOM   3561  C CE1 . PHE B  1 60  ? -43.48699 -15.07441  61.23931  1.000 39.64852  ? 40  PHE A CE1 1 
ATOM   3562  C CE2 . PHE B  1 60  ? -43.80339 -16.62985  63.02600  1.000 38.21945  ? 40  PHE A CE2 1 
ATOM   3563  C CZ  . PHE B  1 60  ? -44.15897 -15.45728  62.38031  1.000 39.05681  ? 40  PHE A CZ  1 
ATOM   3564  N N   . GLY B  1 61  ? -39.74621 -15.60095  62.91838  1.000 45.76750  ? 41  GLY A N   1 
ATOM   3565  C CA  . GLY B  1 61  ? -40.06477 -15.13920  64.25536  1.000 28.09963  ? 41  GLY A CA  1 
ATOM   3566  C C   . GLY B  1 61  ? -38.94100 -15.16058  65.25803  1.000 35.41296  ? 41  GLY A C   1 
ATOM   3567  O O   . GLY B  1 61  ? -39.18558 -14.89887  66.44028  1.000 33.69543  ? 41  GLY A O   1 
ATOM   3568  N N   A GLY B  1 62  ? -37.72542 -15.50697  64.83344  0.606 35.11746  ? 42  GLY A N   1 
ATOM   3569  N N   B GLY B  1 62  ? -37.71078 -15.42346  64.83278  0.394 35.06584  ? 42  GLY A N   1 
ATOM   3570  C CA  A GLY B  1 62  ? -36.64245 -15.78111  65.75594  0.606 34.55264  ? 42  GLY A CA  1 
ATOM   3571  C CA  B GLY B  1 62  ? -36.55214 -15.30159  65.69790  0.394 33.93974  ? 42  GLY A CA  1 
ATOM   3572  C C   A GLY B  1 62  ? -37.03448 -16.92510  66.66109  0.606 27.64314  ? 42  GLY A C   1 
ATOM   3573  C C   B GLY B  1 62  ? -35.81063 -16.59118  65.97287  0.394 35.39486  ? 42  GLY A C   1 
ATOM   3574  O O   A GLY B  1 62  ? -36.47413 -17.11211  67.74486  0.606 27.85910  ? 42  GLY A O   1 
ATOM   3575  O O   B GLY B  1 62  ? -34.68032 -16.53418  66.47849  0.394 45.09953  ? 42  GLY A O   1 
ATOM   3576  N N   A LYS B  1 63  ? -38.02142 -17.69332  66.21428  0.606 26.69364  ? 43  LYS A N   1 
ATOM   3577  N N   B LYS B  1 63  ? -36.38245 -17.75642  65.67066  0.394 31.19488  ? 43  LYS A N   1 
ATOM   3578  C CA  A LYS B  1 63  ? -38.66140 -18.71875  67.01747  0.606 28.31842  ? 43  LYS A CA  1 
ATOM   3579  C CA  B LYS B  1 63  ? -35.68307 -19.01009  65.92928  0.394 29.02213  ? 43  LYS A CA  1 
ATOM   3580  C C   A LYS B  1 63  ? -38.40139 -20.12261  66.51166  0.606 32.86534  ? 43  LYS A C   1 
ATOM   3581  C C   B LYS B  1 63  ? -36.17460 -20.14330  65.04067  0.394 28.83170  ? 43  LYS A C   1 
ATOM   3582  O O   A LYS B  1 63  ? -38.09436 -21.00843  67.30949  0.606 39.88037  ? 43  LYS A O   1 
ATOM   3583  O O   B LYS B  1 63  ? -35.41577 -20.67259  64.22271  0.394 31.12132  ? 43  LYS A O   1 
ATOM   3584  C CB  A LYS B  1 63  ? -40.17426 -18.47871  67.06125  0.606 27.19793  ? 43  LYS A CB  1 
ATOM   3585  C CB  B LYS B  1 63  ? -35.83309 -19.41591  67.39538  0.394 26.39644  ? 43  LYS A CB  1 
ATOM   3586  C CG  A LYS B  1 63  ? -40.95422 -19.51541  67.84664  0.606 25.06255  ? 43  LYS A CG  1 
ATOM   3587  C CG  B LYS B  1 63  ? -34.97344 -20.60642  67.78784  0.394 31.12791  ? 43  LYS A CG  1 
ATOM   3588  C CD  A LYS B  1 63  ? -40.78427 -19.32516  69.34285  0.606 25.54998  ? 43  LYS A CD  1 
ATOM   3589  C CD  B LYS B  1 63  ? -35.50281 -21.29015  69.03754  0.394 30.12203  ? 43  LYS A CD  1 
ATOM   3590  C CE  A LYS B  1 63  ? -41.95723 -19.91555  70.11105  0.606 25.34320  ? 43  LYS A CE  1 
ATOM   3591  C CE  B LYS B  1 63  ? -35.92366 -20.27219  70.07570  0.394 28.51678  ? 43  LYS A CE  1 
ATOM   3592  N NZ  A LYS B  1 63  ? -41.74356 -19.83037  71.58140  0.606 27.47602  ? 43  LYS A NZ  1 
ATOM   3593  N NZ  B LYS B  1 63  ? -34.77156 -19.44286  70.52496  0.394 27.53282  ? 43  LYS A NZ  1 
ATOM   3594  N N   A ALA B  1 64  ? -38.51071 -20.33796  65.20427  0.606 32.25842  ? 44  ALA A N   1 
ATOM   3595  N N   B ALA B  1 64  ? -37.43906 -20.52352  65.20309  0.394 29.49399  ? 44  ALA A N   1 
ATOM   3596  C CA  A ALA B  1 64  ? -38.45700 -21.66778  64.60580  0.606 27.70880  ? 44  ALA A CA  1 
ATOM   3597  C CA  B ALA B  1 64  ? -37.96883 -21.72417  64.57681  0.394 27.79821  ? 44  ALA A CA  1 
ATOM   3598  C C   A ALA B  1 64  ? -38.43673 -21.51353  63.08769  0.606 25.40894  ? 44  ALA A C   1 
ATOM   3599  C C   B ALA B  1 64  ? -38.08923 -21.55195  63.06047  0.394 25.77010  ? 44  ALA A C   1 
ATOM   3600  O O   A ALA B  1 64  ? -38.41111 -20.40061  62.55406  0.606 28.59627  ? 44  ALA A O   1 
ATOM   3601  O O   B ALA B  1 64  ? -37.86059 -20.47604  62.50082  0.394 27.14765  ? 44  ALA A O   1 
ATOM   3602  C CB  A ALA B  1 64  ? -39.64780 -22.52157  65.04882  0.606 27.79527  ? 44  ALA A CB  1 
ATOM   3603  C CB  B ALA B  1 64  ? -39.32894 -22.07885  65.17708  0.394 27.09880  ? 44  ALA A CB  1 
ATOM   3604  N N   . ARG B  1 65  ? -38.44865 -22.64310  62.39287  1.000 23.94239  ? 45  ARG A N   1 
ATOM   3605  C CA  . ARG B  1 65  ? -38.72105 -22.62848  60.96868  1.000 29.56077  ? 45  ARG A CA  1 
ATOM   3606  C C   . ARG B  1 65  ? -40.21563 -22.84839  60.75385  1.000 27.32005  ? 45  ARG A C   1 
ATOM   3607  O O   . ARG B  1 65  ? -40.92923 -23.30136  61.65186  1.000 30.82836  ? 45  ARG A O   1 
ATOM   3608  C CB  . ARG B  1 65  ? -37.89363 -23.68740  60.23780  1.000 32.24650  ? 45  ARG A CB  1 
ATOM   3609  C CG  . ARG B  1 65  ? -36.39159 -23.42064  60.22874  1.000 25.04869  ? 45  ARG A CG  1 
ATOM   3610  C CD  . ARG B  1 65  ? -35.67212 -24.59390  59.56236  1.000 29.13725  ? 45  ARG A CD  1 
ATOM   3611  N NE  . ARG B  1 65  ? -34.23388 -24.51508  59.74885  1.000 34.23565  ? 45  ARG A NE  1 
ATOM   3612  C CZ  . ARG B  1 65  ? -33.36939 -24.12154  58.81320  1.000 31.39959  ? 45  ARG A CZ  1 
ATOM   3613  N NH1 . ARG B  1 65  ? -33.77653 -23.89641  57.58122  1.000 38.18682  ? 45  ARG A NH1 1 
ATOM   3614  N NH2 . ARG B  1 65  ? -32.07372 -24.18656  59.09340  1.000 36.64151  ? 45  ARG A NH2 1 
ATOM   3615  N N   . ILE B  1 66  ? -40.68891 -22.49381  59.55549  1.000 27.15539  ? 46  ILE A N   1 
ATOM   3616  C CA  . ILE B  1 66  ? -42.12075 -22.55676  59.26449  1.000 28.45264  ? 46  ILE A CA  1 
ATOM   3617  C C   . ILE B  1 66  ? -42.67413 -23.95320  59.50596  1.000 34.87326  ? 46  ILE A C   1 
ATOM   3618  O O   . ILE B  1 66  ? -43.76273 -24.11419  60.07233  1.000 31.43130  ? 46  ILE A O   1 
ATOM   3619  C CB  . ILE B  1 66  ? -42.39748 -22.09282  57.82536  1.000 30.70295  ? 46  ILE A CB  1 
ATOM   3620  C CG1 . ILE B  1 66  ? -41.65010 -20.79033  57.54848  1.000 27.66251  ? 46  ILE A CG1 1 
ATOM   3621  C CG2 . ILE B  1 66  ? -43.89527 -21.96230  57.60054  1.000 25.44567  ? 46  ILE A CG2 1 
ATOM   3622  C CD1 . ILE B  1 66  ? -42.06321 -20.09745  56.27665  1.000 31.22769  ? 46  ILE A CD1 1 
ATOM   3623  N N   . ILE B  1 67  ? -41.94757 -24.98479  59.07192  1.000 25.13681  ? 47  ILE A N   1 
ATOM   3624  C CA  . ILE B  1 67  ? -42.44886 -26.34127  59.22728  1.000 24.23545  ? 47  ILE A CA  1 
ATOM   3625  C C   . ILE B  1 67  ? -42.67861 -26.69201  60.69435  1.000 28.37214  ? 47  ILE A C   1 
ATOM   3626  O O   . ILE B  1 67  ? -43.50622 -27.55737  60.99834  1.000 25.88928  ? 47  ILE A O   1 
ATOM   3627  C CB  . ILE B  1 67  ? -41.48366 -27.34447  58.55353  1.000 26.42283  ? 47  ILE A CB  1 
ATOM   3628  C CG1 . ILE B  1 67  ? -42.17357 -28.69677  58.36125  1.000 30.07961  ? 47  ILE A CG1 1 
ATOM   3629  C CG2 . ILE B  1 67  ? -40.18931 -27.48617  59.35416  1.000 23.03203  ? 47  ILE A CG2 1 
ATOM   3630  C CD1 . ILE B  1 67  ? -41.37376 -29.69858  57.55314  1.000 33.47378  ? 47  ILE A CD1 1 
ATOM   3631  N N   . ASP B  1 68  ? -41.99570 -26.01271  61.62286  1.000 23.60401  ? 48  ASP A N   1 
ATOM   3632  C CA  . ASP B  1 68  ? -42.07176 -26.42095  63.02178  1.000 23.34495  ? 48  ASP A CA  1 
ATOM   3633  C C   . ASP B  1 68  ? -43.44963 -26.20784  63.62628  1.000 21.82811  ? 48  ASP A C   1 
ATOM   3634  O O   . ASP B  1 68  ? -43.73522 -26.77705  64.68033  1.000 22.03101  ? 48  ASP A O   1 
ATOM   3635  C CB  . ASP B  1 68  ? -41.02712 -25.68483  63.85908  1.000 21.95052  ? 48  ASP A CB  1 
ATOM   3636  C CG  . ASP B  1 68  ? -39.61931 -26.15068  63.56593  1.000 22.02791  ? 48  ASP A CG  1 
ATOM   3637  O OD1 . ASP B  1 68  ? -38.71634 -25.29272  63.51439  1.000 22.52093  ? 48  ASP A OD1 1 
ATOM   3638  O OD2 . ASP B  1 68  ? -39.41565 -27.37277  63.37494  1.000 27.68063  ? 48  ASP A OD2 1 
ATOM   3639  N N   . PHE B  1 69  ? -44.31338 -25.41554  62.99331  1.000 25.87490  ? 49  PHE A N   1 
ATOM   3640  C CA  . PHE B  1 69  ? -45.63215 -25.19186  63.57270  1.000 22.50298  ? 49  PHE A CA  1 
ATOM   3641  C C   . PHE B  1 69  ? -46.54423 -26.39040  63.34359  1.000 30.17965  ? 49  PHE A C   1 
ATOM   3642  O O   . PHE B  1 69  ? -47.10775 -26.94148  64.29603  1.000 25.09649  ? 49  PHE A O   1 
ATOM   3643  C CB  . PHE B  1 69  ? -46.23415 -23.90104  63.00931  1.000 27.32060  ? 49  PHE A CB  1 
ATOM   3644  C CG  . PHE B  1 69  ? -45.55101 -22.67068  63.51793  1.000 23.47512  ? 49  PHE A CG  1 
ATOM   3645  C CD1 . PHE B  1 69  ? -46.01694 -22.02266  64.64335  1.000 23.80201  ? 49  PHE A CD1 1 
ATOM   3646  C CD2 . PHE B  1 69  ? -44.39694 -22.20424  62.91004  1.000 23.57734  ? 49  PHE A CD2 1 
ATOM   3647  C CE1 . PHE B  1 69  ? -45.36479 -20.90493  65.13344  1.000 25.84210  ? 49  PHE A CE1 1 
ATOM   3648  C CE2 . PHE B  1 69  ? -43.73957 -21.08921  63.39614  1.000 23.99188  ? 49  PHE A CE2 1 
ATOM   3649  C CZ  . PHE B  1 69  ? -44.22329 -20.44124  64.50829  1.000 24.30520  ? 49  PHE A CZ  1 
ATOM   3650  N N   . ALA B  1 70  ? -46.67757 -26.82161  62.08891  1.000 24.54967  ? 50  ALA A N   1 
ATOM   3651  C CA  . ALA B  1 70  ? -47.48446 -27.99994  61.79363  1.000 23.30053  ? 50  ALA A CA  1 
ATOM   3652  C C   . ALA B  1 70  ? -46.94618 -29.23534  62.51016  1.000 26.82503  ? 50  ALA A C   1 
ATOM   3653  O O   . ALA B  1 70  ? -47.71860 -30.04291  63.03782  1.000 26.48724  ? 50  ALA A O   1 
ATOM   3654  C CB  . ALA B  1 70  ? -47.53640 -28.22649  60.28356  1.000 23.16909  ? 50  ALA A CB  1 
ATOM   3655  N N   . LEU B  1 71  ? -45.62353 -29.40439  62.53835  1.000 21.70709  ? 51  LEU A N   1 
ATOM   3656  C CA  . LEU B  1 71  ? -45.05102 -30.50531  63.30282  1.000 26.28102  ? 51  LEU A CA  1 
ATOM   3657  C C   . LEU B  1 71  ? -45.38898 -30.38015  64.78313  1.000 21.76539  ? 51  LEU A C   1 
ATOM   3658  O O   . LEU B  1 71  ? -45.66293 -31.38368  65.44834  1.000 20.99057  ? 51  LEU A O   1 
ATOM   3659  C CB  . LEU B  1 71  ? -43.53809 -30.55962  63.10452  1.000 22.16515  ? 51  LEU A CB  1 
ATOM   3660  C CG  . LEU B  1 71  ? -43.08082 -30.76624  61.65781  1.000 25.50646  ? 51  LEU A CG  1 
ATOM   3661  C CD1 . LEU B  1 71  ? -41.60653 -30.42913  61.49660  1.000 27.49876  ? 51  LEU A CD1 1 
ATOM   3662  C CD2 . LEU B  1 71  ? -43.36415 -32.19743  61.19552  1.000 21.56047  ? 51  LEU A CD2 1 
ATOM   3663  N N   . SER B  1 72  ? -45.38933 -29.14969  65.31140  1.000 21.23399  ? 52  SER A N   1 
ATOM   3664  C CA  . SER B  1 72  ? -45.65570 -28.93314  66.73287  1.000 27.42406  ? 52  SER A CA  1 
ATOM   3665  C C   . SER B  1 72  ? -47.13304 -29.09065  67.06254  1.000 29.36427  ? 52  SER A C   1 
ATOM   3666  O O   . SER B  1 72  ? -47.47499 -29.55509  68.15518  1.000 22.78340  ? 52  SER A O   1 
ATOM   3667  C CB  . SER B  1 72  ? -45.18081 -27.54585  67.16962  1.000 21.55593  ? 52  SER A CB  1 
ATOM   3668  O OG  . SER B  1 72  ? -43.77420 -27.50429  67.32950  1.000 23.44664  ? 52  SER A OG  1 
ATOM   3669  N N   . ASN B  1 73  ? -48.02260 -28.67839  66.15582  1.000 22.18624  ? 53  ASN A N   1 
ATOM   3670  C CA  . ASN B  1 73  ? -49.43968 -28.92643  66.38438  1.000 22.82004  ? 53  ASN A CA  1 
ATOM   3671  C C   . ASN B  1 73  ? -49.72272 -30.42338  66.45122  1.000 22.74487  ? 53  ASN A C   1 
ATOM   3672  O O   . ASN B  1 73  ? -50.53601 -30.87437  67.26342  1.000 25.85011  ? 53  ASN A O   1 
ATOM   3673  C CB  . ASN B  1 73  ? -50.27685 -28.27024  65.29164  1.000 27.54470  ? 53  ASN A CB  1 
ATOM   3674  C CG  . ASN B  1 73  ? -50.24400 -26.75339  65.36094  1.000 24.69828  ? 53  ASN A CG  1 
ATOM   3675  O OD1 . ASN B  1 73  ? -49.85719 -26.17161  66.37459  1.000 23.71875  ? 53  ASN A OD1 1 
ATOM   3676  N ND2 . ASN B  1 73  ? -50.61918 -26.10986  64.26566  1.000 24.15757  ? 53  ASN A ND2 1 
ATOM   3677  N N   . ALA B  1 74  ? -49.04978 -31.20960  65.60899  1.000 22.31806  ? 54  ALA A N   1 
ATOM   3678  C CA  . ALA B  1 74  ? -49.21536 -32.65956  65.64679  1.000 30.70756  ? 54  ALA A CA  1 
ATOM   3679  C C   . ALA B  1 74  ? -48.75238 -33.21877  66.98279  1.000 24.51993  ? 54  ALA A C   1 
ATOM   3680  O O   . ALA B  1 74  ? -49.49651 -33.93206  67.66583  1.000 25.28466  ? 54  ALA A O   1 
ATOM   3681  C CB  . ALA B  1 74  ? -48.44186 -33.30099  64.49270  1.000 22.07046  ? 54  ALA A CB  1 
ATOM   3682  N N   . LEU B  1 75  ? -47.52113 -32.88613  67.37318  1.000 25.96204  ? 55  LEU A N   1 
ATOM   3683  C CA  . LEU B  1 75  ? -46.98573 -33.27770  68.67464  1.000 23.49163  ? 55  LEU A CA  1 
ATOM   3684  C C   . LEU B  1 75  ? -47.96481 -32.95072  69.79621  1.000 24.99904  ? 55  LEU A C   1 
ATOM   3685  O O   . LEU B  1 75  ? -48.45656 -33.84842  70.49104  1.000 22.37088  ? 55  LEU A O   1 
ATOM   3686  C CB  . LEU B  1 75  ? -45.63984 -32.57771  68.89543  1.000 21.70987  ? 55  LEU A CB  1 
ATOM   3687  C CG  . LEU B  1 75  ? -44.85331 -32.85386  70.17670  1.000 31.46009  ? 55  LEU A CG  1 
ATOM   3688  C CD1 . LEU B  1 75  ? -44.42566 -34.31967  70.24197  1.000 26.39540  ? 55  LEU A CD1 1 
ATOM   3689  C CD2 . LEU B  1 75  ? -43.64407 -31.93607  70.27465  1.000 20.79758  ? 55  LEU A CD2 1 
ATOM   3690  N N   . ASN B  1 76  ? -48.29431 -31.65963  69.95322  1.000 22.31232  ? 56  ASN A N   1 
ATOM   3691  C CA  . ASN B  1 76  ? -49.12153 -31.22719  71.07552  1.000 27.69529  ? 56  ASN A CA  1 
ATOM   3692  C C   . ASN B  1 76  ? -50.53466 -31.79501  71.00191  1.000 26.25672  ? 56  ASN A C   1 
ATOM   3693  O O   . ASN B  1 76  ? -51.20677 -31.92139  72.03390  1.000 29.90094  ? 56  ASN A O   1 
ATOM   3694  C CB  . ASN B  1 76  ? -49.17605 -29.69797  71.15085  1.000 31.34870  ? 56  ASN A CB  1 
ATOM   3695  C CG  . ASN B  1 76  ? -47.80081 -29.04900  71.05883  1.000 34.98460  ? 56  ASN A CG  1 
ATOM   3696  O OD1 . ASN B  1 76  ? -46.83442 -29.52349  71.66567  1.000 22.55877  ? 56  ASN A OD1 1 
ATOM   3697  N ND2 . ASN B  1 76  ? -47.71442 -27.94671  70.32550  1.000 29.12531  ? 56  ASN A ND2 1 
ATOM   3698  N N   . SER B  1 77  ? -51.01176 -32.13449  69.80663  1.000 23.81520  ? 57  SER A N   1 
ATOM   3699  C CA  . SER B  1 77  ? -52.30937 -32.78291  69.67748  1.000 33.60780  ? 57  SER A CA  1 
ATOM   3700  C C   . SER B  1 77  ? -52.26873 -34.26555  70.03295  1.000 24.71458  ? 57  SER A C   1 
ATOM   3701  O O   . SER B  1 77  ? -53.31973 -34.90930  70.04825  1.000 29.50867  ? 57  SER A O   1 
ATOM   3702  C CB  . SER B  1 77  ? -52.84873 -32.60693  68.25411  1.000 40.86628  ? 57  SER A CB  1 
ATOM   3703  O OG  . SER B  1 77  ? -53.04560 -31.23521  67.93681  1.000 35.63948  ? 57  SER A OG  1 
ATOM   3704  N N   . GLY B  1 78  ? -51.09557 -34.82264  70.31870  1.000 24.66895  ? 58  GLY A N   1 
ATOM   3705  C CA  . GLY B  1 78  ? -50.98549 -36.22186  70.67289  1.000 24.03013  ? 58  GLY A CA  1 
ATOM   3706  C C   . GLY B  1 78  ? -50.67157 -37.15814  69.52581  1.000 26.61702  ? 58  GLY A C   1 
ATOM   3707  O O   . GLY B  1 78  ? -50.58520 -38.37006  69.74794  1.000 35.68333  ? 58  GLY A O   1 
ATOM   3708  N N   . ILE B  1 79  ? -50.50132 -36.64469  68.31130  1.000 25.88998  ? 59  ILE A N   1 
ATOM   3709  C CA  . ILE B  1 79  ? -50.14102 -37.47822  67.16933  1.000 29.61005  ? 59  ILE A CA  1 
ATOM   3710  C C   . ILE B  1 79  ? -48.63854 -37.72665  67.21255  1.000 31.35922  ? 59  ILE A C   1 
ATOM   3711  O O   . ILE B  1 79  ? -47.83925 -36.78836  67.12174  1.000 36.03904  ? 59  ILE A O   1 
ATOM   3712  C CB  . ILE B  1 79  ? -50.55259 -36.81740  65.84777  1.000 23.40886  ? 59  ILE A CB  1 
ATOM   3713  C CG1 . ILE B  1 79  ? -52.04625 -36.49377  65.85446  1.000 24.38183  ? 59  ILE A CG1 1 
ATOM   3714  C CG2 . ILE B  1 79  ? -50.20449 -37.72192  64.67660  1.000 35.07082  ? 59  ILE A CG2 1 
ATOM   3715  C CD1 . ILE B  1 79  ? -52.52925 -35.85501  64.57591  1.000 24.77858  ? 59  ILE A CD1 1 
ATOM   3716  N N   . ARG B  1 80  ? -48.24793 -38.99067  67.34386  1.000 28.17640  ? 60  ARG A N   1 
ATOM   3717  C CA  . ARG B  1 80  ? -46.84976 -39.33211  67.56177  1.000 34.21182  ? 60  ARG A CA  1 
ATOM   3718  C C   . ARG B  1 80  ? -46.23866 -40.10823  66.40332  1.000 25.40016  ? 60  ARG A C   1 
ATOM   3719  O O   . ARG B  1 80  ? -45.08386 -40.53664  66.50013  1.000 31.25431  ? 60  ARG A O   1 
ATOM   3720  C CB  . ARG B  1 80  ? -46.70377 -40.09647  68.87820  1.000 38.63169  ? 60  ARG A CB  1 
ATOM   3721  C CG  . ARG B  1 80  ? -47.22581 -39.29406  70.06873  1.000 45.57696  ? 60  ARG A CG  1 
ATOM   3722  C CD  . ARG B  1 80  ? -46.55345 -39.68426  71.36492  1.000 52.25840  ? 60  ARG A CD  1 
ATOM   3723  N NE  . ARG B  1 80  ? -45.27532 -39.00247  71.54848  1.000 57.51694  ? 60  ARG A NE  1 
ATOM   3724  C CZ  . ARG B  1 80  ? -45.14133 -37.79514  72.08470  1.000 59.92067  ? 60  ARG A CZ  1 
ATOM   3725  N NH1 . ARG B  1 80  ? -46.21193 -37.12571  72.49096  1.000 59.01480  ? 60  ARG A NH1 1 
ATOM   3726  N NH2 . ARG B  1 80  ? -43.93484 -37.26016  72.21849  1.000 65.84902  ? 60  ARG A NH2 1 
ATOM   3727  N N   . ARG B  1 81  ? -46.97383 -40.28130  65.30751  1.000 24.42445  ? 61  ARG A N   1 
ATOM   3728  C CA  . ARG B  1 81  ? -46.43270 -40.78791  64.05223  1.000 23.77102  ? 61  ARG A CA  1 
ATOM   3729  C C   . ARG B  1 81  ? -46.52755 -39.67175  63.02265  1.000 22.68243  ? 61  ARG A C   1 
ATOM   3730  O O   . ARG B  1 81  ? -47.62700 -39.20421  62.71222  1.000 23.07966  ? 61  ARG A O   1 
ATOM   3731  C CB  . ARG B  1 81  ? -47.18340 -42.02978  63.56819  1.000 26.13016  ? 61  ARG A CB  1 
ATOM   3732  C CG  . ARG B  1 81  ? -47.04210 -43.25320  64.45662  1.000 24.04075  ? 61  ARG A CG  1 
ATOM   3733  C CD  . ARG B  1 81  ? -47.18287 -44.51694  63.61890  1.000 26.15676  ? 61  ARG A CD  1 
ATOM   3734  N NE  . ARG B  1 81  ? -47.19342 -45.72682  64.43167  1.000 33.46737  ? 61  ARG A NE  1 
ATOM   3735  C CZ  . ARG B  1 81  ? -46.10372 -46.33388  64.89198  1.000 36.95874  ? 61  ARG A CZ  1 
ATOM   3736  N NH1 . ARG B  1 81  ? -44.89914 -45.84164  64.62998  1.000 24.25966  ? 61  ARG A NH1 1 
ATOM   3737  N NH2 . ARG B  1 81  ? -46.22094 -47.43634  65.62104  1.000 25.46871  ? 61  ARG A NH2 1 
ATOM   3738  N N   . ILE B  1 82  ? -45.38024 -39.23623  62.50895  1.000 24.87180  ? 62  ILE A N   1 
ATOM   3739  C CA  . ILE B  1 82  ? -45.31446 -38.11332  61.58491  1.000 29.03433  ? 62  ILE A CA  1 
ATOM   3740  C C   . ILE B  1 82  ? -44.50463 -38.52493  60.36322  1.000 26.88839  ? 62  ILE A C   1 
ATOM   3741  O O   . ILE B  1 82  ? -43.45926 -39.17590  60.48677  1.000 32.39156  ? 62  ILE A O   1 
ATOM   3742  C CB  . ILE B  1 82  ? -44.70522 -36.86083  62.25837  1.000 31.42419  ? 62  ILE A CB  1 
ATOM   3743  C CG1 . ILE B  1 82  ? -45.53851 -36.44589  63.47666  1.000 21.48561  ? 62  ILE A CG1 1 
ATOM   3744  C CG2 . ILE B  1 82  ? -44.61926 -35.70851  61.27333  1.000 23.61604  ? 62  ILE A CG2 1 
ATOM   3745  C CD1 . ILE B  1 82  ? -44.92785 -35.31739  64.28767  1.000 20.98818  ? 62  ILE A CD1 1 
ATOM   3746  N N   . GLY B  1 83  ? -45.01414 -38.18177  59.18820  1.000 29.90281  ? 63  GLY A N   1 
ATOM   3747  C CA  . GLY B  1 83  ? -44.26701 -38.30290  57.94470  1.000 24.86897  ? 63  GLY A CA  1 
ATOM   3748  C C   . GLY B  1 83  ? -44.14541 -36.93366  57.30234  1.000 38.53639  ? 63  GLY A C   1 
ATOM   3749  O O   . GLY B  1 83  ? -45.10120 -36.15406  57.30552  1.000 32.65375  ? 63  GLY A O   1 
ATOM   3750  N N   . VAL B  1 84  ? -42.96028 -36.63620  56.77243  1.000 35.40355  ? 64  VAL A N   1 
ATOM   3751  C CA  . VAL B  1 84  ? -42.67398 -35.35721  56.13278  1.000 24.78582  ? 64  VAL A CA  1 
ATOM   3752  C C   . VAL B  1 84  ? -42.26501 -35.62493  54.68849  1.000 34.79106  ? 64  VAL A C   1 
ATOM   3753  O O   . VAL B  1 84  ? -41.27411 -36.32240  54.43833  1.000 37.12766  ? 64  VAL A O   1 
ATOM   3754  C CB  . VAL B  1 84  ? -41.57387 -34.57720  56.86940  1.000 24.21907  ? 64  VAL A CB  1 
ATOM   3755  C CG1 . VAL B  1 84  ? -41.41561 -33.19788  56.26177  1.000 24.44215  ? 64  VAL A CG1 1 
ATOM   3756  C CG2 . VAL B  1 84  ? -41.88297 -34.47890  58.35973  1.000 23.52932  ? 64  VAL A CG2 1 
ATOM   3757  N N   . ALA B  1 85  ? -43.02537 -35.07796  53.74057  1.000 29.61329  ? 65  ALA A N   1 
ATOM   3758  C CA  . ALA B  1 85  ? -42.67791 -35.15514  52.32763  1.000 28.22226  ? 65  ALA A CA  1 
ATOM   3759  C C   . ALA B  1 85  ? -41.84564 -33.93974  51.93097  1.000 38.95531  ? 65  ALA A C   1 
ATOM   3760  O O   . ALA B  1 85  ? -42.22467 -32.79926  52.21782  1.000 33.41656  ? 65  ALA A O   1 
ATOM   3761  C CB  . ALA B  1 85  ? -43.93712 -35.23554  51.46617  1.000 29.19762  ? 65  ALA A CB  1 
ATOM   3762  N N   . THR B  1 86  ? -40.70859 -34.18341  51.28021  1.000 37.30739  ? 66  THR A N   1 
ATOM   3763  C CA  . THR B  1 86  ? -39.86537 -33.11072  50.77295  1.000 36.36115  ? 66  THR A CA  1 
ATOM   3764  C C   . THR B  1 86  ? -39.61205 -33.32408  49.28871  1.000 37.82471  ? 66  THR A C   1 
ATOM   3765  O O   . THR B  1 86  ? -39.77508 -34.42555  48.75642  1.000 34.24900  ? 66  THR A O   1 
ATOM   3766  C CB  . THR B  1 86  ? -38.52122 -33.02504  51.51060  1.000 38.08977  ? 66  THR A CB  1 
ATOM   3767  O OG1 . THR B  1 86  ? -37.75322 -34.20726  51.24608  1.000 47.36902  ? 66  THR A OG1 1 
ATOM   3768  C CG2 . THR B  1 86  ? -38.73984 -32.88815  53.00977  1.000 33.20066  ? 66  THR A CG2 1 
ATOM   3769  N N   . GLN B  1 87  ? -39.20060 -32.24720  48.62531  1.000 35.81433  ? 67  GLN A N   1 
ATOM   3770  C CA  . GLN B  1 87  ? -38.91190 -32.29030  47.19869  1.000 38.14468  ? 67  GLN A CA  1 
ATOM   3771  C C   . GLN B  1 87  ? -37.93275 -31.18347  46.84464  1.000 43.55606  ? 67  GLN A C   1 
ATOM   3772  O O   . GLN B  1 87  ? -36.72095 -31.41583  46.76477  1.000 45.97980  ? 67  GLN A O   1 
ATOM   3773  C CB  . GLN B  1 87  ? -40.20306 -32.15743  46.38233  1.000 39.31637  ? 67  GLN A CB  1 
ATOM   3774  C CG  . GLN B  1 87  ? -40.00518 -32.05244  44.86846  1.000 49.24638  ? 67  GLN A CG  1 
ATOM   3775  C CD  . GLN B  1 87  ? -40.33833 -33.34478  44.13551  1.000 62.13595  ? 67  GLN A CD  1 
ATOM   3776  O OE1 . GLN B  1 87  ? -39.70883 -34.38091  44.35584  1.000 61.09483  ? 67  GLN A OE1 1 
ATOM   3777  N NE2 . GLN B  1 87  ? -41.34036 -33.28845  43.26510  1.000 62.87129  ? 67  GLN A NE2 1 
ATOM   3778  N N   . TYR B  1 88  ? -38.44179 -29.97183  46.65671  1.000 43.26049  ? 68  TYR A N   1 
ATOM   3779  C CA  . TYR B  1 88  ? -37.59233 -28.86788  46.24233  1.000 49.88087  ? 68  TYR A CA  1 
ATOM   3780  C C   . TYR B  1 88  ? -36.54844 -28.56963  47.30672  1.000 52.99492  ? 68  TYR A C   1 
ATOM   3781  O O   . TYR B  1 88  ? -36.86655 -28.50722  48.50099  1.000 47.47647  ? 68  TYR A O   1 
ATOM   3782  C CB  . TYR B  1 88  ? -38.43987 -27.62753  45.98634  1.000 55.33177  ? 68  TYR A CB  1 
ATOM   3783  C CG  . TYR B  1 88  ? -37.66969 -26.43207  45.47340  1.000 57.20622  ? 68  TYR A CG  1 
ATOM   3784  C CD1 . TYR B  1 88  ? -36.46161 -26.57386  44.78888  1.000 59.18553  ? 68  TYR A CD1 1 
ATOM   3785  C CD2 . TYR B  1 88  ? -38.14019 -25.15273  45.70933  1.000 60.81043  ? 68  TYR A CD2 1 
ATOM   3786  C CE1 . TYR B  1 88  ? -35.77010 -25.46640  44.33446  1.000 57.89370  ? 68  TYR A CE1 1 
ATOM   3787  C CE2 . TYR B  1 88  ? -37.46455 -24.04582  45.26560  1.000 66.13659  ? 68  TYR A CE2 1 
ATOM   3788  C CZ  . TYR B  1 88  ? -36.28047 -24.20456  44.58070  1.000 60.91577  ? 68  TYR A CZ  1 
ATOM   3789  O OH  . TYR B  1 88  ? -35.61036 -23.09018  44.14319  1.000 61.81182  ? 68  TYR A OH  1 
ATOM   3790  N N   . LYS B  1 89  ? -35.29493 -28.41956  46.85645  1.000 59.29445  ? 69  LYS A N   1 
ATOM   3791  C CA  . LYS B  1 89  ? -34.18146 -27.85561  47.61318  1.000 61.36524  ? 69  LYS A CA  1 
ATOM   3792  C C   . LYS B  1 89  ? -34.29148 -28.15610  49.09839  1.000 57.92111  ? 69  LYS A C   1 
ATOM   3793  O O   . LYS B  1 89  ? -34.43609 -27.23847  49.91759  1.000 50.74798  ? 69  LYS A O   1 
ATOM   3794  C CB  . LYS B  1 89  ? -34.10420 -26.34404  47.39549  1.000 53.95148  ? 69  LYS A CB  1 
ATOM   3795  C CG  . LYS B  1 89  ? -32.68935 -25.79840  47.36675  1.000 57.66156  ? 69  LYS A CG  1 
ATOM   3796  C CD  . LYS B  1 89  ? -32.24244 -25.48007  45.95033  1.000 58.37032  ? 69  LYS A CD  1 
ATOM   3797  C CE  . LYS B  1 89  ? -30.79127 -25.02667  45.93015  1.000 60.33593  ? 69  LYS A CE  1 
ATOM   3798  N NZ  . LYS B  1 89  ? -30.42104 -24.38615  44.63908  1.000 61.39121  ? 69  LYS A NZ  1 
ATOM   3799  N N   . ALA B  1 90  ? -34.24304 -29.43860  49.44838  1.000 37.10421  ? 70  ALA A N   1 
ATOM   3800  C CA  . ALA B  1 90  ? -34.59189 -29.89181  50.78342  1.000 40.49797  ? 70  ALA A CA  1 
ATOM   3801  C C   . ALA B  1 90  ? -33.37700 -30.19301  51.64745  1.000 45.13989  ? 70  ALA A C   1 
ATOM   3802  O O   . ALA B  1 90  ? -33.53212 -30.76650  52.73166  1.000 47.61716  ? 70  ALA A O   1 
ATOM   3803  C CB  . ALA B  1 90  ? -35.48889 -31.12577  50.69194  1.000 52.39385  ? 70  ALA A CB  1 
ATOM   3804  N N   . HIS B  1 91  ? -32.17478 -29.82863  51.19338  1.000 43.78503  ? 71  HIS A N   1 
ATOM   3805  C CA  . HIS B  1 91  ? -30.97624 -30.07670  51.98960  1.000 42.65187  ? 71  HIS A CA  1 
ATOM   3806  C C   . HIS B  1 91  ? -31.09218 -29.43574  53.36099  1.000 36.91471  ? 71  HIS A C   1 
ATOM   3807  O O   . HIS B  1 91  ? -30.82619 -30.07031  54.38743  1.000 33.46069  ? 71  HIS A O   1 
ATOM   3808  C CB  . HIS B  1 91  ? -29.73874 -29.54225  51.27164  1.000 57.00014  ? 71  HIS A CB  1 
ATOM   3809  C CG  . HIS B  1 91  ? -28.46469 -29.77685  52.02285  1.000 68.41761  ? 71  HIS A CG  1 
ATOM   3810  N ND1 . HIS B  1 91  ? -28.08697 -31.02445  52.47324  1.000 67.34926  ? 71  HIS A ND1 1 
ATOM   3811  C CD2 . HIS B  1 91  ? -27.48734 -28.92411  52.41309  1.000 69.33813  ? 71  HIS A CD2 1 
ATOM   3812  C CE1 . HIS B  1 91  ? -26.92742 -30.93208  53.09948  1.000 66.67061  ? 71  HIS A CE1 1 
ATOM   3813  N NE2 . HIS B  1 91  ? -26.54210 -29.66830  53.07772  1.000 70.57409  ? 71  HIS A NE2 1 
ATOM   3814  N N   . ASP B  1 92  ? -31.47812 -28.16414  53.39394  1.000 41.60479  ? 72  ASP A N   1 
ATOM   3815  C CA  . ASP B  1 92  ? -31.64208 -27.49050  54.67152  1.000 39.91716  ? 72  ASP A CA  1 
ATOM   3816  C C   . ASP B  1 92  ? -32.81076 -28.07645  55.44676  1.000 35.97735  ? 72  ASP A C   1 
ATOM   3817  O O   . ASP B  1 92  ? -32.71015 -28.29760  56.65737  1.000 40.73854  ? 72  ASP A O   1 
ATOM   3818  C CB  . ASP B  1 92  ? -31.81827 -25.98754  54.45050  1.000 40.77307  ? 72  ASP A CB  1 
ATOM   3819  C CG  . ASP B  1 92  ? -30.50602 -25.28534  54.16821  1.000 60.07210  ? 72  ASP A CG  1 
ATOM   3820  O OD1 . ASP B  1 92  ? -29.70287 -25.17827  55.11337  1.000 70.29467  ? 72  ASP A OD1 1 
ATOM   3821  O OD2 . ASP B  1 92  ? -30.27382 -24.83734  53.02390  1.000 69.02467  ? 72  ASP A OD2 1 
ATOM   3822  N N   . LEU B  1 93  ? -33.91346 -28.36795  54.75764  1.000 32.73826  ? 73  LEU A N   1 
ATOM   3823  C CA  . LEU B  1 93  ? -35.09747 -28.88997  55.43074  1.000 30.29949  ? 73  LEU A CA  1 
ATOM   3824  C C   . LEU B  1 93  ? -34.79393 -30.19688  56.15434  1.000 27.67060  ? 73  LEU A C   1 
ATOM   3825  O O   . LEU B  1 93  ? -35.10318 -30.35271  57.34284  1.000 27.51675  ? 73  LEU A O   1 
ATOM   3826  C CB  . LEU B  1 93  ? -36.21271 -29.08814  54.41004  1.000 29.56450  ? 73  LEU A CB  1 
ATOM   3827  C CG  . LEU B  1 93  ? -37.58599 -29.48352  54.93622  1.000 31.42961  ? 73  LEU A CG  1 
ATOM   3828  C CD1 . LEU B  1 93  ? -37.96414 -28.62966  56.13384  1.000 29.84849  ? 73  LEU A CD1 1 
ATOM   3829  C CD2 . LEU B  1 93  ? -38.59622 -29.35692  53.81283  1.000 27.95214  ? 73  LEU A CD2 1 
ATOM   3830  N N   . ILE B  1 94  ? -34.17067 -31.14388  55.45453  1.000 27.42844  ? 74  ILE A N   1 
ATOM   3831  C CA  . ILE B  1 94  ? -33.94491 -32.45968  56.03993  1.000 27.05257  ? 74  ILE A CA  1 
ATOM   3832  C C   . ILE B  1 94  ? -32.92806 -32.37887  57.17108  1.000 31.25203  ? 74  ILE A C   1 
ATOM   3833  O O   . ILE B  1 94  ? -33.10882 -32.99178  58.22768  1.000 25.90565  ? 74  ILE A O   1 
ATOM   3834  C CB  . ILE B  1 94  ? -33.52565 -33.45544  54.94837  1.000 37.03106  ? 74  ILE A CB  1 
ATOM   3835  C CG1 . ILE B  1 94  ? -34.74141 -33.76079  54.07485  1.000 37.91858  ? 74  ILE A CG1 1 
ATOM   3836  C CG2 . ILE B  1 94  ? -32.95772 -34.73951  55.56973  1.000 33.41861  ? 74  ILE A CG2 1 
ATOM   3837  C CD1 . ILE B  1 94  ? -34.42621 -33.99895  52.62663  1.000 46.32665  ? 74  ILE A CD1 1 
ATOM   3838  N N   . ARG B  1 95  ? -31.87167 -31.58671  56.99271  1.000 28.32778  ? 75  ARG A N   1 
ATOM   3839  C CA  . ARG B  1 95  ? -30.88427 -31.43800  58.05597  1.000 38.41368  ? 75  ARG A CA  1 
ATOM   3840  C C   . ARG B  1 95  ? -31.52038 -30.84735  59.31382  1.000 37.27301  ? 75  ARG A C   1 
ATOM   3841  O O   . ARG B  1 95  ? -31.14012 -31.20716  60.43184  1.000 35.07407  ? 75  ARG A O   1 
ATOM   3842  C CB  . ARG B  1 95  ? -29.70595 -30.59890  57.54008  1.000 41.81986  ? 75  ARG A CB  1 
ATOM   3843  C CG  . ARG B  1 95  ? -28.53801 -30.28251  58.50587  1.000 48.26750  ? 75  ARG A CG  1 
ATOM   3844  C CD  . ARG B  1 95  ? -27.60572 -29.20042  57.91551  1.000 66.02475  ? 75  ARG A CD  1 
ATOM   3845  N NE  . ARG B  1 95  ? -28.30992 -28.24111  57.11128  1.000 78.55987  ? 75  ARG A NE  1 
ATOM   3846  C CZ  . ARG B  1 95  ? -29.21650 -27.31968  57.70057  1.000 82.16847  ? 75  ARG A CZ  1 
ATOM   3847  N NH1 . ARG B  1 95  ? -29.88863 -26.44783  56.96141  1.000 81.85180  ? 75  ARG A NH1 1 
ATOM   3848  N NH2 . ARG B  1 95  ? -29.49478 -27.35002  59.05565  1.000 72.39574  ? 75  ARG A NH2 1 
ATOM   3849  N N   . HIS B  1 96  ? -32.51743 -29.97051  59.15322  1.000 35.96872  ? 76  HIS A N   1 
ATOM   3850  C CA  . HIS B  1 96  ? -33.25248 -29.44789  60.30504  1.000 33.66400  ? 76  HIS A CA  1 
ATOM   3851  C C   . HIS B  1 96  ? -34.14291 -30.50867  60.93721  1.000 23.88816  ? 76  HIS A C   1 
ATOM   3852  O O   . HIS B  1 96  ? -34.27211 -30.57201  62.16449  1.000 23.28598  ? 76  HIS A O   1 
ATOM   3853  C CB  . HIS B  1 96  ? -34.10139 -28.26719  59.86901  1.000 25.08740  ? 76  HIS A CB  1 
ATOM   3854  C CG  . HIS B  1 96  ? -35.12168 -27.82998  60.87492  1.000 23.90587  ? 76  HIS A CG  1 
ATOM   3855  N ND1 . HIS B  1 96  ? -34.88817 -26.86616  61.83846  1.000 30.53205  ? 76  HIS A ND1 1 
ATOM   3856  C CD2 . HIS B  1 96  ? -36.41869 -28.18532  61.00890  1.000 23.18668  ? 76  HIS A CD2 1 
ATOM   3857  C CE1 . HIS B  1 96  ? -35.99114 -26.68108  62.54577  1.000 23.50044  ? 76  HIS A CE1 1 
ATOM   3858  N NE2 . HIS B  1 96  ? -36.93299 -27.47007  62.06171  1.000 27.99722  ? 76  HIS A NE2 1 
ATOM   3859  N N   . LEU B  1 97  ? -34.80265 -31.31815  60.11504  1.000 27.85713  ? 77  LEU A N   1 
ATOM   3860  C CA  . LEU B  1 97  ? -35.63902 -32.38706  60.65306  1.000 28.64677  ? 77  LEU A CA  1 
ATOM   3861  C C   . LEU B  1 97  ? -34.80536 -33.42010  61.40328  1.000 28.64127  ? 77  LEU A C   1 
ATOM   3862  O O   . LEU B  1 97  ? -35.19779 -33.87400  62.48529  1.000 22.48339  ? 77  LEU A O   1 
ATOM   3863  C CB  . LEU B  1 97  ? -36.43226 -33.05182  59.52876  1.000 23.40121  ? 77  LEU A CB  1 
ATOM   3864  C CG  . LEU B  1 97  ? -37.33723 -32.12681  58.71503  1.000 32.95011  ? 77  LEU A CG  1 
ATOM   3865  C CD1 . LEU B  1 97  ? -37.93853 -32.84713  57.51558  1.000 24.16159  ? 77  LEU A CD1 1 
ATOM   3866  C CD2 . LEU B  1 97  ? -38.41798 -31.54773  59.60598  1.000 23.22203  ? 77  LEU A CD2 1 
ATOM   3867  N N   . GLN B  1 98  ? -33.64801 -33.79711  60.84566  1.000 31.61560  ? 78  GLN A N   1 
ATOM   3868  C CA  . GLN B  1 98  ? -32.81405 -34.82891  61.45964  1.000 27.43064  ? 78  GLN A CA  1 
ATOM   3869  C C   . GLN B  1 98  ? -32.30464 -34.39786  62.82829  1.000 31.99313  ? 78  GLN A C   1 
ATOM   3870  O O   . GLN B  1 98  ? -32.21756 -35.21527  63.75191  1.000 23.63951  ? 78  GLN A O   1 
ATOM   3871  C CB  . GLN B  1 98  ? -31.62505 -35.16095  60.55542  1.000 29.08583  ? 78  GLN A CB  1 
ATOM   3872  C CG  . GLN B  1 98  ? -31.96782 -35.82677  59.23549  1.000 39.43449  ? 78  GLN A CG  1 
ATOM   3873  C CD  . GLN B  1 98  ? -30.75104 -35.96474  58.32931  1.000 45.35040  ? 78  GLN A CD  1 
ATOM   3874  O OE1 . GLN B  1 98  ? -29.79184 -35.20216  58.44196  1.000 52.85580  ? 78  GLN A OE1 1 
ATOM   3875  N NE2 . GLN B  1 98  ? -30.78590 -36.94235  57.42912  1.000 37.89796  ? 78  GLN A NE2 1 
ATOM   3876  N N   . ARG B  1 99  ? -31.94270 -33.12094  62.97601  1.000 34.65139  ? 79  ARG A N   1 
ATOM   3877  C CA  . ARG B  1 99  ? -31.30781 -32.66338  64.20272  1.000 27.51095  ? 79  ARG A CA  1 
ATOM   3878  C C   . ARG B  1 99  ? -32.28849 -32.07621  65.20348  1.000 24.04615  ? 79  ARG A C   1 
ATOM   3879  O O   . ARG B  1 99  ? -31.98216 -32.05136  66.40184  1.000 26.37624  ? 79  ARG A O   1 
ATOM   3880  C CB  . ARG B  1 99  ? -30.20325 -31.63984  63.88161  1.000 30.94577  ? 79  ARG A CB  1 
ATOM   3881  C CG  . ARG B  1 99  ? -29.22662 -32.13267  62.80412  1.000 45.86805  ? 79  ARG A CG  1 
ATOM   3882  C CD  . ARG B  1 99  ? -28.07719 -31.15578  62.53175  1.000 50.67405  ? 79  ARG A CD  1 
ATOM   3883  N NE  . ARG B  1 99  ? -27.37000 -31.49339  61.29473  1.000 52.22851  ? 79  ARG A NE  1 
ATOM   3884  C CZ  . ARG B  1 99  ? -26.23532 -32.18854  61.23256  1.000 51.63940  ? 79  ARG A CZ  1 
ATOM   3885  N NH1 . ARG B  1 99  ? -25.65553 -32.62607  62.34433  1.000 53.39303  ? 79  ARG A NH1 1 
ATOM   3886  N NH2 . ARG B  1 99  ? -25.67575 -32.44495  60.05396  1.000 32.20329  ? 79  ARG A NH2 1 
ATOM   3887  N N   . GLY B  1 100 ? -33.46255 -31.63579  64.75724  1.000 22.78463  ? 80  GLY A N   1 
ATOM   3888  C CA  . GLY B  1 100 ? -34.43131 -31.06924  65.67220  1.000 22.18706  ? 80  GLY A CA  1 
ATOM   3889  C C   . GLY B  1 100 ? -35.50052 -32.04448  66.12103  1.000 21.51275  ? 80  GLY A C   1 
ATOM   3890  O O   . GLY B  1 100 ? -35.93423 -32.00950  67.27494  1.000 28.99613  ? 80  GLY A O   1 
ATOM   3891  N N   . TRP B  1 101 ? -35.92132 -32.93072  65.22040  1.000 21.40974  ? 81  TRP A N   1 
ATOM   3892  C CA  . TRP B  1 101 ? -37.04995 -33.81525  65.47979  1.000 27.99742  ? 81  TRP A CA  1 
ATOM   3893  C C   . TRP B  1 101 ? -36.58283 -35.26009  65.60657  1.000 29.07593  ? 81  TRP A C   1 
ATOM   3894  O O   . TRP B  1 101 ? -36.99269 -36.13410  64.83544  1.000 26.02959  ? 81  TRP A O   1 
ATOM   3895  C CB  . TRP B  1 101 ? -38.09402 -33.63153  64.37561  1.000 25.98195  ? 81  TRP A CB  1 
ATOM   3896  C CG  . TRP B  1 101 ? -38.70494 -32.26611  64.46924  1.000 23.22780  ? 81  TRP A CG  1 
ATOM   3897  C CD1 . TRP B  1 101 ? -38.20603 -31.10084  63.95201  1.000 21.14302  ? 81  TRP A CD1 1 
ATOM   3898  C CD2 . TRP B  1 101 ? -39.89648 -31.91416  65.17838  1.000 20.51303  ? 81  TRP A CD2 1 
ATOM   3899  N NE1 . TRP B  1 101 ? -39.02832 -30.04556  64.28450  1.000 21.96355  ? 81  TRP A NE1 1 
ATOM   3900  C CE2 . TRP B  1 101 ? -40.07302 -30.51966  65.03604  1.000 26.37714  ? 81  TRP A CE2 1 
ATOM   3901  C CE3 . TRP B  1 101 ? -40.83674 -32.64413  65.91143  1.000 20.28847  ? 81  TRP A CE3 1 
ATOM   3902  C CZ2 . TRP B  1 101 ? -41.15505 -29.84457  65.59674  1.000 20.64411  ? 81  TRP A CZ2 1 
ATOM   3903  C CZ3 . TRP B  1 101 ? -41.90474 -31.97758  66.46486  1.000 21.60143  ? 81  TRP A CZ3 1 
ATOM   3904  C CH2 . TRP B  1 101 ? -42.05772 -30.58850  66.30738  1.000 22.45121  ? 81  TRP A CH2 1 
ATOM   3905  N N   . ASP B  1 102 ? -35.73600 -35.51195  66.60785  1.000 37.64761  ? 82  ASP A N   1 
ATOM   3906  C CA  . ASP B  1 102 ? -34.98848 -36.75871  66.73712  1.000 34.62093  ? 82  ASP A CA  1 
ATOM   3907  C C   . ASP B  1 102 ? -35.30139 -37.49871  68.03124  1.000 26.21643  ? 82  ASP A C   1 
ATOM   3908  O O   . ASP B  1 102 ? -34.48032 -38.29234  68.49577  1.000 24.77284  ? 82  ASP A O   1 
ATOM   3909  C CB  . ASP B  1 102 ? -33.48912 -36.46914  66.67419  1.000 37.01398  ? 82  ASP A CB  1 
ATOM   3910  C CG  . ASP B  1 102 ? -33.03487 -35.52928  67.78899  1.000 36.47159  ? 82  ASP A CG  1 
ATOM   3911  O OD1 . ASP B  1 102 ? -33.90693 -34.96520  68.49365  1.000 27.34203  ? 82  ASP A OD1 1 
ATOM   3912  O OD2 . ASP B  1 102 ? -31.80907 -35.35636  67.96550  1.000 38.10788  ? 82  ASP A OD2 1 
ATOM   3913  N N   . PHE B  1 103 ? -36.44987 -37.23640  68.64537  1.000 29.31213  ? 83  PHE A N   1 
ATOM   3914  C CA  . PHE B  1 103 ? -36.75164 -37.77660  69.96360  1.000 28.93383  ? 83  PHE A CA  1 
ATOM   3915  C C   . PHE B  1 103 ? -37.91633 -38.75793  69.93790  1.000 26.71081  ? 83  PHE A C   1 
ATOM   3916  O O   . PHE B  1 103 ? -38.45562 -39.09753  70.99848  1.000 20.87300  ? 83  PHE A O   1 
ATOM   3917  C CB  . PHE B  1 103 ? -37.02947 -36.63440  70.94637  1.000 20.90951  ? 83  PHE A CB  1 
ATOM   3918  C CG  . PHE B  1 103 ? -38.11397 -35.69913  70.49859  1.000 20.59599  ? 83  PHE A CG  1 
ATOM   3919  C CD1 . PHE B  1 103 ? -39.44617 -35.98208  70.76061  1.000 20.46877  ? 83  PHE A CD1 1 
ATOM   3920  C CD2 . PHE B  1 103 ? -37.80173 -34.52223  69.83033  1.000 24.07720  ? 83  PHE A CD2 1 
ATOM   3921  C CE1 . PHE B  1 103 ? -40.45034 -35.10769  70.35566  1.000 21.21574  ? 83  PHE A CE1 1 
ATOM   3922  C CE2 . PHE B  1 103 ? -38.79664 -33.64370  69.42999  1.000 20.41726  ? 83  PHE A CE2 1 
ATOM   3923  C CZ  . PHE B  1 103 ? -40.12297 -33.93987  69.68875  1.000 20.29431  ? 83  PHE A CZ  1 
ATOM   3924  N N   . PHE B  1 104 ? -38.32462 -39.20524  68.75466  1.000 20.75594  ? 84  PHE A N   1 
ATOM   3925  C CA  . PHE B  1 104 ? -39.31442 -40.26694  68.62414  1.000 24.47497  ? 84  PHE A CA  1 
ATOM   3926  C C   . PHE B  1 104 ? -38.60829 -41.61735  68.61324  1.000 25.36758  ? 84  PHE A C   1 
ATOM   3927  O O   . PHE B  1 104 ? -37.53302 -41.76175  68.02529  1.000 37.01703  ? 84  PHE A O   1 
ATOM   3928  C CB  . PHE B  1 104 ? -40.13659 -40.10149  67.33991  1.000 30.74853  ? 84  PHE A CB  1 
ATOM   3929  C CG  . PHE B  1 104 ? -40.90352 -38.80871  67.26142  1.000 33.28157  ? 84  PHE A CG  1 
ATOM   3930  C CD1 . PHE B  1 104 ? -40.25171 -37.60903  67.01747  1.000 41.08933  ? 84  PHE A CD1 1 
ATOM   3931  C CD2 . PHE B  1 104 ? -42.27600 -38.79481  67.41968  1.000 37.92333  ? 84  PHE A CD2 1 
ATOM   3932  C CE1 . PHE B  1 104 ? -40.95441 -36.42239  66.94359  1.000 40.59907  ? 84  PHE A CE1 1 
ATOM   3933  C CE2 . PHE B  1 104 ? -42.98709 -37.60777  67.34315  1.000 41.12855  ? 84  PHE A CE2 1 
ATOM   3934  C CZ  . PHE B  1 104 ? -42.32673 -36.42435  67.10583  1.000 37.67334  ? 84  PHE A CZ  1 
ATOM   3935  N N   . ARG B  1 105 ? -39.21111 -42.60462  69.27364  1.000 23.75647  ? 85  ARG A N   1 
ATOM   3936  C CA  . ARG B  1 105 ? -38.64868 -43.95133  69.31744  1.000 24.56247  ? 85  ARG A CA  1 
ATOM   3937  C C   . ARG B  1 105 ? -39.72872 -44.95395  68.93369  1.000 24.83108  ? 85  ARG A C   1 
ATOM   3938  O O   . ARG B  1 105 ? -40.84334 -44.90527  69.48368  1.000 24.57408  ? 85  ARG A O   1 
ATOM   3939  C CB  . ARG B  1 105 ? -38.08445 -44.28776  70.70265  1.000 22.24603  ? 85  ARG A CB  1 
ATOM   3940  C CG  . ARG B  1 105 ? -36.64973 -43.82433  70.91838  1.000 22.35670  ? 85  ARG A CG  1 
ATOM   3941  C CD  . ARG B  1 105 ? -35.72861 -44.39820  69.85850  1.000 30.52121  ? 85  ARG A CD  1 
ATOM   3942  N NE  . ARG B  1 105 ? -35.35324 -45.78396  70.12968  1.000 23.45236  ? 85  ARG A NE  1 
ATOM   3943  C CZ  . ARG B  1 105 ? -34.10308 -46.22764  70.07691  1.000 32.25720  ? 85  ARG A CZ  1 
ATOM   3944  N NH1 . ARG B  1 105 ? -33.12260 -45.38377  69.76825  1.000 24.17659  ? 85  ARG A NH1 1 
ATOM   3945  N NH2 . ARG B  1 105 ? -33.82949 -47.50312  70.33076  1.000 24.80081  ? 85  ARG A NH2 1 
ATOM   3946  N N   . PRO B  1 106 ? -39.44667 -45.87771  68.01367  1.000 28.23308  ? 86  PRO A N   1 
ATOM   3947  C CA  . PRO B  1 106 ? -40.50323 -46.80501  67.58321  1.000 31.99419  ? 86  PRO A CA  1 
ATOM   3948  C C   . PRO B  1 106 ? -40.95814 -47.75592  68.67567  1.000 23.80149  ? 86  PRO A C   1 
ATOM   3949  O O   . PRO B  1 106 ? -42.10156 -48.22324  68.62285  1.000 32.51697  ? 86  PRO A O   1 
ATOM   3950  C CB  . PRO B  1 106 ? -39.86341 -47.54229  66.39641  1.000 27.78172  ? 86  PRO A CB  1 
ATOM   3951  C CG  . PRO B  1 106 ? -38.77553 -46.61144  65.91358  1.000 34.83271  ? 86  PRO A CG  1 
ATOM   3952  C CD  . PRO B  1 106 ? -38.24548 -45.97444  67.16871  1.000 26.67561  ? 86  PRO A CD  1 
ATOM   3953  N N   . GLU B  1 107 ? -40.12179 -48.04196  69.68007  1.000 26.78232  ? 87  GLU A N   1 
ATOM   3954  C CA  . GLU B  1 107 ? -40.56462 -48.93678  70.74744  1.000 29.62579  ? 87  GLU A CA  1 
ATOM   3955  C C   . GLU B  1 107 ? -41.66734 -48.32111  71.58796  1.000 32.58269  ? 87  GLU A C   1 
ATOM   3956  O O   . GLU B  1 107 ? -42.36390 -49.05618  72.29006  1.000 24.82255  ? 87  GLU A O   1 
ATOM   3957  C CB  . GLU B  1 107 ? -39.41575 -49.33534  71.67423  1.000 24.65060  ? 87  GLU A CB  1 
ATOM   3958  C CG  . GLU B  1 107 ? -38.16849 -49.78216  70.98069  1.000 26.94906  ? 87  GLU A CG  1 
ATOM   3959  C CD  . GLU B  1 107 ? -37.12275 -48.70246  70.98696  1.000 24.46667  ? 87  GLU A CD  1 
ATOM   3960  O OE1 . GLU B  1 107 ? -37.45727 -47.56724  70.58290  1.000 23.79396  ? 87  GLU A OE1 1 
ATOM   3961  O OE2 . GLU B  1 107 ? -35.98734 -48.98781  71.42383  1.000 24.88014  ? 87  GLU A OE2 1 
ATOM   3962  N N   . ARG B  1 108 ? -41.81744 -46.99484  71.55283  1.000 24.10954  ? 88  ARG A N   1 
ATOM   3963  C CA  . ARG B  1 108 ? -42.93810 -46.29655  72.16569  1.000 23.46582  ? 88  ARG A CA  1 
ATOM   3964  C C   . ARG B  1 108 ? -44.04535 -46.00653  71.15581  1.000 30.41002  ? 88  ARG A C   1 
ATOM   3965  O O   . ARG B  1 108 ? -44.91162 -45.16135  71.41382  1.000 24.27114  ? 88  ARG A O   1 
ATOM   3966  C CB  . ARG B  1 108 ? -42.45514 -44.99485  72.81277  1.000 23.79271  ? 88  ARG A CB  1 
ATOM   3967  C CG  . ARG B  1 108 ? -41.35503 -45.19552  73.85237  1.000 23.11980  ? 88  ARG A CG  1 
ATOM   3968  C CD  . ARG B  1 108 ? -41.05815 -43.90677  74.62043  1.000 26.46267  ? 88  ARG A CD  1 
ATOM   3969  N NE  . ARG B  1 108 ? -40.50813 -42.85511  73.77027  1.000 27.62586  ? 88  ARG A NE  1 
ATOM   3970  C CZ  . ARG B  1 108 ? -39.22153 -42.51371  73.72874  1.000 25.80472  ? 88  ARG A CZ  1 
ATOM   3971  N NH1 . ARG B  1 108 ? -38.33356 -43.13975  74.48973  1.000 22.59102  ? 88  ARG A NH1 1 
ATOM   3972  N NH2 . ARG B  1 108 ? -38.82350 -41.53563  72.92658  1.000 21.67876  ? 88  ARG A NH2 1 
ATOM   3973  N N   . ASN B  1 109 ? -44.00974 -46.67338  69.99926  1.000 24.92664  ? 89  ASN A N   1 
ATOM   3974  C CA  . ASN B  1 109 ? -45.00466 -46.49546  68.94059  1.000 23.89856  ? 89  ASN A CA  1 
ATOM   3975  C C   . ASN B  1 109 ? -45.03532 -45.05802  68.44023  1.000 23.21299  ? 89  ASN A C   1 
ATOM   3976  O O   . ASN B  1 109 ? -46.09486 -44.51060  68.14147  1.000 31.96377  ? 89  ASN A O   1 
ATOM   3977  C CB  . ASN B  1 109 ? -46.39157 -46.94051  69.40114  1.000 29.03297  ? 89  ASN A CB  1 
ATOM   3978  C CG  . ASN B  1 109 ? -46.52039 -48.43106  69.43172  1.000 29.44428  ? 89  ASN A CG  1 
ATOM   3979  O OD1 . ASN B  1 109 ? -45.70035 -49.13627  68.84722  1.000 44.85251  ? 89  ASN A OD1 1 
ATOM   3980  N ND2 . ASN B  1 109 ? -47.52454 -48.93197  70.14010  1.000 31.75788  ? 89  ASN A ND2 1 
ATOM   3981  N N   . GLU B  1 110 ? -43.86182 -44.44150  68.36306  1.000 29.64417  ? 90  GLU A N   1 
ATOM   3982  C CA  . GLU B  1 110 ? -43.67839 -43.14799  67.72442  1.000 30.67683  ? 90  GLU A CA  1 
ATOM   3983  C C   . GLU B  1 110 ? -42.83481 -43.32510  66.47243  1.000 26.55571  ? 90  GLU A C   1 
ATOM   3984  O O   . GLU B  1 110 ? -42.07737 -44.28847  66.34159  1.000 30.73720  ? 90  GLU A O   1 
ATOM   3985  C CB  . GLU B  1 110 ? -43.01139 -42.14239  68.66973  1.000 21.53814  ? 90  GLU A CB  1 
ATOM   3986  C CG  . GLU B  1 110 ? -43.51364 -42.21167  70.08304  1.000 28.69038  ? 90  GLU A CG  1 
ATOM   3987  C CD  . GLU B  1 110 ? -42.45950 -41.83850  71.08808  1.000 36.18949  ? 90  GLU A CD  1 
ATOM   3988  O OE1 . GLU B  1 110 ? -42.84432 -41.50380  72.22537  1.000 48.69310  ? 90  GLU A OE1 1 
ATOM   3989  O OE2 . GLU B  1 110 ? -41.25765 -41.86259  70.74014  1.000 33.67171  ? 90  GLU A OE2 1 
ATOM   3990  N N   . SER B  1 111 ? -42.97101 -42.38345  65.54823  1.000 25.56498  ? 91  SER A N   1 
ATOM   3991  C CA  . SER B  1 111 ? -42.16527 -42.43518  64.33830  1.000 22.25001  ? 91  SER A CA  1 
ATOM   3992  C C   . SER B  1 111 ? -42.07527 -41.04388  63.73527  1.000 28.64527  ? 91  SER A C   1 
ATOM   3993  O O   . SER B  1 111 ? -43.02494 -40.25660  63.79447  1.000 21.75646  ? 91  SER A O   1 
ATOM   3994  C CB  . SER B  1 111 ? -42.73869 -43.42072  63.32063  1.000 25.77359  ? 91  SER A CB  1 
ATOM   3995  O OG  . SER B  1 111 ? -44.06083 -43.06247  62.97509  1.000 32.04195  ? 91  SER A OG  1 
ATOM   3996  N N   . PHE B  1 112 ? -40.90516 -40.75079  63.18074  1.000 22.01151  ? 92  PHE A N   1 
ATOM   3997  C CA  . PHE B  1 112 ? -40.68192 -39.55567  62.38926  1.000 24.28798  ? 92  PHE A CA  1 
ATOM   3998  C C   . PHE B  1 112 ? -39.96530 -39.97742  61.12204  1.000 32.78151  ? 92  PHE A C   1 
ATOM   3999  O O   . PHE B  1 112 ? -38.79000 -40.36751  61.14857  1.000 23.03079  ? 92  PHE A O   1 
ATOM   4000  C CB  . PHE B  1 112 ? -39.88447 -38.50912  63.14158  1.000 30.53465  ? 92  PHE A CB  1 
ATOM   4001  C CG  . PHE B  1 112 ? -40.10958 -37.11299  62.64584  1.000 23.36089  ? 92  PHE A CG  1 
ATOM   4002  C CD1 . PHE B  1 112 ? -39.35657 -36.60255  61.59581  1.000 22.42679  ? 92  PHE A CD1 1 
ATOM   4003  C CD2 . PHE B  1 112 ? -41.04928 -36.30118  63.25005  1.000 21.58926  ? 92  PHE A CD2 1 
ATOM   4004  C CE1 . PHE B  1 112 ? -39.54914 -35.30953  61.14824  1.000 24.16540  ? 92  PHE A CE1 1 
ATOM   4005  C CE2 . PHE B  1 112 ? -41.24837 -35.00232  62.81242  1.000 23.12617  ? 92  PHE A CE2 1 
ATOM   4006  C CZ  . PHE B  1 112 ? -40.49637 -34.50434  61.75793  1.000 21.38700  ? 92  PHE A CZ  1 
ATOM   4007  N N   . ASP B  1 113 ? -40.67805 -39.84545  60.02064  1.000 31.45908  ? 93  ASP A N   1 
ATOM   4008  C CA  . ASP B  1 113 ? -40.26825 -40.34705  58.72646  1.000 24.29813  ? 93  ASP A CA  1 
ATOM   4009  C C   . ASP B  1 113 ? -40.00832 -39.16620  57.77720  1.000 33.49377  ? 93  ASP A C   1 
ATOM   4010  O O   . ASP B  1 113 ? -40.93725 -38.43058  57.42736  1.000 27.98076  ? 93  ASP A O   1 
ATOM   4011  C CB  . ASP B  1 113 ? -41.34459 -41.31141  58.19968  1.000 31.15306  ? 93  ASP A CB  1 
ATOM   4012  C CG  . ASP B  1 113 ? -41.37098 -42.66642  58.96225  1.000 27.51805  ? 93  ASP A CG  1 
ATOM   4013  O OD1 . ASP B  1 113 ? -42.41570 -43.06498  59.52589  1.000 30.89093  ? 93  ASP A OD1 1 
ATOM   4014  O OD2 . ASP B  1 113 ? -40.29220 -43.29408  59.07200  1.000 25.28309  ? 93  ASP A OD2 1 
ATOM   4015  N N   . ILE B  1 114 ? -38.75004 -38.97240  57.36249  1.000 36.13527  ? 94  ILE A N   1 
ATOM   4016  C CA  . ILE B  1 114 ? -38.41584 -37.93670  56.37872  1.000 25.65684  ? 94  ILE A CA  1 
ATOM   4017  C C   . ILE B  1 114 ? -38.38809 -38.57925  54.99837  1.000 36.57077  ? 94  ILE A C   1 
ATOM   4018  O O   . ILE B  1 114 ? -37.57576 -39.47364  54.74327  1.000 43.66617  ? 94  ILE A O   1 
ATOM   4019  C CB  . ILE B  1 114 ? -37.07436 -37.25501  56.68918  1.000 37.17323  ? 94  ILE A CB  1 
ATOM   4020  C CG1 . ILE B  1 114 ? -37.05796 -36.71031  58.11803  1.000 29.07501  ? 94  ILE A CG1 1 
ATOM   4021  C CG2 . ILE B  1 114 ? -36.82198 -36.12609  55.69390  1.000 30.02907  ? 94  ILE A CG2 1 
ATOM   4022  C CD1 . ILE B  1 114 ? -35.67342 -36.34244  58.59586  1.000 25.97380  ? 94  ILE A CD1 1 
ATOM   4023  N N   . LEU B  1 115 ? -39.26651 -38.11892  54.09819  1.000 39.64152  ? 95  LEU A N   1 
ATOM   4024  C CA  . LEU B  1 115 ? -39.59944 -38.84688  52.87323  1.000 35.20760  ? 95  LEU A CA  1 
ATOM   4025  C C   . LEU B  1 115 ? -39.33337 -38.00580  51.62766  1.000 30.66520  ? 95  LEU A C   1 
ATOM   4026  O O   . LEU B  1 115 ? -40.27132 -37.48366  51.00614  1.000 33.54849  ? 95  LEU A O   1 
ATOM   4027  C CB  . LEU B  1 115 ? -41.05489 -39.30397  52.91755  1.000 35.53779  ? 95  LEU A CB  1 
ATOM   4028  C CG  . LEU B  1 115 ? -41.32135 -40.34150  54.00359  1.000 35.10195  ? 95  LEU A CG  1 
ATOM   4029  C CD1 . LEU B  1 115 ? -42.80888 -40.61321  54.11800  1.000 39.89363  ? 95  LEU A CD1 1 
ATOM   4030  C CD2 . LEU B  1 115 ? -40.54795 -41.62530  53.71267  1.000 31.38205  ? 95  LEU A CD2 1 
ATOM   4031  N N   . PRO B  1 116 ? -38.07544 -37.88224  51.21358  1.000 36.86524  ? 96  PRO A N   1 
ATOM   4032  C CA  . PRO B  1 116 ? -37.76997 -37.18706  49.96166  1.000 40.69611  ? 96  PRO A CA  1 
ATOM   4033  C C   . PRO B  1 116 ? -38.02552 -38.08024  48.75996  1.000 48.91261  ? 96  PRO A C   1 
ATOM   4034  O O   . PRO B  1 116 ? -38.06234 -39.30857  48.85488  1.000 64.33498  ? 96  PRO A O   1 
ATOM   4035  C CB  . PRO B  1 116 ? -36.27236 -36.86174  50.08000  1.000 32.71339  ? 96  PRO A CB  1 
ATOM   4036  C CG  . PRO B  1 116 ? -35.83335 -37.38612  51.45049  1.000 41.10108  ? 96  PRO A CG  1 
ATOM   4037  C CD  . PRO B  1 116 ? -36.85618 -38.39768  51.85349  1.000 43.01565  ? 96  PRO A CD  1 
ATOM   4038  N N   . ALA B  1 117 ? -38.19174 -37.43572  47.61024  1.000 65.63676  ? 97  ALA A N   1 
ATOM   4039  C CA  . ALA B  1 117 ? -38.27092 -38.16079  46.35017  1.000 74.13446  ? 97  ALA A CA  1 
ATOM   4040  C C   . ALA B  1 117 ? -36.86162 -38.53461  45.91234  1.000 75.77956  ? 97  ALA A C   1 
ATOM   4041  O O   . ALA B  1 117 ? -36.00827 -37.65907  45.73204  1.000 81.58668  ? 97  ALA A O   1 
ATOM   4042  C CB  . ALA B  1 117 ? -38.96877 -37.31617  45.28773  1.000 74.38304  ? 97  ALA A CB  1 
ATOM   4043  N N   . SER B  1 118 ? -36.60770 -39.82840  45.76030  1.000 77.21592  ? 98  SER A N   1 
ATOM   4044  C CA  . SER B  1 118 ? -35.27471 -40.29641  45.40219  1.000 93.38012  ? 98  SER A CA  1 
ATOM   4045  C C   . SER B  1 118 ? -35.40517 -41.64754  44.71146  1.000 104.52112 ? 98  SER A C   1 
ATOM   4046  O O   . SER B  1 118 ? -36.50076 -42.20578  44.59588  1.000 104.75778 ? 98  SER A O   1 
ATOM   4047  C CB  . SER B  1 118 ? -34.37141 -40.38730  46.63611  1.000 91.08715  ? 98  SER A CB  1 
ATOM   4048  O OG  . SER B  1 118 ? -34.92272 -41.25597  47.61415  1.000 84.42900  ? 98  SER A OG  1 
ATOM   4049  N N   . GLN B  1 119 ? -34.26805 -42.16721  44.24651  1.000 111.01427 ? 99  GLN A N   1 
ATOM   4050  C CA  . GLN B  1 119 ? -34.19055 -43.53964  43.75004  1.000 112.96387 ? 99  GLN A CA  1 
ATOM   4051  C C   . GLN B  1 119 ? -34.41527 -44.49968  44.91215  1.000 117.05132 ? 99  GLN A C   1 
ATOM   4052  O O   . GLN B  1 119 ? -33.58410 -44.59115  45.82372  1.000 119.59638 ? 99  GLN A O   1 
ATOM   4053  C CB  . GLN B  1 119 ? -32.84002 -43.79705  43.09022  1.000 111.73914 ? 99  GLN A CB  1 
ATOM   4054  N N   . ARG B  1 120 ? -35.53388 -45.22301  44.87324  1.000 116.57620 ? 100 ARG A N   1 
ATOM   4055  C CA  . ARG B  1 120 ? -35.91406 -46.12650  45.95106  1.000 111.80136 ? 100 ARG A CA  1 
ATOM   4056  C C   . ARG B  1 120 ? -36.99922 -47.08262  45.47018  1.000 108.31898 ? 100 ARG A C   1 
ATOM   4057  O O   . ARG B  1 120 ? -36.72012 -48.23944  45.13904  1.000 104.57535 ? 100 ARG A O   1 
ATOM   4058  C CB  . ARG B  1 120 ? -36.39643 -45.32811  47.16538  1.000 104.56351 ? 100 ARG A CB  1 
ATOM   4059  C CG  . ARG B  1 120 ? -36.91443 -46.17768  48.30973  1.000 100.58585 ? 100 ARG A CG  1 
ATOM   4060  C CD  . ARG B  1 120 ? -37.74968 -45.35295  49.28273  1.000 92.61928  ? 100 ARG A CD  1 
ATOM   4061  N NE  . ARG B  1 120 ? -39.09182 -45.07260  48.77861  1.000 91.49999  ? 100 ARG A NE  1 
ATOM   4062  C CZ  . ARG B  1 120 ? -40.21716 -45.42132  49.39738  1.000 85.00849  ? 100 ARG A CZ  1 
ATOM   4063  N NH1 . ARG B  1 120 ? -41.38919 -45.12027  48.85561  1.000 87.16036  ? 100 ARG A NH1 1 
ATOM   4064  N NH2 . ARG B  1 120 ? -40.17574 -46.07226  50.55229  1.000 76.98732  ? 100 ARG A NH2 1 
ATOM   4065  N N   . VAL B  1 121 ? -38.24712 -46.60328  45.42773  1.000 107.04479 ? 101 VAL A N   1 
ATOM   4066  C CA  . VAL B  1 121 ? -39.35263 -47.40130  44.90280  1.000 105.65663 ? 101 VAL A CA  1 
ATOM   4067  C C   . VAL B  1 121 ? -39.56890 -47.15952  43.41668  1.000 108.44835 ? 101 VAL A C   1 
ATOM   4068  O O   . VAL B  1 121 ? -40.28469 -47.93883  42.76812  1.000 111.33045 ? 101 VAL A O   1 
ATOM   4069  C CB  . VAL B  1 121 ? -40.64595 -47.11934  45.69872  1.000 97.12601  ? 101 VAL A CB  1 
ATOM   4070  C CG1 . VAL B  1 121 ? -41.31886 -45.84096  45.21196  1.000 92.61760  ? 101 VAL A CG1 1 
ATOM   4071  C CG2 . VAL B  1 121 ? -41.60128 -48.31038  45.62259  1.000 95.39699  ? 101 VAL A CG2 1 
ATOM   4072  N N   . SER B  1 122 ? -38.95526 -46.12062  42.85372  1.000 107.97536 ? 102 SER A N   1 
ATOM   4073  C CA  . SER B  1 122 ? -39.07438 -45.80717  41.43749  1.000 106.88110 ? 102 SER A CA  1 
ATOM   4074  C C   . SER B  1 122 ? -37.95161 -44.85165  41.06020  1.000 109.08635 ? 102 SER A C   1 
ATOM   4075  O O   . SER B  1 122 ? -37.43213 -44.11450  41.90378  1.000 110.70015 ? 102 SER A O   1 
ATOM   4076  C CB  . SER B  1 122 ? -40.44019 -45.19004  41.11113  1.000 102.78088 ? 102 SER A CB  1 
ATOM   4077  O OG  . SER B  1 122 ? -40.75630 -44.13428  42.00782  1.000 96.74479  ? 102 SER A OG  1 
ATOM   4078  N N   . GLU B  1 123 ? -37.57798 -44.87837  39.77780  1.000 105.60633 ? 103 GLU A N   1 
ATOM   4079  C CA  . GLU B  1 123 ? -36.63484 -43.89176  39.26018  1.000 102.68445 ? 103 GLU A CA  1 
ATOM   4080  C C   . GLU B  1 123 ? -37.19906 -42.48238  39.40715  1.000 102.62183 ? 103 GLU A C   1 
ATOM   4081  O O   . GLU B  1 123 ? -36.65108 -41.65695  40.14553  1.000 106.14020 ? 103 GLU A O   1 
ATOM   4082  C CB  . GLU B  1 123 ? -36.29668 -44.20110  37.80008  1.000 104.88053 ? 103 GLU A CB  1 
ATOM   4083  N N   . THR B  1 124 ? -38.30152 -42.19457  38.70406  1.000 103.07676 ? 104 THR A N   1 
ATOM   4084  C CA  . THR B  1 124 ? -39.14316 -40.99950  38.84790  1.000 105.93013 ? 104 THR A CA  1 
ATOM   4085  C C   . THR B  1 124 ? -38.42981 -39.67063  39.10824  1.000 105.30929 ? 104 THR A C   1 
ATOM   4086  O O   . THR B  1 124 ? -38.83863 -38.64108  38.55959  1.000 103.25146 ? 104 THR A O   1 
ATOM   4087  C CB  . THR B  1 124 ? -40.17890 -41.21664  39.96185  1.000 102.53463 ? 104 THR A CB  1 
ATOM   4088  O OG1 . THR B  1 124 ? -39.55811 -41.80764  41.11091  1.000 101.41360 ? 104 THR A OG1 1 
ATOM   4089  C CG2 . THR B  1 124 ? -41.30219 -42.11665  39.46954  1.000 100.22964 ? 104 THR A CG2 1 
ATOM   4090  N N   . GLN B  1 125 ? -37.40507 -39.67476  39.96725  1.000 101.98711 ? 105 GLN A N   1 
ATOM   4091  C CA  . GLN B  1 125 ? -36.66914 -38.48627  40.39286  1.000 95.44730  ? 105 GLN A CA  1 
ATOM   4092  C C   . GLN B  1 125 ? -37.49044 -37.65435  41.37213  1.000 90.12240  ? 105 GLN A C   1 
ATOM   4093  O O   . GLN B  1 125 ? -37.05554 -37.43102  42.50600  1.000 85.71438  ? 105 GLN A O   1 
ATOM   4094  C CB  . GLN B  1 125 ? -36.23111 -37.63311  39.19546  1.000 96.12371  ? 105 GLN A CB  1 
ATOM   4095  N N   . TRP B  1 126 ? -38.67666 -37.20295  40.96580  1.000 88.31632  ? 106 TRP A N   1 
ATOM   4096  C CA  . TRP B  1 126 ? -39.47110 -36.29416  41.78115  1.000 80.63946  ? 106 TRP A CA  1 
ATOM   4097  C C   . TRP B  1 126 ? -40.90496 -36.79626  41.90967  1.000 71.16505  ? 106 TRP A C   1 
ATOM   4098  O O   . TRP B  1 126 ? -41.37737 -37.60809  41.11020  1.000 78.29035  ? 106 TRP A O   1 
ATOM   4099  C CB  . TRP B  1 126 ? -39.45009 -34.86877  41.19606  1.000 80.72386  ? 106 TRP A CB  1 
ATOM   4100  C CG  . TRP B  1 126 ? -38.07022 -34.27233  41.16196  1.000 85.98845  ? 106 TRP A CG  1 
ATOM   4101  C CD1 . TRP B  1 126 ? -37.35595 -33.79133  42.22382  1.000 86.01645  ? 106 TRP A CD1 1 
ATOM   4102  C CD2 . TRP B  1 126 ? -37.23278 -34.11018  40.00962  1.000 94.34006  ? 106 TRP A CD2 1 
ATOM   4103  N NE1 . TRP B  1 126 ? -36.12790 -33.33724  41.80182  1.000 94.41937  ? 106 TRP A NE1 1 
ATOM   4104  C CE2 . TRP B  1 126 ? -36.02763 -33.52198  40.44698  1.000 97.33888  ? 106 TRP A CE2 1 
ATOM   4105  C CE3 . TRP B  1 126 ? -37.38565 -34.40432  38.65010  1.000 97.75209  ? 106 TRP A CE3 1 
ATOM   4106  C CZ2 . TRP B  1 126 ? -34.98275 -33.22147  39.57170  1.000 100.25716 ? 106 TRP A CZ2 1 
ATOM   4107  C CZ3 . TRP B  1 126 ? -36.34727 -34.10741  37.78380  1.000 99.75369  ? 106 TRP A CZ3 1 
ATOM   4108  C CH2 . TRP B  1 126 ? -35.16195 -33.52196  38.24766  1.000 101.59839 ? 106 TRP A CH2 1 
ATOM   4109  N N   . TYR B  1 127 ? -41.58789 -36.31647  42.94936  1.000 59.88156  ? 107 TYR A N   1 
ATOM   4110  C CA  . TYR B  1 127 ? -43.01533 -36.56570  43.08632  1.000 55.91939  ? 107 TYR A CA  1 
ATOM   4111  C C   . TYR B  1 127 ? -43.78409 -35.78434  42.02410  1.000 63.82957  ? 107 TYR A C   1 
ATOM   4112  O O   . TYR B  1 127 ? -43.31896 -34.76449  41.50790  1.000 67.84222  ? 107 TYR A O   1 
ATOM   4113  C CB  . TYR B  1 127 ? -43.52630 -36.15397  44.47058  1.000 51.42320  ? 107 TYR A CB  1 
ATOM   4114  C CG  . TYR B  1 127 ? -42.91038 -36.86282  45.66253  1.000 53.16090  ? 107 TYR A CG  1 
ATOM   4115  C CD1 . TYR B  1 127 ? -42.40673 -36.13673  46.73126  1.000 48.59707  ? 107 TYR A CD1 1 
ATOM   4116  C CD2 . TYR B  1 127 ? -42.86231 -38.24931  45.73594  1.000 57.72263  ? 107 TYR A CD2 1 
ATOM   4117  C CE1 . TYR B  1 127 ? -41.85449 -36.76194  47.82962  1.000 47.33475  ? 107 TYR A CE1 1 
ATOM   4118  C CE2 . TYR B  1 127 ? -42.30848 -38.88649  46.83539  1.000 55.76037  ? 107 TYR A CE2 1 
ATOM   4119  C CZ  . TYR B  1 127 ? -41.80617 -38.13330  47.87865  1.000 55.32084  ? 107 TYR A CZ  1 
ATOM   4120  O OH  . TYR B  1 127 ? -41.25365 -38.74633  48.98037  1.000 56.11167  ? 107 TYR A OH  1 
ATOM   4121  N N   . GLU B  1 128 ? -44.98523 -36.26561  41.71131  1.000 60.43036  ? 108 GLU A N   1 
ATOM   4122  C CA  . GLU B  1 128 ? -45.83510 -35.59751  40.73510  1.000 61.05765  ? 108 GLU A CA  1 
ATOM   4123  C C   . GLU B  1 128 ? -46.78108 -34.57309  41.35334  1.000 59.92407  ? 108 GLU A C   1 
ATOM   4124  O O   . GLU B  1 128 ? -47.40770 -33.81648  40.60497  1.000 56.34065  ? 108 GLU A O   1 
ATOM   4125  C CB  . GLU B  1 128 ? -46.65177 -36.62834  39.94106  1.000 59.72722  ? 108 GLU A CB  1 
ATOM   4126  C CG  . GLU B  1 128 ? -45.88551 -37.34237  38.82932  1.000 73.08120  ? 108 GLU A CG  1 
ATOM   4127  C CD  . GLU B  1 128 ? -45.23680 -36.38592  37.83493  1.000 81.23988  ? 108 GLU A CD  1 
ATOM   4128  O OE1 . GLU B  1 128 ? -43.99587 -36.42155  37.69400  1.000 82.75827  ? 108 GLU A OE1 1 
ATOM   4129  O OE2 . GLU B  1 128 ? -45.96526 -35.60112  37.18953  1.000 80.73217  ? 108 GLU A OE2 1 
ATOM   4130  N N   . GLY B  1 129 ? -46.90808 -34.53343  42.67482  1.000 52.70960  ? 109 GLY A N   1 
ATOM   4131  C CA  . GLY B  1 129 ? -47.77852 -33.56961  43.32453  1.000 48.60201  ? 109 GLY A CA  1 
ATOM   4132  C C   . GLY B  1 129 ? -48.12341 -33.98302  44.74137  1.000 52.95317  ? 109 GLY A C   1 
ATOM   4133  O O   . GLY B  1 129 ? -47.66168 -35.00934  45.24537  1.000 58.66342  ? 109 GLY A O   1 
ATOM   4134  N N   . THR B  1 130 ? -48.95925 -33.15496  45.37651  1.000 54.41325  ? 110 THR A N   1 
ATOM   4135  C CA  . THR B  1 130 ? -49.31431 -33.38100  46.78034  1.000 53.59352  ? 110 THR A CA  1 
ATOM   4136  C C   . THR B  1 130 ? -49.75583 -34.81779  47.02800  1.000 60.87503  ? 110 THR A C   1 
ATOM   4137  O O   . THR B  1 130 ? -49.43361 -35.40571  48.06895  1.000 62.80894  ? 110 THR A O   1 
ATOM   4138  C CB  . THR B  1 130 ? -50.44861 -32.43621  47.22308  1.000 45.04852  ? 110 THR A CB  1 
ATOM   4139  O OG1 . THR B  1 130 ? -51.52113 -32.48588  46.28330  1.000 55.19432  ? 110 THR A OG1 1 
ATOM   4140  C CG2 . THR B  1 130 ? -49.96533 -30.99312  47.32800  1.000 38.85276  ? 110 THR A CG2 1 
ATOM   4141  N N   . ALA B  1 131 ? -50.54240 -35.37825  46.10445  1.000 43.12592  ? 111 ALA A N   1 
ATOM   4142  C CA  . ALA B  1 131 ? -51.08755 -36.70879  46.32234  1.000 53.03008  ? 111 ALA A CA  1 
ATOM   4143  C C   . ALA B  1 131 ? -50.05264 -37.78778  46.04359  1.000 49.95187  ? 111 ALA A C   1 
ATOM   4144  O O   . ALA B  1 131 ? -50.01015 -38.80040  46.74784  1.000 44.77196  ? 111 ALA A O   1 
ATOM   4145  C CB  . ALA B  1 131 ? -52.32122 -36.93163  45.45360  1.000 64.18648  ? 111 ALA A CB  1 
ATOM   4146  N N   . ASP B  1 132 ? -49.22566 -37.59491  45.01025  1.000 47.33107  ? 112 ASP A N   1 
ATOM   4147  C CA  . ASP B  1 132 ? -48.17048 -38.55753  44.71221  1.000 53.27613  ? 112 ASP A CA  1 
ATOM   4148  C C   . ASP B  1 132 ? -47.14499 -38.62537  45.83355  1.000 50.03499  ? 112 ASP A C   1 
ATOM   4149  O O   . ASP B  1 132 ? -46.49762 -39.66101  46.02253  1.000 48.84230  ? 112 ASP A O   1 
ATOM   4150  C CB  . ASP B  1 132 ? -47.49169 -38.19434  43.39208  1.000 52.22431  ? 112 ASP A CB  1 
ATOM   4151  C CG  . ASP B  1 132 ? -46.60678 -39.29888  42.87633  1.000 55.15245  ? 112 ASP A CG  1 
ATOM   4152  O OD1 . ASP B  1 132 ? -47.07395 -40.45273  42.83939  1.000 56.18739  ? 112 ASP A OD1 1 
ATOM   4153  O OD2 . ASP B  1 132 ? -45.44807 -39.01989  42.50536  1.000 59.75661  ? 112 ASP A OD2 1 
ATOM   4154  N N   . ALA B  1 133 ? -46.98649 -37.53610  46.58644  1.000 49.76613  ? 113 ALA A N   1 
ATOM   4155  C CA  . ALA B  1 133 ? -46.06875 -37.54786  47.71873  1.000 48.68317  ? 113 ALA A CA  1 
ATOM   4156  C C   . ALA B  1 133 ? -46.51175 -38.54204  48.78339  1.000 42.61289  ? 113 ALA A C   1 
ATOM   4157  O O   . ALA B  1 133 ? -45.67130 -39.11624  49.48545  1.000 42.66954  ? 113 ALA A O   1 
ATOM   4158  C CB  . ALA B  1 133 ? -45.94836 -36.14092  48.30854  1.000 41.73132  ? 113 ALA A CB  1 
ATOM   4159  N N   . VAL B  1 134 ? -47.81834 -38.75544  48.92176  1.000 41.77035  ? 114 VAL A N   1 
ATOM   4160  C CA  . VAL B  1 134 ? -48.31396 -39.77032  49.84283  1.000 41.03945  ? 114 VAL A CA  1 
ATOM   4161  C C   . VAL B  1 134 ? -48.42370 -41.13082  49.15730  1.000 44.93982  ? 114 VAL A C   1 
ATOM   4162  O O   . VAL B  1 134 ? -48.19851 -42.16444  49.79565  1.000 43.86216  ? 114 VAL A O   1 
ATOM   4163  C CB  . VAL B  1 134 ? -49.66453 -39.33641  50.43753  1.000 42.96564  ? 114 VAL A CB  1 
ATOM   4164  C CG1 . VAL B  1 134 ? -50.01861 -40.19388  51.63086  1.000 38.23799  ? 114 VAL A CG1 1 
ATOM   4165  C CG2 . VAL B  1 134 ? -49.61623 -37.87159  50.84244  1.000 47.87222  ? 114 VAL A CG2 1 
ATOM   4166  N N   . TYR B  1 135 ? -48.73965 -41.14370  47.85923  1.000 45.65484  ? 115 TYR A N   1 
ATOM   4167  C CA  . TYR B  1 135 ? -48.90321 -42.39787  47.13338  1.000 51.93533  ? 115 TYR A CA  1 
ATOM   4168  C C   . TYR B  1 135 ? -47.59679 -43.18082  47.06557  1.000 50.29762  ? 115 TYR A C   1 
ATOM   4169  O O   . TYR B  1 135 ? -47.56259 -44.38128  47.34451  1.000 51.45988  ? 115 TYR A O   1 
ATOM   4170  C CB  . TYR B  1 135 ? -49.42683 -42.12712  45.72205  1.000 50.59259  ? 115 TYR A CB  1 
ATOM   4171  C CG  . TYR B  1 135 ? -49.39255 -43.35771  44.84421  1.000 54.01382  ? 115 TYR A CG  1 
ATOM   4172  C CD1 . TYR B  1 135 ? -48.39906 -43.53195  43.88997  1.000 56.84628  ? 115 TYR A CD1 1 
ATOM   4173  C CD2 . TYR B  1 135 ? -50.35292 -44.34872  44.97620  1.000 54.72652  ? 115 TYR A CD2 1 
ATOM   4174  C CE1 . TYR B  1 135 ? -48.36741 -44.66162  43.09384  1.000 60.30663  ? 115 TYR A CE1 1 
ATOM   4175  C CE2 . TYR B  1 135 ? -50.32814 -45.47999  44.19215  1.000 58.07638  ? 115 TYR A CE2 1 
ATOM   4176  C CZ  . TYR B  1 135 ? -49.33690 -45.63357  43.25147  1.000 62.24452  ? 115 TYR A CZ  1 
ATOM   4177  O OH  . TYR B  1 135 ? -49.32448 -46.76580  42.46780  1.000 64.53392  ? 115 TYR A OH  1 
ATOM   4178  N N   A GLN B  1 136 ? -46.50830 -42.51513  46.68085  0.636 50.95183  ? 116 GLN A N   1 
ATOM   4179  N N   B GLN B  1 136 ? -46.50639 -42.51688  46.68659  0.364 50.94449  ? 116 GLN A N   1 
ATOM   4180  C CA  A GLN B  1 136 ? -45.23525 -43.20780  46.53241  0.636 53.31453  ? 116 GLN A CA  1 
ATOM   4181  C CA  B GLN B  1 136 ? -45.24472 -43.22786  46.52757  0.364 53.34269  ? 116 GLN A CA  1 
ATOM   4182  C C   A GLN B  1 136 ? -44.73562 -43.80595  47.84133  0.636 53.40610  ? 116 GLN A C   1 
ATOM   4183  C C   B GLN B  1 136 ? -44.72132 -43.79601  47.84216  0.364 53.81905  ? 116 GLN A C   1 
ATOM   4184  O O   A GLN B  1 136 ? -43.90209 -44.71876  47.81347  0.636 54.49001  ? 116 GLN A O   1 
ATOM   4185  O O   B GLN B  1 136 ? -43.86133 -44.68381  47.81937  0.364 54.47394  ? 116 GLN A O   1 
ATOM   4186  C CB  A GLN B  1 136 ? -44.18466 -42.25045  45.97182  0.636 54.24205  ? 116 GLN A CB  1 
ATOM   4187  C CB  B GLN B  1 136 ? -44.20142 -42.30088  45.90538  0.364 54.42669  ? 116 GLN A CB  1 
ATOM   4188  C CG  A GLN B  1 136 ? -44.50173 -41.70633  44.59148  0.636 56.09345  ? 116 GLN A CG  1 
ATOM   4189  C CG  B GLN B  1 136 ? -43.43345 -42.91932  44.75039  0.364 59.44971  ? 116 GLN A CG  1 
ATOM   4190  C CD  A GLN B  1 136 ? -44.58175 -42.78751  43.53934  0.636 59.82129  ? 116 GLN A CD  1 
ATOM   4191  C CD  B GLN B  1 136 ? -42.17088 -42.15053  44.41415  0.364 60.04532  ? 116 GLN A CD  1 
ATOM   4192  O OE1 A GLN B  1 136 ? -43.93381 -43.83063  43.65053  0.636 67.72710  ? 116 GLN A OE1 1 
ATOM   4193  O OE1 B GLN B  1 136 ? -41.05917 -42.64296  44.60958  0.364 63.80443  ? 116 GLN A OE1 1 
ATOM   4194  N NE2 A GLN B  1 136 ? -45.37651 -42.54476  42.50428  0.636 61.09334  ? 116 GLN A NE2 1 
ATOM   4195  N NE2 B GLN B  1 136 ? -42.33604 -40.93766  43.90149  0.364 59.27743  ? 116 GLN A NE2 1 
ATOM   4196  N N   . ASN B  1 137 ? -45.21817 -43.31657  48.98267  1.000 57.03297  ? 117 ASN A N   1 
ATOM   4197  C CA  . ASN B  1 137 ? -44.70522 -43.71957  50.28412  1.000 57.00919  ? 117 ASN A CA  1 
ATOM   4198  C C   . ASN B  1 137 ? -45.67532 -44.59555  51.05125  1.000 53.45507  ? 117 ASN A C   1 
ATOM   4199  O O   . ASN B  1 137 ? -45.47016 -44.81789  52.24629  1.000 68.38486  ? 117 ASN A O   1 
ATOM   4200  C CB  . ASN B  1 137 ? -44.34573 -42.48634  51.10721  1.000 45.30257  ? 117 ASN A CB  1 
ATOM   4201  C CG  . ASN B  1 137 ? -43.17835 -41.74490  50.52461  1.000 46.55173  ? 117 ASN A CG  1 
ATOM   4202  O OD1 . ASN B  1 137 ? -42.05044 -42.24080  50.53932  1.000 48.61569  ? 117 ASN A OD1 1 
ATOM   4203  N ND2 . ASN B  1 137 ? -43.43461 -40.55679  49.99349  1.000 45.64114  ? 117 ASN A ND2 1 
ATOM   4204  N N   . ILE B  1 138 ? -46.70666 -45.11350  50.38150  1.000 51.72132  ? 118 ILE A N   1 
ATOM   4205  C CA  . ILE B  1 138 ? -47.73810 -45.93780  51.01146  1.000 57.38943  ? 118 ILE A CA  1 
ATOM   4206  C C   . ILE B  1 138 ? -47.13259 -47.11887  51.77055  1.000 51.02963  ? 118 ILE A C   1 
ATOM   4207  O O   . ILE B  1 138 ? -47.66116 -47.54187  52.80759  1.000 47.48561  ? 118 ILE A O   1 
ATOM   4208  C CB  . ILE B  1 138 ? -48.73380 -46.40277  49.92717  1.000 62.80202  ? 118 ILE A CB  1 
ATOM   4209  C CG1 . ILE B  1 138 ? -49.50189 -45.17913  49.40065  1.000 62.36101  ? 118 ILE A CG1 1 
ATOM   4210  C CG2 . ILE B  1 138 ? -49.67847 -47.44382  50.47190  1.000 51.76332  ? 118 ILE A CG2 1 
ATOM   4211  C CD1 . ILE B  1 138 ? -50.29816 -45.41118  48.13776  1.000 59.09350  ? 118 ILE A CD1 1 
ATOM   4212  N N   . ASP B  1 139 ? -45.99950 -47.64710  51.29726  1.000 51.12123  ? 119 ASP A N   1 
ATOM   4213  C CA  . ASP B  1 139 ? -45.35511 -48.74713  52.00727  1.000 56.20144  ? 119 ASP A CA  1 
ATOM   4214  C C   . ASP B  1 139 ? -44.71028 -48.31142  53.31519  1.000 53.42409  ? 119 ASP A C   1 
ATOM   4215  O O   . ASP B  1 139 ? -44.17754 -49.17268  54.02725  1.000 51.93888  ? 119 ASP A O   1 
ATOM   4216  C CB  . ASP B  1 139 ? -44.31816 -49.42935  51.10830  1.000 56.33941  ? 119 ASP A CB  1 
ATOM   4217  C CG  . ASP B  1 139 ? -43.30847 -48.45700  50.53949  1.000 58.07477  ? 119 ASP A CG  1 
ATOM   4218  O OD1 . ASP B  1 139 ? -43.41194 -47.24840  50.83273  1.000 53.97308  ? 119 ASP A OD1 1 
ATOM   4219  O OD2 . ASP B  1 139 ? -42.41641 -48.91470  49.79295  1.000 61.87675  ? 119 ASP A OD2 1 
ATOM   4220  N N   . ILE B  1 140 ? -44.74886 -47.02322  53.65292  1.000 56.17832  ? 120 ILE A N   1 
ATOM   4221  C CA  . ILE B  1 140 ? -44.28536 -46.54387  54.95297  1.000 52.43892  ? 120 ILE A CA  1 
ATOM   4222  C C   . ILE B  1 140 ? -45.43731 -46.45273  55.94700  1.000 57.47037  ? 120 ILE A C   1 
ATOM   4223  O O   . ILE B  1 140 ? -45.28742 -46.82370  57.11219  1.000 60.21746  ? 120 ILE A O   1 
ATOM   4224  C CB  . ILE B  1 140 ? -43.57536 -45.18040  54.80052  1.000 51.80601  ? 120 ILE A CB  1 
ATOM   4225  C CG1 . ILE B  1 140 ? -42.53503 -45.23010  53.67836  1.000 49.72986  ? 120 ILE A CG1 1 
ATOM   4226  C CG2 . ILE B  1 140 ? -42.94096 -44.74170  56.12019  1.000 43.79906  ? 120 ILE A CG2 1 
ATOM   4227  C CD1 . ILE B  1 140 ? -41.17537 -45.71965  54.12042  1.000 49.92876  ? 120 ILE A CD1 1 
ATOM   4228  N N   . ILE B  1 141 ? -46.58861 -45.93667  55.51296  1.000 65.57621  ? 121 ILE A N   1 
ATOM   4229  C CA  . ILE B  1 141 ? -47.76618 -45.91376  56.37382  1.000 53.32793  ? 121 ILE A CA  1 
ATOM   4230  C C   . ILE B  1 141 ? -48.28470 -47.33078  56.57780  1.000 52.64524  ? 121 ILE A C   1 
ATOM   4231  O O   . ILE B  1 141 ? -48.85353 -47.65292  57.62945  1.000 47.18406  ? 121 ILE A O   1 
ATOM   4232  C CB  . ILE B  1 141 ? -48.84136 -44.97529  55.77985  1.000 39.52379  ? 121 ILE A CB  1 
ATOM   4233  C CG1 . ILE B  1 141 ? -48.31325 -43.54147  55.69833  1.000 41.43263  ? 121 ILE A CG1 1 
ATOM   4234  C CG2 . ILE B  1 141 ? -50.10798 -44.98120  56.60940  1.000 40.86390  ? 121 ILE A CG2 1 
ATOM   4235  C CD1 . ILE B  1 141 ? -48.74409 -42.79765  54.43969  1.000 42.39777  ? 121 ILE A CD1 1 
ATOM   4236  N N   . GLU B  1 142 ? -48.05545 -48.21225  55.58855  1.000 62.91757  ? 122 GLU A N   1 
ATOM   4237  C CA  . GLU B  1 142 ? -48.51653 -49.60254  55.57803  1.000 55.54123  ? 122 GLU A CA  1 
ATOM   4238  C C   . GLU B  1 142 ? -48.26548 -50.26485  56.93264  1.000 48.94361  ? 122 GLU A C   1 
ATOM   4239  O O   . GLU B  1 142 ? -49.23430 -50.58698  57.63674  1.000 48.91977  ? 122 GLU A O   1 
ATOM   4240  C CB  . GLU B  1 142 ? -47.85390 -50.39204  54.44020  1.000 64.24206  ? 122 GLU A CB  1 
ATOM   4241  C CG  . GLU B  1 142 ? -48.69242 -51.47734  53.76810  1.000 79.58678  ? 122 GLU A CG  1 
ATOM   4242  C CD  . GLU B  1 142 ? -48.81327 -52.73094  54.62689  1.000 83.14238  ? 122 GLU A CD  1 
ATOM   4243  O OE1 . GLU B  1 142 ? -47.79576 -53.13130  55.23032  1.000 82.02191  ? 122 GLU A OE1 1 
ATOM   4244  O OE2 . GLU B  1 142 ? -49.92225 -53.30548  54.71871  1.000 80.60842  ? 122 GLU A OE2 1 
ATOM   4245  N N   . PRO B  1 143 ? -47.00919 -50.45105  57.36058  1.000 48.59149  ? 123 PRO A N   1 
ATOM   4246  C CA  . PRO B  1 143 ? -46.76196 -51.22304  58.58849  1.000 55.68565  ? 123 PRO A CA  1 
ATOM   4247  C C   . PRO B  1 143 ? -47.09890 -50.48474  59.88045  1.000 51.23681  ? 123 PRO A C   1 
ATOM   4248  O O   . PRO B  1 143 ? -47.06413 -51.10891  60.94834  1.000 60.94010  ? 123 PRO A O   1 
ATOM   4249  C CB  . PRO B  1 143 ? -45.24541 -51.52265  58.51269  1.000 57.25901  ? 123 PRO A CB  1 
ATOM   4250  C CG  . PRO B  1 143 ? -44.78717 -51.03609  57.14834  1.000 59.46776  ? 123 PRO A CG  1 
ATOM   4251  C CD  . PRO B  1 143 ? -45.73916 -49.93140  56.82472  1.000 55.59688  ? 123 PRO A CD  1 
ATOM   4252  N N   . TYR B  1 144 ? -47.40066 -49.18673  59.83472  1.000 49.73786  ? 124 TYR A N   1 
ATOM   4253  C CA  . TYR B  1 144 ? -47.86496 -48.50041  61.03936  1.000 52.75559  ? 124 TYR A CA  1 
ATOM   4254  C C   . TYR B  1 144 ? -49.33577 -48.77865  61.31637  1.000 45.87003  ? 124 TYR A C   1 
ATOM   4255  O O   . TYR B  1 144 ? -49.75882 -48.76552  62.47797  1.000 40.63710  ? 124 TYR A O   1 
ATOM   4256  C CB  . TYR B  1 144 ? -47.64384 -46.99206  60.91245  1.000 39.40535  ? 124 TYR A CB  1 
ATOM   4257  C CG  . TYR B  1 144 ? -46.19429 -46.58646  60.84651  1.000 39.81598  ? 124 TYR A CG  1 
ATOM   4258  C CD1 . TYR B  1 144 ? -45.77304 -45.60486  59.96347  1.000 39.15748  ? 124 TYR A CD1 1 
ATOM   4259  C CD2 . TYR B  1 144 ? -45.24455 -47.18998  61.66020  1.000 41.19602  ? 124 TYR A CD2 1 
ATOM   4260  C CE1 . TYR B  1 144 ? -44.45406 -45.22978  59.89427  1.000 39.86144  ? 124 TYR A CE1 1 
ATOM   4261  C CE2 . TYR B  1 144 ? -43.91588 -46.81803  61.59761  1.000 41.96466  ? 124 TYR A CE2 1 
ATOM   4262  C CZ  . TYR B  1 144 ? -43.52956 -45.83401  60.71117  1.000 41.50021  ? 124 TYR A CZ  1 
ATOM   4263  O OH  . TYR B  1 144 ? -42.21442 -45.45177  60.63283  1.000 46.99353  ? 124 TYR A OH  1 
ATOM   4264  N N   . ALA B  1 145 ? -50.11481 -49.02365  60.26548  1.000 43.84047  ? 125 ALA A N   1 
ATOM   4265  C CA  . ALA B  1 145 ? -51.54850 -49.26563  60.36334  1.000 50.34580  ? 125 ALA A CA  1 
ATOM   4266  C C   . ALA B  1 145 ? -52.28510 -48.21247  61.19886  1.000 45.74560  ? 125 ALA A C   1 
ATOM   4267  O O   . ALA B  1 145 ? -53.01185 -48.55293  62.13455  1.000 42.16960  ? 125 ALA A O   1 
ATOM   4268  C CB  . ALA B  1 145 ? -51.81724 -50.65881  60.91516  1.000 43.96183  ? 125 ALA A CB  1 
ATOM   4269  N N   . PRO B  1 146 ? -52.12782 -46.92922  60.88448  1.000 38.02448  ? 126 PRO A N   1 
ATOM   4270  C CA  . PRO B  1 146 ? -52.89526 -45.92080  61.61497  1.000 42.80048  ? 126 PRO A CA  1 
ATOM   4271  C C   . PRO B  1 146 ? -54.34450 -45.92969  61.15974  1.000 43.20923  ? 126 PRO A C   1 
ATOM   4272  O O   . PRO B  1 146 ? -54.65450 -46.21103  59.99993  1.000 37.88748  ? 126 PRO A O   1 
ATOM   4273  C CB  . PRO B  1 146 ? -52.19599 -44.60721  61.25097  1.000 45.89919  ? 126 PRO A CB  1 
ATOM   4274  C CG  . PRO B  1 146 ? -51.64757 -44.85054  59.89283  1.000 45.69955  ? 126 PRO A CG  1 
ATOM   4275  C CD  . PRO B  1 146 ? -51.35440 -46.33025  59.77988  1.000 37.72648  ? 126 PRO A CD  1 
ATOM   4276  N N   . GLU B  1 147 ? -55.24403 -45.64841  62.10225  1.000 43.18494  ? 127 GLU A N   1 
ATOM   4277  C CA  . GLU B  1 147 ? -56.65111 -45.51529  61.74129  1.000 45.13057  ? 127 GLU A CA  1 
ATOM   4278  C C   . GLU B  1 147 ? -56.88228 -44.27388  60.88603  1.000 36.29176  ? 127 GLU A C   1 
ATOM   4279  O O   . GLU B  1 147 ? -57.65590 -44.30944  59.92289  1.000 37.28835  ? 127 GLU A O   1 
ATOM   4280  C CB  . GLU B  1 147 ? -57.51529 -45.46773  63.00328  1.000 49.08224  ? 127 GLU A CB  1 
ATOM   4281  C CG  . GLU B  1 147 ? -58.09767 -46.81271  63.43204  1.000 60.80692  ? 127 GLU A CG  1 
ATOM   4282  C CD  . GLU B  1 147 ? -59.26942 -47.25463  62.56887  1.000 66.99345  ? 127 GLU A CD  1 
ATOM   4283  O OE1 . GLU B  1 147 ? -59.03175 -47.77811  61.45914  1.000 66.04605  ? 127 GLU A OE1 1 
ATOM   4284  O OE2 . GLU B  1 147 ? -60.43007 -47.08009  62.99974  1.000 67.57346  ? 127 GLU A OE2 1 
ATOM   4285  N N   . TYR B  1 148 ? -56.20757 -43.17443  61.20519  1.000 35.01555  ? 128 TYR A N   1 
ATOM   4286  C CA  . TYR B  1 148 ? -56.47957 -41.89052  60.57387  1.000 34.72510  ? 128 TYR A CA  1 
ATOM   4287  C C   . TYR B  1 148 ? -55.19785 -41.26909  60.05213  1.000 32.47842  ? 128 TYR A C   1 
ATOM   4288  O O   . TYR B  1 148 ? -54.14535 -41.35302  60.69180  1.000 37.29204  ? 128 TYR A O   1 
ATOM   4289  C CB  . TYR B  1 148 ? -57.15602 -40.93074  61.55221  1.000 32.96625  ? 128 TYR A CB  1 
ATOM   4290  C CG  . TYR B  1 148 ? -58.20209 -41.61069  62.39278  1.000 34.30306  ? 128 TYR A CG  1 
ATOM   4291  C CD1 . TYR B  1 148 ? -59.37956 -42.06839  61.82236  1.000 36.00056  ? 128 TYR A CD1 1 
ATOM   4292  C CD2 . TYR B  1 148 ? -58.00131 -41.82777  63.74829  1.000 37.16327  ? 128 TYR A CD2 1 
ATOM   4293  C CE1 . TYR B  1 148 ? -60.33904 -42.70608  62.57800  1.000 41.99055  ? 128 TYR A CE1 1 
ATOM   4294  C CE2 . TYR B  1 148 ? -58.95920 -42.46872  64.51685  1.000 41.62035  ? 128 TYR A CE2 1 
ATOM   4295  C CZ  . TYR B  1 148 ? -60.12635 -42.90410  63.92336  1.000 41.78323  ? 128 TYR A CZ  1 
ATOM   4296  O OH  . TYR B  1 148 ? -61.08675 -43.54090  64.67376  1.000 50.85901  ? 128 TYR A OH  1 
ATOM   4297  N N   . MET B  1 149 ? -55.29700 -40.65980  58.87921  1.000 32.54014  ? 129 MET A N   1 
ATOM   4298  C CA  . MET B  1 149 ? -54.25254 -39.80042  58.34985  1.000 32.98000  ? 129 MET A CA  1 
ATOM   4299  C C   . MET B  1 149 ? -54.66650 -38.34607  58.53126  1.000 31.86864  ? 129 MET A C   1 
ATOM   4300  O O   . MET B  1 149 ? -55.82564 -37.98722  58.29671  1.000 32.71328  ? 129 MET A O   1 
ATOM   4301  C CB  . MET B  1 149 ? -54.00799 -40.08843  56.86802  1.000 35.58224  ? 129 MET A CB  1 
ATOM   4302  C CG  . MET B  1 149 ? -53.57027 -41.50944  56.55918  1.000 40.36483  ? 129 MET A CG  1 
ATOM   4303  S SD  . MET B  1 149 ? -52.16403 -41.98904  57.56270  1.000 45.37320  ? 129 MET A SD  1 
ATOM   4304  C CE  . MET B  1 149 ? -50.84444 -41.11437  56.73622  1.000 35.11580  ? 129 MET A CE  1 
ATOM   4305  N N   . VAL B  1 150 ? -53.71937 -37.51440  58.94760  1.000 37.69834  ? 130 VAL A N   1 
ATOM   4306  C CA  . VAL B  1 150 ? -53.92911 -36.07931  59.08208  1.000 29.13584  ? 130 VAL A CA  1 
ATOM   4307  C C   . VAL B  1 150 ? -52.96402 -35.41790  58.10961  1.000 37.12851  ? 130 VAL A C   1 
ATOM   4308  O O   . VAL B  1 150 ? -51.76319 -35.30378  58.39006  1.000 37.37404  ? 130 VAL A O   1 
ATOM   4309  C CB  . VAL B  1 150 ? -53.70644 -35.58390  60.51531  1.000 27.56639  ? 130 VAL A CB  1 
ATOM   4310  C CG1 . VAL B  1 150 ? -53.67743 -34.05708  60.55563  1.000 29.92880  ? 130 VAL A CG1 1 
ATOM   4311  C CG2 . VAL B  1 150 ? -54.78812 -36.10995  61.43319  1.000 28.09994  ? 130 VAL A CG2 1 
ATOM   4312  N N   . ILE B  1 151 ? -53.47800 -34.99227  56.95842  1.000 29.04705  ? 131 ILE A N   1 
ATOM   4313  C CA  . ILE B  1 151 ? -52.65314 -34.35059  55.94070  1.000 29.27318  ? 131 ILE A CA  1 
ATOM   4314  C C   . ILE B  1 151 ? -52.54911 -32.86671  56.26432  1.000 35.64777  ? 131 ILE A C   1 
ATOM   4315  O O   . ILE B  1 151 ? -53.56821 -32.19025  56.45303  1.000 38.52024  ? 131 ILE A O   1 
ATOM   4316  C CB  . ILE B  1 151 ? -53.24560 -34.57767  54.54115  1.000 30.79918  ? 131 ILE A CB  1 
ATOM   4317  C CG1 . ILE B  1 151 ? -53.50057 -36.07193  54.29172  1.000 33.24848  ? 131 ILE A CG1 1 
ATOM   4318  C CG2 . ILE B  1 151 ? -52.32995 -34.00031  53.46479  1.000 31.40393  ? 131 ILE A CG2 1 
ATOM   4319  C CD1 . ILE B  1 151 ? -52.27009 -36.95734  54.44551  1.000 32.04451  ? 131 ILE A CD1 1 
ATOM   4320  N N   . LEU B  1 152 ? -51.32000 -32.35425  56.32409  1.000 34.80807  ? 132 LEU A N   1 
ATOM   4321  C CA  . LEU B  1 152 ? -51.06153 -30.97557  56.71634  1.000 27.29624  ? 132 LEU A CA  1 
ATOM   4322  C C   . LEU B  1 152 ? -50.17519 -30.28815  55.69291  1.000 31.22836  ? 132 LEU A C   1 
ATOM   4323  O O   . LEU B  1 152 ? -49.20711 -30.87389  55.20395  1.000 34.05612  ? 132 LEU A O   1 
ATOM   4324  C CB  . LEU B  1 152 ? -50.38004 -30.90001  58.08470  1.000 26.34535  ? 132 LEU A CB  1 
ATOM   4325  C CG  . LEU B  1 152 ? -51.13629 -31.55186  59.23596  1.000 25.94077  ? 132 LEU A CG  1 
ATOM   4326  C CD1 . LEU B  1 152 ? -50.29042 -31.53749  60.51198  1.000 25.37107  ? 132 LEU A CD1 1 
ATOM   4327  C CD2 . LEU B  1 152 ? -52.45945 -30.83091  59.43372  1.000 26.02579  ? 132 LEU A CD2 1 
ATOM   4328  N N   . ALA B  1 153 ? -50.50558 -29.04124  55.37852  1.000 35.84948  ? 133 ALA A N   1 
ATOM   4329  C CA  . ALA B  1 153 ? -49.57741 -28.19470  54.64526  1.000 38.40842  ? 133 ALA A CA  1 
ATOM   4330  C C   . ALA B  1 153 ? -48.46099 -27.75642  55.58101  1.000 33.53262  ? 133 ALA A C   1 
ATOM   4331  O O   . ALA B  1 153 ? -48.71991 -27.32042  56.70530  1.000 29.48548  ? 133 ALA A O   1 
ATOM   4332  C CB  . ALA B  1 153 ? -50.29924 -26.97765  54.07458  1.000 30.40970  ? 133 ALA A CB  1 
ATOM   4333  N N   . GLY B  1 154 ? -47.21918 -27.87162  55.12981  1.000 38.20678  ? 134 GLY A N   1 
ATOM   4334  C CA  . GLY B  1 154 ? -46.11901 -27.53881  56.01152  1.000 34.20906  ? 134 GLY A CA  1 
ATOM   4335  C C   . GLY B  1 154 ? -45.58036 -26.13482  55.84418  1.000 28.95869  ? 134 GLY A C   1 
ATOM   4336  O O   . GLY B  1 154 ? -44.46645 -25.84508  56.29024  1.000 31.10571  ? 134 GLY A O   1 
ATOM   4337  N N   . ASP B  1 155 ? -46.34892 -25.24881  55.21150  1.000 29.22917  ? 135 ASP A N   1 
ATOM   4338  C CA  . ASP B  1 155 ? -45.85686 -23.91460  54.88552  1.000 30.04512  ? 135 ASP A CA  1 
ATOM   4339  C C   . ASP B  1 155 ? -46.73641 -22.80501  55.46310  1.000 31.21220  ? 135 ASP A C   1 
ATOM   4340  O O   . ASP B  1 155 ? -46.76984 -21.69212  54.93339  1.000 46.13805  ? 135 ASP A O   1 
ATOM   4341  C CB  . ASP B  1 155 ? -45.70484 -23.75996  53.37280  1.000 31.64687  ? 135 ASP A CB  1 
ATOM   4342  C CG  . ASP B  1 155 ? -47.03349 -23.63278  52.65787  1.000 40.38379  ? 135 ASP A CG  1 
ATOM   4343  O OD1 . ASP B  1 155 ? -47.93877 -24.45285  52.92140  1.000 41.08953  ? 135 ASP A OD1 1 
ATOM   4344  O OD2 . ASP B  1 155 ? -47.16851 -22.70740  51.82866  1.000 42.26047  ? 135 ASP A OD2 1 
ATOM   4345  N N   . HIS B  1 156 ? -47.43212 -23.07924  56.56578  1.000 31.89778  ? 136 HIS A N   1 
ATOM   4346  C CA  . HIS B  1 156 ? -48.26928 -22.08768  57.22814  1.000 28.34163  ? 136 HIS A CA  1 
ATOM   4347  C C   . HIS B  1 156 ? -47.87108 -21.96999  58.69244  1.000 31.21237  ? 136 HIS A C   1 
ATOM   4348  O O   . HIS B  1 156 ? -47.38533 -22.92714  59.29913  1.000 26.96395  ? 136 HIS A O   1 
ATOM   4349  C CB  . HIS B  1 156 ? -49.75802 -22.44131  57.13438  1.000 28.10701  ? 136 HIS A CB  1 
ATOM   4350  C CG  . HIS B  1 156 ? -50.26726 -22.54927  55.73364  1.000 29.06592  ? 136 HIS A CG  1 
ATOM   4351  N ND1 . HIS B  1 156 ? -49.59150 -22.02489  54.65300  1.000 30.13462  ? 136 HIS A ND1 1 
ATOM   4352  C CD2 . HIS B  1 156 ? -51.38301 -23.13006  55.23403  1.000 29.42005  ? 136 HIS A CD2 1 
ATOM   4353  C CE1 . HIS B  1 156 ? -50.27468 -22.26946  53.54793  1.000 31.10013  ? 136 HIS A CE1 1 
ATOM   4354  N NE2 . HIS B  1 156 ? -51.36810 -22.93489  53.87332  1.000 30.69202  ? 136 HIS A NE2 1 
ATOM   4355  N N   . ILE B  1 157 ? -48.08285 -20.78043  59.25265  1.000 30.38849  ? 137 ILE A N   1 
ATOM   4356  C CA  . ILE B  1 157 ? -47.80714 -20.49288  60.65703  1.000 27.74893  ? 137 ILE A CA  1 
ATOM   4357  C C   . ILE B  1 157 ? -49.14624 -20.37183  61.37121  1.000 32.97347  ? 137 ILE A C   1 
ATOM   4358  O O   . ILE B  1 157 ? -49.95532 -19.49756  61.03759  1.000 37.66773  ? 137 ILE A O   1 
ATOM   4359  C CB  . ILE B  1 157 ? -46.96693 -19.21541  60.81470  1.000 28.72101  ? 137 ILE A CB  1 
ATOM   4360  C CG1 . ILE B  1 157 ? -45.62490 -19.38345  60.09967  1.000 34.35587  ? 137 ILE A CG1 1 
ATOM   4361  C CG2 . ILE B  1 157 ? -46.74382 -18.88215  62.29433  1.000 28.82372  ? 137 ILE A CG2 1 
ATOM   4362  C CD1 . ILE B  1 157 ? -45.07974 -18.10859  59.50988  1.000 31.68832  ? 137 ILE A CD1 1 
ATOM   4363  N N   . TYR B  1 158 ? -49.37924 -21.24220  62.35207  1.000 27.03472  ? 138 TYR A N   1 
ATOM   4364  C CA  . TYR B  1 158 ? -50.67809 -21.36065  63.01050  1.000 33.40684  ? 138 TYR A CA  1 
ATOM   4365  C C   . TYR B  1 158 ? -50.57767 -22.44699  64.07266  1.000 35.11780  ? 138 TYR A C   1 
ATOM   4366  O O   . TYR B  1 158 ? -49.73145 -23.34329  63.98998  1.000 27.90741  ? 138 TYR A O   1 
ATOM   4367  C CB  . TYR B  1 158 ? -51.79533 -21.70180  62.01194  1.000 27.38858  ? 138 TYR A CB  1 
ATOM   4368  C CG  . TYR B  1 158 ? -51.71299 -23.13075  61.52398  1.000 26.60125  ? 138 TYR A CG  1 
ATOM   4369  C CD1 . TYR B  1 158 ? -50.77504 -23.50479  60.56966  1.000 26.31621  ? 138 TYR A CD1 1 
ATOM   4370  C CD2 . TYR B  1 158 ? -52.54921 -24.11425  62.04284  1.000 26.44333  ? 138 TYR A CD2 1 
ATOM   4371  C CE1 . TYR B  1 158 ? -50.67973 -24.81407  60.13552  1.000 33.70184  ? 138 TYR A CE1 1 
ATOM   4372  C CE2 . TYR B  1 158 ? -52.46015 -25.43118  61.61229  1.000 27.98886  ? 138 TYR A CE2 1 
ATOM   4373  C CZ  . TYR B  1 158 ? -51.52649 -25.77153  60.65887  1.000 25.68121  ? 138 TYR A CZ  1 
ATOM   4374  O OH  . TYR B  1 158 ? -51.43555 -27.06909  60.22736  1.000 35.09926  ? 138 TYR A OH  1 
ATOM   4375  N N   . LYS B  1 159 ? -51.45932 -22.36210  65.06574  1.000 32.56023  ? 139 LYS A N   1 
ATOM   4376  C CA  . LYS B  1 159 ? -51.54329 -23.34260  66.13882  1.000 26.97467  ? 139 LYS A CA  1 
ATOM   4377  C C   . LYS B  1 159 ? -52.96078 -23.89353  66.19512  1.000 28.01892  ? 139 LYS A C   1 
ATOM   4378  O O   . LYS B  1 159 ? -53.93187 -23.13237  66.13949  1.000 28.41235  ? 139 LYS A O   1 
ATOM   4379  C CB  . LYS B  1 159 ? -51.15032 -22.72659  67.48690  1.000 27.75487  ? 139 LYS A CB  1 
ATOM   4380  C CG  . LYS B  1 159 ? -49.64617 -22.54249  67.66116  1.000 32.97370  ? 139 LYS A CG  1 
ATOM   4381  C CD  . LYS B  1 159 ? -49.32658 -21.61653  68.81223  1.000 28.73881  ? 139 LYS A CD  1 
ATOM   4382  C CE  . LYS B  1 159 ? -50.30499 -20.46116  68.87033  1.000 38.37704  ? 139 LYS A CE  1 
ATOM   4383  N NZ  . LYS B  1 159 ? -49.75092 -19.28592  69.59598  1.000 38.06877  ? 139 LYS A NZ  1 
ATOM   4384  N N   . MET B  1 160 ? -53.07841 -25.21564  66.31610  1.000 26.91343  ? 140 MET A N   1 
ATOM   4385  C CA  . MET B  1 160 ? -54.38539 -25.85259  66.20605  1.000 27.47577  ? 140 MET A CA  1 
ATOM   4386  C C   . MET B  1 160 ? -54.32488 -27.27169  66.76489  1.000 35.11000  ? 140 MET A C   1 
ATOM   4387  O O   . MET B  1 160 ? -53.37418 -28.00872  66.50348  1.000 31.54878  ? 140 MET A O   1 
ATOM   4388  C CB  . MET B  1 160 ? -54.86045 -25.86198  64.74801  1.000 29.94481  ? 140 MET A CB  1 
ATOM   4389  C CG  . MET B  1 160 ? -56.02593 -26.79724  64.52813  1.000 45.77758  ? 140 MET A CG  1 
ATOM   4390  S SD  . MET B  1 160 ? -56.91210 -26.62582  62.97403  1.000 90.61471  ? 140 MET A SD  1 
ATOM   4391  C CE  . MET B  1 160 ? -55.56825 -26.96538  61.89763  1.000 41.23782  ? 140 MET A CE  1 
ATOM   4392  N N   . ASP B  1 161 ? -55.35277 -27.63839  67.53220  1.000 30.89175  ? 141 ASP A N   1 
ATOM   4393  C CA  . ASP B  1 161 ? -55.43823 -28.93889  68.19629  1.000 28.43403  ? 141 ASP A CA  1 
ATOM   4394  C C   . ASP B  1 161 ? -56.19897 -29.89360  67.27361  1.000 33.16761  ? 141 ASP A C   1 
ATOM   4395  O O   . ASP B  1 161 ? -57.42304 -29.81039  67.15296  1.000 29.68402  ? 141 ASP A O   1 
ATOM   4396  C CB  . ASP B  1 161 ? -56.11414 -28.77707  69.55576  1.000 30.09977  ? 141 ASP A CB  1 
ATOM   4397  C CG  . ASP B  1 161 ? -56.18785 -30.07419  70.34598  1.000 35.38263  ? 141 ASP A CG  1 
ATOM   4398  O OD1 . ASP B  1 161 ? -55.77573 -31.13742  69.82088  1.000 29.94255  ? 141 ASP A OD1 1 
ATOM   4399  O OD2 . ASP B  1 161 ? -56.65833 -30.01166  71.50848  1.000 31.88736  ? 141 ASP A OD2 1 
ATOM   4400  N N   . TYR B  1 162 ? -55.47529 -30.81914  66.64054  1.000 28.38210  ? 142 TYR A N   1 
ATOM   4401  C CA  . TYR B  1 162 ? -56.09813 -31.67499  65.63415  1.000 29.25489  ? 142 TYR A CA  1 
ATOM   4402  C C   . TYR B  1 162 ? -57.04925 -32.70329  66.23059  1.000 36.39496  ? 142 TYR A C   1 
ATOM   4403  O O   . TYR B  1 162 ? -57.72982 -33.40646  65.47504  1.000 34.69405  ? 142 TYR A O   1 
ATOM   4404  C CB  . TYR B  1 162 ? -55.02995 -32.38816  64.80302  1.000 28.99469  ? 142 TYR A CB  1 
ATOM   4405  C CG  . TYR B  1 162 ? -54.05424 -31.46082  64.11505  1.000 28.27580  ? 142 TYR A CG  1 
ATOM   4406  C CD1 . TYR B  1 162 ? -54.49743 -30.36605  63.38297  1.000 31.04800  ? 142 TYR A CD1 1 
ATOM   4407  C CD2 . TYR B  1 162 ? -52.68851 -31.68652  64.18975  1.000 27.53554  ? 142 TYR A CD2 1 
ATOM   4408  C CE1 . TYR B  1 162 ? -53.60015 -29.51789  62.75115  1.000 27.87074  ? 142 TYR A CE1 1 
ATOM   4409  C CE2 . TYR B  1 162 ? -51.78866 -30.84862  63.56097  1.000 29.80437  ? 142 TYR A CE2 1 
ATOM   4410  C CZ  . TYR B  1 162 ? -52.24978 -29.76343  62.84176  1.000 30.34233  ? 142 TYR A CZ  1 
ATOM   4411  O OH  . TYR B  1 162 ? -51.34692 -28.93054  62.21768  1.000 30.33388  ? 142 TYR A OH  1 
ATOM   4412  N N   . GLU B  1 163 ? -57.11955 -32.80932  67.55702  1.000 34.46395  ? 143 GLU A N   1 
ATOM   4413  C CA  . GLU B  1 163 ? -58.06283 -33.74700  68.15110  1.000 35.43581  ? 143 GLU A CA  1 
ATOM   4414  C C   . GLU B  1 163 ? -59.49399 -33.37285  67.79285  1.000 37.09164  ? 143 GLU A C   1 
ATOM   4415  O O   . GLU B  1 163 ? -60.32807 -34.25219  67.54949  1.000 32.98299  ? 143 GLU A O   1 
ATOM   4416  C CB  . GLU B  1 163 ? -57.87163 -33.79911  69.66601  1.000 30.61624  ? 143 GLU A CB  1 
ATOM   4417  C CG  . GLU B  1 163 ? -58.54464 -34.99260  70.32442  1.000 39.61459  ? 143 GLU A CG  1 
ATOM   4418  C CD  . GLU B  1 163 ? -57.69362 -36.24340  70.25463  1.000 45.30241  ? 143 GLU A CD  1 
ATOM   4419  O OE1 . GLU B  1 163 ? -58.01871 -37.12878  69.43926  1.000 37.64036  ? 143 GLU A OE1 1 
ATOM   4420  O OE2 . GLU B  1 163 ? -56.69133 -36.32968  71.00353  1.000 57.91514  ? 143 GLU A OE2 1 
ATOM   4421  N N   . TYR B  1 164 ? -59.78478 -32.06932  67.71990  1.000 31.66137  ? 144 TYR A N   1 
ATOM   4422  C CA  . TYR B  1 164 ? -61.12610 -31.62443  67.35584  1.000 32.62928  ? 144 TYR A CA  1 
ATOM   4423  C C   . TYR B  1 164 ? -61.50550 -32.10024  65.95963  1.000 36.37673  ? 144 TYR A C   1 
ATOM   4424  O O   . TYR B  1 164 ? -62.59480 -32.64782  65.75384  1.000 41.95592  ? 144 TYR A O   1 
ATOM   4425  C CB  . TYR B  1 164 ? -61.21650 -30.10261  67.44162  1.000 42.63075  ? 144 TYR A CB  1 
ATOM   4426  C CG  . TYR B  1 164 ? -61.23011 -29.57576  68.85166  1.000 39.15589  ? 144 TYR A CG  1 
ATOM   4427  C CD1 . TYR B  1 164 ? -60.04392 -29.32997  69.53066  1.000 35.82029  ? 144 TYR A CD1 1 
ATOM   4428  C CD2 . TYR B  1 164 ? -62.42751 -29.33007  69.50971  1.000 38.52632  ? 144 TYR A CD2 1 
ATOM   4429  C CE1 . TYR B  1 164 ? -60.04720 -28.84876  70.82538  1.000 40.53540  ? 144 TYR A CE1 1 
ATOM   4430  C CE2 . TYR B  1 164 ? -62.44272 -28.84836  70.80884  1.000 45.71134  ? 144 TYR A CE2 1 
ATOM   4431  C CZ  . TYR B  1 164 ? -61.24909 -28.60960  71.46164  1.000 48.40444  ? 144 TYR A CZ  1 
ATOM   4432  O OH  . TYR B  1 164 ? -61.25542 -28.12890  72.75234  1.000 52.59945  ? 144 TYR A OH  1 
ATOM   4433  N N   . MET B  1 165 ? -60.61619 -31.89695  64.98343  1.000 32.79204  ? 145 MET A N   1 
ATOM   4434  C CA  . MET B  1 165 ? -60.90655 -32.33536  63.62089  1.000 41.22657  ? 145 MET A CA  1 
ATOM   4435  C C   . MET B  1 165 ? -61.13251 -33.84139  63.55390  1.000 34.95621  ? 145 MET A C   1 
ATOM   4436  O O   . MET B  1 165 ? -62.02670 -34.30797  62.83892  1.000 35.57243  ? 145 MET A O   1 
ATOM   4437  C CB  . MET B  1 165 ? -59.77332 -31.93221  62.68185  1.000 45.96725  ? 145 MET A CB  1 
ATOM   4438  C CG  . MET B  1 165 ? -60.07766 -30.72813  61.82091  1.000 46.96829  ? 145 MET A CG  1 
ATOM   4439  S SD  . MET B  1 165 ? -58.71571 -30.37824  60.70201  1.000 50.02668  ? 145 MET A SD  1 
ATOM   4440  C CE  . MET B  1 165 ? -59.32588 -31.15142  59.20560  1.000 47.46047  ? 145 MET A CE  1 
ATOM   4441  N N   . LEU B  1 166 ? -60.33010 -34.61849  64.28636  1.000 33.85844  ? 146 LEU A N   1 
ATOM   4442  C CA  . LEU B  1 166 ? -60.48466 -36.06943  64.25599  1.000 35.26206  ? 146 LEU A CA  1 
ATOM   4443  C C   . LEU B  1 166 ? -61.83490 -36.49765  64.81752  1.000 35.90017  ? 146 LEU A C   1 
ATOM   4444  O O   . LEU B  1 166 ? -62.50320 -37.36511  64.24402  1.000 37.11423  ? 146 LEU A O   1 
ATOM   4445  C CB  . LEU B  1 166 ? -59.34650 -36.73768  65.02542  1.000 42.03241  ? 146 LEU A CB  1 
ATOM   4446  C CG  . LEU B  1 166 ? -57.95613 -36.61836  64.39976  1.000 35.77469  ? 146 LEU A CG  1 
ATOM   4447  C CD1 . LEU B  1 166 ? -56.89531 -36.89708  65.44464  1.000 31.95774  ? 146 LEU A CD1 1 
ATOM   4448  C CD2 . LEU B  1 166 ? -57.80336 -37.55597  63.20577  1.000 33.93920  ? 146 LEU A CD2 1 
ATOM   4449  N N   . GLN B  1 167 ? -62.25775 -35.89393  65.92974  1.000 35.69996  ? 147 GLN A N   1 
ATOM   4450  C CA  . GLN B  1 167 ? -63.54863 -36.24271  66.51010  1.000 38.72674  ? 147 GLN A CA  1 
ATOM   4451  C C   . GLN B  1 167 ? -64.69742 -35.85774  65.58784  1.000 40.60396  ? 147 GLN A C   1 
ATOM   4452  O O   . GLN B  1 167 ? -65.65489 -36.62653  65.43142  1.000 40.66472  ? 147 GLN A O   1 
ATOM   4453  C CB  . GLN B  1 167 ? -63.70164 -35.58869  67.87927  1.000 37.86677  ? 147 GLN A CB  1 
ATOM   4454  C CG  . GLN B  1 167 ? -62.59056 -35.98766  68.83353  1.000 47.48607  ? 147 GLN A CG  1 
ATOM   4455  C CD  . GLN B  1 167 ? -62.99240 -35.89395  70.28893  1.000 54.42196  ? 147 GLN A CD  1 
ATOM   4456  O OE1 . GLN B  1 167 ? -64.05593 -35.36724  70.62014  1.000 68.10583  ? 147 GLN A OE1 1 
ATOM   4457  N NE2 . GLN B  1 167 ? -62.13736 -36.40182  71.17138  1.000 39.18605  ? 147 GLN A NE2 1 
ATOM   4458  N N   . GLN B  1 168 ? -64.62070 -34.68054  64.95986  1.000 37.50149  ? 148 GLN A N   1 
ATOM   4459  C CA  . GLN B  1 168 ? -65.65314 -34.30595  63.99943  1.000 44.96608  ? 148 GLN A CA  1 
ATOM   4460  C C   . GLN B  1 168 ? -65.68593 -35.27913  62.82868  1.000 40.10750  ? 148 GLN A C   1 
ATOM   4461  O O   . GLN B  1 168 ? -66.76165 -35.70677  62.39996  1.000 51.52550  ? 148 GLN A O   1 
ATOM   4462  C CB  . GLN B  1 168 ? -65.43568 -32.87553  63.49827  1.000 43.76799  ? 148 GLN A CB  1 
ATOM   4463  C CG  . GLN B  1 168 ? -66.48131 -32.43916  62.47135  1.000 44.97963  ? 148 GLN A CG  1 
ATOM   4464  C CD  . GLN B  1 168 ? -66.12549 -31.14158  61.77488  1.000 58.79454  ? 148 GLN A CD  1 
ATOM   4465  O OE1 . GLN B  1 168 ? -65.87252 -31.12231  60.57195  1.000 65.77957  ? 148 GLN A OE1 1 
ATOM   4466  N NE2 . GLN B  1 168 ? -66.11373 -30.04830  62.52463  1.000 60.50113  ? 148 GLN A NE2 1 
ATOM   4467  N N   . HIS B  1 169 ? -64.51401 -35.65994  62.31793  1.000 40.56674  ? 149 HIS A N   1 
ATOM   4468  C CA  . HIS B  1 169 ? -64.44947 -36.54733  61.16038  1.000 42.59479  ? 149 HIS A CA  1 
ATOM   4469  C C   . HIS B  1 169 ? -65.15197 -37.87377  61.43132  1.000 47.45583  ? 149 HIS A C   1 
ATOM   4470  O O   . HIS B  1 169 ? -65.90770 -38.37090  60.58895  1.000 48.84977  ? 149 HIS A O   1 
ATOM   4471  C CB  . HIS B  1 169 ? -62.99013 -36.77919  60.77160  1.000 38.41348  ? 149 HIS A CB  1 
ATOM   4472  C CG  . HIS B  1 169 ? -62.81017 -37.70090  59.60670  1.000 39.25101  ? 149 HIS A CG  1 
ATOM   4473  N ND1 . HIS B  1 169 ? -63.03333 -37.30857  58.30463  1.000 39.82702  ? 149 HIS A ND1 1 
ATOM   4474  C CD2 . HIS B  1 169 ? -62.41671 -38.99604  59.54791  1.000 42.91092  ? 149 HIS A CD2 1 
ATOM   4475  C CE1 . HIS B  1 169 ? -62.78657 -38.32246  57.49407  1.000 40.59465  ? 149 HIS A CE1 1 
ATOM   4476  N NE2 . HIS B  1 169 ? -62.41062 -39.35828  58.22350  1.000 40.51980  ? 149 HIS A NE2 1 
ATOM   4477  N N   . VAL B  1 170 ? -64.91328 -38.46892  62.60159  1.000 45.44407  ? 150 VAL A N   1 
ATOM   4478  C CA  . VAL B  1 170 ? -65.51017 -39.77114  62.87845  1.000 41.99473  ? 150 VAL A CA  1 
ATOM   4479  C C   . VAL B  1 170 ? -66.99187 -39.62109  63.21134  1.000 48.23978  ? 150 VAL A C   1 
ATOM   4480  O O   . VAL B  1 170 ? -67.81319 -40.46567  62.83314  1.000 51.16905  ? 150 VAL A O   1 
ATOM   4481  C CB  . VAL B  1 170 ? -64.73375 -40.50545  63.99291  1.000 45.78210  ? 150 VAL A CB  1 
ATOM   4482  C CG1 . VAL B  1 170 ? -63.23003 -40.46273  63.72162  1.000 44.22059  ? 150 VAL A CG1 1 
ATOM   4483  C CG2 . VAL B  1 170 ? -65.03556 -39.92213  65.36802  1.000 50.17310  ? 150 VAL A CG2 1 
ATOM   4484  N N   . ASP B  1 171 ? -67.36643 -38.53701  63.89857  1.000 49.99114  ? 151 ASP A N   1 
ATOM   4485  C CA  . ASP B  1 171 ? -68.77083 -38.33670  64.23659  1.000 46.93336  ? 151 ASP A CA  1 
ATOM   4486  C C   . ASP B  1 171 ? -69.57709 -37.96311  62.99903  1.000 51.03771  ? 151 ASP A C   1 
ATOM   4487  O O   . ASP B  1 171 ? -70.70301 -38.43914  62.81201  1.000 57.84171  ? 151 ASP A O   1 
ATOM   4488  C CB  . ASP B  1 171 ? -68.90356 -37.26129  65.31609  1.000 46.52679  ? 151 ASP A CB  1 
ATOM   4489  C CG  . ASP B  1 171 ? -68.33828 -37.70603  66.65806  1.000 57.37807  ? 151 ASP A CG  1 
ATOM   4490  O OD1 . ASP B  1 171 ? -67.70733 -38.78271  66.72093  1.000 64.37938  ? 151 ASP A OD1 1 
ATOM   4491  O OD2 . ASP B  1 171 ? -68.51615 -36.97304  67.65250  1.000 61.41920  ? 151 ASP A OD2 1 
ATOM   4492  N N   . SER B  1 172 ? -69.01247 -37.12094  62.13988  1.000 48.58983  ? 152 SER A N   1 
ATOM   4493  C CA  . SER B  1 172 ? -69.65512 -36.78334  60.88134  1.000 45.15021  ? 152 SER A CA  1 
ATOM   4494  C C   . SER B  1 172 ? -69.84185 -37.97919  59.95303  1.000 49.63057  ? 152 SER A C   1 
ATOM   4495  O O   . SER B  1 172 ? -70.70673 -37.93161  59.07782  1.000 52.75336  ? 152 SER A O   1 
ATOM   4496  C CB  . SER B  1 172 ? -68.81325 -35.74570  60.15709  1.000 50.50135  ? 152 SER A CB  1 
ATOM   4497  O OG  . SER B  1 172 ? -67.92967 -36.43452  59.29742  1.000 57.30478  ? 152 SER A OG  1 
ATOM   4498  N N   . GLY B  1 173 ? -69.02132 -39.01457  60.08597  1.000 50.53016  ? 153 GLY A N   1 
ATOM   4499  C CA  . GLY B  1 173 ? -68.99143 -40.03512  59.05748  1.000 47.29622  ? 153 GLY A CA  1 
ATOM   4500  C C   . GLY B  1 173 ? -68.46966 -39.56754  57.71553  1.000 47.03525  ? 153 GLY A C   1 
ATOM   4501  O O   . GLY B  1 173 ? -68.72732 -40.21902  56.70306  1.000 48.30218  ? 153 GLY A O   1 
ATOM   4502  N N   . ALA B  1 174 ? -67.73312 -38.45989  57.67132  1.000 45.51755  ? 154 ALA A N   1 
ATOM   4503  C CA  . ALA B  1 174 ? -67.29696 -37.92472  56.39035  1.000 45.37838  ? 154 ALA A CA  1 
ATOM   4504  C C   . ALA B  1 174 ? -66.20032 -38.77795  55.76576  1.000 45.13042  ? 154 ALA A C   1 
ATOM   4505  O O   . ALA B  1 174 ? -65.45779 -39.49476  56.44320  1.000 44.46715  ? 154 ALA A O   1 
ATOM   4506  C CB  . ALA B  1 174 ? -66.77371 -36.49705  56.53138  1.000 44.86724  ? 154 ALA A CB  1 
ATOM   4507  N N   . ASP B  1 175 ? -66.09484 -38.66862  54.44181  1.000 45.72902  ? 155 ASP A N   1 
ATOM   4508  C CA  . ASP B  1 175 ? -64.95226 -39.22791  53.73583  1.000 45.38447  ? 155 ASP A CA  1 
ATOM   4509  C C   . ASP B  1 175 ? -63.71870 -38.33702  53.86806  1.000 50.03990  ? 155 ASP A C   1 
ATOM   4510  O O   . ASP B  1 175 ? -62.59247 -38.84370  53.87807  1.000 47.45179  ? 155 ASP A O   1 
ATOM   4511  C CB  . ASP B  1 175 ? -65.30404 -39.43954  52.26363  1.000 56.54320  ? 155 ASP A CB  1 
ATOM   4512  C CG  . ASP B  1 175 ? -66.37150 -40.51178  52.05825  1.000 64.76707  ? 155 ASP A CG  1 
ATOM   4513  O OD1 . ASP B  1 175 ? -66.66397 -41.28170  53.00312  1.000 54.23000  ? 155 ASP A OD1 1 
ATOM   4514  O OD2 . ASP B  1 175 ? -66.93488 -40.56502  50.94358  1.000 68.10750  ? 155 ASP A OD2 1 
ATOM   4515  N N   . VAL B  1 176 ? -63.90112 -37.02304  53.96350  1.000 42.85551  ? 156 VAL A N   1 
ATOM   4516  C CA  . VAL B  1 176 ? -62.79223 -36.12526  54.27188  1.000 45.54478  ? 156 VAL A CA  1 
ATOM   4517  C C   . VAL B  1 176 ? -63.32896 -34.92415  55.04097  1.000 44.64152  ? 156 VAL A C   1 
ATOM   4518  O O   . VAL B  1 176 ? -64.34631 -34.32735  54.66950  1.000 43.40684  ? 156 VAL A O   1 
ATOM   4519  C CB  . VAL B  1 176 ? -62.01670 -35.68207  53.01201  1.000 42.42032  ? 156 VAL A CB  1 
ATOM   4520  C CG1 . VAL B  1 176 ? -62.90738 -34.88170  52.07441  1.000 43.01082  ? 156 VAL A CG1 1 
ATOM   4521  C CG2 . VAL B  1 176 ? -60.77516 -34.86799  53.40938  1.000 51.16864  ? 156 VAL A CG2 1 
ATOM   4522  N N   . THR B  1 177 ? -62.65946 -34.59927  56.13935  1.000 42.31296  ? 157 THR A N   1 
ATOM   4523  C CA  . THR B  1 177 ? -62.89571 -33.37262  56.88228  1.000 38.37478  ? 157 THR A CA  1 
ATOM   4524  C C   . THR B  1 177 ? -61.76682 -32.40820  56.55050  1.000 39.80735  ? 157 THR A C   1 
ATOM   4525  O O   . THR B  1 177 ? -60.59545 -32.79881  56.54989  1.000 38.74189  ? 157 THR A O   1 
ATOM   4526  C CB  . THR B  1 177 ? -62.96656 -33.65446  58.38291  1.000 37.83553  ? 157 THR A CB  1 
ATOM   4527  O OG1 . THR B  1 177 ? -63.98721 -34.62960  58.62499  1.000 43.97198  ? 157 THR A OG1 1 
ATOM   4528  C CG2 . THR B  1 177 ? -63.29375 -32.39358  59.15698  1.000 39.51130  ? 157 THR A CG2 1 
ATOM   4529  N N   . ILE B  1 178 ? -62.11748 -31.16191  56.24863  1.000 38.14825  ? 158 ILE A N   1 
ATOM   4530  C CA  . ILE B  1 178 ? -61.18134 -30.19649  55.68825  1.000 38.64025  ? 158 ILE A CA  1 
ATOM   4531  C C   . ILE B  1 178 ? -61.13360 -28.97965  56.60190  1.000 38.35140  ? 158 ILE A C   1 
ATOM   4532  O O   . ILE B  1 178 ? -62.17175 -28.36721  56.88373  1.000 36.24092  ? 158 ILE A O   1 
ATOM   4533  C CB  . ILE B  1 178 ? -61.57885 -29.80173  54.25667  1.000 47.18093  ? 158 ILE A CB  1 
ATOM   4534  C CG1 . ILE B  1 178 ? -61.74336 -31.05961  53.39717  1.000 38.37601  ? 158 ILE A CG1 1 
ATOM   4535  C CG2 . ILE B  1 178 ? -60.56414 -28.83333  53.65522  1.000 47.72086  ? 158 ILE A CG2 1 
ATOM   4536  C CD1 . ILE B  1 178 ? -62.04692 -30.78330  51.94993  1.000 41.03399  ? 158 ILE A CD1 1 
ATOM   4537  N N   . GLY B  1 179 ? -59.93504 -28.63629  57.06680  1.000 34.06947  ? 159 GLY A N   1 
ATOM   4538  C CA  . GLY B  1 179 ? -59.77543 -27.43303  57.86440  1.000 45.48357  ? 159 GLY A CA  1 
ATOM   4539  C C   . GLY B  1 179 ? -59.91545 -26.19319  57.00083  1.000 39.26164  ? 159 GLY A C   1 
ATOM   4540  O O   . GLY B  1 179 ? -59.38006 -26.11888  55.89433  1.000 38.92420  ? 159 GLY A O   1 
ATOM   4541  N N   . CYS B  1 180 ? -60.65464 -25.21046  57.51276  1.000 37.76216  ? 160 CYS A N   1 
ATOM   4542  C CA  . CYS B  1 180 ? -61.01355 -24.04372  56.71977  1.000 47.14897  ? 160 CYS A CA  1 
ATOM   4543  C C   . CYS B  1 180 ? -60.92872 -22.76900  57.54646  1.000 35.68497  ? 160 CYS A C   1 
ATOM   4544  O O   . CYS B  1 180 ? -61.35837 -22.73377  58.70312  1.000 36.86706  ? 160 CYS A O   1 
ATOM   4545  C CB  . CYS B  1 180 ? -62.42809 -24.18550  56.14582  1.000 49.25107  ? 160 CYS A CB  1 
ATOM   4546  S SG  . CYS B  1 180 ? -62.52986 -25.26263  54.70581  1.000 48.86983  ? 160 CYS A SG  1 
ATOM   4547  N N   . LEU B  1 181 ? -60.37127 -21.72679  56.94052  1.000 33.03979  ? 161 LEU A N   1 
ATOM   4548  C CA  . LEU B  1 181 ? -60.44823 -20.38941  57.50303  1.000 34.42647  ? 161 LEU A CA  1 
ATOM   4549  C C   . LEU B  1 181 ? -61.80359 -19.77396  57.18465  1.000 40.78284  ? 161 LEU A C   1 
ATOM   4550  O O   . LEU B  1 181 ? -62.42530 -20.08610  56.16531  1.000 46.39021  ? 161 LEU A O   1 
ATOM   4551  C CB  . LEU B  1 181 ? -59.34817 -19.49588  56.93528  1.000 36.82481  ? 161 LEU A CB  1 
ATOM   4552  C CG  . LEU B  1 181 ? -57.88529 -19.89382  57.09310  1.000 38.01638  ? 161 LEU A CG  1 
ATOM   4553  C CD1 . LEU B  1 181 ? -57.02398 -18.84133  56.41921  1.000 35.57112  ? 161 LEU A CD1 1 
ATOM   4554  C CD2 . LEU B  1 181 ? -57.51073 -20.04165  58.56838  1.000 36.97314  ? 161 LEU A CD2 1 
ATOM   4555  N N   . GLU B  1 182 ? -62.25909 -18.88849  58.06355  1.000 43.27701  ? 162 GLU A N   1 
ATOM   4556  C CA  . GLU B  1 182 ? -63.46803 -18.10389  57.82889  1.000 47.05559  ? 162 GLU A CA  1 
ATOM   4557  C C   . GLU B  1 182 ? -63.01911 -16.67150  57.55583  1.000 43.23324  ? 162 GLU A C   1 
ATOM   4558  O O   . GLU B  1 182 ? -62.69966 -15.91912  58.48209  1.000 38.01820  ? 162 GLU A O   1 
ATOM   4559  C CB  . GLU B  1 182 ? -64.42687 -18.19032  59.00865  1.000 47.68083  ? 162 GLU A CB  1 
ATOM   4560  C CG  . GLU B  1 182 ? -65.76452 -17.53095  58.74093  1.000 55.95505  ? 162 GLU A CG  1 
ATOM   4561  C CD  . GLU B  1 182 ? -66.74566 -17.72282  59.87769  1.000 62.87237  ? 162 GLU A CD  1 
ATOM   4562  O OE1 . GLU B  1 182 ? -67.40395 -16.73364  60.26796  1.000 64.52044  ? 162 GLU A OE1 1 
ATOM   4563  O OE2 . GLU B  1 182 ? -66.86063 -18.86412  60.37586  1.000 57.59769  ? 162 GLU A OE2 1 
ATOM   4564  N N   . VAL B  1 183 ? -63.01003 -16.30067  56.28040  1.000 37.30016  ? 163 VAL A N   1 
ATOM   4565  C CA  . VAL B  1 183 ? -62.33346 -15.09673  55.81051  1.000 40.13189  ? 163 VAL A CA  1 
ATOM   4566  C C   . VAL B  1 183 ? -63.34955 -14.24597  55.05777  1.000 47.66416  ? 163 VAL A C   1 
ATOM   4567  O O   . VAL B  1 183 ? -64.33236 -14.79152  54.53392  1.000 55.13512  ? 163 VAL A O   1 
ATOM   4568  C CB  . VAL B  1 183 ? -61.12176 -15.48370  54.94075  1.000 44.63926  ? 163 VAL A CB  1 
ATOM   4569  C CG1 . VAL B  1 183 ? -60.77353 -14.42056  53.93731  1.000 40.90060  ? 163 VAL A CG1 1 
ATOM   4570  C CG2 . VAL B  1 183 ? -59.92041 -15.79541  55.81596  1.000 53.00371  ? 163 VAL A CG2 1 
ATOM   4571  N N   . PRO B  1 184 ? -63.20269 -12.91928  55.02394  1.000 41.75023  ? 164 PRO A N   1 
ATOM   4572  C CA  . PRO B  1 184 ? -64.01594 -12.12507  54.09740  1.000 46.64131  ? 164 PRO A CA  1 
ATOM   4573  C C   . PRO B  1 184 ? -63.79679 -12.55713  52.65334  1.000 58.96060  ? 164 PRO A C   1 
ATOM   4574  O O   . PRO B  1 184 ? -62.66947 -12.82058  52.23069  1.000 66.99113  ? 164 PRO A O   1 
ATOM   4575  C CB  . PRO B  1 184 ? -63.53193 -10.69533  54.34707  1.000 36.89338  ? 164 PRO A CB  1 
ATOM   4576  C CG  . PRO B  1 184 ? -63.18572 -10.71207  55.79003  1.000 35.93648  ? 164 PRO A CG  1 
ATOM   4577  C CD  . PRO B  1 184 ? -62.49987 -12.05005  55.98485  1.000 35.15670  ? 164 PRO A CD  1 
ATOM   4578  N N   . ARG B  1 185 ? -64.89646 -12.61977  51.89477  1.000 62.56379  ? 165 ARG A N   1 
ATOM   4579  C CA  . ARG B  1 185 ? -64.83831 -13.18140  50.54708  1.000 55.63038  ? 165 ARG A CA  1 
ATOM   4580  C C   . ARG B  1 185 ? -63.79551 -12.48129  49.68963  1.000 39.62319  ? 165 ARG A C   1 
ATOM   4581  O O   . ARG B  1 185 ? -63.04660 -13.13512  48.95590  1.000 51.33746  ? 165 ARG A O   1 
ATOM   4582  C CB  . ARG B  1 185 ? -66.20592 -13.10461  49.87274  1.000 53.54192  ? 165 ARG A CB  1 
ATOM   4583  C CG  . ARG B  1 185 ? -67.37779 -13.46499  50.75019  1.000 54.20232  ? 165 ARG A CG  1 
ATOM   4584  C CD  . ARG B  1 185 ? -68.65448 -12.98723  50.12102  1.000 54.76529  ? 165 ARG A CD  1 
ATOM   4585  N NE  . ARG B  1 185 ? -68.64151 -13.25060  48.69064  1.000 49.66477  ? 165 ARG A NE  1 
ATOM   4586  C CZ  . ARG B  1 185 ? -68.84798 -12.32972  47.76206  1.000 57.35800  ? 165 ARG A CZ  1 
ATOM   4587  N NH1 . ARG B  1 185 ? -69.09612 -11.07357  48.11537  1.000 52.26964  ? 165 ARG A NH1 1 
ATOM   4588  N NH2 . ARG B  1 185 ? -68.80729 -12.66860  46.48056  1.000 68.49349  ? 165 ARG A NH2 1 
ATOM   4589  N N   . MET B  1 186 ? -63.72121 -11.15572  49.78139  1.000 39.80695  ? 166 MET A N   1 
ATOM   4590  C CA  . MET B  1 186 ? -62.74714 -10.40306  48.99790  1.000 50.44830  ? 166 MET A CA  1 
ATOM   4591  C C   . MET B  1 186 ? -61.33632 -10.95645  49.17836  1.000 50.98941  ? 166 MET A C   1 
ATOM   4592  O O   . MET B  1 186 ? -60.55476 -11.02141  48.22249  1.000 53.92637  ? 166 MET A O   1 
ATOM   4593  C CB  . MET B  1 186 ? -62.81584 -8.93013   49.39813  1.000 58.29132  ? 166 MET A CB  1 
ATOM   4594  C CG  . MET B  1 186 ? -63.19762 -8.74452   50.85944  1.000 63.86738  ? 166 MET A CG  1 
ATOM   4595  S SD  . MET B  1 186 ? -63.57672 -7.04643   51.32010  1.000 67.44768  ? 166 MET A SD  1 
ATOM   4596  C CE  . MET B  1 186 ? -63.34440 -7.11437   53.10057  1.000 47.04062  ? 166 MET A CE  1 
ATOM   4597  N N   . GLU B  1 187 ? -61.00380 -11.38641  50.39146  1.000 52.83700  ? 167 GLU A N   1 
ATOM   4598  C CA  . GLU B  1 187 ? -59.70100 -11.96821  50.67715  1.000 55.14872  ? 167 GLU A CA  1 
ATOM   4599  C C   . GLU B  1 187 ? -59.63495 -13.46537  50.40333  1.000 59.20546  ? 167 GLU A C   1 
ATOM   4600  O O   . GLU B  1 187 ? -58.54232 -14.04046  50.46547  1.000 63.50356  ? 167 GLU A O   1 
ATOM   4601  C CB  . GLU B  1 187 ? -59.31768 -11.70376  52.13607  1.000 58.33440  ? 167 GLU A CB  1 
ATOM   4602  C CG  . GLU B  1 187 ? -59.72190 -10.32898  52.64024  1.000 63.80311  ? 167 GLU A CG  1 
ATOM   4603  C CD  . GLU B  1 187 ? -59.54858 -10.18687  54.13836  1.000 70.62911  ? 167 GLU A CD  1 
ATOM   4604  O OE1 . GLU B  1 187 ? -58.48196 -10.58036  54.65362  1.000 74.21936  ? 167 GLU A OE1 1 
ATOM   4605  O OE2 . GLU B  1 187 ? -60.47038 -9.66740   54.79915  1.000 74.52302  ? 167 GLU A OE2 1 
ATOM   4606  N N   . ALA B  1 188 ? -60.76222 -14.11080  50.10450  1.000 51.00759  ? 168 ALA A N   1 
ATOM   4607  C CA  . ALA B  1 188 ? -60.76068 -15.53789  49.80727  1.000 45.69003  ? 168 ALA A CA  1 
ATOM   4608  C C   . ALA B  1 188 ? -60.40907 -15.84512  48.35708  1.000 42.75180  ? 168 ALA A C   1 
ATOM   4609  O O   . ALA B  1 188 ? -60.31824 -17.02388  47.99709  1.000 52.91328  ? 168 ALA A O   1 
ATOM   4610  C CB  . ALA B  1 188 ? -62.12440 -16.14811  50.14602  1.000 46.02999  ? 168 ALA A CB  1 
ATOM   4611  N N   . THR B  1 189 ? -60.19313 -14.82358  47.52451  1.000 46.03902  ? 169 THR A N   1 
ATOM   4612  C CA  . THR B  1 189 ? -59.98240 -15.04351  46.09680  1.000 54.11708  ? 169 THR A CA  1 
ATOM   4613  C C   . THR B  1 189 ? -58.64878 -15.70942  45.78776  1.000 57.90283  ? 169 THR A C   1 
ATOM   4614  O O   . THR B  1 189 ? -58.46084 -16.19335  44.66735  1.000 52.68956  ? 169 THR A O   1 
ATOM   4615  C CB  . THR B  1 189 ? -60.06907 -13.71856  45.34405  1.000 49.27049  ? 169 THR A CB  1 
ATOM   4616  O OG1 . THR B  1 189 ? -59.17492 -12.77744  45.94921  1.000 51.61853  ? 169 THR A OG1 1 
ATOM   4617  C CG2 . THR B  1 189 ? -61.48966 -13.17311  45.38648  1.000 50.34165  ? 169 THR A CG2 1 
ATOM   4618  N N   . GLY B  1 190 ? -57.71888 -15.73105  46.73621  1.000 59.39940  ? 170 GLY A N   1 
ATOM   4619  C CA  . GLY B  1 190 ? -56.45854 -16.40976  46.53963  1.000 48.42887  ? 170 GLY A CA  1 
ATOM   4620  C C   . GLY B  1 190 ? -56.42729 -17.84882  46.98962  1.000 50.65711  ? 170 GLY A C   1 
ATOM   4621  O O   . GLY B  1 190 ? -55.42515 -18.53579  46.77228  1.000 52.10655  ? 170 GLY A O   1 
ATOM   4622  N N   . PHE B  1 191 ? -57.49909 -18.33896  47.60090  1.000 52.15476  ? 171 PHE A N   1 
ATOM   4623  C CA  . PHE B  1 191 ? -57.53142 -19.67355  48.17476  1.000 43.99769  ? 171 PHE A CA  1 
ATOM   4624  C C   . PHE B  1 191 ? -58.35944 -20.61425  47.31482  1.000 46.13138  ? 171 PHE A C   1 
ATOM   4625  O O   . PHE B  1 191 ? -59.12553 -20.19290  46.44339  1.000 44.13954  ? 171 PHE A O   1 
ATOM   4626  C CB  . PHE B  1 191 ? -58.13188 -19.66039  49.58585  1.000 53.07471  ? 171 PHE A CB  1 
ATOM   4627  C CG  . PHE B  1 191 ? -57.34824 -18.86126  50.58579  1.000 48.19204  ? 171 PHE A CG  1 
ATOM   4628  C CD1 . PHE B  1 191 ? -57.41712 -17.47998  50.59758  1.000 34.60754  ? 171 PHE A CD1 1 
ATOM   4629  C CD2 . PHE B  1 191 ? -56.56924 -19.49818  51.53937  1.000 48.32531  ? 171 PHE A CD2 1 
ATOM   4630  C CE1 . PHE B  1 191 ? -56.70432 -16.74365  51.52837  1.000 35.33039  ? 171 PHE A CE1 1 
ATOM   4631  C CE2 . PHE B  1 191 ? -55.85650 -18.76750  52.47246  1.000 44.55613  ? 171 PHE A CE2 1 
ATOM   4632  C CZ  . PHE B  1 191 ? -55.92507 -17.38567  52.46607  1.000 37.99992  ? 171 PHE A CZ  1 
ATOM   4633  N N   . GLY B  1 192 ? -58.19603 -21.90725  47.58003  1.000 37.50477  ? 172 GLY A N   1 
ATOM   4634  C CA  . GLY B  1 192 ? -59.24217 -22.85397  47.24048  1.000 40.66596  ? 172 GLY A CA  1 
ATOM   4635  C C   . GLY B  1 192 ? -60.38523 -22.69922  48.22645  1.000 39.96857  ? 172 GLY A C   1 
ATOM   4636  O O   . GLY B  1 192 ? -60.17927 -22.72800  49.44609  1.000 37.52605  ? 172 GLY A O   1 
ATOM   4637  N N   . VAL B  1 193 ? -61.59275 -22.50415  47.71072  1.000 39.80856  ? 173 VAL A N   1 
ATOM   4638  C CA  . VAL B  1 193 ? -62.72133 -22.10157  48.53941  1.000 42.41573  ? 173 VAL A CA  1 
ATOM   4639  C C   . VAL B  1 193 ? -63.77626 -23.19754  48.51995  1.000 42.66831  ? 173 VAL A C   1 
ATOM   4640  O O   . VAL B  1 193 ? -64.10864 -23.73456  47.45742  1.000 54.50894  ? 173 VAL A O   1 
ATOM   4641  C CB  . VAL B  1 193 ? -63.30418 -20.75101  48.07116  1.000 40.55543  ? 173 VAL A CB  1 
ATOM   4642  C CG1 . VAL B  1 193 ? -64.59077 -20.42279  48.82265  1.000 40.96940  ? 173 VAL A CG1 1 
ATOM   4643  C CG2 . VAL B  1 193 ? -62.26573 -19.64652  48.24331  1.000 39.51620  ? 173 VAL A CG2 1 
ATOM   4644  N N   . MET B  1 194 ? -64.30379 -23.52046  49.70195  1.000 43.31347  ? 174 MET A N   1 
ATOM   4645  C CA  . MET B  1 194 ? -65.33172 -24.54377  49.86798  1.000 48.81329  ? 174 MET A CA  1 
ATOM   4646  C C   . MET B  1 194 ? -66.71048 -23.88893  49.94144  1.000 46.95463  ? 174 MET A C   1 
ATOM   4647  O O   . MET B  1 194 ? -67.03394 -23.20205  50.91534  1.000 52.40364  ? 174 MET A O   1 
ATOM   4648  C CB  . MET B  1 194 ? -65.06313 -25.37959  51.11837  1.000 46.98469  ? 174 MET A CB  1 
ATOM   4649  C CG  . MET B  1 194 ? -63.67249 -25.99243  51.17630  1.000 45.75192  ? 174 MET A CG  1 
ATOM   4650  S SD  . MET B  1 194 ? -63.37192 -27.18686  49.85704  1.000 59.77130  ? 174 MET A SD  1 
ATOM   4651  C CE  . MET B  1 194 ? -61.60503 -27.43868  50.02162  1.000 64.44386  ? 174 MET A CE  1 
ATOM   4652  N N   . HIS B  1 195 ? -67.51300 -24.09904  48.90665  1.000 44.18999  ? 175 HIS A N   1 
ATOM   4653  C CA  . HIS B  1 195 ? -68.94209 -23.82888  48.98072  1.000 45.42628  ? 175 HIS A CA  1 
ATOM   4654  C C   . HIS B  1 195 ? -69.60063 -24.88196  49.87060  1.000 47.95885  ? 175 HIS A C   1 
ATOM   4655  O O   . HIS B  1 195 ? -69.41727 -26.08415  49.65554  1.000 46.08734  ? 175 HIS A O   1 
ATOM   4656  C CB  . HIS B  1 195 ? -69.52936 -23.85453  47.56645  1.000 47.62871  ? 175 HIS A CB  1 
ATOM   4657  C CG  . HIS B  1 195 ? -70.90352 -23.27103  47.44985  1.000 52.70655  ? 175 HIS A CG  1 
ATOM   4658  N ND1 . HIS B  1 195 ? -71.72323 -23.05251  48.53617  1.000 53.46363  ? 175 HIS A ND1 1 
ATOM   4659  C CD2 . HIS B  1 195 ? -71.60606 -22.87253  46.36281  1.000 52.05264  ? 175 HIS A CD2 1 
ATOM   4660  C CE1 . HIS B  1 195 ? -72.87025 -22.54241  48.12400  1.000 56.74224  ? 175 HIS A CE1 1 
ATOM   4661  N NE2 . HIS B  1 195 ? -72.82493 -22.42383  46.80932  1.000 58.30704  ? 175 HIS A NE2 1 
ATOM   4662  N N   . VAL B  1 196 ? -70.34767 -24.44432  50.88935  1.000 45.65621  ? 176 VAL A N   1 
ATOM   4663  C CA  . VAL B  1 196 ? -70.93054 -25.37454  51.85107  1.000 50.19920  ? 176 VAL A CA  1 
ATOM   4664  C C   . VAL B  1 196 ? -72.41432 -25.09863  52.04877  1.000 51.94979  ? 176 VAL A C   1 
ATOM   4665  O O   . VAL B  1 196 ? -72.92837 -24.03156  51.71039  1.000 53.52460  ? 176 VAL A O   1 
ATOM   4666  C CB  . VAL B  1 196 ? -70.22152 -25.32953  53.21906  1.000 47.47231  ? 176 VAL A CB  1 
ATOM   4667  C CG1 . VAL B  1 196 ? -68.76825 -25.74341  53.08054  1.000 46.77498  ? 176 VAL A CG1 1 
ATOM   4668  C CG2 . VAL B  1 196 ? -70.36472 -23.94791  53.83928  1.000 44.56570  ? 176 VAL A CG2 1 
ATOM   4669  N N   . ASN B  1 197 ? -73.08640 -26.07278  52.65664  1.000 50.23401  ? 177 ASN A N   1 
ATOM   4670  C CA  . ASN B  1 197 ? -74.52357 -26.03229  52.87335  1.000 51.97980  ? 177 ASN A CA  1 
ATOM   4671  C C   . ASN B  1 197 ? -74.85274 -25.55789  54.28703  1.000 55.04641  ? 177 ASN A C   1 
ATOM   4672  O O   . ASN B  1 197 ? -73.99734 -25.06248  55.03135  1.000 51.26081  ? 177 ASN A O   1 
ATOM   4673  C CB  . ASN B  1 197 ? -75.13209 -27.41462  52.62268  1.000 50.89665  ? 177 ASN A CB  1 
ATOM   4674  C CG  . ASN B  1 197 ? -74.97400 -28.35634  53.81887  1.000 50.47433  ? 177 ASN A CG  1 
ATOM   4675  O OD1 . ASN B  1 197 ? -73.96174 -28.32684  54.52259  1.000 57.22696  ? 177 ASN A OD1 1 
ATOM   4676  N ND2 . ASN B  1 197 ? -75.98429 -29.18655  54.05682  1.000 51.85119  ? 177 ASN A ND2 1 
ATOM   4677  N N   . GLU B  1 198 ? -76.11857 -25.73749  54.65754  1.000 61.12824  ? 178 GLU A N   1 
ATOM   4678  C CA  . GLU B  1 198 ? -76.58598 -25.41764  55.99941  1.000 63.37477  ? 178 GLU A CA  1 
ATOM   4679  C C   . GLU B  1 198 ? -75.75011 -26.09745  57.08141  1.000 60.72607  ? 178 GLU A C   1 
ATOM   4680  O O   . GLU B  1 198 ? -75.53308 -25.51699  58.14951  1.000 55.56126  ? 178 GLU A O   1 
ATOM   4681  C CB  . GLU B  1 198 ? -78.05389 -25.85408  56.12100  1.000 69.11756  ? 178 GLU A CB  1 
ATOM   4682  C CG  . GLU B  1 198 ? -78.32476 -27.13360  55.34043  1.000 73.43874  ? 178 GLU A CG  1 
ATOM   4683  C CD  . GLU B  1 198 ? -79.06450 -26.90706  54.04412  1.000 85.66133  ? 178 GLU A CD  1 
ATOM   4684  O OE1 . GLU B  1 198 ? -80.02007 -27.66505  53.77844  1.000 92.05159  ? 178 GLU A OE1 1 
ATOM   4685  O OE2 . GLU B  1 198 ? -78.69938 -25.96927  53.30157  1.000 87.61502  ? 178 GLU A OE2 1 
ATOM   4686  N N   . LYS B  1 199 ? -75.28693 -27.32195  56.82506  1.000 59.37373  ? 179 LYS A N   1 
ATOM   4687  C CA  . LYS B  1 199 ? -74.63181 -28.14184  57.83298  1.000 50.17237  ? 179 LYS A CA  1 
ATOM   4688  C C   . LYS B  1 199 ? -73.12853 -28.25128  57.60011  1.000 49.82509  ? 179 LYS A C   1 
ATOM   4689  O O   . LYS B  1 199 ? -72.50817 -29.25898  57.96035  1.000 54.22860  ? 179 LYS A O   1 
ATOM   4690  C CB  . LYS B  1 199 ? -75.26665 -29.53049  57.86510  1.000 56.22404  ? 179 LYS A CB  1 
ATOM   4691  C CG  . LYS B  1 199 ? -76.77466 -29.49745  57.69281  1.000 63.27673  ? 179 LYS A CG  1 
ATOM   4692  C CD  . LYS B  1 199 ? -77.49986 -29.91593  58.95727  1.000 70.02802  ? 179 LYS A CD  1 
ATOM   4693  C CE  . LYS B  1 199 ? -77.77707 -31.41687  58.95594  1.000 70.66245  ? 179 LYS A CE  1 
ATOM   4694  N NZ  . LYS B  1 199 ? -78.78872 -31.79756  59.98283  1.000 70.18903  ? 179 LYS A NZ  1 
ATOM   4695  N N   . ASP B  1 200 ? -72.54009 -27.22308  56.98940  1.000 45.40377  ? 180 ASP A N   1 
ATOM   4696  C CA  . ASP B  1 200 ? -71.11091 -27.15199  56.70045  1.000 44.33208  ? 180 ASP A CA  1 
ATOM   4697  C C   . ASP B  1 200 ? -70.60830 -28.35287  55.89881  1.000 54.02209  ? 180 ASP A C   1 
ATOM   4698  O O   . ASP B  1 200 ? -69.41856 -28.68072  55.94621  1.000 54.03059  ? 180 ASP A O   1 
ATOM   4699  C CB  . ASP B  1 200 ? -70.29326 -26.99257  57.98674  1.000 47.66453  ? 180 ASP A CB  1 
ATOM   4700  C CG  . ASP B  1 200 ? -69.99993 -25.53641  58.30805  1.000 52.63818  ? 180 ASP A CG  1 
ATOM   4701  O OD1 . ASP B  1 200 ? -70.26103 -24.67187  57.44047  1.000 46.96340  ? 180 ASP A OD1 1 
ATOM   4702  O OD2 . ASP B  1 200 ? -69.50240 -25.25622  59.42124  1.000 45.16506  ? 180 ASP A OD2 1 
ATOM   4703  N N   . GLU B  1 201 ? -71.49749 -29.02352  55.16510  1.000 54.49895  ? 181 GLU A N   1 
ATOM   4704  C CA  . GLU B  1 201 ? -71.07229 -30.04602  54.21389  1.000 53.98134  ? 181 GLU A CA  1 
ATOM   4705  C C   . GLU B  1 201 ? -70.73897 -29.38826  52.87926  1.000 51.72704  ? 181 GLU A C   1 
ATOM   4706  O O   . GLU B  1 201 ? -71.50330 -28.55710  52.37652  1.000 52.50015  ? 181 GLU A O   1 
ATOM   4707  C CB  . GLU B  1 201 ? -72.14803 -31.11917  54.04137  1.000 52.88180  ? 181 GLU A CB  1 
ATOM   4708  C CG  . GLU B  1 201 ? -72.99826 -31.37321  55.27931  1.000 56.09501  ? 181 GLU A CG  1 
ATOM   4709  C CD  . GLU B  1 201 ? -74.07472 -32.40476  55.02973  1.000 62.68969  ? 181 GLU A CD  1 
ATOM   4710  O OE1 . GLU B  1 201 ? -74.06905 -33.44854  55.71734  1.000 64.49730  ? 181 GLU A OE1 1 
ATOM   4711  O OE2 . GLU B  1 201 ? -74.91158 -32.18024  54.12966  1.000 63.16055  ? 181 GLU A OE2 1 
ATOM   4712  N N   . ILE B  1 202 ? -69.59851 -29.76772  52.31180  1.000 50.53809  ? 182 ILE A N   1 
ATOM   4713  C CA  . ILE B  1 202 ? -69.03966 -29.09217  51.14684  1.000 45.78130  ? 182 ILE A CA  1 
ATOM   4714  C C   . ILE B  1 202 ? -69.80759 -29.53089  49.90277  1.000 56.66082  ? 182 ILE A C   1 
ATOM   4715  O O   . ILE B  1 202 ? -69.74578 -30.69630  49.50400  1.000 61.85654  ? 182 ILE A O   1 
ATOM   4716  C CB  . ILE B  1 202 ? -67.54351 -29.38888  51.01026  1.000 44.49540  ? 182 ILE A CB  1 
ATOM   4717  C CG1 . ILE B  1 202 ? -66.80092 -28.93115  52.26970  1.000 42.75166  ? 182 ILE A CG1 1 
ATOM   4718  C CG2 . ILE B  1 202 ? -66.96663 -28.73682  49.76107  1.000 44.56234  ? 182 ILE A CG2 1 
ATOM   4719  C CD1 . ILE B  1 202 ? -65.38075 -29.40634  52.32599  1.000 48.85444  ? 182 ILE A CD1 1 
ATOM   4720  N N   . ILE B  1 203 ? -70.52591 -28.59159  49.27804  1.000 59.60617  ? 183 ILE A N   1 
ATOM   4721  C CA  . ILE B  1 203 ? -71.30849 -28.89275  48.07834  1.000 50.34675  ? 183 ILE A CA  1 
ATOM   4722  C C   . ILE B  1 203 ? -70.55494 -28.60989  46.78572  1.000 50.45172  ? 183 ILE A C   1 
ATOM   4723  O O   . ILE B  1 203 ? -71.01648 -29.02004  45.70964  1.000 57.80720  ? 183 ILE A O   1 
ATOM   4724  C CB  . ILE B  1 203 ? -72.62989 -28.09961  48.09622  1.000 51.45338  ? 183 ILE A CB  1 
ATOM   4725  C CG1 . ILE B  1 203 ? -72.36200 -26.60379  47.90031  1.000 50.70259  ? 183 ILE A CG1 1 
ATOM   4726  C CG2 . ILE B  1 203 ? -73.36669 -28.33517  49.40352  1.000 55.67680  ? 183 ILE A CG2 1 
ATOM   4727  C CD1 . ILE B  1 203 ? -72.69335 -26.09434  46.51599  1.000 56.68214  ? 183 ILE A CD1 1 
ATOM   4728  N N   . ASP B  1 204 ? -69.41835 -27.92177  46.85389  1.000 56.24749  ? 184 ASP A N   1 
ATOM   4729  C CA  . ASP B  1 204 ? -68.62243 -27.56697  45.68499  1.000 58.89925  ? 184 ASP A CA  1 
ATOM   4730  C C   . ASP B  1 204 ? -67.29379 -27.01034  46.17262  1.000 54.73151  ? 184 ASP A C   1 
ATOM   4731  O O   . ASP B  1 204 ? -67.14976 -26.63494  47.34012  1.000 58.47692  ? 184 ASP A O   1 
ATOM   4732  C CB  . ASP B  1 204 ? -69.34043 -26.54270  44.79116  1.000 63.97670  ? 184 ASP A CB  1 
ATOM   4733  C CG  . ASP B  1 204 ? -68.74672 -26.45911  43.38442  1.000 69.53739  ? 184 ASP A CG  1 
ATOM   4734  O OD1 . ASP B  1 204 ? -67.58234 -26.86930  43.18581  1.000 71.31356  ? 184 ASP A OD1 1 
ATOM   4735  O OD2 . ASP B  1 204 ? -69.45100 -25.97765  42.47153  1.000 70.89370  ? 184 ASP A OD2 1 
ATOM   4736  N N   . PHE B  1 205 ? -66.32561 -26.96426  45.26003  1.000 48.21131  ? 185 PHE A N   1 
ATOM   4737  C CA  . PHE B  1 205 ? -65.02175 -26.37637  45.52365  1.000 50.24503  ? 185 PHE A CA  1 
ATOM   4738  C C   . PHE B  1 205 ? -64.57040 -25.61800  44.28731  1.000 52.99905  ? 185 PHE A C   1 
ATOM   4739  O O   . PHE B  1 205 ? -64.69441 -26.11945  43.16654  1.000 61.08345  ? 185 PHE A O   1 
ATOM   4740  C CB  . PHE B  1 205 ? -63.98023 -27.44323  45.89516  1.000 60.90279  ? 185 PHE A CB  1 
ATOM   4741  C CG  . PHE B  1 205 ? -62.55496 -26.98924  45.72203  1.000 61.85095  ? 185 PHE A CG  1 
ATOM   4742  C CD1 . PHE B  1 205 ? -61.86929 -27.22869  44.53947  1.000 63.67159  ? 185 PHE A CD1 1 
ATOM   4743  C CD2 . PHE B  1 205 ? -61.90220 -26.31892  46.74325  1.000 47.96766  ? 185 PHE A CD2 1 
ATOM   4744  C CE1 . PHE B  1 205 ? -60.56236 -26.80553  44.38118  1.000 60.67243  ? 185 PHE A CE1 1 
ATOM   4745  C CE2 . PHE B  1 205 ? -60.59519 -25.90324  46.59453  1.000 46.49384  ? 185 PHE A CE2 1 
ATOM   4746  C CZ  . PHE B  1 205 ? -59.92424 -26.14305  45.41054  1.000 53.92821  ? 185 PHE A CZ  1 
ATOM   4747  N N   . ILE B  1 206 ? -64.04396 -24.41196  44.49393  1.000 48.40871  ? 186 ILE A N   1 
ATOM   4748  C CA  . ILE B  1 206 ? -63.55256 -23.57462  43.40732  1.000 47.95619  ? 186 ILE A CA  1 
ATOM   4749  C C   . ILE B  1 206 ? -62.14317 -23.11742  43.75098  1.000 44.66225  ? 186 ILE A C   1 
ATOM   4750  O O   . ILE B  1 206 ? -61.87963 -22.69801  44.88370  1.000 42.39572  ? 186 ILE A O   1 
ATOM   4751  C CB  . ILE B  1 206 ? -64.46702 -22.36041  43.14197  1.000 52.41556  ? 186 ILE A CB  1 
ATOM   4752  C CG1 . ILE B  1 206 ? -65.93335 -22.79040  43.01384  1.000 52.50192  ? 186 ILE A CG1 1 
ATOM   4753  C CG2 . ILE B  1 206 ? -64.04554 -21.65780  41.86649  1.000 49.03001  ? 186 ILE A CG2 1 
ATOM   4754  C CD1 . ILE B  1 206 ? -66.72092 -22.74680  44.31364  1.000 49.21275  ? 186 ILE A CD1 1 
ATOM   4755  N N   . GLU B  1 207 ? -61.24322 -23.20126  42.77498  1.000 43.94637  ? 187 GLU A N   1 
ATOM   4756  C CA  . GLU B  1 207 ? -59.86619 -22.75397  42.93375  1.000 42.73865  ? 187 GLU A CA  1 
ATOM   4757  C C   . GLU B  1 207 ? -59.76672 -21.27351  42.58169  1.000 43.12108  ? 187 GLU A C   1 
ATOM   4758  O O   . GLU B  1 207 ? -59.97323 -20.89063  41.42450  1.000 45.71418  ? 187 GLU A O   1 
ATOM   4759  C CB  . GLU B  1 207 ? -58.92942 -23.57228  42.04881  1.000 48.41025  ? 187 GLU A CB  1 
ATOM   4760  C CG  . GLU B  1 207 ? -57.50522 -23.04089  42.00803  1.000 54.54261  ? 187 GLU A CG  1 
ATOM   4761  C CD  . GLU B  1 207 ? -56.76256 -23.26748  43.31337  1.000 63.43935  ? 187 GLU A CD  1 
ATOM   4762  O OE1 . GLU B  1 207 ? -57.13407 -24.20354  44.05323  1.000 65.39721  ? 187 GLU A OE1 1 
ATOM   4763  O OE2 . GLU B  1 207 ? -55.81060 -22.50865  43.60177  1.000 66.25192  ? 187 GLU A OE2 1 
ATOM   4764  N N   . LYS B  1 208 ? -59.42721 -20.45294  43.56919  1.000 41.52643  ? 188 LYS A N   1 
ATOM   4765  C CA  . LYS B  1 208 ? -59.32539 -19.00835  43.40081  1.000 45.35751  ? 188 LYS A CA  1 
ATOM   4766  C C   . LYS B  1 208 ? -60.54672 -18.42535  42.68479  1.000 46.96330  ? 188 LYS A C   1 
ATOM   4767  O O   . LYS B  1 208 ? -60.41889 -17.85703  41.59600  1.000 47.64285  ? 188 LYS A O   1 
ATOM   4768  C CB  . LYS B  1 208 ? -58.05002 -18.63673  42.65674  1.000 50.06979  ? 188 LYS A CB  1 
ATOM   4769  C CG  . LYS B  1 208 ? -56.76736 -19.21607  43.22116  1.000 54.12953  ? 188 LYS A CG  1 
ATOM   4770  C CD  . LYS B  1 208 ? -55.56644 -18.45670  42.66800  1.000 54.66217  ? 188 LYS A CD  1 
ATOM   4771  C CE  . LYS B  1 208 ? -54.35056 -19.35545  42.50523  1.000 53.29300  ? 188 LYS A CE  1 
ATOM   4772  N NZ  . LYS B  1 208 ? -53.61137 -19.53526  43.78586  1.000 49.58849  ? 188 LYS A NZ  1 
ATOM   4773  N N   . PRO B  1 209 ? -61.74013 -18.54907  43.26189  1.000 49.02972  ? 189 PRO A N   1 
ATOM   4774  C CA  . PRO B  1 209 ? -62.89941 -17.88227  42.65873  1.000 48.83372  ? 189 PRO A CA  1 
ATOM   4775  C C   . PRO B  1 209 ? -62.71566 -16.37314  42.71175  1.000 44.28884  ? 189 PRO A C   1 
ATOM   4776  O O   . PRO B  1 209 ? -62.31064 -15.81901  43.73453  1.000 43.06932  ? 189 PRO A O   1 
ATOM   4777  C CB  . PRO B  1 209 ? -64.06922 -18.34545  43.53272  1.000 44.65508  ? 189 PRO A CB  1 
ATOM   4778  C CG  . PRO B  1 209 ? -63.44298 -18.57870  44.86648  1.000 43.82504  ? 189 PRO A CG  1 
ATOM   4779  C CD  . PRO B  1 209 ? -62.07034 -19.13648  44.57361  1.000 42.30939  ? 189 PRO A CD  1 
ATOM   4780  N N   . ALA B  1 210 ? -62.98354 -15.70789  41.58669  1.000 45.52892  ? 190 ALA A N   1 
ATOM   4781  C CA  . ALA B  1 210 ? -62.99480 -14.24976  41.60845  1.000 45.87967  ? 190 ALA A CA  1 
ATOM   4782  C C   . ALA B  1 210 ? -64.13901 -13.72871  42.46225  1.000 47.78543  ? 190 ALA A C   1 
ATOM   4783  O O   . ALA B  1 210 ? -64.02754 -12.65540  43.06157  1.000 51.02227  ? 190 ALA A O   1 
ATOM   4784  C CB  . ALA B  1 210 ? -63.09532 -13.69243  40.18764  1.000 47.38391  ? 190 ALA A CB  1 
ATOM   4785  N N   . ASP B  1 211 ? -65.23649 -14.47977  42.53468  1.000 56.17769  ? 191 ASP A N   1 
ATOM   4786  C CA  . ASP B  1 211 ? -66.41386 -14.11215  43.31598  1.000 56.92517  ? 191 ASP A CA  1 
ATOM   4787  C C   . ASP B  1 211 ? -66.74256 -15.27062  44.24384  1.000 45.99806  ? 191 ASP A C   1 
ATOM   4788  O O   . ASP B  1 211 ? -67.63690 -16.07593  43.95781  1.000 47.03424  ? 191 ASP A O   1 
ATOM   4789  C CB  . ASP B  1 211 ? -67.59917 -13.77296  42.41499  1.000 59.76672  ? 191 ASP A CB  1 
ATOM   4790  C CG  . ASP B  1 211 ? -68.64009 -12.95594  43.13260  1.000 61.52507  ? 191 ASP A CG  1 
ATOM   4791  O OD1 . ASP B  1 211 ? -68.27574 -12.31163  44.13716  1.000 65.06558  ? 191 ASP A OD1 1 
ATOM   4792  O OD2 . ASP B  1 211 ? -69.81346 -12.96329  42.71248  1.000 66.93620  ? 191 ASP A OD2 1 
ATOM   4793  N N   . PRO B  1 212 ? -66.05550 -15.36610  45.37717  1.000 44.47547  ? 192 PRO A N   1 
ATOM   4794  C CA  . PRO B  1 212 ? -66.13516 -16.56980  46.21001  1.000 54.08436  ? 192 PRO A CA  1 
ATOM   4795  C C   . PRO B  1 212 ? -67.53599 -16.80388  46.74469  1.000 58.79671  ? 192 PRO A C   1 
ATOM   4796  O O   . PRO B  1 212 ? -68.24524 -15.85315  47.10861  1.000 44.95328  ? 192 PRO A O   1 
ATOM   4797  C CB  . PRO B  1 212 ? -65.15060 -16.27309  47.35153  1.000 55.07432  ? 192 PRO A CB  1 
ATOM   4798  C CG  . PRO B  1 212 ? -64.21817 -15.25634  46.79382  1.000 49.72183  ? 192 PRO A CG  1 
ATOM   4799  C CD  . PRO B  1 212 ? -65.04791 -14.41407  45.87164  1.000 53.94791  ? 192 PRO A CD  1 
ATOM   4800  N N   . PRO B  1 213 ? -67.95858 -18.06760  46.82474  1.000 45.08113  ? 193 PRO A N   1 
ATOM   4801  C CA  . PRO B  1 213 ? -69.27918 -18.38075  47.38878  1.000 45.88340  ? 193 PRO A CA  1 
ATOM   4802  C C   . PRO B  1 213 ? -69.28479 -18.17864  48.89585  1.000 47.29274  ? 193 PRO A C   1 
ATOM   4803  O O   . PRO B  1 213 ? -68.44112 -18.72344  49.61193  1.000 43.51395  ? 193 PRO A O   1 
ATOM   4804  C CB  . PRO B  1 213 ? -69.48608 -19.85696  47.02651  1.000 54.14241  ? 193 PRO A CB  1 
ATOM   4805  C CG  . PRO B  1 213 ? -68.32281 -20.23575  46.14909  1.000 54.78845  ? 193 PRO A CG  1 
ATOM   4806  C CD  . PRO B  1 213 ? -67.22385 -19.27745  46.43649  1.000 44.88287  ? 193 PRO A CD  1 
ATOM   4807  N N   . GLY B  1 214 ? -70.25315 -17.39633  49.37399  1.000 51.17428  ? 194 GLY A N   1 
ATOM   4808  C CA  . GLY B  1 214 ? -70.35198 -17.11300  50.78813  1.000 48.41705  ? 194 GLY A CA  1 
ATOM   4809  C C   . GLY B  1 214 ? -70.96515 -18.25220  51.58239  1.000 47.87872  ? 194 GLY A C   1 
ATOM   4810  O O   . GLY B  1 214 ? -71.58197 -19.17568  51.05318  1.000 45.63476  ? 194 GLY A O   1 
ATOM   4811  N N   . ILE B  1 215 ? -70.78359 -18.17603  52.89069  1.000 46.57030  ? 195 ILE A N   1 
ATOM   4812  C CA  . ILE B  1 215 ? -71.37245 -19.17445  53.78916  1.000 48.70044  ? 195 ILE A CA  1 
ATOM   4813  C C   . ILE B  1 215 ? -72.86838 -18.90719  53.91532  1.000 61.00632  ? 195 ILE A C   1 
ATOM   4814  O O   . ILE B  1 215 ? -73.28092 -17.73111  53.95144  1.000 61.33651  ? 195 ILE A O   1 
ATOM   4815  C CB  . ILE B  1 215 ? -70.68467 -19.11665  55.15498  1.000 47.75241  ? 195 ILE A CB  1 
ATOM   4816  C CG1 . ILE B  1 215 ? -69.21096 -19.51300  55.04753  1.000 48.93324  ? 195 ILE A CG1 1 
ATOM   4817  C CG2 . ILE B  1 215 ? -71.43760 -19.95224  56.19983  1.000 49.24990  ? 195 ILE A CG2 1 
ATOM   4818  C CD1 . ILE B  1 215 ? -68.36271 -18.94586  56.16770  1.000 39.59126  ? 195 ILE A CD1 1 
ATOM   4819  N N   . PRO B  1 216 ? -73.71747 -19.93708  53.96458  1.000 60.04066  ? 196 PRO A N   1 
ATOM   4820  C CA  . PRO B  1 216 ? -75.15198 -19.69768  54.16828  1.000 58.23772  ? 196 PRO A CA  1 
ATOM   4821  C C   . PRO B  1 216 ? -75.42828 -19.05430  55.52011  1.000 57.34204  ? 196 PRO A C   1 
ATOM   4822  O O   . PRO B  1 216 ? -74.78671 -19.36470  56.52633  1.000 53.25220  ? 196 PRO A O   1 
ATOM   4823  C CB  . PRO B  1 216 ? -75.76326 -21.09931  54.08373  1.000 67.61594  ? 196 PRO A CB  1 
ATOM   4824  C CG  . PRO B  1 216 ? -74.75848 -21.91173  53.32865  1.000 62.76247  ? 196 PRO A CG  1 
ATOM   4825  C CD  . PRO B  1 216 ? -73.42393 -21.35456  53.70171  1.000 58.55384  ? 196 PRO A CD  1 
ATOM   4826  N N   . GLY B  1 217 ? -76.40752 -18.15073  55.53650  1.000 64.61438  ? 197 GLY A N   1 
ATOM   4827  C CA  . GLY B  1 217 ? -76.73327 -17.39833  56.72774  1.000 68.97341  ? 197 GLY A CA  1 
ATOM   4828  C C   . GLY B  1 217 ? -75.76207 -16.28918  57.07549  1.000 59.40314  ? 197 GLY A C   1 
ATOM   4829  O O   . GLY B  1 217 ? -76.08989 -15.44793  57.91849  1.000 67.33033  ? 197 GLY A O   1 
ATOM   4830  N N   . ASN B  1 218 ? -74.56930 -16.28324  56.48170  1.000 51.92177  ? 198 ASN A N   1 
ATOM   4831  C CA  . ASN B  1 218 ? -73.73137 -15.09491  56.49070  1.000 50.15959  ? 198 ASN A CA  1 
ATOM   4832  C C   . ASN B  1 218 ? -72.96004 -14.95085  55.16522  1.000 53.08140  ? 198 ASN A C   1 
ATOM   4833  O O   . ASN B  1 218 ? -71.81601 -15.37731  55.03234  1.000 59.48408  ? 198 ASN A O   1 
ATOM   4834  C CB  . ASN B  1 218 ? -72.85668 -15.04632  57.78056  1.000 51.58515  ? 198 ASN A CB  1 
ATOM   4835  C CG  . ASN B  1 218 ? -71.67779 -16.05792  57.84043  1.000 62.81751  ? 198 ASN A CG  1 
ATOM   4836  O OD1 . ASN B  1 218 ? -71.49619 -16.92195  56.98172  1.000 73.21055  ? 198 ASN A OD1 1 
ATOM   4837  N ND2 . ASN B  1 218 ? -70.88315 -15.94712  58.91872  1.000 68.71184  ? 198 ASN A ND2 1 
ATOM   4838  N N   . GLU B  1 219 ? -73.59056 -14.31133  54.17814  1.000 49.11702  ? 199 GLU A N   1 
ATOM   4839  C CA  . GLU B  1 219 ? -72.93221 -14.22047  52.87999  1.000 46.55404  ? 199 GLU A CA  1 
ATOM   4840  C C   . GLU B  1 219 ? -71.73539 -13.28529  52.90719  1.000 46.76261  ? 199 GLU A C   1 
ATOM   4841  O O   . GLU B  1 219 ? -71.09884 -13.10256  51.86819  1.000 46.13500  ? 199 GLU A O   1 
ATOM   4842  C CB  . GLU B  1 219 ? -73.91629 -13.79577  51.77571  1.000 60.18461  ? 199 GLU A CB  1 
ATOM   4843  C CG  . GLU B  1 219 ? -73.58104 -14.41181  50.41787  1.000 68.97034  ? 199 GLU A CG  1 
ATOM   4844  C CD  . GLU B  1 219 ? -74.13984 -15.80939  50.26964  1.000 75.17942  ? 199 GLU A CD  1 
ATOM   4845  O OE1 . GLU B  1 219 ? -75.15684 -16.12817  50.92365  1.000 80.90488  ? 199 GLU A OE1 1 
ATOM   4846  O OE2 . GLU B  1 219 ? -73.56993 -16.57965  49.47445  1.000 73.67238  ? 199 GLU A OE2 1 
ATOM   4847  N N   . GLY B  1 220 ? -71.38160 -12.73619  54.06932  1.000 46.11277  ? 200 GLY A N   1 
ATOM   4848  C CA  . GLY B  1 220 ? -70.24627 -11.85488  54.18829  1.000 43.66266  ? 200 GLY A CA  1 
ATOM   4849  C C   . GLY B  1 220 ? -68.92233 -12.52541  54.43645  1.000 58.74707  ? 200 GLY A C   1 
ATOM   4850  O O   . GLY B  1 220 ? -67.91701 -11.83260  54.62026  1.000 84.16806  ? 200 GLY A O   1 
ATOM   4851  N N   . PHE B  1 221 ? -68.86951 -13.85220  54.45300  1.000 42.27183  ? 201 PHE A N   1 
ATOM   4852  C CA  . PHE B  1 221 ? -67.62114 -14.55445  54.70392  1.000 44.07146  ? 201 PHE A CA  1 
ATOM   4853  C C   . PHE B  1 221 ? -67.58396 -15.82936  53.87975  1.000 39.90126  ? 201 PHE A C   1 
ATOM   4854  O O   . PHE B  1 221 ? -68.61715 -16.34072  53.44000  1.000 45.23780  ? 201 PHE A O   1 
ATOM   4855  C CB  . PHE B  1 221 ? -67.43921 -14.87573  56.19440  1.000 44.78293  ? 201 PHE A CB  1 
ATOM   4856  C CG  . PHE B  1 221 ? -67.19240 -13.66298  57.04585  1.000 38.47892  ? 201 PHE A CG  1 
ATOM   4857  C CD1 . PHE B  1 221 ? -65.90367 -13.31290  57.41349  1.000 36.88054  ? 201 PHE A CD1 1 
ATOM   4858  C CD2 . PHE B  1 221 ? -68.24904 -12.87477  57.48147  1.000 38.83436  ? 201 PHE A CD2 1 
ATOM   4859  C CE1 . PHE B  1 221 ? -65.67071 -12.18915  58.19538  1.000 43.01927  ? 201 PHE A CE1 1 
ATOM   4860  C CE2 . PHE B  1 221 ? -68.02499 -11.75469  58.25781  1.000 40.33197  ? 201 PHE A CE2 1 
ATOM   4861  C CZ  . PHE B  1 221 ? -66.73234 -11.41136  58.61750  1.000 39.61289  ? 201 PHE A CZ  1 
ATOM   4862  N N   . ALA B  1 222 ? -66.37150 -16.33738  53.67557  1.000 38.99062  ? 202 ALA A N   1 
ATOM   4863  C CA  . ALA B  1 222 ? -66.14714 -17.53572  52.88289  1.000 39.29837  ? 202 ALA A CA  1 
ATOM   4864  C C   . ALA B  1 222 ? -65.25318 -18.49958  53.65184  1.000 43.34771  ? 202 ALA A C   1 
ATOM   4865  O O   . ALA B  1 222 ? -64.56060 -18.11754  54.59886  1.000 49.19533  ? 202 ALA A O   1 
ATOM   4866  C CB  . ALA B  1 222 ? -65.51927 -17.19949  51.52339  1.000 39.59500  ? 202 ALA A CB  1 
ATOM   4867  N N   . LEU B  1 223 ? -65.28144 -19.76357  53.23296  1.000 44.36882  ? 203 LEU A N   1 
ATOM   4868  C CA  . LEU B  1 223 ? -64.49326 -20.82598  53.84778  1.000 38.18456  ? 203 LEU A CA  1 
ATOM   4869  C C   . LEU B  1 223 ? -63.31529 -21.13525  52.93379  1.000 40.27190  ? 203 LEU A C   1 
ATOM   4870  O O   . LEU B  1 223 ? -63.48344 -21.76533  51.88516  1.000 52.40876  ? 203 LEU A O   1 
ATOM   4871  C CB  . LEU B  1 223 ? -65.34389 -22.06976  54.09599  1.000 38.42250  ? 203 LEU A CB  1 
ATOM   4872  C CG  . LEU B  1 223 ? -66.38382 -21.96452  55.21559  1.000 38.69741  ? 203 LEU A CG  1 
ATOM   4873  C CD1 . LEU B  1 223 ? -67.09712 -23.29639  55.41023  1.000 40.28061  ? 203 LEU A CD1 1 
ATOM   4874  C CD2 . LEU B  1 223 ? -65.75048 -21.50417  56.51664  1.000 37.41451  ? 203 LEU A CD2 1 
ATOM   4875  N N   . ALA B  1 224 ? -62.12829 -20.69155  53.33531  1.000 38.53614  ? 204 ALA A N   1 
ATOM   4876  C CA  . ALA B  1 224 ? -60.90797 -20.86492  52.55976  1.000 36.28444  ? 204 ALA A CA  1 
ATOM   4877  C C   . ALA B  1 224 ? -60.13322 -22.06464  53.08493  1.000 34.98516  ? 204 ALA A C   1 
ATOM   4878  O O   . ALA B  1 224 ? -59.93140 -22.19663  54.29668  1.000 34.15719  ? 204 ALA A O   1 
ATOM   4879  C CB  . ALA B  1 224 ? -60.04189 -19.60836  52.62915  1.000 37.20813  ? 204 ALA A CB  1 
ATOM   4880  N N   . SER B  1 225 ? -59.68601 -22.92416  52.17451  1.000 39.97162  ? 205 SER A N   1 
ATOM   4881  C CA  . SER B  1 225 ? -59.05512 -24.17457  52.57639  1.000 34.88379  ? 205 SER A CA  1 
ATOM   4882  C C   . SER B  1 225 ? -57.64596 -23.92169  53.09441  1.000 35.87027  ? 205 SER A C   1 
ATOM   4883  O O   . SER B  1 225 ? -56.80461 -23.35292  52.39017  1.000 33.43126  ? 205 SER A O   1 
ATOM   4884  C CB  . SER B  1 225 ? -59.02754 -25.15716  51.40959  1.000 42.56171  ? 205 SER A CB  1 
ATOM   4885  O OG  . SER B  1 225 ? -58.61933 -26.44395  51.84544  1.000 36.32664  ? 205 SER A OG  1 
ATOM   4886  N N   . MET B  1 226 ? -57.39231 -24.34550  54.33068  1.000 37.93206  ? 206 MET A N   1 
ATOM   4887  C CA  . MET B  1 226 ? -56.04955 -24.34121  54.89150  1.000 33.55489  ? 206 MET A CA  1 
ATOM   4888  C C   . MET B  1 226 ? -55.17808 -25.47958  54.37749  1.000 32.21608  ? 206 MET A C   1 
ATOM   4889  O O   . MET B  1 226 ? -54.02202 -25.59354  54.80222  1.000 38.00507  ? 206 MET A O   1 
ATOM   4890  C CB  . MET B  1 226 ? -56.11669 -24.38916  56.42207  1.000 32.34860  ? 206 MET A CB  1 
ATOM   4891  C CG  . MET B  1 226 ? -57.29300 -23.64098  57.02750  1.000 31.19446  ? 206 MET A CG  1 
ATOM   4892  S SD  . MET B  1 226 ? -57.69361 -24.14632  58.71448  1.000 42.97766  ? 206 MET A SD  1 
ATOM   4893  C CE  . MET B  1 226 ? -56.11825 -23.96499  59.51769  1.000 29.43216  ? 206 MET A CE  1 
ATOM   4894  N N   . GLY B  1 227 ? -55.68737 -26.30788  53.47613  1.000 35.62641  ? 207 GLY A N   1 
ATOM   4895  C CA  . GLY B  1 227 ? -54.91643 -27.44482  53.01440  1.000 41.51765  ? 207 GLY A CA  1 
ATOM   4896  C C   . GLY B  1 227 ? -54.70198 -28.47939  54.09455  1.000 36.26500  ? 207 GLY A C   1 
ATOM   4897  O O   . GLY B  1 227 ? -53.60647 -29.04702  54.19723  1.000 32.08216  ? 207 GLY A O   1 
ATOM   4898  N N   . ILE B  1 228 ? -55.72096 -28.73031  54.91217  1.000 32.52363  ? 208 ILE A N   1 
ATOM   4899  C CA  . ILE B  1 228 ? -55.64354 -29.67620  56.01600  1.000 34.46863  ? 208 ILE A CA  1 
ATOM   4900  C C   . ILE B  1 228 ? -56.78734 -30.66082  55.85961  1.000 44.80369  ? 208 ILE A C   1 
ATOM   4901  O O   . ILE B  1 228 ? -57.95724 -30.25660  55.83370  1.000 43.10008  ? 208 ILE A O   1 
ATOM   4902  C CB  . ILE B  1 228 ? -55.70109 -28.96837  57.37585  1.000 31.11810  ? 208 ILE A CB  1 
ATOM   4903  C CG1 . ILE B  1 228 ? -54.39207 -28.22105  57.58128  1.000 38.58456  ? 208 ILE A CG1 1 
ATOM   4904  C CG2 . ILE B  1 228 ? -55.93249 -29.96284  58.49925  1.000 31.01941  ? 208 ILE A CG2 1 
ATOM   4905  C CD1 . ILE B  1 228 ? -54.39831 -27.31960  58.74876  1.000 29.31545  ? 208 ILE A CD1 1 
ATOM   4906  N N   . TYR B  1 229 ? -56.45031 -31.94487  55.73763  1.000 33.40324  ? 209 TYR A N   1 
ATOM   4907  C CA  . TYR B  1 229 ? -57.42330 -32.98355  55.44217  1.000 35.87283  ? 209 TYR A CA  1 
ATOM   4908  C C   . TYR B  1 229 ? -57.24771 -34.15081  56.40044  1.000 45.72603  ? 209 TYR A C   1 
ATOM   4909  O O   . TYR B  1 229 ? -56.12459 -34.60142  56.65195  1.000 37.83363  ? 209 TYR A O   1 
ATOM   4910  C CB  . TYR B  1 229 ? -57.29133 -33.49501  54.00048  1.000 35.60799  ? 209 TYR A CB  1 
ATOM   4911  C CG  . TYR B  1 229 ? -56.91534 -32.44503  52.98343  1.000 40.13853  ? 209 TYR A CG  1 
ATOM   4912  C CD1 . TYR B  1 229 ? -57.86528 -31.56280  52.48845  1.000 44.71682  ? 209 TYR A CD1 1 
ATOM   4913  C CD2 . TYR B  1 229 ? -55.61414 -32.34650  52.50608  1.000 34.96109  ? 209 TYR A CD2 1 
ATOM   4914  C CE1 . TYR B  1 229 ? -57.53090 -30.60765  51.55362  1.000 49.57756  ? 209 TYR A CE1 1 
ATOM   4915  C CE2 . TYR B  1 229 ? -55.26826 -31.39764  51.57151  1.000 35.01978  ? 209 TYR A CE2 1 
ATOM   4916  C CZ  . TYR B  1 229 ? -56.23260 -30.52649  51.09980  1.000 53.93072  ? 209 TYR A CZ  1 
ATOM   4917  O OH  . TYR B  1 229 ? -55.90768 -29.56854  50.16957  1.000 63.01096  ? 209 TYR A OH  1 
ATOM   4918  N N   . VAL B  1 230 ? -58.36569 -34.64618  56.92015  1.000 39.01771  ? 210 VAL A N   1 
ATOM   4919  C CA  . VAL B  1 230 ? -58.38310 -35.82870  57.76755  1.000 38.31290  ? 210 VAL A CA  1 
ATOM   4920  C C   . VAL B  1 230 ? -59.16772 -36.90564  57.03518  1.000 45.04248  ? 210 VAL A C   1 
ATOM   4921  O O   . VAL B  1 230 ? -60.32312 -36.68501  56.65154  1.000 45.98359  ? 210 VAL A O   1 
ATOM   4922  C CB  . VAL B  1 230 ? -58.99783 -35.53867  59.14569  1.000 38.85373  ? 210 VAL A CB  1 
ATOM   4923  C CG1 . VAL B  1 230 ? -59.15402 -36.83054  59.93555  1.000 35.50072  ? 210 VAL A CG1 1 
ATOM   4924  C CG2 . VAL B  1 230 ? -58.14560 -34.53594  59.90618  1.000 33.63213  ? 210 VAL A CG2 1 
ATOM   4925  N N   . PHE B  1 231 ? -58.53510 -38.05756  56.82809  1.000 45.98110  ? 211 PHE A N   1 
ATOM   4926  C CA  . PHE B  1 231 ? -59.16941 -39.22790  56.24081  1.000 40.52751  ? 211 PHE A CA  1 
ATOM   4927  C C   . PHE B  1 231 ? -59.09402 -40.40127  57.20550  1.000 38.80235  ? 211 PHE A C   1 
ATOM   4928  O O   . PHE B  1 231 ? -58.23962 -40.45075  58.09650  1.000 37.68119  ? 211 PHE A O   1 
ATOM   4929  C CB  . PHE B  1 231 ? -58.49745 -39.67409  54.93000  1.000 39.15441  ? 211 PHE A CB  1 
ATOM   4930  C CG  . PHE B  1 231 ? -58.27986 -38.57819  53.92259  1.000 47.98758  ? 211 PHE A CG  1 
ATOM   4931  C CD1 . PHE B  1 231 ? -57.17947 -37.74499  54.01382  1.000 37.58726  ? 211 PHE A CD1 1 
ATOM   4932  C CD2 . PHE B  1 231 ? -59.14167 -38.42606  52.84611  1.000 43.82261  ? 211 PHE A CD2 1 
ATOM   4933  C CE1 . PHE B  1 231 ? -56.96107 -36.76000  53.07683  1.000 48.19506  ? 211 PHE A CE1 1 
ATOM   4934  C CE2 . PHE B  1 231 ? -58.92844 -37.43768  51.90158  1.000 40.15040  ? 211 PHE A CE2 1 
ATOM   4935  C CZ  . PHE B  1 231 ? -57.83792 -36.60393  52.01623  1.000 43.21363  ? 211 PHE A CZ  1 
ATOM   4936  N N   . HIS B  1 232 ? -59.99419 -41.35971  57.00646  1.000 48.52144  ? 212 HIS A N   1 
ATOM   4937  C CA  . HIS B  1 232 ? -59.69718 -42.72549  57.40806  1.000 40.74821  ? 212 HIS A CA  1 
ATOM   4938  C C   . HIS B  1 232 ? -58.59095 -43.25277  56.50461  1.000 40.67391  ? 212 HIS A C   1 
ATOM   4939  O O   . HIS B  1 232 ? -58.58889 -43.00553  55.29513  1.000 41.20105  ? 212 HIS A O   1 
ATOM   4940  C CB  . HIS B  1 232 ? -60.93981 -43.61066  57.31609  1.000 42.53418  ? 212 HIS A CB  1 
ATOM   4941  C CG  . HIS B  1 232 ? -61.90165 -43.42329  58.44829  1.000 44.67258  ? 212 HIS A CG  1 
ATOM   4942  N ND1 . HIS B  1 232 ? -63.00456 -42.60088  58.35977  1.000 44.18117  ? 212 HIS A ND1 1 
ATOM   4943  C CD2 . HIS B  1 232 ? -61.92744 -43.95352  59.69426  1.000 43.16794  ? 212 HIS A CD2 1 
ATOM   4944  C CE1 . HIS B  1 232 ? -63.66575 -42.62908  59.50311  1.000 43.31580  ? 212 HIS A CE1 1 
ATOM   4945  N NE2 . HIS B  1 232 ? -63.03383 -43.44303  60.32947  1.000 43.07114  ? 212 HIS A NE2 1 
ATOM   4946  N N   . THR B  1 233 ? -57.62697 -43.95205  57.10245  1.000 40.04901  ? 213 THR A N   1 
ATOM   4947  C CA  . THR B  1 233 ? -56.42605 -44.32613  56.36432  1.000 39.77742  ? 213 THR A CA  1 
ATOM   4948  C C   . THR B  1 233 ? -56.76729 -45.18328  55.15558  1.000 42.42777  ? 213 THR A C   1 
ATOM   4949  O O   . THR B  1 233 ? -56.33701 -44.88577  54.04223  1.000 41.53805  ? 213 THR A O   1 
ATOM   4950  C CB  . THR B  1 233 ? -55.44693 -45.05097  57.28379  1.000 51.74975  ? 213 THR A CB  1 
ATOM   4951  O OG1 . THR B  1 233 ? -55.10734 -44.19449  58.38126  1.000 53.45983  ? 213 THR A OG1 1 
ATOM   4952  C CG2 . THR B  1 233 ? -54.17601 -45.43188  56.53153  1.000 55.15431  ? 213 THR A CG2 1 
ATOM   4953  N N   . LYS B  1 234 ? -57.57884 -46.22608  55.34907  1.000 42.73630  ? 214 LYS A N   1 
ATOM   4954  C CA  . LYS B  1 234 ? -57.89376 -47.13673  54.25198  1.000 48.24168  ? 214 LYS A CA  1 
ATOM   4955  C C   . LYS B  1 234 ? -58.56535 -46.39984  53.09978  1.000 48.07828  ? 214 LYS A C   1 
ATOM   4956  O O   . LYS B  1 234 ? -58.22326 -46.60803  51.92915  1.000 45.86900  ? 214 LYS A O   1 
ATOM   4957  C CB  . LYS B  1 234 ? -58.77937 -48.27868  54.75591  1.000 51.44156  ? 214 LYS A CB  1 
ATOM   4958  C CG  . LYS B  1 234 ? -58.04011 -49.59830  54.97707  1.000 59.22229  ? 214 LYS A CG  1 
ATOM   4959  C CD  . LYS B  1 234 ? -57.01607 -49.49280  56.10903  1.000 61.12072  ? 214 LYS A CD  1 
ATOM   4960  C CE  . LYS B  1 234 ? -57.67459 -49.51804  57.48798  1.000 61.14493  ? 214 LYS A CE  1 
ATOM   4961  N NZ  . LYS B  1 234 ? -56.72084 -49.14176  58.58347  1.000 53.89387  ? 214 LYS A NZ  1 
ATOM   4962  N N   . PHE B  1 235 ? -59.52514 -45.52776  53.41298  1.000 45.08818  ? 215 PHE A N   1 
ATOM   4963  C CA  . PHE B  1 235 ? -60.19482 -44.77379  52.35891  1.000 45.81389  ? 215 PHE A CA  1 
ATOM   4964  C C   . PHE B  1 235 ? -59.20819 -43.90075  51.59487  1.000 52.09512  ? 215 PHE A C   1 
ATOM   4965  O O   . PHE B  1 235 ? -59.27904 -43.80671  50.36277  1.000 55.39590  ? 215 PHE A O   1 
ATOM   4966  C CB  . PHE B  1 235 ? -61.32124 -43.92258  52.94725  1.000 47.29618  ? 215 PHE A CB  1 
ATOM   4967  C CG  . PHE B  1 235 ? -62.03119 -43.07104  51.92759  1.000 51.02944  ? 215 PHE A CG  1 
ATOM   4968  C CD1 . PHE B  1 235 ? -63.07099 -43.59191  51.16836  1.000 48.43066  ? 215 PHE A CD1 1 
ATOM   4969  C CD2 . PHE B  1 235 ? -61.65662 -41.74875  51.72716  1.000 45.32813  ? 215 PHE A CD2 1 
ATOM   4970  C CE1 . PHE B  1 235 ? -63.72551 -42.80849  50.22738  1.000 49.17370  ? 215 PHE A CE1 1 
ATOM   4971  C CE2 . PHE B  1 235 ? -62.29933 -40.96561  50.78993  1.000 46.04916  ? 215 PHE A CE2 1 
ATOM   4972  C CZ  . PHE B  1 235 ? -63.33677 -41.49216  50.03920  1.000 55.23749  ? 215 PHE A CZ  1 
ATOM   4973  N N   . LEU B  1 236 ? -58.27663 -43.25706  52.30784  1.000 43.06859  ? 216 LEU A N   1 
ATOM   4974  C CA  . LEU B  1 236 ? -57.32314 -42.37629  51.63839  1.000 47.29071  ? 216 LEU A CA  1 
ATOM   4975  C C   . LEU B  1 236 ? -56.44389 -43.14920  50.66986  1.000 49.19427  ? 216 LEU A C   1 
ATOM   4976  O O   . LEU B  1 236 ? -56.20999 -42.69911  49.54375  1.000 43.11528  ? 216 LEU A O   1 
ATOM   4977  C CB  . LEU B  1 236 ? -56.45701 -41.63023  52.65332  1.000 40.27921  ? 216 LEU A CB  1 
ATOM   4978  C CG  . LEU B  1 236 ? -55.37928 -40.75823  51.99457  1.000 41.86247  ? 216 LEU A CG  1 
ATOM   4979  C CD1 . LEU B  1 236 ? -56.00778 -39.77295  51.00863  1.000 39.94547  ? 216 LEU A CD1 1 
ATOM   4980  C CD2 . LEU B  1 236 ? -54.54401 -40.01505  53.02686  1.000 38.44986  ? 216 LEU A CD2 1 
ATOM   4981  N N   . MET B  1 237 ? -55.95789 -44.31927  51.07890  1.000 46.99069  ? 217 MET A N   1 
ATOM   4982  C CA  . MET B  1 237 ? -55.02946 -45.03176  50.22079  1.000 44.66029  ? 217 MET A CA  1 
ATOM   4983  C C   . MET B  1 237 ? -55.76341 -45.58840  48.99981  1.000 49.22913  ? 217 MET A C   1 
ATOM   4984  O O   . MET B  1 237 ? -55.18693 -45.67471  47.91097  1.000 46.15607  ? 217 MET A O   1 
ATOM   4985  C CB  . MET B  1 237 ? -54.34231 -46.12730  51.04448  1.000 48.33317  ? 217 MET A CB  1 
ATOM   4986  C CG  . MET B  1 237 ? -53.82116 -45.65694  52.45163  1.000 62.25491  ? 217 MET A CG  1 
ATOM   4987  S SD  . MET B  1 237 ? -52.31334 -44.72812  52.32025  1.000 76.38198  ? 217 MET A SD  1 
ATOM   4988  C CE  . MET B  1 237 ? -51.72889 -45.47152  50.89069  1.000 72.22015  ? 217 MET A CE  1 
ATOM   4989  N N   . GLU B  1 238 ? -57.05172 -45.91964  49.14814  1.000 54.65988  ? 218 GLU A N   1 
ATOM   4990  C CA  . GLU B  1 238 ? -57.87463 -46.23757  47.98213  1.000 54.47724  ? 218 GLU A CA  1 
ATOM   4991  C C   . GLU B  1 238 ? -57.94175 -45.04757  47.03332  1.000 53.36865  ? 218 GLU A C   1 
ATOM   4992  O O   . GLU B  1 238 ? -57.68403 -45.17864  45.83052  1.000 51.66665  ? 218 GLU A O   1 
ATOM   4993  C CB  . GLU B  1 238 ? -59.27979 -46.65826  48.42129  1.000 58.33366  ? 218 GLU A CB  1 
ATOM   4994  N N   . ALA B  1 239 ? -58.26411 -43.86651  47.56855  1.000 49.48590  ? 219 ALA A N   1 
ATOM   4995  C CA  . ALA B  1 239 ? -58.34074 -42.67158  46.73611  1.000 47.11634  ? 219 ALA A CA  1 
ATOM   4996  C C   . ALA B  1 239 ? -57.00672 -42.38052  46.06136  1.000 46.45683  ? 219 ALA A C   1 
ATOM   4997  O O   . ALA B  1 239 ? -56.96905 -41.98127  44.89129  1.000 47.23068  ? 219 ALA A O   1 
ATOM   4998  C CB  . ALA B  1 239 ? -58.79273 -41.47704  47.57376  1.000 45.91391  ? 219 ALA A CB  1 
ATOM   4999  N N   . LEU B  1 240 ? -55.89920 -42.58805  46.77741  1.000 45.12649  ? 220 LEU A N   1 
ATOM   5000  C CA  . LEU B  1 240 ? -54.58687 -42.31473  46.19911  1.000 44.51459  ? 220 LEU A CA  1 
ATOM   5001  C C   . LEU B  1 240 ? -54.24983 -43.30170  45.08958  1.000 59.03152  ? 220 LEU A C   1 
ATOM   5002  O O   . LEU B  1 240 ? -53.60757 -42.93337  44.09756  1.000 55.81643  ? 220 LEU A O   1 
ATOM   5003  C CB  . LEU B  1 240 ? -53.51584 -42.34699  47.28678  1.000 42.84526  ? 220 LEU A CB  1 
ATOM   5004  C CG  . LEU B  1 240 ? -53.67007 -41.32987  48.41843  1.000 51.74881  ? 220 LEU A CG  1 
ATOM   5005  C CD1 . LEU B  1 240 ? -52.64441 -41.59391  49.51693  1.000 52.71708  ? 220 LEU A CD1 1 
ATOM   5006  C CD2 . LEU B  1 240 ? -53.55755 -39.90275  47.88772  1.000 40.81029  ? 220 LEU A CD2 1 
ATOM   5007  N N   . ARG B  1 241 ? -54.66480 -44.56244  45.24127  1.000 47.06282  ? 221 ARG A N   1 
ATOM   5008  C CA  . ARG B  1 241 ? -54.43729 -45.53363  44.17869  1.000 51.31524  ? 221 ARG A CA  1 
ATOM   5009  C C   . ARG B  1 241 ? -55.28652 -45.21386  42.95446  1.000 57.59377  ? 221 ARG A C   1 
ATOM   5010  O O   . ARG B  1 241 ? -54.79925 -45.28795  41.82007  1.000 57.58076  ? 221 ARG A O   1 
ATOM   5011  C CB  . ARG B  1 241 ? -54.71626 -46.94731  44.68825  1.000 57.78748  ? 221 ARG A CB  1 
ATOM   5012  C CG  . ARG B  1 241 ? -53.68807 -47.43712  45.70303  1.000 52.83694  ? 221 ARG A CG  1 
ATOM   5013  C CD  . ARG B  1 241 ? -53.53922 -48.95205  45.68972  1.000 50.42762  ? 221 ARG A CD  1 
ATOM   5014  N NE  . ARG B  1 241 ? -52.43925 -49.37849  46.55287  1.000 54.14823  ? 221 ARG A NE  1 
ATOM   5015  C CZ  . ARG B  1 241 ? -52.55795 -49.62142  47.85595  1.000 51.36455  ? 221 ARG A CZ  1 
ATOM   5016  N NH1 . ARG B  1 241 ? -53.73521 -49.49107  48.45555  1.000 47.49682  ? 221 ARG A NH1 1 
ATOM   5017  N NH2 . ARG B  1 241 ? -51.49897 -49.99814  48.56053  1.000 47.99940  ? 221 ARG A NH2 1 
ATOM   5018  N N   . ARG B  1 242 ? -56.55435 -44.84423  43.16017  1.000 57.75784  ? 222 ARG A N   1 
ATOM   5019  C CA  . ARG B  1 242 ? -57.38827 -44.45894  42.02732  1.000 56.43155  ? 222 ARG A CA  1 
ATOM   5020  C C   . ARG B  1 242 ? -56.84171 -43.20376  41.35793  1.000 65.65369  ? 222 ARG A C   1 
ATOM   5021  O O   . ARG B  1 242 ? -56.89746 -43.07033  40.12975  1.000 68.36008  ? 222 ARG A O   1 
ATOM   5022  C CB  . ARG B  1 242 ? -58.83619 -44.25001  42.47255  1.000 53.05444  ? 222 ARG A CB  1 
ATOM   5023  C CG  . ARG B  1 242 ? -59.75572 -43.70114  41.37693  1.000 59.22158  ? 222 ARG A CG  1 
ATOM   5024  C CD  . ARG B  1 242 ? -60.16627 -42.25326  41.64723  1.000 68.97233  ? 222 ARG A CD  1 
ATOM   5025  N NE  . ARG B  1 242 ? -60.88409 -42.11605  42.91565  1.000 77.71612  ? 222 ARG A NE  1 
ATOM   5026  C CZ  . ARG B  1 242 ? -60.38751 -41.53009  44.00362  1.000 78.51451  ? 222 ARG A CZ  1 
ATOM   5027  N NH1 . ARG B  1 242 ? -61.11528 -41.45739  45.11380  1.000 76.01113  ? 222 ARG A NH1 1 
ATOM   5028  N NH2 . ARG B  1 242 ? -59.15602 -41.03404  43.98747  1.000 76.18795  ? 222 ARG A NH2 1 
ATOM   5029  N N   . ASP B  1 243 ? -56.28471 -42.28004  42.14856  1.000 61.98937  ? 223 ASP A N   1 
ATOM   5030  C CA  . ASP B  1 243 ? -55.67772 -41.08792  41.56590  1.000 60.05331  ? 223 ASP A CA  1 
ATOM   5031  C C   . ASP B  1 243 ? -54.41204 -41.42684  40.79149  1.000 61.75852  ? 223 ASP A C   1 
ATOM   5032  O O   . ASP B  1 243 ? -54.05928 -40.71323  39.84552  1.000 63.89165  ? 223 ASP A O   1 
ATOM   5033  C CB  . ASP B  1 243 ? -55.38474 -40.05217  42.65388  1.000 58.50103  ? 223 ASP A CB  1 
ATOM   5034  C CG  . ASP B  1 243 ? -54.80165 -38.76012  42.09166  1.000 68.73454  ? 223 ASP A CG  1 
ATOM   5035  O OD1 . ASP B  1 243 ? -55.54468 -37.75563  42.00645  1.000 66.39042  ? 223 ASP A OD1 1 
ATOM   5036  O OD2 . ASP B  1 243 ? -53.59347 -38.73833  41.76283  1.000 74.30831  ? 223 ASP A OD2 1 
ATOM   5037  N N   . ALA B  1 244 ? -53.72661 -42.51186  41.16239  1.000 57.76852  ? 224 ALA A N   1 
ATOM   5038  C CA  . ALA B  1 244 ? -52.50366 -42.88572  40.45951  1.000 60.99280  ? 224 ALA A CA  1 
ATOM   5039  C C   . ALA B  1 244 ? -52.79187 -43.47741  39.08426  1.000 58.19233  ? 224 ALA A C   1 
ATOM   5040  O O   . ALA B  1 244 ? -51.94292 -43.39490  38.18822  1.000 53.96372  ? 224 ALA A O   1 
ATOM   5041  C CB  . ALA B  1 244 ? -51.69327 -43.87088  41.30010  1.000 61.20905  ? 224 ALA A CB  1 
ATOM   5042  N N   . ALA B  1 245 ? -53.96687 -44.07820  38.89498  1.000 60.20926  ? 225 ALA A N   1 
ATOM   5043  C CA  . ALA B  1 245 ? -54.34532 -44.62325  37.59638  1.000 63.61585  ? 225 ALA A CA  1 
ATOM   5044  C C   . ALA B  1 245 ? -55.02958 -43.60227  36.69610  1.000 65.38098  ? 225 ALA A C   1 
ATOM   5045  O O   . ALA B  1 245 ? -55.18976 -43.86550  35.49856  1.000 62.91676  ? 225 ALA A O   1 
ATOM   5046  C CB  . ALA B  1 245 ? -55.26134 -45.83944  37.77246  1.000 60.39218  ? 225 ALA A CB  1 
ATOM   5047  N N   . ASP B  1 246 ? -55.40755 -42.44722  37.23233  1.000 75.08010  ? 226 ASP A N   1 
ATOM   5048  C CA  . ASP B  1 246 ? -56.11300 -41.43908  36.45379  1.000 65.50527  ? 226 ASP A CA  1 
ATOM   5049  C C   . ASP B  1 246 ? -55.11331 -40.59573  35.67446  1.000 59.09291  ? 226 ASP A C   1 
ATOM   5050  O O   . ASP B  1 246 ? -54.29002 -39.90616  36.28606  1.000 56.16842  ? 226 ASP A O   1 
ATOM   5051  C CB  . ASP B  1 246 ? -56.95339 -40.55125  37.36289  1.000 64.13525  ? 226 ASP A CB  1 
ATOM   5052  C CG  . ASP B  1 246 ? -58.06462 -39.82782  36.61404  1.000 75.83801  ? 226 ASP A CG  1 
ATOM   5053  O OD1 . ASP B  1 246 ? -58.96627 -39.26231  37.27171  1.000 82.87242  ? 226 ASP A OD1 1 
ATOM   5054  O OD2 . ASP B  1 246 ? -58.04131 -39.82582  35.36543  1.000 84.77907  ? 226 ASP A OD2 1 
ATOM   5055  N N   . PRO B  1 247 ? -55.13886 -40.62851  34.34152  1.000 59.54388  ? 227 PRO A N   1 
ATOM   5056  C CA  . PRO B  1 247 ? -54.26383 -39.73633  33.57157  1.000 56.58301  ? 227 PRO A CA  1 
ATOM   5057  C C   . PRO B  1 247 ? -54.73072 -38.29681  33.58657  1.000 58.66818  ? 227 PRO A C   1 
ATOM   5058  O O   . PRO B  1 247 ? -53.91222 -37.39484  33.36807  1.000 57.42102  ? 227 PRO A O   1 
ATOM   5059  C CB  . PRO B  1 247 ? -54.31490 -40.32353  32.15143  1.000 64.30696  ? 227 PRO A CB  1 
ATOM   5060  C CG  . PRO B  1 247 ? -55.09519 -41.61875  32.26877  1.000 65.15673  ? 227 PRO A CG  1 
ATOM   5061  C CD  . PRO B  1 247 ? -55.95726 -41.48268  33.47182  1.000 62.83040  ? 227 PRO A CD  1 
ATOM   5062  N N   . THR B  1 248 ? -56.02109 -38.05379  33.83252  1.000 66.87182  ? 228 THR A N   1 
ATOM   5063  C CA  . THR B  1 248 ? -56.51814 -36.68628  33.93330  1.000 59.04139  ? 228 THR A CA  1 
ATOM   5064  C C   . THR B  1 248 ? -56.00682 -35.99653  35.18978  1.000 60.49829  ? 228 THR A C   1 
ATOM   5065  O O   . THR B  1 248 ? -55.85265 -34.76958  35.20201  1.000 59.75534  ? 228 THR A O   1 
ATOM   5066  C CB  . THR B  1 248 ? -58.04760 -36.67578  33.93001  1.000 64.45287  ? 228 THR A CB  1 
ATOM   5067  O OG1 . THR B  1 248 ? -58.53097 -37.16749  35.18650  1.000 70.83054  ? 228 THR A OG1 1 
ATOM   5068  C CG2 . THR B  1 248 ? -58.59032 -37.55313  32.81252  1.000 64.79328  ? 228 THR A CG2 1 
ATOM   5069  N N   . SER B  1 249 ? -55.73570 -36.76224  36.24596  1.000 63.83256  ? 229 SER A N   1 
ATOM   5070  C CA  . SER B  1 249 ? -55.41316 -36.17944  37.54340  1.000 57.60690  ? 229 SER A CA  1 
ATOM   5071  C C   . SER B  1 249 ? -54.02870 -35.53969  37.53359  1.000 51.85391  ? 229 SER A C   1 
ATOM   5072  O O   . SER B  1 249 ? -53.03508 -36.18379  37.18441  1.000 66.60498  ? 229 SER A O   1 
ATOM   5073  C CB  . SER B  1 249 ? -55.49184 -37.25308  38.63068  1.000 60.13556  ? 229 SER A CB  1 
ATOM   5074  O OG  . SER B  1 249 ? -55.01549 -36.76866  39.87525  1.000 60.28725  ? 229 SER A OG  1 
ATOM   5075  N N   . SER B  1 250 ? -53.96199 -34.27010  37.93226  1.000 51.30506  ? 230 SER A N   1 
ATOM   5076  C CA  . SER B  1 250 ? -52.67666 -33.60878  38.14327  1.000 52.98359  ? 230 SER A CA  1 
ATOM   5077  C C   . SER B  1 250 ? -51.99762 -34.04787  39.44336  1.000 54.97796  ? 230 SER A C   1 
ATOM   5078  O O   . SER B  1 250 ? -50.98215 -33.44659  39.83097  1.000 59.64724  ? 230 SER A O   1 
ATOM   5079  C CB  . SER B  1 250 ? -52.85619 -32.08858  38.12387  1.000 64.08821  ? 230 SER A CB  1 
ATOM   5080  O OG  . SER B  1 250 ? -53.37630 -31.61124  39.35251  1.000 60.05804  ? 230 SER A OG  1 
ATOM   5081  N N   . ARG B  1 251 ? -52.56250 -35.07794  40.08018  1.000 53.77808  ? 231 ARG A N   1 
ATOM   5082  C CA  . ARG B  1 251 ? -51.96765 -35.72514  41.24898  1.000 56.47302  ? 231 ARG A CA  1 
ATOM   5083  C C   . ARG B  1 251 ? -51.83264 -34.74722  42.41410  1.000 57.17242  ? 231 ARG A C   1 
ATOM   5084  O O   . ARG B  1 251 ? -50.76025 -34.58965  43.00309  1.000 57.75340  ? 231 ARG A O   1 
ATOM   5085  C CB  . ARG B  1 251 ? -50.61481 -36.35592  40.89517  1.000 55.33470  ? 231 ARG A CB  1 
ATOM   5086  C CG  . ARG B  1 251 ? -50.57688 -37.07403  39.54212  1.000 49.95985  ? 231 ARG A CG  1 
ATOM   5087  C CD  . ARG B  1 251 ? -51.36298 -38.37702  39.58774  1.000 57.19224  ? 231 ARG A CD  1 
ATOM   5088  N NE  . ARG B  1 251 ? -51.09906 -39.11499  40.82073  1.000 55.68938  ? 231 ARG A NE  1 
ATOM   5089  C CZ  . ARG B  1 251 ? -50.03732 -39.89031  41.01643  1.000 49.23277  ? 231 ARG A CZ  1 
ATOM   5090  N NH1 . ARG B  1 251 ? -49.13707 -40.04533  40.05408  1.000 51.64489  ? 231 ARG A NH1 1 
ATOM   5091  N NH2 . ARG B  1 251 ? -49.87613 -40.51160  42.17624  1.000 44.36547  ? 231 ARG A NH2 1 
ATOM   5092  N N   . ASP B  1 252 ? -52.94026 -34.08284  42.75404  1.000 60.82466  ? 232 ASP A N   1 
ATOM   5093  C CA  . ASP B  1 252 ? -52.91662 -33.08584  43.81790  1.000 54.90934  ? 232 ASP A CA  1 
ATOM   5094  C C   . ASP B  1 252 ? -54.15050 -33.21834  44.70115  1.000 49.03866  ? 232 ASP A C   1 
ATOM   5095  O O   . ASP B  1 252 ? -55.24872 -33.51405  44.22013  1.000 48.77201  ? 232 ASP A O   1 
ATOM   5096  C CB  . ASP B  1 252 ? -52.80145 -31.66168  43.24522  1.000 64.35688  ? 232 ASP A CB  1 
ATOM   5097  C CG  . ASP B  1 252 ? -52.96031 -30.58930  44.30334  1.000 64.40338  ? 232 ASP A CG  1 
ATOM   5098  O OD1 . ASP B  1 252 ? -54.10682 -30.16634  44.56437  1.000 63.43425  ? 232 ASP A OD1 1 
ATOM   5099  O OD2 . ASP B  1 252 ? -51.92904 -30.18094  44.88425  1.000 66.19253  ? 232 ASP A OD2 1 
ATOM   5100  N N   . PHE B  1 253 ? -53.95086 -32.99407  46.00333  1.000 39.19095  ? 233 PHE A N   1 
ATOM   5101  C CA  . PHE B  1 253 ? -55.02364 -33.17530  46.98204  1.000 39.07797  ? 233 PHE A CA  1 
ATOM   5102  C C   . PHE B  1 253 ? -56.15405 -32.18047  46.75525  1.000 40.96812  ? 233 PHE A C   1 
ATOM   5103  O O   . PHE B  1 253 ? -57.30396 -32.57127  46.52836  1.000 46.53772  ? 233 PHE A O   1 
ATOM   5104  C CB  . PHE B  1 253 ? -54.47360 -33.04508  48.40637  1.000 37.51128  ? 233 PHE A CB  1 
ATOM   5105  C CG  . PHE B  1 253 ? -54.04605 -34.35398  49.01874  1.000 40.37830  ? 233 PHE A CG  1 
ATOM   5106  C CD1 . PHE B  1 253 ? -54.98267 -35.22769  49.56219  1.000 38.79770  ? 233 PHE A CD1 1 
ATOM   5107  C CD2 . PHE B  1 253 ? -52.70520 -34.70420  49.06526  1.000 43.62683  ? 233 PHE A CD2 1 
ATOM   5108  C CE1 . PHE B  1 253 ? -54.58267 -36.43935  50.12728  1.000 37.78564  ? 233 PHE A CE1 1 
ATOM   5109  C CE2 . PHE B  1 253 ? -52.29995 -35.90710  49.62527  1.000 37.84945  ? 233 PHE A CE2 1 
ATOM   5110  C CZ  . PHE B  1 253 ? -53.23985 -36.77402  50.15782  1.000 37.08739  ? 233 PHE A CZ  1 
ATOM   5111  N N   . GLY B  1 254 ? -55.84603 -30.88143  46.83803  1.000 40.91733  ? 234 GLY A N   1 
ATOM   5112  C CA  . GLY B  1 254 ? -56.87604 -29.86974  46.67786  1.000 39.25987  ? 234 GLY A CA  1 
ATOM   5113  C C   . GLY B  1 254 ? -57.46505 -29.81698  45.28281  1.000 47.48294  ? 234 GLY A C   1 
ATOM   5114  O O   . GLY B  1 254 ? -58.66136 -29.56018  45.12201  1.000 54.52035  ? 234 GLY A O   1 
ATOM   5115  N N   . LYS B  1 255 ? -56.64609 -30.06651  44.25758  1.000 48.57307  ? 235 LYS A N   1 
ATOM   5116  C CA  . LYS B  1 255 ? -57.12375 -29.98564  42.88095  1.000 54.40213  ? 235 LYS A CA  1 
ATOM   5117  C C   . LYS B  1 255 ? -57.84660 -31.25095  42.43443  1.000 61.59452  ? 235 LYS A C   1 
ATOM   5118  O O   . LYS B  1 255 ? -58.72832 -31.17968  41.57087  1.000 66.38392  ? 235 LYS A O   1 
ATOM   5119  C CB  . LYS B  1 255 ? -55.95420 -29.70507  41.93716  1.000 52.24583  ? 235 LYS A CB  1 
ATOM   5120  C CG  . LYS B  1 255 ? -55.90446 -28.28093  41.42236  1.000 61.36725  ? 235 LYS A CG  1 
ATOM   5121  C CD  . LYS B  1 255 ? -57.07061 -27.99134  40.49303  1.000 69.45783  ? 235 LYS A CD  1 
ATOM   5122  C CE  . LYS B  1 255 ? -57.45897 -26.51643  40.52809  1.000 65.83699  ? 235 LYS A CE  1 
ATOM   5123  N NZ  . LYS B  1 255 ? -58.77380 -26.27232  39.86811  1.000 60.72972  ? 235 LYS A NZ  1 
ATOM   5124  N N   . ASP B  1 256 ? -57.50098 -32.41032  42.99351  1.000 56.75182  ? 236 ASP A N   1 
ATOM   5125  C CA  . ASP B  1 256 ? -58.02144 -33.65820  42.44739  1.000 57.15469  ? 236 ASP A CA  1 
ATOM   5126  C C   . ASP B  1 256 ? -58.71529 -34.52623  43.48231  1.000 54.71132  ? 236 ASP A C   1 
ATOM   5127  O O   . ASP B  1 256 ? -59.90210 -34.82899  43.32703  1.000 57.06480  ? 236 ASP A O   1 
ATOM   5128  C CB  . ASP B  1 256 ? -56.90515 -34.46170  41.78481  1.000 45.76307  ? 236 ASP A CB  1 
ATOM   5129  C CG  . ASP B  1 256 ? -56.21920 -33.69385  40.68393  1.000 48.52131  ? 236 ASP A CG  1 
ATOM   5130  O OD1 . ASP B  1 256 ? -55.12619 -33.15031  40.93288  1.000 45.40909  ? 236 ASP A OD1 1 
ATOM   5131  O OD2 . ASP B  1 256 ? -56.77536 -33.62734  39.56752  1.000 49.94949  ? 236 ASP A OD2 1 
ATOM   5132  N N   . ILE B  1 257 ? -57.99540 -34.96533  44.51642  1.000 58.01289  ? 237 ILE A N   1 
ATOM   5133  C CA  . ILE B  1 257 ? -58.60928 -35.86730  45.48539  1.000 56.44859  ? 237 ILE A CA  1 
ATOM   5134  C C   . ILE B  1 257 ? -59.87125 -35.23083  46.05676  1.000 52.50207  ? 237 ILE A C   1 
ATOM   5135  O O   . ILE B  1 257 ? -60.98454 -35.71914  45.81854  1.000 59.87389  ? 237 ILE A O   1 
ATOM   5136  C CB  . ILE B  1 257 ? -57.59546 -36.27579  46.57278  1.000 57.58443  ? 237 ILE A CB  1 
ATOM   5137  C CG1 . ILE B  1 257 ? -56.73608 -37.43735  46.08241  1.000 56.80390  ? 237 ILE A CG1 1 
ATOM   5138  C CG2 . ILE B  1 257 ? -58.27502 -36.76864  47.83363  1.000 52.88336  ? 237 ILE A CG2 1 
ATOM   5139  C CD1 . ILE B  1 257 ? -55.72070 -37.06345  45.05835  1.000 52.71045  ? 237 ILE A CD1 1 
ATOM   5140  N N   . ILE B  1 258 ? -59.73000 -34.07911  46.71325  1.000 44.19252  ? 238 ILE A N   1 
ATOM   5141  C CA  . ILE B  1 258 ? -60.85183 -33.37816  47.34766  1.000 46.53482  ? 238 ILE A CA  1 
ATOM   5142  C C   . ILE B  1 258 ? -62.02087 -33.20977  46.37829  1.000 59.53305  ? 238 ILE A C   1 
ATOM   5143  O O   . ILE B  1 258 ? -63.12348 -33.68536  46.69388  1.000 45.67470  ? 238 ILE A O   1 
ATOM   5144  C CB  . ILE B  1 258 ? -60.41634 -32.02331  47.93106  1.000 41.61288  ? 238 ILE A CB  1 
ATOM   5145  C CG1 . ILE B  1 258 ? -59.96480 -32.18674  49.37778  1.000 49.43696  ? 238 ILE A CG1 1 
ATOM   5146  C CG2 . ILE B  1 258 ? -61.57226 -31.03861  47.90437  1.000 42.13968  ? 238 ILE A CG2 1 
ATOM   5147  C CD1 . ILE B  1 258 ? -58.87698 -33.22833  49.57948  1.000 39.67380  ? 238 ILE A CD1 1 
ATOM   5148  N N   . PRO B  1 259 ? -61.86316 -32.57874  45.20268  1.000 63.19462  ? 239 PRO A N   1 
ATOM   5149  C CA  . PRO B  1 259 ? -63.04755 -32.37729  44.34740  1.000 57.16011  ? 239 PRO A CA  1 
ATOM   5150  C C   . PRO B  1 259 ? -63.71916 -33.67757  43.95292  1.000 48.65767  ? 239 PRO A C   1 
ATOM   5151  O O   . PRO B  1 259 ? -64.94089 -33.70551  43.76374  1.000 56.85536  ? 239 PRO A O   1 
ATOM   5152  C CB  . PRO B  1 259 ? -62.47896 -31.63825  43.12764  1.000 58.01145  ? 239 PRO A CB  1 
ATOM   5153  C CG  . PRO B  1 259 ? -61.24763 -30.97315  43.64102  1.000 56.97407  ? 239 PRO A CG  1 
ATOM   5154  C CD  . PRO B  1 259 ? -60.66674 -31.97446  44.58901  1.000 61.24161  ? 239 PRO A CD  1 
ATOM   5155  N N   . TYR B  1 260 ? -62.95060 -34.76445  43.84356  1.000 59.19470  ? 240 TYR A N   1 
ATOM   5156  C CA  . TYR B  1 260 ? -63.54775 -36.06906  43.58147  1.000 54.66506  ? 240 TYR A CA  1 
ATOM   5157  C C   . TYR B  1 260 ? -64.49714 -36.46439  44.70353  1.000 53.38740  ? 240 TYR A C   1 
ATOM   5158  O O   . TYR B  1 260 ? -65.65663 -36.81283  44.45060  1.000 52.50902  ? 240 TYR A O   1 
ATOM   5159  C CB  . TYR B  1 260 ? -62.45481 -37.12589  43.39214  1.000 58.87302  ? 240 TYR A CB  1 
ATOM   5160  C CG  . TYR B  1 260 ? -62.90565 -38.31988  42.58681  1.000 63.42871  ? 240 TYR A CG  1 
ATOM   5161  C CD1 . TYR B  1 260 ? -62.78173 -38.33245  41.20035  1.000 67.78014  ? 240 TYR A CD1 1 
ATOM   5162  C CD2 . TYR B  1 260 ? -63.45612 -39.43492  43.20811  1.000 65.70401  ? 240 TYR A CD2 1 
ATOM   5163  C CE1 . TYR B  1 260 ? -63.20215 -39.42097  40.44999  1.000 65.90317  ? 240 TYR A CE1 1 
ATOM   5164  C CE2 . TYR B  1 260 ? -63.87792 -40.52719  42.46912  1.000 71.51153  ? 240 TYR A CE2 1 
ATOM   5165  C CZ  . TYR B  1 260 ? -63.75155 -40.51632  41.09313  1.000 72.95982  ? 240 TYR A CZ  1 
ATOM   5166  O OH  . TYR B  1 260 ? -64.17647 -41.61514  40.37681  1.000 84.96782  ? 240 TYR A OH  1 
ATOM   5167  N N   . ILE B  1 261 ? -64.03740 -36.38768  45.95894  1.000 48.63251  ? 241 ILE A N   1 
ATOM   5168  C CA  . ILE B  1 261 ? -64.92060 -36.79851  47.04445  1.000 48.77703  ? 241 ILE A CA  1 
ATOM   5169  C C   . ILE B  1 261 ? -66.08505 -35.82878  47.20012  1.000 52.25549  ? 241 ILE A C   1 
ATOM   5170  O O   . ILE B  1 261 ? -67.20812 -36.25031  47.49902  1.000 56.30343  ? 241 ILE A O   1 
ATOM   5171  C CB  . ILE B  1 261 ? -64.18348 -36.98871  48.38693  1.000 47.07913  ? 241 ILE A CB  1 
ATOM   5172  C CG1 . ILE B  1 261 ? -63.07401 -38.03025  48.33394  1.000 48.95441  ? 241 ILE A CG1 1 
ATOM   5173  C CG2 . ILE B  1 261 ? -65.10426 -37.44568  49.43682  1.000 61.90088  ? 241 ILE A CG2 1 
ATOM   5174  C CD1 . ILE B  1 261 ? -61.71461 -37.44364  48.21389  1.000 53.37422  ? 241 ILE A CD1 1 
ATOM   5175  N N   . VAL B  1 262 ? -65.84984 -34.52428  47.02298  1.000 48.36838  ? 242 VAL A N   1 
ATOM   5176  C CA  . VAL B  1 262 ? -66.96463 -33.57685  47.06826  1.000 53.05297  ? 242 VAL A CA  1 
ATOM   5177  C C   . VAL B  1 262 ? -68.04809 -33.99966  46.08253  1.000 59.78421  ? 242 VAL A C   1 
ATOM   5178  O O   . VAL B  1 262 ? -69.24070 -34.03444  46.41263  1.000 60.60594  ? 242 VAL A O   1 
ATOM   5179  C CB  . VAL B  1 262 ? -66.47394 -32.14371  46.78925  1.000 55.00385  ? 242 VAL A CB  1 
ATOM   5180  C CG1 . VAL B  1 262 ? -67.65361 -31.18415  46.69870  1.000 48.69596  ? 242 VAL A CG1 1 
ATOM   5181  C CG2 . VAL B  1 262 ? -65.50203 -31.69745  47.86405  1.000 45.89887  ? 242 VAL A CG2 1 
ATOM   5182  N N   . GLU B  1 263 ? -67.63875 -34.35278  44.86232  1.000 58.16517  ? 243 GLU A N   1 
ATOM   5183  C CA  . GLU B  1 263 ? -68.58502 -34.82166  43.85595  1.000 70.04307  ? 243 GLU A CA  1 
ATOM   5184  C C   . GLU B  1 263 ? -69.33037 -36.06326  44.33370  1.000 79.92410  ? 243 GLU A C   1 
ATOM   5185  O O   . GLU B  1 263 ? -70.55517 -36.04699  44.50201  1.000 85.26240  ? 243 GLU A O   1 
ATOM   5186  C CB  . GLU B  1 263 ? -67.85021 -35.12087  42.54642  1.000 72.88947  ? 243 GLU A CB  1 
ATOM   5187  C CG  . GLU B  1 263 ? -67.44600 -33.90804  41.73084  1.000 78.98581  ? 243 GLU A CG  1 
ATOM   5188  C CD  . GLU B  1 263 ? -67.55365 -34.16323  40.23374  1.000 83.46560  ? 243 GLU A CD  1 
ATOM   5189  O OE1 . GLU B  1 263 ? -68.42954 -34.95663  39.82730  1.000 77.89544  ? 243 GLU A OE1 1 
ATOM   5190  O OE2 . GLU B  1 263 ? -66.76111 -33.57802  39.46409  1.000 84.51824  ? 243 GLU A OE2 1 
ATOM   5191  N N   . HIS B  1 264 ? -68.59661 -37.14998  44.57248  1.000 77.10656  ? 244 HIS A N   1 
ATOM   5192  C CA  . HIS B  1 264 ? -69.18548 -38.47504  44.72073  1.000 73.11627  ? 244 HIS A CA  1 
ATOM   5193  C C   . HIS B  1 264 ? -69.36463 -38.92094  46.16516  1.000 67.11197  ? 244 HIS A C   1 
ATOM   5194  O O   . HIS B  1 264 ? -70.26588 -39.72031  46.44231  1.000 66.54059  ? 244 HIS A O   1 
ATOM   5195  C CB  . HIS B  1 264 ? -68.32602 -39.50682  43.98300  1.000 75.08904  ? 244 HIS A CB  1 
ATOM   5196  C CG  . HIS B  1 264 ? -68.12920 -39.19963  42.52998  1.000 81.07829  ? 244 HIS A CG  1 
ATOM   5197  N ND1 . HIS B  1 264 ? -66.88175 -39.10223  41.95138  1.000 80.98365  ? 244 HIS A ND1 1 
ATOM   5198  C CD2 . HIS B  1 264 ? -69.02229 -38.97280  41.53727  1.000 81.24051  ? 244 HIS A CD2 1 
ATOM   5199  C CE1 . HIS B  1 264 ? -67.01495 -38.82577  40.66595  1.000 81.67354  ? 244 HIS A CE1 1 
ATOM   5200  N NE2 . HIS B  1 264 ? -68.30366 -38.74215  40.38918  1.000 81.42450  ? 244 HIS A NE2 1 
ATOM   5201  N N   . GLY B  1 265 ? -68.53319 -38.43968  47.09114  1.000 60.46080  ? 245 GLY A N   1 
ATOM   5202  C CA  . GLY B  1 265 ? -68.59503 -38.83980  48.47280  1.000 59.20119  ? 245 GLY A CA  1 
ATOM   5203  C C   . GLY B  1 265 ? -69.06459 -37.72767  49.38840  1.000 58.70007  ? 245 GLY A C   1 
ATOM   5204  O O   . GLY B  1 265 ? -69.71505 -36.76256  48.96526  1.000 52.16352  ? 245 GLY A O   1 
ATOM   5205  N N   . LYS B  1 266 ? -68.72654 -37.86474  50.66938  1.000 58.84743  ? 246 LYS A N   1 
ATOM   5206  C CA  . LYS B  1 266 ? -69.12858 -36.91922  51.70290  1.000 54.55743  ? 246 LYS A CA  1 
ATOM   5207  C C   . LYS B  1 266 ? -67.89662 -36.18043  52.20791  1.000 56.09868  ? 246 LYS A C   1 
ATOM   5208  O O   . LYS B  1 266 ? -66.95043 -36.80503  52.69773  1.000 61.06741  ? 246 LYS A O   1 
ATOM   5209  C CB  . LYS B  1 266 ? -69.84091 -37.62898  52.85541  1.000 54.90096  ? 246 LYS A CB  1 
ATOM   5210  C CG  . LYS B  1 266 ? -70.92333 -36.78597  53.51770  1.000 60.27457  ? 246 LYS A CG  1 
ATOM   5211  C CD  . LYS B  1 266 ? -70.99976 -37.02682  55.01986  1.000 63.94047  ? 246 LYS A CD  1 
ATOM   5212  C CE  . LYS B  1 266 ? -71.96426 -36.04478  55.68154  1.000 71.75439  ? 246 LYS A CE  1 
ATOM   5213  N NZ  . LYS B  1 266 ? -71.84982 -36.02533  57.17105  1.000 69.50701  ? 246 LYS A NZ  1 
ATOM   5214  N N   . ALA B  1 267 ? -67.91435 -34.85516  52.08865  1.000 49.27050  ? 247 ALA A N   1 
ATOM   5215  C CA  . ALA B  1 267 ? -66.83177 -33.99926  52.55452  1.000 52.02729  ? 247 ALA A CA  1 
ATOM   5216  C C   . ALA B  1 267 ? -67.41917 -32.91671  53.44448  1.000 46.81296  ? 247 ALA A C   1 
ATOM   5217  O O   . ALA B  1 267 ? -68.33960 -32.20456  53.03012  1.000 46.59083  ? 247 ALA A O   1 
ATOM   5218  C CB  . ALA B  1 267 ? -66.07254 -33.37055  51.38127  1.000 44.62901  ? 247 ALA A CB  1 
ATOM   5219  N N   . VAL B  1 268 ? -66.89880 -32.79749  54.66462  1.000 43.06496  ? 248 VAL A N   1 
ATOM   5220  C CA  . VAL B  1 268 ? -67.37048 -31.78383  55.59949  1.000 53.17513  ? 248 VAL A CA  1 
ATOM   5221  C C   . VAL B  1 268 ? -66.23906 -30.80885  55.89583  1.000 45.56061  ? 248 VAL A C   1 
ATOM   5222  O O   . VAL B  1 268 ? -65.05519 -31.16250  55.86584  1.000 43.43693  ? 248 VAL A O   1 
ATOM   5223  C CB  . VAL B  1 268 ? -67.92047 -32.40172  56.90562  1.000 48.77837  ? 248 VAL A CB  1 
ATOM   5224  C CG1 . VAL B  1 268 ? -69.04781 -33.37339  56.59735  1.000 56.01056  ? 248 VAL A CG1 1 
ATOM   5225  C CG2 . VAL B  1 268 ? -66.81155 -33.08453  57.69363  1.000 45.79307  ? 248 VAL A CG2 1 
ATOM   5226  N N   . ALA B  1 269 ? -66.61469 -29.56533  56.17418  1.000 43.70404  ? 249 ALA A N   1 
ATOM   5227  C CA  . ALA B  1 269 ? -65.65007 -28.53459  56.52309  1.000 39.07344  ? 249 ALA A CA  1 
ATOM   5228  C C   . ALA B  1 269 ? -65.52753 -28.42184  58.03791  1.000 38.19402  ? 249 ALA A C   1 
ATOM   5229  O O   . ALA B  1 269 ? -66.51458 -28.56590  58.76750  1.000 38.84150  ? 249 ALA A O   1 
ATOM   5230  C CB  . ALA B  1 269 ? -66.06570 -27.19072  55.92071  1.000 40.51575  ? 249 ALA A CB  1 
ATOM   5231  N N   . HIS B  1 270 ? -64.30631 -28.18870  58.50939  1.000 36.80987  ? 250 HIS A N   1 
ATOM   5232  C CA  . HIS B  1 270 ? -64.05873 -27.86253  59.90741  1.000 35.90989  ? 250 HIS A CA  1 
ATOM   5233  C C   . HIS B  1 270 ? -63.43383 -26.47308  59.98074  1.000 34.95683  ? 250 HIS A C   1 
ATOM   5234  O O   . HIS B  1 270 ? -62.49323 -26.16575  59.23858  1.000 34.40221  ? 250 HIS A O   1 
ATOM   5235  C CB  . HIS B  1 270 ? -63.17111 -28.91412  60.57993  1.000 35.82032  ? 250 HIS A CB  1 
ATOM   5236  C CG  . HIS B  1 270 ? -62.77016 -28.56020  61.97854  1.000 36.61982  ? 250 HIS A CG  1 
ATOM   5237  N ND1 . HIS B  1 270 ? -61.66980 -27.78165  62.26058  1.000 37.33013  ? 250 HIS A ND1 1 
ATOM   5238  C CD2 . HIS B  1 270 ? -63.33798 -28.85601  63.17244  1.000 34.48445  ? 250 HIS A CD2 1 
ATOM   5239  C CE1 . HIS B  1 270 ? -61.56956 -27.62326  63.56748  1.000 39.52766  ? 250 HIS A CE1 1 
ATOM   5240  N NE2 . HIS B  1 270 ? -62.56813 -28.26655  64.14444  1.000 37.89997  ? 250 HIS A NE2 1 
ATOM   5241  N N   . ARG B  1 271 ? -63.96745 -25.63194  60.86083  1.000 34.87256  ? 251 ARG A N   1 
ATOM   5242  C CA  . ARG B  1 271 ? -63.59151 -24.22460  60.90653  1.000 36.10560  ? 251 ARG A CA  1 
ATOM   5243  C C   . ARG B  1 271 ? -62.43870 -24.01643  61.87616  1.000 35.33058  ? 251 ARG A C   1 
ATOM   5244  O O   . ARG B  1 271 ? -62.49651 -24.46719  63.02722  1.000 35.67441  ? 251 ARG A O   1 
ATOM   5245  C CB  . ARG B  1 271 ? -64.78509 -23.36163  61.30845  1.000 35.56412  ? 251 ARG A CB  1 
ATOM   5246  C CG  . ARG B  1 271 ? -65.78360 -23.14318  60.18822  1.000 40.39872  ? 251 ARG A CG  1 
ATOM   5247  C CD  . ARG B  1 271 ? -67.18238 -23.49815  60.64320  1.000 51.77376  ? 251 ARG A CD  1 
ATOM   5248  N NE  . ARG B  1 271 ? -68.18086 -23.18443  59.62546  1.000 58.37202  ? 251 ARG A NE  1 
ATOM   5249  C CZ  . ARG B  1 271 ? -68.82740 -22.02672  59.54392  1.000 49.57584  ? 251 ARG A CZ  1 
ATOM   5250  N NH1 . ARG B  1 271 ? -68.58239 -21.06285  60.41991  1.000 41.19000  ? 251 ARG A NH1 1 
ATOM   5251  N NH2 . ARG B  1 271 ? -69.71938 -21.83254  58.58385  1.000 45.77977  ? 251 ARG A NH2 1 
ATOM   5252  N N   . PHE B  1 272 ? -61.40314 -23.31532  61.40125  1.000 33.49243  ? 252 PHE A N   1 
ATOM   5253  C CA  . PHE B  1 272 ? -60.19515 -23.07932  62.18752  1.000 31.03703  ? 252 PHE A CA  1 
ATOM   5254  C C   . PHE B  1 272 ? -60.50238 -22.52005  63.56800  1.000 30.80480  ? 252 PHE A C   1 
ATOM   5255  O O   . PHE B  1 272 ? -59.81186 -22.84936  64.53886  1.000 30.11902  ? 252 PHE A O   1 
ATOM   5256  C CB  . PHE B  1 272 ? -59.27201 -22.12171  61.42866  1.000 30.53255  ? 252 PHE A CB  1 
ATOM   5257  C CG  . PHE B  1 272 ? -57.97197 -21.83909  62.13124  1.000 35.62252  ? 252 PHE A CG  1 
ATOM   5258  C CD1 . PHE B  1 272 ? -57.54080 -20.53299  62.32314  1.000 36.30113  ? 252 PHE A CD1 1 
ATOM   5259  C CD2 . PHE B  1 272 ? -57.18015 -22.87840  62.59373  1.000 33.93075  ? 252 PHE A CD2 1 
ATOM   5260  C CE1 . PHE B  1 272 ? -56.34554 -20.27025  62.95986  1.000 28.16454  ? 252 PHE A CE1 1 
ATOM   5261  C CE2 . PHE B  1 272 ? -55.98500 -22.62291  63.23134  1.000 38.65667  ? 252 PHE A CE2 1 
ATOM   5262  C CZ  . PHE B  1 272 ? -55.56572 -21.31857  63.41306  1.000 35.61887  ? 252 PHE A CZ  1 
ATOM   5263  N N   . ALA B  1 273 ? -61.53202 -21.67612  63.67679  1.000 31.44214  ? 253 ALA A N   1 
ATOM   5264  C CA  . ALA B  1 273 ? -61.84338 -21.04154  64.95099  1.000 31.33299  ? 253 ALA A CA  1 
ATOM   5265  C C   . ALA B  1 273 ? -62.26840 -22.04547  66.01341  1.000 39.90126  ? 253 ALA A C   1 
ATOM   5266  O O   . ALA B  1 273 ? -62.10138 -21.77022  67.20691  1.000 35.85593  ? 253 ALA A O   1 
ATOM   5267  C CB  . ALA B  1 273 ? -62.93364 -19.98843  64.75855  1.000 32.13136  ? 253 ALA A CB  1 
ATOM   5268  N N   . ASP B  1 274 ? -62.79584 -23.20736  65.61128  1.000 34.11518  ? 254 ASP A N   1 
ATOM   5269  C CA  . ASP B  1 274 ? -63.26725 -24.19133  66.57511  1.000 36.21454  ? 254 ASP A CA  1 
ATOM   5270  C C   . ASP B  1 274 ? -62.13631 -24.97298  67.23047  1.000 36.02205  ? 254 ASP A C   1 
ATOM   5271  O O   . ASP B  1 274 ? -62.33505 -25.53105  68.31467  1.000 42.54542  ? 254 ASP A O   1 
ATOM   5272  C CB  . ASP B  1 274 ? -64.23918 -25.16216  65.90057  1.000 35.25690  ? 254 ASP A CB  1 
ATOM   5273  C CG  . ASP B  1 274 ? -65.50159 -24.47661  65.42230  1.000 46.27127  ? 254 ASP A CG  1 
ATOM   5274  O OD1 . ASP B  1 274 ? -65.94741 -23.52558  66.09581  1.000 48.91127  ? 254 ASP A OD1 1 
ATOM   5275  O OD2 . ASP B  1 274 ? -66.04626 -24.87975  64.37342  1.000 47.38317  ? 254 ASP A OD2 1 
ATOM   5276  N N   . SER B  1 275 ? -60.96256 -25.03054  66.60657  1.000 30.86044  ? 255 SER A N   1 
ATOM   5277  C CA  . SER B  1 275 ? -59.86207 -25.82199  67.13209  1.000 30.40394  ? 255 SER A CA  1 
ATOM   5278  C C   . SER B  1 275 ? -58.55188 -25.05656  67.20590  1.000 34.97361  ? 255 SER A C   1 
ATOM   5279  O O   . SER B  1 275 ? -57.53974 -25.63674  67.62100  1.000 28.39806  ? 255 SER A O   1 
ATOM   5280  C CB  . SER B  1 275 ? -59.66097 -27.08329  66.28460  1.000 30.35453  ? 255 SER A CB  1 
ATOM   5281  O OG  . SER B  1 275 ? -59.26213 -26.74033  64.97118  1.000 30.25790  ? 255 SER A OG  1 
ATOM   5282  N N   . CYS B  1 276 ? -58.53693 -23.78329  66.81454  1.000 29.24239  ? 256 CYS A N   1 
ATOM   5283  C CA  . CYS B  1 276 ? -57.33744 -22.97597  66.97650  1.000 28.04101  ? 256 CYS A CA  1 
ATOM   5284  C C   . CYS B  1 276 ? -56.96061 -22.91908  68.45039  1.000 27.62322  ? 256 CYS A C   1 
ATOM   5285  O O   . CYS B  1 276 ? -57.82780 -22.88088  69.32689  1.000 28.09237  ? 256 CYS A O   1 
ATOM   5286  C CB  . CYS B  1 276 ? -57.55888 -21.56159  66.43164  1.000 28.17258  ? 256 CYS A CB  1 
ATOM   5287  S SG  . CYS B  1 276 ? -56.17145 -20.42985  66.76290  1.000 33.43536  ? 256 CYS A SG  1 
ATOM   5288  N N   . VAL B  1 277 ? -55.66065 -22.93078  68.72295  1.000 26.82548  ? 257 VAL A N   1 
ATOM   5289  C CA  . VAL B  1 277 ? -55.14095 -22.86784  70.08403  1.000 26.43596  ? 257 VAL A CA  1 
ATOM   5290  C C   . VAL B  1 277 ? -54.63345 -21.44652  70.30242  1.000 44.46912  ? 257 VAL A C   1 
ATOM   5291  O O   . VAL B  1 277 ? -53.51593 -21.10050  69.90527  1.000 51.93446  ? 257 VAL A O   1 
ATOM   5292  C CB  . VAL B  1 277 ? -54.04162 -23.90458  70.32384  1.000 27.93320  ? 257 VAL A CB  1 
ATOM   5293  C CG1 . VAL B  1 277 ? -53.46290 -23.73247  71.71563  1.000 33.60463  ? 257 VAL A CG1 1 
ATOM   5294  C CG2 . VAL B  1 277 ? -54.58870 -25.32012  70.13467  1.000 27.15375  ? 257 VAL A CG2 1 
ATOM   5295  N N   . ARG B  1 278 ? -55.45731 -20.61510  70.93087  1.000 26.55198  ? 258 ARG A N   1 
ATOM   5296  C CA  . ARG B  1 278 ? -55.09014 -19.23613  71.21306  1.000 31.84394  ? 258 ARG A CA  1 
ATOM   5297  C C   . ARG B  1 278 ? -54.48452 -19.13820  72.60469  1.000 33.63109  ? 258 ARG A C   1 
ATOM   5298  O O   . ARG B  1 278 ? -55.05330 -19.65185  73.57343  1.000 34.74995  ? 258 ARG A O   1 
ATOM   5299  C CB  . ARG B  1 278 ? -56.30556 -18.31145  71.11754  1.000 30.70918  ? 258 ARG A CB  1 
ATOM   5300  C CG  . ARG B  1 278 ? -56.81923 -18.06419  69.71280  1.000 33.59208  ? 258 ARG A CG  1 
ATOM   5301  C CD  . ARG B  1 278 ? -58.09498 -17.24871  69.75982  1.000 37.82002  ? 258 ARG A CD  1 
ATOM   5302  N NE  . ARG B  1 278 ? -58.12687 -16.39546  70.94350  1.000 42.42921  ? 258 ARG A NE  1 
ATOM   5303  C CZ  . ARG B  1 278 ? -59.14621 -15.61094  71.27649  1.000 48.08818  ? 258 ARG A CZ  1 
ATOM   5304  N NH1 . ARG B  1 278 ? -60.22907 -15.56367  70.51185  1.000 44.08142  ? 258 ARG A NH1 1 
ATOM   5305  N NH2 . ARG B  1 278 ? -59.08124 -14.87058  72.37525  1.000 52.37248  ? 258 ARG A NH2 1 
ATOM   5306  N N   . SER B  1 279 ? -53.33325 -18.47913  72.70292  1.000 38.48519  ? 259 SER A N   1 
ATOM   5307  C CA  . SER B  1 279 ? -52.86013 -18.08394  74.01608  1.000 39.85172  ? 259 SER A CA  1 
ATOM   5308  C C   . SER B  1 279 ? -53.75368 -16.96619  74.55142  1.000 34.11809  ? 259 SER A C   1 
ATOM   5309  O O   . SER B  1 279 ? -54.56905 -16.38690  73.82869  1.000 28.44252  ? 259 SER A O   1 
ATOM   5310  C CB  . SER B  1 279 ? -51.39850 -17.63499  73.95997  1.000 37.37542  ? 259 SER A CB  1 
ATOM   5311  O OG  . SER B  1 279 ? -51.29295 -16.22613  73.85184  1.000 34.21292  ? 259 SER A OG  1 
ATOM   5312  N N   . ASP B  1 280 ? -53.60438 -16.67118  75.84254  1.000 37.23383  ? 260 ASP A N   1 
ATOM   5313  C CA  . ASP B  1 280 ? -54.38720 -15.60416  76.45345  1.000 39.93415  ? 260 ASP A CA  1 
ATOM   5314  C C   . ASP B  1 280 ? -54.01059 -14.22330  75.93878  1.000 33.13313  ? 260 ASP A C   1 
ATOM   5315  O O   . ASP B  1 280 ? -54.74731 -13.26475  76.19252  1.000 33.09082  ? 260 ASP A O   1 
ATOM   5316  C CB  . ASP B  1 280 ? -54.23163 -15.64739  77.97202  1.000 49.15650  ? 260 ASP A CB  1 
ATOM   5317  C CG  . ASP B  1 280 ? -55.18539 -16.62502  78.62217  1.000 44.86240  ? 260 ASP A CG  1 
ATOM   5318  O OD1 . ASP B  1 280 ? -56.19176 -16.98616  77.97432  1.000 42.68365  ? 260 ASP A OD1 1 
ATOM   5319  O OD2 . ASP B  1 280 ? -54.93413 -17.02127  79.78086  1.000 49.43732  ? 260 ASP A OD2 1 
ATOM   5320  N N   . PHE B  1 281 ? -52.89847 -14.10004  75.21717  1.000 26.45631  ? 261 PHE A N   1 
ATOM   5321  C CA  . PHE B  1 281 ? -52.43313 -12.82028  74.70193  1.000 36.97041  ? 261 PHE A CA  1 
ATOM   5322  C C   . PHE B  1 281 ? -52.59486 -12.71696  73.18874  1.000 37.10541  ? 261 PHE A C   1 
ATOM   5323  O O   . PHE B  1 281 ? -51.98482 -11.84709  72.55631  1.000 33.51382  ? 261 PHE A O   1 
ATOM   5324  C CB  . PHE B  1 281 ? -50.97880 -12.59249  75.11454  1.000 27.32592  ? 261 PHE A CB  1 
ATOM   5325  C CG  . PHE B  1 281 ? -50.72228 -12.85078  76.57350  1.000 39.85843  ? 261 PHE A CG  1 
ATOM   5326  C CD1 . PHE B  1 281 ? -50.28340 -14.09169  77.00806  1.000 50.22568  ? 261 PHE A CD1 1 
ATOM   5327  C CD2 . PHE B  1 281 ? -50.93712 -11.85809  77.51213  1.000 46.89874  ? 261 PHE A CD2 1 
ATOM   5328  C CE1 . PHE B  1 281 ? -50.05176 -14.33256  78.35028  1.000 47.27897  ? 261 PHE A CE1 1 
ATOM   5329  C CE2 . PHE B  1 281 ? -50.70779 -12.09372  78.85532  1.000 51.78967  ? 261 PHE A CE2 1 
ATOM   5330  C CZ  . PHE B  1 281 ? -50.26454 -13.33353  79.27358  1.000 48.25977  ? 261 PHE A CZ  1 
ATOM   5331  N N   . GLU B  1 282 ? -53.41748 -13.57993  72.59992  1.000 31.39566  ? 262 GLU A N   1 
ATOM   5332  C CA  . GLU B  1 282 ? -53.71428 -13.55377  71.17235  1.000 31.95218  ? 262 GLU A CA  1 
ATOM   5333  C C   . GLU B  1 282 ? -55.18593 -13.19101  71.00110  1.000 40.57588  ? 262 GLU A C   1 
ATOM   5334  O O   . GLU B  1 282 ? -56.07139 -13.97818  71.35326  1.000 36.69432  ? 262 GLU A O   1 
ATOM   5335  C CB  . GLU B  1 282 ? -53.37061 -14.89707  70.53281  1.000 30.17768  ? 262 GLU A CB  1 
ATOM   5336  C CG  . GLU B  1 282 ? -51.88945 -15.23274  70.68701  1.000 28.16780  ? 262 GLU A CG  1 
ATOM   5337  C CD  . GLU B  1 282 ? -51.51177 -16.59978  70.15922  1.000 32.11835  ? 262 GLU A CD  1 
ATOM   5338  O OE1 . GLU B  1 282 ? -52.38149 -17.50045  70.11231  1.000 36.61407  ? 262 GLU A OE1 1 
ATOM   5339  O OE2 . GLU B  1 282 ? -50.33069 -16.76800  69.79031  1.000 32.13905  ? 262 GLU A OE2 1 
ATOM   5340  N N   . HIS B  1 283 ? -55.44017 -11.99208  70.46334  1.000 40.49257  ? 263 HIS A N   1 
ATOM   5341  C CA  . HIS B  1 283 ? -56.79333 -11.44706  70.41737  1.000 39.49178  ? 263 HIS A CA  1 
ATOM   5342  C C   . HIS B  1 283 ? -57.68214 -12.14796  69.39905  1.000 34.75726  ? 263 HIS A C   1 
ATOM   5343  O O   . HIS B  1 283 ? -58.90899 -12.02597  69.48154  1.000 37.48822  ? 263 HIS A O   1 
ATOM   5344  C CB  . HIS B  1 283 ? -56.74972 -9.94361   70.11682  1.000 36.54785  ? 263 HIS A CB  1 
ATOM   5345  C CG  . HIS B  1 283 ? -56.51294 -9.61550   68.67366  1.000 33.05062  ? 263 HIS A CG  1 
ATOM   5346  N ND1 . HIS B  1 283 ? -55.28752 -9.78047   68.06239  1.000 38.78786  ? 263 HIS A ND1 1 
ATOM   5347  C CD2 . HIS B  1 283 ? -57.34387 -9.12772   67.72212  1.000 33.59092  ? 263 HIS A CD2 1 
ATOM   5348  C CE1 . HIS B  1 283 ? -55.37578 -9.41355   66.79614  1.000 34.51580  ? 263 HIS A CE1 1 
ATOM   5349  N NE2 . HIS B  1 283 ? -56.61215 -9.00976   66.56502  1.000 34.97363  ? 263 HIS A NE2 1 
ATOM   5350  N N   . GLU B  1 284 ? -57.10543 -12.86905  68.44740  1.000 31.91768  ? 264 GLU A N   1 
ATOM   5351  C CA  . GLU B  1 284 ? -57.89142 -13.57033  67.44411  1.000 38.73767  ? 264 GLU A CA  1 
ATOM   5352  C C   . GLU B  1 284 ? -57.11264 -14.79848  67.00282  1.000 31.18275  ? 264 GLU A C   1 
ATOM   5353  O O   . GLU B  1 284 ? -55.89797 -14.87874  67.22544  1.000 27.52239  ? 264 GLU A O   1 
ATOM   5354  C CB  . GLU B  1 284 ? -58.20683 -12.66341  66.24373  1.000 34.70187  ? 264 GLU A CB  1 
ATOM   5355  C CG  . GLU B  1 284 ? -56.98021 -12.18808  65.47882  1.000 42.91148  ? 264 GLU A CG  1 
ATOM   5356  C CD  . GLU B  1 284 ? -57.32634 -11.59835  64.12134  1.000 49.24120  ? 264 GLU A CD  1 
ATOM   5357  O OE1 . GLU B  1 284 ? -58.53057 -11.54192  63.78337  1.000 52.12261  ? 264 GLU A OE1 1 
ATOM   5358  O OE2 . GLU B  1 284 ? -56.39150 -11.20508  63.38902  1.000 54.75959  ? 264 GLU A OE2 1 
ATOM   5359  N N   . PRO B  1 285 ? -57.78039 -15.78147  66.39622  1.000 28.52185  ? 265 PRO A N   1 
ATOM   5360  C CA  . PRO B  1 285 ? -57.05324 -16.95109  65.88153  1.000 34.17937  ? 265 PRO A CA  1 
ATOM   5361  C C   . PRO B  1 285 ? -56.02104 -16.53703  64.84200  1.000 34.71172  ? 265 PRO A C   1 
ATOM   5362  O O   . PRO B  1 285 ? -56.30975 -15.76688  63.92355  1.000 44.30699  ? 265 PRO A O   1 
ATOM   5363  C CB  . PRO B  1 285 ? -58.16182 -17.81872  65.27619  1.000 34.06474  ? 265 PRO A CB  1 
ATOM   5364  C CG  . PRO B  1 285 ? -59.38707 -17.43417  66.04247  1.000 35.45436  ? 265 PRO A CG  1 
ATOM   5365  C CD  . PRO B  1 285 ? -59.24123 -15.96128  66.31114  1.000 29.38862  ? 265 PRO A CD  1 
ATOM   5366  N N   . TYR B  1 286 ? -54.80696 -17.04983  65.00166  1.000 27.02401  ? 266 TYR A N   1 
ATOM   5367  C CA  . TYR B  1 286 ? -53.66064 -16.63062  64.20879  1.000 26.69082  ? 266 TYR A CA  1 
ATOM   5368  C C   . TYR B  1 286 ? -53.36711 -17.65868  63.12540  1.000 42.01706  ? 266 TYR A C   1 
ATOM   5369  O O   . TYR B  1 286 ? -53.29987 -18.86690  63.39849  1.000 30.69981  ? 266 TYR A O   1 
ATOM   5370  C CB  . TYR B  1 286 ? -52.44155 -16.43703  65.10998  1.000 26.00085  ? 266 TYR A CB  1 
ATOM   5371  C CG  . TYR B  1 286 ? -51.21202 -15.86092  64.44260  1.000 26.72805  ? 266 TYR A CG  1 
ATOM   5372  C CD1 . TYR B  1 286 ? -50.30756 -16.68335  63.79193  1.000 25.42469  ? 266 TYR A CD1 1 
ATOM   5373  C CD2 . TYR B  1 286 ? -50.93976 -14.49390  64.49343  1.000 28.99444  ? 266 TYR A CD2 1 
ATOM   5374  C CE1 . TYR B  1 286 ? -49.17906 -16.17517  63.19378  1.000 25.27729  ? 266 TYR A CE1 1 
ATOM   5375  C CE2 . TYR B  1 286 ? -49.80455 -13.97021  63.89530  1.000 25.74953  ? 266 TYR A CE2 1 
ATOM   5376  C CZ  . TYR B  1 286 ? -48.92377 -14.82249  63.25368  1.000 28.69936  ? 266 TYR A CZ  1 
ATOM   5377  O OH  . TYR B  1 286 ? -47.78813 -14.32851  62.65376  1.000 25.39885  ? 266 TYR A OH  1 
ATOM   5378  N N   . TRP B  1 287 ? -53.19711 -17.17265  61.89831  1.000 36.36218  ? 267 TRP A N   1 
ATOM   5379  C CA  . TRP B  1 287 ? -52.79789 -18.01966  60.78253  1.000 38.14691  ? 267 TRP A CA  1 
ATOM   5380  C C   . TRP B  1 287 ? -52.17604 -17.11968  59.72779  1.000 37.01660  ? 267 TRP A C   1 
ATOM   5381  O O   . TRP B  1 287 ? -52.75985 -16.09565  59.36122  1.000 32.33963  ? 267 TRP A O   1 
ATOM   5382  C CB  . TRP B  1 287 ? -53.99028 -18.80707  60.21298  1.000 27.81930  ? 267 TRP A CB  1 
ATOM   5383  C CG  . TRP B  1 287 ? -53.64822 -19.71373  59.05059  1.000 28.78554  ? 267 TRP A CG  1 
ATOM   5384  C CD1 . TRP B  1 287 ? -53.40793 -21.06333  59.09917  1.000 38.78429  ? 267 TRP A CD1 1 
ATOM   5385  C CD2 . TRP B  1 287 ? -53.53616 -19.34035  57.67125  1.000 28.60754  ? 267 TRP A CD2 1 
ATOM   5386  N NE1 . TRP B  1 287 ? -53.14408 -21.54491  57.83829  1.000 33.65966  ? 267 TRP A NE1 1 
ATOM   5387  C CE2 . TRP B  1 287 ? -53.21523 -20.50619  56.94561  1.000 35.75051  ? 267 TRP A CE2 1 
ATOM   5388  C CE3 . TRP B  1 287 ? -53.66924 -18.13208  56.97963  1.000 36.96211  ? 267 TRP A CE3 1 
ATOM   5389  C CZ2 . TRP B  1 287 ? -53.02867 -20.49599  55.56408  1.000 35.05190  ? 267 TRP A CZ2 1 
ATOM   5390  C CZ3 . TRP B  1 287 ? -53.48355 -18.12663  55.60694  1.000 36.68534  ? 267 TRP A CZ3 1 
ATOM   5391  C CH2 . TRP B  1 287 ? -53.16776 -19.30107  54.91522  1.000 41.34267  ? 267 TRP A CH2 1 
ATOM   5392  N N   . ARG B  1 288 ? -50.98343 -17.48830  59.26900  1.000 34.50912  ? 268 ARG A N   1 
ATOM   5393  C CA  . ARG B  1 288 ? -50.26405 -16.74033  58.24988  1.000 29.37101  ? 268 ARG A CA  1 
ATOM   5394  C C   . ARG B  1 288 ? -49.65962 -17.72696  57.26739  1.000 38.87739  ? 268 ARG A C   1 
ATOM   5395  O O   . ARG B  1 288 ? -49.13001 -18.76536  57.67424  1.000 42.70618  ? 268 ARG A O   1 
ATOM   5396  C CB  . ARG B  1 288 ? -49.15381 -15.87731  58.85942  1.000 26.73299  ? 268 ARG A CB  1 
ATOM   5397  C CG  . ARG B  1 288 ? -49.62551 -14.91337  59.92853  1.000 27.40493  ? 268 ARG A CG  1 
ATOM   5398  C CD  . ARG B  1 288 ? -50.37202 -13.73836  59.33427  1.000 27.34405  ? 268 ARG A CD  1 
ATOM   5399  N NE  . ARG B  1 288 ? -50.63085 -12.70539  60.33284  1.000 27.31410  ? 268 ARG A NE  1 
ATOM   5400  C CZ  . ARG B  1 288 ? -51.70023 -12.67448  61.12252  1.000 30.65552  ? 268 ARG A CZ  1 
ATOM   5401  N NH1 . ARG B  1 288 ? -52.62338 -13.62487  61.03268  1.000 27.59369  ? 268 ARG A NH1 1 
ATOM   5402  N NH2 . ARG B  1 288 ? -51.84945 -11.68904  62.00107  1.000 27.48076  ? 268 ARG A NH2 1 
ATOM   5403  N N   . ASP B  1 289 ? -49.74553 -17.41471  55.97581  1.000 30.76965  ? 269 ASP A N   1 
ATOM   5404  C CA  . ASP B  1 289 ? -49.03658 -18.20892  54.98543  1.000 34.88273  ? 269 ASP A CA  1 
ATOM   5405  C C   . ASP B  1 289 ? -47.76461 -17.53071  54.49698  1.000 28.16118  ? 269 ASP A C   1 
ATOM   5406  O O   . ASP B  1 289 ? -46.98439 -18.16528  53.78193  1.000 32.60433  ? 269 ASP A O   1 
ATOM   5407  C CB  . ASP B  1 289 ? -49.95979 -18.56494  53.80846  1.000 42.71901  ? 269 ASP A CB  1 
ATOM   5408  C CG  . ASP B  1 289 ? -50.08794 -17.45723  52.78923  1.000 43.76081  ? 269 ASP A CG  1 
ATOM   5409  O OD1 . ASP B  1 289 ? -50.06632 -16.27427  53.17725  1.000 60.34247  ? 269 ASP A OD1 1 
ATOM   5410  O OD2 . ASP B  1 289 ? -50.23104 -17.77768  51.58924  1.000 48.11149  ? 269 ASP A OD2 1 
ATOM   5411  N N   . VAL B  1 290 ? -47.51505 -16.28798  54.92511  1.000 28.03137  ? 270 VAL A N   1 
ATOM   5412  C CA  . VAL B  1 290 ? -46.34005 -15.48063  54.58518  1.000 28.07470  ? 270 VAL A CA  1 
ATOM   5413  C C   . VAL B  1 290 ? -45.86446 -15.77000  53.16675  1.000 28.72373  ? 270 VAL A C   1 
ATOM   5414  O O   . VAL B  1 290 ? -44.69571 -16.10504  52.94635  1.000 28.57993  ? 270 VAL A O   1 
ATOM   5415  C CB  . VAL B  1 290 ? -45.19369 -15.67876  55.60420  1.000 28.79447  ? 270 VAL A CB  1 
ATOM   5416  C CG1 . VAL B  1 290 ? -45.50177 -14.94912  56.90037  1.000 26.85518  ? 270 VAL A CG1 1 
ATOM   5417  C CG2 . VAL B  1 290 ? -44.89409 -17.15904  55.87967  1.000 34.83607  ? 270 VAL A CG2 1 
ATOM   5418  N N   . GLY B  1 291 ? -46.77219 -15.63966  52.19319  1.000 36.52989  ? 271 GLY A N   1 
ATOM   5419  C CA  . GLY B  1 291 ? -46.47689 -16.05464  50.83144  1.000 36.65003  ? 271 GLY A CA  1 
ATOM   5420  C C   . GLY B  1 291 ? -45.74361 -15.02856  50.00321  1.000 34.57822  ? 271 GLY A C   1 
ATOM   5421  O O   . GLY B  1 291 ? -45.14127 -15.38554  48.98698  1.000 37.85362  ? 271 GLY A O   1 
ATOM   5422  N N   . THR B  1 292 ? -45.77999 -13.76820  50.41546  1.000 33.02076  ? 272 THR A N   1 
ATOM   5423  C CA  . THR B  1 292 ? -45.07797 -12.67289  49.76628  1.000 34.03083  ? 272 THR A CA  1 
ATOM   5424  C C   . THR B  1 292 ? -43.84921 -12.29908  50.58319  1.000 38.81002  ? 272 THR A C   1 
ATOM   5425  O O   . THR B  1 292 ? -43.73580 -12.63524  51.76509  1.000 42.15664  ? 272 THR A O   1 
ATOM   5426  C CB  . THR B  1 292 ? -45.97977 -11.43980  49.63652  1.000 39.17961  ? 272 THR A CB  1 
ATOM   5427  O OG1 . THR B  1 292 ? -45.87705 -10.67000  50.83664  1.000 44.98364  ? 272 THR A OG1 1 
ATOM   5428  C CG2 . THR B  1 292 ? -47.42575 -11.85089  49.46394  1.000 54.76548  ? 272 THR A CG2 1 
ATOM   5429  N N   . ILE B  1 293 ? -42.91694 -11.59504  49.94089  1.000 43.41038  ? 273 ILE A N   1 
ATOM   5430  C CA  . ILE B  1 293 ? -41.85965 -10.93644  50.70414  1.000 40.32666  ? 273 ILE A CA  1 
ATOM   5431  C C   . ILE B  1 293 ? -42.46312 -9.91198   51.65589  1.000 30.82595  ? 273 ILE A C   1 
ATOM   5432  O O   . ILE B  1 293 ? -42.04179 -9.79108   52.81393  1.000 30.15885  ? 273 ILE A O   1 
ATOM   5433  C CB  . ILE B  1 293 ? -40.83306 -10.29122  49.75706  1.000 42.51628  ? 273 ILE A CB  1 
ATOM   5434  C CG1 . ILE B  1 293 ? -40.00982 -11.37157  49.06478  1.000 36.28351  ? 273 ILE A CG1 1 
ATOM   5435  C CG2 . ILE B  1 293 ? -39.93371 -9.32084   50.51796  1.000 40.19189  ? 273 ILE A CG2 1 
ATOM   5436  C CD1 . ILE B  1 293 ? -39.17313 -10.84543  47.93927  1.000 43.31718  ? 273 ILE A CD1 1 
ATOM   5437  N N   . ASP B  1 294 ? -43.46703 -9.16559   51.18171  1.000 39.29917  ? 274 ASP A N   1 
ATOM   5438  C CA  . ASP B  1 294 ? -44.14449 -8.17875   52.02293  1.000 42.14252  ? 274 ASP A CA  1 
ATOM   5439  C C   . ASP B  1 294 ? -44.81794 -8.83230   53.22333  1.000 46.25793  ? 274 ASP A C   1 
ATOM   5440  O O   . ASP B  1 294 ? -44.77316 -8.29469   54.33734  1.000 31.50641  ? 274 ASP A O   1 
ATOM   5441  C CB  . ASP B  1 294 ? -45.18332 -7.41003   51.20434  1.000 53.05285  ? 274 ASP A CB  1 
ATOM   5442  C CG  . ASP B  1 294 ? -44.63808 -6.11654   50.62026  1.000 62.92390  ? 274 ASP A CG  1 
ATOM   5443  O OD1 . ASP B  1 294 ? -45.14213 -5.68316   49.56112  1.000 65.40685  ? 274 ASP A OD1 1 
ATOM   5444  O OD2 . ASP B  1 294 ? -43.71703 -5.52853   51.22284  1.000 68.64534  ? 274 ASP A OD2 1 
ATOM   5445  N N   . ALA B  1 295 ? -45.46022 -9.98847   53.01471  1.000 34.03591  ? 275 ALA A N   1 
ATOM   5446  C CA  . ALA B  1 295 ? -46.21200 -10.60690  54.09808  1.000 29.56149  ? 275 ALA A CA  1 
ATOM   5447  C C   . ALA B  1 295 ? -45.27521 -11.26888  55.09529  1.000 38.45363  ? 275 ALA A C   1 
ATOM   5448  O O   . ALA B  1 295 ? -45.50486 -11.20755  56.31064  1.000 36.14228  ? 275 ALA A O   1 
ATOM   5449  C CB  . ALA B  1 295 ? -47.21767 -11.60597  53.53476  1.000 29.75298  ? 275 ALA A CB  1 
ATOM   5450  N N   . TYR B  1 296 ? -44.20571 -11.89078  54.59427  1.000 39.49744  ? 276 TYR A N   1 
ATOM   5451  C CA  . TYR B  1 296 ? -43.18560 -12.46392  55.46317  1.000 27.87592  ? 276 TYR A CA  1 
ATOM   5452  C C   . TYR B  1 296 ? -42.54428 -11.39126  56.33710  1.000 38.06124  ? 276 TYR A C   1 
ATOM   5453  O O   . TYR B  1 296 ? -42.41920 -11.56011  57.55549  1.000 42.11707  ? 276 TYR A O   1 
ATOM   5454  C CB  . TYR B  1 296 ? -42.13740 -13.17766  54.61193  1.000 28.19366  ? 276 TYR A CB  1 
ATOM   5455  C CG  . TYR B  1 296 ? -40.94077 -13.67433  55.38146  1.000 29.83187  ? 276 TYR A CG  1 
ATOM   5456  C CD1 . TYR B  1 296 ? -40.95209 -14.92333  55.98665  1.000 26.77636  ? 276 TYR A CD1 1 
ATOM   5457  C CD2 . TYR B  1 296 ? -39.79193 -12.90601  55.48299  1.000 36.54447  ? 276 TYR A CD2 1 
ATOM   5458  C CE1 . TYR B  1 296 ? -39.86125 -15.37726  56.68987  1.000 32.79802  ? 276 TYR A CE1 1 
ATOM   5459  C CE2 . TYR B  1 296 ? -38.69336 -13.35773  56.17338  1.000 36.17992  ? 276 TYR A CE2 1 
ATOM   5460  C CZ  . TYR B  1 296 ? -38.72938 -14.59300  56.77257  1.000 30.61070  ? 276 TYR A CZ  1 
ATOM   5461  O OH  . TYR B  1 296 ? -37.62532 -15.03283  57.46596  1.000 27.81987  ? 276 TYR A OH  1 
ATOM   5462  N N   . TRP B  1 297 ? -42.13046 -10.27387  55.73270  1.000 28.41803  ? 277 TRP A N   1 
ATOM   5463  C CA  . TRP B  1 297 ? -41.63188 -9.16405   56.53687  1.000 34.82892  ? 277 TRP A CA  1 
ATOM   5464  C C   . TRP B  1 297 ? -42.71276 -8.61863   57.45746  1.000 35.76956  ? 277 TRP A C   1 
ATOM   5465  O O   . TRP B  1 297 ? -42.42065 -8.19445   58.58039  1.000 37.61897  ? 277 TRP A O   1 
ATOM   5466  C CB  . TRP B  1 297 ? -41.10756 -8.05347   55.63402  1.000 36.08102  ? 277 TRP A CB  1 
ATOM   5467  C CG  . TRP B  1 297 ? -40.80402 -6.77271   56.33177  1.000 30.69998  ? 277 TRP A CG  1 
ATOM   5468  C CD1 . TRP B  1 297 ? -39.58867 -6.36732   56.80168  1.000 29.70173  ? 277 TRP A CD1 1 
ATOM   5469  C CD2 . TRP B  1 297 ? -41.72001 -5.70579   56.61611  1.000 36.89962  ? 277 TRP A CD2 1 
ATOM   5470  N NE1 . TRP B  1 297 ? -39.69299 -5.12144   57.36889  1.000 35.44183  ? 277 TRP A NE1 1 
ATOM   5471  C CE2 . TRP B  1 297 ? -40.98971 -4.69215   57.26693  1.000 38.13796  ? 277 TRP A CE2 1 
ATOM   5472  C CE3 . TRP B  1 297 ? -43.08640 -5.51090   56.38659  1.000 41.42647  ? 277 TRP A CE3 1 
ATOM   5473  C CZ2 . TRP B  1 297 ? -41.57918 -3.49570   57.68836  1.000 38.12998  ? 277 TRP A CZ2 1 
ATOM   5474  C CZ3 . TRP B  1 297 ? -43.67250 -4.31864   56.80817  1.000 30.70243  ? 277 TRP A CZ3 1 
ATOM   5475  C CH2 . TRP B  1 297 ? -42.91860 -3.33162   57.45129  1.000 30.96668  ? 277 TRP A CH2 1 
ATOM   5476  N N   . GLN B  1 298 ? -43.96290 -8.62138   57.00579  1.000 35.57121  ? 278 GLN A N   1 
ATOM   5477  C CA  . GLN B  1 298 ? -45.05170 -8.14912   57.85610  1.000 33.97232  ? 278 GLN A CA  1 
ATOM   5478  C C   . GLN B  1 298 ? -45.19913 -9.00615   59.10723  1.000 37.57035  ? 278 GLN A C   1 
ATOM   5479  O O   . GLN B  1 298 ? -45.27042 -8.47757   60.22246  1.000 28.34313  ? 278 GLN A O   1 
ATOM   5480  C CB  . GLN B  1 298 ? -46.35870 -8.14326   57.07358  1.000 29.03869  ? 278 GLN A CB  1 
ATOM   5481  C CG  . GLN B  1 298 ? -47.42488 -7.23232   57.63106  1.000 29.35628  ? 278 GLN A CG  1 
ATOM   5482  C CD  . GLN B  1 298 ? -46.92909 -5.82673   57.94353  1.000 39.29858  ? 278 GLN A CD  1 
ATOM   5483  O OE1 . GLN B  1 298 ? -46.40122 -5.53475   59.02335  1.000 44.48693  ? 278 GLN A OE1 1 
ATOM   5484  N NE2 . GLN B  1 298 ? -47.07470 -4.95193   56.96727  1.000 30.61772  ? 278 GLN A NE2 1 
ATOM   5485  N N   . ALA B  1 299 ? -45.26247 -10.33323  58.94362  1.000 27.28569  ? 279 ALA A N   1 
ATOM   5486  C CA  . ALA B  1 299 ? -45.51985 -11.19324  60.09356  1.000 26.61020  ? 279 ALA A CA  1 
ATOM   5487  C C   . ALA B  1 299 ? -44.33957 -11.21942  61.05599  1.000 26.12366  ? 279 ALA A C   1 
ATOM   5488  O O   . ALA B  1 299 ? -44.52812 -11.38974  62.26658  1.000 25.73388  ? 279 ALA A O   1 
ATOM   5489  C CB  . ALA B  1 299 ? -45.86547 -12.60978  59.63546  1.000 26.38637  ? 279 ALA A CB  1 
ATOM   5490  N N   . ASN B  1 300 ? -43.12097 -11.05539  60.54217  1.000 32.79173  ? 280 ASN A N   1 
ATOM   5491  C CA  . ASN B  1 300 ? -41.95431 -10.98544  61.41486  1.000 25.90192  ? 280 ASN A CA  1 
ATOM   5492  C C   . ASN B  1 300 ? -41.93220 -9.67868   62.19774  1.000 35.24381  ? 280 ASN A C   1 
ATOM   5493  O O   . ASN B  1 300 ? -41.78925 -9.68440   63.42680  1.000 29.64302  ? 280 ASN A O   1 
ATOM   5494  C CB  . ASN B  1 300 ? -40.68081 -11.15803  60.58683  1.000 26.06513  ? 280 ASN A CB  1 
ATOM   5495  C CG  . ASN B  1 300 ? -40.43457 -12.61961  60.20535  1.000 34.52881  ? 280 ASN A CG  1 
ATOM   5496  O OD1 . ASN B  1 300 ? -40.61611 -13.02218  59.05506  1.000 27.44072  ? 280 ASN A OD1 1 
ATOM   5497  N ND2 . ASN B  1 300 ? -40.02934 -13.41568  61.18060  1.000 25.07303  ? 280 ASN A ND2 1 
ATOM   5498  N N   . ILE B  1 301 ? -42.09656 -8.54657   61.50188  1.000 26.99121  ? 281 ILE A N   1 
ATOM   5499  C CA  . ILE B  1 301 ? -42.01003 -7.24366   62.15628  1.000 28.42665  ? 281 ILE A CA  1 
ATOM   5500  C C   . ILE B  1 301 ? -43.17155 -7.03868   63.12466  1.000 27.20589  ? 281 ILE A C   1 
ATOM   5501  O O   . ILE B  1 301 ? -43.02628 -6.34284   64.13774  1.000 27.73588  ? 281 ILE A O   1 
ATOM   5502  C CB  . ILE B  1 301 ? -41.92059 -6.12559   61.09351  1.000 39.60230  ? 281 ILE A CB  1 
ATOM   5503  C CG1 . ILE B  1 301 ? -40.48091 -5.98156   60.60908  1.000 34.15238  ? 281 ILE A CG1 1 
ATOM   5504  C CG2 . ILE B  1 301 ? -42.37882 -4.77999   61.62511  1.000 44.61776  ? 281 ILE A CG2 1 
ATOM   5505  C CD1 . ILE B  1 301 ? -39.59288 -5.35292   61.63568  1.000 32.84119  ? 281 ILE A CD1 1 
ATOM   5506  N N   . ASP B  1 302 ? -44.32125 -7.66892   62.86869  1.000 33.71152  ? 282 ASP A N   1 
ATOM   5507  C CA  . ASP B  1 302 ? -45.45473 -7.51982   63.77758  1.000 38.83008  ? 282 ASP A CA  1 
ATOM   5508  C C   . ASP B  1 302 ? -45.15002 -8.04043   65.17580  1.000 38.73799  ? 282 ASP A C   1 
ATOM   5509  O O   . ASP B  1 302 ? -45.81137 -7.62936   66.13797  1.000 33.20329  ? 282 ASP A O   1 
ATOM   5510  C CB  . ASP B  1 302 ? -46.68017 -8.24185   63.22550  1.000 44.56254  ? 282 ASP A CB  1 
ATOM   5511  C CG  . ASP B  1 302 ? -47.36531 -7.46663   62.12625  1.000 39.25022  ? 282 ASP A CG  1 
ATOM   5512  O OD1 . ASP B  1 302 ? -48.29498 -8.03004   61.51529  1.000 35.75009  ? 282 ASP A OD1 1 
ATOM   5513  O OD2 . ASP B  1 302 ? -46.97079 -6.30653   61.86520  1.000 31.55270  ? 282 ASP A OD2 1 
ATOM   5514  N N   . LEU B  1 303 ? -44.16639 -8.93413   65.30602  1.000 25.98222  ? 283 LEU A N   1 
ATOM   5515  C CA  . LEU B  1 303 ? -43.76416 -9.43479   66.61388  1.000 25.54382  ? 283 LEU A CA  1 
ATOM   5516  C C   . LEU B  1 303 ? -43.06501 -8.37888   67.45770  1.000 25.86849  ? 283 LEU A C   1 
ATOM   5517  O O   . LEU B  1 303 ? -42.99057 -8.53438   68.67958  1.000 25.78001  ? 283 LEU A O   1 
ATOM   5518  C CB  . LEU B  1 303 ? -42.84898 -10.64524  66.44882  1.000 24.99391  ? 283 LEU A CB  1 
ATOM   5519  C CG  . LEU B  1 303 ? -43.52278 -11.84271  65.78133  1.000 24.70164  ? 283 LEU A CG  1 
ATOM   5520  C CD1 . LEU B  1 303 ? -42.50584 -12.92184  65.50336  1.000 24.28378  ? 283 LEU A CD1 1 
ATOM   5521  C CD2 . LEU B  1 303 ? -44.64639 -12.37428  66.66127  1.000 24.53148  ? 283 LEU A CD2 1 
ATOM   5522  N N   . THR B  1 304 ? -42.53734 -7.31925   66.84538  1.000 26.41192  ? 284 THR A N   1 
ATOM   5523  C CA  . THR B  1 304 ? -41.96313 -6.25284   67.65358  1.000 34.59652  ? 284 THR A CA  1 
ATOM   5524  C C   . THR B  1 304 ? -43.02513 -5.39742   68.32564  1.000 27.31537  ? 284 THR A C   1 
ATOM   5525  O O   . THR B  1 304 ? -42.67515 -4.57721   69.17702  1.000 33.99164  ? 284 THR A O   1 
ATOM   5526  C CB  . THR B  1 304 ? -41.04658 -5.36172   66.81105  1.000 29.39155  ? 284 THR A CB  1 
ATOM   5527  O OG1 . THR B  1 304 ? -41.78268 -4.80745   65.71274  1.000 29.16534  ? 284 THR A OG1 1 
ATOM   5528  C CG2 . THR B  1 304 ? -39.86585 -6.16293   66.27598  1.000 31.57175  ? 284 THR A CG2 1 
ATOM   5529  N N   . ASP B  1 305 ? -44.30004 -5.56789   67.97338  1.000 27.31228  ? 285 ASP A N   1 
ATOM   5530  C CA  . ASP B  1 305 ? -45.36312 -4.77858   68.58376  1.000 32.93921  ? 285 ASP A CA  1 
ATOM   5531  C C   . ASP B  1 305 ? -45.38498 -4.99013   70.09686  1.000 32.05371  ? 285 ASP A C   1 
ATOM   5532  O O   . ASP B  1 305 ? -44.88802 -5.99307   70.62246  1.000 35.26105  ? 285 ASP A O   1 
ATOM   5533  C CB  . ASP B  1 305 ? -46.73125 -5.15505   68.00692  1.000 38.90814  ? 285 ASP A CB  1 
ATOM   5534  C CG  . ASP B  1 305 ? -46.90632 -4.72037   66.56016  1.000 38.67938  ? 285 ASP A CG  1 
ATOM   5535  O OD1 . ASP B  1 305 ? -46.06798 -3.94769   66.05048  1.000 40.71887  ? 285 ASP A OD1 1 
ATOM   5536  O OD2 . ASP B  1 305 ? -47.89861 -5.16201   65.93694  1.000 37.65957  ? 285 ASP A OD2 1 
ATOM   5537  N N   . VAL B  1 306 ? -45.98478 -4.02657   70.80315  1.000 29.49324  ? 286 VAL A N   1 
ATOM   5538  C CA  . VAL B  1 306 ? -46.12624 -4.16577   72.24441  1.000 28.80660  ? 286 VAL A CA  1 
ATOM   5539  C C   . VAL B  1 306 ? -47.15375 -5.25656   72.57005  1.000 33.22431  ? 286 VAL A C   1 
ATOM   5540  O O   . VAL B  1 306 ? -46.93186 -6.09020   73.45011  1.000 37.19630  ? 286 VAL A O   1 
ATOM   5541  C CB  . VAL B  1 306 ? -46.48390 -2.80570   72.87687  1.000 41.83186  ? 286 VAL A CB  1 
ATOM   5542  C CG1 . VAL B  1 306 ? -45.41145 -1.78389   72.56690  1.000 35.75535  ? 286 VAL A CG1 1 
ATOM   5543  C CG2 . VAL B  1 306 ? -47.83007 -2.30908   72.39640  1.000 50.87296  ? 286 VAL A CG2 1 
ATOM   5544  N N   . VAL B  1 307 ? -48.24068 -5.32685   71.80736  1.000 31.50841  ? 287 VAL A N   1 
ATOM   5545  C CA  . VAL B  1 307 ? -49.22031 -6.42012   71.89643  1.000 27.64915  ? 287 VAL A CA  1 
ATOM   5546  C C   . VAL B  1 307 ? -49.26496 -7.17609   70.56763  1.000 36.90566  ? 287 VAL A C   1 
ATOM   5547  O O   . VAL B  1 307 ? -50.07798 -6.84530   69.68446  1.000 27.59813  ? 287 VAL A O   1 
ATOM   5548  C CB  . VAL B  1 307 ? -50.62339 -5.90253   72.26836  1.000 28.81671  ? 287 VAL A CB  1 
ATOM   5549  C CG1 . VAL B  1 307 ? -51.62734 -7.04779   72.30848  1.000 28.05243  ? 287 VAL A CG1 1 
ATOM   5550  C CG2 . VAL B  1 307 ? -50.57460 -5.18273   73.59634  1.000 28.76802  ? 287 VAL A CG2 1 
ATOM   5551  N N   . PRO B  1 308 ? -48.41865 -8.18262   70.36923  1.000 27.91480  ? 288 PRO A N   1 
ATOM   5552  C CA  . PRO B  1 308 ? -48.39470 -8.87155   69.07589  1.000 26.32489  ? 288 PRO A CA  1 
ATOM   5553  C C   . PRO B  1 308 ? -49.59340 -9.79305   68.88703  1.000 38.63333  ? 288 PRO A C   1 
ATOM   5554  O O   . PRO B  1 308 ? -50.20441 -10.27571  69.84575  1.000 26.24883  ? 288 PRO A O   1 
ATOM   5555  C CB  . PRO B  1 308 ? -47.08192 -9.66577   69.12295  1.000 25.72474  ? 288 PRO A CB  1 
ATOM   5556  C CG  . PRO B  1 308 ? -46.81446 -9.85819   70.56792  1.000 29.79252  ? 288 PRO A CG  1 
ATOM   5557  C CD  . PRO B  1 308 ? -47.35848 -8.64959   71.27692  1.000 26.19940  ? 288 PRO A CD  1 
ATOM   5558  N N   . ASP B  1 309 ? -49.93436 -10.01536  67.61259  1.000 26.37384  ? 289 ASP A N   1 
ATOM   5559  C CA  . ASP B  1 309 ? -50.94977 -11.00470  67.26824  1.000 34.23277  ? 289 ASP A CA  1 
ATOM   5560  C C   . ASP B  1 309 ? -50.50554 -12.40961  67.65173  1.000 29.97773  ? 289 ASP A C   1 
ATOM   5561  O O   . ASP B  1 309 ? -51.32717 -13.24102  68.04997  1.000 27.63528  ? 289 ASP A O   1 
ATOM   5562  C CB  . ASP B  1 309 ? -51.24827 -10.95137  65.76991  1.000 32.92248  ? 289 ASP A CB  1 
ATOM   5563  C CG  . ASP B  1 309 ? -51.71142 -9.59598   65.32209  1.000 31.96073  ? 289 ASP A CG  1 
ATOM   5564  O OD1 . ASP B  1 309 ? -51.28872 -9.15182   64.23847  1.000 35.40901  ? 289 ASP A OD1 1 
ATOM   5565  O OD2 . ASP B  1 309 ? -52.50212 -8.97844   66.05700  1.000 43.51676  ? 289 ASP A OD2 1 
ATOM   5566  N N   . LEU B  1 310 ? -49.21635 -12.69654  67.50904  1.000 26.51461  ? 290 LEU A N   1 
ATOM   5567  C CA  . LEU B  1 310 ? -48.64320 -13.99584  67.81881  1.000 24.77485  ? 290 LEU A CA  1 
ATOM   5568  C C   . LEU B  1 310 ? -47.87972 -13.91313  69.13363  1.000 27.33620  ? 290 LEU A C   1 
ATOM   5569  O O   . LEU B  1 310 ? -47.01565 -13.04603  69.30101  1.000 27.64549  ? 290 LEU A O   1 
ATOM   5570  C CB  . LEU B  1 310 ? -47.71380 -14.45205  66.69691  1.000 26.67893  ? 290 LEU A CB  1 
ATOM   5571  C CG  . LEU B  1 310 ? -47.06024 -15.82390  66.88180  1.000 27.69359  ? 290 LEU A CG  1 
ATOM   5572  C CD1 . LEU B  1 310 ? -48.11077 -16.92551  66.93281  1.000 24.09957  ? 290 LEU A CD1 1 
ATOM   5573  C CD2 . LEU B  1 310 ? -46.06245 -16.08399  65.76936  1.000 23.91738  ? 290 LEU A CD2 1 
ATOM   5574  N N   . ASP B  1 311 ? -48.19751 -14.81525  70.06261  1.000 28.01562  ? 291 ASP A N   1 
ATOM   5575  C CA  . ASP B  1 311 ? -47.55596 -14.86475  71.37800  1.000 24.12999  ? 291 ASP A CA  1 
ATOM   5576  C C   . ASP B  1 311 ? -46.44376 -15.90691  71.31258  1.000 36.48576  ? 291 ASP A C   1 
ATOM   5577  O O   . ASP B  1 311 ? -46.65995 -17.09033  71.58207  1.000 26.79701  ? 291 ASP A O   1 
ATOM   5578  C CB  . ASP B  1 311 ? -48.57985 -15.18912  72.46005  1.000 24.37379  ? 291 ASP A CB  1 
ATOM   5579  C CG  . ASP B  1 311 ? -47.95624 -15.35077  73.84449  1.000 24.26546  ? 291 ASP A CG  1 
ATOM   5580  O OD1 . ASP B  1 311 ? -46.74959 -15.08329  74.01926  1.000 24.04095  ? 291 ASP A OD1 1 
ATOM   5581  O OD2 . ASP B  1 311 ? -48.69152 -15.74712  74.77176  1.000 32.30917  ? 291 ASP A OD2 1 
ATOM   5582  N N   . ILE B  1 312 ? -45.23231 -15.45961  70.95942  1.000 23.45290  ? 292 ILE A N   1 
ATOM   5583  C CA  . ILE B  1 312 ? -44.10162 -16.38290  70.90241  1.000 26.26424  ? 292 ILE A CA  1 
ATOM   5584  C C   . ILE B  1 312 ? -43.54827 -16.70480  72.27895  1.000 32.54827  ? 292 ILE A C   1 
ATOM   5585  O O   . ILE B  1 312 ? -42.58166 -17.47452  72.38043  1.000 25.69499  ? 292 ILE A O   1 
ATOM   5586  C CB  . ILE B  1 312 ? -42.97811 -15.84398  69.99518  1.000 24.23624  ? 292 ILE A CB  1 
ATOM   5587  C CG1 . ILE B  1 312 ? -42.32955 -14.60138  70.60603  1.000 23.58296  ? 292 ILE A CG1 1 
ATOM   5588  C CG2 . ILE B  1 312 ? -43.52594 -15.54985  68.60565  1.000 26.78740  ? 292 ILE A CG2 1 
ATOM   5589  C CD1 . ILE B  1 312 ? -41.04367 -14.18585  69.90371  1.000 23.96367  ? 292 ILE A CD1 1 
ATOM   5590  N N   . TYR B  1 313 ? -44.13955 -16.15663  73.34231  1.000 23.17753  ? 293 TYR A N   1 
ATOM   5591  C CA  . TYR B  1 313 ? -43.76047 -16.48743  74.70898  1.000 29.00898  ? 293 TYR A CA  1 
ATOM   5592  C C   . TYR B  1 313 ? -44.76371 -17.40326  75.39533  1.000 26.66616  ? 293 TYR A C   1 
ATOM   5593  O O   . TYR B  1 313 ? -44.60308 -17.69999  76.58261  1.000 37.25682  ? 293 TYR A O   1 
ATOM   5594  C CB  . TYR B  1 313 ? -43.57318 -15.20700  75.52828  1.000 23.60025  ? 293 TYR A CB  1 
ATOM   5595  C CG  . TYR B  1 313 ? -42.44770 -14.34866  74.99053  1.000 32.36715  ? 293 TYR A CG  1 
ATOM   5596  C CD1 . TYR B  1 313 ? -41.12628 -14.62128  75.31944  1.000 23.50034  ? 293 TYR A CD1 1 
ATOM   5597  C CD2 . TYR B  1 313 ? -42.70433 -13.28277  74.13045  1.000 31.29079  ? 293 TYR A CD2 1 
ATOM   5598  C CE1 . TYR B  1 313 ? -40.08773 -13.85335  74.81878  1.000 25.01898  ? 293 TYR A CE1 1 
ATOM   5599  C CE2 . TYR B  1 313 ? -41.67158 -12.50630  73.62317  1.000 29.70492  ? 293 TYR A CE2 1 
ATOM   5600  C CZ  . TYR B  1 313 ? -40.36571 -12.79933  73.97252  1.000 25.86564  ? 293 TYR A CZ  1 
ATOM   5601  O OH  . TYR B  1 313 ? -39.33167 -12.04517  73.47428  1.000 35.72106  ? 293 TYR A OH  1 
ATOM   5602  N N   . ASP B  1 314 ? -45.78761 -17.85707  74.68380  1.000 23.26082  ? 294 ASP A N   1 
ATOM   5603  C CA  . ASP B  1 314 ? -46.70433 -18.82822  75.25412  1.000 32.38864  ? 294 ASP A CA  1 
ATOM   5604  C C   . ASP B  1 314 ? -46.00112 -20.16074  75.47447  1.000 28.82879  ? 294 ASP A C   1 
ATOM   5605  O O   . ASP B  1 314 ? -45.20693 -20.60988  74.64243  1.000 22.69135  ? 294 ASP A O   1 
ATOM   5606  C CB  . ASP B  1 314 ? -47.90784 -19.02978  74.34320  1.000 40.61084  ? 294 ASP A CB  1 
ATOM   5607  C CG  . ASP B  1 314 ? -48.67474 -20.28458  74.68073  1.000 42.27102  ? 294 ASP A CG  1 
ATOM   5608  O OD1 . ASP B  1 314 ? -49.32530 -20.29053  75.74607  1.000 43.44686  ? 294 ASP A OD1 1 
ATOM   5609  O OD2 . ASP B  1 314 ? -48.62330 -21.26025  73.90271  1.000 31.08087  ? 294 ASP A OD2 1 
ATOM   5610  N N   . LYS B  1 315 ? -46.29056 -20.78904  76.61676  1.000 27.75641  ? 295 LYS A N   1 
ATOM   5611  C CA  . LYS B  1 315 ? -45.77635 -22.11203  76.94019  1.000 32.97655  ? 295 LYS A CA  1 
ATOM   5612  C C   . LYS B  1 315 ? -46.87464 -23.16380  76.96173  1.000 26.74016  ? 295 LYS A C   1 
ATOM   5613  O O   . LYS B  1 315 ? -46.57393 -24.35614  77.10419  1.000 25.06975  ? 295 LYS A O   1 
ATOM   5614  C CB  . LYS B  1 315 ? -45.06376 -22.07423  78.29978  1.000 35.30656  ? 295 LYS A CB  1 
ATOM   5615  C CG  . LYS B  1 315 ? -43.78137 -21.24000  78.29724  1.000 33.93580  ? 295 LYS A CG  1 
ATOM   5616  C CD  . LYS B  1 315 ? -43.08440 -21.30271  79.64762  1.000 35.22768  ? 295 LYS A CD  1 
ATOM   5617  C CE  . LYS B  1 315 ? -41.61951 -20.90485  79.53248  1.000 43.47784  ? 295 LYS A CE  1 
ATOM   5618  N NZ  . LYS B  1 315 ? -40.99007 -20.72282  80.87120  1.000 51.33667  ? 295 LYS A NZ  1 
ATOM   5619  N N   . SER B  1 316 ? -48.12840 -22.75691  76.81166  1.000 25.27072  ? 296 SER A N   1 
ATOM   5620  C CA  . SER B  1 316 ? -49.24491 -23.68611  76.76322  1.000 24.07010  ? 296 SER A CA  1 
ATOM   5621  C C   . SER B  1 316 ? -49.23826 -24.59437  75.52996  1.000 29.47685  ? 296 SER A C   1 
ATOM   5622  O O   . SER B  1 316 ? -49.56058 -25.77538  75.64191  1.000 28.62039  ? 296 SER A O   1 
ATOM   5623  C CB  . SER B  1 316 ? -50.54300 -22.87689  76.80037  1.000 24.61216  ? 296 SER A CB  1 
ATOM   5624  O OG  . SER B  1 316 ? -50.95746 -22.62072  75.46230  1.000 43.43828  ? 296 SER A OG  1 
ATOM   5625  N N   . TRP B  1 317 ? -48.93145 -24.04747  74.35285  1.000 25.08210  ? 297 TRP A N   1 
ATOM   5626  C CA  . TRP B  1 317 ? -48.92234 -24.80524  73.09938  1.000 28.58599  ? 297 TRP A CA  1 
ATOM   5627  C C   . TRP B  1 317 ? -47.55977 -24.55786  72.46869  1.000 23.04603  ? 297 TRP A C   1 
ATOM   5628  O O   . TRP B  1 317 ? -47.43297 -23.76838  71.52099  1.000 24.87224  ? 297 TRP A O   1 
ATOM   5629  C CB  . TRP B  1 317 ? -50.06191 -24.37892  72.17528  1.000 23.98882  ? 297 TRP A CB  1 
ATOM   5630  C CG  . TRP B  1 317 ? -50.38119 -25.35697  71.09055  1.000 25.03354  ? 297 TRP A CG  1 
ATOM   5631  C CD1 . TRP B  1 317 ? -49.94158 -25.31060  69.80649  1.000 24.05112  ? 297 TRP A CD1 1 
ATOM   5632  C CD2 . TRP B  1 317 ? -51.22669 -26.51241  71.18550  1.000 24.67699  ? 297 TRP A CD2 1 
ATOM   5633  N NE1 . TRP B  1 317 ? -50.44715 -26.36816  69.09367  1.000 24.42478  ? 297 TRP A NE1 1 
ATOM   5634  C CE2 . TRP B  1 317 ? -51.24070 -27.12108  69.91618  1.000 24.81808  ? 297 TRP A CE2 1 
ATOM   5635  C CE3 . TRP B  1 317 ? -51.96957 -27.08958  72.21855  1.000 26.32753  ? 297 TRP A CE3 1 
ATOM   5636  C CZ2 . TRP B  1 317 ? -51.96764 -28.28132  69.64777  1.000 33.86836  ? 297 TRP A CZ2 1 
ATOM   5637  C CZ3 . TRP B  1 317 ? -52.68509 -28.25070  71.95458  1.000 34.02307  ? 297 TRP A CZ3 1 
ATOM   5638  C CH2 . TRP B  1 317 ? -52.68012 -28.83170  70.67842  1.000 31.52052  ? 297 TRP A CH2 1 
ATOM   5639  N N   . PRO B  1 318 ? -46.51644 -25.19907  72.97891  1.000 24.06083  ? 298 PRO A N   1 
ATOM   5640  C CA  . PRO B  1 318 ? -45.15654 -24.79614  72.61775  1.000 22.31256  ? 298 PRO A CA  1 
ATOM   5641  C C   . PRO B  1 318 ? -44.77247 -25.23974  71.21810  1.000 24.22453  ? 298 PRO A C   1 
ATOM   5642  O O   . PRO B  1 318 ? -45.26997 -26.23945  70.69069  1.000 26.52502  ? 298 PRO A O   1 
ATOM   5643  C CB  . PRO B  1 318 ? -44.29794 -25.49925  73.67138  1.000 22.13885  ? 298 PRO A CB  1 
ATOM   5644  C CG  . PRO B  1 318 ? -45.08202 -26.73485  73.98628  1.000 22.41609  ? 298 PRO A CG  1 
ATOM   5645  C CD  . PRO B  1 318 ? -46.52693 -26.32975  73.92228  1.000 22.83416  ? 298 PRO A CD  1 
ATOM   5646  N N   . ILE B  1 319 ? -43.85380 -24.48113  70.62878  1.000 24.97996  ? 299 ILE A N   1 
ATOM   5647  C CA  . ILE B  1 319 ? -43.36161 -24.72954  69.28061  1.000 21.97744  ? 299 ILE A CA  1 
ATOM   5648  C C   . ILE B  1 319 ? -41.96760 -25.32494  69.42038  1.000 25.55846  ? 299 ILE A C   1 
ATOM   5649  O O   . ILE B  1 319 ? -40.99441 -24.60954  69.68317  1.000 21.52548  ? 299 ILE A O   1 
ATOM   5650  C CB  . ILE B  1 319 ? -43.34151 -23.45585  68.43322  1.000 28.91724  ? 299 ILE A CB  1 
ATOM   5651  C CG1 . ILE B  1 319 ? -44.71128 -22.77312  68.44732  1.000 25.35133  ? 299 ILE A CG1 1 
ATOM   5652  C CG2 . ILE B  1 319 ? -42.90607 -23.78477  67.01004  1.000 26.86112  ? 299 ILE A CG2 1 
ATOM   5653  C CD1 . ILE B  1 319 ? -45.80030 -23.59896  67.81211  1.000 22.73838  ? 299 ILE A CD1 1 
ATOM   5654  N N   . TRP B  1 320 ? -41.86618 -26.63867  69.24423  1.000 21.72424  ? 300 TRP A N   1 
ATOM   5655  C CA  . TRP B  1 320 ? -40.56195 -27.28241  69.25621  1.000 21.53363  ? 300 TRP A CA  1 
ATOM   5656  C C   . TRP B  1 320 ? -39.80700 -26.96259  67.97431  1.000 21.56833  ? 300 TRP A C   1 
ATOM   5657  O O   . TRP B  1 320 ? -40.40035 -26.84236  66.89795  1.000 21.81147  ? 300 TRP A O   1 
ATOM   5658  C CB  . TRP B  1 320 ? -40.70854 -28.79685  69.40928  1.000 21.65109  ? 300 TRP A CB  1 
ATOM   5659  C CG  . TRP B  1 320 ? -39.38734 -29.48731  69.45525  1.000 24.90725  ? 300 TRP A CG  1 
ATOM   5660  C CD1 . TRP B  1 320 ? -38.71146 -30.03642  68.40493  1.000 23.22252  ? 300 TRP A CD1 1 
ATOM   5661  C CD2 . TRP B  1 320 ? -38.56215 -29.68092  70.60999  1.000 21.33718  ? 300 TRP A CD2 1 
ATOM   5662  N NE1 . TRP B  1 320 ? -37.52231 -30.56903  68.83659  1.000 21.49680  ? 300 TRP A NE1 1 
ATOM   5663  C CE2 . TRP B  1 320 ? -37.40762 -30.36600  70.18676  1.000 21.32524  ? 300 TRP A CE2 1 
ATOM   5664  C CE3 . TRP B  1 320 ? -38.69336 -29.35166  71.96125  1.000 21.26839  ? 300 TRP A CE3 1 
ATOM   5665  C CZ2 . TRP B  1 320 ? -36.38732 -30.72261  71.06636  1.000 21.23473  ? 300 TRP A CZ2 1 
ATOM   5666  C CZ3 . TRP B  1 320 ? -37.68176 -29.70583  72.83144  1.000 21.19305  ? 300 TRP A CZ3 1 
ATOM   5667  C CH2 . TRP B  1 320 ? -36.54325 -30.38604  72.38116  1.000 21.16987  ? 300 TRP A CH2 1 
ATOM   5668  N N   . THR B  1 321 ? -38.48985 -26.81438  68.09396  1.000 24.68378  ? 301 THR A N   1 
ATOM   5669  C CA  . THR B  1 321 ? -37.63556 -26.62697  66.92989  1.000 21.53090  ? 301 THR A CA  1 
ATOM   5670  C C   . THR B  1 321 ? -36.23422 -27.10361  67.29027  1.000 21.42724  ? 301 THR A C   1 
ATOM   5671  O O   . THR B  1 321 ? -35.96318 -27.49147  68.42685  1.000 21.26170  ? 301 THR A O   1 
ATOM   5672  C CB  . THR B  1 321 ? -37.64408 -25.16239  66.46570  1.000 27.24715  ? 301 THR A CB  1 
ATOM   5673  O OG1 . THR B  1 321 ? -36.91236 -25.03107  65.24249  1.000 36.75460  ? 301 THR A OG1 1 
ATOM   5674  C CG2 . THR B  1 321 ? -37.02242 -24.25736  67.50150  1.000 22.77971  ? 301 THR A CG2 1 
ATOM   5675  N N   . TYR B  1 322 ? -35.34170 -27.09318  66.30506  1.000 26.88107  ? 302 TYR A N   1 
ATOM   5676  C CA  . TYR B  1 322 ? -33.93989 -27.38013  66.57365  1.000 21.60100  ? 302 TYR A CA  1 
ATOM   5677  C C   . TYR B  1 322 ? -33.28210 -26.14417  67.17815  1.000 21.55857  ? 302 TYR A C   1 
ATOM   5678  O O   . TYR B  1 322 ? -33.28018 -25.07262  66.56643  1.000 22.62550  ? 302 TYR A O   1 
ATOM   5679  C CB  . TYR B  1 322 ? -33.21247 -27.80872  65.30603  1.000 25.10444  ? 302 TYR A CB  1 
ATOM   5680  C CG  . TYR B  1 322 ? -31.73343 -27.98200  65.53712  1.000 34.09077  ? 302 TYR A CG  1 
ATOM   5681  C CD1 . TYR B  1 322 ? -31.26132 -29.08982  66.20982  1.000 31.86684  ? 302 TYR A CD1 1 
ATOM   5682  C CD2 . TYR B  1 322 ? -30.81018 -27.04630  65.07510  1.000 36.92102  ? 302 TYR A CD2 1 
ATOM   5683  C CE1 . TYR B  1 322 ? -29.93117 -29.26633  66.44565  1.000 39.43219  ? 302 TYR A CE1 1 
ATOM   5684  C CE2 . TYR B  1 322 ? -29.45376 -27.22270  65.30031  1.000 31.62760  ? 302 TYR A CE2 1 
ATOM   5685  C CZ  . TYR B  1 322 ? -29.02884 -28.34478  65.99114  1.000 22.32735  ? 302 TYR A CZ  1 
ATOM   5686  O OH  . TYR B  1 322 ? -27.70438 -28.58200  66.25298  1.000 30.19931  ? 302 TYR A OH  1 
ATOM   5687  N N   . ALA B  1 323 ? -32.73670 -26.29302  68.38233  1.000 22.80551  ? 303 ALA A N   1 
ATOM   5688  C CA  . ALA B  1 323 ? -32.09154 -25.20116  69.09478  1.000 34.55797  ? 303 ALA A CA  1 
ATOM   5689  C C   . ALA B  1 323 ? -30.74486 -25.66775  69.61918  1.000 29.77767  ? 303 ALA A C   1 
ATOM   5690  O O   . ALA B  1 323 ? -30.61636 -26.79076  70.11669  1.000 31.74657  ? 303 ALA A O   1 
ATOM   5691  C CB  . ALA B  1 323 ? -32.95265 -24.70107  70.26186  1.000 45.29911  ? 303 ALA A CB  1 
ATOM   5692  N N   . GLU B  1 324 ? -29.74418 -24.80788  69.49900  1.000 27.34796  ? 304 GLU A N   1 
ATOM   5693  C CA  . GLU B  1 324 ? -28.42779 -25.06885  70.05397  1.000 32.46038  ? 304 GLU A CA  1 
ATOM   5694  C C   . GLU B  1 324 ? -28.21807 -24.21131  71.29443  1.000 33.05992  ? 304 GLU A C   1 
ATOM   5695  O O   . GLU B  1 324 ? -28.87921 -23.18993  71.48397  1.000 26.60311  ? 304 GLU A O   1 
ATOM   5696  C CB  . GLU B  1 324 ? -27.33508 -24.79949  69.01539  1.000 28.43903  ? 304 GLU A CB  1 
ATOM   5697  C CG  . GLU B  1 324 ? -27.38035 -25.78716  67.86729  1.000 36.68373  ? 304 GLU A CG  1 
ATOM   5698  C CD  . GLU B  1 324 ? -26.24259 -25.63073  66.88236  1.000 41.87044  ? 304 GLU A CD  1 
ATOM   5699  O OE1 . GLU B  1 324 ? -26.08130 -26.53772  66.03893  1.000 46.98678  ? 304 GLU A OE1 1 
ATOM   5700  O OE2 . GLU B  1 324 ? -25.51638 -24.61389  66.94143  1.000 35.35482  ? 304 GLU A OE2 1 
ATOM   5701  N N   . ILE B  1 325 ? -27.31448 -24.66175  72.16432  1.000 36.50441  ? 305 ILE A N   1 
ATOM   5702  C CA  . ILE B  1 325 ? -26.92932 -23.84147  73.30523  1.000 32.90370  ? 305 ILE A CA  1 
ATOM   5703  C C   . ILE B  1 325 ? -26.30218 -22.56086  72.77661  1.000 30.91923  ? 305 ILE A C   1 
ATOM   5704  O O   . ILE B  1 325 ? -25.34243 -22.59455  71.99840  1.000 25.81168  ? 305 ILE A O   1 
ATOM   5705  C CB  . ILE B  1 325 ? -25.97799 -24.60399  74.23062  1.000 37.62401  ? 305 ILE A CB  1 
ATOM   5706  C CG1 . ILE B  1 325 ? -26.59710 -25.93797  74.65390  1.000 22.45482  ? 305 ILE A CG1 1 
ATOM   5707  C CG2 . ILE B  1 325 ? -25.64773 -23.76668  75.45004  1.000 23.18041  ? 305 ILE A CG2 1 
ATOM   5708  C CD1 . ILE B  1 325 ? -25.72001 -26.72782  75.59696  1.000 23.62814  ? 305 ILE A CD1 1 
ATOM   5709  N N   . THR B  1 326 ? -26.85198 -21.42321  73.18298  1.000 32.48880  ? 306 THR A N   1 
ATOM   5710  C CA  . THR B  1 326 ? -26.52800 -20.16311  72.54982  1.000 36.61233  ? 306 THR A CA  1 
ATOM   5711  C C   . THR B  1 326 ? -26.15006 -19.13636  73.60968  1.000 35.30888  ? 306 THR A C   1 
ATOM   5712  O O   . THR B  1 326 ? -26.89946 -18.94882  74.58352  1.000 31.36306  ? 306 THR A O   1 
ATOM   5713  C CB  . THR B  1 326 ? -27.72131 -19.67749  71.72015  1.000 35.97739  ? 306 THR A CB  1 
ATOM   5714  O OG1 . THR B  1 326 ? -27.90636 -20.55325  70.60285  1.000 36.90053  ? 306 THR A OG1 1 
ATOM   5715  C CG2 . THR B  1 326 ? -27.48591 -18.27775  71.21317  1.000 41.47510  ? 306 THR A CG2 1 
ATOM   5716  N N   . PRO B  1 327 ? -25.00838 -18.46683  73.47009  1.000 33.22892  ? 307 PRO A N   1 
ATOM   5717  C CA  . PRO B  1 327 ? -24.64888 -17.39302  74.40691  1.000 32.93858  ? 307 PRO A CA  1 
ATOM   5718  C C   . PRO B  1 327 ? -25.66833 -16.27044  74.35629  1.000 35.06909  ? 307 PRO A C   1 
ATOM   5719  O O   . PRO B  1 327 ? -26.36613 -16.09776  73.34566  1.000 30.69162  ? 307 PRO A O   1 
ATOM   5720  C CB  . PRO B  1 327 ? -23.27674 -16.92149  73.89916  1.000 26.09032  ? 307 PRO A CB  1 
ATOM   5721  C CG  . PRO B  1 327 ? -23.23625 -17.34159  72.47275  1.000 28.63860  ? 307 PRO A CG  1 
ATOM   5722  C CD  . PRO B  1 327 ? -23.99535 -18.64241  72.41699  1.000 29.59724  ? 307 PRO A CD  1 
ATOM   5723  N N   . PRO B  1 328 ? -25.78356 -15.48297  75.42181  1.000 36.76490  ? 308 PRO A N   1 
ATOM   5724  C CA  . PRO B  1 328 ? -26.79827 -14.41927  75.44559  1.000 35.62555  ? 308 PRO A CA  1 
ATOM   5725  C C   . PRO B  1 328 ? -26.51156 -13.32848  74.43230  1.000 29.47136  ? 308 PRO A C   1 
ATOM   5726  O O   . PRO B  1 328 ? -25.49156 -13.37099  73.73913  1.000 26.70016  ? 308 PRO A O   1 
ATOM   5727  C CB  . PRO B  1 328 ? -26.72180 -13.88932  76.88414  1.000 26.38249  ? 308 PRO A CB  1 
ATOM   5728  C CG  . PRO B  1 328 ? -25.36691 -14.27687  77.35877  1.000 29.28701  ? 308 PRO A CG  1 
ATOM   5729  C CD  . PRO B  1 328 ? -25.00620 -15.54838  76.67002  1.000 38.28446  ? 308 PRO A CD  1 
ATOM   5730  N N   . ALA B  1 329 ? -27.40905 -12.35471  74.33382  1.000 37.04984  ? 309 ALA A N   1 
ATOM   5731  C CA  . ALA B  1 329 ? -27.19028 -11.18078  73.50156  1.000 32.89948  ? 309 ALA A CA  1 
ATOM   5732  C C   . ALA B  1 329 ? -26.42089 -10.12280  74.28604  1.000 34.95256  ? 309 ALA A C   1 
ATOM   5733  O O   . ALA B  1 329 ? -26.50930 -10.04949  75.51518  1.000 44.55833  ? 309 ALA A O   1 
ATOM   5734  C CB  . ALA B  1 329 ? -28.52460 -10.62052  73.00959  1.000 26.87415  ? 309 ALA A CB  1 
ATOM   5735  N N   . LYS B  1 330 ? -25.65959 -9.30114   73.56667  1.000 33.88907  ? 310 LYS A N   1 
ATOM   5736  C CA  . LYS B  1 330 ? -24.76637 -8.34279   74.20896  1.000 38.44091  ? 310 LYS A CA  1 
ATOM   5737  C C   . LYS B  1 330 ? -24.77042 -7.03148   73.43881  1.000 30.74120  ? 310 LYS A C   1 
ATOM   5738  O O   . LYS B  1 330 ? -24.67363 -7.03074   72.20757  1.000 30.69553  ? 310 LYS A O   1 
ATOM   5739  C CB  . LYS B  1 330 ? -23.34370 -8.91341   74.30191  1.000 32.72295  ? 310 LYS A CB  1 
ATOM   5740  C CG  . LYS B  1 330 ? -22.23989 -7.89067   74.42808  1.000 37.18683  ? 310 LYS A CG  1 
ATOM   5741  C CD  . LYS B  1 330 ? -20.90527 -8.56800   74.71581  1.000 32.27330  ? 310 LYS A CD  1 
ATOM   5742  C CE  . LYS B  1 330 ? -20.02691 -7.67538   75.57183  1.000 36.57501  ? 310 LYS A CE  1 
ATOM   5743  N NZ  . LYS B  1 330 ? -19.43551 -8.38968   76.73470  1.000 40.55232  ? 310 LYS A NZ  1 
ATOM   5744  N N   . PHE B  1 331 ? -24.88762 -5.92260   74.16325  1.000 31.53704  ? 311 PHE A N   1 
ATOM   5745  C CA  . PHE B  1 331 ? -24.87093 -4.58190   73.58667  1.000 32.46045  ? 311 PHE A CA  1 
ATOM   5746  C C   . PHE B  1 331 ? -23.68262 -3.83133   74.17132  1.000 33.75781  ? 311 PHE A C   1 
ATOM   5747  O O   . PHE B  1 331 ? -23.53169 -3.78670   75.39379  1.000 34.06565  ? 311 PHE A O   1 
ATOM   5748  C CB  . PHE B  1 331 ? -26.18466 -3.83186   73.88037  1.000 32.39522  ? 311 PHE A CB  1 
ATOM   5749  C CG  . PHE B  1 331 ? -27.42610 -4.63468   73.60963  1.000 34.71691  ? 311 PHE A CG  1 
ATOM   5750  C CD1 . PHE B  1 331 ? -28.21753 -4.34308   72.51166  1.000 43.21642  ? 311 PHE A CD1 1 
ATOM   5751  C CD2 . PHE B  1 331 ? -27.81435 -5.66338   74.45519  1.000 30.38707  ? 311 PHE A CD2 1 
ATOM   5752  C CE1 . PHE B  1 331 ? -29.35287 -5.07684   72.24048  1.000 29.94319  ? 311 PHE A CE1 1 
ATOM   5753  C CE2 . PHE B  1 331 ? -28.95314 -6.40302   74.19105  1.000 35.10134  ? 311 PHE A CE2 1 
ATOM   5754  C CZ  . PHE B  1 331 ? -29.72405 -6.10781   73.07845  1.000 30.05248  ? 311 PHE A CZ  1 
ATOM   5755  N N   . VAL B  1 332 ? -22.83110 -3.25562   73.31913  1.000 44.64741  ? 312 VAL A N   1 
ATOM   5756  C CA  . VAL B  1 332 ? -21.63398 -2.56971   73.80701  1.000 48.40284  ? 312 VAL A CA  1 
ATOM   5757  C C   . VAL B  1 332 ? -21.54739 -1.14305   73.27297  1.000 40.65315  ? 312 VAL A C   1 
ATOM   5758  O O   . VAL B  1 332 ? -22.07284 -0.82987   72.19959  1.000 37.02552  ? 312 VAL A O   1 
ATOM   5759  C CB  . VAL B  1 332 ? -20.34032 -3.34279   73.46456  1.000 46.99588  ? 312 VAL A CB  1 
ATOM   5760  C CG1 . VAL B  1 332 ? -20.10653 -4.42388   74.48280  1.000 46.39932  ? 312 VAL A CG1 1 
ATOM   5761  C CG2 . VAL B  1 332 ? -20.42008 -3.95120   72.08460  1.000 40.36318  ? 312 VAL A CG2 1 
ATOM   5762  N N   . HIS B  1 333 ? -20.85433 -0.28655   74.04525  1.000 39.91753  ? 313 HIS A N   1 
ATOM   5763  C CA  . HIS B  1 333 ? -20.56957 1.12960    73.78481  1.000 40.00281  ? 313 HIS A CA  1 
ATOM   5764  C C   . HIS B  1 333 ? -21.76265 2.05378    73.97653  1.000 43.43094  ? 313 HIS A C   1 
ATOM   5765  O O   . HIS B  1 333 ? -22.89542 1.72202    73.62484  1.000 45.42032  ? 313 HIS A O   1 
ATOM   5766  C CB  . HIS B  1 333 ? -19.99899 1.33708    72.38933  1.000 40.82995  ? 313 HIS A CB  1 
ATOM   5767  C CG  . HIS B  1 333 ? -18.83975 0.45290    72.10455  1.000 49.04089  ? 313 HIS A CG  1 
ATOM   5768  N ND1 . HIS B  1 333 ? -18.94031 -0.67452   71.32129  1.000 54.12449  ? 313 HIS A ND1 1 
ATOM   5769  C CD2 . HIS B  1 333 ? -17.55981 0.50528    72.53615  1.000 50.50327  ? 313 HIS A CD2 1 
ATOM   5770  C CE1 . HIS B  1 333 ? -17.76582 -1.27283   71.27434  1.000 51.40426  ? 313 HIS A CE1 1 
ATOM   5771  N NE2 . HIS B  1 333 ? -16.91258 -0.58021   72.00520  1.000 54.23102  ? 313 HIS A NE2 1 
ATOM   5772  N N   . ASP B  1 334 ? -21.46559 3.25299    74.46621  1.000 41.55828  ? 314 ASP A N   1 
ATOM   5773  C CA  . ASP B  1 334 ? -22.48493 4.16061    74.96249  1.000 53.57936  ? 314 ASP A CA  1 
ATOM   5774  C C   . ASP B  1 334 ? -21.89320 5.55451    75.13853  1.000 45.54539  ? 314 ASP A C   1 
ATOM   5775  O O   . ASP B  1 334 ? -21.88559 6.09378    76.24980  1.000 48.67620  ? 314 ASP A O   1 
ATOM   5776  C CB  . ASP B  1 334 ? -23.03889 3.62420    76.28559  1.000 54.40648  ? 314 ASP A CB  1 
ATOM   5777  C CG  . ASP B  1 334 ? -24.25206 4.39500    76.77038  1.000 54.91313  ? 314 ASP A CG  1 
ATOM   5778  O OD1 . ASP B  1 334 ? -24.86184 5.12795    75.96572  1.000 55.60245  ? 314 ASP A OD1 1 
ATOM   5779  O OD2 . ASP B  1 334 ? -24.58981 4.27984    77.96909  1.000 56.64048  ? 314 ASP A OD2 1 
ATOM   5780  N N   . ASP B  1 335 ? -21.38363 6.14137    74.06148  1.000 44.58178  ? 315 ASP A N   1 
ATOM   5781  C CA  . ASP B  1 335 ? -20.85940 7.50080    74.10653  1.000 56.00876  ? 315 ASP A CA  1 
ATOM   5782  C C   . ASP B  1 335 ? -21.69493 8.39574    73.19266  1.000 56.19021  ? 315 ASP A C   1 
ATOM   5783  O O   . ASP B  1 335 ? -22.73687 7.98803    72.66809  1.000 57.09029  ? 315 ASP A O   1 
ATOM   5784  C CB  . ASP B  1 335 ? -19.37164 7.54080    73.73877  1.000 54.62796  ? 315 ASP A CB  1 
ATOM   5785  C CG  . ASP B  1 335 ? -19.06117 6.83259    72.43235  1.000 57.58090  ? 315 ASP A CG  1 
ATOM   5786  O OD1 . ASP B  1 335 ? -19.81038 7.01030    71.44969  1.000 58.59087  ? 315 ASP A OD1 1 
ATOM   5787  O OD2 . ASP B  1 335 ? -18.03831 6.11681    72.38070  1.000 63.16974  ? 315 ASP A OD2 1 
ATOM   5788  N N   . GLU B  1 336 ? -21.21858 9.62456    72.99358  1.000 58.67151  ? 316 GLU A N   1 
ATOM   5789  C CA  . GLU B  1 336 ? -21.99385 10.61692   72.25941  1.000 62.21488  ? 316 GLU A CA  1 
ATOM   5790  C C   . GLU B  1 336 ? -22.03703 10.36259   70.75823  1.000 58.20526  ? 316 GLU A C   1 
ATOM   5791  O O   . GLU B  1 336 ? -22.82422 11.01708   70.06546  1.000 60.30427  ? 316 GLU A O   1 
ATOM   5792  C CB  . GLU B  1 336 ? -21.44085 12.01628   72.52532  1.000 62.06806  ? 316 GLU A CB  1 
ATOM   5793  C CG  . GLU B  1 336 ? -22.51806 13.06802   72.73677  1.000 71.26466  ? 316 GLU A CG  1 
ATOM   5794  C CD  . GLU B  1 336 ? -23.21415 12.93479   74.08190  1.000 78.21647  ? 316 GLU A CD  1 
ATOM   5795  O OE1 . GLU B  1 336 ? -22.57379 12.45562   75.04386  1.000 80.98503  ? 316 GLU A OE1 1 
ATOM   5796  O OE2 . GLU B  1 336 ? -24.40175 13.31453   74.17823  1.000 79.07250  ? 316 GLU A OE2 1 
ATOM   5797  N N   . ASP B  1 337 ? -21.22536 9.44151    70.24072  1.000 51.33330  ? 317 ASP A N   1 
ATOM   5798  C CA  . ASP B  1 337 ? -21.19846 9.13266    68.81392  1.000 52.65064  ? 317 ASP A CA  1 
ATOM   5799  C C   . ASP B  1 337 ? -21.80678 7.78348    68.47436  1.000 54.40734  ? 317 ASP A C   1 
ATOM   5800  O O   . ASP B  1 337 ? -22.45230 7.64904    67.43293  1.000 63.31741  ? 317 ASP A O   1 
ATOM   5801  C CB  . ASP B  1 337 ? -19.76069 9.17848    68.28949  1.000 61.10016  ? 317 ASP A CB  1 
ATOM   5802  C CG  . ASP B  1 337 ? -19.09496 10.52047   68.53100  1.000 65.54245  ? 317 ASP A CG  1 
ATOM   5803  O OD1 . ASP B  1 337 ? -19.69581 11.55473   68.16701  1.000 61.23191  ? 317 ASP A OD1 1 
ATOM   5804  O OD2 . ASP B  1 337 ? -17.97031 10.53805   69.07355  1.000 62.46133  ? 317 ASP A OD2 1 
ATOM   5805  N N   . ARG B  1 338 ? -21.61981 6.77611    69.32052  1.000 48.29975  ? 318 ARG A N   1 
ATOM   5806  C CA  . ARG B  1 338 ? -22.18736 5.45914    69.07762  1.000 50.48006  ? 318 ARG A CA  1 
ATOM   5807  C C   . ARG B  1 338 ? -22.79977 4.93232    70.36377  1.000 42.47039  ? 318 ARG A C   1 
ATOM   5808  O O   . ARG B  1 338 ? -22.37472 5.28405    71.46800  1.000 51.00446  ? 318 ARG A O   1 
ATOM   5809  C CB  . ARG B  1 338 ? -21.14153 4.46855    68.55584  1.000 46.21914  ? 318 ARG A CB  1 
ATOM   5810  C CG  . ARG B  1 338 ? -19.99355 4.24219    69.52214  1.000 47.56824  ? 318 ARG A CG  1 
ATOM   5811  C CD  . ARG B  1 338 ? -18.92993 3.31706    68.94964  1.000 46.34177  ? 318 ARG A CD  1 
ATOM   5812  N NE  . ARG B  1 338 ? -17.67717 3.41365    69.69663  1.000 49.86974  ? 318 ARG A NE  1 
ATOM   5813  C CZ  . ARG B  1 338 ? -16.61350 2.64746    69.47883  1.000 52.26688  ? 318 ARG A CZ  1 
ATOM   5814  N NH1 . ARG B  1 338 ? -16.64312 1.71832    68.53276  1.000 45.36468  ? 318 ARG A NH1 1 
ATOM   5815  N NH2 . ARG B  1 338 ? -15.51826 2.81097    70.20907  1.000 59.77277  ? 318 ARG A NH2 1 
ATOM   5816  N N   . ARG B  1 339 ? -23.81232 4.08846    70.20385  1.000 50.28297  ? 319 ARG A N   1 
ATOM   5817  C CA  . ARG B  1 339 ? -24.42883 3.39992    71.33029  1.000 48.22445  ? 319 ARG A CA  1 
ATOM   5818  C C   . ARG B  1 339 ? -25.07070 2.12763    70.80839  1.000 48.47934  ? 319 ARG A C   1 
ATOM   5819  O O   . ARG B  1 339 ? -25.97548 2.19193    69.97055  1.000 57.13569  ? 319 ARG A O   1 
ATOM   5820  C CB  . ARG B  1 339 ? -25.46683 4.28098    72.02880  1.000 49.85995  ? 319 ARG A CB  1 
ATOM   5821  C CG  . ARG B  1 339 ? -26.31182 3.53411    73.05205  1.000 52.68400  ? 319 ARG A CG  1 
ATOM   5822  C CD  . ARG B  1 339 ? -27.05895 4.48762    73.97825  1.000 59.27610  ? 319 ARG A CD  1 
ATOM   5823  N NE  . ARG B  1 339 ? -28.17626 5.15066    73.31734  1.000 60.62863  ? 319 ARG A NE  1 
ATOM   5824  C CZ  . ARG B  1 339 ? -28.82520 6.19642    73.81695  1.000 62.04422  ? 319 ARG A CZ  1 
ATOM   5825  N NH1 . ARG B  1 339 ? -28.46854 6.71018    74.98742  1.000 56.76818  ? 319 ARG A NH1 1 
ATOM   5826  N NH2 . ARG B  1 339 ? -29.83164 6.73074    73.14121  1.000 66.61045  ? 319 ARG A NH2 1 
ATOM   5827  N N   . GLY B  1 340 ? -24.59313 0.98229    71.29042  1.000 37.03408  ? 320 GLY A N   1 
ATOM   5828  C CA  . GLY B  1 340 ? -25.23149 -0.28124   70.99304  1.000 37.66612  ? 320 GLY A CA  1 
ATOM   5829  C C   . GLY B  1 340 ? -26.46450 -0.46706   71.84738  1.000 34.76956  ? 320 GLY A C   1 
ATOM   5830  O O   . GLY B  1 340 ? -26.36062 -0.65264   73.06412  1.000 34.77333  ? 320 GLY A O   1 
ATOM   5831  N N   . SER B  1 341 ? -27.63976 -0.40384   71.22878  1.000 34.20306  ? 321 SER A N   1 
ATOM   5832  C CA  . SER B  1 341 ? -28.88133 -0.57665   71.96752  1.000 33.53549  ? 321 SER A CA  1 
ATOM   5833  C C   . SER B  1 341 ? -29.99076 -0.96079   71.00425  1.000 34.00064  ? 321 SER A C   1 
ATOM   5834  O O   . SER B  1 341 ? -29.95026 -0.62000   69.81885  1.000 32.96412  ? 321 SER A O   1 
ATOM   5835  C CB  . SER B  1 341 ? -29.26587 0.69175    72.73489  1.000 45.87934  ? 321 SER A CB  1 
ATOM   5836  O OG  . SER B  1 341 ? -29.33948 1.81338    71.87165  1.000 55.01822  ? 321 SER A OG  1 
ATOM   5837  N N   . ALA B  1 342 ? -30.98167 -1.67049   71.53478  1.000 31.78794  ? 322 ALA A N   1 
ATOM   5838  C CA  . ALA B  1 342 ? -32.14193 -2.10300   70.77534  1.000 33.39584  ? 322 ALA A CA  1 
ATOM   5839  C C   . ALA B  1 342 ? -33.39673 -1.48316   71.37019  1.000 31.12762  ? 322 ALA A C   1 
ATOM   5840  O O   . ALA B  1 342 ? -33.56493 -1.44746   72.59457  1.000 31.19809  ? 322 ALA A O   1 
ATOM   5841  C CB  . ALA B  1 342 ? -32.26558 -3.63465   70.76392  1.000 29.87070  ? 322 ALA A CB  1 
ATOM   5842  N N   . VAL B  1 343 ? -34.27812 -1.00850   70.49614  1.000 31.20337  ? 323 VAL A N   1 
ATOM   5843  C CA  . VAL B  1 343 ? -35.51867 -0.36069   70.89512  1.000 31.39795  ? 323 VAL A CA  1 
ATOM   5844  C C   . VAL B  1 343 ? -36.65858 -0.95060   70.08011  1.000 31.07357  ? 323 VAL A C   1 
ATOM   5845  O O   . VAL B  1 343 ? -36.53043 -1.13511   68.86387  1.000 30.57390  ? 323 VAL A O   1 
ATOM   5846  C CB  . VAL B  1 343 ? -35.43511 1.16843    70.70480  1.000 36.52221  ? 323 VAL A CB  1 
ATOM   5847  C CG1 . VAL B  1 343 ? -36.82138 1.78190    70.64358  1.000 38.81415  ? 323 VAL A CG1 1 
ATOM   5848  C CG2 . VAL B  1 343 ? -34.61658 1.78292    71.82432  1.000 33.41972  ? 323 VAL A CG2 1 
ATOM   5849  N N   . SER B  1 344 ? -37.76992 -1.24995   70.75921  1.000 30.27829  ? 324 SER A N   1 
ATOM   5850  C CA  . SER B  1 344 ? -38.96249 -1.82372   70.13294  1.000 31.70761  ? 324 SER A CA  1 
ATOM   5851  C C   . SER B  1 344 ? -38.58977 -2.96656   69.19941  1.000 30.27703  ? 324 SER A C   1 
ATOM   5852  O O   . SER B  1 344 ? -39.08449 -3.06920   68.07742  1.000 37.46063  ? 324 SER A O   1 
ATOM   5853  C CB  . SER B  1 344 ? -39.76640 -0.74961   69.40088  1.000 31.54728  ? 324 SER A CB  1 
ATOM   5854  O OG  . SER B  1 344 ? -39.93238 0.39418    70.22485  1.000 31.17889  ? 324 SER A OG  1 
ATOM   5855  N N   . SER B  1 345 ? -37.70589 -3.83891   69.67601  1.000 28.49565  ? 325 SER A N   1 
ATOM   5856  C CA  . SER B  1 345 ? -37.08236 -4.84595   68.83979  1.000 27.96743  ? 325 SER A CA  1 
ATOM   5857  C C   . SER B  1 345 ? -37.12821 -6.21015   69.51605  1.000 27.74506  ? 325 SER A C   1 
ATOM   5858  O O   . SER B  1 345 ? -37.36206 -6.33365   70.72170  1.000 28.54682  ? 325 SER A O   1 
ATOM   5859  C CB  . SER B  1 345 ? -35.62590 -4.47132   68.51787  1.000 28.47514  ? 325 SER A CB  1 
ATOM   5860  O OG  . SER B  1 345 ? -35.55194 -3.38922   67.60384  1.000 29.25808  ? 325 SER A OG  1 
ATOM   5861  N N   . VAL B  1 346 ? -36.90147 -7.23930   68.71009  1.000 26.59428  ? 326 VAL A N   1 
ATOM   5862  C CA  . VAL B  1 346 ? -36.76455 -8.61018   69.18129  1.000 27.54341  ? 326 VAL A CA  1 
ATOM   5863  C C   . VAL B  1 346 ? -35.36354 -9.07351   68.80314  1.000 29.55309  ? 326 VAL A C   1 
ATOM   5864  O O   . VAL B  1 346 ? -35.01099 -9.09160   67.61778  1.000 29.64203  ? 326 VAL A O   1 
ATOM   5865  C CB  . VAL B  1 346 ? -37.83856 -9.52719   68.57930  1.000 25.31449  ? 326 VAL A CB  1 
ATOM   5866  C CG1 . VAL B  1 346 ? -37.55922 -10.96020  68.93385  1.000 31.85615  ? 326 VAL A CG1 1 
ATOM   5867  C CG2 . VAL B  1 346 ? -39.21474 -9.12547   69.07823  1.000 27.66400  ? 326 VAL A CG2 1 
ATOM   5868  N N   . VAL B  1 347 ? -34.55866 -9.42352   69.80271  1.000 25.76873  ? 327 VAL A N   1 
ATOM   5869  C CA  . VAL B  1 347 ? -33.16347 -9.79241   69.59136  1.000 26.47972  ? 327 VAL A CA  1 
ATOM   5870  C C   . VAL B  1 347 ? -32.94256 -11.19922  70.12849  1.000 27.01571  ? 327 VAL A C   1 
ATOM   5871  O O   . VAL B  1 347 ? -33.24126 -11.47759  71.29658  1.000 26.68119  ? 327 VAL A O   1 
ATOM   5872  C CB  . VAL B  1 347 ? -32.20421 -8.79333   70.26428  1.000 30.18540  ? 327 VAL A CB  1 
ATOM   5873  C CG1 . VAL B  1 347 ? -30.75921 -9.23439   70.08450  1.000 26.80583  ? 327 VAL A CG1 1 
ATOM   5874  C CG2 . VAL B  1 347 ? -32.42504 -7.38548   69.70923  1.000 27.39088  ? 327 VAL A CG2 1 
ATOM   5875  N N   . SER B  1 348 ? -32.41002 -12.07956  69.27822  1.000 29.98485  ? 328 SER A N   1 
ATOM   5876  C CA  . SER B  1 348 ? -32.15910 -13.46367  69.64752  1.000 30.85196  ? 328 SER A CA  1 
ATOM   5877  C C   . SER B  1 348 ? -30.78605 -13.60800  70.29735  1.000 30.46769  ? 328 SER A C   1 
ATOM   5878  O O   . SER B  1 348 ? -30.02602 -12.64750  70.44118  1.000 28.10214  ? 328 SER A O   1 
ATOM   5879  C CB  . SER B  1 348 ? -32.27053 -14.37670  68.42791  1.000 29.73819  ? 328 SER A CB  1 
ATOM   5880  O OG  . SER B  1 348 ? -33.52378 -14.22035  67.78467  1.000 36.51901  ? 328 SER A OG  1 
ATOM   5881  N N   . GLY B  1 349 ? -30.46304 -14.83421  70.69065  1.000 27.69114  ? 329 GLY A N   1 
ATOM   5882  C CA  . GLY B  1 349 ? -29.18283 -15.10432  71.30225  1.000 24.46044  ? 329 GLY A CA  1 
ATOM   5883  C C   . GLY B  1 349 ? -28.04275 -14.98018  70.31264  1.000 34.08741  ? 329 GLY A C   1 
ATOM   5884  O O   . GLY B  1 349 ? -28.22809 -14.82025  69.10271  1.000 28.60701  ? 329 GLY A O   1 
ATOM   5885  N N   . ASP B  1 350 ? -26.82708 -15.04783  70.85746  1.000 34.49947  ? 330 ASP A N   1 
ATOM   5886  C CA  . ASP B  1 350 ? -25.60417 -14.93766  70.06472  1.000 31.17606  ? 330 ASP A CA  1 
ATOM   5887  C C   . ASP B  1 350 ? -25.61460 -13.67916  69.20064  1.000 26.44875  ? 330 ASP A C   1 
ATOM   5888  O O   . ASP B  1 350 ? -25.06012 -13.65326  68.10232  1.000 31.09158  ? 330 ASP A O   1 
ATOM   5889  C CB  . ASP B  1 350 ? -25.39410 -16.18558  69.20290  1.000 30.08904  ? 330 ASP A CB  1 
ATOM   5890  C CG  . ASP B  1 350 ? -23.98472 -16.29177  68.66812  1.000 36.77489  ? 330 ASP A CG  1 
ATOM   5891  O OD1 . ASP B  1 350 ? -23.05020 -15.88068  69.38102  1.000 45.98084  ? 330 ASP A OD1 1 
ATOM   5892  O OD2 . ASP B  1 350 ? -23.80988 -16.77915  67.53418  1.000 50.94661  ? 330 ASP A OD2 1 
ATOM   5893  N N   . CYS B  1 351 ? -26.26434 -12.62582  69.68207  1.000 31.03984  ? 331 CYS A N   1 
ATOM   5894  C CA  . CYS B  1 351 ? -26.30804 -11.34801  68.98202  1.000 37.52828  ? 331 CYS A CA  1 
ATOM   5895  C C   . CYS B  1 351 ? -25.45351 -10.34776  69.74357  1.000 31.67219  ? 331 CYS A C   1 
ATOM   5896  O O   . CYS B  1 351 ? -25.68871 -10.10662  70.93199  1.000 36.49751  ? 331 CYS A O   1 
ATOM   5897  C CB  . CYS B  1 351 ? -27.74137 -10.83475  68.85079  1.000 38.53930  ? 331 CYS A CB  1 
ATOM   5898  S SG  . CYS B  1 351 ? -28.70214 -11.61265  67.53937  1.000 31.69298  ? 331 CYS A SG  1 
ATOM   5899  N N   . ILE B  1 352 ? -24.46739 -9.77332   69.06495  1.000 34.35065  ? 332 ILE A N   1 
ATOM   5900  C CA  . ILE B  1 352 ? -23.61033 -8.74545   69.64168  1.000 32.53315  ? 332 ILE A CA  1 
ATOM   5901  C C   . ILE B  1 352 ? -23.91186 -7.43845   68.92156  1.000 40.31637  ? 332 ILE A C   1 
ATOM   5902  O O   . ILE B  1 352 ? -23.54097 -7.25989   67.75471  1.000 41.61090  ? 332 ILE A O   1 
ATOM   5903  C CB  . ILE B  1 352 ? -22.12559 -9.11336   69.54298  1.000 37.23333  ? 332 ILE A CB  1 
ATOM   5904  C CG1 . ILE B  1 352 ? -21.87396 -10.46145  70.22197  1.000 34.92442  ? 332 ILE A CG1 1 
ATOM   5905  C CG2 . ILE B  1 352 ? -21.26780 -8.01705   70.16767  1.000 37.22448  ? 332 ILE A CG2 1 
ATOM   5906  C CD1 . ILE B  1 352 ? -20.45513 -10.65230  70.71917  1.000 30.69395  ? 332 ILE A CD1 1 
ATOM   5907  N N   . ILE B  1 353 ? -24.59220 -6.52746   69.61457  1.000 40.37567  ? 333 ILE A N   1 
ATOM   5908  C CA  . ILE B  1 353 ? -24.98398 -5.23323   69.05852  1.000 31.95876  ? 333 ILE A CA  1 
ATOM   5909  C C   . ILE B  1 353 ? -23.90547 -4.23768   69.46949  1.000 35.89091  ? 333 ILE A C   1 
ATOM   5910  O O   . ILE B  1 353 ? -23.95230 -3.66663   70.56078  1.000 39.65159  ? 333 ILE A O   1 
ATOM   5911  C CB  . ILE B  1 353 ? -26.36561 -4.80265   69.55407  1.000 34.05246  ? 333 ILE A CB  1 
ATOM   5912  C CG1 . ILE B  1 353 ? -27.35431 -5.97863   69.52396  1.000 30.09254  ? 333 ILE A CG1 1 
ATOM   5913  C CG2 . ILE B  1 353 ? -26.88674 -3.63698   68.73459  1.000 31.99746  ? 333 ILE A CG2 1 
ATOM   5914  C CD1 . ILE B  1 353 ? -27.37098 -6.72373   68.23020  1.000 29.65470  ? 333 ILE A CD1 1 
ATOM   5915  N N   . SER B  1 354 ? -22.93208 -4.02103   68.59001  1.000 41.89011  ? 334 SER A N   1 
ATOM   5916  C CA  . SER B  1 354 ? -21.71083 -3.29850   68.93600  1.000 39.27220  ? 334 SER A CA  1 
ATOM   5917  C C   . SER B  1 354 ? -21.80419 -1.86319   68.41873  1.000 38.90648  ? 334 SER A C   1 
ATOM   5918  O O   . SER B  1 354 ? -21.48580 -1.57975   67.26921  1.000 41.06351  ? 334 SER A O   1 
ATOM   5919  C CB  . SER B  1 354 ? -20.49604 -4.02035   68.36631  1.000 39.45723  ? 334 SER A CB  1 
ATOM   5920  O OG  . SER B  1 354 ? -19.30093 -3.59210   68.99515  1.000 50.50403  ? 334 SER A OG  1 
ATOM   5921  N N   . GLY B  1 355 ? -22.22081 -0.94439   69.29212  1.000 36.75002  ? 335 GLY A N   1 
ATOM   5922  C CA  . GLY B  1 355 ? -22.30240 0.44505    68.88156  1.000 40.06814  ? 335 GLY A CA  1 
ATOM   5923  C C   . GLY B  1 355 ? -23.32032 0.72114    67.80077  1.000 42.09954  ? 335 GLY A C   1 
ATOM   5924  O O   . GLY B  1 355 ? -23.28416 1.78829    67.17797  1.000 49.14616  ? 335 GLY A O   1 
ATOM   5925  N N   . ALA B  1 356 ? -24.23607 -0.20930   67.56780  1.000 36.22744  ? 336 ALA A N   1 
ATOM   5926  C CA  . ALA B  1 356 ? -25.25254 -0.09888   66.53630  1.000 35.83304  ? 336 ALA A CA  1 
ATOM   5927  C C   . ALA B  1 356 ? -26.59889 0.27404    67.14653  1.000 35.36722  ? 336 ALA A C   1 
ATOM   5928  O O   . ALA B  1 356 ? -26.87919 -0.00857   68.31552  1.000 36.53077  ? 336 ALA A O   1 
ATOM   5929  C CB  . ALA B  1 356 ? -25.37291 -1.41499   65.76517  1.000 45.58224  ? 336 ALA A CB  1 
ATOM   5930  N N   . ALA B  1 357 ? -27.44430 0.89560    66.32566  1.000 35.54823  ? 337 ALA A N   1 
ATOM   5931  C CA  . ALA B  1 357 ? -28.74755 1.39074    66.75454  1.000 41.77239  ? 337 ALA A CA  1 
ATOM   5932  C C   . ALA B  1 357 ? -29.84824 0.58404    66.07673  1.000 34.20286  ? 337 ALA A C   1 
ATOM   5933  O O   . ALA B  1 357 ? -29.93447 0.55885    64.84343  1.000 34.31425  ? 337 ALA A O   1 
ATOM   5934  C CB  . ALA B  1 357 ? -28.89453 2.88061    66.43927  1.000 40.51213  ? 337 ALA A CB  1 
ATOM   5935  N N   . LEU B  1 358 ? -30.69420 -0.05446   66.88539  1.000 33.25159  ? 338 LEU A N   1 
ATOM   5936  C CA  . LEU B  1 358 ? -31.75662 -0.93432   66.40838  1.000 47.73460  ? 338 LEU A CA  1 
ATOM   5937  C C   . LEU B  1 358 ? -33.10711 -0.37259   66.82384  1.000 32.15300  ? 338 LEU A C   1 
ATOM   5938  O O   . LEU B  1 358 ? -33.31841 -0.07241   68.00309  1.000 32.23653  ? 338 LEU A O   1 
ATOM   5939  C CB  . LEU B  1 358 ? -31.60879 -2.35422   66.97141  1.000 31.13599  ? 338 LEU A CB  1 
ATOM   5940  C CG  . LEU B  1 358 ? -30.78516 -3.39684   66.21866  1.000 38.49575  ? 338 LEU A CG  1 
ATOM   5941  C CD1 . LEU B  1 358 ? -29.43969 -2.84049   65.80339  1.000 35.86385  ? 338 LEU A CD1 1 
ATOM   5942  C CD2 . LEU B  1 358 ? -30.60820 -4.65216   67.07753  1.000 32.57130  ? 338 LEU A CD2 1 
ATOM   5943  N N   . ASN B  1 359 ? -34.02301 -0.25607   65.86376  1.000 32.07006  ? 339 ASN A N   1 
ATOM   5944  C CA  . ASN B  1 359 ? -35.38880 0.15315    66.15512  1.000 31.98270  ? 339 ASN A CA  1 
ATOM   5945  C C   . ASN B  1 359 ? -36.35460 -0.65064   65.29990  1.000 31.26183  ? 339 ASN A C   1 
ATOM   5946  O O   . ASN B  1 359 ? -36.16744 -0.76230   64.08441  1.000 32.65302  ? 339 ASN A O   1 
ATOM   5947  C CB  . ASN B  1 359 ? -35.58573 1.65790    65.91586  1.000 33.14772  ? 339 ASN A CB  1 
ATOM   5948  C CG  . ASN B  1 359 ? -37.03577 2.08487    66.05623  1.000 36.86853  ? 339 ASN A CG  1 
ATOM   5949  O OD1 . ASN B  1 359 ? -37.75258 2.24248    65.06706  1.000 45.27154  ? 339 ASN A OD1 1 
ATOM   5950  N ND2 . ASN B  1 359 ? -37.48231 2.24602    67.29418  1.000 35.58823  ? 339 ASN A ND2 1 
ATOM   5951  N N   . ARG B  1 360 ? -37.38087 -1.20602   65.94103  1.000 30.57480  ? 340 ARG A N   1 
ATOM   5952  C CA  . ARG B  1 360 ? -38.41753 -1.98981   65.26749  1.000 32.43463  ? 340 ARG A CA  1 
ATOM   5953  C C   . ARG B  1 360 ? -37.81368 -3.05193   64.34751  1.000 32.22290  ? 340 ARG A C   1 
ATOM   5954  O O   . ARG B  1 360 ? -38.15125 -3.16112   63.16968  1.000 29.70076  ? 340 ARG A O   1 
ATOM   5955  C CB  . ARG B  1 360 ? -39.38259 -1.07837   64.50254  1.000 39.23311  ? 340 ARG A CB  1 
ATOM   5956  C CG  . ARG B  1 360 ? -40.67272 -1.78330   64.09054  1.000 47.52654  ? 340 ARG A CG  1 
ATOM   5957  C CD  . ARG B  1 360 ? -41.83384 -0.82689   63.87219  1.000 48.17080  ? 340 ARG A CD  1 
ATOM   5958  N NE  . ARG B  1 360 ? -43.01870 -1.53485   63.38280  1.000 47.66575  ? 340 ARG A NE  1 
ATOM   5959  C CZ  . ARG B  1 360 ? -43.46536 -1.46877   62.13065  1.000 49.14788  ? 340 ARG A CZ  1 
ATOM   5960  N NH1 . ARG B  1 360 ? -42.82952 -0.71741   61.23838  1.000 45.13658  ? 340 ARG A NH1 1 
ATOM   5961  N NH2 . ARG B  1 360 ? -44.54774 -2.14959   61.76891  1.000 42.88913  ? 340 ARG A NH2 1 
ATOM   5962  N N   . SER B  1 361 ? -36.90582 -3.84980   64.89153  1.000 34.60880  ? 341 SER A N   1 
ATOM   5963  C CA  . SER B  1 361 ? -36.28289 -4.91662   64.11845  1.000 39.42479  ? 341 SER A CA  1 
ATOM   5964  C C   . SER B  1 361 ? -36.37853 -6.23479   64.87386  1.000 35.99087  ? 341 SER A C   1 
ATOM   5965  O O   . SER B  1 361 ? -36.46776 -6.26216   66.10366  1.000 35.57408  ? 341 SER A O   1 
ATOM   5966  C CB  . SER B  1 361 ? -34.81455 -4.59060   63.80150  1.000 36.05356  ? 341 SER A CB  1 
ATOM   5967  O OG  . SER B  1 361 ? -34.71956 -3.41845   63.00726  1.000 30.12445  ? 341 SER A OG  1 
ATOM   5968  N N   . LEU B  1 362 ? -36.37387 -7.33467   64.12289  1.000 31.82975  ? 342 LEU A N   1 
ATOM   5969  C CA  . LEU B  1 362 ? -36.31724 -8.67777   64.69182  1.000 26.39771  ? 342 LEU A CA  1 
ATOM   5970  C C   . LEU B  1 362 ? -35.05929 -9.34523   64.16423  1.000 30.19133  ? 342 LEU A C   1 
ATOM   5971  O O   . LEU B  1 362 ? -34.86686 -9.42693   62.94439  1.000 26.64941  ? 342 LEU A O   1 
ATOM   5972  C CB  . LEU B  1 362 ? -37.57273 -9.48806   64.34965  1.000 25.91671  ? 342 LEU A CB  1 
ATOM   5973  C CG  . LEU B  1 362 ? -37.70690 -10.88952  64.97917  1.000 32.70739  ? 342 LEU A CG  1 
ATOM   5974  C CD1 . LEU B  1 362 ? -39.15145 -11.35254  65.00822  1.000 42.06957  ? 342 LEU A CD1 1 
ATOM   5975  C CD2 . LEU B  1 362 ? -36.88834 -11.94092  64.26829  1.000 31.10602  ? 342 LEU A CD2 1 
ATOM   5976  N N   . LEU B  1 363 ? -34.21216 -9.83263   65.07438  1.000 26.11579  ? 343 LEU A N   1 
ATOM   5977  C CA  . LEU B  1 363 ? -32.91102 -10.39637  64.72181  1.000 26.19015  ? 343 LEU A CA  1 
ATOM   5978  C C   . LEU B  1 363 ? -32.84208 -11.84301  65.17786  1.000 25.44613  ? 343 LEU A C   1 
ATOM   5979  O O   . LEU B  1 363 ? -33.02426 -12.12947  66.36666  1.000 29.18167  ? 343 LEU A O   1 
ATOM   5980  C CB  . LEU B  1 363 ? -31.78003 -9.59043   65.35085  1.000 26.76700  ? 343 LEU A CB  1 
ATOM   5981  C CG  . LEU B  1 363 ? -31.27128 -8.41684   64.52512  1.000 31.96083  ? 343 LEU A CG  1 
ATOM   5982  C CD1 . LEU B  1 363 ? -32.32765 -7.33632   64.47913  1.000 28.01052  ? 343 LEU A CD1 1 
ATOM   5983  C CD2 . LEU B  1 363 ? -30.02758 -7.88174   65.19055  1.000 37.03177  ? 343 LEU A CD2 1 
ATOM   5984  N N   . PHE B  1 364 ? -32.55177 -12.74377  64.24606  1.000 28.44855  ? 344 PHE A N   1 
ATOM   5985  C CA  . PHE B  1 364 ? -32.36892 -14.14988  64.58249  1.000 24.71652  ? 344 PHE A CA  1 
ATOM   5986  C C   . PHE B  1 364 ? -30.99772 -14.32278  65.24422  1.000 24.84159  ? 344 PHE A C   1 
ATOM   5987  O O   . PHE B  1 364 ? -30.28034 -13.35913  65.52139  1.000 30.32567  ? 344 PHE A O   1 
ATOM   5988  C CB  . PHE B  1 364 ? -32.53273 -15.03266  63.34527  1.000 25.89340  ? 344 PHE A CB  1 
ATOM   5989  C CG  . PHE B  1 364 ? -33.93719 -15.05584  62.77902  1.000 24.53424  ? 344 PHE A CG  1 
ATOM   5990  C CD1 . PHE B  1 364 ? -34.66555 -16.23780  62.74617  1.000 27.34851  ? 344 PHE A CD1 1 
ATOM   5991  C CD2 . PHE B  1 364 ? -34.51536 -13.91027  62.25765  1.000 27.82482  ? 344 PHE A CD2 1 
ATOM   5992  C CE1 . PHE B  1 364 ? -35.95051 -16.26529  62.22954  1.000 27.73495  ? 344 PHE A CE1 1 
ATOM   5993  C CE2 . PHE B  1 364 ? -35.79595 -13.93164  61.73031  1.000 30.64742  ? 344 PHE A CE2 1 
ATOM   5994  C CZ  . PHE B  1 364 ? -36.51481 -15.10837  61.71498  1.000 24.62445  ? 344 PHE A CZ  1 
ATOM   5995  N N   A THR B  1 365 ? -30.61528 -15.57530  65.47726  0.356 29.67004  ? 345 THR A N   1 
ATOM   5996  N N   B THR B  1 365 ? -30.62391 -15.56989  65.51388  0.644 30.61603  ? 345 THR A N   1 
ATOM   5997  C CA  A THR B  1 365 ? -29.39611 -15.89591  66.20800  0.356 28.56763  ? 345 THR A CA  1 
ATOM   5998  C CA  B THR B  1 365 ? -29.39587 -15.84167  66.24467  0.644 28.64079  ? 345 THR A CA  1 
ATOM   5999  C C   A THR B  1 365 ? -28.14641 -15.48610  65.43146  0.356 25.20176  ? 345 THR A C   1 
ATOM   6000  C C   B THR B  1 365 ? -28.16612 -15.42000  65.44557  0.644 25.21780  ? 345 THR A C   1 
ATOM   6001  O O   A THR B  1 365 ? -28.14177 -15.42424  64.19994  0.356 25.49084  ? 345 THR A O   1 
ATOM   6002  O O   B THR B  1 365 ? -28.19028 -15.29609  64.21823  0.644 25.51922  ? 345 THR A O   1 
ATOM   6003  C CB  A THR B  1 365 ? -29.35484 -17.39784  66.49976  0.356 25.78335  ? 345 THR A CB  1 
ATOM   6004  C CB  B THR B  1 365 ? -29.28704 -17.33019  66.58331  0.644 26.28417  ? 345 THR A CB  1 
ATOM   6005  O OG1 A THR B  1 365 ? -30.68528 -17.86007  66.75977  0.356 23.43615  ? 345 THR A OG1 1 
ATOM   6006  O OG1 B THR B  1 365 ? -29.69512 -18.10439  65.44976  0.644 27.56185  ? 345 THR A OG1 1 
ATOM   6007  C CG2 A THR B  1 365 ? -28.47485 -17.70220  67.70049  0.356 23.94944  ? 345 THR A CG2 1 
ATOM   6008  C CG2 B THR B  1 365 ? -30.16403 -17.67184  67.77901  0.644 23.47897  ? 345 THR A CG2 1 
ATOM   6009  N N   . GLY B  1 366 ? -27.07458 -15.20061  66.17003  1.000 32.05031  ? 346 GLY A N   1 
ATOM   6010  C CA  . GLY B  1 366 ? -25.77945 -15.00754  65.54389  1.000 36.27154  ? 346 GLY A CA  1 
ATOM   6011  C C   . GLY B  1 366 ? -25.55742 -13.71793  64.78932  1.000 30.96823  ? 346 GLY A C   1 
ATOM   6012  O O   . GLY B  1 366 ? -24.60882 -13.63949  64.00366  1.000 35.19130  ? 346 GLY A O   1 
ATOM   6013  N N   . VAL B  1 367 ? -26.37740 -12.69451  64.99808  1.000 27.15085  ? 347 VAL A N   1 
ATOM   6014  C CA  . VAL B  1 367 ? -26.18571 -11.44446  64.26381  1.000 34.01797  ? 347 VAL A CA  1 
ATOM   6015  C C   . VAL B  1 367 ? -25.03821 -10.65875  64.88403  1.000 28.80974  ? 347 VAL A C   1 
ATOM   6016  O O   . VAL B  1 367 ? -24.86111 -10.64488  66.10889  1.000 40.44619  ? 347 VAL A O   1 
ATOM   6017  C CB  . VAL B  1 367 ? -27.47889 -10.61182  64.23848  1.000 29.62357  ? 347 VAL A CB  1 
ATOM   6018  C CG1 . VAL B  1 367 ? -27.20832 -9.23555   63.64584  1.000 28.89686  ? 347 VAL A CG1 1 
ATOM   6019  C CG2 . VAL B  1 367 ? -28.56493 -11.33399  63.44700  1.000 27.30747  ? 347 VAL A CG2 1 
ATOM   6020  N N   . ARG B  1 368 ? -24.24498 -10.00448  64.03289  1.000 35.01554  ? 348 ARG A N   1 
ATOM   6021  C CA  . ARG B  1 368 ? -23.20061 -9.07352   64.45614  1.000 36.81529  ? 348 ARG A CA  1 
ATOM   6022  C C   . ARG B  1 368 ? -23.44558 -7.72467   63.78410  1.000 36.11377  ? 348 ARG A C   1 
ATOM   6023  O O   . ARG B  1 368 ? -23.30453 -7.59892   62.56230  1.000 38.90809  ? 348 ARG A O   1 
ATOM   6024  C CB  . ARG B  1 368 ? -21.80971 -9.61070   64.10867  1.000 39.66816  ? 348 ARG A CB  1 
ATOM   6025  C CG  . ARG B  1 368 ? -21.44037 -10.91343  64.81329  1.000 30.57889  ? 348 ARG A CG  1 
ATOM   6026  C CD  . ARG B  1 368 ? -21.18915 -10.69761  66.29964  1.000 32.82783  ? 348 ARG A CD  1 
ATOM   6027  N NE  . ARG B  1 368 ? -20.69132 -11.89882  66.97002  1.000 41.47799  ? 348 ARG A NE  1 
ATOM   6028  C CZ  . ARG B  1 368 ? -21.46699 -12.88249  67.41847  1.000 44.29332  ? 348 ARG A CZ  1 
ATOM   6029  N NH1 . ARG B  1 368 ? -20.92983 -13.93168  68.02423  1.000 44.17739  ? 348 ARG A NH1 1 
ATOM   6030  N NH2 . ARG B  1 368 ? -22.78227 -12.81917  67.26515  1.000 40.62916  ? 348 ARG A NH2 1 
ATOM   6031  N N   . ALA B  1 369 ? -23.80612 -6.71660   64.57671  1.000 31.89396  ? 349 ALA A N   1 
ATOM   6032  C CA  . ALA B  1 369 ? -24.04085 -5.36414   64.08400  1.000 32.79288  ? 349 ALA A CA  1 
ATOM   6033  C C   . ALA B  1 369 ? -23.04327 -4.42360   64.73909  1.000 40.31579  ? 349 ALA A C   1 
ATOM   6034  O O   . ALA B  1 369 ? -22.90109 -4.42088   65.96568  1.000 50.09237  ? 349 ALA A O   1 
ATOM   6035  C CB  . ALA B  1 369 ? -25.46903 -4.90350   64.36956  1.000 32.30188  ? 349 ALA A CB  1 
ATOM   6036  N N   . ASN B  1 370 ? -22.36351 -3.62446   63.92950  1.000 35.08511  ? 350 ASN A N   1 
ATOM   6037  C CA  . ASN B  1 370 ? -21.16282 -2.93985   64.38209  1.000 36.29843  ? 350 ASN A CA  1 
ATOM   6038  C C   . ASN B  1 370 ? -21.35726 -1.42622   64.37544  1.000 38.88300  ? 350 ASN A C   1 
ATOM   6039  O O   . ASN B  1 370 ? -22.40644 -0.90208   63.98952  1.000 37.24215  ? 350 ASN A O   1 
ATOM   6040  C CB  . ASN B  1 370 ? -19.95449 -3.36855   63.54667  1.000 36.94684  ? 350 ASN A CB  1 
ATOM   6041  C CG  . ASN B  1 370 ? -19.57380 -4.82905   63.78936  1.000 44.78748  ? 350 ASN A CG  1 
ATOM   6042  O OD1 . ASN B  1 370 ? -19.10881 -5.18358   64.87546  1.000 43.05016  ? 350 ASN A OD1 1 
ATOM   6043  N ND2 . ASN B  1 370 ? -19.77635 -5.67570   62.78752  1.000 39.34296  ? 350 ASN A ND2 1 
ATOM   6044  N N   . SER B  1 371 ? -20.31232 -0.73312   64.82114  1.000 43.35020  ? 351 SER A N   1 
ATOM   6045  C CA  . SER B  1 371 ? -20.44033 0.64639    65.26982  1.000 45.45097  ? 351 SER A CA  1 
ATOM   6046  C C   . SER B  1 371 ? -21.00154 1.55581    64.18601  1.000 40.33008  ? 351 SER A C   1 
ATOM   6047  O O   . SER B  1 371 ? -20.61805 1.47869    63.01620  1.000 40.76733  ? 351 SER A O   1 
ATOM   6048  C CB  . SER B  1 371 ? -19.08427 1.16871    65.74308  1.000 51.58811  ? 351 SER A CB  1 
ATOM   6049  O OG  . SER B  1 371 ? -18.77444 0.66890    67.03287  1.000 57.03467  ? 351 SER A OG  1 
ATOM   6050  N N   . TYR B  1 372 ? -21.92093 2.42718    64.59764  1.000 42.20020  ? 352 TYR A N   1 
ATOM   6051  C CA  . TYR B  1 372 ? -22.53229 3.48197    63.79640  1.000 43.63387  ? 352 TYR A CA  1 
ATOM   6052  C C   . TYR B  1 372 ? -23.48765 2.93310    62.75171  1.000 40.56954  ? 352 TYR A C   1 
ATOM   6053  O O   . TYR B  1 372 ? -24.01524 3.70653    61.94250  1.000 40.82383  ? 352 TYR A O   1 
ATOM   6054  C CB  . TYR B  1 372 ? -21.48545 4.38530    63.12265  1.000 42.92524  ? 352 TYR A CB  1 
ATOM   6055  C CG  . TYR B  1 372 ? -20.37744 4.84197    64.05471  1.000 44.02317  ? 352 TYR A CG  1 
ATOM   6056  C CD1 . TYR B  1 372 ? -19.16282 4.16659    64.11889  1.000 45.74835  ? 352 TYR A CD1 1 
ATOM   6057  C CD2 . TYR B  1 372 ? -20.55243 5.94722    64.87710  1.000 49.15351  ? 352 TYR A CD2 1 
ATOM   6058  C CE1 . TYR B  1 372 ? -18.15191 4.58529    64.97615  1.000 45.35553  ? 352 TYR A CE1 1 
ATOM   6059  C CE2 . TYR B  1 372 ? -19.54995 6.37716    65.73110  1.000 50.97648  ? 352 TYR A CE2 1 
ATOM   6060  C CZ  . TYR B  1 372 ? -18.35219 5.69480    65.77842  1.000 53.02274  ? 352 TYR A CZ  1 
ATOM   6061  O OH  . TYR B  1 372 ? -17.36133 6.12894    66.63478  1.000 47.47465  ? 352 TYR A OH  1 
ATOM   6062  N N   . SER B  1 373 ? -23.73973 1.62936    62.74151  1.000 49.58801  ? 353 SER A N   1 
ATOM   6063  C CA  . SER B  1 373 ? -24.75514 1.07291    61.86182  1.000 47.83181  ? 353 SER A CA  1 
ATOM   6064  C C   . SER B  1 373 ? -26.13627 1.21333    62.48929  1.000 46.07254  ? 353 SER A C   1 
ATOM   6065  O O   . SER B  1 373 ? -26.30471 1.07531    63.70524  1.000 41.01267  ? 353 SER A O   1 
ATOM   6066  C CB  . SER B  1 373 ? -24.46049 -0.39472   61.55671  1.000 36.98297  ? 353 SER A CB  1 
ATOM   6067  O OG  . SER B  1 373 ? -24.81302 -1.22497   62.64551  1.000 38.59161  ? 353 SER A OG  1 
ATOM   6068  N N   . ARG B  1 374 ? -27.13207 1.49570    61.65400  1.000 43.28594  ? 354 ARG A N   1 
ATOM   6069  C CA  . ARG B  1 374 ? -28.48825 1.69117    62.14330  1.000 36.46009  ? 354 ARG A CA  1 
ATOM   6070  C C   . ARG B  1 374 ? -29.45254 0.81014    61.36746  1.000 35.47526  ? 354 ARG A C   1 
ATOM   6071  O O   . ARG B  1 374 ? -29.33840 0.67305    60.14458  1.000 37.64495  ? 354 ARG A O   1 
ATOM   6072  C CB  . ARG B  1 374 ? -28.93646 3.15481    62.02093  1.000 39.56644  ? 354 ARG A CB  1 
ATOM   6073  C CG  . ARG B  1 374 ? -27.91099 4.16091    62.40601  1.000 47.91324  ? 354 ARG A CG  1 
ATOM   6074  C CD  . ARG B  1 374 ? -28.42158 5.54299    62.07964  1.000 67.22085  ? 354 ARG A CD  1 
ATOM   6075  N NE  . ARG B  1 374 ? -28.96749 6.17157    63.27934  1.000 73.45872  ? 354 ARG A NE  1 
ATOM   6076  C CZ  . ARG B  1 374 ? -28.23633 6.54788    64.32525  1.000 71.33066  ? 354 ARG A CZ  1 
ATOM   6077  N NH1 . ARG B  1 374 ? -26.91566 6.38567    64.33387  1.000 70.27142  ? 354 ARG A NH1 1 
ATOM   6078  N NH2 . ARG B  1 374 ? -28.81945 7.09832    65.37779  1.000 69.50503  ? 354 ARG A NH2 1 
ATOM   6079  N N   . LEU B  1 375 ? -30.41744 0.23493    62.08184  1.000 39.63509  ? 355 LEU A N   1 
ATOM   6080  C CA  . LEU B  1 375 ? -31.42830 -0.63109   61.48513  1.000 44.28809  ? 355 LEU A CA  1 
ATOM   6081  C C   . LEU B  1 375 ? -32.80501 -0.16905   61.92378  1.000 33.25709  ? 355 LEU A C   1 
ATOM   6082  O O   . LEU B  1 375 ? -33.03587 0.07191    63.11269  1.000 35.06920  ? 355 LEU A O   1 
ATOM   6083  C CB  . LEU B  1 375 ? -31.24011 -2.10158   61.87695  1.000 32.36489  ? 355 LEU A CB  1 
ATOM   6084  C CG  . LEU B  1 375 ? -29.85740 -2.70346   61.68094  1.000 37.15404  ? 355 LEU A CG  1 
ATOM   6085  C CD1 . LEU B  1 375 ? -29.92033 -4.20503   61.88947  1.000 35.47520  ? 355 LEU A CD1 1 
ATOM   6086  C CD2 . LEU B  1 375 ? -29.34931 -2.39605   60.30397  1.000 48.38944  ? 355 LEU A CD2 1 
ATOM   6087  N N   . GLU B  1 376 ? -33.71547 -0.05358   60.96709  1.000 33.31514  ? 356 GLU A N   1 
ATOM   6088  C CA  . GLU B  1 376 ? -35.09555 0.27015    61.28239  1.000 33.08165  ? 356 GLU A CA  1 
ATOM   6089  C C   . GLU B  1 376 ? -36.00324 -0.57737   60.40977  1.000 32.48117  ? 356 GLU A C   1 
ATOM   6090  O O   . GLU B  1 376 ? -35.79457 -0.66248   59.19631  1.000 33.81204  ? 356 GLU A O   1 
ATOM   6091  C CB  . GLU B  1 376 ? -35.37536 1.75696    61.07023  1.000 40.52281  ? 356 GLU A CB  1 
ATOM   6092  C CG  . GLU B  1 376 ? -36.82995 2.13813    61.20937  1.000 43.69928  ? 356 GLU A CG  1 
ATOM   6093  C CD  . GLU B  1 376 ? -36.99361 3.62765    61.35501  1.000 57.84278  ? 356 GLU A CD  1 
ATOM   6094  O OE1 . GLU B  1 376 ? -36.30489 4.21398    62.21765  1.000 64.42440  ? 356 GLU A OE1 1 
ATOM   6095  O OE2 . GLU B  1 376 ? -37.78934 4.21412    60.59355  1.000 68.08721  ? 356 GLU A OE2 1 
ATOM   6096  N N   . ASN B  1 377 ? -36.99766 -1.20770   61.03418  1.000 31.63955  ? 357 ASN A N   1 
ATOM   6097  C CA  . ASN B  1 377 ? -37.94587 -2.07501   60.33013  1.000 42.19585  ? 357 ASN A CA  1 
ATOM   6098  C C   . ASN B  1 377 ? -37.23401 -3.21531   59.60526  1.000 32.03776  ? 357 ASN A C   1 
ATOM   6099  O O   . ASN B  1 377 ? -37.53977 -3.52408   58.45093  1.000 30.87299  ? 357 ASN A O   1 
ATOM   6100  C CB  . ASN B  1 377 ? -38.79427 -1.26753   59.35123  1.000 36.70367  ? 357 ASN A CB  1 
ATOM   6101  C CG  . ASN B  1 377 ? -39.78868 -0.36476   60.04308  1.000 37.04921  ? 357 ASN A CG  1 
ATOM   6102  O OD1 . ASN B  1 377 ? -39.80284 -0.25488   61.26969  1.000 38.50177  ? 357 ASN A OD1 1 
ATOM   6103  N ND2 . ASN B  1 377 ? -40.63068 0.29036    59.25640  1.000 35.65123  ? 357 ASN A ND2 1 
ATOM   6104  N N   . ALA B  1 378 ? -36.27625 -3.84647   60.27944  1.000 30.25673  ? 358 ALA A N   1 
ATOM   6105  C CA  . ALA B  1 378 ? -35.42606 -4.85870   59.66193  1.000 37.25407  ? 358 ALA A CA  1 
ATOM   6106  C C   . ALA B  1 378 ? -35.74060 -6.24377   60.21186  1.000 38.80245  ? 358 ALA A C   1 
ATOM   6107  O O   . ALA B  1 378 ? -35.78023 -6.44254   61.42993  1.000 31.52796  ? 358 ALA A O   1 
ATOM   6108  C CB  . ALA B  1 378 ? -33.94395 -4.54381   59.87992  1.000 30.47574  ? 358 ALA A CB  1 
ATOM   6109  N N   . VAL B  1 379 ? -35.95691 -7.19675   59.31228  1.000 34.15427  ? 359 VAL A N   1 
ATOM   6110  C CA  . VAL B  1 379 ? -35.99308 -8.61444   59.65232  1.000 27.85259  ? 359 VAL A CA  1 
ATOM   6111  C C   . VAL B  1 379 ? -34.65237 -9.20071   59.24564  1.000 28.16148  ? 359 VAL A C   1 
ATOM   6112  O O   . VAL B  1 379 ? -34.30188 -9.19596   58.05910  1.000 28.49190  ? 359 VAL A O   1 
ATOM   6113  C CB  . VAL B  1 379 ? -37.15089 -9.33575   58.94994  1.000 29.31647  ? 359 VAL A CB  1 
ATOM   6114  C CG1 . VAL B  1 379 ? -37.24895 -10.78175  59.44259  1.000 30.76373  ? 359 VAL A CG1 1 
ATOM   6115  C CG2 . VAL B  1 379 ? -38.45513 -8.58824   59.18265  1.000 27.73457  ? 359 VAL A CG2 1 
ATOM   6116  N N   . VAL B  1 380 ? -33.89702 -9.69124   60.22089  1.000 27.52244  ? 360 VAL A N   1 
ATOM   6117  C CA  . VAL B  1 380 ? -32.48379 -10.00222  60.03680  1.000 28.61106  ? 360 VAL A CA  1 
ATOM   6118  C C   . VAL B  1 380 ? -32.27348 -11.47393  60.37610  1.000 29.22600  ? 360 VAL A C   1 
ATOM   6119  O O   . VAL B  1 380 ? -32.21674 -11.85477  61.55162  1.000 38.11855  ? 360 VAL A O   1 
ATOM   6120  C CB  . VAL B  1 380 ? -31.58982 -9.09288   60.88300  1.000 28.18316  ? 360 VAL A CB  1 
ATOM   6121  C CG1 . VAL B  1 380 ? -30.13348 -9.41848   60.65171  1.000 32.95757  ? 360 VAL A CG1 1 
ATOM   6122  C CG2 . VAL B  1 380 ? -31.87084 -7.62567   60.54778  1.000 30.94536  ? 360 VAL A CG2 1 
ATOM   6123  N N   . LEU B  1 381 ? -32.12746 -12.30232  59.34271  1.000 34.66454  ? 361 LEU A N   1 
ATOM   6124  C CA  . LEU B  1 381 ? -32.03357 -13.75502  59.49557  1.000 29.94776  ? 361 LEU A CA  1 
ATOM   6125  C C   . LEU B  1 381 ? -30.68473 -14.12348  60.12409  1.000 26.42893  ? 361 LEU A C   1 
ATOM   6126  O O   . LEU B  1 381 ? -29.82526 -13.26029  60.31720  1.000 31.99683  ? 361 LEU A O   1 
ATOM   6127  C CB  . LEU B  1 381 ? -32.26118 -14.41692  58.13435  1.000 26.71728  ? 361 LEU A CB  1 
ATOM   6128  C CG  . LEU B  1 381 ? -33.71184 -14.79595  57.79413  1.000 26.44539  ? 361 LEU A CG  1 
ATOM   6129  C CD1 . LEU B  1 381 ? -34.70082 -13.67877  58.09789  1.000 26.52913  ? 361 LEU A CD1 1 
ATOM   6130  C CD2 . LEU B  1 381 ? -33.81815 -15.18790  56.32920  1.000 26.98380  ? 361 LEU A CD2 1 
ATOM   6131  N N   . PRO B  1 382 ? -30.47551 -15.39307  60.49440  1.000 32.88827  ? 362 PRO A N   1 
ATOM   6132  C CA  . PRO B  1 382 ? -29.32232 -15.71320  61.34352  1.000 29.87024  ? 362 PRO A CA  1 
ATOM   6133  C C   . PRO B  1 382 ? -27.98220 -15.32022  60.73790  1.000 28.78549  ? 362 PRO A C   1 
ATOM   6134  O O   . PRO B  1 382 ? -27.83252 -15.16900  59.52149  1.000 27.15279  ? 362 PRO A O   1 
ATOM   6135  C CB  . PRO B  1 382 ? -29.42443 -17.23662  61.51871  1.000 25.22334  ? 362 PRO A CB  1 
ATOM   6136  C CG  . PRO B  1 382 ? -30.86387 -17.51190  61.40544  1.000 24.80352  ? 362 PRO A CG  1 
ATOM   6137  C CD  . PRO B  1 382 ? -31.36245 -16.56965  60.35194  1.000 25.33325  ? 362 PRO A CD  1 
ATOM   6138  N N   . SER B  1 383 ? -27.01341 -15.12255  61.63188  1.000 26.72109  ? 363 SER A N   1 
ATOM   6139  C CA  . SER B  1 383 ? -25.58717 -15.01330  61.31974  1.000 27.43449  ? 363 SER A CA  1 
ATOM   6140  C C   . SER B  1 383 ? -25.26129 -13.82695  60.41832  1.000 28.38537  ? 363 SER A C   1 
ATOM   6141  O O   . SER B  1 383 ? -24.19973 -13.79382  59.78839  1.000 29.11847  ? 363 SER A O   1 
ATOM   6142  C CB  . SER B  1 383 ? -25.06096 -16.31676  60.70061  1.000 30.32091  ? 363 SER A CB  1 
ATOM   6143  O OG  . SER B  1 383 ? -25.30130 -17.42208  61.56738  1.000 26.57452  ? 363 SER A OG  1 
ATOM   6144  N N   . VAL B  1 384 ? -26.13504 -12.83860  60.35955  1.000 31.77904  ? 364 VAL A N   1 
ATOM   6145  C CA  . VAL B  1 384 ? -25.91914 -11.68706  59.49471  1.000 29.42945  ? 364 VAL A CA  1 
ATOM   6146  C C   . VAL B  1 384 ? -24.90987 -10.74665  60.14035  1.000 31.58776  ? 364 VAL A C   1 
ATOM   6147  O O   . VAL B  1 384 ? -24.92225 -10.53632  61.35873  1.000 37.94885  ? 364 VAL A O   1 
ATOM   6148  C CB  . VAL B  1 384 ? -27.25408 -10.98030  59.21436  1.000 37.21752  ? 364 VAL A CB  1 
ATOM   6149  C CG1 . VAL B  1 384 ? -27.03795 -9.50256   58.91746  1.000 30.29392  ? 364 VAL A CG1 1 
ATOM   6150  C CG2 . VAL B  1 384 ? -27.95818 -11.65739  58.07307  1.000 29.17789  ? 364 VAL A CG2 1 
ATOM   6151  N N   . LYS B  1 385 ? -24.02224 -10.18035  59.32648  1.000 31.18274  ? 365 LYS A N   1 
ATOM   6152  C CA  . LYS B  1 385 ? -23.05211 -9.19660   59.78710  1.000 32.08706  ? 365 LYS A CA  1 
ATOM   6153  C C   . LYS B  1 385 ? -23.34568 -7.85114   59.13633  1.000 32.98106  ? 365 LYS A C   1 
ATOM   6154  O O   . LYS B  1 385 ? -23.44828 -7.75835   57.90791  1.000 38.67361  ? 365 LYS A O   1 
ATOM   6155  C CB  . LYS B  1 385 ? -21.62526 -9.65161   59.46829  1.000 40.60045  ? 365 LYS A CB  1 
ATOM   6156  C CG  . LYS B  1 385 ? -20.54655 -8.76993   60.05812  1.000 49.97404  ? 365 LYS A CG  1 
ATOM   6157  C CD  . LYS B  1 385 ? -19.17908 -9.09621   59.47503  1.000 50.76622  ? 365 LYS A CD  1 
ATOM   6158  C CE  . LYS B  1 385 ? -18.19032 -9.48673   60.56035  1.000 52.29392  ? 365 LYS A CE  1 
ATOM   6159  N NZ  . LYS B  1 385 ? -16.86615 -8.82303   60.34437  1.000 54.19500  ? 365 LYS A NZ  1 
ATOM   6160  N N   . ILE B  1 386 ? -23.48559 -6.81504   59.95764  1.000 37.46867  ? 366 ILE A N   1 
ATOM   6161  C CA  . ILE B  1 386 ? -23.77790 -5.46332   59.48921  1.000 41.54043  ? 366 ILE A CA  1 
ATOM   6162  C C   . ILE B  1 386 ? -22.55124 -4.60085   59.75842  1.000 39.73371  ? 366 ILE A C   1 
ATOM   6163  O O   . ILE B  1 386 ? -22.27582 -4.23935   60.90981  1.000 35.46448  ? 366 ILE A O   1 
ATOM   6164  C CB  . ILE B  1 386 ? -25.02038 -4.87897   60.17231  1.000 40.45108  ? 366 ILE A CB  1 
ATOM   6165  C CG1 . ILE B  1 386 ? -26.20764 -5.84157   60.04745  1.000 43.97002  ? 366 ILE A CG1 1 
ATOM   6166  C CG2 . ILE B  1 386 ? -25.34856 -3.52778   59.57781  1.000 34.65575  ? 366 ILE A CG2 1 
ATOM   6167  C CD1 . ILE B  1 386 ? -26.98381 -5.69545   58.75882  1.000 50.27007  ? 366 ILE A CD1 1 
ATOM   6168  N N   . GLY B  1 387 ? -21.82281 -4.25739   58.70256  1.000 36.49147  ? 367 GLY A N   1 
ATOM   6169  C CA  . GLY B  1 387 ? -20.60669 -3.48634   58.85644  1.000 37.80969  ? 367 GLY A CA  1 
ATOM   6170  C C   . GLY B  1 387 ? -20.87477 -2.08308   59.37122  1.000 43.94686  ? 367 GLY A C   1 
ATOM   6171  O O   . GLY B  1 387 ? -21.99749 -1.57677   59.37773  1.000 42.65629  ? 367 GLY A O   1 
ATOM   6172  N N   . ARG B  1 388 ? -19.79513 -1.44021   59.81012  1.000 43.67038  ? 368 ARG A N   1 
ATOM   6173  C CA  . ARG B  1 388 ? -19.91312 -0.12292   60.41881  1.000 49.24406  ? 368 ARG A CA  1 
ATOM   6174  C C   . ARG B  1 388 ? -20.47925 0.88841    59.43330  1.000 41.33945  ? 368 ARG A C   1 
ATOM   6175  O O   . ARG B  1 388 ? -20.20738 0.83174    58.22941  1.000 41.92185  ? 368 ARG A O   1 
ATOM   6176  C CB  . ARG B  1 388 ? -18.55484 0.35556    60.93294  1.000 50.49252  ? 368 ARG A CB  1 
ATOM   6177  C CG  . ARG B  1 388 ? -18.04855 -0.42107   62.12925  1.000 53.81841  ? 368 ARG A CG  1 
ATOM   6178  C CD  . ARG B  1 388 ? -16.56738 -0.19304   62.34365  1.000 60.13154  ? 368 ARG A CD  1 
ATOM   6179  N NE  . ARG B  1 388 ? -16.24442 0.07057    63.74352  1.000 58.20366  ? 368 ARG A NE  1 
ATOM   6180  C CZ  . ARG B  1 388 ? -15.50091 1.09066    64.15529  1.000 61.74782  ? 368 ARG A CZ  1 
ATOM   6181  N NH1 . ARG B  1 388 ? -15.00695 1.94360    63.27076  1.000 63.38056  ? 368 ARG A NH1 1 
ATOM   6182  N NH2 . ARG B  1 388 ? -15.24669 1.25654    65.44738  1.000 65.17167  ? 368 ARG A NH2 1 
ATOM   6183  N N   . HIS B  1 389 ? -21.28553 1.80916    59.95933  1.000 41.42914  ? 369 HIS A N   1 
ATOM   6184  C CA  . HIS B  1 389 ? -21.87146 2.93963    59.24386  1.000 51.28883  ? 369 HIS A CA  1 
ATOM   6185  C C   . HIS B  1 389 ? -22.96597 2.52827    58.26520  1.000 45.56005  ? 369 HIS A C   1 
ATOM   6186  O O   . HIS B  1 389 ? -23.54809 3.40277    57.61206  1.000 53.70536  ? 369 HIS A O   1 
ATOM   6187  C CB  . HIS B  1 389 ? -20.81501 3.76616    58.48777  1.000 47.02313  ? 369 HIS A CB  1 
ATOM   6188  C CG  . HIS B  1 389 ? -19.85442 4.48681    59.38335  1.000 49.72255  ? 369 HIS A CG  1 
ATOM   6189  N ND1 . HIS B  1 389 ? -18.72237 3.88916    59.89543  1.000 48.41439  ? 369 HIS A ND1 1 
ATOM   6190  C CD2 . HIS B  1 389 ? -19.84830 5.75979    59.84613  1.000 49.34525  ? 369 HIS A CD2 1 
ATOM   6191  C CE1 . HIS B  1 389 ? -18.06693 4.75943    60.64356  1.000 51.38201  ? 369 HIS A CE1 1 
ATOM   6192  N NE2 . HIS B  1 389 ? -18.72906 5.90262    60.63003  1.000 50.84530  ? 369 HIS A NE2 1 
ATOM   6193  N N   . ALA B  1 390 ? -23.26462 1.23951    58.13369  1.000 42.62045  ? 370 ALA A N   1 
ATOM   6194  C CA  . ALA B  1 390 ? -24.34967 0.80938    57.26276  1.000 41.00769  ? 370 ALA A CA  1 
ATOM   6195  C C   . ALA B  1 390 ? -25.70025 1.19705    57.85660  1.000 47.55171  ? 370 ALA A C   1 
ATOM   6196  O O   . ALA B  1 390 ? -25.90256 1.14020    59.07093  1.000 49.34053  ? 370 ALA A O   1 
ATOM   6197  C CB  . ALA B  1 390 ? -24.27854 -0.69824   57.04273  1.000 38.41559  ? 370 ALA A CB  1 
ATOM   6198  N N   . GLN B  1 391 ? -26.63163 1.59974    56.99515  1.000 39.02457  ? 371 GLN A N   1 
ATOM   6199  C CA  . GLN B  1 391 ? -27.94070 2.07295    57.43518  1.000 38.57069  ? 371 GLN A CA  1 
ATOM   6200  C C   . GLN B  1 391 ? -29.01863 1.45085    56.56140  1.000 44.20874  ? 371 GLN A C   1 
ATOM   6201  O O   . GLN B  1 391 ? -29.00115 1.62025    55.33653  1.000 45.61810  ? 371 GLN A O   1 
ATOM   6202  C CB  . GLN B  1 391 ? -28.02161 3.60131    57.38266  1.000 39.89716  ? 371 GLN A CB  1 
ATOM   6203  C CG  . GLN B  1 391 ? -27.11580 4.31422    58.37730  1.000 42.14874  ? 371 GLN A CG  1 
ATOM   6204  C CD  . GLN B  1 391 ? -27.46824 5.78459    58.52221  1.000 57.20497  ? 371 GLN A CD  1 
ATOM   6205  O OE1 . GLN B  1 391 ? -27.10244 6.43369    59.50449  1.000 64.81328  ? 371 GLN A OE1 1 
ATOM   6206  N NE2 . GLN B  1 391 ? -28.18955 6.31598    57.54045  1.000 50.86268  ? 371 GLN A NE2 1 
ATOM   6207  N N   . LEU B  1 392 ? -29.96924 0.76209    57.19318  1.000 36.63537  ? 372 LEU A N   1 
ATOM   6208  C CA  . LEU B  1 392 ? -30.93829 -0.07233   56.49541  1.000 36.05292  ? 372 LEU A CA  1 
ATOM   6209  C C   . LEU B  1 392 ? -32.33402 0.19013    57.04324  1.000 35.32721  ? 372 LEU A C   1 
ATOM   6210  O O   . LEU B  1 392 ? -32.52873 0.23305    58.26288  1.000 34.81075  ? 372 LEU A O   1 
ATOM   6211  C CB  . LEU B  1 392 ? -30.58618 -1.56815   56.64420  1.000 34.82900  ? 372 LEU A CB  1 
ATOM   6212  C CG  . LEU B  1 392 ? -29.20957 -2.07471   56.18794  1.000 39.69277  ? 372 LEU A CG  1 
ATOM   6213  C CD1 . LEU B  1 392 ? -28.83286 -1.51836   54.84247  1.000 36.43705  ? 372 LEU A CD1 1 
ATOM   6214  C CD2 . LEU B  1 392 ? -28.09843 -1.77203   57.18459  1.000 46.89745  ? 372 LEU A CD2 1 
ATOM   6215  N N   . SER B  1 393 ? -33.30733 0.33101    56.14646  1.000 35.49192  ? 373 SER A N   1 
ATOM   6216  C CA  . SER B  1 393 ? -34.69009 0.54943    56.54571  1.000 35.06442  ? 373 SER A CA  1 
ATOM   6217  C C   . SER B  1 393 ? -35.61088 -0.27160   55.65754  1.000 34.61063  ? 373 SER A C   1 
ATOM   6218  O O   . SER B  1 393 ? -35.41596 -0.32329   54.44056  1.000 55.32318  ? 373 SER A O   1 
ATOM   6219  C CB  . SER B  1 393 ? -35.06258 2.03489    56.46162  1.000 36.14374  ? 373 SER A CB  1 
ATOM   6220  O OG  . SER B  1 393 ? -34.27982 2.79270    57.36889  1.000 53.46397  ? 373 SER A OG  1 
ATOM   6221  N N   . ASN B  1 394 ? -36.61055 -0.90911   56.27184  1.000 40.21196  ? 374 ASN A N   1 
ATOM   6222  C CA  . ASN B  1 394 ? -37.60147 -1.72567   55.55974  1.000 43.65361  ? 374 ASN A CA  1 
ATOM   6223  C C   . ASN B  1 394 ? -36.93953 -2.83846   54.74230  1.000 34.27885  ? 374 ASN A C   1 
ATOM   6224  O O   . ASN B  1 394 ? -37.03286 -2.89015   53.51599  1.000 33.61563  ? 374 ASN A O   1 
ATOM   6225  C CB  . ASN B  1 394 ? -38.48742 -0.84701   54.66470  1.000 34.10390  ? 374 ASN A CB  1 
ATOM   6226  C CG  . ASN B  1 394 ? -39.42222 0.03826    55.46105  1.000 44.02568  ? 374 ASN A CG  1 
ATOM   6227  O OD1 . ASN B  1 394 ? -39.87399 1.08344    54.98589  1.000 56.85457  ? 374 ASN A OD1 1 
ATOM   6228  N ND2 . ASN B  1 394 ? -39.73538 -0.38611   56.66938  1.000 39.16852  ? 374 ASN A ND2 1 
ATOM   6229  N N   . VAL B  1 395 ? -36.27260 -3.75760   55.43407  1.000 32.24619  ? 375 VAL A N   1 
ATOM   6230  C CA  . VAL B  1 395 ? -35.49905 -4.76953   54.72722  1.000 32.14495  ? 375 VAL A CA  1 
ATOM   6231  C C   . VAL B  1 395 ? -35.73211 -6.15136   55.31782  1.000 33.66686  ? 375 VAL A C   1 
ATOM   6232  O O   . VAL B  1 395 ? -36.14985 -6.30891   56.46697  1.000 30.31031  ? 375 VAL A O   1 
ATOM   6233  C CB  . VAL B  1 395 ? -33.98721 -4.44338   54.71712  1.000 42.31515  ? 375 VAL A CB  1 
ATOM   6234  C CG1 . VAL B  1 395 ? -33.70980 -3.22622   53.82610  1.000 34.00675  ? 375 VAL A CG1 1 
ATOM   6235  C CG2 . VAL B  1 395 ? -33.47564 -4.21058   56.12576  1.000 40.64979  ? 375 VAL A CG2 1 
ATOM   6236  N N   . VAL B  1 396 ? -35.48498 -7.15523   54.48171  1.000 33.61475  ? 376 VAL A N   1 
ATOM   6237  C CA  . VAL B  1 396 ? -35.29084 -8.53684   54.89798  1.000 30.08050  ? 376 VAL A CA  1 
ATOM   6238  C C   . VAL B  1 396 ? -33.86715 -8.90702   54.50476  1.000 36.22572  ? 376 VAL A C   1 
ATOM   6239  O O   . VAL B  1 396 ? -33.50576 -8.82640   53.32287  1.000 31.17172  ? 376 VAL A O   1 
ATOM   6240  C CB  . VAL B  1 396 ? -36.30166 -9.49094   54.24209  1.000 29.81513  ? 376 VAL A CB  1 
ATOM   6241  C CG1 . VAL B  1 396 ? -36.01564 -10.93404  54.65892  1.000 38.26249  ? 376 VAL A CG1 1 
ATOM   6242  C CG2 . VAL B  1 396 ? -37.72905 -9.09685   54.58173  1.000 29.62949  ? 376 VAL A CG2 1 
ATOM   6243  N N   . ILE B  1 397 ? -33.05266 -9.28186   55.48700  1.000 35.63971  ? 377 ILE A N   1 
ATOM   6244  C CA  . ILE B  1 397 ? -31.66106 -9.64966   55.24903  1.000 38.36823  ? 377 ILE A CA  1 
ATOM   6245  C C   . ILE B  1 397 ? -31.55524 -11.16448  55.36255  1.000 29.48927  ? 377 ILE A C   1 
ATOM   6246  O O   . ILE B  1 397 ? -31.73838 -11.73283  56.44555  1.000 33.96325  ? 377 ILE A O   1 
ATOM   6247  C CB  . ILE B  1 397 ? -30.70069 -8.94970   56.21715  1.000 37.26657  ? 377 ILE A CB  1 
ATOM   6248  C CG1 . ILE B  1 397 ? -30.96157 -7.44630   56.23529  1.000 32.38451  ? 377 ILE A CG1 1 
ATOM   6249  C CG2 . ILE B  1 397 ? -29.25116 -9.21850   55.80861  1.000 33.67330  ? 377 ILE A CG2 1 
ATOM   6250  C CD1 . ILE B  1 397 ? -29.86682 -6.66935   56.90272  1.000 31.61845  ? 377 ILE A CD1 1 
ATOM   6251  N N   . ASP B  1 398 ? -31.24696 -11.81470  54.24503  1.000 35.59603  ? 378 ASP A N   1 
ATOM   6252  C CA  . ASP B  1 398 ? -31.20888 -13.27038  54.17610  1.000 33.81595  ? 378 ASP A CA  1 
ATOM   6253  C C   . ASP B  1 398 ? -30.10211 -13.82683  55.07368  1.000 33.08659  ? 378 ASP A C   1 
ATOM   6254  O O   . ASP B  1 398 ? -29.20258 -13.11124  55.52403  1.000 32.04893  ? 378 ASP A O   1 
ATOM   6255  C CB  . ASP B  1 398 ? -31.01937 -13.71192  52.71694  1.000 32.34895  ? 378 ASP A CB  1 
ATOM   6256  C CG  . ASP B  1 398 ? -30.88881 -15.22597  52.55219  1.000 33.00035  ? 378 ASP A CG  1 
ATOM   6257  O OD1 . ASP B  1 398 ? -31.67023 -15.97132  53.18359  1.000 30.80636  ? 378 ASP A OD1 1 
ATOM   6258  O OD2 . ASP B  1 398 ? -30.02088 -15.66330  51.76263  1.000 32.65325  ? 378 ASP A OD2 1 
ATOM   6259  N N   . HIS B  1 399 ? -30.19600 -15.12890  55.33739  1.000 33.90142  ? 379 HIS A N   1 
ATOM   6260  C CA  . HIS B  1 399 ? -29.25910 -15.82854  56.20408  1.000 35.37175  ? 379 HIS A CA  1 
ATOM   6261  C C   . HIS B  1 399 ? -27.81341 -15.59041  55.77887  1.000 35.80444  ? 379 HIS A C   1 
ATOM   6262  O O   . HIS B  1 399 ? -27.47706 -15.65282  54.59391  1.000 40.50291  ? 379 HIS A O   1 
ATOM   6263  C CB  . HIS B  1 399 ? -29.58726 -17.32435  56.17069  1.000 38.43350  ? 379 HIS A CB  1 
ATOM   6264  C CG  . HIS B  1 399 ? -28.74098 -18.16156  57.07468  1.000 38.87150  ? 379 HIS A CG  1 
ATOM   6265  N ND1 . HIS B  1 399 ? -29.26482 -18.85982  58.13977  1.000 43.06627  ? 379 HIS A ND1 1 
ATOM   6266  C CD2 . HIS B  1 399 ? -27.41559 -18.43695  57.05941  1.000 42.39568  ? 379 HIS A CD2 1 
ATOM   6267  C CE1 . HIS B  1 399 ? -28.29702 -19.51714  58.75246  1.000 42.43276  ? 379 HIS A CE1 1 
ATOM   6268  N NE2 . HIS B  1 399 ? -27.16484 -19.27851  58.11593  1.000 43.25787  ? 379 HIS A NE2 1 
ATOM   6269  N N   . GLY B  1 400 ? -26.95997 -15.30336  56.76216  1.000 35.07488  ? 380 GLY A N   1 
ATOM   6270  C CA  . GLY B  1 400 ? -25.52537 -15.25211  56.56387  1.000 35.59652  ? 380 GLY A CA  1 
ATOM   6271  C C   . GLY B  1 400 ? -25.00124 -14.06558  55.78572  1.000 37.23890  ? 380 GLY A C   1 
ATOM   6272  O O   . GLY B  1 400 ? -23.78171 -13.95567  55.61284  1.000 38.38164  ? 380 GLY A O   1 
ATOM   6273  N N   . VAL B  1 401 ? -25.87424 -13.17168  55.31722  1.000 38.50198  ? 381 VAL A N   1 
ATOM   6274  C CA  . VAL B  1 401 ? -25.43873 -12.06962  54.46997  1.000 38.09033  ? 381 VAL A CA  1 
ATOM   6275  C C   . VAL B  1 401 ? -24.48223 -11.16280  55.23139  1.000 40.95855  ? 381 VAL A C   1 
ATOM   6276  O O   . VAL B  1 401 ? -24.68741 -10.85203  56.41277  1.000 41.99194  ? 381 VAL A O   1 
ATOM   6277  C CB  . VAL B  1 401 ? -26.65818 -11.28373  53.95768  1.000 37.01638  ? 381 VAL A CB  1 
ATOM   6278  C CG1 . VAL B  1 401 ? -26.23746 -9.92290   53.40023  1.000 33.64320  ? 381 VAL A CG1 1 
ATOM   6279  C CG2 . VAL B  1 401 ? -27.39711 -12.08336  52.90435  1.000 31.84627  ? 381 VAL A CG2 1 
ATOM   6280  N N   . VAL B  1 402 ? -23.42062 -10.74272  54.55473  1.000 46.11323  ? 382 VAL A N   1 
ATOM   6281  C CA  . VAL B  1 402 ? -22.50000 -9.73935   55.07440  1.000 46.81742  ? 382 VAL A CA  1 
ATOM   6282  C C   . VAL B  1 402 ? -22.85307 -8.41270   54.41405  1.000 35.08654  ? 382 VAL A C   1 
ATOM   6283  O O   . VAL B  1 402 ? -22.72801 -8.25809   53.19454  1.000 38.95413  ? 382 VAL A O   1 
ATOM   6284  C CB  . VAL B  1 402 ? -21.03875 -10.12774  54.81766  1.000 43.71824  ? 382 VAL A CB  1 
ATOM   6285  C CG1 . VAL B  1 402 ? -20.11479 -9.38030   55.77004  1.000 47.75599  ? 382 VAL A CG1 1 
ATOM   6286  C CG2 . VAL B  1 402 ? -20.86589 -11.63049  54.96189  1.000 46.43739  ? 382 VAL A CG2 1 
ATOM   6287  N N   . ILE B  1 403 ? -23.31131 -7.45571   55.21131  1.000 41.93886  ? 383 ILE A N   1 
ATOM   6288  C CA  . ILE B  1 403 ? -23.68251 -6.13431   54.71633  1.000 36.50875  ? 383 ILE A CA  1 
ATOM   6289  C C   . ILE B  1 403 ? -22.42377 -5.27096   54.69239  1.000 43.07651  ? 383 ILE A C   1 
ATOM   6290  O O   . ILE B  1 403 ? -21.81529 -5.05927   55.75389  1.000 47.95311  ? 383 ILE A O   1 
ATOM   6291  C CB  . ILE B  1 403 ? -24.77077 -5.49545   55.58423  1.000 40.63257  ? 383 ILE A CB  1 
ATOM   6292  C CG1 . ILE B  1 403 ? -26.05513 -6.32723   55.52308  1.000 34.10116  ? 383 ILE A CG1 1 
ATOM   6293  C CG2 . ILE B  1 403 ? -25.02123 -4.05863   55.14569  1.000 36.32904  ? 383 ILE A CG2 1 
ATOM   6294  C CD1 . ILE B  1 403 ? -26.72886 -6.31356   54.16456  1.000 34.48771  ? 383 ILE A CD1 1 
ATOM   6295  N N   . PRO B  1 404 ? -22.00861 -4.75733   53.53380  1.000 39.60583  ? 384 PRO A N   1 
ATOM   6296  C CA  . PRO B  1 404 ? -20.75772 -3.99536   53.47518  1.000 40.65004  ? 384 PRO A CA  1 
ATOM   6297  C C   . PRO B  1 404 ? -20.83381 -2.73244   54.31668  1.000 42.56665  ? 384 PRO A C   1 
ATOM   6298  O O   . PRO B  1 404 ? -21.89004 -2.11351   54.46149  1.000 39.98580  ? 384 PRO A O   1 
ATOM   6299  C CB  . PRO B  1 404 ? -20.60570 -3.66191   51.98450  1.000 41.59100  ? 384 PRO A CB  1 
ATOM   6300  C CG  . PRO B  1 404 ? -21.59280 -4.52349   51.26987  1.000 40.21629  ? 384 PRO A CG  1 
ATOM   6301  C CD  . PRO B  1 404 ? -22.69559 -4.80014   52.23308  1.000 38.74204  ? 384 PRO A CD  1 
ATOM   6302  N N   . GLU B  1 405 ? -19.69032 -2.36445   54.88262  1.000 41.07901  ? 385 GLU A N   1 
ATOM   6303  C CA  . GLU B  1 405 ? -19.59515 -1.14524   55.67127  1.000 48.75744  ? 385 GLU A CA  1 
ATOM   6304  C C   . GLU B  1 405 ? -20.04833 0.06765    54.86187  1.000 42.84830  ? 385 GLU A C   1 
ATOM   6305  O O   . GLU B  1 405 ? -19.63842 0.25674    53.71333  1.000 43.90617  ? 385 GLU A O   1 
ATOM   6306  C CB  . GLU B  1 405 ? -18.15828 -0.97640   56.15797  1.000 51.41221  ? 385 GLU A CB  1 
ATOM   6307  C CG  . GLU B  1 405 ? -17.68923 -2.06980   57.11361  1.000 53.27194  ? 385 GLU A CG  1 
ATOM   6308  C CD  . GLU B  1 405 ? -16.21508 -1.93349   57.45651  1.000 52.17660  ? 385 GLU A CD  1 
ATOM   6309  O OE1 . GLU B  1 405 ? -15.46503 -1.38129   56.61859  1.000 49.96710  ? 385 GLU A OE1 1 
ATOM   6310  O OE2 . GLU B  1 405 ? -15.80893 -2.35386   58.56259  1.000 52.73617  ? 385 GLU A OE2 1 
ATOM   6311  N N   . GLY B  1 406 ? -20.93514 0.86573    55.45283  1.000 42.62034  ? 386 GLY A N   1 
ATOM   6312  C CA  . GLY B  1 406 ? -21.42910 2.06800    54.82144  1.000 43.65129  ? 386 GLY A CA  1 
ATOM   6313  C C   . GLY B  1 406 ? -22.60482 1.89739    53.88250  1.000 43.16848  ? 386 GLY A C   1 
ATOM   6314  O O   . GLY B  1 406 ? -23.06716 2.89788    53.31960  1.000 51.12907  ? 386 GLY A O   1 
ATOM   6315  N N   . LEU B  1 407 ? -23.10984 0.67850    53.69290  1.000 46.57677  ? 387 LEU A N   1 
ATOM   6316  C CA  . LEU B  1 407 ? -24.23010 0.47498    52.78063  1.000 47.02387  ? 387 LEU A CA  1 
ATOM   6317  C C   . LEU B  1 407 ? -25.47943 1.19821    53.27617  1.000 44.83537  ? 387 LEU A C   1 
ATOM   6318  O O   . LEU B  1 407 ? -25.78640 1.19897    54.47151  1.000 45.78343  ? 387 LEU A O   1 
ATOM   6319  C CB  . LEU B  1 407 ? -24.51939 -1.01742   52.61910  1.000 40.22379  ? 387 LEU A CB  1 
ATOM   6320  C CG  . LEU B  1 407 ? -25.64884 -1.36668   51.64447  1.000 42.29849  ? 387 LEU A CG  1 
ATOM   6321  C CD1 . LEU B  1 407 ? -25.33191 -0.83846   50.26126  1.000 41.33803  ? 387 LEU A CD1 1 
ATOM   6322  C CD2 . LEU B  1 407 ? -25.90588 -2.87561   51.59893  1.000 38.66488  ? 387 LEU A CD2 1 
ATOM   6323  N N   . ILE B  1 408 ? -26.20741 1.81217    52.34602  1.000 41.73124  ? 388 ILE A N   1 
ATOM   6324  C CA  . ILE B  1 408 ? -27.42744 2.55357    52.65285  1.000 41.53319  ? 388 ILE A CA  1 
ATOM   6325  C C   . ILE B  1 408 ? -28.56920 1.94985    51.84971  1.000 42.68093  ? 388 ILE A C   1 
ATOM   6326  O O   . ILE B  1 408 ? -28.50706 1.90549    50.61382  1.000 42.96693  ? 388 ILE A O   1 
ATOM   6327  C CB  . ILE B  1 408 ? -27.28316 4.05155    52.34405  1.000 43.10576  ? 388 ILE A CB  1 
ATOM   6328  C CG1 . ILE B  1 408 ? -25.97906 4.59366    52.92780  1.000 44.01886  ? 388 ILE A CG1 1 
ATOM   6329  C CG2 . ILE B  1 408 ? -28.48189 4.81640    52.88205  1.000 42.87363  ? 388 ILE A CG2 1 
ATOM   6330  C CD1 . ILE B  1 408 ? -25.89851 4.52962    54.43808  1.000 43.22602  ? 388 ILE A CD1 1 
ATOM   6331  N N   . VAL B  1 409 ? -29.61370 1.49814    52.54774  1.000 39.64398  ? 389 VAL A N   1 
ATOM   6332  C CA  . VAL B  1 409 ? -30.76139 0.84043    51.92546  1.000 41.68105  ? 389 VAL A CA  1 
ATOM   6333  C C   . VAL B  1 409 ? -32.03149 1.37272    52.57028  1.000 38.76138  ? 389 VAL A C   1 
ATOM   6334  O O   . VAL B  1 409 ? -32.16610 1.34710    53.79811  1.000 38.48259  ? 389 VAL A O   1 
ATOM   6335  C CB  . VAL B  1 409 ? -30.70480 -0.69665   52.06382  1.000 37.75934  ? 389 VAL A CB  1 
ATOM   6336  C CG1 . VAL B  1 409 ? -31.94395 -1.32575   51.46488  1.000 37.19643  ? 389 VAL A CG1 1 
ATOM   6337  C CG2 . VAL B  1 409 ? -29.45535 -1.24797   51.41100  1.000 38.26109  ? 389 VAL A CG2 1 
ATOM   6338  N N   . GLY B  1 410 ? -32.97389 1.82338    51.74514  1.000 39.02285  ? 390 GLY A N   1 
ATOM   6339  C CA  . GLY B  1 410 ? -34.17412 2.47397    52.22884  1.000 41.62637  ? 390 GLY A CA  1 
ATOM   6340  C C   . GLY B  1 410 ? -34.20216 3.97411    52.04103  1.000 43.86708  ? 390 GLY A C   1 
ATOM   6341  O O   . GLY B  1 410 ? -35.17730 4.61838    52.45035  1.000 44.23314  ? 390 GLY A O   1 
ATOM   6342  N N   . GLU B  1 411 ? -33.16659 4.55000    51.44016  1.000 46.34660  ? 391 GLU A N   1 
ATOM   6343  C CA  . GLU B  1 411 ? -33.11934 5.97892    51.16912  1.000 47.00893  ? 391 GLU A CA  1 
ATOM   6344  C C   . GLU B  1 411 ? -33.52885 6.31955    49.74260  1.000 48.41029  ? 391 GLU A C   1 
ATOM   6345  O O   . GLU B  1 411 ? -34.28810 7.27065    49.53090  1.000 52.75638  ? 391 GLU A O   1 
ATOM   6346  C CB  . GLU B  1 411 ? -31.71081 6.51429    51.44661  1.000 51.36047  ? 391 GLU A CB  1 
ATOM   6347  C CG  . GLU B  1 411 ? -31.26912 7.63784    50.51791  1.000 69.57653  ? 391 GLU A CG  1 
ATOM   6348  C CD  . GLU B  1 411 ? -29.78841 7.95547    50.64165  1.000 73.80742  ? 391 GLU A CD  1 
ATOM   6349  O OE1 . GLU B  1 411 ? -29.40633 8.63698    51.61830  1.000 69.90920  ? 391 GLU A OE1 1 
ATOM   6350  O OE2 . GLU B  1 411 ? -29.00843 7.52421    49.76269  1.000 75.25576  ? 391 GLU A OE2 1 
ATOM   6351  N N   . ASP B  1 412 ? -33.06018 5.55000    48.76380  1.000 44.11090  ? 392 ASP A N   1 
ATOM   6352  C CA  . ASP B  1 412 ? -33.29603 5.82499    47.34558  1.000 45.11989  ? 392 ASP A CA  1 
ATOM   6353  C C   . ASP B  1 412 ? -33.99833 4.63092    46.71734  1.000 53.39081  ? 392 ASP A C   1 
ATOM   6354  O O   . ASP B  1 412 ? -33.35293 3.60217    46.44259  1.000 54.05398  ? 392 ASP A O   1 
ATOM   6355  C CB  . ASP B  1 412 ? -31.97404 6.11528    46.63341  1.000 46.42710  ? 392 ASP A CB  1 
ATOM   6356  C CG  . ASP B  1 412 ? -32.14825 6.46932    45.15989  1.000 48.78244  ? 392 ASP A CG  1 
ATOM   6357  O OD1 . ASP B  1 412 ? -33.27418 6.37604    44.62438  1.000 53.76531  ? 392 ASP A OD1 1 
ATOM   6358  O OD2 . ASP B  1 412 ? -31.13864 6.84867    44.52930  1.000 55.21137  ? 392 ASP A OD2 1 
ATOM   6359  N N   . PRO B  1 413 ? -35.30829 4.72058    46.46273  1.000 48.85971  ? 393 PRO A N   1 
ATOM   6360  C CA  . PRO B  1 413 ? -36.02103 3.57045    45.87920  1.000 45.15285  ? 393 PRO A CA  1 
ATOM   6361  C C   . PRO B  1 413 ? -35.43909 3.09821    44.55808  1.000 46.98312  ? 393 PRO A C   1 
ATOM   6362  O O   . PRO B  1 413 ? -35.33843 1.88569    44.32995  1.000 48.92153  ? 393 PRO A O   1 
ATOM   6363  C CB  . PRO B  1 413 ? -37.45151 4.10258    45.71227  1.000 43.56607  ? 393 PRO A CB  1 
ATOM   6364  C CG  . PRO B  1 413 ? -37.57350 5.18849    46.73471  1.000 43.28398  ? 393 PRO A CG  1 
ATOM   6365  C CD  . PRO B  1 413 ? -36.21828 5.82801    46.80380  1.000 43.95070  ? 393 PRO A CD  1 
ATOM   6366  N N   . GLU B  1 414 ? -35.04879 4.02260    43.67911  1.000 49.41073  ? 394 GLU A N   1 
ATOM   6367  C CA  . GLU B  1 414 ? -34.51292 3.62768    42.37982  1.000 54.79845  ? 394 GLU A CA  1 
ATOM   6368  C C   . GLU B  1 414 ? -33.21252 2.85208    42.53863  1.000 49.73190  ? 394 GLU A C   1 
ATOM   6369  O O   . GLU B  1 414 ? -33.05536 1.75499    41.98870  1.000 47.71131  ? 394 GLU A O   1 
ATOM   6370  C CB  . GLU B  1 414 ? -34.29842 4.86270    41.50599  1.000 52.63694  ? 394 GLU A CB  1 
ATOM   6371  C CG  . GLU B  1 414 ? -35.50192 5.25313    40.67011  1.000 65.43005  ? 394 GLU A CG  1 
ATOM   6372  C CD  . GLU B  1 414 ? -35.12829 5.58893    39.23559  1.000 81.59598  ? 394 GLU A CD  1 
ATOM   6373  O OE1 . GLU B  1 414 ? -36.03557 5.93328    38.44792  1.000 85.67306  ? 394 GLU A OE1 1 
ATOM   6374  O OE2 . GLU B  1 414 ? -33.92777 5.50655    38.89413  1.000 83.87949  ? 394 GLU A OE2 1 
ATOM   6375  N N   . LEU B  1 415 ? -32.26494 3.41856    43.28733  1.000 44.85328  ? 395 LEU A N   1 
ATOM   6376  C CA  . LEU B  1 415 ? -31.00910 2.73120    43.55595  1.000 44.28090  ? 395 LEU A CA  1 
ATOM   6377  C C   . LEU B  1 415 ? -31.25146 1.38848    44.23394  1.000 54.72157  ? 395 LEU A C   1 
ATOM   6378  O O   . LEU B  1 415 ? -30.62508 0.38270    43.87808  1.000 62.89443  ? 395 LEU A O   1 
ATOM   6379  C CB  . LEU B  1 415 ? -30.11784 3.62109    44.42044  1.000 46.81588  ? 395 LEU A CB  1 
ATOM   6380  C CG  . LEU B  1 415 ? -28.73664 3.11060    44.82162  1.000 52.72180  ? 395 LEU A CG  1 
ATOM   6381  C CD1 . LEU B  1 415 ? -27.78372 3.18916    43.64075  1.000 53.82104  ? 395 LEU A CD1 1 
ATOM   6382  C CD2 . LEU B  1 415 ? -28.20479 3.90543    46.00491  1.000 59.30845  ? 395 LEU A CD2 1 
ATOM   6383  N N   . ASP B  1 416 ? -32.17058 1.34822    45.20256  1.000 43.95144  ? 396 ASP A N   1 
ATOM   6384  C CA  . ASP B  1 416 ? -32.42497 0.10505    45.92397  1.000 50.26555  ? 396 ASP A CA  1 
ATOM   6385  C C   . ASP B  1 416 ? -33.01138 -0.96379   45.00639  1.000 48.98255  ? 396 ASP A C   1 
ATOM   6386  O O   . ASP B  1 416 ? -32.57312 -2.11946   45.03525  1.000 51.40978  ? 396 ASP A O   1 
ATOM   6387  C CB  . ASP B  1 416 ? -33.35565 0.36520    47.11038  1.000 47.37068  ? 396 ASP A CB  1 
ATOM   6388  C CG  . ASP B  1 416 ? -32.66703 1.09663    48.25163  1.000 43.32954  ? 396 ASP A CG  1 
ATOM   6389  O OD1 . ASP B  1 416 ? -31.42364 1.23212    48.21795  1.000 40.96647  ? 396 ASP A OD1 1 
ATOM   6390  O OD2 . ASP B  1 416 ? -33.37104 1.51858    49.19546  1.000 37.85357  ? 396 ASP A OD2 1 
ATOM   6391  N N   . ALA B  1 417 ? -33.99406 -0.59541   44.17800  1.000 49.62562  ? 397 ALA A N   1 
ATOM   6392  C CA  . ALA B  1 417 ? -34.64552 -1.57547   43.31390  1.000 47.51873  ? 397 ALA A CA  1 
ATOM   6393  C C   . ALA B  1 417 ? -33.67808 -2.17277   42.30100  1.000 53.74162  ? 397 ALA A C   1 
ATOM   6394  O O   . ALA B  1 417 ? -33.83813 -3.33184   41.89800  1.000 67.10180  ? 397 ALA A O   1 
ATOM   6395  C CB  . ALA B  1 417 ? -35.83074 -0.93646   42.59282  1.000 42.70476  ? 397 ALA A CB  1 
ATOM   6396  N N   . LYS B  1 418 ? -32.67762 -1.40415   41.87301  1.000 41.77184  ? 398 LYS A N   1 
ATOM   6397  C CA  . LYS B  1 418 ? -31.68952 -1.93626   40.94240  1.000 46.82625  ? 398 LYS A CA  1 
ATOM   6398  C C   . LYS B  1 418 ? -30.83650 -3.00867   41.60792  1.000 56.12849  ? 398 LYS A C   1 
ATOM   6399  O O   . LYS B  1 418 ? -30.70398 -4.12276   41.08676  1.000 53.96150  ? 398 LYS A O   1 
ATOM   6400  C CB  . LYS B  1 418 ? -30.80997 -0.80672   40.40458  1.000 47.30978  ? 398 LYS A CB  1 
ATOM   6401  N N   . ARG B  1 419 ? -30.25910 -2.69317   42.77113  1.000 52.88438  ? 399 ARG A N   1 
ATOM   6402  C CA  . ARG B  1 419 ? -29.33364 -3.61732   43.41465  1.000 44.95445  ? 399 ARG A CA  1 
ATOM   6403  C C   . ARG B  1 419 ? -30.04501 -4.77707   44.08911  1.000 42.62170  ? 399 ARG A C   1 
ATOM   6404  O O   . ARG B  1 419 ? -29.46635 -5.86303   44.20747  1.000 49.69907  ? 399 ARG A O   1 
ATOM   6405  C CB  . ARG B  1 419 ? -28.48492 -2.89458   44.46083  1.000 45.17280  ? 399 ARG A CB  1 
ATOM   6406  C CG  . ARG B  1 419 ? -28.11221 -1.46794   44.12128  1.000 45.80853  ? 399 ARG A CG  1 
ATOM   6407  C CD  . ARG B  1 419 ? -27.70783 -0.73453   45.38742  1.000 44.61868  ? 399 ARG A CD  1 
ATOM   6408  N NE  . ARG B  1 419 ? -26.55570 0.13384    45.17375  1.000 56.91054  ? 399 ARG A NE  1 
ATOM   6409  C CZ  . ARG B  1 419 ? -26.10902 1.01043    46.06634  1.000 63.09226  ? 399 ARG A CZ  1 
ATOM   6410  N NH1 . ARG B  1 419 ? -26.71892 1.13520    47.23946  1.000 61.80663  ? 399 ARG A NH1 1 
ATOM   6411  N NH2 . ARG B  1 419 ? -25.05118 1.76000    45.78806  1.000 62.40379  ? 399 ARG A NH2 1 
ATOM   6412  N N   . PHE B  1 420 ? -31.27780 -4.57291   44.53971  1.000 38.56299  ? 400 PHE A N   1 
ATOM   6413  C CA  . PHE B  1 420 ? -31.95238 -5.53391   45.39593  1.000 41.73423  ? 400 PHE A CA  1 
ATOM   6414  C C   . PHE B  1 420 ? -33.26449 -5.99083   44.78274  1.000 46.49919  ? 400 PHE A C   1 
ATOM   6415  O O   . PHE B  1 420 ? -33.69231 -5.52970   43.72056  1.000 56.62768  ? 400 PHE A O   1 
ATOM   6416  C CB  . PHE B  1 420 ? -32.22166 -4.93666   46.77878  1.000 44.23427  ? 400 PHE A CB  1 
ATOM   6417  C CG  . PHE B  1 420 ? -31.00337 -4.38792   47.42974  1.000 45.62298  ? 400 PHE A CG  1 
ATOM   6418  C CD1 . PHE B  1 420 ? -30.91294 -3.04661   47.73047  1.000 41.03962  ? 400 PHE A CD1 1 
ATOM   6419  C CD2 . PHE B  1 420 ? -29.93354 -5.21340   47.72119  1.000 47.45514  ? 400 PHE A CD2 1 
ATOM   6420  C CE1 . PHE B  1 420 ? -29.78378 -2.53695   48.31867  1.000 45.48921  ? 400 PHE A CE1 1 
ATOM   6421  C CE2 . PHE B  1 420 ? -28.79987 -4.70734   48.31450  1.000 48.08616  ? 400 PHE A CE2 1 
ATOM   6422  C CZ  . PHE B  1 420 ? -28.72525 -3.36849   48.61598  1.000 37.34527  ? 400 PHE A CZ  1 
ATOM   6423  N N   . ARG B  1 421 ? -33.86955 -6.94703   45.47586  1.000 45.97714  ? 401 ARG A N   1 
ATOM   6424  C CA  . ARG B  1 421 ? -35.26206 -7.31152   45.28089  1.000 45.23858  ? 401 ARG A CA  1 
ATOM   6425  C C   . ARG B  1 421 ? -36.08569 -6.37013   46.14464  1.000 37.62983  ? 401 ARG A C   1 
ATOM   6426  O O   . ARG B  1 421 ? -36.05230 -6.45757   47.37538  1.000 39.55474  ? 401 ARG A O   1 
ATOM   6427  C CB  . ARG B  1 421 ? -35.48648 -8.77108   45.66607  1.000 44.48758  ? 401 ARG A CB  1 
ATOM   6428  C CG  . ARG B  1 421 ? -36.93490 -9.14303   45.88918  1.000 42.58562  ? 401 ARG A CG  1 
ATOM   6429  C CD  . ARG B  1 421 ? -37.68991 -9.18242   44.58035  1.000 43.56978  ? 401 ARG A CD  1 
ATOM   6430  N NE  . ARG B  1 421 ? -37.00713 -10.02580  43.60840  1.000 49.86914  ? 401 ARG A NE  1 
ATOM   6431  C CZ  . ARG B  1 421 ? -37.31265 -10.07328  42.31644  1.000 58.47617  ? 401 ARG A CZ  1 
ATOM   6432  N NH1 . ARG B  1 421 ? -38.28717 -9.30936   41.83417  1.000 59.13422  ? 401 ARG A NH1 1 
ATOM   6433  N NH2 . ARG B  1 421 ? -36.63816 -10.87976  41.50577  1.000 46.33839  ? 401 ARG A NH2 1 
ATOM   6434  N N   . ARG B  1 422 ? -36.78473 -5.43923   45.51287  1.000 41.65234  ? 402 ARG A N   1 
ATOM   6435  C CA  . ARG B  1 422 ? -37.57187 -4.44275   46.22180  1.000 43.10680  ? 402 ARG A CA  1 
ATOM   6436  C C   . ARG B  1 422 ? -39.04319 -4.66377   45.91065  1.000 41.00113  ? 402 ARG A C   1 
ATOM   6437  O O   . ARG B  1 422 ? -39.42985 -4.71220   44.73822  1.000 48.14197  ? 402 ARG A O   1 
ATOM   6438  C CB  . ARG B  1 422 ? -37.14064 -3.02986   45.82385  1.000 36.05712  ? 402 ARG A CB  1 
ATOM   6439  C CG  . ARG B  1 422 ? -38.01489 -1.93265   46.39460  1.000 37.48067  ? 402 ARG A CG  1 
ATOM   6440  C CD  . ARG B  1 422 ? -37.42188 -0.55051   46.14414  1.000 45.36899  ? 402 ARG A CD  1 
ATOM   6441  N NE  . ARG B  1 422 ? -36.94055 0.03154    47.38686  1.000 50.64299  ? 402 ARG A NE  1 
ATOM   6442  C CZ  . ARG B  1 422 ? -37.61273 0.91988    48.10346  1.000 51.87385  ? 402 ARG A CZ  1 
ATOM   6443  N NH1 . ARG B  1 422 ? -38.79891 1.34560    47.67859  1.000 45.65916  ? 402 ARG A NH1 1 
ATOM   6444  N NH2 . ARG B  1 422 ? -37.09732 1.38107    49.23212  1.000 56.54154  ? 402 ARG A NH2 1 
ATOM   6445  N N   . THR B  1 423 ? -39.85634 -4.82330   46.95183  1.000 35.98496  ? 403 THR A N   1 
ATOM   6446  C CA  . THR B  1 423 ? -41.29055 -4.90114   46.72542  1.000 44.89857  ? 403 THR A CA  1 
ATOM   6447  C C   . THR B  1 423 ? -41.80373 -3.54761   46.24735  1.000 44.94808  ? 403 THR A C   1 
ATOM   6448  O O   . THR B  1 423 ? -41.08889 -2.54223   46.25586  1.000 38.94003  ? 403 THR A O   1 
ATOM   6449  C CB  . THR B  1 423 ? -42.04263 -5.30978   47.99419  1.000 49.86558  ? 403 THR A CB  1 
ATOM   6450  O OG1 . THR B  1 423 ? -43.45286 -5.27372   47.73985  1.000 64.13049  ? 403 THR A OG1 1 
ATOM   6451  C CG2 . THR B  1 423 ? -41.78404 -4.33815   49.07702  1.000 36.99005  ? 403 THR A CG2 1 
ATOM   6452  N N   . GLU B  1 424 ? -43.06363 -3.52522   45.82151  1.000 48.49279  ? 404 GLU A N   1 
ATOM   6453  C CA  . GLU B  1 424 ? -43.66348 -2.25145   45.45754  1.000 55.40441  ? 404 GLU A CA  1 
ATOM   6454  C C   . GLU B  1 424 ? -43.94299 -1.37525   46.67482  1.000 47.78004  ? 404 GLU A C   1 
ATOM   6455  O O   . GLU B  1 424 ? -44.10044 -0.16147   46.52239  1.000 48.50012  ? 404 GLU A O   1 
ATOM   6456  C CB  . GLU B  1 424 ? -44.94883 -2.47199   44.66350  1.000 63.97153  ? 404 GLU A CB  1 
ATOM   6457  C CG  . GLU B  1 424 ? -45.40931 -1.23057   43.90603  1.000 70.82701  ? 404 GLU A CG  1 
ATOM   6458  C CD  . GLU B  1 424 ? -46.87204 -0.90983   44.15301  1.000 78.37049  ? 404 GLU A CD  1 
ATOM   6459  O OE1 . GLU B  1 424 ? -47.40514 -1.34528   45.19674  1.000 81.43283  ? 404 GLU A OE1 1 
ATOM   6460  O OE2 . GLU B  1 424 ? -47.48907 -0.22845   43.30470  1.000 81.88619  ? 404 GLU A OE2 1 
ATOM   6461  N N   . SER B  1 425 ? -43.98300 -1.95886   47.87320  1.000 43.24195  ? 405 SER A N   1 
ATOM   6462  C CA  . SER B  1 425 ? -44.26432 -1.20258   49.08748  1.000 45.06916  ? 405 SER A CA  1 
ATOM   6463  C C   . SER B  1 425 ? -43.01813 -0.78954   49.85795  1.000 51.16115  ? 405 SER A C   1 
ATOM   6464  O O   . SER B  1 425 ? -43.14823 -0.09549   50.87739  1.000 59.20847  ? 405 SER A O   1 
ATOM   6465  C CB  . SER B  1 425 ? -45.19029 -1.98845   50.00573  1.000 55.65160  ? 405 SER A CB  1 
ATOM   6466  O OG  . SER B  1 425 ? -46.38440 -2.32350   49.32368  1.000 63.00466  ? 405 SER A OG  1 
ATOM   6467  N N   . GLY B  1 426 ? -41.81962 -1.14488   49.38055  1.000 44.88085  ? 406 GLY A N   1 
ATOM   6468  C CA  . GLY B  1 426 ? -40.57173 -0.58109   49.87103  1.000 45.25299  ? 406 GLY A CA  1 
ATOM   6469  C C   . GLY B  1 426 ? -39.65014 -1.53954   50.60416  1.000 42.63131  ? 406 GLY A C   1 
ATOM   6470  O O   . GLY B  1 426 ? -38.52270 -1.15162   50.93413  1.000 42.69890  ? 406 GLY A O   1 
ATOM   6471  N N   . ILE B  1 427 ? -40.09257 -2.75975   50.89350  1.000 45.89178  ? 407 ILE A N   1 
ATOM   6472  C CA  . ILE B  1 427 ? -39.23414 -3.77376   51.49930  1.000 37.98409  ? 407 ILE A CA  1 
ATOM   6473  C C   . ILE B  1 427 ? -38.21512 -4.24381   50.47171  1.000 33.61298  ? 407 ILE A C   1 
ATOM   6474  O O   . ILE B  1 427 ? -38.57879 -4.67042   49.37064  1.000 33.91394  ? 407 ILE A O   1 
ATOM   6475  C CB  . ILE B  1 427 ? -40.06506 -4.95309   52.01822  1.000 39.73703  ? 407 ILE A CB  1 
ATOM   6476  C CG1 . ILE B  1 427 ? -41.16975 -4.44865   52.94925  1.000 41.04326  ? 407 ILE A CG1 1 
ATOM   6477  C CG2 . ILE B  1 427 ? -39.17227 -6.01310   52.67425  1.000 33.40359  ? 407 ILE A CG2 1 
ATOM   6478  C CD1 . ILE B  1 427 ? -40.67152 -3.57914   54.08236  1.000 42.45341  ? 407 ILE A CD1 1 
ATOM   6479  N N   . CYS B  1 428 ? -36.93414 -4.15894   50.82355  1.000 32.93193  ? 408 CYS A N   1 
ATOM   6480  C CA  . CYS B  1 428 ? -35.85979 -4.74702   50.03317  1.000 41.55533  ? 408 CYS A CA  1 
ATOM   6481  C C   . CYS B  1 428 ? -35.45727 -6.08134   50.65030  1.000 31.50149  ? 408 CYS A C   1 
ATOM   6482  O O   . CYS B  1 428 ? -35.29286 -6.18125   51.86944  1.000 34.69948  ? 408 CYS A O   1 
ATOM   6483  C CB  . CYS B  1 428 ? -34.64386 -3.81757   49.96063  1.000 46.81945  ? 408 CYS A CB  1 
ATOM   6484  S SG  . CYS B  1 428 ? -34.86621 -2.29930   49.00468  1.000 50.03002  ? 408 CYS A SG  1 
ATOM   6485  N N   . LEU B  1 429 ? -35.30724 -7.10038   49.81230  1.000 35.94923  ? 409 LEU A N   1 
ATOM   6486  C CA  . LEU B  1 429 ? -34.78943 -8.39757   50.23147  1.000 30.77856  ? 409 LEU A CA  1 
ATOM   6487  C C   . LEU B  1 429 ? -33.33393 -8.48932   49.79080  1.000 33.50618  ? 409 LEU A C   1 
ATOM   6488  O O   . LEU B  1 429 ? -33.04442 -8.45423   48.58954  1.000 31.58190  ? 409 LEU A O   1 
ATOM   6489  C CB  . LEU B  1 429 ? -35.61360 -9.53786   49.63447  1.000 31.12400  ? 409 LEU A CB  1 
ATOM   6490  C CG  . LEU B  1 429 ? -34.92326 -10.90430  49.59712  1.000 30.95497  ? 409 LEU A CG  1 
ATOM   6491  C CD1 . LEU B  1 429 ? -34.88052 -11.52817  50.98183  1.000 30.31728  ? 409 LEU A CD1 1 
ATOM   6492  C CD2 . LEU B  1 429 ? -35.62823 -11.82239  48.62354  1.000 34.63404  ? 409 LEU A CD2 1 
ATOM   6493  N N   . ILE B  1 430 ? -32.42126 -8.59220   50.75555  1.000 34.59998  ? 410 ILE A N   1 
ATOM   6494  C CA  . ILE B  1 430 ? -30.98611 -8.52350   50.49031  1.000 30.95940  ? 410 ILE A CA  1 
ATOM   6495  C C   . ILE B  1 430 ? -30.38470 -9.91477   50.63838  1.000 32.41465  ? 410 ILE A C   1 
ATOM   6496  O O   . ILE B  1 430 ? -30.38596 -10.48991  51.73336  1.000 33.79568  ? 410 ILE A O   1 
ATOM   6497  C CB  . ILE B  1 430 ? -30.27465 -7.52727   51.41966  1.000 37.48870  ? 410 ILE A CB  1 
ATOM   6498  C CG1 . ILE B  1 430 ? -30.62883 -6.07951   51.05717  1.000 31.87514  ? 410 ILE A CG1 1 
ATOM   6499  C CG2 . ILE B  1 430 ? -28.76595 -7.71816   51.33033  1.000 37.37410  ? 410 ILE A CG2 1 
ATOM   6500  C CD1 . ILE B  1 430 ? -31.90900 -5.56591   51.66999  1.000 31.55437  ? 410 ILE A CD1 1 
ATOM   6501  N N   . THR B  1 431 ? -29.86826 -10.44961  49.53874  1.000 33.69467  ? 411 THR A N   1 
ATOM   6502  C CA  A THR B  1 431 ? -29.14434 -11.70883  49.49751  0.000 34.97959  ? 411 THR A CA  1 
ATOM   6503  C CA  B THR B  1 431 ? -29.13124 -11.70289  49.56911  1.000 35.70183  ? 411 THR A CA  1 
ATOM   6504  C C   . THR B  1 431 ? -27.65154 -11.42945  49.34852  1.000 40.69771  ? 411 THR A C   1 
ATOM   6505  O O   . THR B  1 431 ? -27.24585 -10.34673  48.91487  1.000 40.81120  ? 411 THR A O   1 
ATOM   6506  C CB  A THR B  1 431 ? -29.65230 -12.57595  48.33659  0.000 35.26884  ? 411 THR A CB  1 
ATOM   6507  C CB  B THR B  1 431 ? -29.63278 -12.69292  48.51184  1.000 35.65467  ? 411 THR A CB  1 
ATOM   6508  O OG1 A THR B  1 431 ? -31.05804 -12.35642  48.16132  0.000 34.12129  ? 411 THR A OG1 1 
ATOM   6509  O OG1 B THR B  1 431 ? -29.46814 -12.12372  47.20969  1.000 39.39654  ? 411 THR A OG1 1 
ATOM   6510  C CG2 A THR B  1 431 ? -29.42221 -14.04847  48.60932  0.000 33.29041  ? 411 THR A CG2 1 
ATOM   6511  C CG2 B THR B  1 431 ? -31.10242 -13.03737  48.74082  1.000 31.93477  ? 411 THR A CG2 1 
ATOM   6512  N N   . GLN B  1 432 ? -26.83311 -12.42141  49.70182  1.000 40.32598  ? 412 GLN A N   1 
ATOM   6513  C CA  . GLN B  1 432 ? -25.39679 -12.27061  49.50871  1.000 48.00079  ? 412 GLN A CA  1 
ATOM   6514  C C   . GLN B  1 432 ? -25.05720 -12.15828  48.02970  1.000 54.77726  ? 412 GLN A C   1 
ATOM   6515  O O   . GLN B  1 432 ? -24.09321 -11.47569  47.65997  1.000 49.16504  ? 412 GLN A O   1 
ATOM   6516  C CB  . GLN B  1 432 ? -24.65644 -13.44632  50.14556  1.000 39.59200  ? 412 GLN A CB  1 
ATOM   6517  C CG  . GLN B  1 432 ? -23.14403 -13.32566  50.09350  1.000 45.65500  ? 412 GLN A CG  1 
ATOM   6518  C CD  . GLN B  1 432 ? -22.64018 -12.06653  50.76790  1.000 44.64114  ? 412 GLN A CD  1 
ATOM   6519  O OE1 . GLN B  1 432 ? -22.84709 -11.86173  51.96572  1.000 49.85096  ? 412 GLN A OE1 1 
ATOM   6520  N NE2 . GLN B  1 432 ? -21.97367 -11.21285  50.00041  1.000 50.97800  ? 412 GLN A NE2 1 
ATOM   6521  N N   . SER B  1 433 ? -25.85212 -12.80836  47.17527  1.000 53.95460  ? 413 SER A N   1 
ATOM   6522  C CA  . SER B  1 433 ? -25.63628 -12.74404  45.73364  1.000 50.68307  ? 413 SER A CA  1 
ATOM   6523  C C   . SER B  1 433 ? -25.68176 -11.30500  45.23048  1.000 51.96874  ? 413 SER A C   1 
ATOM   6524  O O   . SER B  1 433 ? -24.81034 -10.87611  44.46485  1.000 48.59209  ? 413 SER A O   1 
ATOM   6525  C CB  . SER B  1 433 ? -26.68066 -13.60619  45.02143  1.000 53.46459  ? 413 SER A CB  1 
ATOM   6526  O OG  . SER B  1 433 ? -26.65679 -13.40548  43.61921  1.000 63.33533  ? 413 SER A OG  1 
ATOM   6527  N N   . MET B  1 434 ? -26.69056 -10.53967  45.65880  1.000 50.39698  ? 414 MET A N   1 
ATOM   6528  C CA  . MET B  1 434 ? -26.80365 -9.14999   45.22383  1.000 38.50890  ? 414 MET A CA  1 
ATOM   6529  C C   . MET B  1 434 ? -25.64335 -8.30852   45.74196  1.000 45.46316  ? 414 MET A C   1 
ATOM   6530  O O   . MET B  1 434 ? -25.07091 -7.50433   44.99705  1.000 44.13718  ? 414 MET A O   1 
ATOM   6531  C CB  . MET B  1 434 ? -28.13942 -8.56876   45.68122  1.000 36.71405  ? 414 MET A CB  1 
ATOM   6532  C CG  . MET B  1 434 ? -29.28749 -9.54771   45.55259  1.000 35.84977  ? 414 MET A CG  1 
ATOM   6533  S SD  . MET B  1 434 ? -30.63690 -9.24882   46.70939  1.000 58.33825  ? 414 MET A SD  1 
ATOM   6534  C CE  . MET B  1 434 ? -32.05156 -9.57094   45.67752  1.000 44.43004  ? 414 MET A CE  1 
ATOM   6535  N N   . ILE B  1 435 ? -25.28257 -8.47908   47.01753  1.000 44.20436  ? 415 ILE A N   1 
ATOM   6536  C CA  . ILE B  1 435 ? -24.14759 -7.75058   47.58472  1.000 39.51528  ? 415 ILE A CA  1 
ATOM   6537  C C   . ILE B  1 435 ? -22.88639 -8.00146   46.76606  1.000 44.09128  ? 415 ILE A C   1 
ATOM   6538  O O   . ILE B  1 435 ? -22.07030 -7.09370   46.56111  1.000 54.53237  ? 415 ILE A O   1 
ATOM   6539  C CB  . ILE B  1 435 ? -23.94555 -8.14464   49.06132  1.000 38.32667  ? 415 ILE A CB  1 
ATOM   6540  C CG1 . ILE B  1 435 ? -25.18654 -7.81453   49.89446  1.000 36.20228  ? 415 ILE A CG1 1 
ATOM   6541  C CG2 . ILE B  1 435 ? -22.70083 -7.48938   49.62944  1.000 40.10844  ? 415 ILE A CG2 1 
ATOM   6542  C CD1 . ILE B  1 435 ? -25.43716 -6.32681   50.07711  1.000 50.96222  ? 415 ILE A CD1 1 
ATOM   6543  N N   . ASP B  1 436 ? -22.70932 -9.23831   46.28411  1.000 51.53017  ? 416 ASP A N   1 
ATOM   6544  C CA  . ASP B  1 436 ? -21.51592 -9.58516   45.51731  1.000 53.29915  ? 416 ASP A CA  1 
ATOM   6545  C C   . ASP B  1 436 ? -21.38485 -8.71536   44.26909  1.000 58.45915  ? 416 ASP A C   1 
ATOM   6546  O O   . ASP B  1 436 ? -20.27233 -8.35937   43.86824  1.000 65.85742  ? 416 ASP A O   1 
ATOM   6547  C CB  . ASP B  1 436 ? -21.55151 -11.06451  45.12881  1.000 53.28338  ? 416 ASP A CB  1 
ATOM   6548  C CG  . ASP B  1 436 ? -21.25918 -11.98997  46.29807  1.000 52.05823  ? 416 ASP A CG  1 
ATOM   6549  O OD1 . ASP B  1 436 ? -20.70789 -11.52141  47.31625  1.000 52.80684  ? 416 ASP A OD1 1 
ATOM   6550  O OD2 . ASP B  1 436 ? -21.57923 -13.19103  46.19685  1.000 46.44336  ? 416 ASP A OD2 1 
ATOM   6551  N N   . LYS B  1 437 ? -22.50910 -8.34591   43.65450  1.000 53.42305  ? 417 LYS A N   1 
ATOM   6552  C CA  . LYS B  1 437 ? -22.49790 -7.59424   42.41096  1.000 58.22708  ? 417 LYS A CA  1 
ATOM   6553  C C   . LYS B  1 437 ? -22.36611 -6.08810   42.59200  1.000 64.15198  ? 417 LYS A C   1 
ATOM   6554  O O   . LYS B  1 437 ? -22.58062 -5.36954   41.61266  1.000 71.04670  ? 417 LYS A O   1 
ATOM   6555  C CB  . LYS B  1 437 ? -23.78592 -7.83004   41.61264  1.000 51.15447  ? 417 LYS A CB  1 
ATOM   6556  C CG  . LYS B  1 437 ? -24.24806 -9.25775   41.49005  1.000 56.02463  ? 417 LYS A CG  1 
ATOM   6557  C CD  . LYS B  1 437 ? -25.20970 -9.38993   40.31705  1.000 58.13874  ? 417 LYS A CD  1 
ATOM   6558  C CE  . LYS B  1 437 ? -26.08273 -10.62685  40.46636  1.000 54.23482  ? 417 LYS A CE  1 
ATOM   6559  N NZ  . LYS B  1 437 ? -25.29469 -11.88698  40.32455  1.000 52.08379  ? 417 LYS A NZ  1 
ATOM   6560  N N   . LEU B  1 438 ? -22.01403 -5.59148   43.78204  1.000 66.03326  ? 418 LEU A N   1 
ATOM   6561  C CA  . LEU B  1 438 ? -22.26673 -4.18708   44.11678  1.000 67.06734  ? 418 LEU A CA  1 
ATOM   6562  C C   . LEU B  1 438 ? -21.05369 -3.28312   43.89919  1.000 72.82697  ? 418 LEU A C   1 
ATOM   6563  O O   . LEU B  1 438 ? -19.90732 -3.66325   44.15347  1.000 71.87629  ? 418 LEU A O   1 
ATOM   6564  C CB  . LEU B  1 438 ? -22.78613 -4.04549   45.55004  1.000 60.19237  ? 418 LEU A CB  1 
ATOM   6565  C CG  . LEU B  1 438 ? -24.31769 -4.05274   45.54044  1.000 55.57276  ? 418 LEU A CG  1 
ATOM   6566  C CD1 . LEU B  1 438 ? -24.84279 -3.88944   46.94499  1.000 48.14155  ? 418 LEU A CD1 1 
ATOM   6567  C CD2 . LEU B  1 438 ? -24.86974 -2.96681   44.59666  1.000 52.04677  ? 418 LEU A CD2 1 
ATOM   6568  N N   . ASP B  1 439 ? -21.34480 -2.07380   43.39537  1.000 79.86683  ? 419 ASP A N   1 
ATOM   6569  C CA  . ASP B  1 439 ? -20.40484 -0.96089   43.23642  1.000 88.30546  ? 419 ASP A CA  1 
ATOM   6570  C C   . ASP B  1 439 ? -21.09628 0.28070    43.78690  1.000 95.50557  ? 419 ASP A C   1 
ATOM   6571  O O   . ASP B  1 439 ? -21.14313 0.47741    45.00464  1.000 97.58812  ? 419 ASP A O   1 
ATOM   6572  C CB  . ASP B  1 439 ? -20.01380 -0.75833   41.76867  1.000 92.64915  ? 419 ASP A CB  1 
ATOM   6573  C CG  . ASP B  1 439 ? -19.00128 -1.77255   41.29092  1.000 99.38252  ? 419 ASP A CG  1 
ATOM   6574  O OD1 . ASP B  1 439 ? -18.22069 -2.25621   42.13947  1.000 101.43099 ? 419 ASP A OD1 1 
ATOM   6575  O OD2 . ASP B  1 439 ? -19.01936 -2.12502   40.08996  1.000 104.29230 ? 419 ASP A OD2 1 
ATOM   6576  N N   . LEU B  1 440 ? -21.66055 1.10498    42.90216  1.000 94.98883  ? 420 LEU A N   1 
ATOM   6577  C CA  . LEU B  1 440 ? -22.52844 2.21420    43.30682  1.000 84.92613  ? 420 LEU A CA  1 
ATOM   6578  C C   . LEU B  1 440 ? -23.93923 2.00214    42.75795  1.000 78.78838  ? 420 LEU A C   1 
ATOM   6579  O O   . LEU B  1 440 ? -24.33452 2.63471    41.77649  1.000 73.55690  ? 420 LEU A O   1 
ATOM   6580  C CB  . LEU B  1 440 ? -21.96616 3.55252    42.81949  1.000 89.73469  ? 420 LEU A CB  1 
ATOM   6581  C CG  . LEU B  1 440 ? -22.18342 4.80614    43.68138  1.000 82.91494  ? 420 LEU A CG  1 
ATOM   6582  C CD1 . LEU B  1 440 ? -21.55940 6.02777    43.01929  1.000 80.24183  ? 420 LEU A CD1 1 
ATOM   6583  C CD2 . LEU B  1 440 ? -23.65894 5.06322    43.99035  1.000 76.54981  ? 420 LEU A CD2 1 
ATOM   6584  N N   . VAL C  1 26  ? 1.35581   -42.66671  71.83048  1.000 65.92699  ? 6   VAL B N   1 
ATOM   6585  C CA  . VAL C  1 26  ? 0.40886   -42.59430  70.72065  1.000 69.34166  ? 6   VAL B CA  1 
ATOM   6586  C C   . VAL C  1 26  ? -0.98245  -42.20132  71.20951  1.000 67.94274  ? 6   VAL B C   1 
ATOM   6587  O O   . VAL C  1 26  ? -1.41087  -41.05589  71.03427  1.000 65.05377  ? 6   VAL B O   1 
ATOM   6588  C CB  . VAL C  1 26  ? 0.34272   -43.92869  69.94806  1.000 59.83950  ? 6   VAL B CB  1 
ATOM   6589  C CG1 . VAL C  1 26  ? -0.61908  -43.81376  68.76563  1.000 57.64647  ? 6   VAL B CG1 1 
ATOM   6590  C CG2 . VAL C  1 26  ? 1.73085   -44.34683  69.47712  1.000 60.72051  ? 6   VAL B CG2 1 
ATOM   6591  N N   . GLN C  1 27  ? -1.67685  -43.16102  71.81816  1.000 62.47866  ? 7   GLN B N   1 
ATOM   6592  C CA  . GLN C  1 27  ? -3.05072  -42.93562  72.24023  1.000 56.42981  ? 7   GLN B CA  1 
ATOM   6593  C C   . GLN C  1 27  ? -3.11496  -41.77666  73.23048  1.000 55.90455  ? 7   GLN B C   1 
ATOM   6594  O O   . GLN C  1 27  ? -2.23074  -41.63701  74.08509  1.000 62.16123  ? 7   GLN B O   1 
ATOM   6595  C CB  . GLN C  1 27  ? -3.63605  -44.19335  72.88281  1.000 51.24194  ? 7   GLN B CB  1 
ATOM   6596  C CG  . GLN C  1 27  ? -3.59045  -45.42331  71.99892  1.000 56.13500  ? 7   GLN B CG  1 
ATOM   6597  C CD  . GLN C  1 27  ? -4.13572  -46.65452  72.69485  1.000 59.92021  ? 7   GLN B CD  1 
ATOM   6598  O OE1 . GLN C  1 27  ? -4.82210  -46.55255  73.71196  1.000 63.78851  ? 7   GLN B OE1 1 
ATOM   6599  N NE2 . GLN C  1 27  ? -3.83915  -47.82734  72.14483  1.000 58.02253  ? 7   GLN B NE2 1 
ATOM   6600  N N   . PRO C  1 28  ? -4.12798  -40.92102  73.13523  1.000 42.58323  ? 8   PRO B N   1 
ATOM   6601  C CA  . PRO C  1 28  ? -4.31393  -39.89697  74.16522  1.000 43.71793  ? 8   PRO B CA  1 
ATOM   6602  C C   . PRO C  1 28  ? -4.60652  -40.54957  75.50525  1.000 35.01843  ? 8   PRO B C   1 
ATOM   6603  O O   . PRO C  1 28  ? -5.34650  -41.53040  75.59151  1.000 40.41015  ? 8   PRO B O   1 
ATOM   6604  C CB  . PRO C  1 28  ? -5.50991  -39.08773  73.65121  1.000 46.64895  ? 8   PRO B CB  1 
ATOM   6605  C CG  . PRO C  1 28  ? -6.22873  -40.02573  72.72614  1.000 41.36060  ? 8   PRO B CG  1 
ATOM   6606  C CD  . PRO C  1 28  ? -5.16016  -40.85311  72.08825  1.000 35.90357  ? 8   PRO B CD  1 
ATOM   6607  N N   . LEU C  1 29  ? -4.00231  -40.00447  76.55705  1.000 35.25225  ? 9   LEU B N   1 
ATOM   6608  C CA  . LEU C  1 29  ? -4.18786  -40.57214  77.88401  1.000 34.72199  ? 9   LEU B CA  1 
ATOM   6609  C C   . LEU C  1 29  ? -5.61173  -40.39057  78.39568  1.000 40.86622  ? 9   LEU B C   1 
ATOM   6610  O O   . LEU C  1 29  ? -6.05435  -41.17154  79.24428  1.000 40.90721  ? 9   LEU B O   1 
ATOM   6611  C CB  . LEU C  1 29  ? -3.19409  -39.94613  78.86274  1.000 35.45536  ? 9   LEU B CB  1 
ATOM   6612  C CG  . LEU C  1 29  ? -1.74543  -40.44426  78.83639  1.000 40.49178  ? 9   LEU B CG  1 
ATOM   6613  C CD1 . LEU C  1 29  ? -1.04973  -40.18118  77.50495  1.000 44.81340  ? 9   LEU B CD1 1 
ATOM   6614  C CD2 . LEU C  1 29  ? -0.96444  -39.81031  79.96834  1.000 37.60228  ? 9   LEU B CD2 1 
ATOM   6615  N N   . ALA C  1 30  ? -6.33675  -39.38596  77.89274  1.000 35.93760  ? 10  ALA B N   1 
ATOM   6616  C CA  . ALA C  1 30  ? -7.69314  -39.12822  78.36600  1.000 31.54219  ? 10  ALA B CA  1 
ATOM   6617  C C   . ALA C  1 30  ? -8.60788  -40.33010  78.16678  1.000 38.45551  ? 10  ALA B C   1 
ATOM   6618  O O   . ALA C  1 30  ? -9.54130  -40.53244  78.95279  1.000 30.94644  ? 10  ALA B O   1 
ATOM   6619  C CB  . ALA C  1 30  ? -8.27050  -37.90691  77.65722  1.000 32.17228  ? 10  ALA B CB  1 
ATOM   6620  N N   . ARG C  1 31  ? -8.35932  -41.13478  77.12751  1.000 45.09488  ? 11  ARG B N   1 
ATOM   6621  C CA  . ARG C  1 31  ? -9.14525  -42.34666  76.91156  1.000 37.10200  ? 11  ARG B CA  1 
ATOM   6622  C C   . ARG C  1 31  ? -9.19170  -43.22044  78.15575  1.000 36.67738  ? 11  ARG B C   1 
ATOM   6623  O O   . ARG C  1 31  ? -10.16923 -43.94449  78.37145  1.000 41.88007  ? 11  ARG B O   1 
ATOM   6624  C CB  . ARG C  1 31  ? -8.56853  -43.16089  75.75180  1.000 33.31406  ? 11  ARG B CB  1 
ATOM   6625  C CG  . ARG C  1 31  ? -8.75093  -42.56827  74.36955  1.000 31.92406  ? 11  ARG B CG  1 
ATOM   6626  C CD  . ARG C  1 31  ? -8.40918  -43.62425  73.33413  1.000 38.44401  ? 11  ARG B CD  1 
ATOM   6627  N NE  . ARG C  1 31  ? -8.21564  -43.08479  71.99184  1.000 43.17180  ? 11  ARG B NE  1 
ATOM   6628  C CZ  . ARG C  1 31  ? -7.58685  -43.73656  71.01914  1.000 43.28081  ? 11  ARG B CZ  1 
ATOM   6629  N NH1 . ARG C  1 31  ? -7.09975  -44.94976  71.24611  1.000 47.61299  ? 11  ARG B NH1 1 
ATOM   6630  N NH2 . ARG C  1 31  ? -7.44448  -43.18292  69.82111  1.000 37.19780  ? 11  ARG B NH2 1 
ATOM   6631  N N   . ASP C  1 32  ? -8.15508  -43.15892  78.98807  1.000 31.23729  ? 12  ASP B N   1 
ATOM   6632  C CA  . ASP C  1 32  ? -8.01118  -44.04119  80.13586  1.000 38.11254  ? 12  ASP B CA  1 
ATOM   6633  C C   . ASP C  1 32  ? -8.15173  -43.31417  81.46372  1.000 30.99457  ? 12  ASP B C   1 
ATOM   6634  O O   . ASP C  1 32  ? -7.77910  -43.86711  82.50421  1.000 31.31408  ? 12  ASP B O   1 
ATOM   6635  C CB  . ASP C  1 32  ? -6.66002  -44.75038  80.07010  1.000 49.72694  ? 12  ASP B CB  1 
ATOM   6636  C CG  . ASP C  1 32  ? -6.51042  -45.57599  78.82074  1.000 55.24884  ? 12  ASP B CG  1 
ATOM   6637  O OD1 . ASP C  1 32  ? -7.29184  -46.53805  78.65894  1.000 57.36551  ? 12  ASP B OD1 1 
ATOM   6638  O OD2 . ASP C  1 32  ? -5.62835  -45.24993  77.99577  1.000 55.12143  ? 12  ASP B OD2 1 
ATOM   6639  N N   . ALA C  1 33  ? -8.66924  -42.09106  81.45671  1.000 38.39790  ? 13  ALA B N   1 
ATOM   6640  C CA  . ALA C  1 33  ? -8.83701  -41.31191  82.67059  1.000 30.28016  ? 13  ALA B CA  1 
ATOM   6641  C C   . ALA C  1 33  ? -10.30696 -41.26052  83.06448  1.000 29.30954  ? 13  ALA B C   1 
ATOM   6642  O O   . ALA C  1 33  ? -11.20367 -41.35505  82.21668  1.000 28.77916  ? 13  ALA B O   1 
ATOM   6643  C CB  . ALA C  1 33  ? -8.29074  -39.89339  82.49346  1.000 31.27100  ? 13  ALA B CB  1 
ATOM   6644  N N   . MET C  1 34  ? -10.54278 -41.14426  84.36882  1.000 29.21344  ? 14  MET B N   1 
ATOM   6645  C CA  . MET C  1 34  ? -11.86502 -40.85351  84.90656  1.000 30.18606  ? 14  MET B CA  1 
ATOM   6646  C C   . MET C  1 34  ? -11.78935 -39.55212  85.69703  1.000 36.42129  ? 14  MET B C   1 
ATOM   6647  O O   . MET C  1 34  ? -11.04864 -39.45729  86.68253  1.000 40.10516  ? 14  MET B O   1 
ATOM   6648  C CB  . MET C  1 34  ? -12.37182 -41.99503  85.78679  1.000 28.42909  ? 14  MET B CB  1 
ATOM   6649  C CG  . MET C  1 34  ? -13.73922 -41.74838  86.39781  1.000 37.19924  ? 14  MET B CG  1 
ATOM   6650  S SD  . MET C  1 34  ? -14.04399 -42.86419  87.76716  1.000 36.06018  ? 14  MET B SD  1 
ATOM   6651  C CE  . MET C  1 34  ? -15.82031 -42.78116  87.93498  1.000 27.55130  ? 14  MET B CE  1 
ATOM   6652  N N   . ALA C  1 35  ? -12.53693 -38.55131  85.26176  1.000 28.13634  ? 15  ALA B N   1 
ATOM   6653  C CA  . ALA C  1 35  ? -12.61708 -37.31209  86.01789  1.000 28.48706  ? 15  ALA B CA  1 
ATOM   6654  C C   . ALA C  1 35  ? -13.59061 -37.46471  87.17916  1.000 34.32052  ? 15  ALA B C   1 
ATOM   6655  O O   . ALA C  1 35  ? -14.66934 -38.04363  87.03374  1.000 33.70650  ? 15  ALA B O   1 
ATOM   6656  C CB  . ALA C  1 35  ? -13.05111 -36.16039  85.11795  1.000 31.78338  ? 15  ALA B CB  1 
ATOM   6657  N N   . TYR C  1 36  ? -13.20555 -36.93655  88.33873  1.000 39.08267  ? 16  TYR B N   1 
ATOM   6658  C CA  . TYR C  1 36  ? -14.01172 -37.03239  89.55271  1.000 33.95002  ? 16  TYR B CA  1 
ATOM   6659  C C   . TYR C  1 36  ? -14.13890 -35.63811  90.15804  1.000 40.29306  ? 16  TYR B C   1 
ATOM   6660  O O   . TYR C  1 36  ? -13.18070 -35.11937  90.73919  1.000 32.83195  ? 16  TYR B O   1 
ATOM   6661  C CB  . TYR C  1 36  ? -13.38491 -38.01033  90.54323  1.000 28.89565  ? 16  TYR B CB  1 
ATOM   6662  C CG  . TYR C  1 36  ? -14.34695 -38.57982  91.55455  1.000 28.90795  ? 16  TYR B CG  1 
ATOM   6663  C CD1 . TYR C  1 36  ? -14.67306 -37.87655  92.70527  1.000 34.80454  ? 16  TYR B CD1 1 
ATOM   6664  C CD2 . TYR C  1 36  ? -14.91908 -39.83457  91.36742  1.000 43.62799  ? 16  TYR B CD2 1 
ATOM   6665  C CE1 . TYR C  1 36  ? -15.54956 -38.39869  93.63687  1.000 36.31876  ? 16  TYR B CE1 1 
ATOM   6666  C CE2 . TYR C  1 36  ? -15.79710 -40.36521  92.29416  1.000 28.85222  ? 16  TYR B CE2 1 
ATOM   6667  C CZ  . TYR C  1 36  ? -16.10286 -39.64678  93.42925  1.000 29.23832  ? 16  TYR B CZ  1 
ATOM   6668  O OH  . TYR C  1 36  ? -16.97045 -40.17075  94.35658  1.000 30.25821  ? 16  TYR B OH  1 
ATOM   6669  N N   . VAL C  1 37  ? -15.32165 -35.04490  90.03247  1.000 34.63124  ? 17  VAL B N   1 
ATOM   6670  C CA  . VAL C  1 37  ? -15.56794 -33.66942  90.45336  1.000 32.14372  ? 17  VAL B CA  1 
ATOM   6671  C C   . VAL C  1 37  ? -16.12461 -33.67170  91.87165  1.000 39.24791  ? 17  VAL B C   1 
ATOM   6672  O O   . VAL C  1 37  ? -17.09102 -34.38607  92.16972  1.000 38.91898  ? 17  VAL B O   1 
ATOM   6673  C CB  . VAL C  1 37  ? -16.54023 -32.97064  89.48805  1.000 27.91055  ? 17  VAL B CB  1 
ATOM   6674  C CG1 . VAL C  1 37  ? -16.64656 -31.48947  89.82157  1.000 30.73186  ? 17  VAL B CG1 1 
ATOM   6675  C CG2 . VAL C  1 37  ? -16.10499 -33.16841  88.04260  1.000 27.64234  ? 17  VAL B CG2 1 
ATOM   6676  N N   . LEU C  1 38  ? -15.51879 -32.87391  92.74949  1.000 29.24843  ? 18  LEU B N   1 
ATOM   6677  C CA  . LEU C  1 38  ? -16.02138 -32.69683  94.10770  1.000 34.24488  ? 18  LEU B CA  1 
ATOM   6678  C C   . LEU C  1 38  ? -16.91827 -31.46349  94.13258  1.000 32.35075  ? 18  LEU B C   1 
ATOM   6679  O O   . LEU C  1 38  ? -16.43673 -30.33288  94.03193  1.000 34.51513  ? 18  LEU B O   1 
ATOM   6680  C CB  . LEU C  1 38  ? -14.87856 -32.56474  95.10772  1.000 30.49754  ? 18  LEU B CB  1 
ATOM   6681  C CG  . LEU C  1 38  ? -13.64772 -33.44140  94.91597  1.000 35.67744  ? 18  LEU B CG  1 
ATOM   6682  C CD1 . LEU C  1 38  ? -12.58815 -33.02604  95.91370  1.000 33.03004  ? 18  LEU B CD1 1 
ATOM   6683  C CD2 . LEU C  1 38  ? -13.98990 -34.92690  95.06793  1.000 30.58234  ? 18  LEU B CD2 1 
ATOM   6684  N N   . ALA C  1 39  ? -18.22330 -31.68569  94.26240  1.000 34.73959  ? 19  ALA B N   1 
ATOM   6685  C CA  . ALA C  1 39  ? -19.21637 -30.62327  94.25086  1.000 29.68845  ? 19  ALA B CA  1 
ATOM   6686  C C   . ALA C  1 39  ? -20.01896 -30.60234  95.54477  1.000 30.32842  ? 19  ALA B C   1 
ATOM   6687  O O   . ALA C  1 39  ? -21.20813 -30.27874  95.54231  1.000 38.58858  ? 19  ALA B O   1 
ATOM   6688  C CB  . ALA C  1 39  ? -20.14499 -30.76669  93.04541  1.000 29.10784  ? 19  ALA B CB  1 
ATOM   6689  N N   . GLY C  1 40  ? -19.37617 -30.93096  96.66537  1.000 30.89528  ? 20  GLY B N   1 
ATOM   6690  C CA  . GLY C  1 40  ? -20.06199 -30.95149  97.94264  1.000 31.98899  ? 20  GLY B CA  1 
ATOM   6691  C C   . GLY C  1 40  ? -19.95955 -29.69071  98.76665  1.000 42.61825  ? 20  GLY B C   1 
ATOM   6692  O O   . GLY C  1 40  ? -20.61809 -29.58961  99.80663  1.000 42.33246  ? 20  GLY B O   1 
ATOM   6693  N N   . GLY C  1 41  ? -19.16213 -28.72118  98.32165  1.000 43.44196  ? 21  GLY B N   1 
ATOM   6694  C CA  . GLY C  1 41  ? -18.88285 -27.54987  99.13703  1.000 42.49724  ? 21  GLY B CA  1 
ATOM   6695  C C   . GLY C  1 41  ? -20.04480 -26.57039  99.16653  1.000 39.95806  ? 21  GLY B C   1 
ATOM   6696  O O   . GLY C  1 41  ? -20.70360 -26.31991  98.15826  1.000 36.03844  ? 21  GLY B O   1 
ATOM   6697  N N   . ARG C  1 42  ? -20.27072 -25.99008  100.34911 1.000 43.80712  ? 22  ARG B N   1 
ATOM   6698  C CA  . ARG C  1 42  ? -21.40213 -25.08973  100.54589 1.000 39.40532  ? 22  ARG B CA  1 
ATOM   6699  C C   . ARG C  1 42  ? -21.16076 -23.71938  99.92635  1.000 51.81175  ? 22  ARG B C   1 
ATOM   6700  O O   . ARG C  1 42  ? -22.08326 -23.12685  99.35750  1.000 69.17416  ? 22  ARG B O   1 
ATOM   6701  C CB  . ARG C  1 42  ? -21.70517 -24.93901  102.03819 1.000 35.97559  ? 22  ARG B CB  1 
ATOM   6702  N N   . GLY C  1 43  ? -19.94185 -23.19579  100.02609 1.000 44.32599  ? 23  GLY B N   1 
ATOM   6703  C CA  . GLY C  1 43  ? -19.70157 -21.81511  99.64932  1.000 38.46567  ? 23  GLY B CA  1 
ATOM   6704  C C   . GLY C  1 43  ? -20.34584 -20.87094  100.64391 1.000 42.96622  ? 23  GLY B C   1 
ATOM   6705  O O   . GLY C  1 43  ? -21.32427 -20.18567  100.32762 1.000 40.53653  ? 23  GLY B O   1 
ATOM   6706  N N   . SER C  1 44  ? -19.79762 -20.84022  101.86208 1.000 47.87042  ? 24  SER B N   1 
ATOM   6707  C CA  . SER C  1 44  ? -20.42863 -20.13621  102.97335 1.000 45.90989  ? 24  SER B CA  1 
ATOM   6708  C C   . SER C  1 44  ? -20.28191 -18.62490  102.87115 1.000 40.22757  ? 24  SER B C   1 
ATOM   6709  O O   . SER C  1 44  ? -21.16290 -17.89072  103.33165 1.000 42.85083  ? 24  SER B O   1 
ATOM   6710  C CB  . SER C  1 44  ? -19.84171 -20.61885  104.30004 1.000 43.55836  ? 24  SER B CB  1 
ATOM   6711  O OG  . SER C  1 44  ? -20.18824 -21.96848  104.54600 1.000 58.27262  ? 24  SER B OG  1 
ATOM   6712  N N   . ARG C  1 45  ? -19.19060 -18.13863  102.28890 1.000 44.81614  ? 25  ARG B N   1 
ATOM   6713  C CA  . ARG C  1 45  ? -18.98987 -16.69957  102.18289 1.000 43.49408  ? 25  ARG B CA  1 
ATOM   6714  C C   . ARG C  1 45  ? -19.84081 -16.06493  101.09240 1.000 46.06819  ? 25  ARG B C   1 
ATOM   6715  O O   . ARG C  1 45  ? -19.78287 -14.84209  100.91551 1.000 55.65433  ? 25  ARG B O   1 
ATOM   6716  C CB  . ARG C  1 45  ? -17.50941 -16.39444  101.94962 1.000 49.75675  ? 25  ARG B CB  1 
ATOM   6717  C CG  . ARG C  1 45  ? -16.60589 -16.88169  103.07751 1.000 58.50062  ? 25  ARG B CG  1 
ATOM   6718  C CD  . ARG C  1 45  ? -15.14049 -16.65041  102.75084 1.000 62.65785  ? 25  ARG B CD  1 
ATOM   6719  N NE  . ARG C  1 45  ? -14.85421 -16.94109  101.34852 1.000 59.49850  ? 25  ARG B NE  1 
ATOM   6720  C CZ  . ARG C  1 45  ? -13.78669 -16.49373  100.69490 1.000 55.99881  ? 25  ARG B CZ  1 
ATOM   6721  N NH1 . ARG C  1 45  ? -12.89894 -15.73112  101.31753 1.000 60.04503  ? 25  ARG B NH1 1 
ATOM   6722  N NH2 . ARG C  1 45  ? -13.61106 -16.80101  99.41590  1.000 50.00720  ? 25  ARG B NH2 1 
ATOM   6723  N N   . LEU C  1 46  ? -20.62341 -16.85534  100.36257 1.000 41.95552  ? 26  LEU B N   1 
ATOM   6724  C CA  . LEU C  1 46  ? -21.61043 -16.31827  99.43808  1.000 44.84829  ? 26  LEU B CA  1 
ATOM   6725  C C   . LEU C  1 46  ? -22.96763 -16.11181  100.09526 1.000 43.03367  ? 26  LEU B C   1 
ATOM   6726  O O   . LEU C  1 46  ? -23.89212 -15.61873  99.43880  1.000 38.46310  ? 26  LEU B O   1 
ATOM   6727  C CB  . LEU C  1 46  ? -21.73943 -17.23178  98.21870  1.000 40.29987  ? 26  LEU B CB  1 
ATOM   6728  C CG  . LEU C  1 46  ? -20.45376 -17.28421  97.39426  1.000 37.13934  ? 26  LEU B CG  1 
ATOM   6729  C CD1 . LEU C  1 46  ? -20.40474 -18.53750  96.53177  1.000 36.19530  ? 26  LEU B CD1 1 
ATOM   6730  C CD2 . LEU C  1 46  ? -20.31761 -16.03014  96.54453  1.000 35.92206  ? 26  LEU B CD2 1 
ATOM   6731  N N   . LYS C  1 47  ? -23.10121 -16.48946  101.36464 1.000 39.05350  ? 27  LYS B N   1 
ATOM   6732  C CA  . LYS C  1 47  ? -24.21881 -16.09624  102.23318 1.000 40.22096  ? 27  LYS B CA  1 
ATOM   6733  C C   . LYS C  1 47  ? -25.51898 -16.65582  101.65720 1.000 45.07645  ? 27  LYS B C   1 
ATOM   6734  O O   . LYS C  1 47  ? -25.54733 -17.83573  101.27564 1.000 39.15435  ? 27  LYS B O   1 
ATOM   6735  C CB  . LYS C  1 47  ? -24.16216 -14.58249  102.42393 1.000 51.01042  ? 27  LYS B CB  1 
ATOM   6736  C CG  . LYS C  1 47  ? -22.87198 -14.10149  103.08840 1.000 47.22365  ? 27  LYS B CG  1 
ATOM   6737  C CD  . LYS C  1 47  ? -22.58855 -14.88169  104.37012 1.000 51.76548  ? 27  LYS B CD  1 
ATOM   6738  C CE  . LYS C  1 47  ? -21.74151 -14.07899  105.34443 1.000 55.58281  ? 27  LYS B CE  1 
ATOM   6739  N NZ  . LYS C  1 47  ? -20.57138 -13.45606  104.66481 1.000 56.22903  ? 27  LYS B NZ  1 
ATOM   6740  N N   . GLU C  1 48  ? -26.59895 -15.87328  101.57867 1.000 43.19286  ? 28  GLU B N   1 
ATOM   6741  C CA  . GLU C  1 48  ? -27.90219 -16.40712  101.18372 1.000 45.69609  ? 28  GLU B CA  1 
ATOM   6742  C C   . GLU C  1 48  ? -27.93348 -16.86102  99.73682  1.000 42.38993  ? 28  GLU B C   1 
ATOM   6743  O O   . GLU C  1 48  ? -28.85851 -17.58734  99.34508  1.000 39.52509  ? 28  GLU B O   1 
ATOM   6744  C CB  . GLU C  1 48  ? -29.01093 -15.38131  101.41411 1.000 45.46510  ? 28  GLU B CB  1 
ATOM   6745  C CG  . GLU C  1 48  ? -29.04938 -14.78533  102.80677 1.000 43.63210  ? 28  GLU B CG  1 
ATOM   6746  C CD  . GLU C  1 48  ? -28.00007 -13.72054  103.04162 1.000 43.81596  ? 28  GLU B CD  1 
ATOM   6747  O OE1 . GLU C  1 48  ? -27.24378 -13.40342  102.09730 1.000 42.88179  ? 28  GLU B OE1 1 
ATOM   6748  O OE2 . GLU C  1 48  ? -27.90962 -13.23026  104.18635 1.000 44.97222  ? 28  GLU B OE2 1 
ATOM   6749  N N   . LEU C  1 49  ? -26.94182 -16.46218  98.93503  1.000 38.87336  ? 29  LEU B N   1 
ATOM   6750  C CA  . LEU C  1 49  ? -26.83004 -16.96916  97.57544  1.000 37.74660  ? 29  LEU B CA  1 
ATOM   6751  C C   . LEU C  1 49  ? -26.69554 -18.48864  97.55516  1.000 44.98448  ? 29  LEU B C   1 
ATOM   6752  O O   . LEU C  1 49  ? -27.09860 -19.13544  96.57919  1.000 37.92631  ? 29  LEU B O   1 
ATOM   6753  C CB  . LEU C  1 49  ? -25.64020 -16.30799  96.88031  1.000 37.83281  ? 29  LEU B CB  1 
ATOM   6754  C CG  . LEU C  1 49  ? -25.55447 -16.42615  95.35888  1.000 42.04826  ? 29  LEU B CG  1 
ATOM   6755  C CD1 . LEU C  1 49  ? -26.80451 -15.85916  94.69870  1.000 36.90219  ? 29  LEU B CD1 1 
ATOM   6756  C CD2 . LEU C  1 49  ? -24.30112 -15.74054  94.83241  1.000 36.11031  ? 29  LEU B CD2 1 
ATOM   6757  N N   . THR C  1 50  ? -26.15718 -19.08278  98.62179  1.000 44.26593  ? 30  THR B N   1 
ATOM   6758  C CA  . THR C  1 50  ? -26.00631 -20.53139  98.69771  1.000 38.92398  ? 30  THR B CA  1 
ATOM   6759  C C   . THR C  1 50  ? -26.85984 -21.15016  99.80101  1.000 45.98037  ? 30  THR B C   1 
ATOM   6760  O O   . THR C  1 50  ? -26.61780 -22.29677  100.19320 1.000 50.04276  ? 30  THR B O   1 
ATOM   6761  C CB  . THR C  1 50  ? -24.53776 -20.91891  98.89277  1.000 41.47426  ? 30  THR B CB  1 
ATOM   6762  O OG1 . THR C  1 50  ? -24.01797 -20.28342  100.06783 1.000 46.21761  ? 30  THR B OG1 1 
ATOM   6763  C CG2 . THR C  1 50  ? -23.70876 -20.51285  97.68473  1.000 35.01471  ? 30  THR B CG2 1 
ATOM   6764  N N   . ASP C  1 51  ? -27.86836 -20.42907  100.29786 1.000 38.31916  ? 31  ASP B N   1 
ATOM   6765  C CA  . ASP C  1 51  ? -28.69894 -20.97604  101.36613 1.000 39.31006  ? 31  ASP B CA  1 
ATOM   6766  C C   . ASP C  1 51  ? -29.57516 -22.11975  100.87607 1.000 51.63217  ? 31  ASP B C   1 
ATOM   6767  O O   . ASP C  1 51  ? -29.93943 -22.99936  101.66511 1.000 60.55849  ? 31  ASP B O   1 
ATOM   6768  C CB  . ASP C  1 51  ? -29.57078 -19.88125  101.97418 1.000 50.14043  ? 31  ASP B CB  1 
ATOM   6769  C CG  . ASP C  1 51  ? -28.84889 -19.08810  103.03807 1.000 54.84067  ? 31  ASP B CG  1 
ATOM   6770  O OD1 . ASP C  1 51  ? -27.72452 -19.48374  103.41420 1.000 61.91488  ? 31  ASP B OD1 1 
ATOM   6771  O OD2 . ASP C  1 51  ? -29.40458 -18.06766  103.49373 1.000 52.46059  ? 31  ASP B OD2 1 
ATOM   6772  N N   . ARG C  1 52  ? -29.92857 -22.12648  99.59057  1.000 45.24450  ? 32  ARG B N   1 
ATOM   6773  C CA  . ARG C  1 52  ? -30.79291 -23.15920  99.03147  1.000 47.26977  ? 32  ARG B CA  1 
ATOM   6774  C C   . ARG C  1 52  ? -30.09485 -24.00304  97.97106  1.000 40.67904  ? 32  ARG B C   1 
ATOM   6775  O O   . ARG C  1 52  ? -30.75527 -24.81410  97.31318  1.000 44.30208  ? 32  ARG B O   1 
ATOM   6776  C CB  . ARG C  1 52  ? -32.06224 -22.52650  98.44638  1.000 43.09625  ? 32  ARG B CB  1 
ATOM   6777  C CG  . ARG C  1 52  ? -32.97625 -21.88615  99.49176  1.000 56.21520  ? 32  ARG B CG  1 
ATOM   6778  C CD  . ARG C  1 52  ? -34.03067 -20.96716  98.86512  1.000 57.90032  ? 32  ARG B CD  1 
ATOM   6779  N NE  . ARG C  1 52  ? -34.13173 -21.13723  97.41679  1.000 60.84012  ? 32  ARG B NE  1 
ATOM   6780  C CZ  . ARG C  1 52  ? -35.04319 -20.54153  96.65387  1.000 57.77243  ? 32  ARG B CZ  1 
ATOM   6781  N NH1 . ARG C  1 52  ? -35.94505 -19.73732  97.19926  1.000 59.71519  ? 32  ARG B NH1 1 
ATOM   6782  N NH2 . ARG C  1 52  ? -35.05918 -20.75501  95.34564  1.000 59.34580  ? 32  ARG B NH2 1 
ATOM   6783  N N   . ARG C  1 53  ? -28.78481 -23.84119  97.78620  1.000 40.96415  ? 33  ARG B N   1 
ATOM   6784  C CA  . ARG C  1 53  ? -28.07136 -24.58222  96.75394  1.000 40.74184  ? 33  ARG B CA  1 
ATOM   6785  C C   . ARG C  1 53  ? -26.57480 -24.52421  97.03255  1.000 43.30097  ? 33  ARG B C   1 
ATOM   6786  O O   . ARG C  1 53  ? -26.06446 -23.53140  97.56233  1.000 36.95624  ? 33  ARG B O   1 
ATOM   6787  C CB  . ARG C  1 53  ? -28.37186 -24.02669  95.35342  1.000 39.22282  ? 33  ARG B CB  1 
ATOM   6788  C CG  . ARG C  1 53  ? -27.70486 -22.68554  95.06885  1.000 45.79124  ? 33  ARG B CG  1 
ATOM   6789  C CD  . ARG C  1 53  ? -28.08911 -22.11536  93.71132  1.000 43.73963  ? 33  ARG B CD  1 
ATOM   6790  N NE  . ARG C  1 53  ? -29.37507 -21.42702  93.73673  1.000 53.13411  ? 33  ARG B NE  1 
ATOM   6791  C CZ  . ARG C  1 53  ? -29.53259 -20.13910  94.03313  1.000 52.39842  ? 33  ARG B CZ  1 
ATOM   6792  N NH1 . ARG C  1 53  ? -28.48535 -19.38168  94.33946  1.000 51.27755  ? 33  ARG B NH1 1 
ATOM   6793  N NH2 . ARG C  1 53  ? -30.74680 -19.61286  94.02114  1.000 52.85707  ? 33  ARG B NH2 1 
ATOM   6794  N N   . ALA C  1 54  ? -25.88257 -25.60351  96.67011  1.000 33.21848  ? 34  ALA B N   1 
ATOM   6795  C CA  . ALA C  1 54  ? -24.43101 -25.63979  96.75947  1.000 32.80706  ? 34  ALA B CA  1 
ATOM   6796  C C   . ALA C  1 54  ? -23.80021 -24.67632  95.75716  1.000 32.40368  ? 34  ALA B C   1 
ATOM   6797  O O   . ALA C  1 54  ? -24.37032 -24.36676  94.70599  1.000 32.12678  ? 34  ALA B O   1 
ATOM   6798  C CB  . ALA C  1 54  ? -23.91420 -27.06372  96.51430  1.000 37.09779  ? 34  ALA B CB  1 
ATOM   6799  N N   . LYS C  1 55  ? -22.60531 -24.20187  96.09754  1.000 32.49005  ? 35  LYS B N   1 
ATOM   6800  C CA  . LYS C  1 55  ? -21.86158 -23.32225  95.20052  1.000 32.22713  ? 35  LYS B CA  1 
ATOM   6801  C C   . LYS C  1 55  ? -21.67405 -23.87757  93.79095  1.000 38.33398  ? 35  LYS B C   1 
ATOM   6802  O O   . LYS C  1 55  ? -21.83996 -23.10287  92.83275  1.000 31.29376  ? 35  LYS B O   1 
ATOM   6803  C CB  . LYS C  1 55  ? -20.50077 -22.98612  95.82595  1.000 32.50516  ? 35  LYS B CB  1 
ATOM   6804  C CG  . LYS C  1 55  ? -19.65887 -22.03136  94.98886  1.000 37.44771  ? 35  LYS B CG  1 
ATOM   6805  C CD  . LYS C  1 55  ? -18.40552 -21.60705  95.73122  1.000 32.92306  ? 35  LYS B CD  1 
ATOM   6806  C CE  . LYS C  1 55  ? -17.39178 -21.00010  94.78735  1.000 32.79931  ? 35  LYS B CE  1 
ATOM   6807  N NZ  . LYS C  1 55  ? -16.02472 -21.06974  95.35856  1.000 33.17699  ? 35  LYS B NZ  1 
ATOM   6808  N N   . PRO C  1 56  ? -21.33609 -25.15808  93.57713  1.000 36.28155  ? 36  PRO B N   1 
ATOM   6809  C CA  . PRO C  1 56  ? -21.18420 -25.63775  92.19315  1.000 30.10056  ? 36  PRO B CA  1 
ATOM   6810  C C   . PRO C  1 56  ? -22.45464 -25.52573  91.37278  1.000 29.98822  ? 36  PRO B C   1 
ATOM   6811  O O   . PRO C  1 56  ? -22.38347 -25.57301  90.13910  1.000 36.05725  ? 36  PRO B O   1 
ATOM   6812  C CB  . PRO C  1 56  ? -20.75281 -27.10350  92.36935  1.000 33.46123  ? 36  PRO B CB  1 
ATOM   6813  C CG  . PRO C  1 56  ? -20.14259 -27.14778  93.73274  1.000 31.68228  ? 36  PRO B CG  1 
ATOM   6814  C CD  . PRO C  1 56  ? -20.97319 -26.20594  94.54854  1.000 30.88442  ? 36  PRO B CD  1 
ATOM   6815  N N   . ALA C  1 57  ? -23.60989 -25.36176  92.01033  1.000 38.35679  ? 37  ALA B N   1 
ATOM   6816  C CA  . ALA C  1 57  ? -24.86869 -25.22492  91.29447  1.000 37.20934  ? 37  ALA B CA  1 
ATOM   6817  C C   . ALA C  1 57  ? -25.26597 -23.77670  91.06407  1.000 32.77354  ? 37  ALA B C   1 
ATOM   6818  O O   . ALA C  1 57  ? -26.27391 -23.52650  90.39584  1.000 37.33893  ? 37  ALA B O   1 
ATOM   6819  C CB  . ALA C  1 57  ? -25.99052 -25.94620  92.05056  1.000 30.91232  ? 37  ALA B CB  1 
ATOM   6820  N N   . VAL C  1 58  ? -24.50439 -22.82035  91.59083  1.000 43.52624  ? 38  VAL B N   1 
ATOM   6821  C CA  . VAL C  1 58  ? -24.86948 -21.41740  91.44836  1.000 32.12993  ? 38  VAL B CA  1 
ATOM   6822  C C   . VAL C  1 58  ? -24.66342 -20.97702  90.00382  1.000 31.85121  ? 38  VAL B C   1 
ATOM   6823  O O   . VAL C  1 58  ? -23.67137 -21.33920  89.35893  1.000 31.28909  ? 38  VAL B O   1 
ATOM   6824  C CB  . VAL C  1 58  ? -24.05160 -20.55833  92.43036  1.000 34.44390  ? 38  VAL B CB  1 
ATOM   6825  C CG1 . VAL C  1 58  ? -23.98332 -19.10570  91.96297  1.000 33.15246  ? 38  VAL B CG1 1 
ATOM   6826  C CG2 . VAL C  1 58  ? -24.63891 -20.64838  93.83188  1.000 33.29677  ? 38  VAL B CG2 1 
ATOM   6827  N N   . TYR C  1 59  ? -25.60661 -20.19115  89.48637  1.000 32.37519  ? 39  TYR B N   1 
ATOM   6828  C CA  . TYR C  1 59  ? -25.52957 -19.72529  88.10934  1.000 35.63112  ? 39  TYR B CA  1 
ATOM   6829  C C   . TYR C  1 59  ? -24.30988 -18.83052  87.90434  1.000 39.01482  ? 39  TYR B C   1 
ATOM   6830  O O   . TYR C  1 59  ? -23.78706 -18.22299  88.84232  1.000 32.75908  ? 39  TYR B O   1 
ATOM   6831  C CB  . TYR C  1 59  ? -26.80350 -18.97387  87.72601  1.000 33.06478  ? 39  TYR B CB  1 
ATOM   6832  C CG  . TYR C  1 59  ? -28.01247 -19.86534  87.70006  1.000 40.74600  ? 39  TYR B CG  1 
ATOM   6833  C CD1 . TYR C  1 59  ? -28.36834 -20.56025  86.54705  1.000 40.04831  ? 39  TYR B CD1 1 
ATOM   6834  C CD2 . TYR C  1 59  ? -28.78828 -20.03226  88.83572  1.000 43.47964  ? 39  TYR B CD2 1 
ATOM   6835  C CE1 . TYR C  1 59  ? -29.47129 -21.38750  86.53067  1.000 34.93083  ? 39  TYR B CE1 1 
ATOM   6836  C CE2 . TYR C  1 59  ? -29.88617 -20.85284  88.83112  1.000 38.05180  ? 39  TYR B CE2 1 
ATOM   6837  C CZ  . TYR C  1 59  ? -30.22660 -21.52907  87.68264  1.000 46.27693  ? 39  TYR B CZ  1 
ATOM   6838  O OH  . TYR C  1 59  ? -31.33515 -22.34690  87.71008  1.000 58.72956  ? 39  TYR B OH  1 
ATOM   6839  N N   . PHE C  1 60  ? -23.84273 -18.77642  86.65618  1.000 32.15754  ? 40  PHE B N   1 
ATOM   6840  C CA  . PHE C  1 60  ? -22.71691 -17.92975  86.30162  1.000 41.30666  ? 40  PHE B CA  1 
ATOM   6841  C C   . PHE C  1 60  ? -22.77379 -17.57125  84.82697  1.000 46.01537  ? 40  PHE B C   1 
ATOM   6842  O O   . PHE C  1 60  ? -23.04140 -18.42903  83.97754  1.000 39.53598  ? 40  PHE B O   1 
ATOM   6843  C CB  . PHE C  1 60  ? -21.35775 -18.57763  86.58721  1.000 44.74297  ? 40  PHE B CB  1 
ATOM   6844  C CG  . PHE C  1 60  ? -20.19735 -17.75883  86.07065  1.000 46.52856  ? 40  PHE B CG  1 
ATOM   6845  C CD1 . PHE C  1 60  ? -19.74145 -16.65821  86.78027  1.000 39.67967  ? 40  PHE B CD1 1 
ATOM   6846  C CD2 . PHE C  1 60  ? -19.59402 -18.06085  84.85903  1.000 50.92533  ? 40  PHE B CD2 1 
ATOM   6847  C CE1 . PHE C  1 60  ? -18.68695 -15.89317  86.30544  1.000 38.59535  ? 40  PHE B CE1 1 
ATOM   6848  C CE2 . PHE C  1 60  ? -18.54312 -17.29330  84.37812  1.000 52.13394  ? 40  PHE B CE2 1 
ATOM   6849  C CZ  . PHE C  1 60  ? -18.09030 -16.21048  85.10290  1.000 39.18814  ? 40  PHE B CZ  1 
ATOM   6850  N N   . GLY C  1 61  ? -22.50575 -16.29650  84.54373  1.000 33.25031  ? 41  GLY B N   1 
ATOM   6851  C CA  . GLY C  1 61  ? -22.16015 -15.82891  83.22107  1.000 33.55135  ? 41  GLY B CA  1 
ATOM   6852  C C   . GLY C  1 61  ? -23.28757 -15.73978  82.22383  1.000 35.13919  ? 41  GLY B C   1 
ATOM   6853  O O   . GLY C  1 61  ? -23.02002 -15.50846  81.04044  1.000 43.73714  ? 41  GLY B O   1 
ATOM   6854  N N   A GLY C  1 62  ? -24.53842 -15.89788  82.64914  0.545 33.98182  ? 42  GLY B N   1 
ATOM   6855  N N   B GLY C  1 62  ? -24.53217 -15.92069  82.65251  0.455 33.96542  ? 42  GLY B N   1 
ATOM   6856  C CA  A GLY C  1 62  ? -25.58923 -16.16546  81.68663  0.545 34.92118  ? 42  GLY B CA  1 
ATOM   6857  C CA  B GLY C  1 62  ? -25.67901 -15.73439  81.78832  0.455 34.47873  ? 42  GLY B CA  1 
ATOM   6858  C C   A GLY C  1 62  ? -25.27629 -17.33382  80.77624  0.545 36.39520  ? 42  GLY B C   1 
ATOM   6859  C C   B GLY C  1 62  ? -26.43157 -16.99872  81.43881  0.455 33.94018  ? 42  GLY B C   1 
ATOM   6860  O O   A GLY C  1 62  ? -25.87455 -17.45917  79.70526  0.545 37.36920  ? 42  GLY B O   1 
ATOM   6861  O O   B GLY C  1 62  ? -27.53164 -16.90447  80.87964  0.455 34.45965  ? 42  GLY B O   1 
ATOM   6862  N N   A LYS C  1 63  ? -24.36815 -18.21333  81.20120  0.545 32.67091  ? 43  LYS B N   1 
ATOM   6863  N N   B LYS C  1 63  ? -25.88821 -18.17661  81.73881  0.455 33.01656  ? 43  LYS B N   1 
ATOM   6864  C CA  A LYS C  1 63  ? -23.69412 -19.18366  80.34907  0.545 34.40142  ? 43  LYS B CA  1 
ATOM   6865  C CA  B LYS C  1 63  ? -26.59957 -19.40605  81.41384  0.455 36.42821  ? 43  LYS B CA  1 
ATOM   6866  C C   A LYS C  1 63  ? -23.90333 -20.61181  80.82162  0.545 35.80705  ? 43  LYS B C   1 
ATOM   6867  C C   B LYS C  1 63  ? -26.14692 -20.57441  82.27580  0.455 32.40376  ? 43  LYS B C   1 
ATOM   6868  O O   A LYS C  1 63  ? -24.19318 -21.50091  80.00893  0.545 36.26653  ? 43  LYS B O   1 
ATOM   6869  O O   B LYS C  1 63  ? -26.93224 -21.11032  83.06372  0.455 36.44546  ? 43  LYS B O   1 
ATOM   6870  C CB  A LYS C  1 63  ? -22.19412 -18.84443  80.31963  0.545 32.86503  ? 43  LYS B CB  1 
ATOM   6871  C CB  B LYS C  1 63  ? -26.41908 -19.74981  79.93671  0.455 32.49178  ? 43  LYS B CB  1 
ATOM   6872  C CG  A LYS C  1 63  ? -21.35141 -19.69496  79.40239  0.545 31.75756  ? 43  LYS B CG  1 
ATOM   6873  C CG  B LYS C  1 63  ? -27.41115 -20.77535  79.42878  0.455 41.45070  ? 43  LYS B CG  1 
ATOM   6874  C CD  A LYS C  1 63  ? -21.60690 -19.31663  77.96625  0.545 32.33299  ? 43  LYS B CD  1 
ATOM   6875  C CD  B LYS C  1 63  ? -26.87134 -21.49076  78.20553  0.455 42.06721  ? 43  LYS B CD  1 
ATOM   6876  C CE  A LYS C  1 63  ? -20.56012 -19.91700  77.05136  0.545 32.25216  ? 43  LYS B CE  1 
ATOM   6877  C CE  B LYS C  1 63  ? -26.33502 -20.49415  77.19946  0.455 38.05082  ? 43  LYS B CE  1 
ATOM   6878  N NZ  A LYS C  1 63  ? -20.88931 -19.67178  75.61969  0.545 32.88325  ? 43  LYS B NZ  1 
ATOM   6879  N NZ  B LYS C  1 63  ? -27.38822 -19.51997  76.79389  0.455 33.64662  ? 43  LYS B NZ  1 
ATOM   6880  N N   A ALA C  1 64  ? -23.77061 -20.84857  82.11886  0.545 36.23030  ? 44  ALA B N   1 
ATOM   6881  N N   B ALA C  1 64  ? -24.88485 -20.97120  82.13166  0.455 34.42056  ? 44  ALA B N   1 
ATOM   6882  C CA  A ALA C  1 64  ? -23.91975 -22.16874  82.71738  0.545 30.32943  ? 44  ALA B CA  1 
ATOM   6883  C CA  B ALA C  1 64  ? -24.38086 -22.17982  82.76527  0.455 30.41040  ? 44  ALA B CA  1 
ATOM   6884  C C   A ALA C  1 64  ? -24.03281 -21.98628  84.22624  0.545 30.42005  ? 44  ALA B C   1 
ATOM   6885  C C   B ALA C  1 64  ? -24.34479 -22.02568  84.28526  0.455 30.46599  ? 44  ALA B C   1 
ATOM   6886  O O   A ALA C  1 64  ? -24.25223 -20.87580  84.72525  0.545 34.47225  ? 44  ALA B O   1 
ATOM   6887  O O   B ALA C  1 64  ? -24.71066 -20.99274  84.85407  0.455 31.07222  ? 44  ALA B O   1 
ATOM   6888  C CB  A ALA C  1 64  ? -22.74519 -23.07578  82.34795  0.545 29.75303  ? 44  ALA B CB  1 
ATOM   6889  C CB  B ALA C  1 64  ? -22.99196 -22.51832  82.22955  0.455 31.91096  ? 44  ALA B CB  1 
ATOM   6890  N N   . ARG C  1 65  ? -23.90578 -23.08638  84.95012  1.000 33.42148  ? 45  ARG B N   1 
ATOM   6891  C CA  . ARG C  1 65  ? -23.64847 -23.05937  86.37476  1.000 35.22235  ? 45  ARG B CA  1 
ATOM   6892  C C   . ARG C  1 65  ? -22.16530 -23.33719  86.56372  1.000 34.73954  ? 45  ARG B C   1 
ATOM   6893  O O   . ARG C  1 65  ? -21.49126 -23.83158  85.65419  1.000 29.34486  ? 45  ARG B O   1 
ATOM   6894  C CB  . ARG C  1 65  ? -24.51409 -24.08018  87.12084  1.000 29.85378  ? 45  ARG B CB  1 
ATOM   6895  C CG  . ARG C  1 65  ? -26.01385 -23.90648  86.88863  1.000 30.28880  ? 45  ARG B CG  1 
ATOM   6896  C CD  . ARG C  1 65  ? -26.82522 -24.93094  87.67858  1.000 30.27780  ? 45  ARG B CD  1 
ATOM   6897  N NE  . ARG C  1 65  ? -28.26733 -24.79649  87.47851  1.000 30.84640  ? 45  ARG B NE  1 
ATOM   6898  C CZ  . ARG C  1 65  ? -29.14526 -24.65189  88.46645  1.000 36.64098  ? 45  ARG B CZ  1 
ATOM   6899  N NH1 . ARG C  1 65  ? -28.72643 -24.58188  89.72265  1.000 31.69261  ? 45  ARG B NH1 1 
ATOM   6900  N NH2 . ARG C  1 65  ? -30.43928 -24.55092  88.19789  1.000 47.76695  ? 45  ARG B NH2 1 
ATOM   6901  N N   . ILE C  1 66  ? -21.65137 -22.99510  87.74519  1.000 32.57433  ? 46  ILE B N   1 
ATOM   6902  C CA  . ILE C  1 66  ? -20.20595 -23.03397  87.93873  1.000 38.31000  ? 46  ILE B CA  1 
ATOM   6903  C C   . ILE C  1 66  ? -19.66565 -24.43821  87.68081  1.000 29.30776  ? 46  ILE B C   1 
ATOM   6904  O O   . ILE C  1 66  ? -18.60802 -24.60421  87.06256  1.000 34.52943  ? 46  ILE B O   1 
ATOM   6905  C CB  . ILE C  1 66  ? -19.83711 -22.51750  89.34134  1.000 37.84803  ? 46  ILE B CB  1 
ATOM   6906  C CG1 . ILE C  1 66  ? -20.03009 -21.00237  89.41111  1.000 41.01445  ? 46  ILE B CG1 1 
ATOM   6907  C CG2 . ILE C  1 66  ? -18.40055 -22.85662  89.67414  1.000 39.74075  ? 46  ILE B CG2 1 
ATOM   6908  C CD1 . ILE C  1 66  ? -20.28457 -20.48750  90.80624  1.000 37.40612  ? 46  ILE B CD1 1 
ATOM   6909  N N   . ILE C  1 67  ? -20.40000 -25.47170  88.10020  1.000 29.00293  ? 47  ILE B N   1 
ATOM   6910  C CA  . ILE C  1 67  ? -19.87663 -26.82948  87.95966  1.000 28.53242  ? 47  ILE B CA  1 
ATOM   6911  C C   . ILE C  1 67  ? -19.65515 -27.19330  86.49725  1.000 28.20202  ? 47  ILE B C   1 
ATOM   6912  O O   . ILE C  1 67  ? -18.78146 -28.01140  86.18316  1.000 36.95288  ? 47  ILE B O   1 
ATOM   6913  C CB  . ILE C  1 67  ? -20.79760 -27.85418  88.65124  1.000 28.36882  ? 47  ILE B CB  1 
ATOM   6914  C CG1 . ILE C  1 67  ? -20.04106 -29.17121  88.87128  1.000 35.17454  ? 47  ILE B CG1 1 
ATOM   6915  C CG2 . ILE C  1 67  ? -22.07392 -28.08868  87.83973  1.000 28.19927  ? 47  ILE B CG2 1 
ATOM   6916  C CD1 . ILE C  1 67  ? -20.90575 -30.30334  89.40660  1.000 27.93955  ? 47  ILE B CD1 1 
ATOM   6917  N N   . ASP C  1 68  ? -20.41751 -26.59069  85.58131  1.000 28.28184  ? 48  ASP B N   1 
ATOM   6918  C CA  . ASP C  1 68  ? -20.34742 -27.00375  84.18616  1.000 28.06506  ? 48  ASP B CA  1 
ATOM   6919  C C   . ASP C  1 68  ? -18.97947 -26.75461  83.56567  1.000 39.09736  ? 48  ASP B C   1 
ATOM   6920  O O   . ASP C  1 68  ? -18.62501 -27.43198  82.59575  1.000 40.31575  ? 48  ASP B O   1 
ATOM   6921  C CB  . ASP C  1 68  ? -21.42901 -26.30153  83.36918  1.000 28.30626  ? 48  ASP B CB  1 
ATOM   6922  C CG  . ASP C  1 68  ? -22.83365 -26.69334  83.79989  1.000 28.26955  ? 48  ASP B CG  1 
ATOM   6923  O OD1 . ASP C  1 68  ? -23.67220 -25.78189  83.99177  1.000 28.72225  ? 48  ASP B OD1 1 
ATOM   6924  O OD2 . ASP C  1 68  ? -23.09480 -27.91825  83.94899  1.000 27.88612  ? 48  ASP B OD2 1 
ATOM   6925  N N   . PHE C  1 69  ? -18.19719 -25.81642  84.10499  1.000 35.51086  ? 49  PHE B N   1 
ATOM   6926  C CA  . PHE C  1 69  ? -16.88985 -25.53137  83.52290  1.000 28.95545  ? 49  PHE B CA  1 
ATOM   6927  C C   . PHE C  1 69  ? -15.94502 -26.71259  83.69006  1.000 28.76103  ? 49  PHE B C   1 
ATOM   6928  O O   . PHE C  1 69  ? -15.35415 -27.18929  82.71417  1.000 28.80949  ? 49  PHE B O   1 
ATOM   6929  C CB  . PHE C  1 69  ? -16.29652 -24.27075  84.15014  1.000 29.53365  ? 49  PHE B CB  1 
ATOM   6930  C CG  . PHE C  1 69  ? -16.94356 -23.00939  83.66923  1.000 29.92386  ? 49  PHE B CG  1 
ATOM   6931  C CD1 . PHE C  1 69  ? -18.12777 -22.56758  84.23346  1.000 29.92146  ? 49  PHE B CD1 1 
ATOM   6932  C CD2 . PHE C  1 69  ? -16.39035 -22.28862  82.63054  1.000 30.41332  ? 49  PHE B CD2 1 
ATOM   6933  C CE1 . PHE C  1 69  ? -18.73735 -21.42019  83.78172  1.000 30.38954  ? 49  PHE B CE1 1 
ATOM   6934  C CE2 . PHE C  1 69  ? -16.99245 -21.13777  82.17393  1.000 41.68856  ? 49  PHE B CE2 1 
ATOM   6935  C CZ  . PHE C  1 69  ? -18.16820 -20.70159  82.75110  1.000 42.33955  ? 49  PHE B CZ  1 
ATOM   6936  N N   . ALA C  1 70  ? -15.78094 -27.18796  84.92497  1.000 28.66184  ? 50  ALA B N   1 
ATOM   6937  C CA  . ALA C  1 70  ? -14.92727 -28.34277  85.15764  1.000 28.57989  ? 50  ALA B CA  1 
ATOM   6938  C C   . ALA C  1 70  ? -15.42341 -29.55069  84.37218  1.000 33.70257  ? 50  ALA B C   1 
ATOM   6939  O O   . ALA C  1 70  ? -14.63086 -30.23776  83.72006  1.000 28.17253  ? 50  ALA B O   1 
ATOM   6940  C CB  . ALA C  1 70  ? -14.85897 -28.65150  86.65308  1.000 28.63733  ? 50  ALA B CB  1 
ATOM   6941  N N   . LEU C  1 71  ? -16.74018 -29.80145  84.39365  1.000 27.69713  ? 51  LEU B N   1 
ATOM   6942  C CA  . LEU C  1 71  ? -17.29875 -30.92334  83.64201  1.000 37.99651  ? 51  LEU B CA  1 
ATOM   6943  C C   . LEU C  1 71  ? -17.04302 -30.77007  82.14980  1.000 41.05177  ? 51  LEU B C   1 
ATOM   6944  O O   . LEU C  1 71  ? -16.76884 -31.75592  81.45526  1.000 27.30132  ? 51  LEU B O   1 
ATOM   6945  C CB  . LEU C  1 71  ? -18.80050 -31.05002  83.90238  1.000 27.03042  ? 51  LEU B CB  1 
ATOM   6946  C CG  . LEU C  1 71  ? -19.29783 -31.22282  85.33402  1.000 27.03396  ? 51  LEU B CG  1 
ATOM   6947  C CD1 . LEU C  1 71  ? -20.80620 -31.01960  85.37208  1.000 27.00928  ? 51  LEU B CD1 1 
ATOM   6948  C CD2 . LEU C  1 71  ? -18.91818 -32.59300  85.87077  1.000 35.28859  ? 51  LEU B CD2 1 
ATOM   6949  N N   . SER C  1 72  ? -17.14203 -29.54095  81.63761  1.000 27.74216  ? 52  SER B N   1 
ATOM   6950  C CA  . SER C  1 72  ? -16.87180 -29.30889  80.22400  1.000 29.90146  ? 52  SER B CA  1 
ATOM   6951  C C   . SER C  1 72  ? -15.39249 -29.52650  79.90984  1.000 34.36927  ? 52  SER B C   1 
ATOM   6952  O O   . SER C  1 72  ? -15.04152 -29.99620  78.81983  1.000 28.61696  ? 52  SER B O   1 
ATOM   6953  C CB  . SER C  1 72  ? -17.30363 -27.89400  79.84197  1.000 28.42340  ? 52  SER B CB  1 
ATOM   6954  O OG  . SER C  1 72  ? -18.66125 -27.85401  79.42430  1.000 28.26968  ? 52  SER B OG  1 
ATOM   6955  N N   . ASN C  1 73  ? -14.51031 -29.18805  80.85456  1.000 32.00679  ? 53  ASN B N   1 
ATOM   6956  C CA  . ASN C  1 73  ? -13.08088 -29.39003  80.63854  1.000 33.95607  ? 53  ASN B CA  1 
ATOM   6957  C C   . ASN C  1 73  ? -12.76231 -30.87277  80.46683  1.000 35.74493  ? 53  ASN B C   1 
ATOM   6958  O O   . ASN C  1 73  ? -11.99207 -31.25006  79.57739  1.000 31.88656  ? 53  ASN B O   1 
ATOM   6959  C CB  . ASN C  1 73  ? -12.27869 -28.80131  81.80272  1.000 29.58052  ? 53  ASN B CB  1 
ATOM   6960  C CG  . ASN C  1 73  ? -12.27736 -27.27317  81.82401  1.000 30.01558  ? 53  ASN B CG  1 
ATOM   6961  O OD1 . ASN C  1 73  ? -12.35926 -26.62182  80.78669  1.000 30.33073  ? 53  ASN B OD1 1 
ATOM   6962  N ND2 . ASN C  1 73  ? -12.16329 -26.70474  83.01801  1.000 30.12981  ? 53  ASN B ND2 1 
ATOM   6963  N N   . ALA C  1 74  ? -13.34875 -31.72727  81.31097  1.000 34.70252  ? 54  ALA B N   1 
ATOM   6964  C CA  . ALA C  1 74  ? -13.18842 -33.16985  81.14637  1.000 41.79317  ? 54  ALA B CA  1 
ATOM   6965  C C   . ALA C  1 74  ? -13.68254 -33.61740  79.77728  1.000 34.18039  ? 54  ALA B C   1 
ATOM   6966  O O   . ALA C  1 74  ? -12.96984 -34.30798  79.03997  1.000 31.85126  ? 54  ALA B O   1 
ATOM   6967  C CB  . ALA C  1 74  ? -13.93800 -33.91268  82.25395  1.000 27.77770  ? 54  ALA B CB  1 
ATOM   6968  N N   . LEU C  1 75  ? -14.91277 -33.23157  79.43059  1.000 31.57812  ? 55  LEU B N   1 
ATOM   6969  C CA  . LEU C  1 75  ? -15.46607 -33.50520  78.10582  1.000 31.05560  ? 55  LEU B CA  1 
ATOM   6970  C C   . LEU C  1 75  ? -14.52632 -33.05955  76.99317  1.000 29.31426  ? 55  LEU B C   1 
ATOM   6971  O O   . LEU C  1 75  ? -14.15298 -33.85702  76.12457  1.000 28.77019  ? 55  LEU B O   1 
ATOM   6972  C CB  . LEU C  1 75  ? -16.81767 -32.79974  77.97521  1.000 27.57503  ? 55  LEU B CB  1 
ATOM   6973  C CG  . LEU C  1 75  ? -17.77434 -33.25549  76.88989  1.000 35.74992  ? 55  LEU B CG  1 
ATOM   6974  C CD1 . LEU C  1 75  ? -18.55153 -34.45217  77.38522  1.000 32.57109  ? 55  LEU B CD1 1 
ATOM   6975  C CD2 . LEU C  1 75  ? -18.69724 -32.09967  76.52399  1.000 27.67105  ? 55  LEU B CD2 1 
ATOM   6976  N N   . ASN C  1 76  ? -14.12809 -31.78326  77.00358  1.000 30.88358  ? 56  ASN B N   1 
ATOM   6977  C CA  . ASN C  1 76  ? -13.30440 -31.25244  75.92391  1.000 32.41807  ? 56  ASN B CA  1 
ATOM   6978  C C   . ASN C  1 76  ? -11.89711 -31.83537  75.93670  1.000 32.82843  ? 56  ASN B C   1 
ATOM   6979  O O   . ASN C  1 76  ? -11.24196 -31.88100  74.89104  1.000 38.00306  ? 56  ASN B O   1 
ATOM   6980  C CB  . ASN C  1 76  ? -13.23625 -29.72977  76.01027  1.000 30.18474  ? 56  ASN B CB  1 
ATOM   6981  C CG  . ASN C  1 76  ? -14.57709 -29.07605  75.79153  1.000 29.89418  ? 56  ASN B CG  1 
ATOM   6982  O OD1 . ASN C  1 76  ? -15.57178 -29.74770  75.51447  1.000 30.22017  ? 56  ASN B OD1 1 
ATOM   6983  N ND2 . ASN C  1 76  ? -14.62131 -27.75731  75.94000  1.000 37.09396  ? 56  ASN B ND2 1 
ATOM   6984  N N   . SER C  1 77  ? -11.40630 -32.25890  77.10107  1.000 30.14048  ? 57  SER B N   1 
ATOM   6985  C CA  . SER C  1 77  ? -10.10195 -32.90432  77.17564  1.000 30.76222  ? 57  SER B CA  1 
ATOM   6986  C C   . SER C  1 77  ? -10.13484 -34.35016  76.69664  1.000 30.63991  ? 57  SER B C   1 
ATOM   6987  O O   . SER C  1 77  ? -9.07618  -34.98238  76.60777  1.000 31.27900  ? 57  SER B O   1 
ATOM   6988  C CB  . SER C  1 77  ? -9.57031  -32.86753  78.61029  1.000 30.73166  ? 57  SER B CB  1 
ATOM   6989  O OG  . SER C  1 77  ? -9.18111  -31.55976  78.97714  1.000 45.11018  ? 57  SER B OG  1 
ATOM   6990  N N   . GLY C  1 78  ? -11.31475 -34.89305  76.40640  1.000 29.95676  ? 58  GLY B N   1 
ATOM   6991  C CA  . GLY C  1 78  ? -11.43578 -36.27178  75.97940  1.000 29.81475  ? 58  GLY B CA  1 
ATOM   6992  C C   . GLY C  1 78  ? -11.76958 -37.25881  77.07663  1.000 29.98503  ? 58  GLY B C   1 
ATOM   6993  O O   . GLY C  1 78  ? -11.85359 -38.46417  76.79657  1.000 46.74934  ? 58  GLY B O   1 
ATOM   6994  N N   . ILE C  1 79  ? -11.96328 -36.79724  78.30877  1.000 28.86567  ? 59  ILE B N   1 
ATOM   6995  C CA  . ILE C  1 79  ? -12.35053 -37.68319  79.40042  1.000 28.39978  ? 59  ILE B CA  1 
ATOM   6996  C C   . ILE C  1 79  ? -13.84245 -37.96913  79.29259  1.000 39.63704  ? 59  ILE B C   1 
ATOM   6997  O O   . ILE C  1 79  ? -14.67330 -37.06415  79.44062  1.000 32.50878  ? 59  ILE B O   1 
ATOM   6998  C CB  . ILE C  1 79  ? -12.00687 -37.07998  80.76721  1.000 28.44547  ? 59  ILE B CB  1 
ATOM   6999  C CG1 . ILE C  1 79  ? -10.52215 -36.72270  80.83902  1.000 29.29604  ? 59  ILE B CG1 1 
ATOM   7000  C CG2 . ILE C  1 79  ? -12.38021 -38.06720  81.87371  1.000 28.12389  ? 59  ILE B CG2 1 
ATOM   7001  C CD1 . ILE C  1 79  ? -10.02769 -36.48014  82.24931  1.000 29.49876  ? 59  ILE B CD1 1 
ATOM   7002  N N   . ARG C  1 80  ? -14.18316 -39.23361  79.04928  1.000 27.50943  ? 60  ARG B N   1 
ATOM   7003  C CA  . ARG C  1 80  ? -15.56566 -39.65834  78.88185  1.000 40.99191  ? 60  ARG B CA  1 
ATOM   7004  C C   . ARG C  1 80  ? -16.12994 -40.35957  80.11124  1.000 35.18704  ? 60  ARG B C   1 
ATOM   7005  O O   . ARG C  1 80  ? -17.28065 -40.79928  80.08137  1.000 37.73801  ? 60  ARG B O   1 
ATOM   7006  C CB  . ARG C  1 80  ? -15.68641 -40.57211  77.65464  1.000 40.61588  ? 60  ARG B CB  1 
ATOM   7007  C CG  . ARG C  1 80  ? -14.62496 -40.31983  76.58441  1.000 57.52255  ? 60  ARG B CG  1 
ATOM   7008  C CD  . ARG C  1 80  ? -15.07216 -39.24419  75.59347  1.000 62.97153  ? 60  ARG B CD  1 
ATOM   7009  N NE  . ARG C  1 80  ? -16.52639 -39.20187  75.43928  1.000 65.13749  ? 60  ARG B NE  1 
ATOM   7010  C CZ  . ARG C  1 80  ? -17.20306 -38.16140  74.95870  1.000 61.81645  ? 60  ARG B CZ  1 
ATOM   7011  N NH1 . ARG C  1 80  ? -16.55874 -37.06406  74.58130  1.000 63.34757  ? 60  ARG B NH1 1 
ATOM   7012  N NH2 . ARG C  1 80  ? -18.52595 -38.21573  74.85666  1.000 57.28415  ? 60  ARG B NH2 1 
ATOM   7013  N N   . ARG C  1 81  ? -15.35677 -40.47765  81.18463  1.000 33.97041  ? 61  ARG B N   1 
ATOM   7014  C CA  . ARG C  1 81  ? -15.83386 -41.02987  82.44565  1.000 34.08484  ? 61  ARG B CA  1 
ATOM   7015  C C   . ARG C  1 81  ? -15.80246 -39.92591  83.49229  1.000 33.27200  ? 61  ARG B C   1 
ATOM   7016  O O   . ARG C  1 81  ? -14.73368 -39.38524  83.79243  1.000 28.62064  ? 61  ARG B O   1 
ATOM   7017  C CB  . ARG C  1 81  ? -14.97733 -42.21226  82.88881  1.000 27.02944  ? 61  ARG B CB  1 
ATOM   7018  C CG  . ARG C  1 81  ? -15.07343 -43.42512  81.97414  1.000 34.27143  ? 61  ARG B CG  1 
ATOM   7019  C CD  . ARG C  1 81  ? -15.11629 -44.70426  82.78247  1.000 27.20156  ? 61  ARG B CD  1 
ATOM   7020  N NE  . ARG C  1 81  ? -15.17301 -45.90240  81.94783  1.000 39.33326  ? 61  ARG B NE  1 
ATOM   7021  C CZ  . ARG C  1 81  ? -16.29637 -46.46061  81.50180  1.000 36.83262  ? 61  ARG B CZ  1 
ATOM   7022  N NH1 . ARG C  1 81  ? -17.47442 -45.92208  81.78678  1.000 26.53742  ? 61  ARG B NH1 1 
ATOM   7023  N NH2 . ARG C  1 81  ? -16.24098 -47.55649  80.75666  1.000 33.64185  ? 61  ARG B NH2 1 
ATOM   7024  N N   . ILE C  1 82  ? -16.96756 -39.59062  84.04316  1.000 26.39213  ? 62  ILE B N   1 
ATOM   7025  C CA  . ILE C  1 82  ? -17.08113 -38.51442  85.01750  1.000 26.47988  ? 62  ILE B CA  1 
ATOM   7026  C C   . ILE C  1 82  ? -17.86320 -39.01340  86.22413  1.000 26.47971  ? 62  ILE B C   1 
ATOM   7027  O O   . ILE C  1 82  ? -18.89569 -39.67812  86.06808  1.000 28.67074  ? 62  ILE B O   1 
ATOM   7028  C CB  . ILE C  1 82  ? -17.75190 -37.26116  84.41574  1.000 32.47946  ? 62  ILE B CB  1 
ATOM   7029  C CG1 . ILE C  1 82  ? -16.84470 -36.63036  83.35980  1.000 31.74799  ? 62  ILE B CG1 1 
ATOM   7030  C CG2 . ILE C  1 82  ? -18.06658 -36.25048  85.50137  1.000 26.46010  ? 62  ILE B CG2 1 
ATOM   7031  C CD1 . ILE C  1 82  ? -17.56670 -35.69862  82.41318  1.000 29.51694  ? 62  ILE B CD1 1 
ATOM   7032  N N   . GLY C  1 83  ? -17.35818 -38.70979  87.42029  1.000 29.69096  ? 63  GLY B N   1 
ATOM   7033  C CA  . GLY C  1 83  ? -18.11294 -38.88174  88.64613  1.000 26.99035  ? 63  GLY B CA  1 
ATOM   7034  C C   . GLY C  1 83  ? -18.32185 -37.53853  89.32338  1.000 36.96407  ? 63  GLY B C   1 
ATOM   7035  O O   . GLY C  1 83  ? -17.48079 -36.64296  89.23095  1.000 27.31902  ? 63  GLY B O   1 
ATOM   7036  N N   . VAL C  1 84  ? -19.45932 -37.39672  90.00329  1.000 30.04815  ? 64  VAL B N   1 
ATOM   7037  C CA  . VAL C  1 84  ? -19.81150 -36.14776  90.68647  1.000 29.32350  ? 64  VAL B CA  1 
ATOM   7038  C C   . VAL C  1 84  ? -20.22380 -36.48149  92.11373  1.000 31.87104  ? 64  VAL B C   1 
ATOM   7039  O O   . VAL C  1 84  ? -21.24585 -37.13849  92.32920  1.000 40.74582  ? 64  VAL B O   1 
ATOM   7040  C CB  . VAL C  1 84  ? -20.94303 -35.38218  89.98721  1.000 27.32670  ? 64  VAL B CB  1 
ATOM   7041  C CG1 . VAL C  1 84  ? -21.18318 -34.06698  90.71726  1.000 27.71906  ? 64  VAL B CG1 1 
ATOM   7042  C CG2 . VAL C  1 84  ? -20.62802 -35.15091  88.52133  1.000 29.65831  ? 64  VAL B CG2 1 
ATOM   7043  N N   . ALA C  1 85  ? -19.44846 -36.02389  93.08037  1.000 32.03613  ? 65  ALA B N   1 
ATOM   7044  C CA  . ALA C  1 85  ? -19.79608 -36.19944  94.48142  1.000 29.20204  ? 65  ALA B CA  1 
ATOM   7045  C C   . ALA C  1 85  ? -20.49646 -34.94034  94.98811  1.000 32.46353  ? 65  ALA B C   1 
ATOM   7046  O O   . ALA C  1 85  ? -19.93663 -33.84242  94.91987  1.000 29.57722  ? 65  ALA B O   1 
ATOM   7047  C CB  . ALA C  1 85  ? -18.54554 -36.49677  95.31228  1.000 29.71624  ? 65  ALA B CB  1 
ATOM   7048  N N   . THR C  1 86  ? -21.72380 -35.09886  95.48121  1.000 29.84636  ? 66  THR B N   1 
ATOM   7049  C CA  . THR C  1 86  ? -22.49615 -33.99942  96.03655  1.000 34.07312  ? 66  THR B CA  1 
ATOM   7050  C C   . THR C  1 86  ? -22.71921 -34.23539  97.52418  1.000 31.26609  ? 66  THR B C   1 
ATOM   7051  O O   . THR C  1 86  ? -22.50591 -35.33347  98.04831  1.000 39.75272  ? 66  THR B O   1 
ATOM   7052  C CB  . THR C  1 86  ? -23.84099 -33.83769  95.31066  1.000 34.04983  ? 66  THR B CB  1 
ATOM   7053  O OG1 . THR C  1 86  ? -24.75943 -34.84469  95.76000  1.000 47.43668  ? 66  THR B OG1 1 
ATOM   7054  C CG2 . THR C  1 86  ? -23.65072 -33.96706  93.80216  1.000 29.30008  ? 66  THR B CG2 1 
ATOM   7055  N N   . GLN C  1 87  ? -23.16042 -33.17925  98.20195  1.000 31.88408  ? 67  GLN B N   1 
ATOM   7056  C CA  . GLN C  1 87  ? -23.39767 -33.22743  99.63964  1.000 40.23253  ? 67  GLN B CA  1 
ATOM   7057  C C   . GLN C  1 87  ? -24.34347 -32.11251  100.07065 1.000 41.55034  ? 67  GLN B C   1 
ATOM   7058  O O   . GLN C  1 87  ? -25.53676 -32.35483  100.27723 1.000 40.32742  ? 67  GLN B O   1 
ATOM   7059  C CB  . GLN C  1 87  ? -22.07598 -33.12835  100.40357 1.000 46.63339  ? 67  GLN B CB  1 
ATOM   7060  C CG  . GLN C  1 87  ? -22.21696 -33.17386  101.92304 1.000 46.12718  ? 67  GLN B CG  1 
ATOM   7061  C CD  . GLN C  1 87  ? -21.38428 -34.27500  102.55550 1.000 56.86936  ? 67  GLN B CD  1 
ATOM   7062  O OE1 . GLN C  1 87  ? -21.65884 -35.46272  102.37619 1.000 54.53262  ? 67  GLN B OE1 1 
ATOM   7063  N NE2 . GLN C  1 87  ? -20.35031 -33.88352  103.29100 1.000 58.03185  ? 67  GLN B NE2 1 
ATOM   7064  N N   . TYR C  1 88  ? -23.82461 -30.88960  100.20378 1.000 43.43276  ? 68  TYR B N   1 
ATOM   7065  C CA  . TYR C  1 88  ? -24.63051 -29.77552  100.69598 1.000 38.69139  ? 68  TYR B CA  1 
ATOM   7066  C C   . TYR C  1 88  ? -25.72373 -29.42196  99.69495  1.000 40.52016  ? 68  TYR B C   1 
ATOM   7067  O O   . TYR C  1 88  ? -25.45878 -29.32419  98.49289  1.000 35.43803  ? 68  TYR B O   1 
ATOM   7068  C CB  . TYR C  1 88  ? -23.74424 -28.55679  100.95991 1.000 40.96442  ? 68  TYR B CB  1 
ATOM   7069  C CG  . TYR C  1 88  ? -24.50192 -27.30148  101.35203 1.000 54.47464  ? 68  TYR B CG  1 
ATOM   7070  C CD1 . TYR C  1 88  ? -24.94268 -27.10983  102.65723 1.000 55.89222  ? 68  TYR B CD1 1 
ATOM   7071  C CD2 . TYR C  1 88  ? -24.76649 -26.30405  100.42026 1.000 54.46864  ? 68  TYR B CD2 1 
ATOM   7072  C CE1 . TYR C  1 88  ? -25.63106 -25.96530  103.02275 1.000 55.17816  ? 68  TYR B CE1 1 
ATOM   7073  C CE2 . TYR C  1 88  ? -25.45174 -25.15461  100.77592 1.000 57.01268  ? 68  TYR B CE2 1 
ATOM   7074  C CZ  . TYR C  1 88  ? -25.88267 -24.99013  102.07851 1.000 59.84094  ? 68  TYR B CZ  1 
ATOM   7075  O OH  . TYR C  1 88  ? -26.56722 -23.84946  102.43721 1.000 57.01996  ? 68  TYR B OH  1 
ATOM   7076  N N   . LYS C  1 89  ? -26.94720 -29.22399  100.20863 1.000 52.25209  ? 69  LYS B N   1 
ATOM   7077  C CA  . LYS C  1 89  ? -28.15045 -28.84890  99.45945  1.000 52.81987  ? 69  LYS B CA  1 
ATOM   7078  C C   . LYS C  1 89  ? -28.04441 -29.14945  97.96943  1.000 49.70895  ? 69  LYS B C   1 
ATOM   7079  O O   . LYS C  1 89  ? -27.82600 -28.23917  97.16134  1.000 35.43922  ? 69  LYS B O   1 
ATOM   7080  C CB  . LYS C  1 89  ? -28.45807 -27.36496  99.66234  1.000 42.81427  ? 69  LYS B CB  1 
ATOM   7081  C CG  . LYS C  1 89  ? -28.44151 -26.91987  101.11509 1.000 49.06570  ? 69  LYS B CG  1 
ATOM   7082  C CD  . LYS C  1 89  ? -29.80032 -27.04766  101.77907 1.000 46.37331  ? 69  LYS B CD  1 
ATOM   7083  C CE  . LYS C  1 89  ? -29.79739 -26.38418  103.15363 1.000 53.67407  ? 69  LYS B CE  1 
ATOM   7084  N NZ  . LYS C  1 89  ? -30.00767 -24.90657  103.08825 1.000 52.53162  ? 69  LYS B NZ  1 
ATOM   7085  N N   . ALA C  1 90  ? -28.19230 -30.42174  97.60128  1.000 44.73690  ? 70  ALA B N   1 
ATOM   7086  C CA  . ALA C  1 90  ? -27.82266 -30.89115  96.27533  1.000 40.99244  ? 70  ALA B CA  1 
ATOM   7087  C C   . ALA C  1 90  ? -29.00621 -31.14242  95.34801  1.000 46.10350  ? 70  ALA B C   1 
ATOM   7088  O O   . ALA C  1 90  ? -28.79416 -31.56495  94.20586  1.000 46.74614  ? 70  ALA B O   1 
ATOM   7089  C CB  . ALA C  1 90  ? -26.98611 -32.16715  96.40476  1.000 37.06469  ? 70  ALA B CB  1 
ATOM   7090  N N   . HIS C  1 91  ? -30.23869 -30.89299  95.80168  1.000 46.20801  ? 71  HIS B N   1 
ATOM   7091  C CA  . HIS C  1 91  ? -31.42749 -31.15243  94.98594  1.000 44.02443  ? 71  HIS B CA  1 
ATOM   7092  C C   . HIS C  1 91  ? -31.34821 -30.44938  93.63443  1.000 32.94842  ? 71  HIS B C   1 
ATOM   7093  O O   . HIS C  1 91  ? -31.57803 -31.06367  92.58556  1.000 33.44294  ? 71  HIS B O   1 
ATOM   7094  C CB  . HIS C  1 91  ? -32.67725 -30.69916  95.75150  1.000 59.64713  ? 71  HIS B CB  1 
ATOM   7095  C CG  . HIS C  1 91  ? -33.96918 -30.92805  95.02178  1.000 66.87693  ? 71  HIS B CG  1 
ATOM   7096  N ND1 . HIS C  1 91  ? -34.81716 -31.97965  95.30287  1.000 72.73059  ? 71  HIS B ND1 1 
ATOM   7097  C CD2 . HIS C  1 91  ? -34.55675 -30.23197  94.01851  1.000 65.46835  ? 71  HIS B CD2 1 
ATOM   7098  C CE1 . HIS C  1 91  ? -35.86139 -31.92975  94.49336  1.000 72.81911  ? 71  HIS B CE1 1 
ATOM   7099  N NE2 . HIS C  1 91  ? -35.74040 -30.86400  93.72268  1.000 67.62049  ? 71  HIS B NE2 1 
ATOM   7100  N N   . ASP C  1 92  ? -31.03888 -29.14865  93.64862  1.000 34.06806  ? 72  ASP B N   1 
ATOM   7101  C CA  . ASP C  1 92  ? -30.98308 -28.38282  92.41100  1.000 32.54400  ? 72  ASP B CA  1 
ATOM   7102  C C   . ASP C  1 92  ? -29.78937 -28.80693  91.56309  1.000 35.83732  ? 72  ASP B C   1 
ATOM   7103  O O   . ASP C  1 92  ? -29.89434 -28.92632  90.33822  1.000 34.90290  ? 72  ASP B O   1 
ATOM   7104  C CB  . ASP C  1 92  ? -30.91263 -26.88176  92.71455  1.000 37.36689  ? 72  ASP B CB  1 
ATOM   7105  C CG  . ASP C  1 92  ? -32.25535 -26.28984  93.07765  1.000 54.54035  ? 72  ASP B CG  1 
ATOM   7106  O OD1 . ASP C  1 92  ? -33.25494 -26.67203  92.43470  1.000 63.44591  ? 72  ASP B OD1 1 
ATOM   7107  O OD2 . ASP C  1 92  ? -32.30829 -25.41314  93.96905  1.000 68.64899  ? 72  ASP B OD2 1 
ATOM   7108  N N   . LEU C  1 93  ? -28.63684 -29.01838  92.20471  1.000 31.43447  ? 73  LEU B N   1 
ATOM   7109  C CA  . LEU C  1 93  ? -27.45224 -29.47954  91.48722  1.000 33.80673  ? 73  LEU B CA  1 
ATOM   7110  C C   . LEU C  1 93  ? -27.69730 -30.83604  90.83646  1.000 33.73623  ? 73  LEU B C   1 
ATOM   7111  O O   . LEU C  1 93  ? -27.30102 -31.06398  89.68774  1.000 32.56398  ? 73  LEU B O   1 
ATOM   7112  C CB  . LEU C  1 93  ? -26.25411 -29.54112  92.44526  1.000 30.11500  ? 73  LEU B CB  1 
ATOM   7113  C CG  . LEU C  1 93  ? -25.03661 -30.38122  92.04168  1.000 29.40545  ? 73  LEU B CG  1 
ATOM   7114  C CD1 . LEU C  1 93  ? -24.38944 -29.82902  90.78019  1.000 28.89376  ? 73  LEU B CD1 1 
ATOM   7115  C CD2 . LEU C  1 93  ? -24.00896 -30.48319  93.17628  1.000 29.62753  ? 73  LEU B CD2 1 
ATOM   7116  N N   . ILE C  1 94  ? -28.37348 -31.74153  91.53812  1.000 30.02361  ? 74  ILE B N   1 
ATOM   7117  C CA  . ILE C  1 94  ? -28.54024 -33.08539  90.99422  1.000 34.30723  ? 74  ILE B CA  1 
ATOM   7118  C C   . ILE C  1 94  ? -29.52615 -33.07607  89.83182  1.000 38.89819  ? 74  ILE B C   1 
ATOM   7119  O O   . ILE C  1 94  ? -29.30512 -33.74035  88.80933  1.000 29.03385  ? 74  ILE B O   1 
ATOM   7120  C CB  . ILE C  1 94  ? -28.96380 -34.06344  92.10206  1.000 30.11564  ? 74  ILE B CB  1 
ATOM   7121  C CG1 . ILE C  1 94  ? -27.78515 -34.34486  93.03510  1.000 30.03387  ? 74  ILE B CG1 1 
ATOM   7122  C CG2 . ILE C  1 94  ? -29.48751 -35.36670  91.50198  1.000 44.43380  ? 74  ILE B CG2 1 
ATOM   7123  C CD1 . ILE C  1 94  ? -28.20835 -34.85711  94.38876  1.000 30.85329  ? 74  ILE B CD1 1 
ATOM   7124  N N   . ARG C  1 95  ? -30.62174 -32.31827  89.95808  1.000 37.56783  ? 75  ARG B N   1 
ATOM   7125  C CA  . ARG C  1 95  ? -31.56527 -32.21837  88.84978  1.000 35.28204  ? 75  ARG B CA  1 
ATOM   7126  C C   . ARG C  1 95  ? -30.89117 -31.63732  87.61568  1.000 32.32894  ? 75  ARG B C   1 
ATOM   7127  O O   . ARG C  1 95  ? -31.22727 -32.01059  86.48563  1.000 29.70913  ? 75  ARG B O   1 
ATOM   7128  C CB  . ARG C  1 95  ? -32.77106 -31.36301  89.25061  1.000 31.56105  ? 75  ARG B CB  1 
ATOM   7129  C CG  . ARG C  1 95  ? -33.77285 -31.15163  88.12016  1.000 42.27864  ? 75  ARG B CG  1 
ATOM   7130  C CD  . ARG C  1 95  ? -34.46476 -29.80457  88.21236  1.000 49.85471  ? 75  ARG B CD  1 
ATOM   7131  N NE  . ARG C  1 95  ? -35.56811 -29.80612  89.16809  1.000 60.16241  ? 75  ARG B NE  1 
ATOM   7132  C CZ  . ARG C  1 95  ? -35.56376 -29.15543  90.32831  1.000 66.07074  ? 75  ARG B CZ  1 
ATOM   7133  N NH1 . ARG C  1 95  ? -34.50328 -28.44804  90.70596  1.000 67.49120  ? 75  ARG B NH1 1 
ATOM   7134  N NH2 . ARG C  1 95  ? -36.62237 -29.22777  91.12236  1.000 59.74452  ? 75  ARG B NH2 1 
ATOM   7135  N N   . HIS C  1 96  ? -29.92344 -30.73881  87.82050  1.000 34.29001  ? 76  HIS B N   1 
ATOM   7136  C CA  . HIS C  1 96  ? -29.21566 -30.11708  86.70783  1.000 31.32744  ? 76  HIS B CA  1 
ATOM   7137  C C   . HIS C  1 96  ? -28.28370 -31.11504  86.02543  1.000 28.48491  ? 76  HIS B C   1 
ATOM   7138  O O   . HIS C  1 96  ? -28.25437 -31.21372  84.79371  1.000 28.25770  ? 76  HIS B O   1 
ATOM   7139  C CB  . HIS C  1 96  ? -28.44589 -28.89196  87.21351  1.000 29.41056  ? 76  HIS B CB  1 
ATOM   7140  C CG  . HIS C  1 96  ? -27.38435 -28.41315  86.27618  1.000 28.97473  ? 76  HIS B CG  1 
ATOM   7141  N ND1 . HIS C  1 96  ? -27.65073 -27.58416  85.20819  1.000 30.14735  ? 76  HIS B ND1 1 
ATOM   7142  C CD2 . HIS C  1 96  ? -26.05205 -28.64989  86.24539  1.000 28.47393  ? 76  HIS B CD2 1 
ATOM   7143  C CE1 . HIS C  1 96  ? -26.52770 -27.33160  84.55900  1.000 28.87358  ? 76  HIS B CE1 1 
ATOM   7144  N NE2 . HIS C  1 96  ? -25.54359 -27.96871  85.16654  1.000 28.41039  ? 76  HIS B NE2 1 
ATOM   7145  N N   . LEU C  1 97  ? -27.51228 -31.86423  86.80999  1.000 28.17556  ? 77  LEU B N   1 
ATOM   7146  C CA  . LEU C  1 97  ? -26.69279 -32.92295  86.22745  1.000 35.11301  ? 77  LEU B CA  1 
ATOM   7147  C C   . LEU C  1 97  ? -27.54689 -33.93693  85.47243  1.000 32.79997  ? 77  LEU B C   1 
ATOM   7148  O O   . LEU C  1 97  ? -27.20760 -34.32512  84.35011  1.000 27.15385  ? 77  LEU B O   1 
ATOM   7149  C CB  . LEU C  1 97  ? -25.87977 -33.61423  87.31638  1.000 27.44529  ? 77  LEU B CB  1 
ATOM   7150  C CG  . LEU C  1 97  ? -25.04895 -32.64818  88.16130  1.000 34.50584  ? 77  LEU B CG  1 
ATOM   7151  C CD1 . LEU C  1 97  ? -24.33139 -33.41047  89.25622  1.000 27.66533  ? 77  LEU B CD1 1 
ATOM   7152  C CD2 . LEU C  1 97  ? -24.06954 -31.84895  87.30981  1.000 27.40001  ? 77  LEU B CD2 1 
ATOM   7153  N N   . GLN C  1 98  ? -28.66823 -34.36530  86.06069  1.000 36.20674  ? 78  GLN B N   1 
ATOM   7154  C CA  . GLN C  1 98  ? -29.50002 -35.37239  85.40452  1.000 37.36577  ? 78  GLN B CA  1 
ATOM   7155  C C   . GLN C  1 98  ? -30.02938 -34.86897  84.06713  1.000 40.40875  ? 78  GLN B C   1 
ATOM   7156  O O   . GLN C  1 98  ? -30.13805 -35.63629  83.10104  1.000 27.87622  ? 78  GLN B O   1 
ATOM   7157  C CB  . GLN C  1 98  ? -30.67016 -35.76941  86.30486  1.000 39.86930  ? 78  GLN B CB  1 
ATOM   7158  C CG  . GLN C  1 98  ? -30.30585 -36.52915  87.56618  1.000 40.79526  ? 78  GLN B CG  1 
ATOM   7159  C CD  . GLN C  1 98  ? -31.49577 -36.66016  88.50628  1.000 46.05975  ? 78  GLN B CD  1 
ATOM   7160  O OE1 . GLN C  1 98  ? -32.35929 -35.78031  88.55676  1.000 44.72487  ? 78  GLN B OE1 1 
ATOM   7161  N NE2 . GLN C  1 98  ? -31.55406 -37.76470  89.24548  1.000 40.12944  ? 78  GLN B NE2 1 
ATOM   7162  N N   . ARG C  1 99  ? -30.36575 -33.58114  83.99276  1.000 28.47964  ? 79  ARG B N   1 
ATOM   7163  C CA  . ARG C  1 99  ? -31.03807 -33.04699  82.81757  1.000 28.81289  ? 79  ARG B CA  1 
ATOM   7164  C C   . ARG C  1 99  ? -30.05887 -32.56035  81.76397  1.000 30.73816  ? 79  ARG B C   1 
ATOM   7165  O O   . ARG C  1 99  ? -30.29115 -32.76543  80.56700  1.000 28.47627  ? 79  ARG B O   1 
ATOM   7166  C CB  . ARG C  1 99  ? -31.99129 -31.91698  83.22424  1.000 29.64149  ? 79  ARG B CB  1 
ATOM   7167  C CG  . ARG C  1 99  ? -33.39301 -32.42352  83.53682  1.000 31.52928  ? 79  ARG B CG  1 
ATOM   7168  C CD  . ARG C  1 99  ? -34.13073 -31.59709  84.57433  1.000 43.05888  ? 79  ARG B CD  1 
ATOM   7169  N NE  . ARG C  1 99  ? -35.07025 -32.44610  85.30531  1.000 54.00458  ? 79  ARG B NE  1 
ATOM   7170  C CZ  . ARG C  1 99  ? -36.17876 -32.01894  85.90092  1.000 53.05303  ? 79  ARG B CZ  1 
ATOM   7171  N NH1 . ARG C  1 99  ? -36.50997 -30.73071  85.85521  1.000 44.89558  ? 79  ARG B NH1 1 
ATOM   7172  N NH2 . ARG C  1 99  ? -36.95712 -32.89016  86.53732  1.000 36.22296  ? 79  ARG B NH2 1 
ATOM   7173  N N   . GLY C  1 100 ? -28.96435 -31.93325  82.18503  1.000 28.13658  ? 80  GLY B N   1 
ATOM   7174  C CA  . GLY C  1 100 ? -27.99136 -31.41377  81.24859  1.000 27.91803  ? 80  GLY B CA  1 
ATOM   7175  C C   . GLY C  1 100 ? -26.98864 -32.44340  80.76833  1.000 27.88955  ? 80  GLY B C   1 
ATOM   7176  O O   . GLY C  1 100 ? -26.70175 -32.52099  79.57100  1.000 33.85831  ? 80  GLY B O   1 
ATOM   7177  N N   . TRP C  1 101 ? -26.45864 -33.24731  81.68602  1.000 26.99825  ? 81  TRP B N   1 
ATOM   7178  C CA  . TRP C  1 101 ? -25.34230 -34.13980  81.38037  1.000 30.79404  ? 81  TRP B CA  1 
ATOM   7179  C C   . TRP C  1 101 ? -25.84009 -35.57911  81.23588  1.000 29.80127  ? 81  TRP B C   1 
ATOM   7180  O O   . TRP C  1 101 ? -25.52457 -36.46963  82.02254  1.000 26.21562  ? 81  TRP B O   1 
ATOM   7181  C CB  . TRP C  1 101 ? -24.26888 -34.00472  82.45310  1.000 26.42040  ? 81  TRP B CB  1 
ATOM   7182  C CG  . TRP C  1 101 ? -23.63291 -32.66896  82.39500  1.000 26.61216  ? 81  TRP B CG  1 
ATOM   7183  C CD1 . TRP C  1 101 ? -24.09844 -31.51250  82.95098  1.000 26.95323  ? 81  TRP B CD1 1 
ATOM   7184  C CD2 . TRP C  1 101 ? -22.43178 -32.32492  81.70061  1.000 28.89778  ? 81  TRP B CD2 1 
ATOM   7185  N NE1 . TRP C  1 101 ? -23.25357 -30.47720  82.66098  1.000 27.11079  ? 81  TRP B NE1 1 
ATOM   7186  C CE2 . TRP C  1 101 ? -22.22293 -30.94413  81.89049  1.000 26.92017  ? 81  TRP B CE2 1 
ATOM   7187  C CE3 . TRP C  1 101 ? -21.51082 -33.04967  80.93820  1.000 26.45730  ? 81  TRP B CE3 1 
ATOM   7188  C CZ2 . TRP C  1 101 ? -21.12491 -30.27142  81.35184  1.000 27.10843  ? 81  TRP B CZ2 1 
ATOM   7189  C CZ3 . TRP C  1 101 ? -20.41956 -32.38084  80.40351  1.000 26.68491  ? 81  TRP B CZ3 1 
ATOM   7190  C CH2 . TRP C  1 101 ? -20.23693 -31.00486  80.61236  1.000 27.00860  ? 81  TRP B CH2 1 
ATOM   7191  N N   . ASP C  1 102 ? -26.61458 -35.79363  80.16814  1.000 26.56995  ? 82  ASP B N   1 
ATOM   7192  C CA  . ASP C  1 102 ? -27.37947 -37.02122  79.98400  1.000 26.58121  ? 82  ASP B CA  1 
ATOM   7193  C C   . ASP C  1 102 ? -27.07432 -37.72142  78.66390  1.000 29.56614  ? 82  ASP B C   1 
ATOM   7194  O O   . ASP C  1 102 ? -27.87030 -38.54920  78.21599  1.000 28.67397  ? 82  ASP B O   1 
ATOM   7195  C CB  . ASP C  1 102 ? -28.87571 -36.71640  80.07173  1.000 27.09364  ? 82  ASP B CB  1 
ATOM   7196  C CG  . ASP C  1 102 ? -29.34136 -35.76653  78.97410  1.000 33.21393  ? 82  ASP B CG  1 
ATOM   7197  O OD1 . ASP C  1 102 ? -28.48800 -35.06911  78.37829  1.000 37.09426  ? 82  ASP B OD1 1 
ATOM   7198  O OD2 . ASP C  1 102 ? -30.56407 -35.71221  78.71160  1.000 37.84532  ? 82  ASP B OD2 1 
ATOM   7199  N N   . PHE C  1 103 ? -25.94962 -37.41574  78.02114  1.000 26.43082  ? 83  PHE B N   1 
ATOM   7200  C CA  . PHE C  1 103 ? -25.67496 -37.94251  76.68924  1.000 26.45403  ? 83  PHE B CA  1 
ATOM   7201  C C   . PHE C  1 103 ? -24.53031 -38.94755  76.68500  1.000 28.32934  ? 83  PHE B C   1 
ATOM   7202  O O   . PHE C  1 103 ? -23.94819 -39.21706  75.63094  1.000 29.42652  ? 83  PHE B O   1 
ATOM   7203  C CB  . PHE C  1 103 ? -25.39336 -36.80273  75.70702  1.000 26.78999  ? 83  PHE B CB  1 
ATOM   7204  C CG  . PHE C  1 103 ? -24.43725 -35.76807  76.22365  1.000 34.16110  ? 83  PHE B CG  1 
ATOM   7205  C CD1 . PHE C  1 103 ? -24.89052 -34.71130  77.00156  1.000 26.83542  ? 83  PHE B CD1 1 
ATOM   7206  C CD2 . PHE C  1 103 ? -23.08767 -35.82817  75.90578  1.000 27.02900  ? 83  PHE B CD2 1 
ATOM   7207  C CE1 . PHE C  1 103 ? -24.01721 -33.75321  77.47453  1.000 26.85070  ? 83  PHE B CE1 1 
ATOM   7208  C CE2 . PHE C  1 103 ? -22.20841 -34.85785  76.37366  1.000 26.76894  ? 83  PHE B CE2 1 
ATOM   7209  C CZ  . PHE C  1 103 ? -22.67910 -33.82115  77.16284  1.000 26.81374  ? 83  PHE B CZ  1 
ATOM   7210  N N   . PHE C  1 104 ? -24.20682 -39.52049  77.83792  1.000 26.92497  ? 84  PHE B N   1 
ATOM   7211  C CA  . PHE C  1 104 ? -23.16415 -40.53044  77.94167  1.000 25.78382  ? 84  PHE B CA  1 
ATOM   7212  C C   . PHE C  1 104 ? -23.82038 -41.90548  77.93812  1.000 31.71978  ? 84  PHE B C   1 
ATOM   7213  O O   . PHE C  1 104 ? -24.82270 -42.11853  78.62885  1.000 25.77039  ? 84  PHE B O   1 
ATOM   7214  C CB  . PHE C  1 104 ? -22.33102 -40.34360  79.21120  1.000 25.65166  ? 84  PHE B CB  1 
ATOM   7215  C CG  . PHE C  1 104 ? -21.48765 -39.09905  79.21619  1.000 39.24958  ? 84  PHE B CG  1 
ATOM   7216  C CD1 . PHE C  1 104 ? -20.18694 -39.14381  79.67719  1.000 44.77894  ? 84  PHE B CD1 1 
ATOM   7217  C CD2 . PHE C  1 104 ? -21.99907 -37.88355  78.79475  1.000 55.58343  ? 84  PHE B CD2 1 
ATOM   7218  C CE1 . PHE C  1 104 ? -19.40922 -38.01725  79.69463  1.000 40.64957  ? 84  PHE B CE1 1 
ATOM   7219  C CE2 . PHE C  1 104 ? -21.22308 -36.75287  78.81302  1.000 57.67698  ? 84  PHE B CE2 1 
ATOM   7220  C CZ  . PHE C  1 104 ? -19.92339 -36.82365  79.26515  1.000 44.85228  ? 84  PHE B CZ  1 
ATOM   7221  N N   . ARG C  1 105 ? -23.26775 -42.83140  77.15874  1.000 25.83745  ? 85  ARG B N   1 
ATOM   7222  C CA  . ARG C  1 105 ? -23.83013 -44.17458  77.05679  1.000 26.62632  ? 85  ARG B CA  1 
ATOM   7223  C C   . ARG C  1 105 ? -22.77261 -45.20100  77.44327  1.000 25.87825  ? 85  ARG B C   1 
ATOM   7224  O O   . ARG C  1 105 ? -21.67053 -45.19783  76.86700  1.000 31.25460  ? 85  ARG B O   1 
ATOM   7225  C CB  . ARG C  1 105 ? -24.35798 -44.44590  75.64196  1.000 29.09560  ? 85  ARG B CB  1 
ATOM   7226  C CG  . ARG C  1 105 ? -25.79137 -43.97678  75.39744  1.000 26.33029  ? 85  ARG B CG  1 
ATOM   7227  C CD  . ARG C  1 105 ? -26.75422 -44.63509  76.36920  1.000 29.40421  ? 85  ARG B CD  1 
ATOM   7228  N NE  . ARG C  1 105 ? -27.09787 -46.01428  76.02027  1.000 26.49534  ? 85  ARG B NE  1 
ATOM   7229  C CZ  . ARG C  1 105 ? -28.28203 -46.55437  76.29355  1.000 37.01441  ? 85  ARG B CZ  1 
ATOM   7230  N NH1 . ARG C  1 105 ? -29.20231 -45.80472  76.89022  1.000 29.97803  ? 85  ARG B NH1 1 
ATOM   7231  N NH2 . ARG C  1 105 ? -28.55837 -47.81835  75.97718  1.000 26.96630  ? 85  ARG B NH2 1 
ATOM   7232  N N   . PRO C  1 106 ? -23.03898 -46.06314  78.42471  1.000 25.84538  ? 86  PRO B N   1 
ATOM   7233  C CA  . PRO C  1 106 ? -22.04504 -47.08255  78.80150  1.000 38.57227  ? 86  PRO B CA  1 
ATOM   7234  C C   . PRO C  1 106 ? -21.60859 -47.99253  77.66403  1.000 30.90763  ? 86  PRO B C   1 
ATOM   7235  O O   . PRO C  1 106 ? -20.50342 -48.54528  77.73389  1.000 28.71255  ? 86  PRO B O   1 
ATOM   7236  C CB  . PRO C  1 106 ? -22.76610 -47.86868  79.90302  1.000 35.74649  ? 86  PRO B CB  1 
ATOM   7237  C CG  . PRO C  1 106 ? -23.64212 -46.83932  80.54755  1.000 43.40506  ? 86  PRO B CG  1 
ATOM   7238  C CD  . PRO C  1 106 ? -24.12079 -45.95513  79.41822  1.000 38.01052  ? 86  PRO B CD  1 
ATOM   7239  N N   . GLU C  1 107 ? -22.43027 -48.17925  76.62743  1.000 26.29580  ? 87  GLU B N   1 
ATOM   7240  C CA  . GLU C  1 107 ? -22.00318 -49.01530  75.50625  1.000 26.62829  ? 87  GLU B CA  1 
ATOM   7241  C C   . GLU C  1 107 ? -20.77512 -48.44429  74.81884  1.000 39.43867  ? 87  GLU B C   1 
ATOM   7242  O O   . GLU C  1 107 ? -19.95831 -49.20476  74.29483  1.000 27.21972  ? 87  GLU B O   1 
ATOM   7243  C CB  . GLU C  1 107 ? -23.10861 -49.15931  74.47080  1.000 26.78731  ? 87  GLU B CB  1 
ATOM   7244  C CG  . GLU C  1 107 ? -24.40118 -49.72483  74.96223  1.000 26.76365  ? 87  GLU B CG  1 
ATOM   7245  C CD  . GLU C  1 107 ? -25.37759 -48.63479  75.32182  1.000 26.60343  ? 87  GLU B CD  1 
ATOM   7246  O OE1 . GLU C  1 107 ? -26.59337 -48.88359  75.21433  1.000 31.08099  ? 87  GLU B OE1 1 
ATOM   7247  O OE2 . GLU C  1 107 ? -24.93330 -47.55958  75.76616  1.000 26.42899  ? 87  GLU B OE2 1 
ATOM   7248  N N   . ARG C  1 108 ? -20.65042 -47.11215  74.78397  1.000 26.70303  ? 88  ARG B N   1 
ATOM   7249  C CA  . ARG C  1 108 ? -19.50540 -46.43375  74.19680  1.000 26.99876  ? 88  ARG B CA  1 
ATOM   7250  C C   . ARG C  1 108 ? -18.40596 -46.15231  75.21401  1.000 26.97976  ? 88  ARG B C   1 
ATOM   7251  O O   . ARG C  1 108 ? -17.53802 -45.31235  74.95518  1.000 36.79297  ? 88  ARG B O   1 
ATOM   7252  C CB  . ARG C  1 108 ? -19.94520 -45.12816  73.52858  1.000 28.30089  ? 88  ARG B CB  1 
ATOM   7253  C CG  . ARG C  1 108 ? -21.30944 -45.21495  72.85684  1.000 28.65319  ? 88  ARG B CG  1 
ATOM   7254  C CD  . ARG C  1 108 ? -21.56734 -44.03654  71.92588  1.000 37.88883  ? 88  ARG B CD  1 
ATOM   7255  N NE  . ARG C  1 108 ? -22.00955 -42.83515  72.63293  1.000 35.14462  ? 88  ARG B NE  1 
ATOM   7256  C CZ  . ARG C  1 108 ? -23.28132 -42.46261  72.73393  1.000 26.91322  ? 88  ARG B CZ  1 
ATOM   7257  N NH1 . ARG C  1 108 ? -24.23808 -43.19897  72.18310  1.000 27.37679  ? 88  ARG B NH1 1 
ATOM   7258  N NH2 . ARG C  1 108 ? -23.60092 -41.36482  73.39649  1.000 26.75325  ? 88  ARG B NH2 1 
ATOM   7259  N N   . ASN C  1 109 ? -18.42218 -46.84857  76.35439  1.000 26.80994  ? 89  ASN B N   1 
ATOM   7260  C CA  . ASN C  1 109 ? -17.47214 -46.62371  77.45090  1.000 26.87087  ? 89  ASN B CA  1 
ATOM   7261  C C   . ASN C  1 109 ? -17.50116 -45.16820  77.91516  1.000 26.63982  ? 89  ASN B C   1 
ATOM   7262  O O   . ASN C  1 109 ? -16.47640 -44.58380  78.26922  1.000 28.99452  ? 89  ASN B O   1 
ATOM   7263  C CB  . ASN C  1 109 ? -16.05963 -47.06324  77.06683  1.000 27.47299  ? 89  ASN B CB  1 
ATOM   7264  C CG  . ASN C  1 109 ? -15.96212 -48.57384  76.85081  1.000 32.04114  ? 89  ASN B CG  1 
ATOM   7265  O OD1 . ASN C  1 109 ? -15.35889 -49.03307  75.88533  1.000 33.86248  ? 89  ASN B OD1 1 
ATOM   7266  N ND2 . ASN C  1 109 ? -16.55873 -49.34598  77.75355  1.000 27.57615  ? 89  ASN B ND2 1 
ATOM   7267  N N   . GLU C  1 110 ? -18.69640 -44.58615  77.89242  1.000 26.28466  ? 90  GLU B N   1 
ATOM   7268  C CA  . GLU C  1 110 ? -19.02057 -43.34405  78.56771  1.000 26.73719  ? 90  GLU B CA  1 
ATOM   7269  C C   . GLU C  1 110 ? -19.69627 -43.67308  79.89574  1.000 25.85282  ? 90  GLU B C   1 
ATOM   7270  O O   . GLU C  1 110 ? -20.34879 -44.71032  80.03599  1.000 40.43886  ? 90  GLU B O   1 
ATOM   7271  C CB  . GLU C  1 110 ? -19.96303 -42.48914  77.71723  1.000 25.98109  ? 90  GLU B CB  1 
ATOM   7272  C CG  . GLU C  1 110 ? -19.33649 -41.81303  76.51439  1.000 27.01367  ? 90  GLU B CG  1 
ATOM   7273  C CD  . GLU C  1 110 ? -20.28938 -41.72917  75.33071  1.000 26.40813  ? 90  GLU B CD  1 
ATOM   7274  O OE1 . GLU C  1 110 ? -19.81553 -41.60991  74.18550  1.000 32.13844  ? 90  GLU B OE1 1 
ATOM   7275  O OE2 . GLU C  1 110 ? -21.51603 -41.80426  75.54544  1.000 33.09029  ? 90  GLU B OE2 1 
ATOM   7276  N N   . SER C  1 111 ? -19.53969 -42.78561  80.87106  1.000 25.80417  ? 91  SER B N   1 
ATOM   7277  C CA  . SER C  1 111 ? -20.34317 -42.86517  82.08253  1.000 32.47324  ? 91  SER B CA  1 
ATOM   7278  C C   . SER C  1 111 ? -20.44175 -41.47986  82.70976  1.000 29.36177  ? 91  SER B C   1 
ATOM   7279  O O   . SER C  1 111 ? -19.51362 -40.66980  82.61159  1.000 25.79212  ? 91  SER B O   1 
ATOM   7280  C CB  . SER C  1 111 ? -19.76385 -43.86834  83.08571  1.000 25.92158  ? 91  SER B CB  1 
ATOM   7281  O OG  . SER C  1 111 ? -18.40525 -43.59564  83.36009  1.000 26.15646  ? 91  SER B OG  1 
ATOM   7282  N N   . PHE C  1 112 ? -21.58302 -41.21615  83.34907  1.000 25.67359  ? 92  PHE B N   1 
ATOM   7283  C CA  . PHE C  1 112 ? -21.75524 -40.01060  84.16013  1.000 37.28014  ? 92  PHE B CA  1 
ATOM   7284  C C   . PHE C  1 112 ? -22.46246 -40.41458  85.44964  1.000 37.26955  ? 92  PHE B C   1 
ATOM   7285  O O   . PHE C  1 112 ? -23.68920 -40.56496  85.47658  1.000 26.04669  ? 92  PHE B O   1 
ATOM   7286  C CB  . PHE C  1 112 ? -22.52523 -38.92356  83.41909  1.000 27.88703  ? 92  PHE B CB  1 
ATOM   7287  C CG  . PHE C  1 112 ? -22.36154 -37.55644  84.02063  1.000 25.87356  ? 92  PHE B CG  1 
ATOM   7288  C CD1 . PHE C  1 112 ? -21.44472 -36.65934  83.49693  1.000 26.74398  ? 92  PHE B CD1 1 
ATOM   7289  C CD2 . PHE C  1 112 ? -23.11240 -37.17573  85.12073  1.000 26.08785  ? 92  PHE B CD2 1 
ATOM   7290  C CE1 . PHE C  1 112 ? -21.28682 -35.39677  84.05263  1.000 31.92028  ? 92  PHE B CE1 1 
ATOM   7291  C CE2 . PHE C  1 112 ? -22.96171 -35.91308  85.68394  1.000 29.65838  ? 92  PHE B CE2 1 
ATOM   7292  C CZ  . PHE C  1 112 ? -22.04402 -35.02418  85.14821  1.000 26.26961  ? 92  PHE B CZ  1 
ATOM   7293  N N   . ASP C  1 113 ? -21.68566 -40.55863  86.51863  1.000 37.23005  ? 93  ASP B N   1 
ATOM   7294  C CA  . ASP C  1 113 ? -22.18154 -41.03187  87.80514  1.000 27.80013  ? 93  ASP B CA  1 
ATOM   7295  C C   . ASP C  1 113 ? -22.35143 -39.85486  88.76051  1.000 37.25371  ? 93  ASP B C   1 
ATOM   7296  O O   . ASP C  1 113 ? -21.40215 -39.09297  88.99069  1.000 37.41993  ? 93  ASP B O   1 
ATOM   7297  C CB  . ASP C  1 113 ? -21.21812 -42.06527  88.38036  1.000 26.72524  ? 93  ASP B CB  1 
ATOM   7298  C CG  . ASP C  1 113 ? -21.28240 -43.39436  87.63912  1.000 34.72989  ? 93  ASP B CG  1 
ATOM   7299  O OD1 . ASP C  1 113 ? -22.34865 -44.05053  87.67911  1.000 28.85745  ? 93  ASP B OD1 1 
ATOM   7300  O OD2 . ASP C  1 113 ? -20.27540 -43.77129  87.00043  1.000 28.53866  ? 93  ASP B OD2 1 
ATOM   7301  N N   . ILE C  1 114 ? -23.55279 -39.70677  89.31620  1.000 27.06593  ? 94  ILE B N   1 
ATOM   7302  C CA  . ILE C  1 114 ? -23.83013 -38.68612  90.32312  1.000 37.16007  ? 94  ILE B CA  1 
ATOM   7303  C C   . ILE C  1 114 ? -23.92516 -39.36951  91.67897  1.000 38.58182  ? 94  ILE B C   1 
ATOM   7304  O O   . ILE C  1 114 ? -24.77454 -40.24621  91.88481  1.000 38.50778  ? 94  ILE B O   1 
ATOM   7305  C CB  . ILE C  1 114 ? -25.10541 -37.89539  89.99162  1.000 27.60498  ? 94  ILE B CB  1 
ATOM   7306  C CG1 . ILE C  1 114 ? -25.11144 -37.50474  88.50962  1.000 30.62095  ? 94  ILE B CG1 1 
ATOM   7307  C CG2 . ILE C  1 114 ? -25.16828 -36.66091  90.82226  1.000 35.13385  ? 94  ILE B CG2 1 
ATOM   7308  C CD1 . ILE C  1 114 ? -26.47889 -37.26833  87.92113  1.000 27.97683  ? 94  ILE B CD1 1 
ATOM   7309  N N   . LEU C  1 115 ? -23.06415 -38.96054  92.61383  1.000 32.97025  ? 95  LEU B N   1 
ATOM   7310  C CA  . LEU C  1 115 ? -22.71261 -39.77270  93.77812  1.000 31.06497  ? 95  LEU B CA  1 
ATOM   7311  C C   . LEU C  1 115 ? -22.95483 -38.97255  95.05249  1.000 31.16058  ? 95  LEU B C   1 
ATOM   7312  O O   . LEU C  1 115 ? -22.00697 -38.47155  95.67532  1.000 40.78287  ? 95  LEU B O   1 
ATOM   7313  C CB  . LEU C  1 115 ? -21.26328 -40.22302  93.63963  1.000 29.70699  ? 95  LEU B CB  1 
ATOM   7314  C CG  . LEU C  1 115 ? -21.16753 -41.32069  92.57691  1.000 39.90327  ? 95  LEU B CG  1 
ATOM   7315  C CD1 . LEU C  1 115 ? -19.83084 -42.01385  92.62499  1.000 46.18393  ? 95  LEU B CD1 1 
ATOM   7316  C CD2 . LEU C  1 115 ? -22.24696 -42.36485  92.79963  1.000 30.08376  ? 95  LEU B CD2 1 
ATOM   7317  N N   . PRO C  1 116 ? -24.20756 -38.83595  95.47197  1.000 33.98694  ? 96  PRO B N   1 
ATOM   7318  C CA  . PRO C  1 116 ? -24.49062 -38.14975  96.73139  1.000 37.34465  ? 96  PRO B CA  1 
ATOM   7319  C C   . PRO C  1 116 ? -24.31735 -39.08439  97.91435  1.000 37.88539  ? 96  PRO B C   1 
ATOM   7320  O O   . PRO C  1 116 ? -24.55827 -40.28925  97.82742  1.000 43.96933  ? 96  PRO B O   1 
ATOM   7321  C CB  . PRO C  1 116 ? -25.95957 -37.72394  96.58398  1.000 34.35519  ? 96  PRO B CB  1 
ATOM   7322  C CG  . PRO C  1 116 ? -26.45736 -38.36460  95.28197  1.000 39.96982  ? 96  PRO B CG  1 
ATOM   7323  C CD  . PRO C  1 116 ? -25.43552 -39.35638  94.85146  1.000 38.96195  ? 96  PRO B CD  1 
ATOM   7324  N N   . ALA C  1 117 ? -23.89692 -38.50910  99.03588  1.000 57.02121  ? 97  ALA B N   1 
ATOM   7325  C CA  . ALA C  1 117 ? -23.83003 -39.27457  100.27237 1.000 61.05739  ? 97  ALA B CA  1 
ATOM   7326  C C   . ALA C  1 117 ? -25.23625 -39.67266  100.70209 1.000 67.16224  ? 97  ALA B C   1 
ATOM   7327  O O   . ALA C  1 117 ? -26.12334 -38.82106  100.81699 1.000 74.76645  ? 97  ALA B O   1 
ATOM   7328  C CB  . ALA C  1 117 ? -23.14573 -38.45796  101.36613 1.000 65.30119  ? 97  ALA B CB  1 
ATOM   7329  N N   . SER C  1 118 ? -25.44380 -40.96628  100.92957 1.000 76.08566  ? 98  SER B N   1 
ATOM   7330  C CA  . SER C  1 118 ? -26.77177 -41.48419  101.23918 1.000 90.01728  ? 98  SER B CA  1 
ATOM   7331  C C   . SER C  1 118 ? -26.63994 -42.87639  101.84787 1.000 103.12377 ? 98  SER B C   1 
ATOM   7332  O O   . SER C  1 118 ? -25.53809 -43.41064  102.00191 1.000 110.46290 ? 98  SER B O   1 
ATOM   7333  C CB  . SER C  1 118 ? -27.65402 -41.50562  99.98867  1.000 87.76538  ? 98  SER B CB  1 
ATOM   7334  O OG  . SER C  1 118 ? -27.04515 -42.26178  98.95507  1.000 88.42972  ? 98  SER B OG  1 
ATOM   7335  N N   . GLN C  1 119 ? -27.79052 -43.46671  102.18302 1.000 105.77341 ? 99  GLN B N   1 
ATOM   7336  C CA  . GLN C  1 119 ? -27.85118 -44.76083  102.86649 1.000 105.33716 ? 99  GLN B CA  1 
ATOM   7337  C C   . GLN C  1 119 ? -27.74314 -45.89150  101.84034 1.000 104.05965 ? 99  GLN B C   1 
ATOM   7338  O O   . GLN C  1 119 ? -28.69292 -46.62519  101.55593 1.000 106.87624 ? 99  GLN B O   1 
ATOM   7339  C CB  . GLN C  1 119 ? -29.12879 -44.86544  103.68833 1.000 105.86794 ? 99  GLN B CB  1 
ATOM   7340  N N   . ARG C  1 120 ? -26.53771 -46.02972  101.28660 1.000 98.69958  ? 100 ARG B N   1 
ATOM   7341  C CA  . ARG C  1 120 ? -26.27609 -47.02138  100.24943 1.000 98.37992  ? 100 ARG B CA  1 
ATOM   7342  C C   . ARG C  1 120 ? -25.69443 -48.29560  100.85075 1.000 99.18537  ? 100 ARG B C   1 
ATOM   7343  O O   . ARG C  1 120 ? -26.38574 -49.31517  100.95015 1.000 100.34243 ? 100 ARG B O   1 
ATOM   7344  C CB  . ARG C  1 120 ? -25.33154 -46.44399  99.19226  1.000 95.15610  ? 100 ARG B CB  1 
ATOM   7345  C CG  . ARG C  1 120 ? -25.40724 -47.12650  97.83474  1.000 92.61757  ? 100 ARG B CG  1 
ATOM   7346  C CD  . ARG C  1 120 ? -24.72717 -46.27926  96.76742  1.000 88.87507  ? 100 ARG B CD  1 
ATOM   7347  N NE  . ARG C  1 120 ? -23.42143 -45.79518  97.20617  1.000 85.62181  ? 100 ARG B NE  1 
ATOM   7348  C CZ  . ARG C  1 120 ? -22.26706 -46.36100  96.87072  1.000 83.96957  ? 100 ARG B CZ  1 
ATOM   7349  N NH1 . ARG C  1 120 ? -21.12274 -45.86208  97.31669  1.000 83.87668  ? 100 ARG B NH1 1 
ATOM   7350  N NH2 . ARG C  1 120 ? -22.25713 -47.43061  96.08993  1.000 86.77442  ? 100 ARG B NH2 1 
ATOM   7351  N N   . VAL C  1 121 ? -24.42221 -48.25022  101.24301 1.000 96.79530  ? 101 VAL B N   1 
ATOM   7352  C CA  . VAL C  1 121 ? -23.78424 -49.36494  101.93466 1.000 100.68103 ? 101 VAL B CA  1 
ATOM   7353  C C   . VAL C  1 121 ? -23.16027 -48.81355  103.21270 1.000 103.24063 ? 101 VAL B C   1 
ATOM   7354  O O   . VAL C  1 121 ? -22.34861 -49.47568  103.87109 1.000 104.46690 ? 101 VAL B O   1 
ATOM   7355  C CB  . VAL C  1 121 ? -22.75679 -50.07685  101.02912 1.000 96.11992  ? 101 VAL B CB  1 
ATOM   7356  C CG1 . VAL C  1 121 ? -21.47020 -49.26117  100.89917 1.000 95.15066  ? 101 VAL B CG1 1 
ATOM   7357  C CG2 . VAL C  1 121 ? -22.48056 -51.50111  101.52330 1.000 89.75365  ? 101 VAL B CG2 1 
ATOM   7358  N N   . SER C  1 122 ? -23.55696 -47.59487  103.57551 1.000 103.20470 ? 102 SER B N   1 
ATOM   7359  C CA  . SER C  1 122 ? -23.14955 -46.96519  104.82285 1.000 103.96250 ? 102 SER B CA  1 
ATOM   7360  C C   . SER C  1 122 ? -24.27302 -46.04864  105.28477 1.000 103.66079 ? 102 SER B C   1 
ATOM   7361  O O   . SER C  1 122 ? -24.87251 -45.34115  104.47051 1.000 104.40638 ? 102 SER B O   1 
ATOM   7362  C CB  . SER C  1 122 ? -21.84553 -46.17377  104.65613 1.000 99.63549  ? 102 SER B CB  1 
ATOM   7363  O OG  . SER C  1 122 ? -21.99910 -45.12356  103.71583 1.000 93.63001  ? 102 SER B OG  1 
ATOM   7364  N N   . GLU C  1 123 ? -24.56176 -46.07435  106.58896 1.000 101.47664 ? 103 GLU B N   1 
ATOM   7365  C CA  . GLU C  1 123 ? -25.60555 -45.21162  107.13659 1.000 100.39642 ? 103 GLU B CA  1 
ATOM   7366  C C   . GLU C  1 123 ? -25.26193 -43.74196  106.92082 1.000 100.05953 ? 103 GLU B C   1 
ATOM   7367  O O   . GLU C  1 123 ? -25.99544 -43.01299  106.24282 1.000 99.47989  ? 103 GLU B O   1 
ATOM   7368  C CB  . GLU C  1 123 ? -25.80816 -45.51225  108.62304 1.000 100.84342 ? 103 GLU B CB  1 
ATOM   7369  N N   . THR C  1 124 ? -24.14573 -43.29699  107.50905 1.000 100.22550 ? 104 THR B N   1 
ATOM   7370  C CA  . THR C  1 124 ? -23.50376 -41.99734  107.30052 1.000 98.71071  ? 104 THR B CA  1 
ATOM   7371  C C   . THR C  1 124 ? -24.42535 -40.88207  106.81024 1.000 94.77192  ? 104 THR B C   1 
ATOM   7372  O O   . THR C  1 124 ? -24.70855 -39.93735  107.55564 1.000 95.08804  ? 104 THR B O   1 
ATOM   7373  C CB  . THR C  1 124 ? -22.33229 -42.14618  106.31793 1.000 99.03591  ? 104 THR B CB  1 
ATOM   7374  O OG1 . THR C  1 124 ? -22.80039 -42.69380  105.07827 1.000 99.77201  ? 104 THR B OG1 1 
ATOM   7375  C CG2 . THR C  1 124 ? -21.25420 -43.06240  106.89548 1.000 96.56788  ? 104 THR B CG2 1 
ATOM   7376  N N   . GLN C  1 125 ? -24.88303 -40.97636  105.55688 1.000 88.75727  ? 105 GLN B N   1 
ATOM   7377  C CA  . GLN C  1 125 ? -25.60271 -39.90119  104.87075 1.000 81.68715  ? 105 GLN B CA  1 
ATOM   7378  C C   . GLN C  1 125 ? -24.78701 -38.61279  104.82195 1.000 78.79364  ? 105 GLN B C   1 
ATOM   7379  O O   . GLN C  1 125 ? -25.33829 -37.52352  104.62477 1.000 66.74550  ? 105 GLN B O   1 
ATOM   7380  C CB  . GLN C  1 125 ? -26.97178 -39.63937  105.51203 1.000 80.97548  ? 105 GLN B CB  1 
ATOM   7381  N N   . TRP C  1 126 ? -23.47240 -38.73318  104.98201 1.000 79.96337  ? 106 TRP B N   1 
ATOM   7382  C CA  . TRP C  1 126 ? -22.57905 -37.58824  105.11665 1.000 72.66367  ? 106 TRP B CA  1 
ATOM   7383  C C   . TRP C  1 126 ? -21.18534 -38.06336  104.74419 1.000 67.34567  ? 106 TRP B C   1 
ATOM   7384  O O   . TRP C  1 126 ? -20.64293 -38.94705  105.41428 1.000 73.14250  ? 106 TRP B O   1 
ATOM   7385  C CB  . TRP C  1 126 ? -22.60618 -37.05212  106.55487 1.000 75.12833  ? 106 TRP B CB  1 
ATOM   7386  C CG  . TRP C  1 126 ? -22.28962 -35.59012  106.70839 1.000 80.17042  ? 106 TRP B CG  1 
ATOM   7387  C CD1 . TRP C  1 126 ? -21.21879 -35.04748  107.36476 1.000 83.44102  ? 106 TRP B CD1 1 
ATOM   7388  C CD2 . TRP C  1 126 ? -23.06886 -34.48395  106.23175 1.000 80.35489  ? 106 TRP B CD2 1 
ATOM   7389  N NE1 . TRP C  1 126 ? -21.27503 -33.67311  107.30916 1.000 85.90620  ? 106 TRP B NE1 1 
ATOM   7390  C CE2 . TRP C  1 126 ? -22.40061 -33.30261  106.62035 1.000 80.50668  ? 106 TRP B CE2 1 
ATOM   7391  C CE3 . TRP C  1 126 ? -24.26095 -34.37754  105.50762 1.000 73.14584  ? 106 TRP B CE3 1 
ATOM   7392  C CZ2 . TRP C  1 126 ? -22.88446 -32.03348  106.30635 1.000 80.01071  ? 106 TRP B CZ2 1 
ATOM   7393  C CZ3 . TRP C  1 126 ? -24.73890 -33.11653  105.19736 1.000 72.21164  ? 106 TRP B CZ3 1 
ATOM   7394  C CH2 . TRP C  1 126 ? -24.05207 -31.96199  105.59607 1.000 75.78393  ? 106 TRP B CH2 1 
ATOM   7395  N N   . TYR C  1 127 ? -20.62004 -37.52401  103.66716 1.000 61.63496  ? 107 TYR B N   1 
ATOM   7396  C CA  . TYR C  1 127 ? -19.20308 -37.74256  103.41411 1.000 56.49607  ? 107 TYR B CA  1 
ATOM   7397  C C   . TYR C  1 127 ? -18.39783 -37.01716  104.48326 1.000 60.38992  ? 107 TYR B C   1 
ATOM   7398  O O   . TYR C  1 127 ? -18.71545 -35.88358  104.85472 1.000 51.01937  ? 107 TYR B O   1 
ATOM   7399  C CB  . TYR C  1 127 ? -18.79361 -37.23477  102.02695 1.000 50.61513  ? 107 TYR B CB  1 
ATOM   7400  C CG  . TYR C  1 127 ? -19.39530 -37.96659  100.84318 1.000 45.85725  ? 107 TYR B CG  1 
ATOM   7401  C CD1 . TYR C  1 127 ? -19.38940 -39.35695  100.77229 1.000 44.77340  ? 107 TYR B CD1 1 
ATOM   7402  C CD2 . TYR C  1 127 ? -19.94861 -37.25952  99.78261  1.000 42.69033  ? 107 TYR B CD2 1 
ATOM   7403  C CE1 . TYR C  1 127 ? -19.93488 -40.01570  99.68743  1.000 44.26804  ? 107 TYR B CE1 1 
ATOM   7404  C CE2 . TYR C  1 127 ? -20.49704 -37.90983  98.69558  1.000 42.23846  ? 107 TYR B CE2 1 
ATOM   7405  C CZ  . TYR C  1 127 ? -20.48891 -39.28647  98.65102  1.000 47.83257  ? 107 TYR B CZ  1 
ATOM   7406  O OH  . TYR C  1 127 ? -21.03339 -39.93079  97.56242  1.000 43.35008  ? 107 TYR B OH  1 
ATOM   7407  N N   . GLU C  1 128 ? -17.35315 -37.67356  104.98486 1.000 58.91766  ? 108 GLU B N   1 
ATOM   7408  C CA  . GLU C  1 128 ? -16.53488 -37.08316  106.03808 1.000 57.91761  ? 108 GLU B CA  1 
ATOM   7409  C C   . GLU C  1 128 ? -15.47490 -36.12788  105.50646 1.000 60.85334  ? 108 GLU B C   1 
ATOM   7410  O O   . GLU C  1 128 ? -14.77407 -35.49844  106.30626 1.000 68.63639  ? 108 GLU B O   1 
ATOM   7411  C CB  . GLU C  1 128 ? -15.87470 -38.18660  106.86137 1.000 60.68526  ? 108 GLU B CB  1 
ATOM   7412  C CG  . GLU C  1 128 ? -16.85324 -39.24570  107.32170 1.000 67.87488  ? 108 GLU B CG  1 
ATOM   7413  C CD  . GLU C  1 128 ? -16.86756 -39.40100  108.82335 1.000 73.20151  ? 108 GLU B CD  1 
ATOM   7414  O OE1 . GLU C  1 128 ? -16.54529 -40.50746  109.30876 1.000 73.36304  ? 108 GLU B OE1 1 
ATOM   7415  O OE2 . GLU C  1 128 ? -17.19311 -38.41012  109.51572 1.000 71.12318  ? 108 GLU B OE2 1 
ATOM   7416  N N   . GLY C  1 129 ? -15.34525 -36.00059  104.19416 1.000 56.91913  ? 109 GLY B N   1 
ATOM   7417  C CA  . GLY C  1 129 ? -14.35388 -35.11617  103.61688 1.000 49.70906  ? 109 GLY B CA  1 
ATOM   7418  C C   . GLY C  1 129 ? -14.18235 -35.41851  102.14810 1.000 48.80968  ? 109 GLY B C   1 
ATOM   7419  O O   . GLY C  1 129 ? -14.75072 -36.37366  101.60951 1.000 55.45431  ? 109 GLY B O   1 
ATOM   7420  N N   . THR C  1 130 ? -13.37738 -34.57425  101.49801 1.000 46.76608  ? 110 THR B N   1 
ATOM   7421  C CA  . THR C  1 130 ? -13.18265 -34.71377  100.05907 1.000 44.83251  ? 110 THR B CA  1 
ATOM   7422  C C   . THR C  1 130 ? -12.52173 -36.03989  99.71277  1.000 48.24502  ? 110 THR B C   1 
ATOM   7423  O O   . THR C  1 130 ? -12.75368 -36.58328  98.62730  1.000 60.23405  ? 110 THR B O   1 
ATOM   7424  C CB  . THR C  1 130 ? -12.36643 -33.53862  99.51686  1.000 41.90988  ? 110 THR B CB  1 
ATOM   7425  O OG1 . THR C  1 130 ? -11.14050 -33.42021  100.24783 1.000 47.76845  ? 110 THR B OG1 1 
ATOM   7426  C CG2 . THR C  1 130 ? -13.15619 -32.24738  99.65071  1.000 39.83987  ? 110 THR B CG2 1 
ATOM   7427  N N   . ALA C  1 131 ? -11.71795 -36.58469  100.62377 1.000 39.80202  ? 111 ALA B N   1 
ATOM   7428  C CA  . ALA C  1 131 ? -11.11854 -37.89146  100.39408 1.000 46.17119  ? 111 ALA B CA  1 
ATOM   7429  C C   . ALA C  1 131 ? -12.12876 -39.00856  100.62010 1.000 48.67338  ? 111 ALA B C   1 
ATOM   7430  O O   . ALA C  1 131 ? -12.14664 -39.99900  99.87951  1.000 52.43335  ? 111 ALA B O   1 
ATOM   7431  C CB  . ALA C  1 131 ? -9.90122  -38.07325  101.30065 1.000 46.72174  ? 111 ALA B CB  1 
ATOM   7432  N N   . ASP C  1 132 ? -12.97673 -38.86157  101.63799 1.000 50.05674  ? 112 ASP B N   1 
ATOM   7433  C CA  . ASP C  1 132 ? -13.99755 -39.86586  101.89987 1.000 48.81116  ? 112 ASP B CA  1 
ATOM   7434  C C   . ASP C  1 132 ? -15.04021 -39.90522  100.79126 1.000 46.70474  ? 112 ASP B C   1 
ATOM   7435  O O   . ASP C  1 132 ? -15.63685 -40.95742  100.54325 1.000 45.61921  ? 112 ASP B O   1 
ATOM   7436  C CB  . ASP C  1 132 ? -14.66108 -39.58993  103.24732 1.000 45.83606  ? 112 ASP B CB  1 
ATOM   7437  C CG  . ASP C  1 132 ? -15.73267 -40.59705  103.58065 1.000 47.16062  ? 112 ASP B CG  1 
ATOM   7438  O OD1 . ASP C  1 132 ? -15.42099 -41.80658  103.59871 1.000 47.83513  ? 112 ASP B OD1 1 
ATOM   7439  O OD2 . ASP C  1 132 ? -16.88412 -40.17988  103.82575 1.000 47.99316  ? 112 ASP B OD2 1 
ATOM   7440  N N   . ALA C  1 133 ? -15.26902 -38.77689  100.11540 1.000 43.89964  ? 113 ALA B N   1 
ATOM   7441  C CA  . ALA C  1 133 ? -16.24419 -38.74882  99.02945  1.000 47.30227  ? 113 ALA B CA  1 
ATOM   7442  C C   . ALA C  1 133 ? -15.82265 -39.64616  97.87063  1.000 41.44341  ? 113 ALA B C   1 
ATOM   7443  O O   . ALA C  1 133 ? -16.67943 -40.21786  97.18935  1.000 38.81369  ? 113 ALA B O   1 
ATOM   7444  C CB  . ALA C  1 133 ? -16.46339 -37.30732  98.55407  1.000 38.65423  ? 113 ALA B CB  1 
ATOM   7445  N N   . VAL C  1 134 ? -14.52144 -39.79046  97.63921  1.000 48.01547  ? 114 VAL B N   1 
ATOM   7446  C CA  . VAL C  1 134 ? -14.03843 -40.72644  96.62758  1.000 46.22957  ? 114 VAL B CA  1 
ATOM   7447  C C   . VAL C  1 134 ? -13.89375 -42.13580  97.19170  1.000 46.27500  ? 114 VAL B C   1 
ATOM   7448  O O   . VAL C  1 134 ? -14.15340 -43.11262  96.48834  1.000 58.27176  ? 114 VAL B O   1 
ATOM   7449  C CB  . VAL C  1 134 ? -12.71034 -40.23070  96.02236  1.000 47.90696  ? 114 VAL B CB  1 
ATOM   7450  C CG1 . VAL C  1 134 ? -12.34141 -41.06887  94.79707  1.000 35.52715  ? 114 VAL B CG1 1 
ATOM   7451  C CG2 . VAL C  1 134 ? -12.80131 -38.75173  95.66511  1.000 35.21226  ? 114 VAL B CG2 1 
ATOM   7452  N N   . TYR C  1 135 ? -13.47261 -42.25721  98.45599  1.000 45.59465  ? 115 TYR B N   1 
ATOM   7453  C CA  . TYR C  1 135 ? -13.23603 -43.58221  99.02105  1.000 43.16496  ? 115 TYR B CA  1 
ATOM   7454  C C   . TYR C  1 135 ? -14.54679 -44.35037  99.18459  1.000 43.20074  ? 115 TYR B C   1 
ATOM   7455  O O   . TYR C  1 135 ? -14.56642 -45.57980  99.07981  1.000 43.65208  ? 115 TYR B O   1 
ATOM   7456  C CB  . TYR C  1 135 ? -12.49352 -43.49688  100.35931 1.000 45.90606  ? 115 TYR B CB  1 
ATOM   7457  C CG  . TYR C  1 135 ? -12.72786 -44.69630  101.25539 1.000 51.56543  ? 115 TYR B CG  1 
ATOM   7458  C CD1 . TYR C  1 135 ? -11.84620 -45.77364  101.23807 1.000 45.82395  ? 115 TYR B CD1 1 
ATOM   7459  C CD2 . TYR C  1 135 ? -13.81990 -44.75579  102.11661 1.000 47.45124  ? 115 TYR B CD2 1 
ATOM   7460  C CE1 . TYR C  1 135 ? -12.05752 -46.88304  102.03570 1.000 52.78372  ? 115 TYR B CE1 1 
ATOM   7461  C CE2 . TYR C  1 135 ? -14.03543 -45.86699  102.92061 1.000 49.17050  ? 115 TYR B CE2 1 
ATOM   7462  C CZ  . TYR C  1 135 ? -13.14884 -46.92162  102.87496 1.000 57.66113  ? 115 TYR B CZ  1 
ATOM   7463  O OH  . TYR C  1 135 ? -13.35732 -48.02242  103.67279 1.000 62.86165  ? 115 TYR B OH  1 
ATOM   7464  N N   A GLN C  1 136 ? -15.64849 -43.64800  99.45012  0.810 43.18892  ? 116 GLN B N   1 
ATOM   7465  N N   B GLN C  1 136 ? -15.64756 -43.64654  99.44826  0.190 43.18489  ? 116 GLN B N   1 
ATOM   7466  C CA  A GLN C  1 136 ? -16.92945 -44.33451  99.59337  0.810 44.75619  ? 116 GLN B CA  1 
ATOM   7467  C CA  B GLN C  1 136 ? -16.93956 -44.30874  99.59368  0.190 44.74317  ? 116 GLN B CA  1 
ATOM   7468  C C   A GLN C  1 136 ? -17.42829 -44.88854  98.26816  0.810 45.05436  ? 116 GLN B C   1 
ATOM   7469  C C   B GLN C  1 136 ? -17.49797 -44.79782  98.26680  0.190 44.63493  ? 116 GLN B C   1 
ATOM   7470  O O   A GLN C  1 136 ? -18.29461 -45.76885  98.26522  0.810 45.43977  ? 116 GLN B O   1 
ATOM   7471  O O   B GLN C  1 136 ? -18.48013 -45.54515  98.26495  0.190 45.41289  ? 116 GLN B O   1 
ATOM   7472  C CB  A GLN C  1 136 ? -17.97918 -43.39286  100.19454 0.810 45.80316  ? 116 GLN B CB  1 
ATOM   7473  C CB  B GLN C  1 136 ? -17.94354 -43.36721  100.26547 0.190 45.68945  ? 116 GLN B CB  1 
ATOM   7474  C CG  A GLN C  1 136 ? -17.72841 -43.00191  101.64961 0.810 47.21312  ? 116 GLN B CG  1 
ATOM   7475  C CG  B GLN C  1 136 ? -18.66074 -44.00661  101.44980 0.190 49.05144  ? 116 GLN B CG  1 
ATOM   7476  C CD  A GLN C  1 136 ? -17.64148 -44.19814  102.58444 0.810 51.58847  ? 116 GLN B CD  1 
ATOM   7477  C CD  B GLN C  1 136 ? -19.89148 -43.23946  101.89335 0.190 49.84155  ? 116 GLN B CD  1 
ATOM   7478  O OE1 A GLN C  1 136 ? -18.31320 -45.21288  102.38932 0.810 54.23430  ? 116 GLN B OE1 1 
ATOM   7479  O OE1 B GLN C  1 136 ? -21.02200 -43.64651  101.62391 0.190 51.57423  ? 116 GLN B OE1 1 
ATOM   7480  N NE2 A GLN C  1 136 ? -16.79473 -44.08647  103.60080 0.810 50.45997  ? 116 GLN B NE2 1 
ATOM   7481  N NE2 B GLN C  1 136 ? -19.67795 -42.13055  102.58992 0.190 49.89191  ? 116 GLN B NE2 1 
ATOM   7482  N N   . ASN C  1 137 ? -16.90011 -44.39293  97.14882  1.000 44.64035  ? 117 ASN B N   1 
ATOM   7483  C CA  . ASN C  1 137 ? -17.34276 -44.78712  95.82132  1.000 41.81598  ? 117 ASN B CA  1 
ATOM   7484  C C   . ASN C  1 137 ? -16.25310 -45.53898  95.07337  1.000 43.61927  ? 117 ASN B C   1 
ATOM   7485  O O   . ASN C  1 137 ? -16.20110 -45.49849  93.84358  1.000 41.17758  ? 117 ASN B O   1 
ATOM   7486  C CB  . ASN C  1 137 ? -17.80787 -43.56904  95.02723  1.000 40.01289  ? 117 ASN B CB  1 
ATOM   7487  C CG  . ASN C  1 137 ? -18.83651 -42.75320  95.78102  1.000 40.72165  ? 117 ASN B CG  1 
ATOM   7488  O OD1 . ASN C  1 137 ? -19.98261 -43.17005  95.92586  1.000 42.31278  ? 117 ASN B OD1 1 
ATOM   7489  N ND2 . ASN C  1 137 ? -18.43202 -41.58278  96.26518  1.000 40.00068  ? 117 ASN B ND2 1 
ATOM   7490  N N   . ILE C  1 138 ? -15.37407 -46.21830  95.81693  1.000 46.32448  ? 118 ILE B N   1 
ATOM   7491  C CA  . ILE C  1 138 ? -14.43626 -47.16417  95.21320  1.000 43.18743  ? 118 ILE B CA  1 
ATOM   7492  C C   . ILE C  1 138 ? -15.17786 -48.13355  94.30100  1.000 41.09432  ? 118 ILE B C   1 
ATOM   7493  O O   . ILE C  1 138 ? -14.78421 -48.36231  93.15110  1.000 40.89239  ? 118 ILE B O   1 
ATOM   7494  C CB  . ILE C  1 138 ? -13.66142 -47.92492  96.30555  1.000 45.32848  ? 118 ILE B CB  1 
ATOM   7495  C CG1 . ILE C  1 138 ? -12.74876 -46.99701  97.10749  1.000 47.77268  ? 118 ILE B CG1 1 
ATOM   7496  C CG2 . ILE C  1 138 ? -12.85614 -49.04476  95.69471  1.000 42.12450  ? 118 ILE B CG2 1 
ATOM   7497  C CD1 . ILE C  1 138 ? -12.01924 -45.98942  96.28731  1.000 52.23911  ? 118 ILE B CD1 1 
ATOM   7498  N N   . ASP C  1 139 ? -16.27246 -48.71236  94.80433  1.000 42.80069  ? 119 ASP B N   1 
ATOM   7499  C CA  . ASP C  1 139 ? -16.98569 -49.74793  94.06231  1.000 49.06224  ? 119 ASP B CA  1 
ATOM   7500  C C   . ASP C  1 139 ? -17.68233 -49.20407  92.82088  1.000 55.13578  ? 119 ASP B C   1 
ATOM   7501  O O   . ASP C  1 139 ? -18.08223 -49.99363  91.96012  1.000 49.91763  ? 119 ASP B O   1 
ATOM   7502  C CB  . ASP C  1 139 ? -18.00079 -50.44928  94.97020  1.000 46.20526  ? 119 ASP B CB  1 
ATOM   7503  C CG  . ASP C  1 139 ? -19.02118 -49.49151  95.55714  1.000 54.90543  ? 119 ASP B CG  1 
ATOM   7504  O OD1 . ASP C  1 139 ? -18.72514 -48.28085  95.62570  1.000 49.49618  ? 119 ASP B OD1 1 
ATOM   7505  O OD2 . ASP C  1 139 ? -20.11258 -49.94840  95.95919  1.000 58.74896  ? 119 ASP B OD2 1 
ATOM   7506  N N   . ILE C  1 140 ? -17.84556 -47.88357  92.71353  1.000 41.56453  ? 120 ILE B N   1 
ATOM   7507  C CA  . ILE C  1 140 ? -18.30986 -47.29031  91.46361  1.000 52.91309  ? 120 ILE B CA  1 
ATOM   7508  C C   . ILE C  1 140 ? -17.16323 -47.19481  90.46824  1.000 52.14665  ? 120 ILE B C   1 
ATOM   7509  O O   . ILE C  1 140 ? -17.35359 -47.36580  89.25894  1.000 52.63958  ? 120 ILE B O   1 
ATOM   7510  C CB  . ILE C  1 140 ? -18.93517 -45.90391  91.72094  1.000 46.41673  ? 120 ILE B CB  1 
ATOM   7511  C CG1 . ILE C  1 140 ? -20.02387 -45.97853  92.79797  1.000 45.95674  ? 120 ILE B CG1 1 
ATOM   7512  C CG2 . ILE C  1 140 ? -19.47406 -45.31069  90.41712  1.000 39.38577  ? 120 ILE B CG2 1 
ATOM   7513  C CD1 . ILE C  1 140 ? -21.41066 -46.27719  92.25708  1.000 50.84632  ? 120 ILE B CD1 1 
ATOM   7514  N N   . ILE C  1 141 ? -15.95812 -46.92673  90.96361  1.000 51.83733  ? 121 ILE B N   1 
ATOM   7515  C CA  . ILE C  1 141 ? -14.82760 -46.65179  90.08917  1.000 44.45690  ? 121 ILE B CA  1 
ATOM   7516  C C   . ILE C  1 141 ? -14.23610 -47.94479  89.53776  1.000 37.40999  ? 121 ILE B C   1 
ATOM   7517  O O   . ILE C  1 141 ? -14.02705 -48.07521  88.32708  1.000 49.71863  ? 121 ILE B O   1 
ATOM   7518  C CB  . ILE C  1 141 ? -13.77566 -45.82546  90.85129  1.000 36.17826  ? 121 ILE B CB  1 
ATOM   7519  C CG1 . ILE C  1 141 ? -14.17855 -44.34740  90.89120  1.000 43.24092  ? 121 ILE B CG1 1 
ATOM   7520  C CG2 . ILE C  1 141 ? -12.39625 -46.01118  90.24165  1.000 35.65925  ? 121 ILE B CG2 1 
ATOM   7521  C CD1 . ILE C  1 141 ? -13.59582 -43.59788  92.07021  1.000 35.27099  ? 121 ILE B CD1 1 
ATOM   7522  N N   . GLU C  1 142 ? -13.97148 -48.91981  90.41103  1.000 38.53398  ? 122 GLU B N   1 
ATOM   7523  C CA  . GLU C  1 142 ? -13.18439 -50.08979  90.01411  1.000 50.05300  ? 122 GLU B CA  1 
ATOM   7524  C C   . GLU C  1 142 ? -13.77349 -50.90072  88.85961  1.000 39.58109  ? 122 GLU B C   1 
ATOM   7525  O O   . GLU C  1 142 ? -12.98600 -51.37572  88.02293  1.000 46.54205  ? 122 GLU B O   1 
ATOM   7526  C CB  . GLU C  1 142 ? -12.93588 -50.98920  91.23679  1.000 46.83234  ? 122 GLU B CB  1 
ATOM   7527  C CG  . GLU C  1 142 ? -11.55999 -50.76655  91.86995  1.000 56.97978  ? 122 GLU B CG  1 
ATOM   7528  C CD  . GLU C  1 142 ? -11.50270 -51.14964  93.34197  1.000 57.73830  ? 122 GLU B CD  1 
ATOM   7529  O OE1 . GLU C  1 142 ? -12.52445 -51.64662  93.87078  1.000 54.39412  ? 122 GLU B OE1 1 
ATOM   7530  O OE2 . GLU C  1 142 ? -10.44745 -50.91213  93.97758  1.000 43.47337  ? 122 GLU B OE2 1 
ATOM   7531  N N   . PRO C  1 143 ? -15.09755 -51.12039  88.75050  1.000 40.44810  ? 123 PRO B N   1 
ATOM   7532  C CA  . PRO C  1 143 ? -15.63446 -51.76420  87.53651  1.000 41.04369  ? 123 PRO B CA  1 
ATOM   7533  C C   . PRO C  1 143 ? -15.23865 -51.08222  86.23166  1.000 39.82899  ? 123 PRO B C   1 
ATOM   7534  O O   . PRO C  1 143 ? -15.20692 -51.72995  85.18249  1.000 40.33655  ? 123 PRO B O   1 
ATOM   7535  C CB  . PRO C  1 143 ? -17.15242 -51.69900  87.75302  1.000 42.20195  ? 123 PRO B CB  1 
ATOM   7536  C CG  . PRO C  1 143 ? -17.30529 -51.78431  89.22944  1.000 46.43531  ? 123 PRO B CG  1 
ATOM   7537  C CD  . PRO C  1 143 ? -16.11120 -51.05526  89.82057  1.000 45.06420  ? 123 PRO B CD  1 
ATOM   7538  N N   . TYR C  1 144 ? -14.94736 -49.78093  86.26654  1.000 45.67726  ? 124 TYR B N   1 
ATOM   7539  C CA  . TYR C  1 144 ? -14.46950 -49.09718  85.07132  1.000 39.13008  ? 124 TYR B CA  1 
ATOM   7540  C C   . TYR C  1 144 ? -12.97053 -49.26505  84.86219  1.000 37.08419  ? 124 TYR B C   1 
ATOM   7541  O O   . TYR C  1 144 ? -12.50225 -49.15892  83.72279  1.000 36.94591  ? 124 TYR B O   1 
ATOM   7542  C CB  . TYR C  1 144 ? -14.79701 -47.60337  85.13511  1.000 36.41947  ? 124 TYR B CB  1 
ATOM   7543  C CG  . TYR C  1 144 ? -16.27190 -47.28711  85.23209  1.000 42.91481  ? 124 TYR B CG  1 
ATOM   7544  C CD1 . TYR C  1 144 ? -17.21325 -48.00360  84.49816  1.000 45.05100  ? 124 TYR B CD1 1 
ATOM   7545  C CD2 . TYR C  1 144 ? -16.72439 -46.26652  86.05689  1.000 36.51282  ? 124 TYR B CD2 1 
ATOM   7546  C CE1 . TYR C  1 144 ? -18.56712 -47.70670  84.59287  1.000 48.22565  ? 124 TYR B CE1 1 
ATOM   7547  C CE2 . TYR C  1 144 ? -18.06787 -45.96373  86.15709  1.000 37.28670  ? 124 TYR B CE2 1 
ATOM   7548  C CZ  . TYR C  1 144 ? -18.98506 -46.67642  85.42255  1.000 38.61813  ? 124 TYR B CZ  1 
ATOM   7549  O OH  . TYR C  1 144 ? -20.32156 -46.37167  85.53144  1.000 39.72824  ? 124 TYR B OH  1 
ATOM   7550  N N   . ALA C  1 145 ? -12.21731 -49.51904  85.93340  1.000 37.15703  ? 125 ALA B N   1 
ATOM   7551  C CA  . ALA C  1 145 ? -10.76380 -49.63708  85.92322  1.000 37.07647  ? 125 ALA B CA  1 
ATOM   7552  C C   . ALA C  1 145 ? -10.09041 -48.56332  85.07542  1.000 36.23500  ? 125 ALA B C   1 
ATOM   7553  O O   . ALA C  1 145 ? -9.29261  -48.89855  84.19153  1.000 37.31239  ? 125 ALA B O   1 
ATOM   7554  C CB  . ALA C  1 145 ? -10.34831 -51.02100  85.41764  1.000 38.18131  ? 125 ALA B CB  1 
ATOM   7555  N N   . PRO C  1 146 ? -10.36909 -47.27588  85.28992  1.000 35.30414  ? 126 PRO B N   1 
ATOM   7556  C CA  . PRO C  1 146 ? -9.62789  -46.25446  84.54809  1.000 34.76764  ? 126 PRO B CA  1 
ATOM   7557  C C   . PRO C  1 146 ? -8.16560  -46.29761  84.95644  1.000 42.08742  ? 126 PRO B C   1 
ATOM   7558  O O   . PRO C  1 146 ? -7.82581  -46.65793  86.08552  1.000 35.50087  ? 126 PRO B O   1 
ATOM   7559  C CB  . PRO C  1 146 ? -10.29952 -44.94430  84.97362  1.000 36.20258  ? 126 PRO B CB  1 
ATOM   7560  C CG  . PRO C  1 146 ? -10.77375 -45.22671  86.36334  1.000 41.76453  ? 126 PRO B CG  1 
ATOM   7561  C CD  . PRO C  1 146 ? -11.21557 -46.67745  86.33938  1.000 38.70552  ? 126 PRO B CD  1 
ATOM   7562  N N   . GLU C  1 147 ? -7.28468  -45.98544  84.00480  1.000 42.00490  ? 127 GLU B N   1 
ATOM   7563  C CA  . GLU C  1 147 ? -5.86517  -45.94045  84.33953  1.000 38.96311  ? 127 GLU B CA  1 
ATOM   7564  C C   . GLU C  1 147 ? -5.54848  -44.71907  85.18066  1.000 35.78795  ? 127 GLU B C   1 
ATOM   7565  O O   . GLU C  1 147 ? -4.68553  -44.77592  86.06398  1.000 46.96509  ? 127 GLU B O   1 
ATOM   7566  C CB  . GLU C  1 147 ? -5.01712  -45.94374  83.06680  1.000 37.00418  ? 127 GLU B CB  1 
ATOM   7567  C CG  . GLU C  1 147 ? -3.77532  -46.81678  83.14529  1.000 59.24539  ? 127 GLU B CG  1 
ATOM   7568  C CD  . GLU C  1 147 ? -4.09964  -48.26555  83.49408  1.000 60.66410  ? 127 GLU B CD  1 
ATOM   7569  O OE1 . GLU C  1 147 ? -4.76984  -48.95571  82.68756  1.000 51.93235  ? 127 GLU B OE1 1 
ATOM   7570  O OE2 . GLU C  1 147 ? -3.68383  -48.71043  84.58798  1.000 56.08284  ? 127 GLU B OE2 1 
ATOM   7571  N N   . TYR C  1 148 ? -6.26012  -43.62353  84.94639  1.000 34.77900  ? 128 TYR B N   1 
ATOM   7572  C CA  . TYR C  1 148 ? -5.96928  -42.34385  85.56742  1.000 35.60767  ? 128 TYR B CA  1 
ATOM   7573  C C   . TYR C  1 148 ? -7.21924  -41.79459  86.22548  1.000 33.43951  ? 128 TYR B C   1 
ATOM   7574  O O   . TYR C  1 148 ? -8.34289  -42.02159  85.76340  1.000 32.96818  ? 128 TYR B O   1 
ATOM   7575  C CB  . TYR C  1 148 ? -5.47478  -41.34216  84.54860  1.000 34.58137  ? 128 TYR B CB  1 
ATOM   7576  C CG  . TYR C  1 148 ? -4.45392  -41.92059  83.60972  1.000 35.79698  ? 128 TYR B CG  1 
ATOM   7577  C CD1 . TYR C  1 148 ? -3.23473  -42.37822  84.07999  1.000 37.01270  ? 128 TYR B CD1 1 
ATOM   7578  C CD2 . TYR C  1 148 ? -4.72140  -42.03663  82.25104  1.000 39.33280  ? 128 TYR B CD2 1 
ATOM   7579  C CE1 . TYR C  1 148 ? -2.28809  -42.91170  83.22041  1.000 42.51474  ? 128 TYR B CE1 1 
ATOM   7580  C CE2 . TYR C  1 148 ? -3.78050  -42.57457  81.37479  1.000 40.00531  ? 128 TYR B CE2 1 
ATOM   7581  C CZ  . TYR C  1 148 ? -2.56270  -43.01060  81.86999  1.000 43.58616  ? 128 TYR B CZ  1 
ATOM   7582  O OH  . TYR C  1 148 ? -1.60973  -43.54697  81.03159  1.000 47.49895  ? 128 TYR B OH  1 
ATOM   7583  N N   . MET C  1 149 ? -7.02351  -41.05384  87.30209  1.000 45.54067  ? 129 MET B N   1 
ATOM   7584  C CA  . MET C  1 149 ? -8.12970  -40.33490  87.90676  1.000 39.61138  ? 129 MET B CA  1 
ATOM   7585  C C   . MET C  1 149 ? -7.73953  -38.88661  88.11993  1.000 35.68405  ? 129 MET B C   1 
ATOM   7586  O O   . MET C  1 149 ? -6.71217  -38.59646  88.73911  1.000 40.98422  ? 129 MET B O   1 
ATOM   7587  C CB  . MET C  1 149 ? -8.57356  -41.00979  89.20109  1.000 39.75215  ? 129 MET B CB  1 
ATOM   7588  C CG  . MET C  1 149 ? -9.17706  -42.36812  88.88515  1.000 33.22898  ? 129 MET B CG  1 
ATOM   7589  S SD  . MET C  1 149 ? -10.59597 -42.81148  89.88315  1.000 43.95785  ? 129 MET B SD  1 
ATOM   7590  C CE  . MET C  1 149 ? -11.55187 -41.30362  89.84206  1.000 36.15066  ? 129 MET B CE  1 
ATOM   7591  N N   . VAL C  1 150 ? -8.55878  -37.98868  87.58084  1.000 39.13292  ? 130 VAL B N   1 
ATOM   7592  C CA  . VAL C  1 150 ? -8.35320  -36.55157  87.66060  1.000 39.03212  ? 130 VAL B CA  1 
ATOM   7593  C C   . VAL C  1 150 ? -9.37241  -36.01485  88.65437  1.000 46.41050  ? 130 VAL B C   1 
ATOM   7594  O O   . VAL C  1 150 ? -10.56488 -35.91433  88.34304  1.000 46.13318  ? 130 VAL B O   1 
ATOM   7595  C CB  . VAL C  1 150 ? -8.49720  -35.87695  86.29312  1.000 33.81503  ? 130 VAL B CB  1 
ATOM   7596  C CG1 . VAL C  1 150 ? -8.01949  -34.43083  86.36121  1.000 31.43447  ? 130 VAL B CG1 1 
ATOM   7597  C CG2 . VAL C  1 150 ? -7.73137  -36.65465  85.23756  1.000 33.57145  ? 130 VAL B CG2 1 
ATOM   7598  N N   . ILE C  1 151 ? -8.90311  -35.67389  89.85138  1.000 43.62763  ? 131 ILE B N   1 
ATOM   7599  C CA  . ILE C  1 151 ? -9.75851  -35.13322  90.90172  1.000 35.61474  ? 131 ILE B CA  1 
ATOM   7600  C C   . ILE C  1 151 ? -9.95025  -33.64278  90.65211  1.000 40.29588  ? 131 ILE B C   1 
ATOM   7601  O O   . ILE C  1 151 ? -8.97833  -32.87974  90.61823  1.000 33.48914  ? 131 ILE B O   1 
ATOM   7602  C CB  . ILE C  1 151 ? -9.15355  -35.38831  92.28825  1.000 32.53391  ? 131 ILE B CB  1 
ATOM   7603  C CG1 . ILE C  1 151 ? -8.89509  -36.88411  92.48976  1.000 34.12290  ? 131 ILE B CG1 1 
ATOM   7604  C CG2 . ILE C  1 151 ? -10.04574 -34.80505  93.38503  1.000 32.62597  ? 131 ILE B CG2 1 
ATOM   7605  C CD1 . ILE C  1 151 ? -10.09671 -37.76648  92.21658  1.000 37.91328  ? 131 ILE B CD1 1 
ATOM   7606  N N   . LEU C  1 152 ? -11.20521 -33.22312  90.49949  1.000 32.26131  ? 132 LEU B N   1 
ATOM   7607  C CA  . LEU C  1 152 ? -11.54199 -31.87016  90.08433  1.000 33.22331  ? 132 LEU B CA  1 
ATOM   7608  C C   . LEU C  1 152 ? -12.28362 -31.13242  91.19058  1.000 36.60054  ? 132 LEU B C   1 
ATOM   7609  O O   . LEU C  1 152 ? -13.20290 -31.68062  91.80735  1.000 36.94739  ? 132 LEU B O   1 
ATOM   7610  C CB  . LEU C  1 152 ? -12.41416 -31.89755  88.82984  1.000 31.21532  ? 132 LEU B CB  1 
ATOM   7611  C CG  . LEU C  1 152 ? -11.74726 -32.40441  87.55299  1.000 40.52145  ? 132 LEU B CG  1 
ATOM   7612  C CD1 . LEU C  1 152 ? -12.63958 -32.16042  86.33463  1.000 29.54064  ? 132 LEU B CD1 1 
ATOM   7613  C CD2 . LEU C  1 152 ? -10.39481 -31.72036  87.38235  1.000 47.92807  ? 132 LEU B CD2 1 
ATOM   7614  N N   . ALA C  1 153 ? -11.88105 -29.88982  91.44167  1.000 38.07804  ? 133 ALA B N   1 
ATOM   7615  C CA  . ALA C  1 153 ? -12.72630 -28.98023  92.20111  1.000 30.93695  ? 133 ALA B CA  1 
ATOM   7616  C C   . ALA C  1 153 ? -13.87228 -28.52699  91.31129  1.000 30.43900  ? 133 ALA B C   1 
ATOM   7617  O O   . ALA C  1 153 ? -13.66395 -28.19005  90.14315  1.000 41.59380  ? 133 ALA B O   1 
ATOM   7618  C CB  . ALA C  1 153 ? -11.92340 -27.78305  92.69274  1.000 31.45953  ? 133 ALA B CB  1 
ATOM   7619  N N   . GLY C  1 154 ? -15.08746 -28.55785  91.84281  1.000 30.71852  ? 134 GLY B N   1 
ATOM   7620  C CA  . GLY C  1 154 ? -16.25601 -28.19951  91.07142  1.000 36.51735  ? 134 GLY B CA  1 
ATOM   7621  C C   . GLY C  1 154 ? -16.80282 -26.80368  91.28885  1.000 37.38298  ? 134 GLY B C   1 
ATOM   7622  O O   . GLY C  1 154 ? -17.92587 -26.53013  90.84800  1.000 39.16975  ? 134 GLY B O   1 
ATOM   7623  N N   . ASP C  1 155 ? -16.05532 -25.90514  91.93704  1.000 31.06563  ? 135 ASP B N   1 
ATOM   7624  C CA  . ASP C  1 155 ? -16.58694 -24.59567  92.30803  1.000 31.74742  ? 135 ASP B CA  1 
ATOM   7625  C C   . ASP C  1 155 ? -15.75401 -23.44200  91.75550  1.000 34.42547  ? 135 ASP B C   1 
ATOM   7626  O O   . ASP C  1 155 ? -15.77150 -22.34035  92.30795  1.000 53.79495  ? 135 ASP B O   1 
ATOM   7627  C CB  . ASP C  1 155 ? -16.71405 -24.47480  93.82512  1.000 38.47989  ? 135 ASP B CB  1 
ATOM   7628  C CG  . ASP C  1 155 ? -15.36928 -24.43791  94.52731  1.000 39.94192  ? 135 ASP B CG  1 
ATOM   7629  O OD1 . ASP C  1 155 ? -14.54874 -25.35971  94.31616  1.000 43.82092  ? 135 ASP B OD1 1 
ATOM   7630  O OD2 . ASP C  1 155 ? -15.13783 -23.48871  95.30073  1.000 40.32164  ? 135 ASP B OD2 1 
ATOM   7631  N N   . HIS C  1 156 ? -15.03648 -23.66718  90.65744  1.000 30.88622  ? 136 HIS B N   1 
ATOM   7632  C CA  . HIS C  1 156 ? -14.22536 -22.63408  90.03216  1.000 31.06138  ? 136 HIS B CA  1 
ATOM   7633  C C   . HIS C  1 156 ? -14.58004 -22.51468  88.55519  1.000 32.53171  ? 136 HIS B C   1 
ATOM   7634  O O   . HIS C  1 156 ? -15.15200 -23.42658  87.95389  1.000 30.39685  ? 136 HIS B O   1 
ATOM   7635  C CB  . HIS C  1 156 ? -12.72542 -22.90533  90.21278  1.000 31.35744  ? 136 HIS B CB  1 
ATOM   7636  C CG  . HIS C  1 156 ? -12.33130 -23.17962  91.63224  1.000 31.86138  ? 136 HIS B CG  1 
ATOM   7637  N ND1 . HIS C  1 156 ? -11.18218 -23.86067  91.97309  1.000 38.00432  ? 136 HIS B ND1 1 
ATOM   7638  C CD2 . HIS C  1 156 ? -12.93757 -22.86070  92.80098  1.000 32.30016  ? 136 HIS B CD2 1 
ATOM   7639  C CE1 . HIS C  1 156 ? -11.09765 -23.94615  93.28996  1.000 42.30306  ? 136 HIS B CE1 1 
ATOM   7640  N NE2 . HIS C  1 156 ? -12.15158 -23.34851  93.81532  1.000 40.17843  ? 136 HIS B NE2 1 
ATOM   7641  N N   . ILE C  1 157 ? -14.25707 -21.35614  87.98173  1.000 37.66363  ? 137 ILE B N   1 
ATOM   7642  C CA  . ILE C  1 157 ? -14.60576 -21.03013  86.60221  1.000 38.93780  ? 137 ILE B CA  1 
ATOM   7643  C C   . ILE C  1 157 ? -13.31571 -20.87987  85.81365  1.000 44.18158  ? 137 ILE B C   1 
ATOM   7644  O O   . ILE C  1 157 ? -12.60452 -19.87551  85.95432  1.000 39.39430  ? 137 ILE B O   1 
ATOM   7645  C CB  . ILE C  1 157 ? -15.46072 -19.76543  86.51278  1.000 31.71816  ? 137 ILE B CB  1 
ATOM   7646  C CG1 . ILE C  1 157 ? -16.73152 -19.96096  87.33587  1.000 35.74803  ? 137 ILE B CG1 1 
ATOM   7647  C CG2 . ILE C  1 157 ? -15.80537 -19.47831  85.06141  1.000 32.03491  ? 137 ILE B CG2 1 
ATOM   7648  C CD1 . ILE C  1 157 ? -17.26187 -18.70588  87.95240  1.000 34.01568  ? 137 ILE B CD1 1 
ATOM   7649  N N   . TYR C  1 158 ? -13.02195 -21.86938  84.97434  1.000 34.99434  ? 138 TYR B N   1 
ATOM   7650  C CA  . TYR C  1 158 ? -11.73797 -21.94887  84.29520  1.000 32.20033  ? 138 TYR B CA  1 
ATOM   7651  C C   . TYR C  1 158 ? -11.82590 -22.98605  83.18696  1.000 38.36047  ? 138 TYR B C   1 
ATOM   7652  O O   . TYR C  1 158 ? -12.57169 -23.96671  83.29149  1.000 31.69532  ? 138 TYR B O   1 
ATOM   7653  C CB  . TYR C  1 158 ? -10.61971 -22.32420  85.27208  1.000 32.40570  ? 138 TYR B CB  1 
ATOM   7654  C CG  . TYR C  1 158 ? -10.66777 -23.78500  85.66887  1.000 36.94428  ? 138 TYR B CG  1 
ATOM   7655  C CD1 . TYR C  1 158 ? -9.73193  -24.68960  85.18904  1.000 32.01195  ? 138 TYR B CD1 1 
ATOM   7656  C CD2 . TYR C  1 158 ? -11.66745 -24.25832  86.50524  1.000 30.93057  ? 138 TYR B CD2 1 
ATOM   7657  C CE1 . TYR C  1 158 ? -9.78384  -26.02271  85.54279  1.000 35.06576  ? 138 TYR B CE1 1 
ATOM   7658  C CE2 . TYR C  1 158 ? -11.72860 -25.57879  86.86400  1.000 46.00255  ? 138 TYR B CE2 1 
ATOM   7659  C CZ  . TYR C  1 158 ? -10.78490 -26.46136  86.38137  1.000 40.86575  ? 138 TYR B CZ  1 
ATOM   7660  O OH  . TYR C  1 158 ? -10.85315 -27.77983  86.74959  1.000 30.35898  ? 138 TYR B OH  1 
ATOM   7661  N N   . LYS C  1 159 ? -11.04649 -22.76147  82.13488  1.000 43.45214  ? 139 LYS B N   1 
ATOM   7662  C CA  . LYS C  1 159 ? -10.90606 -23.69582  81.02779  1.000 44.15625  ? 139 LYS B CA  1 
ATOM   7663  C C   . LYS C  1 159 ? -9.48755  -24.25313  81.02066  1.000 44.03974  ? 139 LYS B C   1 
ATOM   7664  O O   . LYS C  1 159 ? -8.51654  -23.49109  81.10393  1.000 40.81074  ? 139 LYS B O   1 
ATOM   7665  C CB  . LYS C  1 159 ? -11.22386 -23.00958  79.69846  1.000 34.25162  ? 139 LYS B CB  1 
ATOM   7666  C CG  . LYS C  1 159 ? -12.65077 -22.53484  79.59665  1.000 33.85120  ? 139 LYS B CG  1 
ATOM   7667  C CD  . LYS C  1 159 ? -12.88376 -21.75458  78.31571  1.000 35.09820  ? 139 LYS B CD  1 
ATOM   7668  C CE  . LYS C  1 159 ? -12.34899 -20.33214  78.42048  1.000 35.99823  ? 139 LYS B CE  1 
ATOM   7669  N NZ  . LYS C  1 159 ? -12.85943 -19.49008  77.30328  1.000 38.74003  ? 139 LYS B NZ  1 
ATOM   7670  N N   . MET C  1 160 ? -9.36998  -25.57712  80.92654  1.000 34.56574  ? 140 MET B N   1 
ATOM   7671  C CA  . MET C  1 160 ? -8.06894  -26.22999  80.97317  1.000 34.33690  ? 140 MET B CA  1 
ATOM   7672  C C   . MET C  1 160 ? -8.15375  -27.57486  80.26465  1.000 39.14905  ? 140 MET B C   1 
ATOM   7673  O O   . MET C  1 160 ? -9.14444  -28.29408  80.40964  1.000 37.77429  ? 140 MET B O   1 
ATOM   7674  C CB  . MET C  1 160 ? -7.59388  -26.42328  82.41563  1.000 33.94093  ? 140 MET B CB  1 
ATOM   7675  C CG  . MET C  1 160 ? -6.53358  -27.48907  82.54684  1.000 50.59962  ? 140 MET B CG  1 
ATOM   7676  S SD  . MET C  1 160 ? -5.48437  -27.25844  83.97448  1.000 58.63154  ? 140 MET B SD  1 
ATOM   7677  C CE  . MET C  1 160 ? -6.63989  -27.56036  85.27876  1.000 33.53866  ? 140 MET B CE  1 
ATOM   7678  N N   . ASP C  1 161 ? -7.10908  -27.90361  79.50346  1.000 42.94550  ? 141 ASP B N   1 
ATOM   7679  C CA  . ASP C  1 161 ? -7.02344  -29.16516  78.76834  1.000 42.46635  ? 141 ASP B CA  1 
ATOM   7680  C C   . ASP C  1 161 ? -6.26522  -30.17241  79.62740  1.000 44.29312  ? 141 ASP B C   1 
ATOM   7681  O O   . ASP C  1 161 ? -5.03437  -30.14725  79.69488  1.000 46.15594  ? 141 ASP B O   1 
ATOM   7682  C CB  . ASP C  1 161 ? -6.34058  -28.94815  77.42106  1.000 47.79318  ? 141 ASP B CB  1 
ATOM   7683  C CG  . ASP C  1 161 ? -6.31857  -30.20258  76.55603  1.000 43.48167  ? 141 ASP B CG  1 
ATOM   7684  O OD1 . ASP C  1 161 ? -6.49594  -31.31293  77.09221  1.000 42.91904  ? 141 ASP B OD1 1 
ATOM   7685  O OD2 . ASP C  1 161 ? -6.11082  -30.08055  75.32977  1.000 44.03628  ? 141 ASP B OD2 1 
ATOM   7686  N N   . TYR C  1 162 ? -7.00023  -31.09763  80.24913  1.000 45.75850  ? 142 TYR B N   1 
ATOM   7687  C CA  . TYR C  1 162 ? -6.40406  -32.03909  81.19211  1.000 40.65367  ? 142 TYR B CA  1 
ATOM   7688  C C   . TYR C  1 162 ? -5.44502  -33.03104  80.54706  1.000 38.80026  ? 142 TYR B C   1 
ATOM   7689  O O   . TYR C  1 162 ? -4.76471  -33.76250  81.27563  1.000 39.49910  ? 142 TYR B O   1 
ATOM   7690  C CB  . TYR C  1 162 ? -7.49349  -32.80654  81.93161  1.000 41.89368  ? 142 TYR B CB  1 
ATOM   7691  C CG  . TYR C  1 162 ? -8.42402  -31.91669  82.71083  1.000 39.07468  ? 142 TYR B CG  1 
ATOM   7692  C CD1 . TYR C  1 162 ? -9.79162  -31.98213  82.51887  1.000 39.85273  ? 142 TYR B CD1 1 
ATOM   7693  C CD2 . TYR C  1 162 ? -7.93214  -31.00743  83.63311  1.000 42.21118  ? 142 TYR B CD2 1 
ATOM   7694  C CE1 . TYR C  1 162 ? -10.63806 -31.19077  83.23108  1.000 36.82695  ? 142 TYR B CE1 1 
ATOM   7695  C CE2 . TYR C  1 162 ? -8.77899  -30.19227  84.34541  1.000 46.81267  ? 142 TYR B CE2 1 
ATOM   7696  C CZ  . TYR C  1 162 ? -10.13390 -30.28475  84.13701  1.000 37.91566  ? 142 TYR B CZ  1 
ATOM   7697  O OH  . TYR C  1 162 ? -10.99526 -29.47383  84.84363  1.000 36.55116  ? 142 TYR B OH  1 
ATOM   7698  N N   . GLU C  1 163 ? -5.37380  -33.08596  79.21684  1.000 38.68470  ? 143 GLU B N   1 
ATOM   7699  C CA  . GLU C  1 163 ? -4.41766  -33.98306  78.57752  1.000 40.34887  ? 143 GLU B CA  1 
ATOM   7700  C C   . GLU C  1 163 ? -2.98284  -33.60214  78.93689  1.000 43.27964  ? 143 GLU B C   1 
ATOM   7701  O O   . GLU C  1 163 ? -2.12900  -34.47784  79.12733  1.000 44.61530  ? 143 GLU B O   1 
ATOM   7702  C CB  . GLU C  1 163 ? -4.63194  -33.97816  77.06143  1.000 39.07806  ? 143 GLU B CB  1 
ATOM   7703  C CG  . GLU C  1 163 ? -3.75265  -34.96033  76.28011  1.000 40.68546  ? 143 GLU B CG  1 
ATOM   7704  C CD  . GLU C  1 163 ? -4.16210  -36.41452  76.45365  1.000 38.93105  ? 143 GLU B CD  1 
ATOM   7705  O OE1 . GLU C  1 163 ? -3.27211  -37.28872  76.38495  1.000 48.03558  ? 143 GLU B OE1 1 
ATOM   7706  O OE2 . GLU C  1 163 ? -5.36805  -36.68760  76.64680  1.000 46.33685  ? 143 GLU B OE2 1 
ATOM   7707  N N   . TYR C  1 164 ? -2.70507  -32.30141  79.06072  1.000 41.98694  ? 144 TYR B N   1 
ATOM   7708  C CA  . TYR C  1 164 ? -1.36100  -31.85830  79.42874  1.000 43.80057  ? 144 TYR B CA  1 
ATOM   7709  C C   . TYR C  1 164 ? -0.96460  -32.35957  80.81228  1.000 48.44778  ? 144 TYR B C   1 
ATOM   7710  O O   . TYR C  1 164 ? 0.17625   -32.78966  81.01996  1.000 55.45347  ? 144 TYR B O   1 
ATOM   7711  C CB  . TYR C  1 164 ? -1.27846  -30.33269  79.38124  1.000 46.93237  ? 144 TYR B CB  1 
ATOM   7712  C CG  . TYR C  1 164 ? -1.28704  -29.76748  77.98429  1.000 48.02974  ? 144 TYR B CG  1 
ATOM   7713  C CD1 . TYR C  1 164 ? -0.10052  -29.53618  77.29916  1.000 53.40303  ? 144 TYR B CD1 1 
ATOM   7714  C CD2 . TYR C  1 164 ? -2.48252  -29.48100  77.34297  1.000 42.91853  ? 144 TYR B CD2 1 
ATOM   7715  C CE1 . TYR C  1 164 ? -0.10701  -29.02604  76.01535  1.000 55.53569  ? 144 TYR B CE1 1 
ATOM   7716  C CE2 . TYR C  1 164 ? -2.50189  -28.97543  76.06016  1.000 44.64066  ? 144 TYR B CE2 1 
ATOM   7717  C CZ  . TYR C  1 164 ? -1.31154  -28.74806  75.39922  1.000 56.49166  ? 144 TYR B CZ  1 
ATOM   7718  O OH  . TYR C  1 164 ? -1.32812  -28.23810  74.11978  1.000 57.77328  ? 144 TYR B OH  1 
ATOM   7719  N N   . MET C  1 165 ? -1.88950  -32.30016  81.77516  1.000 43.40276  ? 145 MET B N   1 
ATOM   7720  C CA  . MET C  1 165 ? -1.59150  -32.77829  83.12254  1.000 44.09543  ? 145 MET B CA  1 
ATOM   7721  C C   . MET C  1 165 ? -1.34242  -34.28058  83.13185  1.000 49.25721  ? 145 MET B C   1 
ATOM   7722  O O   . MET C  1 165 ? -0.48183  -34.77086  83.87310  1.000 45.00239  ? 145 MET B O   1 
ATOM   7723  C CB  . MET C  1 165 ? -2.73850  -32.42882  84.07132  1.000 54.06001  ? 145 MET B CB  1 
ATOM   7724  C CG  . MET C  1 165 ? -2.44754  -31.29918  85.03434  1.000 54.33091  ? 145 MET B CG  1 
ATOM   7725  S SD  . MET C  1 165 ? -3.75768  -31.04114  86.25048  1.000 48.17667  ? 145 MET B SD  1 
ATOM   7726  C CE  . MET C  1 165 ? -2.99456  -31.70494  87.72750  1.000 53.22193  ? 145 MET B CE  1 
ATOM   7727  N N   . LEU C  1 166 ? -2.09781  -35.02881  82.32550  1.000 42.54849  ? 146 LEU B N   1 
ATOM   7728  C CA  . LEU C  1 166 ? -1.92407  -36.47615  82.28172  1.000 47.45568  ? 146 LEU B CA  1 
ATOM   7729  C C   . LEU C  1 166 ? -0.54840  -36.84332  81.73689  1.000 43.92072  ? 146 LEU B C   1 
ATOM   7730  O O   . LEU C  1 166 ? 0.16048   -37.67158  82.31941  1.000 44.76402  ? 146 LEU B O   1 
ATOM   7731  C CB  . LEU C  1 166 ? -3.02993  -37.10735  81.43700  1.000 40.73226  ? 146 LEU B CB  1 
ATOM   7732  C CG  . LEU C  1 166 ? -4.46033  -36.96822  81.95603  1.000 39.18300  ? 146 LEU B CG  1 
ATOM   7733  C CD1 . LEU C  1 166 ? -5.43988  -37.36738  80.87510  1.000 37.76586  ? 146 LEU B CD1 1 
ATOM   7734  C CD2 . LEU C  1 166 ? -4.68198  -37.79347  83.20870  1.000 39.01286  ? 146 LEU B CD2 1 
ATOM   7735  N N   . GLN C  1 167 ? -0.15290  -36.22381  80.61954  1.000 51.94765  ? 147 GLN B N   1 
ATOM   7736  C CA  . GLN C  1 167 ? 1.17153   -36.45002  80.04753  1.000 54.96778  ? 147 GLN B CA  1 
ATOM   7737  C C   . GLN C  1 167 ? 2.26524   -36.18227  81.07404  1.000 57.72873  ? 147 GLN B C   1 
ATOM   7738  O O   . GLN C  1 167 ? 3.09556   -37.05195  81.36014  1.000 62.53578  ? 147 GLN B O   1 
ATOM   7739  C CB  . GLN C  1 167 ? 1.37351   -35.55907  78.81685  1.000 58.32760  ? 147 GLN B CB  1 
ATOM   7740  C CG  . GLN C  1 167 ? 0.35523   -35.75279  77.70713  1.000 62.44269  ? 147 GLN B CG  1 
ATOM   7741  C CD  . GLN C  1 167 ? 0.73440   -36.86744  76.75534  1.000 64.09288  ? 147 GLN B CD  1 
ATOM   7742  O OE1 . GLN C  1 167 ? 1.70674   -37.58962  76.98196  1.000 67.61371  ? 147 GLN B OE1 1 
ATOM   7743  N NE2 . GLN C  1 167 ? -0.03097  -37.01142  75.67859  1.000 61.58658  ? 147 GLN B NE2 1 
ATOM   7744  N N   . GLN C  1 168 ? 2.27298   -34.97014  81.63994  1.000 53.87739  ? 148 GLN B N   1 
ATOM   7745  C CA  . GLN C  1 168 ? 3.28617   -34.61374  82.62890  1.000 52.71817  ? 148 GLN B CA  1 
ATOM   7746  C C   . GLN C  1 168 ? 3.29696   -35.60105  83.78814  1.000 56.20384  ? 148 GLN B C   1 
ATOM   7747  O O   . GLN C  1 168 ? 4.36645   -36.03878  84.22846  1.000 55.15718  ? 148 GLN B O   1 
ATOM   7748  C CB  . GLN C  1 168 ? 3.04825   -33.19035  83.13775  1.000 49.91828  ? 148 GLN B CB  1 
ATOM   7749  C CG  . GLN C  1 168 ? 3.75989   -32.86995  84.44216  1.000 51.33139  ? 148 GLN B CG  1 
ATOM   7750  C CD  . GLN C  1 168 ? 3.61790   -31.40562  84.85302  1.000 62.37363  ? 148 GLN B CD  1 
ATOM   7751  O OE1 . GLN C  1 168 ? 3.61842   -31.08198  86.04185  1.000 55.00737  ? 148 GLN B OE1 1 
ATOM   7752  N NE2 . GLN C  1 168 ? 3.49455   -30.51750  83.86974  1.000 57.05084  ? 148 GLN B NE2 1 
ATOM   7753  N N   . HIS C  1 169 ? 2.11570   -35.97679  84.28386  1.000 48.24666  ? 149 HIS B N   1 
ATOM   7754  C CA  . HIS C  1 169 ? 2.04385   -36.93068  85.38697  1.000 54.13129  ? 149 HIS B CA  1 
ATOM   7755  C C   . HIS C  1 169 ? 2.76233   -38.22648  85.04787  1.000 48.84411  ? 149 HIS B C   1 
ATOM   7756  O O   . HIS C  1 169 ? 3.53691   -38.75074  85.85560  1.000 56.17024  ? 149 HIS B O   1 
ATOM   7757  C CB  . HIS C  1 169 ? 0.58986   -37.23124  85.74089  1.000 51.28456  ? 149 HIS B CB  1 
ATOM   7758  C CG  . HIS C  1 169 ? 0.43721   -38.30661  86.77108  1.000 50.08559  ? 149 HIS B CG  1 
ATOM   7759  N ND1 . HIS C  1 169 ? 0.63120   -38.07882  88.11612  1.000 51.22151  ? 149 HIS B ND1 1 
ATOM   7760  C CD2 . HIS C  1 169 ? 0.11866   -39.61753  86.65430  1.000 46.38456  ? 149 HIS B CD2 1 
ATOM   7761  C CE1 . HIS C  1 169 ? 0.42981   -39.20014  88.78475  1.000 46.80921  ? 149 HIS B CE1 1 
ATOM   7762  N NE2 . HIS C  1 169 ? 0.11862   -40.14927  87.92102  1.000 45.88024  ? 149 HIS B NE2 1 
ATOM   7763  N N   . VAL C  1 170 ? 2.51130   -38.76258  83.85449  1.000 48.03610  ? 150 VAL B N   1 
ATOM   7764  C CA  . VAL C  1 170 ? 3.00938   -40.09554  83.53396  1.000 60.14752  ? 150 VAL B CA  1 
ATOM   7765  C C   . VAL C  1 170 ? 4.50727   -40.05787  83.25625  1.000 56.63955  ? 150 VAL B C   1 
ATOM   7766  O O   . VAL C  1 170 ? 5.25119   -40.95304  83.67314  1.000 64.78862  ? 150 VAL B O   1 
ATOM   7767  C CB  . VAL C  1 170 ? 2.21515   -40.68540  82.35424  1.000 51.53383  ? 150 VAL B CB  1 
ATOM   7768  C CG1 . VAL C  1 170 ? 2.89296   -41.93422  81.81803  1.000 48.38886  ? 150 VAL B CG1 1 
ATOM   7769  C CG2 . VAL C  1 170 ? 0.79222   -40.99309  82.78709  1.000 44.98136  ? 150 VAL B CG2 1 
ATOM   7770  N N   . ASP C  1 171 ? 4.97981   -39.01306  82.57622  1.000 51.10503  ? 151 ASP B N   1 
ATOM   7771  C CA  . ASP C  1 171 ? 6.38818   -38.95371  82.20175  1.000 53.07648  ? 151 ASP B CA  1 
ATOM   7772  C C   . ASP C  1 171 ? 7.27951   -38.49071  83.34936  1.000 56.14510  ? 151 ASP B C   1 
ATOM   7773  O O   . ASP C  1 171 ? 8.46247   -38.84739  83.38824  1.000 57.96502  ? 151 ASP B O   1 
ATOM   7774  C CB  . ASP C  1 171 ? 6.56425   -38.04290  80.98755  1.000 62.28512  ? 151 ASP B CB  1 
ATOM   7775  C CG  . ASP C  1 171 ? 5.81345   -38.55069  79.76986  1.000 69.25973  ? 151 ASP B CG  1 
ATOM   7776  O OD1 . ASP C  1 171 ? 5.44252   -39.74294  79.75495  1.000 73.32274  ? 151 ASP B OD1 1 
ATOM   7777  O OD2 . ASP C  1 171 ? 5.59321   -37.75962  78.82861  1.000 74.90293  ? 151 ASP B OD2 1 
ATOM   7778  N N   . SER C  1 172 ? 6.74549   -37.70009  84.28313  1.000 60.63554  ? 152 SER B N   1 
ATOM   7779  C CA  . SER C  1 172 ? 7.50669   -37.32399  85.46880  1.000 62.36641  ? 152 SER B CA  1 
ATOM   7780  C C   . SER C  1 172 ? 7.56552   -38.44377  86.49839  1.000 64.20052  ? 152 SER B C   1 
ATOM   7781  O O   . SER C  1 172 ? 8.42099   -38.40545  87.39011  1.000 70.08153  ? 152 SER B O   1 
ATOM   7782  C CB  . SER C  1 172 ? 6.90842   -36.07050  86.11506  1.000 56.31680  ? 152 SER B CB  1 
ATOM   7783  O OG  . SER C  1 172 ? 5.80261   -36.40705  86.93683  1.000 60.00254  ? 152 SER B OG  1 
ATOM   7784  N N   . GLY C  1 173 ? 6.68193   -39.43428  86.39450  1.000 59.48954  ? 153 GLY B N   1 
ATOM   7785  C CA  . GLY C  1 173 ? 6.63449   -40.51658  87.35540  1.000 54.73543  ? 153 GLY B CA  1 
ATOM   7786  C C   . GLY C  1 173 ? 6.12786   -40.14041  88.72717  1.000 54.59782  ? 153 GLY B C   1 
ATOM   7787  O O   . GLY C  1 173 ? 6.26475   -40.93679  89.65924  1.000 55.05119  ? 153 GLY B O   1 
ATOM   7788  N N   . ALA C  1 174 ? 5.53666   -38.95809  88.88111  1.000 61.30259  ? 154 ALA B N   1 
ATOM   7789  C CA  . ALA C  1 174 ? 5.07895   -38.51392  90.18806  1.000 58.86323  ? 154 ALA B CA  1 
ATOM   7790  C C   . ALA C  1 174 ? 3.97974   -39.42909  90.72328  1.000 58.03511  ? 154 ALA B C   1 
ATOM   7791  O O   . ALA C  1 174 ? 3.30177   -40.14058  89.97759  1.000 58.20264  ? 154 ALA B O   1 
ATOM   7792  C CB  . ALA C  1 174 ? 4.57057   -37.07434  90.11500  1.000 58.04623  ? 154 ALA B CB  1 
ATOM   7793  N N   . ASP C  1 175 ? 3.82371   -39.41922  92.04841  1.000 62.84197  ? 155 ASP B N   1 
ATOM   7794  C CA  . ASP C  1 175 ? 2.66599   -40.06382  92.65450  1.000 51.42692  ? 155 ASP B CA  1 
ATOM   7795  C C   . ASP C  1 175 ? 1.42182   -39.19617  92.52220  1.000 54.60440  ? 155 ASP B C   1 
ATOM   7796  O O   . ASP C  1 175 ? 0.30605   -39.72175  92.45668  1.000 52.83948  ? 155 ASP B O   1 
ATOM   7797  C CB  . ASP C  1 175 ? 2.92875   -40.36505  94.12980  1.000 54.89669  ? 155 ASP B CB  1 
ATOM   7798  C CG  . ASP C  1 175 ? 4.27421   -41.00877  94.36331  1.000 73.34177  ? 155 ASP B CG  1 
ATOM   7799  O OD1 . ASP C  1 175 ? 4.69914   -41.07682  95.53552  1.000 76.40456  ? 155 ASP B OD1 1 
ATOM   7800  O OD2 . ASP C  1 175 ? 4.90384   -41.44937  93.37860  1.000 80.52173  ? 155 ASP B OD2 1 
ATOM   7801  N N   . VAL C  1 176 ? 1.58467   -37.87685  92.48244  1.000 50.25990  ? 156 VAL B N   1 
ATOM   7802  C CA  . VAL C  1 176 ? 0.44943   -36.98922  92.26537  1.000 50.50429  ? 156 VAL B CA  1 
ATOM   7803  C C   . VAL C  1 176 ? 0.93442   -35.73291  91.56143  1.000 49.38369  ? 156 VAL B C   1 
ATOM   7804  O O   . VAL C  1 176 ? 1.95746   -35.14802  91.92877  1.000 51.06970  ? 156 VAL B O   1 
ATOM   7805  C CB  . VAL C  1 176 ? -0.28769  -36.65209  93.57794  1.000 48.54591  ? 156 VAL B CB  1 
ATOM   7806  C CG1 . VAL C  1 176 ? 0.61126   -35.88775  94.53960  1.000 50.39461  ? 156 VAL B CG1 1 
ATOM   7807  C CG2 . VAL C  1 176 ? -1.56283  -35.87719  93.28618  1.000 53.99781  ? 156 VAL B CG2 1 
ATOM   7808  N N   . THR C  1 177 ? 0.21072   -35.34735  90.51997  1.000 55.02926  ? 157 THR B N   1 
ATOM   7809  C CA  . THR C  1 177 ? 0.38652   -34.06385  89.86317  1.000 48.29126  ? 157 THR B CA  1 
ATOM   7810  C C   . THR C  1 177 ? -0.69674  -33.12865  90.37550  1.000 47.30668  ? 157 THR B C   1 
ATOM   7811  O O   . THR C  1 177 ? -1.86393  -33.51896  90.46765  1.000 45.76517  ? 157 THR B O   1 
ATOM   7812  C CB  . THR C  1 177 ? 0.29637   -34.20680  88.34283  1.000 52.44389  ? 157 THR B CB  1 
ATOM   7813  O OG1 . THR C  1 177 ? 1.34653   -35.06742  87.89626  1.000 48.57867  ? 157 THR B OG1 1 
ATOM   7814  C CG2 . THR C  1 177 ? 0.43118   -32.84184  87.66918  1.000 58.78252  ? 157 THR B CG2 1 
ATOM   7815  N N   . ILE C  1 178 ? -0.30790  -31.91477  90.74023  1.000 48.25751  ? 158 ILE B N   1 
ATOM   7816  C CA  . ILE C  1 178 ? -1.23270  -30.94363  91.30658  1.000 51.94791  ? 158 ILE B CA  1 
ATOM   7817  C C   . ILE C  1 178 ? -1.27330  -29.72298  90.40404  1.000 48.15526  ? 158 ILE B C   1 
ATOM   7818  O O   . ILE C  1 178 ? -0.22908  -29.13767  90.09312  1.000 48.80926  ? 158 ILE B O   1 
ATOM   7819  C CB  . ILE C  1 178 ? -0.83880  -30.54619  92.73953  1.000 53.22678  ? 158 ILE B CB  1 
ATOM   7820  C CG1 . ILE C  1 178 ? -0.49441  -31.79409  93.55345  1.000 49.32974  ? 158 ILE B CG1 1 
ATOM   7821  C CG2 . ILE C  1 178 ? -1.96397  -29.77019  93.38972  1.000 47.85918  ? 158 ILE B CG2 1 
ATOM   7822  C CD1 . ILE C  1 178 ? -0.34322  -31.52559  95.03311  1.000 60.58467  ? 158 ILE B CD1 1 
ATOM   7823  N N   . GLY C  1 179 ? -2.47645  -29.35528  89.97378  1.000 45.84576  ? 159 GLY B N   1 
ATOM   7824  C CA  . GLY C  1 179 ? -2.64859  -28.11422  89.24016  1.000 49.59599  ? 159 GLY B CA  1 
ATOM   7825  C C   . GLY C  1 179 ? -2.45106  -26.93254  90.16691  1.000 48.90343  ? 159 GLY B C   1 
ATOM   7826  O O   . GLY C  1 179 ? -3.01546  -26.88407  91.26692  1.000 46.37641  ? 159 GLY B O   1 
ATOM   7827  N N   . CYS C  1 180 ? -1.63371  -25.97934  89.73555  1.000 47.75423  ? 160 CYS B N   1 
ATOM   7828  C CA  . CYS C  1 180 ? -1.36160  -24.79001  90.52368  1.000 51.43739  ? 160 CYS B CA  1 
ATOM   7829  C C   . CYS C  1 180 ? -1.42788  -23.56281  89.62969  1.000 48.70588  ? 160 CYS B C   1 
ATOM   7830  O O   . CYS C  1 180 ? -0.96218  -23.58887  88.48680  1.000 56.38713  ? 160 CYS B O   1 
ATOM   7831  C CB  . CYS C  1 180 ? 0.01164   -24.87727  91.19818  1.000 52.39623  ? 160 CYS B CB  1 
ATOM   7832  S SG  . CYS C  1 180 ? 0.18800   -26.25985  92.36661  1.000 56.20702  ? 160 CYS B SG  1 
ATOM   7833  N N   . LEU C  1 181 ? -2.02693  -22.49804  90.14895  1.000 48.47650  ? 161 LEU B N   1 
ATOM   7834  C CA  . LEU C  1 181 ? -1.95128  -21.19359  89.51117  1.000 53.28582  ? 161 LEU B CA  1 
ATOM   7835  C C   . LEU C  1 181 ? -0.69737  -20.47331  89.97914  1.000 50.76472  ? 161 LEU B C   1 
ATOM   7836  O O   . LEU C  1 181 ? -0.24997  -20.63926  91.11818  1.000 51.72527  ? 161 LEU B O   1 
ATOM   7837  C CB  . LEU C  1 181 ? -3.17907  -20.34160  89.82766  1.000 47.63871  ? 161 LEU B CB  1 
ATOM   7838  C CG  . LEU C  1 181 ? -4.55566  -20.98036  89.66167  1.000 53.48152  ? 161 LEU B CG  1 
ATOM   7839  C CD1 . LEU C  1 181 ? -5.49868  -20.46402  90.72507  1.000 57.42189  ? 161 LEU B CD1 1 
ATOM   7840  C CD2 . LEU C  1 181 ? -5.10084  -20.67906  88.29388  1.000 48.74006  ? 161 LEU B CD2 1 
ATOM   7841  N N   . GLU C  1 182 ? -0.12555  -19.67765  89.08031  1.000 51.95601  ? 162 GLU B N   1 
ATOM   7842  C CA  . GLU C  1 182 ? 1.06564   -18.88257  89.37127  1.000 53.41072  ? 162 GLU B CA  1 
ATOM   7843  C C   . GLU C  1 182 ? 0.59639   -17.47755  89.73475  1.000 53.65062  ? 162 GLU B C   1 
ATOM   7844  O O   . GLU C  1 182 ? 0.27445   -16.66833  88.86140  1.000 52.97460  ? 162 GLU B O   1 
ATOM   7845  C CB  . GLU C  1 182 ? 2.02236   -18.87713  88.18572  1.000 54.31026  ? 162 GLU B CB  1 
ATOM   7846  C CG  . GLU C  1 182 ? 3.30280   -18.10593  88.43881  1.000 73.05626  ? 162 GLU B CG  1 
ATOM   7847  C CD  . GLU C  1 182 ? 4.28459   -18.22334  87.29170  1.000 77.52204  ? 162 GLU B CD  1 
ATOM   7848  O OE1 . GLU C  1 182 ? 5.44368   -17.78421  87.45069  1.000 83.94433  ? 162 GLU B OE1 1 
ATOM   7849  O OE2 . GLU C  1 182 ? 3.89667   -18.76039  86.23223  1.000 78.96148  ? 162 GLU B OE2 1 
ATOM   7850  N N   . VAL C  1 183 ? 0.56210   -17.19189  91.03034  1.000 53.94055  ? 163 VAL B N   1 
ATOM   7851  C CA  . VAL C  1 183 ? -0.06770  -15.97908  91.53730  1.000 54.93103  ? 163 VAL B CA  1 
ATOM   7852  C C   . VAL C  1 183 ? 0.97230   -15.10083  92.22179  1.000 61.72475  ? 163 VAL B C   1 
ATOM   7853  O O   . VAL C  1 183 ? 1.99306   -15.61467  92.70157  1.000 57.12319  ? 163 VAL B O   1 
ATOM   7854  C CB  . VAL C  1 183 ? -1.20756  -16.32974  92.50422  1.000 52.52178  ? 163 VAL B CB  1 
ATOM   7855  C CG1 . VAL C  1 183 ? -2.21179  -17.23103  91.81447  1.000 53.59093  ? 163 VAL B CG1 1 
ATOM   7856  C CG2 . VAL C  1 183 ? -0.65408  -17.01154  93.74418  1.000 53.53489  ? 163 VAL B CG2 1 
ATOM   7857  N N   . PRO C  1 184 ? 0.76969   -13.78426  92.27992  1.000 55.95801  ? 164 PRO B N   1 
ATOM   7858  C CA  . PRO C  1 184 ? 1.59805   -12.95564  93.16318  1.000 57.76294  ? 164 PRO B CA  1 
ATOM   7859  C C   . PRO C  1 184 ? 1.42908   -13.40101  94.60482  1.000 58.00990  ? 164 PRO B C   1 
ATOM   7860  O O   . PRO C  1 184 ? 0.32437   -13.72872  95.04298  1.000 56.60155  ? 164 PRO B O   1 
ATOM   7861  C CB  . PRO C  1 184 ? 1.05393   -11.53819  92.94269  1.000 57.47529  ? 164 PRO B CB  1 
ATOM   7862  C CG  . PRO C  1 184 ? 0.36546   -11.59038  91.62722  1.000 57.95845  ? 164 PRO B CG  1 
ATOM   7863  C CD  . PRO C  1 184 ? -0.18722  -12.98212  91.50205  1.000 54.68643  ? 164 PRO B CD  1 
ATOM   7864  N N   . ARG C  1 185 ? 2.54212   -13.42797  95.33862  1.000 59.89176  ? 165 ARG B N   1 
ATOM   7865  C CA  . ARG C  1 185 ? 2.50836   -13.95633  96.69896  1.000 60.34017  ? 165 ARG B CA  1 
ATOM   7866  C C   . ARG C  1 185 ? 1.42930   -13.28783  97.53649  1.000 59.52809  ? 165 ARG B C   1 
ATOM   7867  O O   . ARG C  1 185 ? 0.68533   -13.97632  98.24336  1.000 58.65312  ? 165 ARG B O   1 
ATOM   7868  C CB  . ARG C  1 185 ? 3.85906   -13.79796  97.37123  1.000 62.68225  ? 165 ARG B CB  1 
ATOM   7869  C CG  . ARG C  1 185 ? 5.01554   -13.78893  96.42851  1.000 71.36099  ? 165 ARG B CG  1 
ATOM   7870  C CD  . ARG C  1 185 ? 6.30344   -13.66752  97.21654  1.000 81.15012  ? 165 ARG B CD  1 
ATOM   7871  N NE  . ARG C  1 185 ? 6.27125   -14.36737  98.49454  1.000 81.79848  ? 165 ARG B NE  1 
ATOM   7872  C CZ  . ARG C  1 185 ? 6.29087   -13.76109  99.67547  1.000 76.42494  ? 165 ARG B CZ  1 
ATOM   7873  N NH1 . ARG C  1 185 ? 6.34117   -12.43845  99.74168  1.000 73.33014  ? 165 ARG B NH1 1 
ATOM   7874  N NH2 . ARG C  1 185 ? 6.26657   -14.48154  100.78788 1.000 80.31888  ? 165 ARG B NH2 1 
ATOM   7875  N N   . MET C  1 186 ? 1.31154   -11.94838  97.47229  1.000 59.82521  ? 166 MET B N   1 
ATOM   7876  C CA  . MET C  1 186 ? 0.26097   -11.28533  98.25132  1.000 59.06929  ? 166 MET B CA  1 
ATOM   7877  C C   . MET C  1 186 ? -1.08053  -11.92639  98.01741  1.000 68.35361  ? 166 MET B C   1 
ATOM   7878  O O   . MET C  1 186 ? -1.91234  -11.98714  98.92861  1.000 70.53372  ? 166 MET B O   1 
ATOM   7879  C CB  . MET C  1 186 ? 0.13426   -9.79640   97.94388  1.000 65.86472  ? 166 MET B CB  1 
ATOM   7880  C CG  . MET C  1 186 ? 1.49733   -9.12784   97.91636  1.000 74.48460  ? 166 MET B CG  1 
ATOM   7881  S SD  . MET C  1 186 ? 2.23545   -9.22159   96.24737  1.000 85.68964  ? 166 MET B SD  1 
ATOM   7882  C CE  . MET C  1 186 ? 1.20999   -8.07090   95.27631  1.000 77.20495  ? 166 MET B CE  1 
ATOM   7883  N N   . GLU C  1 187 ? -1.32323  -12.39553  96.79905  1.000 65.97595  ? 167 GLU B N   1 
ATOM   7884  C CA  . GLU C  1 187 ? -2.58355  -13.01302  96.47022  1.000 62.92006  ? 167 GLU B CA  1 
ATOM   7885  C C   . GLU C  1 187 ? -2.60150  -14.51167  96.74059  1.000 58.61507  ? 167 GLU B C   1 
ATOM   7886  O O   . GLU C  1 187 ? -3.64555  -15.14520  96.54359  1.000 56.91086  ? 167 GLU B O   1 
ATOM   7887  C CB  . GLU C  1 187 ? -2.92015  -12.72745  95.01048  1.000 66.17465  ? 167 GLU B CB  1 
ATOM   7888  C CG  . GLU C  1 187 ? -3.15853  -11.25047  94.70518  1.000 66.90308  ? 167 GLU B CG  1 
ATOM   7889  C CD  . GLU C  1 187 ? -3.88401  -11.04394  93.38354  1.000 72.31578  ? 167 GLU B CD  1 
ATOM   7890  O OE1 . GLU C  1 187 ? -3.28510  -11.31146  92.31937  1.000 75.80459  ? 167 GLU B OE1 1 
ATOM   7891  O OE2 . GLU C  1 187 ? -5.05157  -10.59767  93.41017  1.000 75.75203  ? 167 GLU B OE2 1 
ATOM   7892  N N   . ALA C  1 188 ? -1.48415  -15.10217  97.15835  1.000 65.31139  ? 168 ALA B N   1 
ATOM   7893  C CA  . ALA C  1 188 ? -1.46592  -16.50643  97.55456  1.000 63.03073  ? 168 ALA B CA  1 
ATOM   7894  C C   . ALA C  1 188 ? -1.84443  -16.70375  99.01002  1.000 65.03014  ? 168 ALA B C   1 
ATOM   7895  O O   . ALA C  1 188 ? -1.87071  -17.84530  99.48161  1.000 74.62691  ? 168 ALA B O   1 
ATOM   7896  C CB  . ALA C  1 188 ? -0.09011  -17.12785  97.31326  1.000 61.40956  ? 168 ALA B CB  1 
ATOM   7897  N N   . THR C  1 189 ? -2.15275  -15.61961  99.71803  1.000 64.33229  ? 169 THR B N   1 
ATOM   7898  C CA  . THR C  1 189 ? -2.36245  -15.67013  101.15689 1.000 63.84948  ? 169 THR B CA  1 
ATOM   7899  C C   . THR C  1 189 ? -3.58904  -16.48152  101.54647 1.000 58.81603  ? 169 THR B C   1 
ATOM   7900  O O   . THR C  1 189 ? -3.72611  -16.85305  102.71741 1.000 68.80755  ? 169 THR B O   1 
ATOM   7901  C CB  . THR C  1 189 ? -2.48715  -14.24517  101.69173 1.000 56.45610  ? 169 THR B CB  1 
ATOM   7902  O OG1 . THR C  1 189 ? -2.20465  -14.23448  103.09382 1.000 61.28989  ? 169 THR B OG1 1 
ATOM   7903  C CG2 . THR C  1 189 ? -3.89042  -13.70550  101.44047 1.000 54.72787  ? 169 THR B CG2 1 
ATOM   7904  N N   . GLY C  1 190 ? -4.47995  -16.76283  100.60206 1.000 52.45791  ? 170 GLY B N   1 
ATOM   7905  C CA  . GLY C  1 190 ? -5.69648  -17.48233  100.91424 1.000 57.10007  ? 170 GLY B CA  1 
ATOM   7906  C C   . GLY C  1 190 ? -5.73112  -18.90937  100.40903 1.000 50.60794  ? 170 GLY B C   1 
ATOM   7907  O O   . GLY C  1 190 ? -6.67887  -19.64328  100.70063 1.000 54.06990  ? 170 GLY B O   1 
ATOM   7908  N N   . PHE C  1 191 ? -4.71020  -19.32625  99.66837  1.000 54.26422  ? 171 PHE B N   1 
ATOM   7909  C CA  . PHE C  1 191 ? -4.69058  -20.64693  99.05601  1.000 50.05352  ? 171 PHE B CA  1 
ATOM   7910  C C   . PHE C  1 191 ? -3.76382  -21.59837  99.80384  1.000 51.34203  ? 171 PHE B C   1 
ATOM   7911  O O   . PHE C  1 191 ? -2.83925  -21.18953  100.50928 1.000 53.04881  ? 171 PHE B O   1 
ATOM   7912  C CB  . PHE C  1 191 ? -4.23882  -20.57000  97.59353  1.000 54.48402  ? 171 PHE B CB  1 
ATOM   7913  C CG  . PHE C  1 191 ? -5.14783  -19.76508  96.70402  1.000 51.63118  ? 171 PHE B CG  1 
ATOM   7914  C CD1 . PHE C  1 191 ? -5.05158  -18.38026  96.65336  1.000 49.01326  ? 171 PHE B CD1 1 
ATOM   7915  C CD2 . PHE C  1 191 ? -6.07949  -20.39888  95.89613  1.000 46.78112  ? 171 PHE B CD2 1 
ATOM   7916  C CE1 . PHE C  1 191 ? -5.88052  -17.64754  95.82298  1.000 51.50574  ? 171 PHE B CE1 1 
ATOM   7917  C CE2 . PHE C  1 191 ? -6.90900  -19.67633  95.06934  1.000 45.66453  ? 171 PHE B CE2 1 
ATOM   7918  C CZ  . PHE C  1 191 ? -6.81099  -18.29679  95.03130  1.000 56.55762  ? 171 PHE B CZ  1 
ATOM   7919  N N   . GLY C  1 192 ? -4.02112  -22.89150  99.62424  1.000 52.23032  ? 172 GLY B N   1 
ATOM   7920  C CA  . GLY C  1 192 ? -3.02472  -23.89245  99.94573  1.000 51.69201  ? 172 GLY B CA  1 
ATOM   7921  C C   . GLY C  1 192 ? -1.89795  -23.80146  98.93790  1.000 52.52647  ? 172 GLY B C   1 
ATOM   7922  O O   . GLY C  1 192 ? -2.09273  -24.10137  97.75860  1.000 60.18786  ? 172 GLY B O   1 
ATOM   7923  N N   . VAL C  1 193 ? -0.72224  -23.37465  99.37060  1.000 54.43559  ? 173 VAL B N   1 
ATOM   7924  C CA  . VAL C  1 193 ? 0.33743   -22.98663  98.45209  1.000 57.44267  ? 173 VAL B CA  1 
ATOM   7925  C C   . VAL C  1 193 ? 1.39139   -24.08462  98.44444  1.000 59.74824  ? 173 VAL B C   1 
ATOM   7926  O O   . VAL C  1 193 ? 1.54835   -24.85283  99.40084  1.000 64.36798  ? 173 VAL B O   1 
ATOM   7927  C CB  . VAL C  1 193 ? 0.93908   -21.62465  98.85681  1.000 57.55459  ? 173 VAL B CB  1 
ATOM   7928  C CG1 . VAL C  1 193 ? 1.32927   -21.68814  100.28122 1.000 58.25356  ? 173 VAL B CG1 1 
ATOM   7929  C CG2 . VAL C  1 193 ? 2.12686   -21.20603  97.99621  1.000 58.11479  ? 173 VAL B CG2 1 
ATOM   7930  N N   . MET C  1 194 ? 2.14441   -24.12629  97.35296  1.000 60.10306  ? 174 MET B N   1 
ATOM   7931  C CA  . MET C  1 194 ? 3.05160   -25.21423  97.02043  1.000 65.77955  ? 174 MET B CA  1 
ATOM   7932  C C   . MET C  1 194 ? 4.48172   -24.67849  96.97676  1.000 66.29921  ? 174 MET B C   1 
ATOM   7933  O O   . MET C  1 194 ? 4.86103   -23.99805  96.01790  1.000 62.95190  ? 174 MET B O   1 
ATOM   7934  C CB  . MET C  1 194 ? 2.62815   -25.79452  95.67941  1.000 68.12342  ? 174 MET B CB  1 
ATOM   7935  C CG  . MET C  1 194 ? 1.33032   -26.65575  95.73582  1.000 69.67756  ? 174 MET B CG  1 
ATOM   7936  S SD  . MET C  1 194 ? 1.09025   -27.66342  97.23612  1.000 95.47338  ? 174 MET B SD  1 
ATOM   7937  C CE  . MET C  1 194 ? -0.57939  -28.29457  97.04317  1.000 79.69639  ? 174 MET B CE  1 
ATOM   7938  N N   . HIS C  1 195 ? 5.27927   -25.00388  97.99693  1.000 69.63305  ? 175 HIS B N   1 
ATOM   7939  C CA  . HIS C  1 195 ? 6.69207   -24.63213  98.01780  1.000 74.20150  ? 175 HIS B CA  1 
ATOM   7940  C C   . HIS C  1 195 ? 7.46773   -25.58284  97.11306  1.000 84.12410  ? 175 HIS B C   1 
ATOM   7941  O O   . HIS C  1 195 ? 7.47312   -26.79857  97.33558  1.000 101.55105 ? 175 HIS B O   1 
ATOM   7942  C CB  . HIS C  1 195 ? 7.23260   -24.66582  99.44382  1.000 77.93301  ? 175 HIS B CB  1 
ATOM   7943  C CG  . HIS C  1 195 ? 8.66944   -24.25455  99.56407  1.000 81.14090  ? 175 HIS B CG  1 
ATOM   7944  N ND1 . HIS C  1 195 ? 9.42657   -24.53349  100.68173 1.000 82.11237  ? 175 HIS B ND1 1 
ATOM   7945  C CD2 . HIS C  1 195 ? 9.48495   -23.58407  98.71536  1.000 81.45929  ? 175 HIS B CD2 1 
ATOM   7946  C CE1 . HIS C  1 195 ? 10.64676  -24.05686  100.51494 1.000 84.66636  ? 175 HIS B CE1 1 
ATOM   7947  N NE2 . HIS C  1 195 ? 10.70840  -23.47585  99.33046  1.000 85.45613  ? 175 HIS B NE2 1 
ATOM   7948  N N   . VAL C  1 196 ? 8.14122   -25.02363  96.11207  1.000 77.50033  ? 176 VAL B N   1 
ATOM   7949  C CA  . VAL C  1 196 ? 8.57684   -25.76542  94.93875  1.000 75.54964  ? 176 VAL B CA  1 
ATOM   7950  C C   . VAL C  1 196 ? 10.07081  -25.53414  94.72290  1.000 75.02914  ? 176 VAL B C   1 
ATOM   7951  O O   . VAL C  1 196 ? 10.63089  -24.52984  95.16545  1.000 77.24349  ? 176 VAL B O   1 
ATOM   7952  C CB  . VAL C  1 196 ? 7.72734   -25.33852  93.71318  1.000 77.11492  ? 176 VAL B CB  1 
ATOM   7953  C CG1 . VAL C  1 196 ? 8.43851   -25.52969  92.41346  1.000 74.40417  ? 176 VAL B CG1 1 
ATOM   7954  C CG2 . VAL C  1 196 ? 6.40552   -26.09534  93.70457  1.000 72.14290  ? 176 VAL B CG2 1 
ATOM   7955  N N   . ASN C  1 197 ? 10.72954  -26.50693  94.08120  1.000 67.51214  ? 177 ASN B N   1 
ATOM   7956  C CA  . ASN C  1 197 ? 12.13489  -26.38199  93.72583  1.000 75.06781  ? 177 ASN B CA  1 
ATOM   7957  C C   . ASN C  1 197 ? 12.27476  -25.96764  92.25711  1.000 79.13335  ? 177 ASN B C   1 
ATOM   7958  O O   . ASN C  1 197 ? 11.30247  -25.60611  91.58887  1.000 74.84548  ? 177 ASN B O   1 
ATOM   7959  C CB  . ASN C  1 197 ? 12.88773  -27.68139  94.04326  1.000 70.74012  ? 177 ASN B CB  1 
ATOM   7960  C CG  . ASN C  1 197 ? 12.48214  -28.85511  93.15194  1.000 70.70123  ? 177 ASN B CG  1 
ATOM   7961  O OD1 . ASN C  1 197 ? 11.85085  -28.69008  92.10749  1.000 67.75005  ? 177 ASN B OD1 1 
ATOM   7962  N ND2 . ASN C  1 197 ? 12.87998  -30.05558  93.56028  1.000 69.85503  ? 177 ASN B ND2 1 
ATOM   7963  N N   . GLU C  1 198 ? 13.50350  -26.03064  91.74077  1.000 79.68924  ? 178 GLU B N   1 
ATOM   7964  C CA  . GLU C  1 198 ? 13.75696  -25.59254  90.37178  1.000 79.11818  ? 178 GLU B CA  1 
ATOM   7965  C C   . GLU C  1 198 ? 13.12646  -26.53319  89.35249  1.000 75.84172  ? 178 GLU B C   1 
ATOM   7966  O O   . GLU C  1 198 ? 12.77579  -26.10131  88.24745  1.000 75.48584  ? 178 GLU B O   1 
ATOM   7967  C CB  . GLU C  1 198 ? 15.26261  -25.46913  90.12454  1.000 73.60167  ? 178 GLU B CB  1 
ATOM   7968  C CG  . GLU C  1 198 ? 16.06207  -24.88220  91.28843  1.000 86.79839  ? 178 GLU B CG  1 
ATOM   7969  C CD  . GLU C  1 198 ? 16.28851  -25.87168  92.41933  1.000 89.41622  ? 178 GLU B CD  1 
ATOM   7970  O OE1 . GLU C  1 198 ? 16.54898  -27.05698  92.12704  1.000 92.10245  ? 178 GLU B OE1 1 
ATOM   7971  O OE2 . GLU C  1 198 ? 16.18942  -25.46715  93.59804  1.000 91.05665  ? 178 GLU B OE2 1 
ATOM   7972  N N   . LYS C  1 199 ? 12.97201  -27.81146  89.70080  1.000 71.51180  ? 179 LYS B N   1 
ATOM   7973  C CA  . LYS C  1 199 ? 12.35582  -28.79910  88.82603  1.000 75.08516  ? 179 LYS B CA  1 
ATOM   7974  C C   . LYS C  1 199 ? 10.85532  -28.92267  89.05954  1.000 71.45624  ? 179 LYS B C   1 
ATOM   7975  O O   . LYS C  1 199 ? 10.26030  -29.94349  88.70013  1.000 74.94508  ? 179 LYS B O   1 
ATOM   7976  C CB  . LYS C  1 199 ? 13.06049  -30.15301  88.98998  1.000 68.00722  ? 179 LYS B CB  1 
ATOM   7977  C CG  . LYS C  1 199 ? 14.60757  -30.01182  88.94686  1.000 71.54011  ? 179 LYS B CG  1 
ATOM   7978  C CD  . LYS C  1 199 ? 15.36117  -31.35237  88.84898  1.000 78.65331  ? 179 LYS B CD  1 
ATOM   7979  C CE  . LYS C  1 199 ? 14.80316  -32.34223  89.88665  1.000 80.77031  ? 179 LYS B CE  1 
ATOM   7980  N NZ  . LYS C  1 199 ? 15.55817  -33.61431  90.18793  1.000 83.42185  ? 179 LYS B NZ  1 
ATOM   7981  N N   . ASP C  1 200 ? 10.23797  -27.89875  89.64772  1.000 64.23072  ? 180 ASP B N   1 
ATOM   7982  C CA  . ASP C  1 200 ? 8.81265   -27.87759  89.98168  1.000 64.46067  ? 180 ASP B CA  1 
ATOM   7983  C C   . ASP C  1 200 ? 8.37601   -29.09306  90.79874  1.000 62.56961  ? 180 ASP B C   1 
ATOM   7984  O O   . ASP C  1 200 ? 7.17970   -29.38998  90.89171  1.000 62.79332  ? 180 ASP B O   1 
ATOM   7985  C CB  . ASP C  1 200 ? 7.94190   -27.72117  88.72994  1.000 63.30336  ? 180 ASP B CB  1 
ATOM   7986  C CG  . ASP C  1 200 ? 7.57605   -26.26660  88.46037  1.000 66.99740  ? 180 ASP B CG  1 
ATOM   7987  O OD1 . ASP C  1 200 ? 7.07436   -25.95764  87.35788  1.000 67.05512  ? 180 ASP B OD1 1 
ATOM   7988  O OD2 . ASP C  1 200 ? 7.79856   -25.42677  89.35622  1.000 62.72885  ? 180 ASP B OD2 1 
ATOM   7989  N N   . GLU C  1 201 ? 9.31708   -29.80122  91.41444  1.000 67.61672  ? 181 GLU B N   1 
ATOM   7990  C CA  . GLU C  1 201 ? 8.94309   -30.77305  92.42830  1.000 70.38937  ? 181 GLU B CA  1 
ATOM   7991  C C   . GLU C  1 201 ? 8.79484   -30.08041  93.77234  1.000 69.61285  ? 181 GLU B C   1 
ATOM   7992  O O   . GLU C  1 201 ? 9.42905   -29.05687  94.04790  1.000 64.67436  ? 181 GLU B O   1 
ATOM   7993  C CB  . GLU C  1 201 ? 9.95842   -31.89816  92.53461  1.000 64.04410  ? 181 GLU B CB  1 
ATOM   7994  C CG  . GLU C  1 201 ? 10.49777  -32.36362  91.23014  1.000 68.45080  ? 181 GLU B CG  1 
ATOM   7995  C CD  . GLU C  1 201 ? 11.91147  -32.79137  91.41540  1.000 75.89151  ? 181 GLU B CD  1 
ATOM   7996  O OE1 . GLU C  1 201 ? 12.26726  -33.89944  90.97632  1.000 68.95233  ? 181 GLU B OE1 1 
ATOM   7997  O OE2 . GLU C  1 201 ? 12.65408  -32.02497  92.06179  1.000 86.02987  ? 181 GLU B OE2 1 
ATOM   7998  N N   . ILE C  1 202 ? 7.96349   -30.66666  94.62276  1.000 63.12431  ? 182 ILE B N   1 
ATOM   7999  C CA  . ILE C  1 202 ? 7.32321   -29.94356  95.70947  1.000 62.04653  ? 182 ILE B CA  1 
ATOM   8000  C C   . ILE C  1 202 ? 7.94061   -30.37210  97.03445  1.000 70.78228  ? 182 ILE B C   1 
ATOM   8001  O O   . ILE C  1 202 ? 8.13660   -31.56864  97.28696  1.000 80.60586  ? 182 ILE B O   1 
ATOM   8002  C CB  . ILE C  1 202 ? 5.80434   -30.17149  95.66809  1.000 69.92782  ? 182 ILE B CB  1 
ATOM   8003  C CG1 . ILE C  1 202 ? 5.04686   -28.96595  96.18590  1.000 70.82643  ? 182 ILE B CG1 1 
ATOM   8004  C CG2 . ILE C  1 202 ? 5.38737   -31.38002  96.46228  1.000 81.12053  ? 182 ILE B CG2 1 
ATOM   8005  C CD1 . ILE C  1 202 ? 3.74552   -28.86623  95.48104  1.000 69.21344  ? 182 ILE B CD1 1 
ATOM   8006  N N   . ILE C  1 203 ? 8.27745   -29.38956  97.86442  1.000 69.93077  ? 183 ILE B N   1 
ATOM   8007  C CA  . ILE C  1 203 ? 8.96375   -29.67082  99.11878  1.000 80.68049  ? 183 ILE B CA  1 
ATOM   8008  C C   . ILE C  1 203 ? 7.98795   -29.77773  100.28672 1.000 91.79097  ? 183 ILE B C   1 
ATOM   8009  O O   . ILE C  1 203 ? 8.21899   -30.55890  101.21604 1.000 88.55899  ? 183 ILE B O   1 
ATOM   8010  C CB  . ILE C  1 203 ? 10.02541  -28.59144  99.39299  1.000 83.88408  ? 183 ILE B CB  1 
ATOM   8011  C CG1 . ILE C  1 203 ? 10.64242  -28.08633  98.08189  1.000 85.01167  ? 183 ILE B CG1 1 
ATOM   8012  C CG2 . ILE C  1 203 ? 11.10124  -29.12049  100.33782 1.000 87.22743  ? 183 ILE B CG2 1 
ATOM   8013  C CD1 . ILE C  1 203 ? 11.44634  -29.13261  97.31734  1.000 82.03919  ? 183 ILE B CD1 1 
ATOM   8014  N N   . ASP C  1 204 ? 6.89452   -29.02249  100.25132 1.000 105.42334 ? 184 ASP B N   1 
ATOM   8015  C CA  . ASP C  1 204 ? 6.02361   -28.87712  101.40843 1.000 94.81273  ? 184 ASP B CA  1 
ATOM   8016  C C   . ASP C  1 204 ? 4.73926   -28.19362  100.96139 1.000 90.74145  ? 184 ASP B C   1 
ATOM   8017  O O   . ASP C  1 204 ? 4.70835   -27.50704  99.93588  1.000 101.59915 ? 184 ASP B O   1 
ATOM   8018  C CB  . ASP C  1 204 ? 6.71889   -28.07228  102.51564 1.000 90.57408  ? 184 ASP B CB  1 
ATOM   8019  C CG  . ASP C  1 204 ? 5.98329   -28.12817  103.83983 1.000 82.07363  ? 184 ASP B CG  1 
ATOM   8020  O OD1 . ASP C  1 204 ? 5.14241   -29.03234  104.02664 1.000 81.37211  ? 184 ASP B OD1 1 
ATOM   8021  O OD2 . ASP C  1 204 ? 6.24653   -27.25754  104.69487 1.000 77.04864  ? 184 ASP B OD2 1 
ATOM   8022  N N   . PHE C  1 205 ? 3.67899   -28.39591  101.74295 1.000 80.79223  ? 185 PHE B N   1 
ATOM   8023  C CA  . PHE C  1 205 ? 2.39261   -27.74261  101.52957 1.000 71.46078  ? 185 PHE B CA  1 
ATOM   8024  C C   . PHE C  1 205 ? 2.06632   -26.87938  102.73789 1.000 68.05666  ? 185 PHE B C   1 
ATOM   8025  O O   . PHE C  1 205 ? 2.06460   -27.36859  103.87321 1.000 66.97927  ? 185 PHE B O   1 
ATOM   8026  C CB  . PHE C  1 205 ? 1.26880   -28.76141  101.29766 1.000 73.79503  ? 185 PHE B CB  1 
ATOM   8027  C CG  . PHE C  1 205 ? -0.11970  -28.20781  101.52260 1.000 76.42775  ? 185 PHE B CG  1 
ATOM   8028  C CD1 . PHE C  1 205 ? -0.76592  -28.37927  102.74008 1.000 77.90026  ? 185 PHE B CD1 1 
ATOM   8029  C CD2 . PHE C  1 205 ? -0.77690  -27.51933  100.51426 1.000 65.79205  ? 185 PHE B CD2 1 
ATOM   8030  C CE1 . PHE C  1 205 ? -2.03802  -27.87653  102.94517 1.000 74.28324  ? 185 PHE B CE1 1 
ATOM   8031  C CE2 . PHE C  1 205 ? -2.04827  -27.01868  100.71596 1.000 61.19063  ? 185 PHE B CE2 1 
ATOM   8032  C CZ  . PHE C  1 205 ? -2.67958  -27.19584  101.93151 1.000 67.23648  ? 185 PHE B CZ  1 
ATOM   8033  N N   . ILE C  1 206 ? 1.78179   -25.60322  102.49414 1.000 70.80601  ? 186 ILE B N   1 
ATOM   8034  C CA  . ILE C  1 206 ? 1.35181   -24.67967  103.53603 1.000 59.68196  ? 186 ILE B CA  1 
ATOM   8035  C C   . ILE C  1 206 ? -0.09622  -24.29882  103.26837 1.000 57.60903  ? 186 ILE B C   1 
ATOM   8036  O O   . ILE C  1 206 ? -0.47184  -24.00267  102.12629 1.000 56.38412  ? 186 ILE B O   1 
ATOM   8037  C CB  . ILE C  1 206 ? 2.25107   -23.43193  103.61200 1.000 64.67144  ? 186 ILE B CB  1 
ATOM   8038  C CG1 . ILE C  1 206 ? 3.72630   -23.83082  103.69906 1.000 66.42505  ? 186 ILE B CG1 1 
ATOM   8039  C CG2 . ILE C  1 206 ? 1.88064   -22.59421  104.82128 1.000 61.92868  ? 186 ILE B CG2 1 
ATOM   8040  C CD1 . ILE C  1 206 ? 4.44784   -23.85233  102.37042 1.000 67.23884  ? 186 ILE B CD1 1 
ATOM   8041  N N   . GLU C  1 207 ? -0.90565  -24.31648  104.31975 1.000 57.29080  ? 187 GLU B N   1 
ATOM   8042  C CA  . GLU C  1 207 ? -2.32942  -24.02476  104.23051 1.000 55.44557  ? 187 GLU B CA  1 
ATOM   8043  C C   . GLU C  1 207 ? -2.55114  -22.58097  104.67037 1.000 58.85364  ? 187 GLU B C   1 
ATOM   8044  O O   . GLU C  1 207 ? -2.45501  -22.26873  105.86267 1.000 60.35276  ? 187 GLU B O   1 
ATOM   8045  C CB  . GLU C  1 207 ? -3.12154  -24.99751  105.10025 1.000 66.41691  ? 187 GLU B CB  1 
ATOM   8046  C CG  . GLU C  1 207 ? -4.57714  -25.16080  104.71250 1.000 71.75595  ? 187 GLU B CG  1 
ATOM   8047  C CD  . GLU C  1 207 ? -5.39625  -25.79909  105.81994 1.000 78.19498  ? 187 GLU B CD  1 
ATOM   8048  O OE1 . GLU C  1 207 ? -4.86667  -25.95485  106.94332 1.000 81.71440  ? 187 GLU B OE1 1 
ATOM   8049  O OE2 . GLU C  1 207 ? -6.57577  -26.12791  105.57180 1.000 75.28577  ? 187 GLU B OE2 1 
ATOM   8050  N N   . LYS C  1 208 ? -2.83069  -21.70281  103.70890 1.000 55.05909  ? 188 LYS B N   1 
ATOM   8051  C CA  . LYS C  1 208 ? -3.05915  -20.28770  103.98371 1.000 59.95403  ? 188 LYS B CA  1 
ATOM   8052  C C   . LYS C  1 208 ? -1.86335  -19.65274  104.68838 1.000 66.94560  ? 188 LYS B C   1 
ATOM   8053  O O   . LYS C  1 208 ? -1.96649  -19.29705  105.87164 1.000 70.54628  ? 188 LYS B O   1 
ATOM   8054  C CB  . LYS C  1 208 ? -4.30427  -20.10099  104.85057 1.000 63.22519  ? 188 LYS B CB  1 
ATOM   8055  C CG  . LYS C  1 208 ? -5.60411  -19.90222  104.10351 1.000 63.53814  ? 188 LYS B CG  1 
ATOM   8056  C CD  . LYS C  1 208 ? -6.66886  -20.78570  104.72467 1.000 63.80836  ? 188 LYS B CD  1 
ATOM   8057  C CE  . LYS C  1 208 ? -8.07193  -20.28937  104.43828 1.000 65.81735  ? 188 LYS B CE  1 
ATOM   8058  N NZ  . LYS C  1 208 ? -9.06967  -21.31729  104.84712 1.000 66.05963  ? 188 LYS B NZ  1 
ATOM   8059  N N   . PRO C  1 209 ? -0.72237  -19.48603  104.02213 1.000 65.96613  ? 189 PRO B N   1 
ATOM   8060  C CA  . PRO C  1 209 ? 0.39378   -18.78162  104.65864 1.000 66.93573  ? 189 PRO B CA  1 
ATOM   8061  C C   . PRO C  1 209 ? 0.19759   -17.27892  104.56989 1.000 60.96218  ? 189 PRO B C   1 
ATOM   8062  O O   . PRO C  1 209 ? -0.33088  -16.75688  103.58401 1.000 59.70910  ? 189 PRO B O   1 
ATOM   8063  C CB  . PRO C  1 209 ? 1.59750   -19.22127  103.82282 1.000 61.75662  ? 189 PRO B CB  1 
ATOM   8064  C CG  . PRO C  1 209 ? 1.02596   -19.27984  102.47122 1.000 59.99807  ? 189 PRO B CG  1 
ATOM   8065  C CD  . PRO C  1 209 ? -0.39570  -19.82877  102.62958 1.000 58.01408  ? 189 PRO B CD  1 
ATOM   8066  N N   . ALA C  1 210 ? 0.63256   -16.58036  105.61604 1.000 62.54997  ? 190 ALA B N   1 
ATOM   8067  C CA  . ALA C  1 210 ? 0.66465   -15.12228  105.55879 1.000 66.27298  ? 190 ALA B CA  1 
ATOM   8068  C C   . ALA C  1 210 ? 1.68650   -14.64825  104.53258 1.000 73.17717  ? 190 ALA B C   1 
ATOM   8069  O O   . ALA C  1 210 ? 1.35075   -13.92718  103.58669 1.000 75.67522  ? 190 ALA B O   1 
ATOM   8070  C CB  . ALA C  1 210 ? 0.97443   -14.55123  106.94167 1.000 64.68701  ? 190 ALA B CB  1 
ATOM   8071  N N   . ASP C  1 211 ? 2.94526   -15.05378  104.70654 1.000 72.69025  ? 191 ASP B N   1 
ATOM   8072  C CA  . ASP C  1 211 ? 4.03847   -14.75501  103.78950 1.000 71.23639  ? 191 ASP B CA  1 
ATOM   8073  C C   . ASP C  1 211 ? 4.32872   -16.00407  102.96307 1.000 70.82711  ? 191 ASP B C   1 
ATOM   8074  O O   . ASP C  1 211 ? 5.11193   -16.86429  103.38758 1.000 67.26223  ? 191 ASP B O   1 
ATOM   8075  C CB  . ASP C  1 211 ? 5.27677   -14.30436  104.56975 1.000 72.51840  ? 191 ASP B CB  1 
ATOM   8076  C CG  . ASP C  1 211 ? 6.27271   -13.55207  103.71157 1.000 74.31401  ? 191 ASP B CG  1 
ATOM   8077  O OD1 . ASP C  1 211 ? 5.86315   -12.99547  102.66998 1.000 75.52001  ? 191 ASP B OD1 1 
ATOM   8078  O OD2 . ASP C  1 211 ? 7.46527   -13.51166  104.08610 1.000 72.48176  ? 191 ASP B OD2 1 
ATOM   8079  N N   . PRO C  1 212 ? 3.71741   -16.14346  101.79046 1.000 68.89009  ? 192 PRO B N   1 
ATOM   8080  C CA  . PRO C  1 212 ? 3.79536   -17.40902  101.04979 1.000 63.55433  ? 192 PRO B CA  1 
ATOM   8081  C C   . PRO C  1 212 ? 5.18234   -17.63508  100.47854 1.000 71.42168  ? 192 PRO B C   1 
ATOM   8082  O O   . PRO C  1 212 ? 5.83455   -16.68791  100.01692 1.000 66.15410  ? 192 PRO B O   1 
ATOM   8083  C CB  . PRO C  1 212 ? 2.75628   -17.22947  99.93101  1.000 61.41044  ? 192 PRO B CB  1 
ATOM   8084  C CG  . PRO C  1 212 ? 1.93278   -16.03296  100.33462 1.000 64.02258  ? 192 PRO B CG  1 
ATOM   8085  C CD  . PRO C  1 212 ? 2.86528   -15.15998  101.10416 1.000 65.90662  ? 192 PRO B CD  1 
ATOM   8086  N N   . PRO C  1 213 ? 5.66098   -18.87991  100.47867 1.000 73.23388  ? 193 PRO B N   1 
ATOM   8087  C CA  . PRO C  1 213 ? 6.99825   -19.16157  99.94398  1.000 78.34269  ? 193 PRO B CA  1 
ATOM   8088  C C   . PRO C  1 213 ? 7.11669   -18.78556  98.47369  1.000 89.07632  ? 193 PRO B C   1 
ATOM   8089  O O   . PRO C  1 213 ? 6.12607   -18.66021  97.75122  1.000 108.97202 ? 193 PRO B O   1 
ATOM   8090  C CB  . PRO C  1 213 ? 7.14840   -20.67473  100.14170 1.000 80.02395  ? 193 PRO B CB  1 
ATOM   8091  C CG  . PRO C  1 213 ? 6.20531   -21.00046  101.25288 1.000 76.25427  ? 193 PRO B CG  1 
ATOM   8092  C CD  . PRO C  1 213 ? 5.04226   -20.07225  101.08072 1.000 69.54593  ? 193 PRO B CD  1 
ATOM   8093  N N   . GLY C  1 214 ? 8.36821   -18.61520  98.03170  1.000 94.01042  ? 194 GLY B N   1 
ATOM   8094  C CA  . GLY C  1 214 ? 8.64030   -18.17956  96.68092  1.000 93.40616  ? 194 GLY B CA  1 
ATOM   8095  C C   . GLY C  1 214 ? 8.82311   -19.32108  95.68913  1.000 87.17571  ? 194 GLY B C   1 
ATOM   8096  O O   . GLY C  1 214 ? 9.13497   -20.45222  96.05216  1.000 89.24051  ? 194 GLY B O   1 
ATOM   8097  N N   . ILE C  1 215 ? 8.60859   -19.00906  94.41692  1.000 83.43763  ? 195 ILE B N   1 
ATOM   8098  C CA  . ILE C  1 215 ? 9.02230   -19.91270  93.34047  1.000 81.33946  ? 195 ILE B CA  1 
ATOM   8099  C C   . ILE C  1 215 ? 10.49256  -19.64746  93.02859  1.000 83.95634  ? 195 ILE B C   1 
ATOM   8100  O O   . ILE C  1 215 ? 10.87720  -18.47870  92.85787  1.000 83.22626  ? 195 ILE B O   1 
ATOM   8101  C CB  . ILE C  1 215 ? 8.15778   -19.71230  92.09759  1.000 76.65120  ? 195 ILE B CB  1 
ATOM   8102  C CG1 . ILE C  1 215 ? 6.68205   -20.00237  92.38674  1.000 73.75562  ? 195 ILE B CG1 1 
ATOM   8103  C CG2 . ILE C  1 215 ? 8.67198   -20.56502  90.93795  1.000 67.99115  ? 195 ILE B CG2 1 
ATOM   8104  C CD1 . ILE C  1 215 ? 5.73765   -19.39170  91.36180  1.000 67.51991  ? 195 ILE B CD1 1 
ATOM   8105  N N   . PRO C  1 216 ? 11.33809  -20.67537  92.96642  1.000 78.01919  ? 196 PRO B N   1 
ATOM   8106  C CA  . PRO C  1 216 ? 12.75755  -20.44634  92.64923  1.000 77.54497  ? 196 PRO B CA  1 
ATOM   8107  C C   . PRO C  1 216 ? 12.92470  -19.93374  91.22838  1.000 79.65242  ? 196 PRO B C   1 
ATOM   8108  O O   . PRO C  1 216 ? 12.47550  -20.55885  90.26282  1.000 72.52842  ? 196 PRO B O   1 
ATOM   8109  C CB  . PRO C  1 216 ? 13.39028  -21.82933  92.83480  1.000 80.52252  ? 196 PRO B CB  1 
ATOM   8110  C CG  . PRO C  1 216 ? 12.44859  -22.55996  93.72191  1.000 83.04458  ? 196 PRO B CG  1 
ATOM   8111  C CD  . PRO C  1 216 ? 11.08156  -22.07117  93.34646  1.000 76.57820  ? 196 PRO B CD  1 
ATOM   8112  N N   . GLY C  1 217 ? 13.59329  -18.78325  91.10800  1.000 82.88506  ? 197 GLY B N   1 
ATOM   8113  C CA  . GLY C  1 217 ? 13.71859  -18.05676  89.86417  1.000 77.92547  ? 197 GLY B CA  1 
ATOM   8114  C C   . GLY C  1 217 ? 12.82948  -16.82965  89.79617  1.000 81.79697  ? 197 GLY B C   1 
ATOM   8115  O O   . GLY C  1 217 ? 13.15199  -15.88312  89.06529  1.000 85.57293  ? 197 GLY B O   1 
ATOM   8116  N N   . ASN C  1 218 ? 11.69872  -16.83224  90.54142  1.000 85.72214  ? 198 ASN B N   1 
ATOM   8117  C CA  . ASN C  1 218 ? 10.79454  -15.67324  90.65318  1.000 90.13925  ? 198 ASN B CA  1 
ATOM   8118  C C   . ASN C  1 218 ? 10.12160  -15.69501  92.03501  1.000 94.90514  ? 198 ASN B C   1 
ATOM   8119  O O   . ASN C  1 218 ? 8.98914   -16.13287  92.23028  1.000 114.86448 ? 198 ASN B O   1 
ATOM   8120  C CB  . ASN C  1 218 ? 9.79714   -15.57174  89.48629  1.000 87.80192  ? 198 ASN B CB  1 
ATOM   8121  C CG  . ASN C  1 218 ? 8.86090   -16.80622  89.28623  1.000 93.78276  ? 198 ASN B CG  1 
ATOM   8122  O OD1 . ASN C  1 218 ? 8.15042   -17.24345  90.19048  1.000 93.91504  ? 198 ASN B OD1 1 
ATOM   8123  N ND2 . ASN C  1 218 ? 8.84744   -17.33598  88.04624  1.000 100.35449 ? 198 ASN B ND2 1 
ATOM   8124  N N   . GLU C  1 219 ? 10.81409  -15.16886  93.04291  1.000 79.58448  ? 199 GLU B N   1 
ATOM   8125  C CA  . GLU C  1 219 ? 10.01761  -15.10730  94.25706  1.000 71.14506  ? 199 GLU B CA  1 
ATOM   8126  C C   . GLU C  1 219 ? 8.95647   -14.00692  94.16507  1.000 68.69927  ? 199 GLU B C   1 
ATOM   8127  O O   . GLU C  1 219 ? 8.16084   -13.85359  95.08307  1.000 67.94910  ? 199 GLU B O   1 
ATOM   8128  C CB  . GLU C  1 219 ? 10.91963  -14.99130  95.50225  1.000 72.18413  ? 199 GLU B CB  1 
ATOM   8129  C CG  . GLU C  1 219 ? 10.23989  -14.52964  96.77323  1.000 73.66145  ? 199 GLU B CG  1 
ATOM   8130  C CD  . GLU C  1 219 ? 10.75598  -15.19149  98.03970  1.000 81.90802  ? 199 GLU B CD  1 
ATOM   8131  O OE1 . GLU C  1 219 ? 11.77660  -15.91735  97.99743  1.000 90.14432  ? 199 GLU B OE1 1 
ATOM   8132  O OE2 . GLU C  1 219 ? 10.12517  -14.96599  99.09526  1.000 82.10997  ? 199 GLU B OE2 1 
ATOM   8133  N N   . GLY C  1 220 ? 8.80835   -13.33363  93.02594  1.000 68.19026  ? 200 GLY B N   1 
ATOM   8134  C CA  . GLY C  1 220 ? 7.65150   -12.46678  92.89287  1.000 66.65417  ? 200 GLY B CA  1 
ATOM   8135  C C   . GLY C  1 220 ? 6.31683   -13.19016  92.85261  1.000 65.51136  ? 200 GLY B C   1 
ATOM   8136  O O   . GLY C  1 220 ? 5.27730   -12.53900  93.00286  1.000 63.08680  ? 200 GLY B O   1 
ATOM   8137  N N   . PHE C  1 221 ? 6.31446   -14.50896  92.66935  1.000 71.06483  ? 201 PHE B N   1 
ATOM   8138  C CA  . PHE C  1 221 ? 5.07591   -15.23610  92.44022  1.000 71.74097  ? 201 PHE B CA  1 
ATOM   8139  C C   . PHE C  1 221 ? 5.00919   -16.49246  93.29424  1.000 76.47842  ? 201 PHE B C   1 
ATOM   8140  O O   . PHE C  1 221 ? 6.01598   -16.97307  93.82061  1.000 101.27354 ? 201 PHE B O   1 
ATOM   8141  C CB  . PHE C  1 221 ? 4.91605   -15.59428  90.96093  1.000 64.22269  ? 201 PHE B CB  1 
ATOM   8142  C CG  . PHE C  1 221 ? 4.59135   -14.41284  90.09853  1.000 69.51676  ? 201 PHE B CG  1 
ATOM   8143  C CD1 . PHE C  1 221 ? 5.60511   -13.64091  89.55334  1.000 65.20093  ? 201 PHE B CD1 1 
ATOM   8144  C CD2 . PHE C  1 221 ? 3.27524   -14.05604  89.85450  1.000 62.69070  ? 201 PHE B CD2 1 
ATOM   8145  C CE1 . PHE C  1 221 ? 5.31355   -12.54784  88.76573  1.000 65.59826  ? 201 PHE B CE1 1 
ATOM   8146  C CE2 . PHE C  1 221 ? 2.97581   -12.96114  89.06707  1.000 62.21846  ? 201 PHE B CE2 1 
ATOM   8147  C CZ  . PHE C  1 221 ? 3.99675   -12.20554  88.52122  1.000 66.06899  ? 201 PHE B CZ  1 
ATOM   8148  N N   . ALA C  1 222 ? 3.79048   -17.01760  93.41967  1.000 74.85048  ? 202 ALA B N   1 
ATOM   8149  C CA  . ALA C  1 222 ? 3.51428   -18.19357  94.22809  1.000 67.35442  ? 202 ALA B CA  1 
ATOM   8150  C C   . ALA C  1 222 ? 2.69963   -19.20452  93.43923  1.000 59.29286  ? 202 ALA B C   1 
ATOM   8151  O O   . ALA C  1 222 ? 2.01691   -18.86935  92.46893  1.000 55.91880  ? 202 ALA B O   1 
ATOM   8152  C CB  . ALA C  1 222 ? 2.78142   -17.82825  95.52276  1.000 65.67862  ? 202 ALA B CB  1 
ATOM   8153  N N   . LEU C  1 223 ? 2.78791   -20.45605  93.87991  1.000 61.49218  ? 203 LEU B N   1 
ATOM   8154  C CA  . LEU C  1 223 ? 2.07280   -21.57419  93.27652  1.000 55.47302  ? 203 LEU B CA  1 
ATOM   8155  C C   . LEU C  1 223 ? 0.92260   -21.92921  94.21016  1.000 56.16575  ? 203 LEU B C   1 
ATOM   8156  O O   . LEU C  1 223 ? 1.13093   -22.53010  95.26768  1.000 65.11712  ? 203 LEU B O   1 
ATOM   8157  C CB  . LEU C  1 223 ? 3.00909   -22.75450  93.04312  1.000 56.30488  ? 203 LEU B CB  1 
ATOM   8158  C CG  . LEU C  1 223 ? 3.82855   -22.66933  91.75150  1.000 56.91908  ? 203 LEU B CG  1 
ATOM   8159  C CD1 . LEU C  1 223 ? 4.50455   -24.00071  91.42751  1.000 57.34341  ? 203 LEU B CD1 1 
ATOM   8160  C CD2 . LEU C  1 223 ? 2.95735   -22.21010  90.58853  1.000 55.35086  ? 203 LEU B CD2 1 
ATOM   8161  N N   . ALA C  1 224 ? -0.28663  -21.54439  93.81835  1.000 52.55289  ? 204 ALA B N   1 
ATOM   8162  C CA  . ALA C  1 224 ? -1.48706  -21.78644  94.60569  1.000 56.99843  ? 204 ALA B CA  1 
ATOM   8163  C C   . ALA C  1 224 ? -2.20241  -23.02267  94.07375  1.000 49.75436  ? 204 ALA B C   1 
ATOM   8164  O O   . ALA C  1 224 ? -2.43173  -23.13551  92.86670  1.000 48.87980  ? 204 ALA B O   1 
ATOM   8165  C CB  . ALA C  1 224 ? -2.41409  -20.57101  94.55998  1.000 50.47868  ? 204 ALA B CB  1 
ATOM   8166  N N   . SER C  1 225 ? -2.56549  -23.93593  94.97426  1.000 49.46580  ? 205 SER B N   1 
ATOM   8167  C CA  . SER C  1 225 ? -3.15757  -25.20482  94.56507  1.000 53.20891  ? 205 SER B CA  1 
ATOM   8168  C C   . SER C  1 225 ? -4.58939  -24.99322  94.09684  1.000 49.85806  ? 205 SER B C   1 
ATOM   8169  O O   . SER C  1 225 ? -5.42321  -24.46314  94.83744  1.000 53.10517  ? 205 SER B O   1 
ATOM   8170  C CB  . SER C  1 225 ? -3.12164  -26.21297  95.71095  1.000 63.36083  ? 205 SER B CB  1 
ATOM   8171  O OG  . SER C  1 225 ? -3.97555  -27.31937  95.45950  1.000 57.35020  ? 205 SER B OG  1 
ATOM   8172  N N   . MET C  1 226 ? -4.87154  -25.41709  92.86806  1.000 45.24748  ? 206 MET B N   1 
ATOM   8173  C CA  . MET C  1 226 ? -6.20588  -25.36726  92.29115  1.000 43.46842  ? 206 MET B CA  1 
ATOM   8174  C C   . MET C  1 226 ? -7.15097  -26.41237  92.86547  1.000 42.35871  ? 206 MET B C   1 
ATOM   8175  O O   . MET C  1 226 ? -8.34218  -26.38545  92.53763  1.000 50.29856  ? 206 MET B O   1 
ATOM   8176  C CB  . MET C  1 226 ? -6.10383  -25.55554  90.78129  1.000 43.68477  ? 206 MET B CB  1 
ATOM   8177  C CG  . MET C  1 226 ? -5.27389  -24.51414  90.08498  1.000 43.91419  ? 206 MET B CG  1 
ATOM   8178  S SD  . MET C  1 226 ? -4.59259  -25.15041  88.56291  1.000 54.84552  ? 206 MET B SD  1 
ATOM   8179  C CE  . MET C  1 226 ? -5.71346  -24.45024  87.38014  1.000 42.52724  ? 206 MET B CE  1 
ATOM   8180  N N   . GLY C  1 227 ? -6.65955  -27.33335  93.68906  1.000 51.83316  ? 207 GLY B N   1 
ATOM   8181  C CA  . GLY C  1 227 ? -7.46414  -28.47303  94.08351  1.000 48.99162  ? 207 GLY B CA  1 
ATOM   8182  C C   . GLY C  1 227 ? -7.65403  -29.47851  92.97222  1.000 45.48464  ? 207 GLY B C   1 
ATOM   8183  O O   . GLY C  1 227 ? -8.64941  -30.21280  92.96643  1.000 43.30227  ? 207 GLY B O   1 
ATOM   8184  N N   . ILE C  1 228 ? -6.72270  -29.52510  92.02312  1.000 43.38646  ? 208 ILE B N   1 
ATOM   8185  C CA  . ILE C  1 228 ? -6.80123  -30.39446  90.85663  1.000 40.83562  ? 208 ILE B CA  1 
ATOM   8186  C C   . ILE C  1 228 ? -5.66279  -31.39257  90.94798  1.000 49.80012  ? 208 ILE B C   1 
ATOM   8187  O O   . ILE C  1 228 ? -4.48632  -31.01624  90.86354  1.000 62.99569  ? 208 ILE B O   1 
ATOM   8188  C CB  . ILE C  1 228 ? -6.73953  -29.59997  89.55163  1.000 40.60935  ? 208 ILE B CB  1 
ATOM   8189  C CG1 . ILE C  1 228 ? -7.97552  -28.71502  89.47173  1.000 39.46612  ? 208 ILE B CG1 1 
ATOM   8190  C CG2 . ILE C  1 228 ? -6.65990  -30.53829  88.36034  1.000 40.02864  ? 208 ILE B CG2 1 
ATOM   8191  C CD1 . ILE C  1 228 ? -7.94498  -27.74260  88.36405  1.000 39.38893  ? 208 ILE B CD1 1 
ATOM   8192  N N   . TYR C  1 229 ? -6.00772  -32.66423  91.12148  1.000 46.18079  ? 209 TYR B N   1 
ATOM   8193  C CA  . TYR C  1 229 ? -5.03500  -33.71011  91.38838  1.000 47.53106  ? 209 TYR B CA  1 
ATOM   8194  C C   . TYR C  1 229 ? -5.13443  -34.79550  90.32826  1.000 47.93876  ? 209 TYR B C   1 
ATOM   8195  O O   . TYR C  1 229 ? -6.23281  -35.19437  89.93060  1.000 52.80539  ? 209 TYR B O   1 
ATOM   8196  C CB  . TYR C  1 229 ? -5.25145  -34.33158  92.77277  1.000 50.55665  ? 209 TYR B CB  1 
ATOM   8197  C CG  . TYR C  1 229 ? -5.48232  -33.34288  93.89376  1.000 53.82981  ? 209 TYR B CG  1 
ATOM   8198  C CD1 . TYR C  1 229 ? -4.82521  -32.11640  93.92654  1.000 52.54111  ? 209 TYR B CD1 1 
ATOM   8199  C CD2 . TYR C  1 229 ? -6.37095  -33.63289  94.91594  1.000 55.40824  ? 209 TYR B CD2 1 
ATOM   8200  C CE1 . TYR C  1 229 ? -5.04857  -31.21214  94.95211  1.000 55.32287  ? 209 TYR B CE1 1 
ATOM   8201  C CE2 . TYR C  1 229 ? -6.59662  -32.73772  95.93505  1.000 59.38476  ? 209 TYR B CE2 1 
ATOM   8202  C CZ  . TYR C  1 229 ? -5.93499  -31.53334  95.95593  1.000 53.25784  ? 209 TYR B CZ  1 
ATOM   8203  O OH  . TYR C  1 229 ? -6.17248  -30.65032  96.98477  1.000 44.43651  ? 209 TYR B OH  1 
ATOM   8204  N N   . VAL C  1 230 ? -3.98136  -35.27417  89.87850  1.000 47.02705  ? 210 VAL B N   1 
ATOM   8205  C CA  . VAL C  1 230 ? -3.89738  -36.41185  88.97549  1.000 47.35150  ? 210 VAL B CA  1 
ATOM   8206  C C   . VAL C  1 230 ? -3.12931  -37.50938  89.69199  1.000 51.70694  ? 210 VAL B C   1 
ATOM   8207  O O   . VAL C  1 230 ? -2.06892  -37.24845  90.27338  1.000 44.60314  ? 210 VAL B O   1 
ATOM   8208  C CB  . VAL C  1 230 ? -3.22404  -36.03591  87.64363  1.000 46.84597  ? 210 VAL B CB  1 
ATOM   8209  C CG1 . VAL C  1 230 ? -3.01714  -37.26983  86.77847  1.000 42.11440  ? 210 VAL B CG1 1 
ATOM   8210  C CG2 . VAL C  1 230 ? -4.06627  -35.00347  86.90645  1.000 41.41177  ? 210 VAL B CG2 1 
ATOM   8211  N N   . PHE C  1 231 ? -3.68801  -38.72044  89.68408  1.000 42.07556  ? 211 PHE B N   1 
ATOM   8212  C CA  . PHE C  1 231 ? -3.05589  -39.90616  90.24191  1.000 42.84559  ? 211 PHE B CA  1 
ATOM   8213  C C   . PHE C  1 231 ? -3.05862  -41.00983  89.19817  1.000 49.85325  ? 211 PHE B C   1 
ATOM   8214  O O   . PHE C  1 231 ? -3.70994  -40.90787  88.15499  1.000 43.67990  ? 211 PHE B O   1 
ATOM   8215  C CB  . PHE C  1 231 ? -3.78712  -40.44972  91.48018  1.000 44.29592  ? 211 PHE B CB  1 
ATOM   8216  C CG  . PHE C  1 231 ? -3.95094  -39.47003  92.59858  1.000 48.98804  ? 211 PHE B CG  1 
ATOM   8217  C CD1 . PHE C  1 231 ? -3.23022  -39.62461  93.77075  1.000 45.47111  ? 211 PHE B CD1 1 
ATOM   8218  C CD2 . PHE C  1 231 ? -4.86555  -38.43947  92.51027  1.000 41.97884  ? 211 PHE B CD2 1 
ATOM   8219  C CE1 . PHE C  1 231 ? -3.39411  -38.74826  94.81749  1.000 45.45977  ? 211 PHE B CE1 1 
ATOM   8220  C CE2 . PHE C  1 231 ? -5.02879  -37.55612  93.55355  1.000 57.29952  ? 211 PHE B CE2 1 
ATOM   8221  C CZ  . PHE C  1 231 ? -4.29242  -37.70741  94.70806  1.000 52.95944  ? 211 PHE B CZ  1 
ATOM   8222  N N   . HIS C  1 232 ? -2.33615  -42.08416  89.51182  1.000 47.11674  ? 212 HIS B N   1 
ATOM   8223  C CA  . HIS C  1 232 ? -2.65128  -43.39404  88.96398  1.000 42.19311  ? 212 HIS B CA  1 
ATOM   8224  C C   . HIS C  1 232 ? -3.76788  -43.99691  89.79921  1.000 41.08815  ? 212 HIS B C   1 
ATOM   8225  O O   . HIS C  1 232 ? -3.72748  -43.94225  91.03245  1.000 41.69093  ? 212 HIS B O   1 
ATOM   8226  C CB  . HIS C  1 232 ? -1.42507  -44.30632  88.97790  1.000 43.58023  ? 212 HIS B CB  1 
ATOM   8227  C CG  . HIS C  1 232 ? -0.43920  -44.01283  87.89124  1.000 45.33989  ? 212 HIS B CG  1 
ATOM   8228  N ND1 . HIS C  1 232 ? 0.60266   -43.12531  88.05084  1.000 46.64439  ? 212 HIS B ND1 1 
ATOM   8229  C CD2 . HIS C  1 232 ? -0.33227  -44.49502  86.63069  1.000 44.04205  ? 212 HIS B CD2 1 
ATOM   8230  C CE1 . HIS C  1 232 ? 1.30455   -43.06733  86.93336  1.000 46.54679  ? 212 HIS B CE1 1 
ATOM   8231  N NE2 . HIS C  1 232 ? 0.75789   -43.88887  86.05573  1.000 45.73136  ? 212 HIS B NE2 1 
ATOM   8232  N N   . THR C  1 233 ? -4.76983  -44.55978  89.12671  1.000 39.53338  ? 213 THR B N   1 
ATOM   8233  C CA  . THR C  1 233 ? -5.93250  -45.08526  89.83564  1.000 38.41019  ? 213 THR B CA  1 
ATOM   8234  C C   . THR C  1 233 ? -5.53100  -46.01720  90.97106  1.000 45.08929  ? 213 THR B C   1 
ATOM   8235  O O   . THR C  1 233 ? -6.03443  -45.88899  92.09467  1.000 39.20756  ? 213 THR B O   1 
ATOM   8236  C CB  . THR C  1 233 ? -6.87089  -45.79986  88.85600  1.000 41.07036  ? 213 THR B CB  1 
ATOM   8237  O OG1 . THR C  1 233 ? -7.16336  -44.93657  87.74950  1.000 36.23338  ? 213 THR B OG1 1 
ATOM   8238  C CG2 . THR C  1 233 ? -8.17224  -46.18189  89.54716  1.000 36.62729  ? 213 THR B CG2 1 
ATOM   8239  N N   . LYS C  1 234 ? -4.61491  -46.95809  90.71007  1.000 40.05358  ? 214 LYS B N   1 
ATOM   8240  C CA  . LYS C  1 234 ? -4.27248  -47.92008  91.75429  1.000 42.74739  ? 214 LYS B CA  1 
ATOM   8241  C C   . LYS C  1 234 ? -3.64133  -47.22080  92.94784  1.000 45.63718  ? 214 LYS B C   1 
ATOM   8242  O O   . LYS C  1 234 ? -3.99781  -47.48990  94.10024  1.000 42.42186  ? 214 LYS B O   1 
ATOM   8243  C CB  . LYS C  1 234 ? -3.34094  -49.01370  91.22809  1.000 41.56245  ? 214 LYS B CB  1 
ATOM   8244  C CG  . LYS C  1 234 ? -4.00228  -50.07131  90.30550  1.000 58.13279  ? 214 LYS B CG  1 
ATOM   8245  C CD  . LYS C  1 234 ? -5.43706  -50.57126  90.68539  1.000 58.64145  ? 214 LYS B CD  1 
ATOM   8246  C CE  . LYS C  1 234 ? -5.73462  -50.77220  92.18635  1.000 58.00584  ? 214 LYS B CE  1 
ATOM   8247  N NZ  . LYS C  1 234 ? -7.21355  -50.64722  92.47331  1.000 50.34483  ? 214 LYS B NZ  1 
ATOM   8248  N N   . PHE C  1 235 ? -2.69595  -46.31643  92.68982  1.000 43.41220  ? 215 PHE B N   1 
ATOM   8249  C CA  . PHE C  1 235 ? -2.07470  -45.59211  93.78799  1.000 44.85962  ? 215 PHE B CA  1 
ATOM   8250  C C   . PHE C  1 235 ? -3.09688  -44.76340  94.56245  1.000 50.07008  ? 215 PHE B C   1 
ATOM   8251  O O   . PHE C  1 235 ? -2.99810  -44.64985  95.79040  1.000 46.53500  ? 215 PHE B O   1 
ATOM   8252  C CB  . PHE C  1 235 ? -0.94925  -44.71086  93.25603  1.000 46.13348  ? 215 PHE B CB  1 
ATOM   8253  C CG  . PHE C  1 235 ? -0.35869  -43.81747  94.28659  1.000 54.68233  ? 215 PHE B CG  1 
ATOM   8254  C CD1 . PHE C  1 235 ? -0.60427  -42.45726  94.25854  1.000 47.45268  ? 215 PHE B CD1 1 
ATOM   8255  C CD2 . PHE C  1 235 ? 0.42868   -44.33713  95.29980  1.000 51.77292  ? 215 PHE B CD2 1 
ATOM   8256  C CE1 . PHE C  1 235 ? -0.06835  -41.62734  95.21837  1.000 54.31291  ? 215 PHE B CE1 1 
ATOM   8257  C CE2 . PHE C  1 235 ? 0.97202   -43.50982  96.26397  1.000 55.22031  ? 215 PHE B CE2 1 
ATOM   8258  C CZ  . PHE C  1 235 ? 0.72362   -42.15202  96.22286  1.000 51.64680  ? 215 PHE B CZ  1 
ATOM   8259  N N   . LEU C  1 236 ? -4.10267  -44.20764  93.87696  1.000 42.60622  ? 216 LEU B N   1 
ATOM   8260  C CA  . LEU C  1 236 ? -5.11476  -43.42865  94.58633  1.000 48.15654  ? 216 LEU B CA  1 
ATOM   8261  C C   . LEU C  1 236 ? -5.98908  -44.32041  95.45751  1.000 47.10082  ? 216 LEU B C   1 
ATOM   8262  O O   . LEU C  1 236 ? -6.30365  -43.95841  96.59505  1.000 54.27282  ? 216 LEU B O   1 
ATOM   8263  C CB  . LEU C  1 236 ? -5.97833  -42.62878  93.60801  1.000 45.29138  ? 216 LEU B CB  1 
ATOM   8264  C CG  . LEU C  1 236 ? -7.03308  -41.72207  94.26388  1.000 50.31755  ? 216 LEU B CG  1 
ATOM   8265  C CD1 . LEU C  1 236 ? -6.39983  -40.67952  95.18428  1.000 41.17228  ? 216 LEU B CD1 1 
ATOM   8266  C CD2 . LEU C  1 236 ? -7.90897  -41.04493  93.22341  1.000 38.41449  ? 216 LEU B CD2 1 
ATOM   8267  N N   . MET C  1 237 ? -6.38787  -45.49185  94.94975  1.000 50.24952  ? 217 MET B N   1 
ATOM   8268  C CA  . MET C  1 237 ? -7.22039  -46.38775  95.74990  1.000 48.16440  ? 217 MET B CA  1 
ATOM   8269  C C   . MET C  1 237 ? -6.47075  -46.87984  96.98062  1.000 51.93263  ? 217 MET B C   1 
ATOM   8270  O O   . MET C  1 237 ? -7.06323  -47.03597  98.05558  1.000 55.02987  ? 217 MET B O   1 
ATOM   8271  C CB  . MET C  1 237 ? -7.69794  -47.57440  94.90799  1.000 46.23824  ? 217 MET B CB  1 
ATOM   8272  C CG  . MET C  1 237 ? -8.37104  -47.21066  93.59008  1.000 49.41156  ? 217 MET B CG  1 
ATOM   8273  S SD  . MET C  1 237 ? -9.87786  -46.22595  93.74439  1.000 60.67995  ? 217 MET B SD  1 
ATOM   8274  C CE  . MET C  1 237 ? -9.27581  -44.54357  93.52761  1.000 57.28172  ? 217 MET B CE  1 
ATOM   8275  N N   . GLU C  1 238 ? -5.16946  -47.14055  96.83823  1.000 46.05083  ? 218 GLU B N   1 
ATOM   8276  C CA  . GLU C  1 238 ? -4.35575  -47.49707  97.99434  1.000 44.30949  ? 218 GLU B CA  1 
ATOM   8277  C C   . GLU C  1 238 ? -4.33542  -46.36042  99.00483  1.000 58.01036  ? 218 GLU B C   1 
ATOM   8278  O O   . GLU C  1 238 ? -4.53618  -46.57693  100.20573 1.000 60.64059  ? 218 GLU B O   1 
ATOM   8279  C CB  . GLU C  1 238 ? -2.93545  -47.84915  97.55056  1.000 45.72518  ? 218 GLU B CB  1 
ATOM   8280  N N   . ALA C  1 239 ? -4.11174  -45.13234  98.52454  1.000 51.46319  ? 219 ALA B N   1 
ATOM   8281  C CA  . ALA C  1 239 ? -4.06141  -43.97400  99.41091  1.000 50.70678  ? 219 ALA B CA  1 
ATOM   8282  C C   . ALA C  1 239 ? -5.38275  -43.77103  100.14100 1.000 49.48260  ? 219 ALA B C   1 
ATOM   8283  O O   . ALA C  1 239 ? -5.39764  -43.52081  101.35185 1.000 50.20115  ? 219 ALA B O   1 
ATOM   8284  C CB  . ALA C  1 239 ? -3.69173  -42.72173  98.61555  1.000 46.10453  ? 219 ALA B CB  1 
ATOM   8285  N N   . LEU C  1 240 ? -6.50499  -43.88118  99.42623  1.000 44.32837  ? 220 LEU B N   1 
ATOM   8286  C CA  . LEU C  1 240 ? -7.79894  -43.64528  100.05972 1.000 47.17738  ? 220 LEU B CA  1 
ATOM   8287  C C   . LEU C  1 240 ? -8.07025  -44.65952  101.16483 1.000 52.00725  ? 220 LEU B C   1 
ATOM   8288  O O   . LEU C  1 240 ? -8.66703  -44.31887  102.19266 1.000 59.45573  ? 220 LEU B O   1 
ATOM   8289  C CB  . LEU C  1 240 ? -8.91429  -43.67023  99.01437  1.000 40.52310  ? 220 LEU B CB  1 
ATOM   8290  C CG  . LEU C  1 240 ? -8.80526  -42.64969  97.87610  1.000 43.71051  ? 220 LEU B CG  1 
ATOM   8291  C CD1 . LEU C  1 240 ? -9.87740  -42.90928  96.82499  1.000 39.89453  ? 220 LEU B CD1 1 
ATOM   8292  C CD2 . LEU C  1 240 ? -8.87849  -41.20907  98.38795  1.000 45.71192  ? 220 LEU B CD2 1 
ATOM   8293  N N   . ARG C  1 241 ? -7.64226  -45.91065  100.97381 1.000 48.27032  ? 221 ARG B N   1 
ATOM   8294  C CA  . ARG C  1 241 ? -7.78528  -46.90055  102.03608 1.000 52.64236  ? 221 ARG B CA  1 
ATOM   8295  C C   . ARG C  1 241 ? -6.77800  -46.66093  103.14869 1.000 61.29554  ? 221 ARG B C   1 
ATOM   8296  O O   . ARG C  1 241 ? -7.09933  -46.83375  104.32955 1.000 64.14588  ? 221 ARG B O   1 
ATOM   8297  C CB  . ARG C  1 241 ? -7.63357  -48.30720  101.46648 1.000 47.07382  ? 221 ARG B CB  1 
ATOM   8298  C CG  . ARG C  1 241 ? -8.73446  -48.66401  100.51098 1.000 47.76942  ? 221 ARG B CG  1 
ATOM   8299  C CD  . ARG C  1 241 ? -9.27770  -50.07024  100.77385 1.000 49.97827  ? 221 ARG B CD  1 
ATOM   8300  N NE  . ARG C  1 241 ? -10.09070 -50.52833  99.64220  1.000 42.78055  ? 221 ARG B NE  1 
ATOM   8301  C CZ  . ARG C  1 241 ? -9.61422  -50.74814  98.42752  1.000 48.16463  ? 221 ARG B CZ  1 
ATOM   8302  N NH1 . ARG C  1 241 ? -8.31710  -50.59119  98.18846  1.000 60.24835  ? 221 ARG B NH1 1 
ATOM   8303  N NH2 . ARG C  1 241 ? -10.41926 -51.14817  97.44448  1.000 38.80863  ? 221 ARG B NH2 1 
ATOM   8304  N N   . ARG C  1 242 ? -5.55276  -46.27502  102.78497 1.000 64.68540  ? 222 ARG B N   1 
ATOM   8305  C CA  . ARG C  1 242 ? -4.58161  -45.80900  103.76833 1.000 58.20017  ? 222 ARG B CA  1 
ATOM   8306  C C   . ARG C  1 242 ? -5.19882  -44.73925  104.66108 1.000 52.07978  ? 222 ARG B C   1 
ATOM   8307  O O   . ARG C  1 242 ? -5.06203  -44.78057  105.88822 1.000 55.41181  ? 222 ARG B O   1 
ATOM   8308  C CB  . ARG C  1 242 ? -3.33181  -45.26895  103.05874 1.000 62.99624  ? 222 ARG B CB  1 
ATOM   8309  C CG  . ARG C  1 242 ? -2.37709  -46.32998  102.49016 1.000 68.34069  ? 222 ARG B CG  1 
ATOM   8310  C CD  . ARG C  1 242 ? -1.08160  -46.36372  103.27074 1.000 73.17587  ? 222 ARG B CD  1 
ATOM   8311  N NE  . ARG C  1 242 ? -1.22662  -47.14983  104.49174 1.000 76.35135  ? 222 ARG B NE  1 
ATOM   8312  C CZ  . ARG C  1 242 ? -0.44890  -47.02417  105.56247 1.000 80.02499  ? 222 ARG B CZ  1 
ATOM   8313  N NH1 . ARG C  1 242 ? -0.65812  -47.78382  106.63105 1.000 81.19276  ? 222 ARG B NH1 1 
ATOM   8314  N NH2 . ARG C  1 242 ? 0.52504   -46.12254  105.57208 1.000 76.77880  ? 222 ARG B NH2 1 
ATOM   8315  N N   . ASP C  1 243 ? -5.93073  -43.79921  104.05579 1.000 52.35071  ? 223 ASP