data_6VSU
# 
_entry.id   6VSU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.331 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6VSU         
WWPDB D_1000247018 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6VSU 
_pdbx_database_status.recvd_initial_deposition_date   2020-02-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name               'Sekula, B.' 
_audit_author.pdbx_ordinal       1 
_audit_author.identifier_ORCID   ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   CH 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Front Plant Sci' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1664-462X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                987 
_citation.page_last                 987 
_citation.title                     
'The Neighboring Subunit Is Engaged to Stabilize the Substrate in the Active Site of Plant Arginases.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.3389/fpls.2020.00987 
_citation.pdbx_database_id_PubMed   32754173 
_citation.unpublished_flag          ? 
# 
_citation_author.citation_id        primary 
_citation_author.name               'Sekula, B.' 
_citation_author.ordinal            1 
_citation_author.identifier_ORCID   ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6VSU 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     267.322 
_cell.length_a_esd                 ? 
_cell.length_b                     267.322 
_cell.length_b_esd                 ? 
_cell.length_c                     262.894 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        192 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6VSU 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                80 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'I 41' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Arginase 1, mitochondrial' 34958.746 24   3.5.3.1,3.5.3.11 ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'        54.938    48   ?                ? ? ? 
3 non-polymer syn 'SODIUM ION'                22.990    24   ?                ? ? ? 
4 non-polymer syn L-ornithine                 132.161   9    ?                ? ? ? 
5 non-polymer syn GLYCEROL                    92.094    30   ?                ? ? ? 
6 non-polymer syn 'DI(HYDROXYETHYL)ETHER'     106.120   5    ?                ? ? ? 
7 water       nat water                       18.015    4951 ?                ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Agmatinase ARGAH1,Arginine amidohydrolase 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SNASASSIEKGQNRVIDASLTLIRERAKLKGELVRLLGGAKASTSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSA
TEEGKELKDPRVLTDVGDVPVQEIRDCGVDDDRLMNVISESVKLVMEEEPLRPLVLGGDHSISYPVVRAVSEKLGGPVDI
LHLDAHPDIYDCFEGNKYSHASSFARIMEGGYARRLLQVGIRSINQEGREQGKRFGVEQYEMRTFSKDRPMLENLKLGEG
VKGVYISIDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHNLQADVVGADVVEFNPQRDTVDGMTAMVAAKLVRELAAKIS
K
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNASASSIEKGQNRVIDASLTLIRERAKLKGELVRLLGGAKASTSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSA
TEEGKELKDPRVLTDVGDVPVQEIRDCGVDDDRLMNVISESVKLVMEEEPLRPLVLGGDHSISYPVVRAVSEKLGGPVDI
LHLDAHPDIYDCFEGNKYSHASSFARIMEGGYARRLLQVGIRSINQEGREQGKRFGVEQYEMRTFSKDRPMLENLKLGEG
VKGVYISIDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHNLQADVVGADVVEFNPQRDTVDGMTAMVAAKLVRELAAKIS
K
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ALA n 
1 4   SER n 
1 5   ALA n 
1 6   SER n 
1 7   SER n 
1 8   ILE n 
1 9   GLU n 
1 10  LYS n 
1 11  GLY n 
1 12  GLN n 
1 13  ASN n 
1 14  ARG n 
1 15  VAL n 
1 16  ILE n 
1 17  ASP n 
1 18  ALA n 
1 19  SER n 
1 20  LEU n 
1 21  THR n 
1 22  LEU n 
1 23  ILE n 
1 24  ARG n 
1 25  GLU n 
1 26  ARG n 
1 27  ALA n 
1 28  LYS n 
1 29  LEU n 
1 30  LYS n 
1 31  GLY n 
1 32  GLU n 
1 33  LEU n 
1 34  VAL n 
1 35  ARG n 
1 36  LEU n 
1 37  LEU n 
1 38  GLY n 
1 39  GLY n 
1 40  ALA n 
1 41  LYS n 
1 42  ALA n 
1 43  SER n 
1 44  THR n 
1 45  SER n 
1 46  LEU n 
1 47  LEU n 
1 48  GLY n 
1 49  VAL n 
1 50  PRO n 
1 51  LEU n 
1 52  GLY n 
1 53  HIS n 
1 54  ASN n 
1 55  SER n 
1 56  SER n 
1 57  PHE n 
1 58  LEU n 
1 59  GLN n 
1 60  GLY n 
1 61  PRO n 
1 62  ALA n 
1 63  PHE n 
1 64  ALA n 
1 65  PRO n 
1 66  PRO n 
1 67  ARG n 
1 68  ILE n 
1 69  ARG n 
1 70  GLU n 
1 71  ALA n 
1 72  ILE n 
1 73  TRP n 
1 74  CYS n 
1 75  GLY n 
1 76  SER n 
1 77  THR n 
1 78  ASN n 
1 79  SER n 
1 80  ALA n 
1 81  THR n 
1 82  GLU n 
1 83  GLU n 
1 84  GLY n 
1 85  LYS n 
1 86  GLU n 
1 87  LEU n 
1 88  LYS n 
1 89  ASP n 
1 90  PRO n 
1 91  ARG n 
1 92  VAL n 
1 93  LEU n 
1 94  THR n 
1 95  ASP n 
1 96  VAL n 
1 97  GLY n 
1 98  ASP n 
1 99  VAL n 
1 100 PRO n 
1 101 VAL n 
1 102 GLN n 
1 103 GLU n 
1 104 ILE n 
1 105 ARG n 
1 106 ASP n 
1 107 CYS n 
1 108 GLY n 
1 109 VAL n 
1 110 ASP n 
1 111 ASP n 
1 112 ASP n 
1 113 ARG n 
1 114 LEU n 
1 115 MET n 
1 116 ASN n 
1 117 VAL n 
1 118 ILE n 
1 119 SER n 
1 120 GLU n 
1 121 SER n 
1 122 VAL n 
1 123 LYS n 
1 124 LEU n 
1 125 VAL n 
1 126 MET n 
1 127 GLU n 
1 128 GLU n 
1 129 GLU n 
1 130 PRO n 
1 131 LEU n 
1 132 ARG n 
1 133 PRO n 
1 134 LEU n 
1 135 VAL n 
1 136 LEU n 
1 137 GLY n 
1 138 GLY n 
1 139 ASP n 
1 140 HIS n 
1 141 SER n 
1 142 ILE n 
1 143 SER n 
1 144 TYR n 
1 145 PRO n 
1 146 VAL n 
1 147 VAL n 
1 148 ARG n 
1 149 ALA n 
1 150 VAL n 
1 151 SER n 
1 152 GLU n 
1 153 LYS n 
1 154 LEU n 
1 155 GLY n 
1 156 GLY n 
1 157 PRO n 
1 158 VAL n 
1 159 ASP n 
1 160 ILE n 
1 161 LEU n 
1 162 HIS n 
1 163 LEU n 
1 164 ASP n 
1 165 ALA n 
1 166 HIS n 
1 167 PRO n 
1 168 ASP n 
1 169 ILE n 
1 170 TYR n 
1 171 ASP n 
1 172 CYS n 
1 173 PHE n 
1 174 GLU n 
1 175 GLY n 
1 176 ASN n 
1 177 LYS n 
1 178 TYR n 
1 179 SER n 
1 180 HIS n 
1 181 ALA n 
1 182 SER n 
1 183 SER n 
1 184 PHE n 
1 185 ALA n 
1 186 ARG n 
1 187 ILE n 
1 188 MET n 
1 189 GLU n 
1 190 GLY n 
1 191 GLY n 
1 192 TYR n 
1 193 ALA n 
1 194 ARG n 
1 195 ARG n 
1 196 LEU n 
1 197 LEU n 
1 198 GLN n 
1 199 VAL n 
1 200 GLY n 
1 201 ILE n 
1 202 ARG n 
1 203 SER n 
1 204 ILE n 
1 205 ASN n 
1 206 GLN n 
1 207 GLU n 
1 208 GLY n 
1 209 ARG n 
1 210 GLU n 
1 211 GLN n 
1 212 GLY n 
1 213 LYS n 
1 214 ARG n 
1 215 PHE n 
1 216 GLY n 
1 217 VAL n 
1 218 GLU n 
1 219 GLN n 
1 220 TYR n 
1 221 GLU n 
1 222 MET n 
1 223 ARG n 
1 224 THR n 
1 225 PHE n 
1 226 SER n 
1 227 LYS n 
1 228 ASP n 
1 229 ARG n 
1 230 PRO n 
1 231 MET n 
1 232 LEU n 
1 233 GLU n 
1 234 ASN n 
1 235 LEU n 
1 236 LYS n 
1 237 LEU n 
1 238 GLY n 
1 239 GLU n 
1 240 GLY n 
1 241 VAL n 
1 242 LYS n 
1 243 GLY n 
1 244 VAL n 
1 245 TYR n 
1 246 ILE n 
1 247 SER n 
1 248 ILE n 
1 249 ASP n 
1 250 VAL n 
1 251 ASP n 
1 252 CYS n 
1 253 LEU n 
1 254 ASP n 
1 255 PRO n 
1 256 ALA n 
1 257 PHE n 
1 258 ALA n 
1 259 PRO n 
1 260 GLY n 
1 261 VAL n 
1 262 SER n 
1 263 HIS n 
1 264 ILE n 
1 265 GLU n 
1 266 PRO n 
1 267 GLY n 
1 268 GLY n 
1 269 LEU n 
1 270 SER n 
1 271 PHE n 
1 272 ARG n 
1 273 ASP n 
1 274 VAL n 
1 275 LEU n 
1 276 ASN n 
1 277 ILE n 
1 278 LEU n 
1 279 HIS n 
1 280 ASN n 
1 281 LEU n 
1 282 GLN n 
1 283 ALA n 
1 284 ASP n 
1 285 VAL n 
1 286 VAL n 
1 287 GLY n 
1 288 ALA n 
1 289 ASP n 
1 290 VAL n 
1 291 VAL n 
1 292 GLU n 
1 293 PHE n 
1 294 ASN n 
1 295 PRO n 
1 296 GLN n 
1 297 ARG n 
1 298 ASP n 
1 299 THR n 
1 300 VAL n 
1 301 ASP n 
1 302 GLY n 
1 303 MET n 
1 304 THR n 
1 305 ALA n 
1 306 MET n 
1 307 VAL n 
1 308 ALA n 
1 309 ALA n 
1 310 LYS n 
1 311 LEU n 
1 312 VAL n 
1 313 ARG n 
1 314 GLU n 
1 315 LEU n 
1 316 ALA n 
1 317 ALA n 
1 318 LYS n 
1 319 ILE n 
1 320 SER n 
1 321 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   321 
_entity_src_gen.gene_src_common_name               'Mouse-ear cress' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ARGAH1, At4g08900, T3H13.7' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    leaves 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Arabidopsis thaliana' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     3702 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ARGI1_ARATH 
_struct_ref.pdbx_db_accession          P46637 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SASSIEKGQNRVIDASLTLIRERAKLKGELVRLLGGAKASTSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSATEE
GKELKDPRVLTDVGDVPVQEIRDCGVDDDRLMNVISESVKLVMEEEPLRPLVLGGDHSISYPVVRAVSEKLGGPVDILHL
DAHPDIYDCFEGNKYSHASSFARIMEGGYARRLLQVGIRSINQEGREQGKRFGVEQYEMRTFSKDRPMLENLKLGEGVKG
VYISIDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHNLQADVVGADVVEFNPQRDTVDGMTAMVAAKLVRELAAKISK
;
_struct_ref.pdbx_align_begin           25 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6VSU A 4 ? 321 ? P46637 25 ? 342 ? 25 342 
2  1 6VSU B 4 ? 321 ? P46637 25 ? 342 ? 25 342 
3  1 6VSU C 4 ? 321 ? P46637 25 ? 342 ? 25 342 
4  1 6VSU D 4 ? 321 ? P46637 25 ? 342 ? 25 342 
5  1 6VSU E 4 ? 321 ? P46637 25 ? 342 ? 25 342 
6  1 6VSU F 4 ? 321 ? P46637 25 ? 342 ? 25 342 
7  1 6VSU G 4 ? 321 ? P46637 25 ? 342 ? 25 342 
8  1 6VSU H 4 ? 321 ? P46637 25 ? 342 ? 25 342 
9  1 6VSU I 4 ? 321 ? P46637 25 ? 342 ? 25 342 
10 1 6VSU J 4 ? 321 ? P46637 25 ? 342 ? 25 342 
11 1 6VSU K 4 ? 321 ? P46637 25 ? 342 ? 25 342 
12 1 6VSU L 4 ? 321 ? P46637 25 ? 342 ? 25 342 
13 1 6VSU M 4 ? 321 ? P46637 25 ? 342 ? 25 342 
14 1 6VSU N 4 ? 321 ? P46637 25 ? 342 ? 25 342 
15 1 6VSU O 4 ? 321 ? P46637 25 ? 342 ? 25 342 
16 1 6VSU P 4 ? 321 ? P46637 25 ? 342 ? 25 342 
17 1 6VSU Q 4 ? 321 ? P46637 25 ? 342 ? 25 342 
18 1 6VSU R 4 ? 321 ? P46637 25 ? 342 ? 25 342 
19 1 6VSU S 4 ? 321 ? P46637 25 ? 342 ? 25 342 
20 1 6VSU T 4 ? 321 ? P46637 25 ? 342 ? 25 342 
21 1 6VSU U 4 ? 321 ? P46637 25 ? 342 ? 25 342 
22 1 6VSU V 4 ? 321 ? P46637 25 ? 342 ? 25 342 
23 1 6VSU W 4 ? 321 ? P46637 25 ? 342 ? 25 342 
24 1 6VSU X 4 ? 321 ? P46637 25 ? 342 ? 25 342 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  6VSU SER A 1 ? UNP P46637 ? ? 'expression tag' 22 1  
1  6VSU ASN A 2 ? UNP P46637 ? ? 'expression tag' 23 2  
1  6VSU ALA A 3 ? UNP P46637 ? ? 'expression tag' 24 3  
2  6VSU SER B 1 ? UNP P46637 ? ? 'expression tag' 22 4  
2  6VSU ASN B 2 ? UNP P46637 ? ? 'expression tag' 23 5  
2  6VSU ALA B 3 ? UNP P46637 ? ? 'expression tag' 24 6  
3  6VSU SER C 1 ? UNP P46637 ? ? 'expression tag' 22 7  
3  6VSU ASN C 2 ? UNP P46637 ? ? 'expression tag' 23 8  
3  6VSU ALA C 3 ? UNP P46637 ? ? 'expression tag' 24 9  
4  6VSU SER D 1 ? UNP P46637 ? ? 'expression tag' 22 10 
4  6VSU ASN D 2 ? UNP P46637 ? ? 'expression tag' 23 11 
4  6VSU ALA D 3 ? UNP P46637 ? ? 'expression tag' 24 12 
5  6VSU SER E 1 ? UNP P46637 ? ? 'expression tag' 22 13 
5  6VSU ASN E 2 ? UNP P46637 ? ? 'expression tag' 23 14 
5  6VSU ALA E 3 ? UNP P46637 ? ? 'expression tag' 24 15 
6  6VSU SER F 1 ? UNP P46637 ? ? 'expression tag' 22 16 
6  6VSU ASN F 2 ? UNP P46637 ? ? 'expression tag' 23 17 
6  6VSU ALA F 3 ? UNP P46637 ? ? 'expression tag' 24 18 
7  6VSU SER G 1 ? UNP P46637 ? ? 'expression tag' 22 19 
7  6VSU ASN G 2 ? UNP P46637 ? ? 'expression tag' 23 20 
7  6VSU ALA G 3 ? UNP P46637 ? ? 'expression tag' 24 21 
8  6VSU SER H 1 ? UNP P46637 ? ? 'expression tag' 22 22 
8  6VSU ASN H 2 ? UNP P46637 ? ? 'expression tag' 23 23 
8  6VSU ALA H 3 ? UNP P46637 ? ? 'expression tag' 24 24 
9  6VSU SER I 1 ? UNP P46637 ? ? 'expression tag' 22 25 
9  6VSU ASN I 2 ? UNP P46637 ? ? 'expression tag' 23 26 
9  6VSU ALA I 3 ? UNP P46637 ? ? 'expression tag' 24 27 
10 6VSU SER J 1 ? UNP P46637 ? ? 'expression tag' 22 28 
10 6VSU ASN J 2 ? UNP P46637 ? ? 'expression tag' 23 29 
10 6VSU ALA J 3 ? UNP P46637 ? ? 'expression tag' 24 30 
11 6VSU SER K 1 ? UNP P46637 ? ? 'expression tag' 22 31 
11 6VSU ASN K 2 ? UNP P46637 ? ? 'expression tag' 23 32 
11 6VSU ALA K 3 ? UNP P46637 ? ? 'expression tag' 24 33 
12 6VSU SER L 1 ? UNP P46637 ? ? 'expression tag' 22 34 
12 6VSU ASN L 2 ? UNP P46637 ? ? 'expression tag' 23 35 
12 6VSU ALA L 3 ? UNP P46637 ? ? 'expression tag' 24 36 
13 6VSU SER M 1 ? UNP P46637 ? ? 'expression tag' 22 37 
13 6VSU ASN M 2 ? UNP P46637 ? ? 'expression tag' 23 38 
13 6VSU ALA M 3 ? UNP P46637 ? ? 'expression tag' 24 39 
14 6VSU SER N 1 ? UNP P46637 ? ? 'expression tag' 22 40 
14 6VSU ASN N 2 ? UNP P46637 ? ? 'expression tag' 23 41 
14 6VSU ALA N 3 ? UNP P46637 ? ? 'expression tag' 24 42 
15 6VSU SER O 1 ? UNP P46637 ? ? 'expression tag' 22 43 
15 6VSU ASN O 2 ? UNP P46637 ? ? 'expression tag' 23 44 
15 6VSU ALA O 3 ? UNP P46637 ? ? 'expression tag' 24 45 
16 6VSU SER P 1 ? UNP P46637 ? ? 'expression tag' 22 46 
16 6VSU ASN P 2 ? UNP P46637 ? ? 'expression tag' 23 47 
16 6VSU ALA P 3 ? UNP P46637 ? ? 'expression tag' 24 48 
17 6VSU SER Q 1 ? UNP P46637 ? ? 'expression tag' 22 49 
17 6VSU ASN Q 2 ? UNP P46637 ? ? 'expression tag' 23 50 
17 6VSU ALA Q 3 ? UNP P46637 ? ? 'expression tag' 24 51 
18 6VSU SER R 1 ? UNP P46637 ? ? 'expression tag' 22 52 
18 6VSU ASN R 2 ? UNP P46637 ? ? 'expression tag' 23 53 
18 6VSU ALA R 3 ? UNP P46637 ? ? 'expression tag' 24 54 
19 6VSU SER S 1 ? UNP P46637 ? ? 'expression tag' 22 55 
19 6VSU ASN S 2 ? UNP P46637 ? ? 'expression tag' 23 56 
19 6VSU ALA S 3 ? UNP P46637 ? ? 'expression tag' 24 57 
20 6VSU SER T 1 ? UNP P46637 ? ? 'expression tag' 22 58 
20 6VSU ASN T 2 ? UNP P46637 ? ? 'expression tag' 23 59 
20 6VSU ALA T 3 ? UNP P46637 ? ? 'expression tag' 24 60 
21 6VSU SER U 1 ? UNP P46637 ? ? 'expression tag' 22 61 
21 6VSU ASN U 2 ? UNP P46637 ? ? 'expression tag' 23 62 
21 6VSU ALA U 3 ? UNP P46637 ? ? 'expression tag' 24 63 
22 6VSU SER V 1 ? UNP P46637 ? ? 'expression tag' 22 64 
22 6VSU ASN V 2 ? UNP P46637 ? ? 'expression tag' 23 65 
22 6VSU ALA V 3 ? UNP P46637 ? ? 'expression tag' 24 66 
23 6VSU SER W 1 ? UNP P46637 ? ? 'expression tag' 22 67 
23 6VSU ASN W 2 ? UNP P46637 ? ? 'expression tag' 23 68 
23 6VSU ALA W 3 ? UNP P46637 ? ? 'expression tag' 24 69 
24 6VSU SER X 1 ? UNP P46637 ? ? 'expression tag' 22 70 
24 6VSU ASN X 2 ? UNP P46637 ? ? 'expression tag' 23 71 
24 6VSU ALA X 3 ? UNP P46637 ? ? 'expression tag' 24 72 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                 ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE               ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE               ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                   ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                 ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE              ?                               'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION'    ?                               'Mn 2'           54.938  
NA  non-polymer         . 'SODIUM ION'            ?                               'Na 1'           22.990  
ORN 'L-peptide linking' n L-ornithine             ?                               'C5 H12 N2 O2'   132.161 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER' ?                               'C4 H10 O3'      106.120 
PHE 'L-peptide linking' y PHENYLALANINE           ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                 ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                  ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE               ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ?                               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6VSU 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.80 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.05 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '50 mM L-arginine, 50 mM L-glutamic acid, 22% PEG Smear Broad, 5% glycerol' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-06-27 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si (111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6VSU 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.25 
_reflns.d_resolution_low                 30 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       429624 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3 
_reflns.percent_possible_obs             99.0 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.3 
_reflns.pdbx_Rmerge_I_obs                0.064 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            17.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.994 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.25 
_reflns_shell.d_res_low                   2.33 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.5 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           43258 
_reflns_shell.percent_possible_all        99.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.483 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.747 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            0.0500 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][2]                            0.0500 
_refine.aniso_B[2][3]                            -0.0000 
_refine.aniso_B[3][3]                            -0.1100 
_refine.B_iso_max                                152.120 
_refine.B_iso_mean                               41.3100 
_refine.B_iso_min                                14.060 
_refine.correlation_coeff_Fo_to_Fc               0.9650 
_refine.correlation_coeff_Fo_to_Fc_free          0.9530 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : WITH TLS ADDED' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6VSU 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.2500 
_refine.ls_d_res_low                             29.9700 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     424973 
_refine.ls_number_reflns_R_free                  2236 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.4300 
_refine.ls_percent_reflns_R_free                 0.5000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1594 
_refine.ls_R_factor_R_free                       0.1968 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1592 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6VSS 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.2200 
_refine.pdbx_overall_ESU_R_Free                  0.1730 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             11.0420 
_refine.overall_SU_ML                            0.1430 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.2500 
_refine_hist.d_res_low                        29.9700 
_refine_hist.number_atoms_solvent             4951 
_refine_hist.number_atoms_total               63463 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       7594 
_refine_hist.pdbx_B_iso_mean_ligand           53.90 
_refine_hist.pdbx_B_iso_mean_solvent          40.71 
_refine_hist.pdbx_number_atoms_protein        58150 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         362 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.014  0.013  59384  ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.017  56927  ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 1.783  1.638  80143  ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 1.412  1.581  131992 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 7.050  5.000  7583   ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 31.173 21.589 3172   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 14.846 15.000 10506  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 17.451 15.000 529    ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.089  0.200  7514   ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.009  0.020  67014  ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  11973  ? r_gen_planes_other     ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.2510 
_refine_ls_shell.d_res_low                        2.3090 
_refine_ls_shell.number_reflns_all                29995 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             130 
_refine_ls_shell.number_reflns_R_work             29865 
_refine_ls_shell.percent_reflns_obs               93.8700 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3100 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.2370 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_R_complete                  ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6VSU 
_struct.title                        'Arginase from Arabidopsis thaliana in Complex with Ornithine' 
_struct.pdbx_descriptor              'Arginase 1, mitochondrial (E.C.3.5.3.1,3.5.3.11)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6VSU 
_struct_keywords.text            'arginine amidinohydrolase; ureohydrolase; agmatinase; agmatine amidinohydrolase, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 1 ? 
R  N N 1 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 1 ? 
V  N N 1 ? 
W  N N 1 ? 
X  N N 1 ? 
Y  N N 2 ? 
Z  N N 2 ? 
AA N N 3 ? 
BA N N 4 ? 
CA N N 2 ? 
DA N N 2 ? 
EA N N 5 ? 
FA N N 3 ? 
GA N N 5 ? 
HA N N 2 ? 
IA N N 2 ? 
JA N N 5 ? 
KA N N 3 ? 
LA N N 4 ? 
MA N N 2 ? 
NA N N 2 ? 
OA N N 5 ? 
PA N N 3 ? 
QA N N 5 ? 
RA N N 2 ? 
SA N N 2 ? 
TA N N 3 ? 
UA N N 4 ? 
VA N N 5 ? 
WA N N 5 ? 
XA N N 2 ? 
YA N N 2 ? 
ZA N N 3 ? 
AB N N 5 ? 
BB N N 4 ? 
CB N N 2 ? 
DB N N 2 ? 
EB N N 3 ? 
FB N N 4 ? 
GB N N 5 ? 
HB N N 6 ? 
IB N N 6 ? 
JB N N 5 ? 
KB N N 2 ? 
LB N N 2 ? 
MB N N 5 ? 
NB N N 5 ? 
OB N N 3 ? 
PB N N 2 ? 
QB N N 2 ? 
RB N N 3 ? 
SB N N 5 ? 
TB N N 5 ? 
UB N N 2 ? 
VB N N 2 ? 
WB N N 3 ? 
XB N N 5 ? 
YB N N 5 ? 
ZB N N 2 ? 
AC N N 2 ? 
BC N N 5 ? 
CC N N 3 ? 
DC N N 5 ? 
EC N N 4 ? 
FC N N 2 ? 
GC N N 2 ? 
HC N N 5 ? 
IC N N 3 ? 
JC N N 5 ? 
KC N N 6 ? 
LC N N 6 ? 
MC N N 6 ? 
NC N N 2 ? 
OC N N 2 ? 
PC N N 3 ? 
QC N N 2 ? 
RC N N 2 ? 
SC N N 5 ? 
TC N N 3 ? 
UC N N 2 ? 
VC N N 2 ? 
WC N N 3 ? 
XC N N 2 ? 
YC N N 2 ? 
ZC N N 5 ? 
AD N N 3 ? 
BD N N 4 ? 
CD N N 2 ? 
DD N N 2 ? 
ED N N 5 ? 
FD N N 3 ? 
GD N N 2 ? 
HD N N 2 ? 
ID N N 3 ? 
JD N N 5 ? 
KD N N 2 ? 
LD N N 2 ? 
MD N N 5 ? 
ND N N 3 ? 
OD N N 5 ? 
PD N N 2 ? 
QD N N 2 ? 
RD N N 3 ? 
SD N N 5 ? 
TD N N 2 ? 
UD N N 2 ? 
VD N N 5 ? 
WD N N 3 ? 
XD N N 4 ? 
YD N N 2 ? 
ZD N N 2 ? 
AE N N 3 ? 
BE N N 4 ? 
CE N N 2 ? 
DE N N 2 ? 
EE N N 5 ? 
FE N N 3 ? 
GE N N 5 ? 
HE N N 2 ? 
IE N N 2 ? 
JE N N 3 ? 
KE N N 7 ? 
LE N N 7 ? 
ME N N 7 ? 
NE N N 7 ? 
OE N N 7 ? 
PE N N 7 ? 
QE N N 7 ? 
RE N N 7 ? 
SE N N 7 ? 
TE N N 7 ? 
UE N N 7 ? 
VE N N 7 ? 
WE N N 7 ? 
XE N N 7 ? 
YE N N 7 ? 
ZE N N 7 ? 
AF N N 7 ? 
BF N N 7 ? 
CF N N 7 ? 
DF N N 7 ? 
EF N N 7 ? 
FF N N 7 ? 
GF N N 7 ? 
HF N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 SER A 7   ? LEU A 37  ? SER A 28  LEU A 58  1 ? 31 
HELX_P HELX_P2   AA2 GLN A 59  ? ALA A 62  ? GLN A 80  ALA A 83  5 ? 4  
HELX_P HELX_P3   AA3 PHE A 63  ? TRP A 73  ? PHE A 84  TRP A 94  1 ? 11 
HELX_P HELX_P4   AA4 PRO A 100 ? CYS A 107 ? PRO A 121 CYS A 128 1 ? 8  
HELX_P HELX_P5   AA5 ASP A 110 ? GLU A 128 ? ASP A 131 GLU A 149 1 ? 19 
HELX_P HELX_P6   AA6 ASP A 139 ? SER A 141 ? ASP A 160 SER A 162 5 ? 3  
HELX_P HELX_P7   AA7 ILE A 142 ? GLY A 155 ? ILE A 163 GLY A 176 1 ? 14 
HELX_P HELX_P8   AA8 CYS A 172 ? ASN A 176 ? CYS A 193 ASN A 197 5 ? 5  
HELX_P HELX_P9   AA9 SER A 182 ? GLY A 190 ? SER A 203 GLY A 211 1 ? 9  
HELX_P HELX_P10  AB1 ASN A 205 ? GLY A 216 ? ASN A 226 GLY A 237 1 ? 12 
HELX_P HELX_P11  AB2 THR A 224 ? GLU A 233 ? THR A 245 GLU A 254 1 ? 10 
HELX_P HELX_P12  AB3 ASP A 251 ? LEU A 253 ? ASP A 272 LEU A 274 5 ? 3  
HELX_P HELX_P13  AB4 SER A 270 ? LEU A 281 ? SER A 291 LEU A 302 1 ? 12 
HELX_P HELX_P14  AB5 ASN A 294 ? ASP A 298 ? ASN A 315 ASP A 319 5 ? 5  
HELX_P HELX_P15  AB6 GLY A 302 ? SER A 320 ? GLY A 323 SER A 341 1 ? 19 
HELX_P HELX_P16  AB7 SER B 6   ? GLY B 38  ? SER B 27  GLY B 59  1 ? 33 
HELX_P HELX_P17  AB8 GLN B 59  ? ALA B 62  ? GLN B 80  ALA B 83  5 ? 4  
HELX_P HELX_P18  AB9 PHE B 63  ? TRP B 73  ? PHE B 84  TRP B 94  1 ? 11 
HELX_P HELX_P19  AC1 PRO B 100 ? CYS B 107 ? PRO B 121 CYS B 128 1 ? 8  
HELX_P HELX_P20  AC2 ASP B 110 ? GLU B 127 ? ASP B 131 GLU B 148 1 ? 18 
HELX_P HELX_P21  AC3 ASP B 139 ? SER B 141 ? ASP B 160 SER B 162 5 ? 3  
HELX_P HELX_P22  AC4 ILE B 142 ? GLY B 155 ? ILE B 163 GLY B 176 1 ? 14 
HELX_P HELX_P23  AC5 CYS B 172 ? ASN B 176 ? CYS B 193 ASN B 197 5 ? 5  
HELX_P HELX_P24  AC6 SER B 182 ? GLY B 190 ? SER B 203 GLY B 211 1 ? 9  
HELX_P HELX_P25  AC7 ASN B 205 ? GLY B 216 ? ASN B 226 GLY B 237 1 ? 12 
HELX_P HELX_P26  AC8 THR B 224 ? GLU B 233 ? THR B 245 GLU B 254 1 ? 10 
HELX_P HELX_P27  AC9 ASP B 251 ? LEU B 253 ? ASP B 272 LEU B 274 5 ? 3  
HELX_P HELX_P28  AD1 SER B 270 ? LEU B 281 ? SER B 291 LEU B 302 1 ? 12 
HELX_P HELX_P29  AD2 ASN B 294 ? ASP B 298 ? ASN B 315 ASP B 319 5 ? 5  
HELX_P HELX_P30  AD3 GLY B 302 ? SER B 320 ? GLY B 323 SER B 341 1 ? 19 
HELX_P HELX_P31  AD4 SER C 7   ? GLY C 38  ? SER C 28  GLY C 59  1 ? 32 
HELX_P HELX_P32  AD5 GLN C 59  ? ALA C 62  ? GLN C 80  ALA C 83  5 ? 4  
HELX_P HELX_P33  AD6 PHE C 63  ? TRP C 73  ? PHE C 84  TRP C 94  1 ? 11 
HELX_P HELX_P34  AD7 PRO C 100 ? CYS C 107 ? PRO C 121 CYS C 128 1 ? 8  
HELX_P HELX_P35  AD8 ASP C 110 ? GLU C 127 ? ASP C 131 GLU C 148 1 ? 18 
HELX_P HELX_P36  AD9 ASP C 139 ? SER C 141 ? ASP C 160 SER C 162 5 ? 3  
HELX_P HELX_P37  AE1 ILE C 142 ? GLY C 155 ? ILE C 163 GLY C 176 1 ? 14 
HELX_P HELX_P38  AE2 SER C 182 ? GLY C 190 ? SER C 203 GLY C 211 1 ? 9  
HELX_P HELX_P39  AE3 ASN C 205 ? PHE C 215 ? ASN C 226 PHE C 236 1 ? 11 
HELX_P HELX_P40  AE4 THR C 224 ? GLU C 233 ? THR C 245 GLU C 254 1 ? 10 
HELX_P HELX_P41  AE5 ASP C 251 ? LEU C 253 ? ASP C 272 LEU C 274 5 ? 3  
HELX_P HELX_P42  AE6 SER C 270 ? LEU C 281 ? SER C 291 LEU C 302 1 ? 12 
HELX_P HELX_P43  AE7 ASN C 294 ? ASP C 298 ? ASN C 315 ASP C 319 5 ? 5  
HELX_P HELX_P44  AE8 GLY C 302 ? SER C 320 ? GLY C 323 SER C 341 1 ? 19 
HELX_P HELX_P45  AE9 SER D 7   ? GLY D 38  ? SER D 28  GLY D 59  1 ? 32 
HELX_P HELX_P46  AF1 GLN D 59  ? ALA D 62  ? GLN D 80  ALA D 83  5 ? 4  
HELX_P HELX_P47  AF2 PHE D 63  ? TRP D 73  ? PHE D 84  TRP D 94  1 ? 11 
HELX_P HELX_P48  AF3 PRO D 100 ? CYS D 107 ? PRO D 121 CYS D 128 1 ? 8  
HELX_P HELX_P49  AF4 ASP D 110 ? GLU D 127 ? ASP D 131 GLU D 148 1 ? 18 
HELX_P HELX_P50  AF5 ASP D 139 ? SER D 141 ? ASP D 160 SER D 162 5 ? 3  
HELX_P HELX_P51  AF6 ILE D 142 ? GLY D 155 ? ILE D 163 GLY D 176 1 ? 14 
HELX_P HELX_P52  AF7 CYS D 172 ? ASN D 176 ? CYS D 193 ASN D 197 5 ? 5  
HELX_P HELX_P53  AF8 SER D 182 ? GLY D 190 ? SER D 203 GLY D 211 1 ? 9  
HELX_P HELX_P54  AF9 ASN D 205 ? PHE D 215 ? ASN D 226 PHE D 236 1 ? 11 
HELX_P HELX_P55  AG1 THR D 224 ? GLU D 233 ? THR D 245 GLU D 254 1 ? 10 
HELX_P HELX_P56  AG2 ASP D 251 ? LEU D 253 ? ASP D 272 LEU D 274 5 ? 3  
HELX_P HELX_P57  AG3 SER D 270 ? LEU D 281 ? SER D 291 LEU D 302 1 ? 12 
HELX_P HELX_P58  AG4 ASN D 294 ? ASP D 298 ? ASN D 315 ASP D 319 5 ? 5  
HELX_P HELX_P59  AG5 GLY D 302 ? SER D 320 ? GLY D 323 SER D 341 1 ? 19 
HELX_P HELX_P60  AG6 SER E 6   ? GLY E 38  ? SER E 27  GLY E 59  1 ? 33 
HELX_P HELX_P61  AG7 GLN E 59  ? ALA E 62  ? GLN E 80  ALA E 83  5 ? 4  
HELX_P HELX_P62  AG8 PHE E 63  ? TRP E 73  ? PHE E 84  TRP E 94  1 ? 11 
HELX_P HELX_P63  AG9 PRO E 100 ? CYS E 107 ? PRO E 121 CYS E 128 1 ? 8  
HELX_P HELX_P64  AH1 ASP E 110 ? GLU E 127 ? ASP E 131 GLU E 148 1 ? 18 
HELX_P HELX_P65  AH2 ASP E 139 ? SER E 141 ? ASP E 160 SER E 162 5 ? 3  
HELX_P HELX_P66  AH3 ILE E 142 ? GLY E 155 ? ILE E 163 GLY E 176 1 ? 14 
HELX_P HELX_P67  AH4 CYS E 172 ? ASN E 176 ? CYS E 193 ASN E 197 5 ? 5  
HELX_P HELX_P68  AH5 SER E 182 ? GLY E 190 ? SER E 203 GLY E 211 1 ? 9  
HELX_P HELX_P69  AH6 ASN E 205 ? GLY E 216 ? ASN E 226 GLY E 237 1 ? 12 
HELX_P HELX_P70  AH7 THR E 224 ? GLU E 233 ? THR E 245 GLU E 254 1 ? 10 
HELX_P HELX_P71  AH8 ASP E 251 ? LEU E 253 ? ASP E 272 LEU E 274 5 ? 3  
HELX_P HELX_P72  AH9 SER E 270 ? LEU E 281 ? SER E 291 LEU E 302 1 ? 12 
HELX_P HELX_P73  AI1 ASN E 294 ? ASP E 298 ? ASN E 315 ASP E 319 5 ? 5  
HELX_P HELX_P74  AI2 GLY E 302 ? SER E 320 ? GLY E 323 SER E 341 1 ? 19 
HELX_P HELX_P75  AI3 SER F 7   ? GLY F 38  ? SER F 28  GLY F 59  1 ? 32 
HELX_P HELX_P76  AI4 GLN F 59  ? ALA F 62  ? GLN F 80  ALA F 83  5 ? 4  
HELX_P HELX_P77  AI5 PHE F 63  ? TRP F 73  ? PHE F 84  TRP F 94  1 ? 11 
HELX_P HELX_P78  AI6 PRO F 100 ? ASP F 106 ? PRO F 121 ASP F 127 1 ? 7  
HELX_P HELX_P79  AI7 ASP F 110 ? GLU F 127 ? ASP F 131 GLU F 148 1 ? 18 
HELX_P HELX_P80  AI8 ASP F 139 ? SER F 141 ? ASP F 160 SER F 162 5 ? 3  
HELX_P HELX_P81  AI9 ILE F 142 ? GLY F 155 ? ILE F 163 GLY F 176 1 ? 14 
HELX_P HELX_P82  AJ1 CYS F 172 ? ASN F 176 ? CYS F 193 ASN F 197 5 ? 5  
HELX_P HELX_P83  AJ2 SER F 182 ? GLY F 190 ? SER F 203 GLY F 211 1 ? 9  
HELX_P HELX_P84  AJ3 ASN F 205 ? GLY F 216 ? ASN F 226 GLY F 237 1 ? 12 
HELX_P HELX_P85  AJ4 THR F 224 ? GLU F 233 ? THR F 245 GLU F 254 1 ? 10 
HELX_P HELX_P86  AJ5 ASP F 251 ? LEU F 253 ? ASP F 272 LEU F 274 5 ? 3  
HELX_P HELX_P87  AJ6 SER F 270 ? LEU F 281 ? SER F 291 LEU F 302 1 ? 12 
HELX_P HELX_P88  AJ7 ASN F 294 ? ASP F 298 ? ASN F 315 ASP F 319 5 ? 5  
HELX_P HELX_P89  AJ8 GLY F 302 ? SER F 320 ? GLY F 323 SER F 341 1 ? 19 
HELX_P HELX_P90  AJ9 SER G 7   ? GLY G 38  ? SER G 28  GLY G 59  1 ? 32 
HELX_P HELX_P91  AK1 GLN G 59  ? ALA G 62  ? GLN G 80  ALA G 83  5 ? 4  
HELX_P HELX_P92  AK2 PHE G 63  ? TRP G 73  ? PHE G 84  TRP G 94  1 ? 11 
HELX_P HELX_P93  AK3 PRO G 100 ? CYS G 107 ? PRO G 121 CYS G 128 1 ? 8  
HELX_P HELX_P94  AK4 ASP G 110 ? GLU G 127 ? ASP G 131 GLU G 148 1 ? 18 
HELX_P HELX_P95  AK5 ASP G 139 ? SER G 141 ? ASP G 160 SER G 162 5 ? 3  
HELX_P HELX_P96  AK6 ILE G 142 ? GLY G 155 ? ILE G 163 GLY G 176 1 ? 14 
HELX_P HELX_P97  AK7 CYS G 172 ? ASN G 176 ? CYS G 193 ASN G 197 5 ? 5  
HELX_P HELX_P98  AK8 SER G 182 ? GLY G 190 ? SER G 203 GLY G 211 1 ? 9  
HELX_P HELX_P99  AK9 ASN G 205 ? PHE G 215 ? ASN G 226 PHE G 236 1 ? 11 
HELX_P HELX_P100 AL1 THR G 224 ? GLU G 233 ? THR G 245 GLU G 254 1 ? 10 
HELX_P HELX_P101 AL2 ASP G 251 ? LEU G 253 ? ASP G 272 LEU G 274 5 ? 3  
HELX_P HELX_P102 AL3 SER G 270 ? LEU G 281 ? SER G 291 LEU G 302 1 ? 12 
HELX_P HELX_P103 AL4 ASN G 294 ? ASP G 298 ? ASN G 315 ASP G 319 5 ? 5  
HELX_P HELX_P104 AL5 GLY G 302 ? SER G 320 ? GLY G 323 SER G 341 1 ? 19 
HELX_P HELX_P105 AL6 SER H 6   ? GLY H 38  ? SER H 27  GLY H 59  1 ? 33 
HELX_P HELX_P106 AL7 GLN H 59  ? ALA H 62  ? GLN H 80  ALA H 83  5 ? 4  
HELX_P HELX_P107 AL8 PHE H 63  ? TRP H 73  ? PHE H 84  TRP H 94  1 ? 11 
HELX_P HELX_P108 AL9 PRO H 100 ? CYS H 107 ? PRO H 121 CYS H 128 1 ? 8  
HELX_P HELX_P109 AM1 ASP H 110 ? GLU H 127 ? ASP H 131 GLU H 148 1 ? 18 
HELX_P HELX_P110 AM2 ASP H 139 ? SER H 141 ? ASP H 160 SER H 162 5 ? 3  
HELX_P HELX_P111 AM3 ILE H 142 ? GLY H 155 ? ILE H 163 GLY H 176 1 ? 14 
HELX_P HELX_P112 AM4 CYS H 172 ? ASN H 176 ? CYS H 193 ASN H 197 5 ? 5  
HELX_P HELX_P113 AM5 SER H 182 ? GLY H 190 ? SER H 203 GLY H 211 1 ? 9  
HELX_P HELX_P114 AM6 ASN H 205 ? GLY H 216 ? ASN H 226 GLY H 237 1 ? 12 
HELX_P HELX_P115 AM7 THR H 224 ? GLU H 233 ? THR H 245 GLU H 254 1 ? 10 
HELX_P HELX_P116 AM8 ASP H 251 ? LEU H 253 ? ASP H 272 LEU H 274 5 ? 3  
HELX_P HELX_P117 AM9 SER H 270 ? LEU H 281 ? SER H 291 LEU H 302 1 ? 12 
HELX_P HELX_P118 AN1 ASN H 294 ? ASP H 298 ? ASN H 315 ASP H 319 5 ? 5  
HELX_P HELX_P119 AN2 GLY H 302 ? SER H 320 ? GLY H 323 SER H 341 1 ? 19 
HELX_P HELX_P120 AN3 SER I 7   ? GLY I 38  ? SER I 28  GLY I 59  1 ? 32 
HELX_P HELX_P121 AN4 GLN I 59  ? ALA I 62  ? GLN I 80  ALA I 83  5 ? 4  
HELX_P HELX_P122 AN5 PHE I 63  ? TRP I 73  ? PHE I 84  TRP I 94  1 ? 11 
HELX_P HELX_P123 AN6 PRO I 100 ? CYS I 107 ? PRO I 121 CYS I 128 1 ? 8  
HELX_P HELX_P124 AN7 ASP I 110 ? GLU I 127 ? ASP I 131 GLU I 148 1 ? 18 
HELX_P HELX_P125 AN8 ASP I 139 ? SER I 141 ? ASP I 160 SER I 162 5 ? 3  
HELX_P HELX_P126 AN9 ILE I 142 ? GLY I 155 ? ILE I 163 GLY I 176 1 ? 14 
HELX_P HELX_P127 AO1 CYS I 172 ? ASN I 176 ? CYS I 193 ASN I 197 5 ? 5  
HELX_P HELX_P128 AO2 SER I 182 ? GLY I 190 ? SER I 203 GLY I 211 1 ? 9  
HELX_P HELX_P129 AO3 ASN I 205 ? PHE I 215 ? ASN I 226 PHE I 236 1 ? 11 
HELX_P HELX_P130 AO4 THR I 224 ? GLU I 233 ? THR I 245 GLU I 254 1 ? 10 
HELX_P HELX_P131 AO5 ASP I 251 ? LEU I 253 ? ASP I 272 LEU I 274 5 ? 3  
HELX_P HELX_P132 AO6 SER I 270 ? LEU I 281 ? SER I 291 LEU I 302 1 ? 12 
HELX_P HELX_P133 AO7 ASN I 294 ? ASP I 298 ? ASN I 315 ASP I 319 5 ? 5  
HELX_P HELX_P134 AO8 GLY I 302 ? SER I 320 ? GLY I 323 SER I 341 1 ? 19 
HELX_P HELX_P135 AO9 ILE J 8   ? GLY J 38  ? ILE J 29  GLY J 59  1 ? 31 
HELX_P HELX_P136 AP1 GLN J 59  ? ALA J 62  ? GLN J 80  ALA J 83  5 ? 4  
HELX_P HELX_P137 AP2 PHE J 63  ? TRP J 73  ? PHE J 84  TRP J 94  1 ? 11 
HELX_P HELX_P138 AP3 PRO J 100 ? CYS J 107 ? PRO J 121 CYS J 128 1 ? 8  
HELX_P HELX_P139 AP4 ASP J 110 ? GLU J 127 ? ASP J 131 GLU J 148 1 ? 18 
HELX_P HELX_P140 AP5 ASP J 139 ? SER J 141 ? ASP J 160 SER J 162 5 ? 3  
HELX_P HELX_P141 AP6 ILE J 142 ? GLY J 155 ? ILE J 163 GLY J 176 1 ? 14 
HELX_P HELX_P142 AP7 CYS J 172 ? ASN J 176 ? CYS J 193 ASN J 197 5 ? 5  
HELX_P HELX_P143 AP8 SER J 182 ? GLY J 191 ? SER J 203 GLY J 212 1 ? 10 
HELX_P HELX_P144 AP9 ASN J 205 ? GLY J 216 ? ASN J 226 GLY J 237 1 ? 12 
HELX_P HELX_P145 AQ1 THR J 224 ? GLU J 233 ? THR J 245 GLU J 254 1 ? 10 
HELX_P HELX_P146 AQ2 ASP J 251 ? LEU J 253 ? ASP J 272 LEU J 274 5 ? 3  
HELX_P HELX_P147 AQ3 SER J 270 ? LEU J 281 ? SER J 291 LEU J 302 1 ? 12 
HELX_P HELX_P148 AQ4 ASN J 294 ? ASP J 298 ? ASN J 315 ASP J 319 5 ? 5  
HELX_P HELX_P149 AQ5 GLY J 302 ? SER J 320 ? GLY J 323 SER J 341 1 ? 19 
HELX_P HELX_P150 AQ6 SER K 7   ? GLY K 38  ? SER K 28  GLY K 59  1 ? 32 
HELX_P HELX_P151 AQ7 GLN K 59  ? ALA K 62  ? GLN K 80  ALA K 83  5 ? 4  
HELX_P HELX_P152 AQ8 PHE K 63  ? TRP K 73  ? PHE K 84  TRP K 94  1 ? 11 
HELX_P HELX_P153 AQ9 PRO K 100 ? CYS K 107 ? PRO K 121 CYS K 128 1 ? 8  
HELX_P HELX_P154 AR1 ASP K 110 ? GLU K 127 ? ASP K 131 GLU K 148 1 ? 18 
HELX_P HELX_P155 AR2 ASP K 139 ? SER K 141 ? ASP K 160 SER K 162 5 ? 3  
HELX_P HELX_P156 AR3 ILE K 142 ? GLY K 155 ? ILE K 163 GLY K 176 1 ? 14 
HELX_P HELX_P157 AR4 CYS K 172 ? ASN K 176 ? CYS K 193 ASN K 197 5 ? 5  
HELX_P HELX_P158 AR5 SER K 182 ? GLY K 190 ? SER K 203 GLY K 211 1 ? 9  
HELX_P HELX_P159 AR6 ASN K 205 ? PHE K 215 ? ASN K 226 PHE K 236 1 ? 11 
HELX_P HELX_P160 AR7 THR K 224 ? GLU K 233 ? THR K 245 GLU K 254 1 ? 10 
HELX_P HELX_P161 AR8 ASP K 251 ? LEU K 253 ? ASP K 272 LEU K 274 5 ? 3  
HELX_P HELX_P162 AR9 SER K 270 ? LEU K 281 ? SER K 291 LEU K 302 1 ? 12 
HELX_P HELX_P163 AS1 ASN K 294 ? ASP K 298 ? ASN K 315 ASP K 319 5 ? 5  
HELX_P HELX_P164 AS2 GLY K 302 ? SER K 320 ? GLY K 323 SER K 341 1 ? 19 
HELX_P HELX_P165 AS3 SER L 6   ? GLY L 38  ? SER L 27  GLY L 59  1 ? 33 
HELX_P HELX_P166 AS4 GLN L 59  ? ALA L 62  ? GLN L 80  ALA L 83  5 ? 4  
HELX_P HELX_P167 AS5 PHE L 63  ? TRP L 73  ? PHE L 84  TRP L 94  1 ? 11 
HELX_P HELX_P168 AS6 PRO L 100 ? CYS L 107 ? PRO L 121 CYS L 128 1 ? 8  
HELX_P HELX_P169 AS7 ASP L 110 ? GLU L 128 ? ASP L 131 GLU L 149 1 ? 19 
HELX_P HELX_P170 AS8 ASP L 139 ? SER L 141 ? ASP L 160 SER L 162 5 ? 3  
HELX_P HELX_P171 AS9 ILE L 142 ? GLY L 155 ? ILE L 163 GLY L 176 1 ? 14 
HELX_P HELX_P172 AT1 CYS L 172 ? ASN L 176 ? CYS L 193 ASN L 197 5 ? 5  
HELX_P HELX_P173 AT2 SER L 182 ? GLY L 190 ? SER L 203 GLY L 211 1 ? 9  
HELX_P HELX_P174 AT3 ASN L 205 ? PHE L 215 ? ASN L 226 PHE L 236 1 ? 11 
HELX_P HELX_P175 AT4 THR L 224 ? GLU L 233 ? THR L 245 GLU L 254 1 ? 10 
HELX_P HELX_P176 AT5 ASP L 251 ? LEU L 253 ? ASP L 272 LEU L 274 5 ? 3  
HELX_P HELX_P177 AT6 SER L 270 ? LEU L 281 ? SER L 291 LEU L 302 1 ? 12 
HELX_P HELX_P178 AT7 ASN L 294 ? ASP L 298 ? ASN L 315 ASP L 319 5 ? 5  
HELX_P HELX_P179 AT8 GLY L 302 ? SER L 320 ? GLY L 323 SER L 341 1 ? 19 
HELX_P HELX_P180 AT9 SER M 7   ? GLY M 38  ? SER M 28  GLY M 59  1 ? 32 
HELX_P HELX_P181 AU1 GLN M 59  ? ALA M 62  ? GLN M 80  ALA M 83  5 ? 4  
HELX_P HELX_P182 AU2 PHE M 63  ? TRP M 73  ? PHE M 84  TRP M 94  1 ? 11 
HELX_P HELX_P183 AU3 PRO M 100 ? CYS M 107 ? PRO M 121 CYS M 128 1 ? 8  
HELX_P HELX_P184 AU4 ASP M 110 ? GLU M 127 ? ASP M 131 GLU M 148 1 ? 18 
HELX_P HELX_P185 AU5 ASP M 139 ? SER M 141 ? ASP M 160 SER M 162 5 ? 3  
HELX_P HELX_P186 AU6 ILE M 142 ? GLY M 155 ? ILE M 163 GLY M 176 1 ? 14 
HELX_P HELX_P187 AU7 CYS M 172 ? ASN M 176 ? CYS M 193 ASN M 197 5 ? 5  
HELX_P HELX_P188 AU8 SER M 182 ? GLY M 190 ? SER M 203 GLY M 211 1 ? 9  
HELX_P HELX_P189 AU9 ASN M 205 ? GLY M 216 ? ASN M 226 GLY M 237 1 ? 12 
HELX_P HELX_P190 AV1 THR M 224 ? GLU M 233 ? THR M 245 GLU M 254 1 ? 10 
HELX_P HELX_P191 AV2 ASP M 251 ? LEU M 253 ? ASP M 272 LEU M 274 5 ? 3  
HELX_P HELX_P192 AV3 SER M 270 ? LEU M 281 ? SER M 291 LEU M 302 1 ? 12 
HELX_P HELX_P193 AV4 ASN M 294 ? ASP M 298 ? ASN M 315 ASP M 319 5 ? 5  
HELX_P HELX_P194 AV5 GLY M 302 ? SER M 320 ? GLY M 323 SER M 341 1 ? 19 
HELX_P HELX_P195 AV6 SER N 7   ? GLY N 38  ? SER N 28  GLY N 59  1 ? 32 
HELX_P HELX_P196 AV7 GLN N 59  ? ALA N 62  ? GLN N 80  ALA N 83  5 ? 4  
HELX_P HELX_P197 AV8 PHE N 63  ? TRP N 73  ? PHE N 84  TRP N 94  1 ? 11 
HELX_P HELX_P198 AV9 PRO N 100 ? CYS N 107 ? PRO N 121 CYS N 128 1 ? 8  
HELX_P HELX_P199 AW1 ASP N 110 ? GLU N 127 ? ASP N 131 GLU N 148 1 ? 18 
HELX_P HELX_P200 AW2 ASP N 139 ? SER N 141 ? ASP N 160 SER N 162 5 ? 3  
HELX_P HELX_P201 AW3 ILE N 142 ? GLY N 155 ? ILE N 163 GLY N 176 1 ? 14 
HELX_P HELX_P202 AW4 CYS N 172 ? ASN N 176 ? CYS N 193 ASN N 197 5 ? 5  
HELX_P HELX_P203 AW5 SER N 182 ? GLY N 190 ? SER N 203 GLY N 211 1 ? 9  
HELX_P HELX_P204 AW6 ASN N 205 ? PHE N 215 ? ASN N 226 PHE N 236 1 ? 11 
HELX_P HELX_P205 AW7 THR N 224 ? GLU N 233 ? THR N 245 GLU N 254 1 ? 10 
HELX_P HELX_P206 AW8 ASP N 251 ? LEU N 253 ? ASP N 272 LEU N 274 5 ? 3  
HELX_P HELX_P207 AW9 SER N 270 ? LEU N 281 ? SER N 291 LEU N 302 1 ? 12 
HELX_P HELX_P208 AX1 ASN N 294 ? ASP N 298 ? ASN N 315 ASP N 319 5 ? 5  
HELX_P HELX_P209 AX2 GLY N 302 ? SER N 320 ? GLY N 323 SER N 341 1 ? 19 
HELX_P HELX_P210 AX3 SER O 7   ? GLY O 38  ? SER O 28  GLY O 59  1 ? 32 
HELX_P HELX_P211 AX4 GLN O 59  ? ALA O 62  ? GLN O 80  ALA O 83  5 ? 4  
HELX_P HELX_P212 AX5 PHE O 63  ? TRP O 73  ? PHE O 84  TRP O 94  1 ? 11 
HELX_P HELX_P213 AX6 PRO O 100 ? CYS O 107 ? PRO O 121 CYS O 128 1 ? 8  
HELX_P HELX_P214 AX7 ASP O 110 ? GLU O 127 ? ASP O 131 GLU O 148 1 ? 18 
HELX_P HELX_P215 AX8 ASP O 139 ? SER O 141 ? ASP O 160 SER O 162 5 ? 3  
HELX_P HELX_P216 AX9 ILE O 142 ? GLY O 155 ? ILE O 163 GLY O 176 1 ? 14 
HELX_P HELX_P217 AY1 CYS O 172 ? ASN O 176 ? CYS O 193 ASN O 197 5 ? 5  
HELX_P HELX_P218 AY2 SER O 179 ? ALA O 181 ? SER O 200 ALA O 202 5 ? 3  
HELX_P HELX_P219 AY3 SER O 182 ? GLY O 190 ? SER O 203 GLY O 211 1 ? 9  
HELX_P HELX_P220 AY4 ASN O 205 ? PHE O 215 ? ASN O 226 PHE O 236 1 ? 11 
HELX_P HELX_P221 AY5 THR O 224 ? GLU O 233 ? THR O 245 GLU O 254 1 ? 10 
HELX_P HELX_P222 AY6 ASP O 251 ? LEU O 253 ? ASP O 272 LEU O 274 5 ? 3  
HELX_P HELX_P223 AY7 SER O 270 ? LEU O 281 ? SER O 291 LEU O 302 1 ? 12 
HELX_P HELX_P224 AY8 ASN O 294 ? ASP O 298 ? ASN O 315 ASP O 319 5 ? 5  
HELX_P HELX_P225 AY9 GLY O 302 ? SER O 320 ? GLY O 323 SER O 341 1 ? 19 
HELX_P HELX_P226 AZ1 SER P 7   ? GLY P 38  ? SER P 28  GLY P 59  1 ? 32 
HELX_P HELX_P227 AZ2 GLN P 59  ? ALA P 62  ? GLN P 80  ALA P 83  5 ? 4  
HELX_P HELX_P228 AZ3 PHE P 63  ? TRP P 73  ? PHE P 84  TRP P 94  1 ? 11 
HELX_P HELX_P229 AZ4 PRO P 100 ? CYS P 107 ? PRO P 121 CYS P 128 1 ? 8  
HELX_P HELX_P230 AZ5 ASP P 110 ? GLU P 127 ? ASP P 131 GLU P 148 1 ? 18 
HELX_P HELX_P231 AZ6 ASP P 139 ? SER P 141 ? ASP P 160 SER P 162 5 ? 3  
HELX_P HELX_P232 AZ7 ILE P 142 ? GLY P 155 ? ILE P 163 GLY P 176 1 ? 14 
HELX_P HELX_P233 AZ8 CYS P 172 ? ASN P 176 ? CYS P 193 ASN P 197 5 ? 5  
HELX_P HELX_P234 AZ9 SER P 182 ? GLY P 190 ? SER P 203 GLY P 211 1 ? 9  
HELX_P HELX_P235 BA1 ASN P 205 ? PHE P 215 ? ASN P 226 PHE P 236 1 ? 11 
HELX_P HELX_P236 BA2 THR P 224 ? GLU P 233 ? THR P 245 GLU P 254 1 ? 10 
HELX_P HELX_P237 BA3 ASP P 251 ? LEU P 253 ? ASP P 272 LEU P 274 5 ? 3  
HELX_P HELX_P238 BA4 SER P 270 ? LEU P 281 ? SER P 291 LEU P 302 1 ? 12 
HELX_P HELX_P239 BA5 ASN P 294 ? ASP P 298 ? ASN P 315 ASP P 319 5 ? 5  
HELX_P HELX_P240 BA6 GLY P 302 ? SER P 320 ? GLY P 323 SER P 341 1 ? 19 
HELX_P HELX_P241 BA7 SER Q 7   ? GLY Q 38  ? SER Q 28  GLY Q 59  1 ? 32 
HELX_P HELX_P242 BA8 GLN Q 59  ? ALA Q 62  ? GLN Q 80  ALA Q 83  5 ? 4  
HELX_P HELX_P243 BA9 PHE Q 63  ? TRP Q 73  ? PHE Q 84  TRP Q 94  1 ? 11 
HELX_P HELX_P244 BB1 PRO Q 100 ? CYS Q 107 ? PRO Q 121 CYS Q 128 1 ? 8  
HELX_P HELX_P245 BB2 ASP Q 110 ? GLU Q 127 ? ASP Q 131 GLU Q 148 1 ? 18 
HELX_P HELX_P246 BB3 ASP Q 139 ? SER Q 141 ? ASP Q 160 SER Q 162 5 ? 3  
HELX_P HELX_P247 BB4 ILE Q 142 ? GLY Q 155 ? ILE Q 163 GLY Q 176 1 ? 14 
HELX_P HELX_P248 BB5 CYS Q 172 ? ASN Q 176 ? CYS Q 193 ASN Q 197 5 ? 5  
HELX_P HELX_P249 BB6 SER Q 182 ? GLY Q 190 ? SER Q 203 GLY Q 211 1 ? 9  
HELX_P HELX_P250 BB7 ASN Q 205 ? PHE Q 215 ? ASN Q 226 PHE Q 236 1 ? 11 
HELX_P HELX_P251 BB8 THR Q 224 ? GLU Q 233 ? THR Q 245 GLU Q 254 1 ? 10 
HELX_P HELX_P252 BB9 ASP Q 251 ? LEU Q 253 ? ASP Q 272 LEU Q 274 5 ? 3  
HELX_P HELX_P253 BC1 SER Q 270 ? LEU Q 281 ? SER Q 291 LEU Q 302 1 ? 12 
HELX_P HELX_P254 BC2 ASN Q 294 ? ASP Q 298 ? ASN Q 315 ASP Q 319 5 ? 5  
HELX_P HELX_P255 BC3 GLY Q 302 ? SER Q 320 ? GLY Q 323 SER Q 341 1 ? 19 
HELX_P HELX_P256 BC4 SER R 7   ? GLY R 38  ? SER R 28  GLY R 59  1 ? 32 
HELX_P HELX_P257 BC5 GLN R 59  ? ALA R 62  ? GLN R 80  ALA R 83  5 ? 4  
HELX_P HELX_P258 BC6 PHE R 63  ? TRP R 73  ? PHE R 84  TRP R 94  1 ? 11 
HELX_P HELX_P259 BC7 PRO R 100 ? CYS R 107 ? PRO R 121 CYS R 128 1 ? 8  
HELX_P HELX_P260 BC8 ASP R 110 ? GLU R 127 ? ASP R 131 GLU R 148 1 ? 18 
HELX_P HELX_P261 BC9 ASP R 139 ? SER R 141 ? ASP R 160 SER R 162 5 ? 3  
HELX_P HELX_P262 BD1 ILE R 142 ? GLY R 155 ? ILE R 163 GLY R 176 1 ? 14 
HELX_P HELX_P263 BD2 CYS R 172 ? ASN R 176 ? CYS R 193 ASN R 197 5 ? 5  
HELX_P HELX_P264 BD3 SER R 182 ? GLY R 190 ? SER R 203 GLY R 211 1 ? 9  
HELX_P HELX_P265 BD4 ASN R 205 ? PHE R 215 ? ASN R 226 PHE R 236 1 ? 11 
HELX_P HELX_P266 BD5 THR R 224 ? GLU R 233 ? THR R 245 GLU R 254 1 ? 10 
HELX_P HELX_P267 BD6 ASP R 251 ? LEU R 253 ? ASP R 272 LEU R 274 5 ? 3  
HELX_P HELX_P268 BD7 SER R 270 ? LEU R 281 ? SER R 291 LEU R 302 1 ? 12 
HELX_P HELX_P269 BD8 ASN R 294 ? ASP R 298 ? ASN R 315 ASP R 319 5 ? 5  
HELX_P HELX_P270 BD9 GLY R 302 ? SER R 320 ? GLY R 323 SER R 341 1 ? 19 
HELX_P HELX_P271 BE1 SER S 7   ? GLY S 38  ? SER S 28  GLY S 59  1 ? 32 
HELX_P HELX_P272 BE2 GLN S 59  ? ALA S 62  ? GLN S 80  ALA S 83  5 ? 4  
HELX_P HELX_P273 BE3 PHE S 63  ? TRP S 73  ? PHE S 84  TRP S 94  1 ? 11 
HELX_P HELX_P274 BE4 PRO S 100 ? ASP S 106 ? PRO S 121 ASP S 127 1 ? 7  
HELX_P HELX_P275 BE5 ASP S 110 ? GLU S 127 ? ASP S 131 GLU S 148 1 ? 18 
HELX_P HELX_P276 BE6 ASP S 139 ? SER S 141 ? ASP S 160 SER S 162 5 ? 3  
HELX_P HELX_P277 BE7 ILE S 142 ? GLY S 155 ? ILE S 163 GLY S 176 1 ? 14 
HELX_P HELX_P278 BE8 CYS S 172 ? ASN S 176 ? CYS S 193 ASN S 197 5 ? 5  
HELX_P HELX_P279 BE9 SER S 182 ? GLY S 190 ? SER S 203 GLY S 211 1 ? 9  
HELX_P HELX_P280 BF1 ASN S 205 ? GLY S 216 ? ASN S 226 GLY S 237 1 ? 12 
HELX_P HELX_P281 BF2 THR S 224 ? GLU S 233 ? THR S 245 GLU S 254 1 ? 10 
HELX_P HELX_P282 BF3 ASP S 251 ? LEU S 253 ? ASP S 272 LEU S 274 5 ? 3  
HELX_P HELX_P283 BF4 SER S 270 ? LEU S 281 ? SER S 291 LEU S 302 1 ? 12 
HELX_P HELX_P284 BF5 ASN S 294 ? ASP S 298 ? ASN S 315 ASP S 319 5 ? 5  
HELX_P HELX_P285 BF6 GLY S 302 ? SER S 320 ? GLY S 323 SER S 341 1 ? 19 
HELX_P HELX_P286 BF7 ALA T 5   ? GLY T 38  ? ALA T 26  GLY T 59  1 ? 34 
HELX_P HELX_P287 BF8 GLN T 59  ? ALA T 62  ? GLN T 80  ALA T 83  5 ? 4  
HELX_P HELX_P288 BF9 PHE T 63  ? TRP T 73  ? PHE T 84  TRP T 94  1 ? 11 
HELX_P HELX_P289 BG1 PRO T 100 ? CYS T 107 ? PRO T 121 CYS T 128 1 ? 8  
HELX_P HELX_P290 BG2 ASP T 110 ? GLU T 128 ? ASP T 131 GLU T 149 1 ? 19 
HELX_P HELX_P291 BG3 ASP T 139 ? SER T 141 ? ASP T 160 SER T 162 5 ? 3  
HELX_P HELX_P292 BG4 ILE T 142 ? GLY T 155 ? ILE T 163 GLY T 176 1 ? 14 
HELX_P HELX_P293 BG5 CYS T 172 ? ASN T 176 ? CYS T 193 ASN T 197 5 ? 5  
HELX_P HELX_P294 BG6 SER T 182 ? GLY T 190 ? SER T 203 GLY T 211 1 ? 9  
HELX_P HELX_P295 BG7 ASN T 205 ? PHE T 215 ? ASN T 226 PHE T 236 1 ? 11 
HELX_P HELX_P296 BG8 THR T 224 ? GLU T 233 ? THR T 245 GLU T 254 1 ? 10 
HELX_P HELX_P297 BG9 ASP T 251 ? LEU T 253 ? ASP T 272 LEU T 274 5 ? 3  
HELX_P HELX_P298 BH1 SER T 270 ? LEU T 281 ? SER T 291 LEU T 302 1 ? 12 
HELX_P HELX_P299 BH2 ASN T 294 ? ASP T 298 ? ASN T 315 ASP T 319 5 ? 5  
HELX_P HELX_P300 BH3 GLY T 302 ? SER T 320 ? GLY T 323 SER T 341 1 ? 19 
HELX_P HELX_P301 BH4 SER U 7   ? GLY U 38  ? SER U 28  GLY U 59  1 ? 32 
HELX_P HELX_P302 BH5 GLN U 59  ? ALA U 62  ? GLN U 80  ALA U 83  5 ? 4  
HELX_P HELX_P303 BH6 PHE U 63  ? TRP U 73  ? PHE U 84  TRP U 94  1 ? 11 
HELX_P HELX_P304 BH7 PRO U 100 ? CYS U 107 ? PRO U 121 CYS U 128 1 ? 8  
HELX_P HELX_P305 BH8 ASP U 110 ? GLU U 127 ? ASP U 131 GLU U 148 1 ? 18 
HELX_P HELX_P306 BH9 ASP U 139 ? SER U 141 ? ASP U 160 SER U 162 5 ? 3  
HELX_P HELX_P307 BI1 ILE U 142 ? GLY U 155 ? ILE U 163 GLY U 176 1 ? 14 
HELX_P HELX_P308 BI2 CYS U 172 ? ASN U 176 ? CYS U 193 ASN U 197 5 ? 5  
HELX_P HELX_P309 BI3 SER U 182 ? GLY U 190 ? SER U 203 GLY U 211 1 ? 9  
HELX_P HELX_P310 BI4 ASN U 205 ? GLY U 216 ? ASN U 226 GLY U 237 1 ? 12 
HELX_P HELX_P311 BI5 THR U 224 ? GLU U 233 ? THR U 245 GLU U 254 1 ? 10 
HELX_P HELX_P312 BI6 ASP U 251 ? LEU U 253 ? ASP U 272 LEU U 274 5 ? 3  
HELX_P HELX_P313 BI7 SER U 270 ? LEU U 281 ? SER U 291 LEU U 302 1 ? 12 
HELX_P HELX_P314 BI8 ASN U 294 ? ASP U 298 ? ASN U 315 ASP U 319 5 ? 5  
HELX_P HELX_P315 BI9 GLY U 302 ? SER U 320 ? GLY U 323 SER U 341 1 ? 19 
HELX_P HELX_P316 BJ1 SER V 7   ? GLY V 38  ? SER V 28  GLY V 59  1 ? 32 
HELX_P HELX_P317 BJ2 GLN V 59  ? ALA V 62  ? GLN V 80  ALA V 83  5 ? 4  
HELX_P HELX_P318 BJ3 PHE V 63  ? TRP V 73  ? PHE V 84  TRP V 94  1 ? 11 
HELX_P HELX_P319 BJ4 PRO V 100 ? CYS V 107 ? PRO V 121 CYS V 128 1 ? 8  
HELX_P HELX_P320 BJ5 ASP V 110 ? GLU V 127 ? ASP V 131 GLU V 148 1 ? 18 
HELX_P HELX_P321 BJ6 ASP V 139 ? SER V 141 ? ASP V 160 SER V 162 5 ? 3  
HELX_P HELX_P322 BJ7 ILE V 142 ? GLY V 155 ? ILE V 163 GLY V 176 1 ? 14 
HELX_P HELX_P323 BJ8 CYS V 172 ? ASN V 176 ? CYS V 193 ASN V 197 5 ? 5  
HELX_P HELX_P324 BJ9 SER V 182 ? GLY V 191 ? SER V 203 GLY V 212 1 ? 10 
HELX_P HELX_P325 BK1 ASN V 205 ? PHE V 215 ? ASN V 226 PHE V 236 1 ? 11 
HELX_P HELX_P326 BK2 THR V 224 ? GLU V 233 ? THR V 245 GLU V 254 1 ? 10 
HELX_P HELX_P327 BK3 ASP V 251 ? LEU V 253 ? ASP V 272 LEU V 274 5 ? 3  
HELX_P HELX_P328 BK4 SER V 270 ? LEU V 281 ? SER V 291 LEU V 302 1 ? 12 
HELX_P HELX_P329 BK5 ASN V 294 ? ASP V 298 ? ASN V 315 ASP V 319 5 ? 5  
HELX_P HELX_P330 BK6 GLY V 302 ? SER V 320 ? GLY V 323 SER V 341 1 ? 19 
HELX_P HELX_P331 BK7 SER W 6   ? LEU W 36  ? SER W 27  LEU W 57  1 ? 31 
HELX_P HELX_P332 BK8 GLN W 59  ? ALA W 62  ? GLN W 80  ALA W 83  5 ? 4  
HELX_P HELX_P333 BK9 PHE W 63  ? TRP W 73  ? PHE W 84  TRP W 94  1 ? 11 
HELX_P HELX_P334 BL1 PRO W 100 ? CYS W 107 ? PRO W 121 CYS W 128 1 ? 8  
HELX_P HELX_P335 BL2 ASP W 110 ? GLU W 128 ? ASP W 131 GLU W 149 1 ? 19 
HELX_P HELX_P336 BL3 ASP W 139 ? SER W 141 ? ASP W 160 SER W 162 5 ? 3  
HELX_P HELX_P337 BL4 ILE W 142 ? GLY W 155 ? ILE W 163 GLY W 176 1 ? 14 
HELX_P HELX_P338 BL5 CYS W 172 ? ASN W 176 ? CYS W 193 ASN W 197 5 ? 5  
HELX_P HELX_P339 BL6 SER W 182 ? GLY W 190 ? SER W 203 GLY W 211 1 ? 9  
HELX_P HELX_P340 BL7 ASN W 205 ? GLY W 216 ? ASN W 226 GLY W 237 1 ? 12 
HELX_P HELX_P341 BL8 THR W 224 ? GLU W 233 ? THR W 245 GLU W 254 1 ? 10 
HELX_P HELX_P342 BL9 ASP W 251 ? LEU W 253 ? ASP W 272 LEU W 274 5 ? 3  
HELX_P HELX_P343 BM1 SER W 270 ? ASN W 280 ? SER W 291 ASN W 301 1 ? 11 
HELX_P HELX_P344 BM2 ASN W 294 ? ASP W 298 ? ASN W 315 ASP W 319 5 ? 5  
HELX_P HELX_P345 BM3 GLY W 302 ? SER W 320 ? GLY W 323 SER W 341 1 ? 19 
HELX_P HELX_P346 BM4 SER X 7   ? GLY X 38  ? SER X 28  GLY X 59  1 ? 32 
HELX_P HELX_P347 BM5 GLN X 59  ? ALA X 62  ? GLN X 80  ALA X 83  5 ? 4  
HELX_P HELX_P348 BM6 PHE X 63  ? TRP X 73  ? PHE X 84  TRP X 94  1 ? 11 
HELX_P HELX_P349 BM7 PRO X 100 ? CYS X 107 ? PRO X 121 CYS X 128 1 ? 8  
HELX_P HELX_P350 BM8 ASP X 110 ? GLU X 127 ? ASP X 131 GLU X 148 1 ? 18 
HELX_P HELX_P351 BM9 ASP X 139 ? SER X 141 ? ASP X 160 SER X 162 5 ? 3  
HELX_P HELX_P352 BN1 ILE X 142 ? GLY X 155 ? ILE X 163 GLY X 176 1 ? 14 
HELX_P HELX_P353 BN2 CYS X 172 ? ASN X 176 ? CYS X 193 ASN X 197 5 ? 5  
HELX_P HELX_P354 BN3 SER X 182 ? GLY X 190 ? SER X 203 GLY X 211 1 ? 9  
HELX_P HELX_P355 BN4 ASN X 205 ? GLY X 216 ? ASN X 226 GLY X 237 1 ? 12 
HELX_P HELX_P356 BN5 THR X 224 ? GLU X 233 ? THR X 245 GLU X 254 1 ? 10 
HELX_P HELX_P357 BN6 ASP X 251 ? LEU X 253 ? ASP X 272 LEU X 274 5 ? 3  
HELX_P HELX_P358 BN7 SER X 270 ? LEU X 281 ? SER X 291 LEU X 302 1 ? 12 
HELX_P HELX_P359 BN8 ASN X 294 ? ASP X 298 ? ASN X 315 ASP X 319 5 ? 5  
HELX_P HELX_P360 BN9 GLY X 302 ? SER X 320 ? GLY X 323 SER X 341 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1   metalc ? ? A  SER 55  OG  ? ? ? 1_555 AA NA  . NA ? ? A SER 76  A NA  403 1_555 ? ? ? ? ? ? ? 2.860 ? ? 
metalc2   metalc ? ? A  LEU 58  O   ? ? ? 1_555 AA NA  . NA ? ? A LEU 79  A NA  403 1_555 ? ? ? ? ? ? ? 2.909 ? ? 
metalc3   metalc ? ? A  HIS 140 ND1 ? ? ? 1_555 Z  MN  . MN ? ? A HIS 161 A MN  402 1_555 ? ? ? ? ? ? ? 2.287 ? ? 
metalc4   metalc ? ? A  ASP 164 OD1 ? ? ? 1_555 Y  MN  . MN ? ? A ASP 185 A MN  401 1_555 ? ? ? ? ? ? ? 2.044 ? ? 
metalc5   metalc ? ? A  ASP 164 OD2 ? ? ? 1_555 Z  MN  . MN ? ? A ASP 185 A MN  402 1_555 ? ? ? ? ? ? ? 1.986 ? ? 
metalc6   metalc ? ? A  HIS 166 ND1 ? ? ? 1_555 Y  MN  . MN ? ? A HIS 187 A MN  401 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc7   metalc ? ? A  ASP 168 OD2 ? ? ? 1_555 Z  MN  . MN ? ? A ASP 189 A MN  402 1_555 ? ? ? ? ? ? ? 1.902 ? ? 
metalc8   metalc ? ? A  ASP 249 OD2 ? ? ? 1_555 Y  MN  . MN ? ? A ASP 270 A MN  401 1_555 ? ? ? ? ? ? ? 2.144 ? ? 
metalc9   metalc ? ? A  ASP 249 OD2 ? ? ? 1_555 Z  MN  . MN ? ? A ASP 270 A MN  402 1_555 ? ? ? ? ? ? ? 2.449 ? ? 
metalc10  metalc ? ? A  ASP 251 OD1 ? ? ? 1_555 Y  MN  . MN ? ? A ASP 272 A MN  401 1_555 ? ? ? ? ? ? ? 2.467 ? ? 
metalc11  metalc ? ? A  ASP 251 OD2 ? ? ? 1_555 Y  MN  . MN ? ? A ASP 272 A MN  401 1_555 ? ? ? ? ? ? ? 2.138 ? ? 
metalc12  metalc ? ? A  SER 262 OG  ? ? ? 1_555 AA NA  . NA ? ? A SER 283 A NA  403 1_555 ? ? ? ? ? ? ? 3.029 ? ? 
metalc13  metalc ? ? A  GLU 292 OE1 ? ? ? 1_555 AA NA  . NA ? ? A GLU 313 A NA  403 1_555 ? ? ? ? ? ? ? 2.718 ? ? 
metalc14  metalc ? ? Y  MN  .   MN  ? ? ? 1_555 KE HOH . O  ? ? A MN  401 A HOH 517 1_555 ? ? ? ? ? ? ? 1.996 ? ? 
metalc15  metalc ? ? Z  MN  .   MN  ? ? ? 1_555 KE HOH . O  ? ? A MN  402 A HOH 502 1_555 ? ? ? ? ? ? ? 2.374 ? ? 
metalc16  metalc ? ? Z  MN  .   MN  ? ? ? 1_555 KE HOH . O  ? ? A MN  402 A HOH 517 1_555 ? ? ? ? ? ? ? 2.394 ? ? 
metalc17  metalc ? ? AA NA  .   NA  ? ? ? 1_555 KE HOH . O  ? ? A NA  403 A HOH 586 1_555 ? ? ? ? ? ? ? 2.631 ? ? 
metalc18  metalc ? ? B  SER 55  OG  ? ? ? 1_555 FA NA  . NA ? ? B SER 76  B NA  404 1_555 ? ? ? ? ? ? ? 2.735 ? ? 
metalc19  metalc ? ? B  LEU 58  O   ? ? ? 1_555 FA NA  . NA ? ? B LEU 79  B NA  404 1_555 ? ? ? ? ? ? ? 2.843 ? ? 
metalc20  metalc ? ? B  HIS 140 ND1 ? ? ? 1_555 DA MN  . MN ? ? B HIS 161 B MN  402 1_555 ? ? ? ? ? ? ? 2.260 ? ? 
metalc21  metalc ? ? B  ASP 164 OD1 ? ? ? 1_555 CA MN  . MN ? ? B ASP 185 B MN  401 1_555 ? ? ? ? ? ? ? 2.191 ? ? 
metalc22  metalc ? ? B  ASP 164 OD2 ? ? ? 1_555 DA MN  . MN ? ? B ASP 185 B MN  402 1_555 ? ? ? ? ? ? ? 2.206 ? ? 
metalc23  metalc ? ? B  HIS 166 ND1 ? ? ? 1_555 CA MN  . MN ? ? B HIS 187 B MN  401 1_555 ? ? ? ? ? ? ? 2.270 ? ? 
metalc24  metalc ? ? B  ASP 168 OD2 ? ? ? 1_555 DA MN  . MN ? ? B ASP 189 B MN  402 1_555 ? ? ? ? ? ? ? 2.017 ? ? 
metalc25  metalc ? ? B  ASP 249 OD2 ? ? ? 1_555 CA MN  . MN ? ? B ASP 270 B MN  401 1_555 ? ? ? ? ? ? ? 2.242 ? ? 
metalc26  metalc ? ? B  ASP 249 OD2 ? ? ? 1_555 DA MN  . MN ? ? B ASP 270 B MN  402 1_555 ? ? ? ? ? ? ? 2.448 ? ? 
metalc27  metalc ? ? B  ASP 251 OD1 ? ? ? 1_555 CA MN  . MN ? ? B ASP 272 B MN  401 1_555 ? ? ? ? ? ? ? 2.565 ? ? 
metalc28  metalc ? ? B  ASP 251 OD2 ? ? ? 1_555 CA MN  . MN ? ? B ASP 272 B MN  401 1_555 ? ? ? ? ? ? ? 1.947 ? ? 
metalc29  metalc ? ? B  SER 262 OG  ? ? ? 1_555 FA NA  . NA ? ? B SER 283 B NA  404 1_555 ? ? ? ? ? ? ? 2.916 ? ? 
metalc30  metalc ? ? B  GLU 292 OE1 ? ? ? 1_555 FA NA  . NA ? ? B GLU 313 B NA  404 1_555 ? ? ? ? ? ? ? 2.793 ? ? 
metalc31  metalc ? ? CA MN  .   MN  ? ? ? 1_555 LE HOH . O  ? ? B MN  401 B HOH 505 1_555 ? ? ? ? ? ? ? 1.878 ? ? 
metalc32  metalc ? ? DA MN  .   MN  ? ? ? 1_555 LE HOH . O  ? ? B MN  402 B HOH 505 1_555 ? ? ? ? ? ? ? 1.946 ? ? 
metalc33  metalc ? ? DA MN  .   MN  ? ? ? 1_555 LE HOH . O  ? ? B MN  402 B HOH 630 1_555 ? ? ? ? ? ? ? 2.724 ? ? 
metalc34  metalc ? ? FA NA  .   NA  ? ? ? 1_555 LE HOH . O  ? ? B NA  404 B HOH 645 1_555 ? ? ? ? ? ? ? 2.877 ? ? 
metalc35  metalc ? ? C  SER 55  OG  ? ? ? 1_555 KA NA  . NA ? ? C SER 76  C NA  404 1_555 ? ? ? ? ? ? ? 2.967 ? ? 
metalc36  metalc ? ? C  LEU 58  O   ? ? ? 1_555 KA NA  . NA ? ? C LEU 79  C NA  404 1_555 ? ? ? ? ? ? ? 2.730 ? ? 
metalc37  metalc ? ? C  HIS 140 ND1 ? ? ? 1_555 IA MN  . MN ? ? C HIS 161 C MN  402 1_555 ? ? ? ? ? ? ? 1.816 ? ? 
metalc38  metalc ? ? C  ASP 164 OD1 ? ? ? 1_555 HA MN  . MN ? ? C ASP 185 C MN  401 1_555 ? ? ? ? ? ? ? 2.080 ? ? 
metalc39  metalc ? ? C  ASP 164 OD2 ? ? ? 1_555 IA MN  . MN ? ? C ASP 185 C MN  402 1_555 ? ? ? ? ? ? ? 2.077 ? ? 
metalc40  metalc ? ? C  HIS 166 ND1 ? ? ? 1_555 HA MN  . MN ? ? C HIS 187 C MN  401 1_555 ? ? ? ? ? ? ? 2.316 ? ? 
metalc41  metalc ? ? C  ASP 168 OD2 ? ? ? 1_555 IA MN  . MN ? ? C ASP 189 C MN  402 1_555 ? ? ? ? ? ? ? 2.004 ? ? 
metalc42  metalc ? ? C  ASP 249 OD2 ? ? ? 1_555 HA MN  . MN ? ? C ASP 270 C MN  401 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc43  metalc ? ? C  ASP 251 OD2 ? ? ? 1_555 HA MN  . MN ? ? C ASP 272 C MN  401 1_555 ? ? ? ? ? ? ? 2.370 ? ? 
metalc44  metalc ? ? C  SER 262 OG  ? ? ? 1_555 KA NA  . NA ? ? C SER 283 C NA  404 1_555 ? ? ? ? ? ? ? 2.995 ? ? 
metalc45  metalc ? ? C  GLU 292 OE1 ? ? ? 1_555 KA NA  . NA ? ? C GLU 313 C NA  404 1_555 ? ? ? ? ? ? ? 3.020 ? ? 
metalc46  metalc ? ? HA MN  .   MN  ? ? ? 1_555 ME HOH . O  ? ? C MN  401 C HOH 534 1_555 ? ? ? ? ? ? ? 1.967 ? ? 
metalc47  metalc ? ? IA MN  .   MN  ? ? ? 1_555 ME HOH . O  ? ? C MN  402 C HOH 534 1_555 ? ? ? ? ? ? ? 1.973 ? ? 
metalc48  metalc ? ? IA MN  .   MN  ? ? ? 1_555 ME HOH . O  ? ? C MN  402 C HOH 569 1_555 ? ? ? ? ? ? ? 2.381 ? ? 
metalc49  metalc ? ? KA NA  .   NA  ? ? ? 1_555 ME HOH . O  ? ? C NA  404 C HOH 544 1_555 ? ? ? ? ? ? ? 2.606 ? ? 
metalc50  metalc ? ? D  SER 55  OG  ? ? ? 1_555 PA NA  . NA ? ? D SER 76  D NA  404 1_555 ? ? ? ? ? ? ? 2.840 ? ? 
metalc51  metalc ? ? D  LEU 58  O   ? ? ? 1_555 PA NA  . NA ? ? D LEU 79  D NA  404 1_555 ? ? ? ? ? ? ? 2.916 ? ? 
metalc52  metalc ? ? D  HIS 140 ND1 ? ? ? 1_555 NA MN  . MN ? ? D HIS 161 D MN  402 1_555 ? ? ? ? ? ? ? 2.040 ? ? 
metalc53  metalc ? ? D  ASP 164 OD1 ? ? ? 1_555 MA MN  . MN ? ? D ASP 185 D MN  401 1_555 ? ? ? ? ? ? ? 2.252 ? ? 
metalc54  metalc ? ? D  ASP 164 OD2 ? ? ? 1_555 NA MN  . MN ? ? D ASP 185 D MN  402 1_555 ? ? ? ? ? ? ? 2.253 ? ? 
metalc55  metalc ? ? D  HIS 166 ND1 ? ? ? 1_555 MA MN  . MN ? ? D HIS 187 D MN  401 1_555 ? ? ? ? ? ? ? 2.118 ? ? 
metalc56  metalc ? ? D  ASP 168 OD2 ? ? ? 1_555 NA MN  . MN ? ? D ASP 189 D MN  402 1_555 ? ? ? ? ? ? ? 1.920 ? ? 
metalc57  metalc ? ? D  ASP 249 OD2 ? ? ? 1_555 MA MN  . MN ? ? D ASP 270 D MN  401 1_555 ? ? ? ? ? ? ? 1.941 ? ? 
metalc58  metalc ? ? D  ASP 249 OD2 ? ? ? 1_555 NA MN  . MN ? ? D ASP 270 D MN  402 1_555 ? ? ? ? ? ? ? 2.622 ? ? 
metalc59  metalc ? ? D  ASP 251 OD1 ? ? ? 1_555 MA MN  . MN ? ? D ASP 272 D MN  401 1_555 ? ? ? ? ? ? ? 2.682 ? ? 
metalc60  metalc ? ? D  ASP 251 OD2 ? ? ? 1_555 MA MN  . MN ? ? D ASP 272 D MN  401 1_555 ? ? ? ? ? ? ? 2.206 ? ? 
metalc61  metalc ? ? D  SER 262 OG  ? ? ? 1_555 PA NA  . NA ? ? D SER 283 D NA  404 1_555 ? ? ? ? ? ? ? 2.834 ? ? 
metalc62  metalc ? ? D  GLU 292 OE1 ? ? ? 1_555 PA NA  . NA ? ? D GLU 313 D NA  404 1_555 ? ? ? ? ? ? ? 2.686 ? ? 
metalc63  metalc ? ? MA MN  .   MN  ? ? ? 1_555 NE HOH . O  ? ? D MN  401 D HOH 525 1_555 ? ? ? ? ? ? ? 2.212 ? ? 
metalc64  metalc ? ? MA MN  .   MN  ? ? ? 1_555 NE HOH . O  ? ? D MN  401 D HOH 660 1_555 ? ? ? ? ? ? ? 2.745 ? ? 
metalc65  metalc ? ? NA MN  .   MN  ? ? ? 1_555 NE HOH . O  ? ? D MN  402 D HOH 525 1_555 ? ? ? ? ? ? ? 1.776 ? ? 
metalc66  metalc ? ? PA NA  .   NA  ? ? ? 1_555 NE HOH . O  ? ? D NA  404 D HOH 633 1_555 ? ? ? ? ? ? ? 2.812 ? ? 
metalc67  metalc ? ? E  SER 55  OG  ? ? ? 1_555 TA NA  . NA ? ? E SER 76  E NA  403 1_555 ? ? ? ? ? ? ? 3.000 ? ? 
metalc68  metalc ? ? E  LEU 58  O   ? ? ? 1_555 TA NA  . NA ? ? E LEU 79  E NA  403 1_555 ? ? ? ? ? ? ? 2.843 ? ? 
metalc69  metalc ? ? E  HIS 140 ND1 ? ? ? 1_555 SA MN  . MN ? ? E HIS 161 E MN  402 1_555 ? ? ? ? ? ? ? 2.308 ? ? 
metalc70  metalc ? ? E  ASP 164 OD1 ? ? ? 1_555 RA MN  . MN ? ? E ASP 185 E MN  401 1_555 ? ? ? ? ? ? ? 2.183 ? ? 
metalc71  metalc ? ? E  ASP 164 OD2 ? ? ? 1_555 SA MN  . MN ? ? E ASP 185 E MN  402 1_555 ? ? ? ? ? ? ? 2.175 ? ? 
metalc72  metalc ? ? E  HIS 166 ND1 ? ? ? 1_555 RA MN  . MN ? ? E HIS 187 E MN  401 1_555 ? ? ? ? ? ? ? 2.251 ? ? 
metalc73  metalc ? ? E  ASP 168 OD2 ? ? ? 1_555 SA MN  . MN ? ? E ASP 189 E MN  402 1_555 ? ? ? ? ? ? ? 1.940 ? ? 
metalc74  metalc ? ? E  ASP 249 OD2 ? ? ? 1_555 RA MN  . MN ? ? E ASP 270 E MN  401 1_555 ? ? ? ? ? ? ? 2.264 ? ? 
metalc75  metalc ? ? E  ASP 249 OD2 ? ? ? 1_555 SA MN  . MN ? ? E ASP 270 E MN  402 1_555 ? ? ? ? ? ? ? 2.617 ? ? 
metalc76  metalc ? ? E  ASP 251 OD1 ? ? ? 1_555 RA MN  . MN ? ? E ASP 272 E MN  401 1_555 ? ? ? ? ? ? ? 2.565 ? ? 
metalc77  metalc ? ? E  ASP 251 OD2 ? ? ? 1_555 RA MN  . MN ? ? E ASP 272 E MN  401 1_555 ? ? ? ? ? ? ? 2.134 ? ? 
metalc78  metalc ? ? E  SER 262 OG  ? ? ? 1_555 TA NA  . NA ? ? E SER 283 E NA  403 1_555 ? ? ? ? ? ? ? 2.867 ? ? 
metalc79  metalc ? ? E  GLU 292 OE1 ? ? ? 1_555 TA NA  . NA ? ? E GLU 313 E NA  403 1_555 ? ? ? ? ? ? ? 2.750 ? ? 
metalc80  metalc ? ? RA MN  .   MN  ? ? ? 1_555 OE HOH . O  ? ? E MN  401 E HOH 507 1_555 ? ? ? ? ? ? ? 2.159 ? ? 
metalc81  metalc ? ? SA MN  .   MN  ? ? ? 1_555 OE HOH . O  ? ? E MN  402 E HOH 507 1_555 ? ? ? ? ? ? ? 2.132 ? ? 
metalc82  metalc ? ? SA MN  .   MN  ? ? ? 1_555 OE HOH . O  ? ? E MN  402 E HOH 521 1_555 ? ? ? ? ? ? ? 2.428 ? ? 
metalc83  metalc ? ? TA NA  .   NA  ? ? ? 1_555 OE HOH . O  ? ? E NA  403 E HOH 671 1_555 ? ? ? ? ? ? ? 2.847 ? ? 
metalc84  metalc ? ? F  SER 55  OG  ? ? ? 1_555 ZA NA  . NA ? ? F SER 76  F NA  403 1_555 ? ? ? ? ? ? ? 2.871 ? ? 
metalc85  metalc ? ? F  LEU 58  O   ? ? ? 1_555 ZA NA  . NA ? ? F LEU 79  F NA  403 1_555 ? ? ? ? ? ? ? 2.961 ? ? 
metalc86  metalc ? ? F  HIS 140 ND1 ? ? ? 1_555 YA MN  . MN ? ? F HIS 161 F MN  402 1_555 ? ? ? ? ? ? ? 2.334 ? ? 
metalc87  metalc ? ? F  ASP 164 OD1 ? ? ? 1_555 XA MN  . MN ? ? F ASP 185 F MN  401 1_555 ? ? ? ? ? ? ? 2.272 ? ? 
metalc88  metalc ? ? F  ASP 164 OD2 ? ? ? 1_555 YA MN  . MN ? ? F ASP 185 F MN  402 1_555 ? ? ? ? ? ? ? 2.236 ? ? 
metalc89  metalc ? ? F  HIS 166 ND1 ? ? ? 1_555 XA MN  . MN ? ? F HIS 187 F MN  401 1_555 ? ? ? ? ? ? ? 2.344 ? ? 
metalc90  metalc ? ? F  ASP 168 OD2 ? ? ? 1_555 YA MN  . MN ? ? F ASP 189 F MN  402 1_555 ? ? ? ? ? ? ? 1.787 ? ? 
metalc91  metalc ? ? F  ASP 249 OD2 ? ? ? 1_555 XA MN  . MN ? ? F ASP 270 F MN  401 1_555 ? ? ? ? ? ? ? 2.246 ? ? 
metalc92  metalc ? ? F  ASP 249 OD2 ? ? ? 1_555 YA MN  . MN ? ? F ASP 270 F MN  402 1_555 ? ? ? ? ? ? ? 2.705 ? ? 
metalc93  metalc ? ? F  ASP 251 OD1 ? ? ? 1_555 XA MN  . MN ? ? F ASP 272 F MN  401 1_555 ? ? ? ? ? ? ? 2.547 ? ? 
metalc94  metalc ? ? F  ASP 251 OD2 ? ? ? 1_555 XA MN  . MN ? ? F ASP 272 F MN  401 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
metalc95  metalc ? ? F  SER 262 OG  ? ? ? 1_555 ZA NA  . NA ? ? F SER 283 F NA  403 1_555 ? ? ? ? ? ? ? 2.840 ? ? 
metalc96  metalc ? ? F  GLU 292 OE1 ? ? ? 1_555 ZA NA  . NA ? ? F GLU 313 F NA  403 1_555 ? ? ? ? ? ? ? 2.763 ? ? 
metalc97  metalc ? ? XA MN  .   MN  ? ? ? 1_555 PE HOH . O  ? ? F MN  401 F HOH 538 1_555 ? ? ? ? ? ? ? 1.922 ? ? 
metalc98  metalc ? ? YA MN  .   MN  ? ? ? 1_555 PE HOH . O  ? ? F MN  402 F HOH 501 1_555 ? ? ? ? ? ? ? 2.730 ? ? 
metalc99  metalc ? ? YA MN  .   MN  ? ? ? 1_555 PE HOH . O  ? ? F MN  402 F HOH 538 1_555 ? ? ? ? ? ? ? 2.267 ? ? 
metalc100 metalc ? ? ZA NA  .   NA  ? ? ? 1_555 PE HOH . O  ? ? F NA  403 F HOH 661 1_555 ? ? ? ? ? ? ? 2.750 ? ? 
metalc101 metalc ? ? G  SER 55  OG  ? ? ? 1_555 EB NA  . NA ? ? G SER 76  G NA  403 1_555 ? ? ? ? ? ? ? 2.951 ? ? 
metalc102 metalc ? ? G  LEU 58  O   ? ? ? 1_555 EB NA  . NA ? ? G LEU 79  G NA  403 1_555 ? ? ? ? ? ? ? 2.818 ? ? 
metalc103 metalc ? ? G  HIS 140 ND1 ? ? ? 1_555 DB MN  . MN ? ? G HIS 161 G MN  402 1_555 ? ? ? ? ? ? ? 2.308 ? ? 
metalc104 metalc ? ? G  ASP 164 OD1 ? ? ? 1_555 CB MN  . MN ? ? G ASP 185 G MN  401 1_555 ? ? ? ? ? ? ? 2.135 ? ? 
metalc105 metalc ? ? G  ASP 164 OD2 ? ? ? 1_555 DB MN  . MN ? ? G ASP 185 G MN  402 1_555 ? ? ? ? ? ? ? 2.339 ? ? 
metalc106 metalc ? ? G  HIS 166 ND1 ? ? ? 1_555 CB MN  . MN ? ? G HIS 187 G MN  401 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc107 metalc ? ? G  ASP 168 OD2 ? ? ? 1_555 DB MN  . MN ? ? G ASP 189 G MN  402 1_555 ? ? ? ? ? ? ? 1.928 ? ? 
metalc108 metalc ? ? G  ASP 249 OD2 ? ? ? 1_555 CB MN  . MN ? ? G ASP 270 G MN  401 1_555 ? ? ? ? ? ? ? 2.191 ? ? 
metalc109 metalc ? ? G  ASP 249 OD2 ? ? ? 1_555 DB MN  . MN ? ? G ASP 270 G MN  402 1_555 ? ? ? ? ? ? ? 2.704 ? ? 
metalc110 metalc ? ? G  ASP 251 OD1 ? ? ? 1_555 CB MN  . MN ? ? G ASP 272 G MN  401 1_555 ? ? ? ? ? ? ? 2.608 ? ? 
metalc111 metalc ? ? G  ASP 251 OD2 ? ? ? 1_555 CB MN  . MN ? ? G ASP 272 G MN  401 1_555 ? ? ? ? ? ? ? 1.958 ? ? 
metalc112 metalc ? ? G  SER 262 OG  ? ? ? 1_555 EB NA  . NA ? ? G SER 283 G NA  403 1_555 ? ? ? ? ? ? ? 2.715 ? ? 
metalc113 metalc ? ? G  GLU 292 OE1 ? ? ? 1_555 EB NA  . NA ? ? G GLU 313 G NA  403 1_555 ? ? ? ? ? ? ? 2.727 ? ? 
metalc114 metalc ? ? CB MN  .   MN  ? ? ? 1_555 QE HOH . O  ? ? G MN  401 G HOH 658 1_555 ? ? ? ? ? ? ? 1.928 ? ? 
metalc115 metalc ? ? DB MN  .   MN  ? ? ? 1_555 QE HOH . O  ? ? G MN  402 G HOH 658 1_555 ? ? ? ? ? ? ? 2.310 ? ? 
metalc116 metalc ? ? DB MN  .   MN  ? ? ? 1_555 QE HOH . O  ? ? G MN  402 G HOH 695 1_555 ? ? ? ? ? ? ? 2.652 ? ? 
metalc117 metalc ? ? EB NA  .   NA  ? ? ? 1_555 QE HOH . O  ? ? G NA  403 G HOH 598 1_555 ? ? ? ? ? ? ? 2.894 ? ? 
metalc118 metalc ? ? QE HOH .   O   ? ? ? 1_555 PB MN  . MN ? ? G HOH 503 I MN  401 1_555 ? ? ? ? ? ? ? 2.136 ? ? 
metalc119 metalc ? ? QE HOH .   O   ? ? ? 1_555 QB MN  . MN ? ? G HOH 503 I MN  402 1_555 ? ? ? ? ? ? ? 2.375 ? ? 
metalc120 metalc ? ? QE HOH .   O   ? ? ? 1_555 QB MN  . MN ? ? G HOH 507 I MN  402 1_555 ? ? ? ? ? ? ? 2.268 ? ? 
metalc121 metalc ? ? H  SER 55  OG  ? ? ? 1_555 OB NA  . NA ? ? H SER 76  H NA  405 1_555 ? ? ? ? ? ? ? 2.990 ? ? 
metalc122 metalc ? ? H  LEU 58  O   ? ? ? 1_555 OB NA  . NA ? ? H LEU 79  H NA  405 1_555 ? ? ? ? ? ? ? 2.970 ? ? 
metalc123 metalc ? ? H  HIS 140 ND1 ? ? ? 1_555 LB MN  . MN ? ? H HIS 161 H MN  402 1_555 ? ? ? ? ? ? ? 2.207 ? ? 
metalc124 metalc ? ? H  ASP 164 OD1 ? ? ? 1_555 KB MN  . MN ? ? H ASP 185 H MN  401 1_555 ? ? ? ? ? ? ? 2.176 ? ? 
metalc125 metalc ? ? H  ASP 164 OD2 ? ? ? 1_555 LB MN  . MN ? ? H ASP 185 H MN  402 1_555 ? ? ? ? ? ? ? 2.174 ? ? 
metalc126 metalc ? ? H  HIS 166 ND1 ? ? ? 1_555 KB MN  . MN ? ? H HIS 187 H MN  401 1_555 ? ? ? ? ? ? ? 2.292 ? ? 
metalc127 metalc ? ? H  ASP 168 OD2 ? ? ? 1_555 LB MN  . MN ? ? H ASP 189 H MN  402 1_555 ? ? ? ? ? ? ? 2.060 ? ? 
metalc128 metalc ? ? H  ASP 249 OD2 ? ? ? 1_555 KB MN  . MN ? ? H ASP 270 H MN  401 1_555 ? ? ? ? ? ? ? 2.160 ? ? 
metalc129 metalc ? ? H  ASP 249 OD2 ? ? ? 1_555 LB MN  . MN ? ? H ASP 270 H MN  402 1_555 ? ? ? ? ? ? ? 2.567 ? ? 
metalc130 metalc ? ? H  ASP 251 OD1 ? ? ? 1_555 KB MN  . MN ? ? H ASP 272 H MN  401 1_555 ? ? ? ? ? ? ? 2.525 ? ? 
metalc131 metalc ? ? H  ASP 251 OD2 ? ? ? 1_555 KB MN  . MN ? ? H ASP 272 H MN  401 1_555 ? ? ? ? ? ? ? 2.157 ? ? 
metalc132 metalc ? ? H  SER 262 OG  ? ? ? 1_555 OB NA  . NA ? ? H SER 283 H NA  405 1_555 ? ? ? ? ? ? ? 2.898 ? ? 
metalc133 metalc ? ? H  GLU 292 OE1 ? ? ? 1_555 OB NA  . NA ? ? H GLU 313 H NA  405 1_555 ? ? ? ? ? ? ? 2.684 ? ? 
metalc134 metalc ? ? KB MN  .   MN  ? ? ? 1_555 RE HOH . O  ? ? H MN  401 H HOH 609 1_555 ? ? ? ? ? ? ? 1.998 ? ? 
metalc135 metalc ? ? LB MN  .   MN  ? ? ? 1_555 RE HOH . O  ? ? H MN  402 H HOH 609 1_555 ? ? ? ? ? ? ? 2.179 ? ? 
metalc136 metalc ? ? OB NA  .   NA  ? ? ? 1_555 RE HOH . O  ? ? H NA  405 H HOH 635 1_555 ? ? ? ? ? ? ? 2.764 ? ? 
metalc137 metalc ? ? I  SER 55  OG  ? ? ? 1_555 RB NA  . NA ? ? I SER 76  I NA  403 1_555 ? ? ? ? ? ? ? 2.941 ? ? 
metalc138 metalc ? ? I  LEU 58  O   ? ? ? 1_555 RB NA  . NA ? ? I LEU 79  I NA  403 1_555 ? ? ? ? ? ? ? 2.843 ? ? 
metalc139 metalc ? ? I  HIS 140 ND1 ? ? ? 1_555 QB MN  . MN ? ? I HIS 161 I MN  402 1_555 ? ? ? ? ? ? ? 2.193 ? ? 
metalc140 metalc ? ? I  ASP 164 OD1 ? ? ? 1_555 PB MN  . MN ? ? I ASP 185 I MN  401 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc141 metalc ? ? I  ASP 164 OD2 ? ? ? 1_555 QB MN  . MN ? ? I ASP 185 I MN  402 1_555 ? ? ? ? ? ? ? 2.216 ? ? 
metalc142 metalc ? ? I  HIS 166 ND1 ? ? ? 1_555 PB MN  . MN ? ? I HIS 187 I MN  401 1_555 ? ? ? ? ? ? ? 2.155 ? ? 
metalc143 metalc ? ? I  ASP 168 OD2 ? ? ? 1_555 QB MN  . MN ? ? I ASP 189 I MN  402 1_555 ? ? ? ? ? ? ? 1.946 ? ? 
metalc144 metalc ? ? I  ASP 249 OD2 ? ? ? 1_555 PB MN  . MN ? ? I ASP 270 I MN  401 1_555 ? ? ? ? ? ? ? 2.265 ? ? 
metalc145 metalc ? ? I  ASP 249 OD2 ? ? ? 1_555 QB MN  . MN ? ? I ASP 270 I MN  402 1_555 ? ? ? ? ? ? ? 2.694 ? ? 
metalc146 metalc ? ? I  ASP 251 OD1 ? ? ? 1_555 PB MN  . MN ? ? I ASP 272 I MN  401 1_555 ? ? ? ? ? ? ? 2.474 ? ? 
metalc147 metalc ? ? I  ASP 251 OD2 ? ? ? 1_555 PB MN  . MN ? ? I ASP 272 I MN  401 1_555 ? ? ? ? ? ? ? 2.232 ? ? 
metalc148 metalc ? ? I  SER 262 OG  ? ? ? 1_555 RB NA  . NA ? ? I SER 283 I NA  403 1_555 ? ? ? ? ? ? ? 2.886 ? ? 
metalc149 metalc ? ? I  GLU 292 OE1 ? ? ? 1_555 RB NA  . NA ? ? I GLU 313 I NA  403 1_555 ? ? ? ? ? ? ? 2.666 ? ? 
metalc150 metalc ? ? RB NA  .   NA  ? ? ? 1_555 SE HOH . O  ? ? I NA  403 I HOH 617 1_555 ? ? ? ? ? ? ? 2.727 ? ? 
metalc151 metalc ? ? J  SER 55  OG  ? ? ? 1_555 WB NA  . NA ? ? J SER 76  J NA  403 1_555 ? ? ? ? ? ? ? 3.011 ? ? 
metalc152 metalc ? ? J  LEU 58  O   ? ? ? 1_555 WB NA  . NA ? ? J LEU 79  J NA  403 1_555 ? ? ? ? ? ? ? 2.904 ? ? 
metalc153 metalc ? ? J  HIS 140 ND1 ? ? ? 1_555 VB MN  . MN ? ? J HIS 161 J MN  402 1_555 ? ? ? ? ? ? ? 2.137 ? ? 
metalc154 metalc ? ? J  ASP 164 OD1 ? ? ? 1_555 UB MN  . MN ? ? J ASP 185 J MN  401 1_555 ? ? ? ? ? ? ? 2.189 ? ? 
metalc155 metalc ? ? J  ASP 164 OD2 ? ? ? 1_555 VB MN  . MN ? ? J ASP 185 J MN  402 1_555 ? ? ? ? ? ? ? 2.204 ? ? 
metalc156 metalc ? ? J  HIS 166 ND1 ? ? ? 1_555 UB MN  . MN ? ? J HIS 187 J MN  401 1_555 ? ? ? ? ? ? ? 2.255 ? ? 
metalc157 metalc ? ? J  ASP 168 OD2 ? ? ? 1_555 VB MN  . MN ? ? J ASP 189 J MN  402 1_555 ? ? ? ? ? ? ? 1.910 ? ? 
metalc158 metalc ? ? J  ASP 249 OD2 ? ? ? 1_555 UB MN  . MN ? ? J ASP 270 J MN  401 1_555 ? ? ? ? ? ? ? 2.082 ? ? 
metalc159 metalc ? ? J  ASP 249 OD2 ? ? ? 1_555 VB MN  . MN ? ? J ASP 270 J MN  402 1_555 ? ? ? ? ? ? ? 2.649 ? ? 
metalc160 metalc ? ? J  ASP 251 OD1 ? ? ? 1_555 UB MN  . MN ? ? J ASP 272 J MN  401 1_555 ? ? ? ? ? ? ? 2.581 ? ? 
metalc161 metalc ? ? J  ASP 251 OD2 ? ? ? 1_555 UB MN  . MN ? ? J ASP 272 J MN  401 1_555 ? ? ? ? ? ? ? 2.174 ? ? 
metalc162 metalc ? ? J  SER 262 OG  ? ? ? 1_555 WB NA  . NA ? ? J SER 283 J NA  403 1_555 ? ? ? ? ? ? ? 2.793 ? ? 
metalc163 metalc ? ? J  GLU 292 OE1 ? ? ? 1_555 WB NA  . NA ? ? J GLU 313 J NA  403 1_555 ? ? ? ? ? ? ? 2.760 ? ? 
metalc164 metalc ? ? UB MN  .   MN  ? ? ? 1_555 TE HOH . O  ? ? J MN  401 J HOH 533 1_555 ? ? ? ? ? ? ? 1.928 ? ? 
metalc165 metalc ? ? VB MN  .   MN  ? ? ? 1_555 TE HOH . O  ? ? J MN  402 J HOH 533 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
metalc166 metalc ? ? WB NA  .   NA  ? ? ? 1_555 TE HOH . O  ? ? J NA  403 J HOH 680 1_555 ? ? ? ? ? ? ? 2.667 ? ? 
metalc167 metalc ? ? K  SER 55  OG  ? ? ? 1_555 CC NA  . NA ? ? K SER 76  K NA  404 1_555 ? ? ? ? ? ? ? 3.002 ? ? 
metalc168 metalc ? ? K  LEU 58  O   ? ? ? 1_555 CC NA  . NA ? ? K LEU 79  K NA  404 1_555 ? ? ? ? ? ? ? 2.746 ? ? 
metalc169 metalc ? ? K  HIS 140 ND1 ? ? ? 1_555 AC MN  . MN ? ? K HIS 161 K MN  402 1_555 ? ? ? ? ? ? ? 2.189 ? ? 
metalc170 metalc ? ? K  ASP 164 OD1 ? ? ? 1_555 ZB MN  . MN ? ? K ASP 185 K MN  401 1_555 ? ? ? ? ? ? ? 2.189 ? ? 
metalc171 metalc ? ? K  ASP 164 OD2 ? ? ? 1_555 AC MN  . MN ? ? K ASP 185 K MN  402 1_555 ? ? ? ? ? ? ? 2.257 ? ? 
metalc172 metalc ? ? K  HIS 166 ND1 ? ? ? 1_555 ZB MN  . MN ? ? K HIS 187 K MN  401 1_555 ? ? ? ? ? ? ? 2.240 ? ? 
metalc173 metalc ? ? K  ASP 168 OD2 ? ? ? 1_555 AC MN  . MN ? ? K ASP 189 K MN  402 1_555 ? ? ? ? ? ? ? 1.902 ? ? 
metalc174 metalc ? ? K  ASP 249 OD2 ? ? ? 1_555 ZB MN  . MN ? ? K ASP 270 K MN  401 1_555 ? ? ? ? ? ? ? 2.091 ? ? 
metalc175 metalc ? ? K  ASP 249 OD2 ? ? ? 1_555 AC MN  . MN ? ? K ASP 270 K MN  402 1_555 ? ? ? ? ? ? ? 2.610 ? ? 
metalc176 metalc ? ? K  ASP 251 OD1 ? ? ? 1_555 ZB MN  . MN ? ? K ASP 272 K MN  401 1_555 ? ? ? ? ? ? ? 2.274 ? ? 
metalc177 metalc ? ? K  ASP 251 OD2 ? ? ? 1_555 ZB MN  . MN ? ? K ASP 272 K MN  401 1_555 ? ? ? ? ? ? ? 2.336 ? ? 
metalc178 metalc ? ? K  SER 262 OG  ? ? ? 1_555 CC NA  . NA ? ? K SER 283 K NA  404 1_555 ? ? ? ? ? ? ? 2.821 ? ? 
metalc179 metalc ? ? K  GLU 292 OE1 ? ? ? 1_555 CC NA  . NA ? ? K GLU 313 K NA  404 1_555 ? ? ? ? ? ? ? 2.745 ? ? 
metalc180 metalc ? ? ZB MN  .   MN  ? ? ? 1_555 UE HOH . O  ? ? K MN  401 K HOH 507 1_555 ? ? ? ? ? ? ? 2.009 ? ? 
metalc181 metalc ? ? AC MN  .   MN  ? ? ? 1_555 UE HOH . O  ? ? K MN  402 K HOH 507 1_555 ? ? ? ? ? ? ? 2.269 ? ? 
metalc182 metalc ? ? AC MN  .   MN  ? ? ? 1_555 UE HOH . O  ? ? K MN  402 K HOH 509 1_555 ? ? ? ? ? ? ? 2.349 ? ? 
metalc183 metalc ? ? CC NA  .   NA  ? ? ? 1_555 UE HOH . O  ? ? K NA  404 K HOH 627 1_555 ? ? ? ? ? ? ? 2.706 ? ? 
metalc184 metalc ? ? L  SER 55  OG  ? ? ? 1_555 IC NA  . NA ? ? L SER 76  L NA  404 1_555 ? ? ? ? ? ? ? 2.930 ? ? 
metalc185 metalc ? ? L  LEU 58  O   ? ? ? 1_555 IC NA  . NA ? ? L LEU 79  L NA  404 1_555 ? ? ? ? ? ? ? 2.983 ? ? 
metalc186 metalc ? ? L  HIS 140 ND1 ? ? ? 1_555 GC MN  . MN ? ? L HIS 161 L MN  402 1_555 ? ? ? ? ? ? ? 2.298 ? ? 
metalc187 metalc ? ? L  ASP 164 OD1 ? ? ? 1_555 FC MN  . MN ? ? L ASP 185 L MN  401 1_555 ? ? ? ? ? ? ? 2.228 ? ? 
metalc188 metalc ? ? L  ASP 164 OD2 ? ? ? 1_555 GC MN  . MN ? ? L ASP 185 L MN  402 1_555 ? ? ? ? ? ? ? 2.171 ? ? 
metalc189 metalc ? ? L  HIS 166 ND1 ? ? ? 1_555 FC MN  . MN ? ? L HIS 187 L MN  401 1_555 ? ? ? ? ? ? ? 2.273 ? ? 
metalc190 metalc ? ? L  ASP 168 OD2 ? ? ? 1_555 GC MN  . MN ? ? L ASP 189 L MN  402 1_555 ? ? ? ? ? ? ? 2.029 ? ? 
metalc191 metalc ? ? L  ASP 249 OD2 ? ? ? 1_555 FC MN  . MN ? ? L ASP 270 L MN  401 1_555 ? ? ? ? ? ? ? 2.205 ? ? 
metalc192 metalc ? ? L  ASP 249 OD2 ? ? ? 1_555 GC MN  . MN ? ? L ASP 270 L MN  402 1_555 ? ? ? ? ? ? ? 2.610 ? ? 
metalc193 metalc ? ? L  ASP 251 OD1 ? ? ? 1_555 FC MN  . MN ? ? L ASP 272 L MN  401 1_555 ? ? ? ? ? ? ? 2.653 ? ? 
metalc194 metalc ? ? L  ASP 251 OD2 ? ? ? 1_555 FC MN  . MN ? ? L ASP 272 L MN  401 1_555 ? ? ? ? ? ? ? 2.086 ? ? 
metalc195 metalc ? ? L  SER 262 OG  ? ? ? 1_555 IC NA  . NA ? ? L SER 283 L NA  404 1_555 ? ? ? ? ? ? ? 2.843 ? ? 
metalc196 metalc ? ? L  GLU 292 OE1 ? ? ? 1_555 IC NA  . NA ? ? L GLU 313 L NA  404 1_555 ? ? ? ? ? ? ? 2.752 ? ? 
metalc197 metalc ? ? FC MN  .   MN  ? ? ? 1_555 VE HOH . O  ? ? L MN  401 L HOH 615 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc198 metalc ? ? GC MN  .   MN  ? ? ? 1_555 VE HOH . O  ? ? L MN  402 L HOH 615 1_555 ? ? ? ? ? ? ? 2.190 ? ? 
metalc199 metalc ? ? IC NA  .   NA  ? ? ? 1_555 VE HOH . O  ? ? L NA  404 L HOH 590 1_555 ? ? ? ? ? ? ? 2.919 ? ? 
metalc200 metalc ? ? M  SER 55  OG  ? ? ? 1_555 PC NA  . NA ? ? M SER 76  M NA  403 1_555 ? ? ? ? ? ? ? 2.906 ? ? 
metalc201 metalc ? ? M  LEU 58  O   ? ? ? 1_555 PC NA  . NA ? ? M LEU 79  M NA  403 1_555 ? ? ? ? ? ? ? 2.932 ? ? 
metalc202 metalc ? ? M  HIS 140 ND1 ? ? ? 1_555 OC MN  . MN ? ? M HIS 161 M MN  402 1_555 ? ? ? ? ? ? ? 2.345 ? ? 
metalc203 metalc ? ? M  ASP 164 OD1 ? ? ? 1_555 NC MN  . MN ? ? M ASP 185 M MN  401 1_555 ? ? ? ? ? ? ? 2.058 ? ? 
metalc204 metalc ? ? M  ASP 164 OD2 ? ? ? 1_555 OC MN  . MN ? ? M ASP 185 M MN  402 1_555 ? ? ? ? ? ? ? 2.045 ? ? 
metalc205 metalc ? ? M  HIS 166 ND1 ? ? ? 1_555 NC MN  . MN ? ? M HIS 187 M MN  401 1_555 ? ? ? ? ? ? ? 2.365 ? ? 
metalc206 metalc ? ? M  ASP 168 OD2 ? ? ? 1_555 OC MN  . MN ? ? M ASP 189 M MN  402 1_555 ? ? ? ? ? ? ? 1.924 ? ? 
metalc207 metalc ? ? M  ASP 249 OD2 ? ? ? 1_555 NC MN  . MN ? ? M ASP 270 M MN  401 1_555 ? ? ? ? ? ? ? 2.317 ? ? 
metalc208 metalc ? ? M  ASP 249 OD2 ? ? ? 1_555 OC MN  . MN ? ? M ASP 270 M MN  402 1_555 ? ? ? ? ? ? ? 2.547 ? ? 
metalc209 metalc ? ? M  ASP 251 OD1 ? ? ? 1_555 NC MN  . MN ? ? M ASP 272 M MN  401 1_555 ? ? ? ? ? ? ? 2.535 ? ? 
metalc210 metalc ? ? M  ASP 251 OD2 ? ? ? 1_555 NC MN  . MN ? ? M ASP 272 M MN  401 1_555 ? ? ? ? ? ? ? 2.123 ? ? 
metalc211 metalc ? ? M  SER 262 OG  ? ? ? 1_555 PC NA  . NA ? ? M SER 283 M NA  403 1_555 ? ? ? ? ? ? ? 3.003 ? ? 
metalc212 metalc ? ? M  GLU 292 OE1 ? ? ? 1_555 PC NA  . NA ? ? M GLU 313 M NA  403 1_555 ? ? ? ? ? ? ? 2.541 ? ? 
metalc213 metalc ? ? NC MN  .   MN  ? ? ? 1_555 OC MN  . MN ? ? M MN  401 M MN  402 1_555 ? ? ? ? ? ? ? 2.978 ? ? 
metalc214 metalc ? ? NC MN  .   MN  ? ? ? 1_555 WE HOH . O  ? ? M MN  401 M HOH 504 1_555 ? ? ? ? ? ? ? 1.880 ? ? 
metalc215 metalc ? ? OC MN  .   MN  ? ? ? 1_555 WE HOH . O  ? ? M MN  402 M HOH 501 1_555 ? ? ? ? ? ? ? 2.015 ? ? 
metalc216 metalc ? ? PC NA  .   NA  ? ? ? 1_555 WE HOH . O  ? ? M NA  403 M HOH 508 1_555 ? ? ? ? ? ? ? 2.874 ? ? 
metalc217 metalc ? ? N  SER 55  OG  ? ? ? 1_555 TC NA  . NA ? ? N SER 76  N NA  404 1_555 ? ? ? ? ? ? ? 2.919 ? ? 
metalc218 metalc ? ? N  LEU 58  O   ? ? ? 1_555 TC NA  . NA ? ? N LEU 79  N NA  404 1_555 ? ? ? ? ? ? ? 2.818 ? ? 
metalc219 metalc ? ? N  HIS 140 ND1 ? ? ? 1_555 RC MN  . MN ? ? N HIS 161 N MN  402 1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc220 metalc ? ? N  ASP 164 OD1 ? ? ? 1_555 QC MN  . MN ? ? N ASP 185 N MN  401 1_555 ? ? ? ? ? ? ? 2.071 ? ? 
metalc221 metalc ? ? N  ASP 164 OD2 ? ? ? 1_555 RC MN  . MN ? ? N ASP 185 N MN  402 1_555 ? ? ? ? ? ? ? 2.116 ? ? 
metalc222 metalc ? ? N  HIS 166 ND1 ? ? ? 1_555 QC MN  . MN ? ? N HIS 187 N MN  401 1_555 ? ? ? ? ? ? ? 2.427 ? ? 
metalc223 metalc ? ? N  ASP 168 OD2 ? ? ? 1_555 RC MN  . MN ? ? N ASP 189 N MN  402 1_555 ? ? ? ? ? ? ? 1.881 ? ? 
metalc224 metalc ? ? N  ASP 249 OD2 ? ? ? 1_555 QC MN  . MN ? ? N ASP 270 N MN  401 1_555 ? ? ? ? ? ? ? 2.157 ? ? 
metalc225 metalc ? ? N  ASP 249 OD2 ? ? ? 1_555 RC MN  . MN ? ? N ASP 270 N MN  402 1_555 ? ? ? ? ? ? ? 2.625 ? ? 
metalc226 metalc ? ? N  ASP 251 OD1 ? ? ? 1_555 QC MN  . MN ? ? N ASP 272 N MN  401 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc227 metalc ? ? N  ASP 251 OD2 ? ? ? 1_555 QC MN  . MN ? ? N ASP 272 N MN  401 1_555 ? ? ? ? ? ? ? 2.135 ? ? 
metalc228 metalc ? ? N  SER 262 OG  ? ? ? 1_555 TC NA  . NA ? ? N SER 283 N NA  404 1_555 ? ? ? ? ? ? ? 2.882 ? ? 
metalc229 metalc ? ? N  GLU 292 OE1 ? ? ? 1_555 TC NA  . NA ? ? N GLU 313 N NA  404 1_555 ? ? ? ? ? ? ? 2.686 ? ? 
metalc230 metalc ? ? QC MN  .   MN  ? ? ? 1_555 XE HOH . O  ? ? N MN  401 N HOH 609 1_555 ? ? ? ? ? ? ? 1.955 ? ? 
metalc231 metalc ? ? RC MN  .   MN  ? ? ? 1_555 XE HOH . O  ? ? N MN  402 N HOH 596 1_555 ? ? ? ? ? ? ? 2.723 ? ? 
metalc232 metalc ? ? RC MN  .   MN  ? ? ? 1_555 XE HOH . O  ? ? N MN  402 N HOH 609 1_555 ? ? ? ? ? ? ? 2.350 ? ? 
metalc233 metalc ? ? TC NA  .   NA  ? ? ? 1_555 XE HOH . O  ? ? N NA  404 N HOH 594 1_555 ? ? ? ? ? ? ? 2.736 ? ? 
metalc234 metalc ? ? O  SER 55  OG  ? ? ? 1_555 WC NA  . NA ? ? O SER 76  O NA  403 1_555 ? ? ? ? ? ? ? 2.732 ? ? 
metalc235 metalc ? ? O  LEU 58  O   ? ? ? 1_555 WC NA  . NA ? ? O LEU 79  O NA  403 1_555 ? ? ? ? ? ? ? 2.803 ? ? 
metalc236 metalc ? ? O  HIS 140 ND1 ? ? ? 1_555 VC MN  . MN ? ? O HIS 161 O MN  402 1_555 ? ? ? ? ? ? ? 2.086 ? ? 
metalc237 metalc ? ? O  ASP 164 OD1 ? ? ? 1_555 UC MN  . MN ? ? O ASP 185 O MN  401 1_555 ? ? ? ? ? ? ? 1.974 ? ? 
metalc238 metalc ? ? O  ASP 164 OD2 ? ? ? 1_555 VC MN  . MN ? ? O ASP 185 O MN  402 1_555 ? ? ? ? ? ? ? 1.965 ? ? 
metalc239 metalc ? ? O  HIS 166 ND1 ? ? ? 1_555 UC MN  . MN ? ? O HIS 187 O MN  401 1_555 ? ? ? ? ? ? ? 2.656 ? ? 
metalc240 metalc ? ? O  ASP 168 OD2 ? ? ? 1_555 VC MN  . MN ? ? O ASP 189 O MN  402 1_555 ? ? ? ? ? ? ? 1.973 ? ? 
metalc241 metalc ? ? O  ASP 249 OD2 ? ? ? 1_555 UC MN  . MN ? ? O ASP 270 O MN  401 1_555 ? ? ? ? ? ? ? 2.131 ? ? 
metalc242 metalc ? ? O  ASP 249 OD2 ? ? ? 1_555 VC MN  . MN ? ? O ASP 270 O MN  402 1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc243 metalc ? ? O  ASP 251 OD1 ? ? ? 1_555 UC MN  . MN ? ? O ASP 272 O MN  401 1_555 ? ? ? ? ? ? ? 2.606 ? ? 
metalc244 metalc ? ? O  ASP 251 OD2 ? ? ? 1_555 UC MN  . MN ? ? O ASP 272 O MN  401 1_555 ? ? ? ? ? ? ? 2.360 ? ? 
metalc245 metalc ? ? O  SER 262 OG  ? ? ? 1_555 WC NA  . NA ? ? O SER 283 O NA  403 1_555 ? ? ? ? ? ? ? 2.963 ? ? 
metalc246 metalc ? ? O  GLU 292 OE1 ? ? ? 1_555 WC NA  . NA ? ? O GLU 313 O NA  403 1_555 ? ? ? ? ? ? ? 3.084 ? ? 
metalc247 metalc ? ? UC MN  .   MN  ? ? ? 1_555 YE HOH . O  ? ? O MN  401 O HOH 509 1_555 ? ? ? ? ? ? ? 2.734 ? ? 
metalc248 metalc ? ? UC MN  .   MN  ? ? ? 1_555 YE HOH . O  ? ? O MN  401 O HOH 521 1_555 ? ? ? ? ? ? ? 2.193 ? ? 
metalc249 metalc ? ? VC MN  .   MN  ? ? ? 1_555 YE HOH . O  ? ? O MN  402 O HOH 521 1_555 ? ? ? ? ? ? ? 2.193 ? ? 
metalc250 metalc ? ? WC NA  .   NA  ? ? ? 1_555 YE HOH . O  ? ? O NA  403 O HOH 532 1_555 ? ? ? ? ? ? ? 2.878 ? ? 
metalc251 metalc ? ? P  SER 55  OG  ? ? ? 1_555 AD NA  . NA ? ? P SER 76  P NA  404 1_555 ? ? ? ? ? ? ? 2.987 ? ? 
metalc252 metalc ? ? P  LEU 58  O   ? ? ? 1_555 AD NA  . NA ? ? P LEU 79  P NA  404 1_555 ? ? ? ? ? ? ? 2.715 ? ? 
metalc253 metalc ? ? P  HIS 140 ND1 ? ? ? 1_555 YC MN  . MN ? ? P HIS 161 P MN  402 1_555 ? ? ? ? ? ? ? 2.234 ? ? 
metalc254 metalc ? ? P  ASP 164 OD1 ? ? ? 1_555 XC MN  . MN ? ? P ASP 185 P MN  401 1_555 ? ? ? ? ? ? ? 2.104 ? ? 
metalc255 metalc ? ? P  ASP 164 OD2 ? ? ? 1_555 YC MN  . MN ? ? P ASP 185 P MN  402 1_555 ? ? ? ? ? ? ? 1.982 ? ? 
metalc256 metalc ? ? P  HIS 166 ND1 ? ? ? 1_555 XC MN  . MN ? ? P HIS 187 P MN  401 1_555 ? ? ? ? ? ? ? 2.266 ? ? 
metalc257 metalc ? ? P  ASP 168 OD2 ? ? ? 1_555 YC MN  . MN ? ? P ASP 189 P MN  402 1_555 ? ? ? ? ? ? ? 2.101 ? ? 
metalc258 metalc ? ? P  ASP 249 OD2 ? ? ? 1_555 XC MN  . MN ? ? P ASP 270 P MN  401 1_555 ? ? ? ? ? ? ? 2.357 ? ? 
metalc259 metalc ? ? P  ASP 249 OD2 ? ? ? 1_555 YC MN  . MN ? ? P ASP 270 P MN  402 1_555 ? ? ? ? ? ? ? 2.748 ? ? 
metalc260 metalc ? ? P  ASP 251 OD1 ? ? ? 1_555 XC MN  . MN ? ? P ASP 272 P MN  401 1_555 ? ? ? ? ? ? ? 2.347 ? ? 
metalc261 metalc ? ? P  ASP 251 OD2 ? ? ? 1_555 XC MN  . MN ? ? P ASP 272 P MN  401 1_555 ? ? ? ? ? ? ? 2.303 ? ? 
metalc262 metalc ? ? P  SER 262 OG  ? ? ? 1_555 AD NA  . NA ? ? P SER 283 P NA  404 1_555 ? ? ? ? ? ? ? 2.820 ? ? 
metalc263 metalc ? ? P  GLU 292 OE1 ? ? ? 1_555 AD NA  . NA ? ? P GLU 313 P NA  404 1_555 ? ? ? ? ? ? ? 2.826 ? ? 
metalc264 metalc ? ? XC MN  .   MN  ? ? ? 1_555 ZE HOH . O  ? ? P MN  401 P HOH 505 1_555 ? ? ? ? ? ? ? 1.914 ? ? 
metalc265 metalc ? ? YC MN  .   MN  ? ? ? 1_555 ZE HOH . O  ? ? P MN  402 P HOH 504 1_555 ? ? ? ? ? ? ? 2.115 ? ? 
metalc266 metalc ? ? YC MN  .   MN  ? ? ? 1_555 ZE HOH . O  ? ? P MN  402 P HOH 505 1_555 ? ? ? ? ? ? ? 2.494 ? ? 
metalc267 metalc ? ? AD NA  .   NA  ? ? ? 1_555 ZE HOH . O  ? ? P NA  404 P HOH 592 1_555 ? ? ? ? ? ? ? 2.627 ? ? 
metalc268 metalc ? ? Q  SER 55  OG  ? ? ? 1_555 FD NA  . NA ? ? Q SER 76  Q NA  404 1_555 ? ? ? ? ? ? ? 2.951 ? ? 
metalc269 metalc ? ? Q  LEU 58  O   ? ? ? 1_555 FD NA  . NA ? ? Q LEU 79  Q NA  404 1_555 ? ? ? ? ? ? ? 2.856 ? ? 
metalc270 metalc ? ? Q  HIS 140 ND1 ? ? ? 1_555 DD MN  . MN ? ? Q HIS 161 Q MN  402 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc271 metalc ? ? Q  ASP 164 OD1 ? ? ? 1_555 CD MN  . MN ? ? Q ASP 185 Q MN  401 1_555 ? ? ? ? ? ? ? 2.098 ? ? 
metalc272 metalc ? ? Q  ASP 164 OD2 ? ? ? 1_555 DD MN  . MN ? ? Q ASP 185 Q MN  402 1_555 ? ? ? ? ? ? ? 2.065 ? ? 
metalc273 metalc ? ? Q  HIS 166 ND1 ? ? ? 1_555 CD MN  . MN ? ? Q HIS 187 Q MN  401 1_555 ? ? ? ? ? ? ? 2.242 ? ? 
metalc274 metalc ? ? Q  ASP 168 OD2 ? ? ? 1_555 DD MN  . MN ? ? Q ASP 189 Q MN  402 1_555 ? ? ? ? ? ? ? 2.167 ? ? 
metalc275 metalc ? ? Q  ASP 249 OD2 ? ? ? 1_555 CD MN  . MN ? ? Q ASP 270 Q MN  401 1_555 ? ? ? ? ? ? ? 2.348 ? ? 
metalc276 metalc ? ? Q  ASP 249 OD2 ? ? ? 1_555 DD MN  . MN ? ? Q ASP 270 Q MN  402 1_555 ? ? ? ? ? ? ? 2.707 ? ? 
metalc277 metalc ? ? Q  ASP 251 OD1 ? ? ? 1_555 CD MN  . MN ? ? Q ASP 272 Q MN  401 1_555 ? ? ? ? ? ? ? 2.525 ? ? 
metalc278 metalc ? ? Q  ASP 251 OD2 ? ? ? 1_555 CD MN  . MN ? ? Q ASP 272 Q MN  401 1_555 ? ? ? ? ? ? ? 2.159 ? ? 
metalc279 metalc ? ? Q  SER 262 OG  ? ? ? 1_555 FD NA  . NA ? ? Q SER 283 Q NA  404 1_555 ? ? ? ? ? ? ? 2.826 ? ? 
metalc280 metalc ? ? Q  GLU 292 OE1 ? ? ? 1_555 FD NA  . NA ? ? Q GLU 313 Q NA  404 1_555 ? ? ? ? ? ? ? 2.712 ? ? 
metalc281 metalc ? ? CD MN  .   MN  ? ? ? 1_555 AF HOH . O  ? ? Q MN  401 Q HOH 627 1_555 ? ? ? ? ? ? ? 2.023 ? ? 
metalc282 metalc ? ? DD MN  .   MN  ? ? ? 1_555 AF HOH . O  ? ? Q MN  402 Q HOH 627 1_555 ? ? ? ? ? ? ? 2.185 ? ? 
metalc283 metalc ? ? DD MN  .   MN  ? ? ? 1_555 AF HOH . O  ? ? Q MN  402 Q HOH 647 1_555 ? ? ? ? ? ? ? 2.567 ? ? 
metalc284 metalc ? ? FD NA  .   NA  ? ? ? 1_555 AF HOH . O  ? ? Q NA  404 Q HOH 595 1_555 ? ? ? ? ? ? ? 2.743 ? ? 
metalc285 metalc ? ? R  SER 55  OG  ? ? ? 1_555 ID NA  . NA ? ? R SER 76  R NA  403 1_555 ? ? ? ? ? ? ? 2.788 ? ? 
metalc286 metalc ? ? R  LEU 58  O   ? ? ? 1_555 ID NA  . NA ? ? R LEU 79  R NA  403 1_555 ? ? ? ? ? ? ? 2.895 ? ? 
metalc287 metalc ? ? R  HIS 140 ND1 ? ? ? 1_555 HD MN  . MN ? ? R HIS 161 R MN  402 1_555 ? ? ? ? ? ? ? 2.211 ? ? 
metalc288 metalc ? ? R  ASP 164 OD1 ? ? ? 1_555 GD MN  . MN ? ? R ASP 185 R MN  401 1_555 ? ? ? ? ? ? ? 2.068 ? ? 
metalc289 metalc ? ? R  ASP 164 OD2 ? ? ? 1_555 HD MN  . MN ? ? R ASP 185 R MN  402 1_555 ? ? ? ? ? ? ? 2.191 ? ? 
metalc290 metalc ? ? R  HIS 166 ND1 ? ? ? 1_555 GD MN  . MN ? ? R HIS 187 R MN  401 1_555 ? ? ? ? ? ? ? 2.230 ? ? 
metalc291 metalc ? ? R  ASP 168 OD2 ? ? ? 1_555 HD MN  . MN ? ? R ASP 189 R MN  402 1_555 ? ? ? ? ? ? ? 1.977 ? ? 
metalc292 metalc ? ? R  ASP 249 OD2 ? ? ? 1_555 GD MN  . MN ? ? R ASP 270 R MN  401 1_555 ? ? ? ? ? ? ? 2.086 ? ? 
metalc293 metalc ? ? R  ASP 249 OD2 ? ? ? 1_555 HD MN  . MN ? ? R ASP 270 R MN  402 1_555 ? ? ? ? ? ? ? 2.634 ? ? 
metalc294 metalc ? ? R  ASP 251 OD1 ? ? ? 1_555 GD MN  . MN ? ? R ASP 272 R MN  401 1_555 ? ? ? ? ? ? ? 2.538 ? ? 
metalc295 metalc ? ? R  ASP 251 OD2 ? ? ? 1_555 GD MN  . MN ? ? R ASP 272 R MN  401 1_555 ? ? ? ? ? ? ? 2.201 ? ? 
metalc296 metalc ? ? R  SER 262 OG  ? ? ? 1_555 ID NA  . NA ? ? R SER 283 R NA  403 1_555 ? ? ? ? ? ? ? 2.944 ? ? 
metalc297 metalc ? ? R  GLU 292 OE1 ? ? ? 1_555 ID NA  . NA ? ? R GLU 313 R NA  403 1_555 ? ? ? ? ? ? ? 2.787 ? ? 
metalc298 metalc ? ? GD MN  .   MN  ? ? ? 1_555 BF HOH . O  ? ? R MN  401 R HOH 598 1_555 ? ? ? ? ? ? ? 2.376 ? ? 
metalc299 metalc ? ? HD MN  .   MN  ? ? ? 1_555 BF HOH . O  ? ? R MN  402 R HOH 598 1_555 ? ? ? ? ? ? ? 1.968 ? ? 
metalc300 metalc ? ? HD MN  .   MN  ? ? ? 1_555 BF HOH . O  ? ? R MN  402 R HOH 642 1_555 ? ? ? ? ? ? ? 2.723 ? ? 
metalc301 metalc ? ? ID NA  .   NA  ? ? ? 1_555 BF HOH . O  ? ? R NA  403 R HOH 587 1_555 ? ? ? ? ? ? ? 2.770 ? ? 
metalc302 metalc ? ? S  SER 55  OG  ? ? ? 1_555 ND NA  . NA ? ? S SER 76  S NA  404 1_555 ? ? ? ? ? ? ? 2.911 ? ? 
metalc303 metalc ? ? S  LEU 58  O   ? ? ? 1_555 ND NA  . NA ? ? S LEU 79  S NA  404 1_555 ? ? ? ? ? ? ? 2.982 ? ? 
metalc304 metalc ? ? S  HIS 140 ND1 ? ? ? 1_555 LD MN  . MN ? ? S HIS 161 S MN  402 1_555 ? ? ? ? ? ? ? 2.301 ? ? 
metalc305 metalc ? ? S  ASP 164 OD1 ? ? ? 1_555 KD MN  . MN ? ? S ASP 185 S MN  401 1_555 ? ? ? ? ? ? ? 2.188 ? ? 
metalc306 metalc ? ? S  ASP 164 OD2 ? ? ? 1_555 LD MN  . MN ? ? S ASP 185 S MN  402 1_555 ? ? ? ? ? ? ? 2.204 ? ? 
metalc307 metalc ? ? S  HIS 166 ND1 ? ? ? 1_555 KD MN  . MN ? ? S HIS 187 S MN  401 1_555 ? ? ? ? ? ? ? 2.254 ? ? 
metalc308 metalc ? ? S  ASP 168 OD2 ? ? ? 1_555 LD MN  . MN ? ? S ASP 189 S MN  402 1_555 ? ? ? ? ? ? ? 1.738 ? ? 
metalc309 metalc ? ? S  ASP 249 OD2 ? ? ? 1_555 KD MN  . MN ? ? S ASP 270 S MN  401 1_555 ? ? ? ? ? ? ? 2.130 ? ? 
metalc310 metalc ? ? S  ASP 249 OD2 ? ? ? 1_555 LD MN  . MN ? ? S ASP 270 S MN  402 1_555 ? ? ? ? ? ? ? 2.604 ? ? 
metalc311 metalc ? ? S  ASP 251 OD1 ? ? ? 1_555 KD MN  . MN ? ? S ASP 272 S MN  401 1_555 ? ? ? ? ? ? ? 2.403 ? ? 
metalc312 metalc ? ? S  ASP 251 OD2 ? ? ? 1_555 KD MN  . MN ? ? S ASP 272 S MN  401 1_555 ? ? ? ? ? ? ? 2.172 ? ? 
metalc313 metalc ? ? S  SER 262 OG  ? ? ? 1_555 ND NA  . NA ? ? S SER 283 S NA  404 1_555 ? ? ? ? ? ? ? 2.998 ? ? 
metalc314 metalc ? ? S  GLU 292 OE1 ? ? ? 1_555 ND NA  . NA ? ? S GLU 313 S NA  404 1_555 ? ? ? ? ? ? ? 2.717 ? ? 
metalc315 metalc ? ? KD MN  .   MN  ? ? ? 1_555 CF HOH . O  ? ? S MN  401 S HOH 515 1_555 ? ? ? ? ? ? ? 1.886 ? ? 
metalc316 metalc ? ? LD MN  .   MN  ? ? ? 1_555 CF HOH . O  ? ? S MN  402 S HOH 515 1_555 ? ? ? ? ? ? ? 2.572 ? ? 
metalc317 metalc ? ? ND NA  .   NA  ? ? ? 1_555 CF HOH . O  ? ? S NA  404 S HOH 615 1_555 ? ? ? ? ? ? ? 2.555 ? ? 
metalc318 metalc ? ? T  SER 55  OG  ? ? ? 1_555 RD NA  . NA ? ? T SER 76  T NA  403 1_555 ? ? ? ? ? ? ? 2.937 ? ? 
metalc319 metalc ? ? T  LEU 58  O   ? ? ? 1_555 RD NA  . NA ? ? T LEU 79  T NA  403 1_555 ? ? ? ? ? ? ? 2.851 ? ? 
metalc320 metalc ? ? T  HIS 140 ND1 ? ? ? 1_555 QD MN  . MN ? ? T HIS 161 T MN  402 1_555 ? ? ? ? ? ? ? 2.102 ? ? 
metalc321 metalc ? ? T  ASP 164 OD1 ? ? ? 1_555 PD MN  . MN ? ? T ASP 185 T MN  401 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc322 metalc ? ? T  ASP 164 OD2 ? ? ? 1_555 QD MN  . MN ? ? T ASP 185 T MN  402 1_555 ? ? ? ? ? ? ? 2.261 ? ? 
metalc323 metalc ? ? T  HIS 166 ND1 ? ? ? 1_555 PD MN  . MN ? ? T HIS 187 T MN  401 1_555 ? ? ? ? ? ? ? 2.207 ? ? 
metalc324 metalc ? ? T  ASP 168 OD2 ? ? ? 1_555 QD MN  . MN ? ? T ASP 189 T MN  402 1_555 ? ? ? ? ? ? ? 1.990 ? ? 
metalc325 metalc ? ? T  ASP 249 OD2 ? ? ? 1_555 PD MN  . MN ? ? T ASP 270 T MN  401 1_555 ? ? ? ? ? ? ? 1.915 ? ? 
metalc326 metalc ? ? T  ASP 249 OD2 ? ? ? 1_555 QD MN  . MN ? ? T ASP 270 T MN  402 1_555 ? ? ? ? ? ? ? 2.612 ? ? 
metalc327 metalc ? ? T  ASP 251 OD1 ? ? ? 1_555 PD MN  . MN ? ? T ASP 272 T MN  401 1_555 ? ? ? ? ? ? ? 2.622 ? ? 
metalc328 metalc ? ? T  ASP 251 OD2 ? ? ? 1_555 PD MN  . MN ? ? T ASP 272 T MN  401 1_555 ? ? ? ? ? ? ? 2.228 ? ? 
metalc329 metalc ? ? T  SER 262 OG  ? ? ? 1_555 RD NA  . NA ? ? T SER 283 T NA  403 1_555 ? ? ? ? ? ? ? 2.873 ? ? 
metalc330 metalc ? ? T  GLU 292 OE1 ? ? ? 1_555 RD NA  . NA ? ? T GLU 313 T NA  403 1_555 ? ? ? ? ? ? ? 2.842 ? ? 
metalc331 metalc ? ? PD MN  .   MN  ? ? ? 1_555 DF HOH . O  ? ? T MN  401 T HOH 603 1_555 ? ? ? ? ? ? ? 2.215 ? ? 
metalc332 metalc ? ? QD MN  .   MN  ? ? ? 1_555 DF HOH . O  ? ? T MN  402 T HOH 603 1_555 ? ? ? ? ? ? ? 2.183 ? ? 
metalc333 metalc ? ? QD MN  .   MN  ? ? ? 1_555 DF HOH . O  ? ? T MN  402 T HOH 648 1_555 ? ? ? ? ? ? ? 2.730 ? ? 
metalc334 metalc ? ? RD NA  .   NA  ? ? ? 1_555 DF HOH . O  ? ? T NA  403 T HOH 624 1_555 ? ? ? ? ? ? ? 2.618 ? ? 
metalc335 metalc ? ? U  SER 55  OG  ? ? ? 1_555 WD NA  . NA ? ? U SER 76  U NA  404 1_555 ? ? ? ? ? ? ? 2.887 ? ? 
metalc336 metalc ? ? U  LEU 58  O   ? ? ? 1_555 WD NA  . NA ? ? U LEU 79  U NA  404 1_555 ? ? ? ? ? ? ? 2.810 ? ? 
metalc337 metalc ? ? U  HIS 140 ND1 ? ? ? 1_555 UD MN  . MN ? ? U HIS 161 U MN  402 1_555 ? ? ? ? ? ? ? 2.215 ? ? 
metalc338 metalc ? ? U  ASP 164 OD1 ? ? ? 1_555 TD MN  . MN ? ? U ASP 185 U MN  401 1_555 ? ? ? ? ? ? ? 1.983 ? ? 
metalc339 metalc ? ? U  ASP 164 OD2 ? ? ? 1_555 UD MN  . MN ? ? U ASP 185 U MN  402 1_555 ? ? ? ? ? ? ? 2.213 ? ? 
metalc340 metalc ? ? U  HIS 166 ND1 ? ? ? 1_555 TD MN  . MN ? ? U HIS 187 U MN  401 1_555 ? ? ? ? ? ? ? 2.290 ? ? 
metalc341 metalc ? ? U  ASP 168 OD2 ? ? ? 1_555 UD MN  . MN ? ? U ASP 189 U MN  402 1_555 ? ? ? ? ? ? ? 1.951 ? ? 
metalc342 metalc ? ? U  ASP 249 OD2 ? ? ? 1_555 TD MN  . MN ? ? U ASP 270 U MN  401 1_555 ? ? ? ? ? ? ? 2.163 ? ? 
metalc343 metalc ? ? U  ASP 249 OD2 ? ? ? 1_555 UD MN  . MN ? ? U ASP 270 U MN  402 1_555 ? ? ? ? ? ? ? 2.498 ? ? 
metalc344 metalc ? ? U  ASP 251 OD1 ? ? ? 1_555 TD MN  . MN ? ? U ASP 272 U MN  401 1_555 ? ? ? ? ? ? ? 2.602 ? ? 
metalc345 metalc ? ? U  ASP 251 OD2 ? ? ? 1_555 TD MN  . MN ? ? U ASP 272 U MN  401 1_555 ? ? ? ? ? ? ? 2.105 ? ? 
metalc346 metalc ? ? U  SER 262 OG  ? ? ? 1_555 WD NA  . NA ? ? U SER 283 U NA  404 1_555 ? ? ? ? ? ? ? 2.737 ? ? 
metalc347 metalc ? ? U  GLU 292 OE1 ? ? ? 1_555 WD NA  . NA ? ? U GLU 313 U NA  404 1_555 ? ? ? ? ? ? ? 2.728 ? ? 
metalc348 metalc ? ? TD MN  .   MN  ? ? ? 1_555 EF HOH . O  ? ? U MN  401 U HOH 527 1_555 ? ? ? ? ? ? ? 2.228 ? ? 
metalc349 metalc ? ? UD MN  .   MN  ? ? ? 1_555 EF HOH . O  ? ? U MN  402 U HOH 527 1_555 ? ? ? ? ? ? ? 1.943 ? ? 
metalc350 metalc ? ? WD NA  .   NA  ? ? ? 1_555 EF HOH . O  ? ? U NA  404 U HOH 605 1_555 ? ? ? ? ? ? ? 2.767 ? ? 
metalc351 metalc ? ? V  SER 55  OG  ? ? ? 1_555 AE NA  . NA ? ? V SER 76  V NA  403 1_555 ? ? ? ? ? ? ? 2.939 ? ? 
metalc352 metalc ? ? V  LEU 58  O   ? ? ? 1_555 AE NA  . NA ? ? V LEU 79  V NA  403 1_555 ? ? ? ? ? ? ? 2.755 ? ? 
metalc353 metalc ? ? V  HIS 140 ND1 ? ? ? 1_555 ZD MN  . MN ? ? V HIS 161 V MN  402 1_555 ? ? ? ? ? ? ? 2.178 ? ? 
metalc354 metalc ? ? V  ASP 164 OD1 ? ? ? 1_555 YD MN  . MN ? ? V ASP 185 V MN  401 1_555 ? ? ? ? ? ? ? 2.188 ? ? 
metalc355 metalc ? ? V  ASP 164 OD2 ? ? ? 1_555 ZD MN  . MN ? ? V ASP 185 V MN  402 1_555 ? ? ? ? ? ? ? 2.326 ? ? 
metalc356 metalc ? ? V  HIS 166 ND1 ? ? ? 1_555 YD MN  . MN ? ? V HIS 187 V MN  401 1_555 ? ? ? ? ? ? ? 2.282 ? ? 
metalc357 metalc ? ? V  ASP 168 OD2 ? ? ? 1_555 ZD MN  . MN ? ? V ASP 189 V MN  402 1_555 ? ? ? ? ? ? ? 2.225 ? ? 
metalc358 metalc ? ? V  ASP 249 OD2 ? ? ? 1_555 YD MN  . MN ? ? V ASP 270 V MN  401 1_555 ? ? ? ? ? ? ? 2.282 ? ? 
metalc359 metalc ? ? V  ASP 249 OD2 ? ? ? 1_555 ZD MN  . MN ? ? V ASP 270 V MN  402 1_555 ? ? ? ? ? ? ? 2.665 ? ? 
metalc360 metalc ? ? V  ASP 251 OD1 ? ? ? 1_555 YD MN  . MN ? ? V ASP 272 V MN  401 1_555 ? ? ? ? ? ? ? 2.757 ? ? 
metalc361 metalc ? ? V  ASP 251 OD2 ? ? ? 1_555 YD MN  . MN ? ? V ASP 272 V MN  401 1_555 ? ? ? ? ? ? ? 2.079 ? ? 
metalc362 metalc ? ? V  SER 262 OG  ? ? ? 1_555 AE NA  . NA ? ? V SER 283 V NA  403 1_555 ? ? ? ? ? ? ? 2.990 ? ? 
metalc363 metalc ? ? V  GLU 292 OE1 ? ? ? 1_555 AE NA  . NA ? ? V GLU 313 V NA  403 1_555 ? ? ? ? ? ? ? 2.747 ? ? 
metalc364 metalc ? ? YD MN  .   MN  ? ? ? 1_555 FF HOH . O  ? ? V MN  401 V HOH 504 1_555 ? ? ? ? ? ? ? 2.127 ? ? 
metalc365 metalc ? ? ZD MN  .   MN  ? ? ? 1_555 FF HOH . O  ? ? V MN  402 V HOH 504 1_555 ? ? ? ? ? ? ? 2.370 ? ? 
metalc366 metalc ? ? ZD MN  .   MN  ? ? ? 1_555 FF HOH . O  ? ? V MN  402 V HOH 515 1_555 ? ? ? ? ? ? ? 2.564 ? ? 
metalc367 metalc ? ? AE NA  .   NA  ? ? ? 1_555 FF HOH . O  ? ? V NA  403 V HOH 522 1_555 ? ? ? ? ? ? ? 2.595 ? ? 
metalc368 metalc ? ? W  SER 55  OG  ? ? ? 1_555 FE NA  . NA ? ? W SER 76  W NA  404 1_555 ? ? ? ? ? ? ? 2.789 ? ? 
metalc369 metalc ? ? W  LEU 58  O   ? ? ? 1_555 FE NA  . NA ? ? W LEU 79  W NA  404 1_555 ? ? ? ? ? ? ? 2.859 ? ? 
metalc370 metalc ? ? W  HIS 140 ND1 ? ? ? 1_555 DE MN  . MN ? ? W HIS 161 W MN  402 1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc371 metalc ? ? W  ASP 164 OD1 ? ? ? 1_555 CE MN  . MN ? ? W ASP 185 W MN  401 1_555 ? ? ? ? ? ? ? 2.262 ? ? 
metalc372 metalc ? ? W  ASP 164 OD2 ? ? ? 1_555 DE MN  . MN ? ? W ASP 185 W MN  402 1_555 ? ? ? ? ? ? ? 2.261 ? ? 
metalc373 metalc ? ? W  HIS 166 ND1 ? ? ? 1_555 CE MN  . MN ? ? W HIS 187 W MN  401 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc374 metalc ? ? W  ASP 168 OD2 ? ? ? 1_555 DE MN  . MN ? ? W ASP 189 W MN  402 1_555 ? ? ? ? ? ? ? 2.107 ? ? 
metalc375 metalc ? ? W  ASP 249 OD2 ? ? ? 1_555 CE MN  . MN ? ? W ASP 270 W MN  401 1_555 ? ? ? ? ? ? ? 2.075 ? ? 
metalc376 metalc ? ? W  ASP 249 OD2 ? ? ? 1_555 DE MN  . MN ? ? W ASP 270 W MN  402 1_555 ? ? ? ? ? ? ? 2.269 ? ? 
metalc377 metalc ? ? W  ASP 251 OD2 ? ? ? 1_555 CE MN  . MN ? ? W ASP 272 W MN  401 1_555 ? ? ? ? ? ? ? 2.084 ? ? 
metalc378 metalc ? ? W  SER 262 OG  ? ? ? 1_555 FE NA  . NA ? ? W SER 283 W NA  404 1_555 ? ? ? ? ? ? ? 2.825 ? ? 
metalc379 metalc ? ? W  GLU 292 OE1 ? ? ? 1_555 FE NA  . NA ? ? W GLU 313 W NA  404 1_555 ? ? ? ? ? ? ? 2.708 ? ? 
metalc380 metalc ? ? CE MN  .   MN  ? ? ? 1_555 DE MN  . MN ? ? W MN  401 W MN  402 1_555 ? ? ? ? ? ? ? 2.917 ? ? 
metalc381 metalc ? ? CE MN  .   MN  ? ? ? 1_555 GF HOH . O  ? ? W MN  401 W HOH 556 1_555 ? ? ? ? ? ? ? 1.976 ? ? 
metalc382 metalc ? ? DE MN  .   MN  ? ? ? 1_555 GF HOH . O  ? ? W MN  402 W HOH 556 1_555 ? ? ? ? ? ? ? 2.416 ? ? 
metalc383 metalc ? ? DE MN  .   MN  ? ? ? 1_555 GF HOH . O  ? ? W MN  402 W HOH 577 1_555 ? ? ? ? ? ? ? 2.572 ? ? 
metalc384 metalc ? ? FE NA  .   NA  ? ? ? 1_555 GF HOH . O  ? ? W NA  404 W HOH 551 1_555 ? ? ? ? ? ? ? 3.067 ? ? 
metalc385 metalc ? ? X  SER 55  OG  ? ? ? 1_555 JE NA  . NA ? ? X SER 76  X NA  403 1_555 ? ? ? ? ? ? ? 2.855 ? ? 
metalc386 metalc ? ? X  LEU 58  O   ? ? ? 1_555 JE NA  . NA ? ? X LEU 79  X NA  403 1_555 ? ? ? ? ? ? ? 3.013 ? ? 
metalc387 metalc ? ? X  HIS 140 ND1 ? ? ? 1_555 IE MN  . MN ? ? X HIS 161 X MN  402 1_555 ? ? ? ? ? ? ? 2.161 ? ? 
metalc388 metalc ? ? X  ASP 164 OD1 ? ? ? 1_555 HE MN  . MN ? ? X ASP 185 X MN  401 1_555 ? ? ? ? ? ? ? 2.304 ? ? 
metalc389 metalc ? ? X  ASP 164 OD2 ? ? ? 1_555 IE MN  . MN ? ? X ASP 185 X MN  402 1_555 ? ? ? ? ? ? ? 2.212 ? ? 
metalc390 metalc ? ? X  HIS 166 ND1 ? ? ? 1_555 HE MN  . MN ? ? X HIS 187 X MN  401 1_555 ? ? ? ? ? ? ? 2.142 ? ? 
metalc391 metalc ? ? X  ASP 168 OD2 ? ? ? 1_555 IE MN  . MN ? ? X ASP 189 X MN  402 1_555 ? ? ? ? ? ? ? 1.873 ? ? 
metalc392 metalc ? ? X  ASP 249 OD2 ? ? ? 1_555 HE MN  . MN ? ? X ASP 270 X MN  401 1_555 ? ? ? ? ? ? ? 2.266 ? ? 
metalc393 metalc ? ? X  ASP 249 OD2 ? ? ? 1_555 IE MN  . MN ? ? X ASP 270 X MN  402 1_555 ? ? ? ? ? ? ? 2.598 ? ? 
metalc394 metalc ? ? X  ASP 251 OD1 ? ? ? 1_555 HE MN  . MN ? ? X ASP 272 X MN  401 1_555 ? ? ? ? ? ? ? 2.504 ? ? 
metalc395 metalc ? ? X  ASP 251 OD2 ? ? ? 1_555 HE MN  . MN ? ? X ASP 272 X MN  401 1_555 ? ? ? ? ? ? ? 2.097 ? ? 
metalc396 metalc ? ? X  SER 262 OG  ? ? ? 1_555 JE NA  . NA ? ? X SER 283 X NA  403 1_555 ? ? ? ? ? ? ? 3.010 ? ? 
metalc397 metalc ? ? X  GLU 292 OE1 ? ? ? 1_555 JE NA  . NA ? ? X GLU 313 X NA  403 1_555 ? ? ? ? ? ? ? 2.730 ? ? 
metalc398 metalc ? ? HE MN  .   MN  ? ? ? 1_555 HF HOH . O  ? ? X MN  401 X HOH 511 1_555 ? ? ? ? ? ? ? 1.727 ? ? 
metalc399 metalc ? ? IE MN  .   MN  ? ? ? 1_555 HF HOH . O  ? ? X MN  402 X HOH 511 1_555 ? ? ? ? ? ? ? 2.057 ? ? 
metalc400 metalc ? ? JE NA  .   NA  ? ? ? 1_555 HF HOH . O  ? ? X NA  403 X HOH 582 1_555 ? ? ? ? ? ? ? 2.823 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLU 129 A . ? GLU 150 A PRO 130 A ? PRO 151 A 1 -9.49 
2  GLY 137 A . ? GLY 158 A GLY 138 A ? GLY 159 A 1 -0.87 
3  GLU 129 B . ? GLU 150 B PRO 130 B ? PRO 151 B 1 -1.59 
4  GLY 137 B . ? GLY 158 B GLY 138 B ? GLY 159 B 1 3.28  
5  GLU 129 C . ? GLU 150 C PRO 130 C ? PRO 151 C 1 -4.11 
6  GLY 137 C . ? GLY 158 C GLY 138 C ? GLY 159 C 1 0.97  
7  GLU 129 D . ? GLU 150 D PRO 130 D ? PRO 151 D 1 -0.67 
8  GLY 137 D . ? GLY 158 D GLY 138 D ? GLY 159 D 1 0.64  
9  GLU 129 E . ? GLU 150 E PRO 130 E ? PRO 151 E 1 -5.86 
10 GLY 137 E . ? GLY 158 E GLY 138 E ? GLY 159 E 1 3.05  
11 GLU 129 F . ? GLU 150 F PRO 130 F ? PRO 151 F 1 -8.01 
12 GLY 137 F . ? GLY 158 F GLY 138 F ? GLY 159 F 1 3.84  
13 GLU 129 G . ? GLU 150 G PRO 130 G ? PRO 151 G 1 0.78  
14 GLY 137 G . ? GLY 158 G GLY 138 G ? GLY 159 G 1 1.15  
15 GLU 129 H . ? GLU 150 H PRO 130 H ? PRO 151 H 1 -8.15 
16 GLY 137 H . ? GLY 158 H GLY 138 H ? GLY 159 H 1 -6.15 
17 GLU 129 I . ? GLU 150 I PRO 130 I ? PRO 151 I 1 -7.67 
18 GLY 137 I . ? GLY 158 I GLY 138 I ? GLY 159 I 1 1.24  
19 GLU 129 J . ? GLU 150 J PRO 130 J ? PRO 151 J 1 -3.95 
20 GLY 137 J . ? GLY 158 J GLY 138 J ? GLY 159 J 1 5.19  
21 GLU 129 K . ? GLU 150 K PRO 130 K ? PRO 151 K 1 -8.55 
22 GLY 137 K . ? GLY 158 K GLY 138 K ? GLY 159 K 1 -3.35 
23 GLU 129 L . ? GLU 150 L PRO 130 L ? PRO 151 L 1 -6.57 
24 GLY 137 L . ? GLY 158 L GLY 138 L ? GLY 159 L 1 14.02 
25 GLU 129 M . ? GLU 150 M PRO 130 M ? PRO 151 M 1 -7.33 
26 GLY 137 M . ? GLY 158 M GLY 138 M ? GLY 159 M 1 2.08  
27 GLU 129 N . ? GLU 150 N PRO 130 N ? PRO 151 N 1 0.23  
28 GLY 137 N . ? GLY 158 N GLY 138 N ? GLY 159 N 1 3.03  
29 GLU 129 O . ? GLU 150 O PRO 130 O ? PRO 151 O 1 -5.07 
30 GLY 137 O . ? GLY 158 O GLY 138 O ? GLY 159 O 1 6.46  
31 GLU 129 P . ? GLU 150 P PRO 130 P ? PRO 151 P 1 8.00  
32 GLY 137 P . ? GLY 158 P GLY 138 P ? GLY 159 P 1 -3.75 
33 GLU 129 Q . ? GLU 150 Q PRO 130 Q ? PRO 151 Q 1 -0.82 
34 GLY 137 Q . ? GLY 158 Q GLY 138 Q ? GLY 159 Q 1 0.75  
35 GLU 129 R . ? GLU 150 R PRO 130 R ? PRO 151 R 1 6.55  
36 GLY 137 R . ? GLY 158 R GLY 138 R ? GLY 159 R 1 6.18  
37 GLU 129 S . ? GLU 150 S PRO 130 S ? PRO 151 S 1 -4.38 
38 GLY 137 S . ? GLY 158 S GLY 138 S ? GLY 159 S 1 2.76  
39 GLU 129 T . ? GLU 150 T PRO 130 T ? PRO 151 T 1 -9.15 
40 GLY 137 T . ? GLY 158 T GLY 138 T ? GLY 159 T 1 -4.28 
41 GLU 129 U . ? GLU 150 U PRO 130 U ? PRO 151 U 1 -5.45 
42 GLY 137 U . ? GLY 158 U GLY 138 U ? GLY 159 U 1 -5.53 
43 GLU 129 V . ? GLU 150 V PRO 130 V ? PRO 151 V 1 -5.07 
44 GLY 137 V . ? GLY 158 V GLY 138 V ? GLY 159 V 1 -6.35 
45 GLU 129 W . ? GLU 150 W PRO 130 W ? PRO 151 W 1 -7.82 
46 GLY 137 W . ? GLY 158 W GLY 138 W ? GLY 159 W 1 3.12  
47 GLU 129 X . ? GLU 150 X PRO 130 X ? PRO 151 X 1 -5.17 
48 GLY 137 X . ? GLY 158 X GLY 138 X ? GLY 159 X 1 4.09  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 8 ? 
AA3 ? 8 ? 
AA4 ? 8 ? 
AA5 ? 8 ? 
AA6 ? 8 ? 
AA7 ? 8 ? 
AA8 ? 8 ? 
AA9 ? 8 ? 
AB1 ? 8 ? 
AB2 ? 8 ? 
AB3 ? 8 ? 
AB4 ? 8 ? 
AB5 ? 8 ? 
AB6 ? 8 ? 
AB7 ? 8 ? 
AB8 ? 8 ? 
AB9 ? 8 ? 
AC1 ? 8 ? 
AC2 ? 8 ? 
AC3 ? 8 ? 
AC4 ? 8 ? 
AC5 ? 8 ? 
AC6 ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA1 2 3 ? parallel 
AA1 3 4 ? parallel 
AA1 4 5 ? parallel 
AA1 5 6 ? parallel 
AA1 6 7 ? parallel 
AA1 7 8 ? parallel 
AA2 1 2 ? parallel 
AA2 2 3 ? parallel 
AA2 3 4 ? parallel 
AA2 4 5 ? parallel 
AA2 5 6 ? parallel 
AA2 6 7 ? parallel 
AA2 7 8 ? parallel 
AA3 1 2 ? parallel 
AA3 2 3 ? parallel 
AA3 3 4 ? parallel 
AA3 4 5 ? parallel 
AA3 5 6 ? parallel 
AA3 6 7 ? parallel 
AA3 7 8 ? parallel 
AA4 1 2 ? parallel 
AA4 2 3 ? parallel 
AA4 3 4 ? parallel 
AA4 4 5 ? parallel 
AA4 5 6 ? parallel 
AA4 6 7 ? parallel 
AA4 7 8 ? parallel 
AA5 1 2 ? parallel 
AA5 2 3 ? parallel 
AA5 3 4 ? parallel 
AA5 4 5 ? parallel 
AA5 5 6 ? parallel 
AA5 6 7 ? parallel 
AA5 7 8 ? parallel 
AA6 1 2 ? parallel 
AA6 2 3 ? parallel 
AA6 3 4 ? parallel 
AA6 4 5 ? parallel 
AA6 5 6 ? parallel 
AA6 6 7 ? parallel 
AA6 7 8 ? parallel 
AA7 1 2 ? parallel 
AA7 2 3 ? parallel 
AA7 3 4 ? parallel 
AA7 4 5 ? parallel 
AA7 5 6 ? parallel 
AA7 6 7 ? parallel 
AA7 7 8 ? parallel 
AA8 1 2 ? parallel 
AA8 2 3 ? parallel 
AA8 3 4 ? parallel 
AA8 4 5 ? parallel 
AA8 5 6 ? parallel 
AA8 6 7 ? parallel 
AA8 7 8 ? parallel 
AA9 1 2 ? parallel 
AA9 2 3 ? parallel 
AA9 3 4 ? parallel 
AA9 4 5 ? parallel 
AA9 5 6 ? parallel 
AA9 6 7 ? parallel 
AA9 7 8 ? parallel 
AB1 1 2 ? parallel 
AB1 2 3 ? parallel 
AB1 3 4 ? parallel 
AB1 4 5 ? parallel 
AB1 5 6 ? parallel 
AB1 6 7 ? parallel 
AB1 7 8 ? parallel 
AB2 1 2 ? parallel 
AB2 2 3 ? parallel 
AB2 3 4 ? parallel 
AB2 4 5 ? parallel 
AB2 5 6 ? parallel 
AB2 6 7 ? parallel 
AB2 7 8 ? parallel 
AB3 1 2 ? parallel 
AB3 2 3 ? parallel 
AB3 3 4 ? parallel 
AB3 4 5 ? parallel 
AB3 5 6 ? parallel 
AB3 6 7 ? parallel 
AB3 7 8 ? parallel 
AB4 1 2 ? parallel 
AB4 2 3 ? parallel 
AB4 3 4 ? parallel 
AB4 4 5 ? parallel 
AB4 5 6 ? parallel 
AB4 6 7 ? parallel 
AB4 7 8 ? parallel 
AB5 1 2 ? parallel 
AB5 2 3 ? parallel 
AB5 3 4 ? parallel 
AB5 4 5 ? parallel 
AB5 5 6 ? parallel 
AB5 6 7 ? parallel 
AB5 7 8 ? parallel 
AB6 1 2 ? parallel 
AB6 2 3 ? parallel 
AB6 3 4 ? parallel 
AB6 4 5 ? parallel 
AB6 5 6 ? parallel 
AB6 6 7 ? parallel 
AB6 7 8 ? parallel 
AB7 1 2 ? parallel 
AB7 2 3 ? parallel 
AB7 3 4 ? parallel 
AB7 4 5 ? parallel 
AB7 5 6 ? parallel 
AB7 6 7 ? parallel 
AB7 7 8 ? parallel 
AB8 1 2 ? parallel 
AB8 2 3 ? parallel 
AB8 3 4 ? parallel 
AB8 4 5 ? parallel 
AB8 5 6 ? parallel 
AB8 6 7 ? parallel 
AB8 7 8 ? parallel 
AB9 1 2 ? parallel 
AB9 2 3 ? parallel 
AB9 3 4 ? parallel 
AB9 4 5 ? parallel 
AB9 5 6 ? parallel 
AB9 6 7 ? parallel 
AB9 7 8 ? parallel 
AC1 1 2 ? parallel 
AC1 2 3 ? parallel 
AC1 3 4 ? parallel 
AC1 4 5 ? parallel 
AC1 5 6 ? parallel 
AC1 6 7 ? parallel 
AC1 7 8 ? parallel 
AC2 1 2 ? parallel 
AC2 2 3 ? parallel 
AC2 3 4 ? parallel 
AC2 4 5 ? parallel 
AC2 5 6 ? parallel 
AC2 6 7 ? parallel 
AC2 7 8 ? parallel 
AC3 1 2 ? parallel 
AC3 2 3 ? parallel 
AC3 3 4 ? parallel 
AC3 4 5 ? parallel 
AC3 5 6 ? parallel 
AC3 6 7 ? parallel 
AC3 7 8 ? parallel 
AC4 1 2 ? parallel 
AC4 2 3 ? parallel 
AC4 3 4 ? parallel 
AC4 4 5 ? parallel 
AC4 5 6 ? parallel 
AC4 6 7 ? parallel 
AC4 7 8 ? parallel 
AC5 1 2 ? parallel 
AC5 2 3 ? parallel 
AC5 3 4 ? parallel 
AC5 4 5 ? parallel 
AC5 5 6 ? parallel 
AC5 6 7 ? parallel 
AC5 7 8 ? parallel 
AC6 1 2 ? parallel 
AC6 2 3 ? parallel 
AC6 3 4 ? parallel 
AC6 4 5 ? parallel 
AC6 5 6 ? parallel 
AC6 6 7 ? parallel 
AC6 7 8 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 93  ? ASP A 98  ? LEU A 114 ASP A 119 
AA1 2 SER A 43  ? VAL A 49  ? SER A 64  VAL A 70  
AA1 3 LEU A 131 ? GLY A 137 ? LEU A 152 GLY A 158 
AA1 4 VAL A 285 ? VAL A 291 ? VAL A 306 VAL A 312 
AA1 5 VAL A 244 ? ASP A 249 ? VAL A 265 ASP A 270 
AA1 6 VAL A 158 ? LEU A 163 ? VAL A 179 LEU A 184 
AA1 7 ALA A 193 ? ILE A 201 ? ALA A 214 ILE A 222 
AA1 8 GLU A 218 ? GLU A 221 ? GLU A 239 GLU A 242 
AA2 1 LEU B 93  ? ASP B 98  ? LEU B 114 ASP B 119 
AA2 2 SER B 43  ? VAL B 49  ? SER B 64  VAL B 70  
AA2 3 LEU B 131 ? GLY B 137 ? LEU B 152 GLY B 158 
AA2 4 VAL B 285 ? VAL B 291 ? VAL B 306 VAL B 312 
AA2 5 VAL B 244 ? ASP B 249 ? VAL B 265 ASP B 270 
AA2 6 VAL B 158 ? LEU B 163 ? VAL B 179 LEU B 184 
AA2 7 ALA B 193 ? ILE B 201 ? ALA B 214 ILE B 222 
AA2 8 GLU B 218 ? GLU B 221 ? GLU B 239 GLU B 242 
AA3 1 LEU C 93  ? ASP C 98  ? LEU C 114 ASP C 119 
AA3 2 SER C 43  ? VAL C 49  ? SER C 64  VAL C 70  
AA3 3 LEU C 131 ? GLY C 137 ? LEU C 152 GLY C 158 
AA3 4 VAL C 285 ? VAL C 291 ? VAL C 306 VAL C 312 
AA3 5 VAL C 244 ? ASP C 249 ? VAL C 265 ASP C 270 
AA3 6 VAL C 158 ? LEU C 163 ? VAL C 179 LEU C 184 
AA3 7 ALA C 193 ? ILE C 201 ? ALA C 214 ILE C 222 
AA3 8 GLU C 218 ? GLU C 221 ? GLU C 239 GLU C 242 
AA4 1 LEU D 93  ? ASP D 98  ? LEU D 114 ASP D 119 
AA4 2 SER D 43  ? VAL D 49  ? SER D 64  VAL D 70  
AA4 3 LEU D 131 ? GLY D 137 ? LEU D 152 GLY D 158 
AA4 4 VAL D 285 ? VAL D 291 ? VAL D 306 VAL D 312 
AA4 5 VAL D 244 ? ASP D 249 ? VAL D 265 ASP D 270 
AA4 6 VAL D 158 ? LEU D 163 ? VAL D 179 LEU D 184 
AA4 7 ALA D 193 ? ILE D 201 ? ALA D 214 ILE D 222 
AA4 8 GLU D 218 ? GLU D 221 ? GLU D 239 GLU D 242 
AA5 1 LEU E 93  ? ASP E 98  ? LEU E 114 ASP E 119 
AA5 2 SER E 43  ? GLY E 48  ? SER E 64  GLY E 69  
AA5 3 LEU E 131 ? LEU E 136 ? LEU E 152 LEU E 157 
AA5 4 VAL E 285 ? VAL E 291 ? VAL E 306 VAL E 312 
AA5 5 VAL E 244 ? ASP E 249 ? VAL E 265 ASP E 270 
AA5 6 VAL E 158 ? LEU E 163 ? VAL E 179 LEU E 184 
AA5 7 ALA E 193 ? ILE E 201 ? ALA E 214 ILE E 222 
AA5 8 GLU E 218 ? GLU E 221 ? GLU E 239 GLU E 242 
AA6 1 LEU F 93  ? ASP F 98  ? LEU F 114 ASP F 119 
AA6 2 SER F 43  ? GLY F 48  ? SER F 64  GLY F 69  
AA6 3 LEU F 131 ? LEU F 136 ? LEU F 152 LEU F 157 
AA6 4 VAL F 285 ? VAL F 291 ? VAL F 306 VAL F 312 
AA6 5 VAL F 244 ? ASP F 249 ? VAL F 265 ASP F 270 
AA6 6 VAL F 158 ? LEU F 163 ? VAL F 179 LEU F 184 
AA6 7 ALA F 193 ? ILE F 201 ? ALA F 214 ILE F 222 
AA6 8 GLU F 218 ? GLU F 221 ? GLU F 239 GLU F 242 
AA7 1 LEU G 93  ? ASP G 98  ? LEU G 114 ASP G 119 
AA7 2 SER G 43  ? GLY G 48  ? SER G 64  GLY G 69  
AA7 3 LEU G 131 ? LEU G 136 ? LEU G 152 LEU G 157 
AA7 4 VAL G 285 ? VAL G 291 ? VAL G 306 VAL G 312 
AA7 5 VAL G 244 ? ASP G 249 ? VAL G 265 ASP G 270 
AA7 6 VAL G 158 ? LEU G 163 ? VAL G 179 LEU G 184 
AA7 7 ALA G 193 ? ILE G 201 ? ALA G 214 ILE G 222 
AA7 8 GLU G 218 ? GLU G 221 ? GLU G 239 GLU G 242 
AA8 1 LEU H 93  ? ASP H 98  ? LEU H 114 ASP H 119 
AA8 2 SER H 43  ? GLY H 48  ? SER H 64  GLY H 69  
AA8 3 LEU H 131 ? LEU H 136 ? LEU H 152 LEU H 157 
AA8 4 VAL H 285 ? VAL H 291 ? VAL H 306 VAL H 312 
AA8 5 VAL H 244 ? ASP H 249 ? VAL H 265 ASP H 270 
AA8 6 VAL H 158 ? LEU H 163 ? VAL H 179 LEU H 184 
AA8 7 ALA H 193 ? ILE H 201 ? ALA H 214 ILE H 222 
AA8 8 GLU H 218 ? GLU H 221 ? GLU H 239 GLU H 242 
AA9 1 LEU I 93  ? ASP I 98  ? LEU I 114 ASP I 119 
AA9 2 SER I 43  ? VAL I 49  ? SER I 64  VAL I 70  
AA9 3 LEU I 131 ? GLY I 137 ? LEU I 152 GLY I 158 
AA9 4 VAL I 285 ? VAL I 291 ? VAL I 306 VAL I 312 
AA9 5 VAL I 244 ? ASP I 249 ? VAL I 265 ASP I 270 
AA9 6 VAL I 158 ? LEU I 163 ? VAL I 179 LEU I 184 
AA9 7 ALA I 193 ? ILE I 201 ? ALA I 214 ILE I 222 
AA9 8 GLU I 218 ? GLU I 221 ? GLU I 239 GLU I 242 
AB1 1 LEU J 93  ? ASP J 98  ? LEU J 114 ASP J 119 
AB1 2 SER J 43  ? VAL J 49  ? SER J 64  VAL J 70  
AB1 3 LEU J 131 ? GLY J 137 ? LEU J 152 GLY J 158 
AB1 4 VAL J 285 ? VAL J 291 ? VAL J 306 VAL J 312 
AB1 5 VAL J 244 ? ASP J 249 ? VAL J 265 ASP J 270 
AB1 6 VAL J 158 ? LEU J 163 ? VAL J 179 LEU J 184 
AB1 7 ALA J 193 ? ILE J 201 ? ALA J 214 ILE J 222 
AB1 8 GLU J 218 ? GLU J 221 ? GLU J 239 GLU J 242 
AB2 1 LEU K 93  ? ASP K 98  ? LEU K 114 ASP K 119 
AB2 2 SER K 43  ? GLY K 48  ? SER K 64  GLY K 69  
AB2 3 LEU K 131 ? LEU K 136 ? LEU K 152 LEU K 157 
AB2 4 VAL K 285 ? VAL K 291 ? VAL K 306 VAL K 312 
AB2 5 VAL K 244 ? ASP K 249 ? VAL K 265 ASP K 270 
AB2 6 VAL K 158 ? LEU K 163 ? VAL K 179 LEU K 184 
AB2 7 ALA K 193 ? ILE K 201 ? ALA K 214 ILE K 222 
AB2 8 GLU K 218 ? GLU K 221 ? GLU K 239 GLU K 242 
AB3 1 LEU L 93  ? ASP L 98  ? LEU L 114 ASP L 119 
AB3 2 SER L 43  ? VAL L 49  ? SER L 64  VAL L 70  
AB3 3 LEU L 131 ? GLY L 137 ? LEU L 152 GLY L 158 
AB3 4 VAL L 285 ? VAL L 291 ? VAL L 306 VAL L 312 
AB3 5 VAL L 244 ? ASP L 249 ? VAL L 265 ASP L 270 
AB3 6 VAL L 158 ? LEU L 163 ? VAL L 179 LEU L 184 
AB3 7 ALA L 193 ? ILE L 201 ? ALA L 214 ILE L 222 
AB3 8 GLU L 218 ? GLU L 221 ? GLU L 239 GLU L 242 
AB4 1 LEU M 93  ? ASP M 98  ? LEU M 114 ASP M 119 
AB4 2 SER M 43  ? GLY M 48  ? SER M 64  GLY M 69  
AB4 3 LEU M 131 ? LEU M 136 ? LEU M 152 LEU M 157 
AB4 4 VAL M 285 ? VAL M 291 ? VAL M 306 VAL M 312 
AB4 5 VAL M 244 ? ASP M 249 ? VAL M 265 ASP M 270 
AB4 6 VAL M 158 ? LEU M 163 ? VAL M 179 LEU M 184 
AB4 7 ALA M 193 ? ILE M 201 ? ALA M 214 ILE M 222 
AB4 8 GLU M 218 ? GLU M 221 ? GLU M 239 GLU M 242 
AB5 1 LEU N 93  ? ASP N 98  ? LEU N 114 ASP N 119 
AB5 2 SER N 43  ? VAL N 49  ? SER N 64  VAL N 70  
AB5 3 LEU N 131 ? GLY N 137 ? LEU N 152 GLY N 158 
AB5 4 VAL N 285 ? VAL N 291 ? VAL N 306 VAL N 312 
AB5 5 VAL N 244 ? ASP N 249 ? VAL N 265 ASP N 270 
AB5 6 VAL N 158 ? LEU N 163 ? VAL N 179 LEU N 184 
AB5 7 ALA N 193 ? ILE N 201 ? ALA N 214 ILE N 222 
AB5 8 GLU N 218 ? GLU N 221 ? GLU N 239 GLU N 242 
AB6 1 LEU O 93  ? ASP O 98  ? LEU O 114 ASP O 119 
AB6 2 SER O 43  ? VAL O 49  ? SER O 64  VAL O 70  
AB6 3 LEU O 131 ? GLY O 137 ? LEU O 152 GLY O 158 
AB6 4 VAL O 285 ? VAL O 291 ? VAL O 306 VAL O 312 
AB6 5 VAL O 244 ? ASP O 249 ? VAL O 265 ASP O 270 
AB6 6 VAL O 158 ? LEU O 163 ? VAL O 179 LEU O 184 
AB6 7 ALA O 193 ? ILE O 201 ? ALA O 214 ILE O 222 
AB6 8 GLU O 218 ? GLU O 221 ? GLU O 239 GLU O 242 
AB7 1 LEU P 93  ? ASP P 98  ? LEU P 114 ASP P 119 
AB7 2 SER P 43  ? GLY P 48  ? SER P 64  GLY P 69  
AB7 3 LEU P 131 ? LEU P 136 ? LEU P 152 LEU P 157 
AB7 4 VAL P 285 ? VAL P 291 ? VAL P 306 VAL P 312 
AB7 5 VAL P 244 ? ASP P 249 ? VAL P 265 ASP P 270 
AB7 6 VAL P 158 ? LEU P 163 ? VAL P 179 LEU P 184 
AB7 7 ALA P 193 ? ILE P 201 ? ALA P 214 ILE P 222 
AB7 8 GLU P 218 ? GLU P 221 ? GLU P 239 GLU P 242 
AB8 1 LEU Q 93  ? ASP Q 98  ? LEU Q 114 ASP Q 119 
AB8 2 SER Q 43  ? GLY Q 48  ? SER Q 64  GLY Q 69  
AB8 3 LEU Q 131 ? LEU Q 136 ? LEU Q 152 LEU Q 157 
AB8 4 VAL Q 285 ? VAL Q 291 ? VAL Q 306 VAL Q 312 
AB8 5 VAL Q 244 ? ASP Q 249 ? VAL Q 265 ASP Q 270 
AB8 6 VAL Q 158 ? LEU Q 163 ? VAL Q 179 LEU Q 184 
AB8 7 ALA Q 193 ? ILE Q 201 ? ALA Q 214 ILE Q 222 
AB8 8 GLU Q 218 ? GLU Q 221 ? GLU Q 239 GLU Q 242 
AB9 1 LEU R 93  ? ASP R 98  ? LEU R 114 ASP R 119 
AB9 2 SER R 43  ? VAL R 49  ? SER R 64  VAL R 70  
AB9 3 LEU R 131 ? GLY R 137 ? LEU R 152 GLY R 158 
AB9 4 VAL R 285 ? VAL R 291 ? VAL R 306 VAL R 312 
AB9 5 VAL R 244 ? ASP R 249 ? VAL R 265 ASP R 270 
AB9 6 VAL R 158 ? LEU R 163 ? VAL R 179 LEU R 184 
AB9 7 ALA R 193 ? ILE R 201 ? ALA R 214 ILE R 222 
AB9 8 GLU R 218 ? GLU R 221 ? GLU R 239 GLU R 242 
AC1 1 LEU S 93  ? ASP S 98  ? LEU S 114 ASP S 119 
AC1 2 SER S 43  ? VAL S 49  ? SER S 64  VAL S 70  
AC1 3 LEU S 131 ? GLY S 137 ? LEU S 152 GLY S 158 
AC1 4 VAL S 285 ? VAL S 291 ? VAL S 306 VAL S 312 
AC1 5 VAL S 244 ? ASP S 249 ? VAL S 265 ASP S 270 
AC1 6 VAL S 158 ? LEU S 163 ? VAL S 179 LEU S 184 
AC1 7 ALA S 193 ? ILE S 201 ? ALA S 214 ILE S 222 
AC1 8 GLU S 218 ? GLU S 221 ? GLU S 239 GLU S 242 
AC2 1 LEU T 93  ? ASP T 98  ? LEU T 114 ASP T 119 
AC2 2 SER T 43  ? GLY T 48  ? SER T 64  GLY T 69  
AC2 3 LEU T 131 ? LEU T 136 ? LEU T 152 LEU T 157 
AC2 4 VAL T 285 ? VAL T 291 ? VAL T 306 VAL T 312 
AC2 5 VAL T 244 ? ASP T 249 ? VAL T 265 ASP T 270 
AC2 6 VAL T 158 ? LEU T 163 ? VAL T 179 LEU T 184 
AC2 7 ALA T 193 ? ILE T 201 ? ALA T 214 ILE T 222 
AC2 8 GLU T 218 ? GLU T 221 ? GLU T 239 GLU T 242 
AC3 1 LEU U 93  ? ASP U 98  ? LEU U 114 ASP U 119 
AC3 2 SER U 43  ? GLY U 48  ? SER U 64  GLY U 69  
AC3 3 LEU U 131 ? LEU U 136 ? LEU U 152 LEU U 157 
AC3 4 VAL U 285 ? VAL U 291 ? VAL U 306 VAL U 312 
AC3 5 VAL U 244 ? ASP U 249 ? VAL U 265 ASP U 270 
AC3 6 VAL U 158 ? LEU U 163 ? VAL U 179 LEU U 184 
AC3 7 ALA U 193 ? ILE U 201 ? ALA U 214 ILE U 222 
AC3 8 GLU U 218 ? GLU U 221 ? GLU U 239 GLU U 242 
AC4 1 LEU V 93  ? ASP V 98  ? LEU V 114 ASP V 119 
AC4 2 SER V 43  ? GLY V 48  ? SER V 64  GLY V 69  
AC4 3 LEU V 131 ? LEU V 136 ? LEU V 152 LEU V 157 
AC4 4 VAL V 285 ? VAL V 291 ? VAL V 306 VAL V 312 
AC4 5 VAL V 244 ? ASP V 249 ? VAL V 265 ASP V 270 
AC4 6 VAL V 158 ? LEU V 163 ? VAL V 179 LEU V 184 
AC4 7 ALA V 193 ? ILE V 201 ? ALA V 214 ILE V 222 
AC4 8 GLU V 218 ? GLU V 221 ? GLU V 239 GLU V 242 
AC5 1 LEU W 93  ? ASP W 98  ? LEU W 114 ASP W 119 
AC5 2 SER W 43  ? VAL W 49  ? SER W 64  VAL W 70  
AC5 3 LEU W 131 ? GLY W 137 ? LEU W 152 GLY W 158 
AC5 4 VAL W 285 ? VAL W 291 ? VAL W 306 VAL W 312 
AC5 5 VAL W 244 ? ASP W 249 ? VAL W 265 ASP W 270 
AC5 6 VAL W 158 ? LEU W 163 ? VAL W 179 LEU W 184 
AC5 7 ALA W 193 ? ILE W 201 ? ALA W 214 ILE W 222 
AC5 8 VAL W 217 ? GLU W 221 ? VAL W 238 GLU W 242 
AC6 1 LEU X 93  ? ASP X 98  ? LEU X 114 ASP X 119 
AC6 2 SER X 43  ? VAL X 49  ? SER X 64  VAL X 70  
AC6 3 LEU X 131 ? GLY X 137 ? LEU X 152 GLY X 158 
AC6 4 VAL X 285 ? VAL X 291 ? VAL X 306 VAL X 312 
AC6 5 VAL X 244 ? ASP X 249 ? VAL X 265 ASP X 270 
AC6 6 VAL X 158 ? LEU X 163 ? VAL X 179 LEU X 184 
AC6 7 ALA X 193 ? ILE X 201 ? ALA X 214 ILE X 222 
AC6 8 GLU X 218 ? GLU X 221 ? GLU X 239 GLU X 242 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O VAL A 96  ? O VAL A 117 N LEU A 46  ? N LEU A 67  
AA1 2 3 N SER A 45  ? N SER A 66  O ARG A 132 ? O ARG A 153 
AA1 3 4 N GLY A 137 ? N GLY A 158 O VAL A 290 ? O VAL A 311 
AA1 4 5 O VAL A 291 ? O VAL A 312 N ILE A 248 ? N ILE A 269 
AA1 5 6 O ASP A 249 ? O ASP A 270 N LEU A 163 ? N LEU A 184 
AA1 6 7 N HIS A 162 ? N HIS A 183 O LEU A 197 ? O LEU A 218 
AA1 7 8 N GLN A 198 ? N GLN A 219 O TYR A 220 ? O TYR A 241 
AA2 1 2 O GLY B 97  ? O GLY B 118 N GLY B 48  ? N GLY B 69  
AA2 2 3 N VAL B 49  ? N VAL B 70  O LEU B 136 ? O LEU B 157 
AA2 3 4 N VAL B 135 ? N VAL B 156 O ALA B 288 ? O ALA B 309 
AA2 4 5 O ASP B 289 ? O ASP B 310 N ILE B 248 ? N ILE B 269 
AA2 5 6 O SER B 247 ? O SER B 268 N LEU B 163 ? N LEU B 184 
AA2 6 7 N HIS B 162 ? N HIS B 183 O LEU B 197 ? O LEU B 218 
AA2 7 8 N LEU B 196 ? N LEU B 217 O GLU B 218 ? O GLU B 239 
AA3 1 2 O VAL C 96  ? O VAL C 117 N LEU C 46  ? N LEU C 67  
AA3 2 3 N VAL C 49  ? N VAL C 70  O LEU C 136 ? O LEU C 157 
AA3 3 4 N GLY C 137 ? N GLY C 158 O VAL C 290 ? O VAL C 311 
AA3 4 5 O ASP C 289 ? O ASP C 310 N ILE C 248 ? N ILE C 269 
AA3 5 6 O ASP C 249 ? O ASP C 270 N LEU C 163 ? N LEU C 184 
AA3 6 7 N ILE C 160 ? N ILE C 181 O ARG C 195 ? O ARG C 216 
AA3 7 8 N GLN C 198 ? N GLN C 219 O TYR C 220 ? O TYR C 241 
AA4 1 2 O GLY D 97  ? O GLY D 118 N GLY D 48  ? N GLY D 69  
AA4 2 3 N VAL D 49  ? N VAL D 70  O LEU D 136 ? O LEU D 157 
AA4 3 4 N GLY D 137 ? N GLY D 158 O VAL D 290 ? O VAL D 311 
AA4 4 5 O VAL D 291 ? O VAL D 312 N ILE D 248 ? N ILE D 269 
AA4 5 6 O SER D 247 ? O SER D 268 N LEU D 163 ? N LEU D 184 
AA4 6 7 N HIS D 162 ? N HIS D 183 O LEU D 197 ? O LEU D 218 
AA4 7 8 N GLN D 198 ? N GLN D 219 O TYR D 220 ? O TYR D 241 
AA5 1 2 O GLY E 97  ? O GLY E 118 N GLY E 48  ? N GLY E 69  
AA5 2 3 N LEU E 47  ? N LEU E 68  O LEU E 136 ? O LEU E 157 
AA5 3 4 N VAL E 135 ? N VAL E 156 O ALA E 288 ? O ALA E 309 
AA5 4 5 O VAL E 286 ? O VAL E 307 N VAL E 244 ? N VAL E 265 
AA5 5 6 O ASP E 249 ? O ASP E 270 N LEU E 163 ? N LEU E 184 
AA5 6 7 N HIS E 162 ? N HIS E 183 O LEU E 197 ? O LEU E 218 
AA5 7 8 N GLN E 198 ? N GLN E 219 O TYR E 220 ? O TYR E 241 
AA6 1 2 O VAL F 96  ? O VAL F 117 N LEU F 46  ? N LEU F 67  
AA6 2 3 N LEU F 47  ? N LEU F 68  O LEU F 136 ? O LEU F 157 
AA6 3 4 N VAL F 135 ? N VAL F 156 O ALA F 288 ? O ALA F 309 
AA6 4 5 O ASP F 289 ? O ASP F 310 N ILE F 248 ? N ILE F 269 
AA6 5 6 O ASP F 249 ? O ASP F 270 N LEU F 163 ? N LEU F 184 
AA6 6 7 N HIS F 162 ? N HIS F 183 O LEU F 197 ? O LEU F 218 
AA6 7 8 N GLN F 198 ? N GLN F 219 O TYR F 220 ? O TYR F 241 
AA7 1 2 O GLY G 97  ? O GLY G 118 N GLY G 48  ? N GLY G 69  
AA7 2 3 N SER G 45  ? N SER G 66  O ARG G 132 ? O ARG G 153 
AA7 3 4 N VAL G 135 ? N VAL G 156 O ALA G 288 ? O ALA G 309 
AA7 4 5 O VAL G 291 ? O VAL G 312 N ILE G 248 ? N ILE G 269 
AA7 5 6 O ASP G 249 ? O ASP G 270 N LEU G 163 ? N LEU G 184 
AA7 6 7 N HIS G 162 ? N HIS G 183 O LEU G 197 ? O LEU G 218 
AA7 7 8 N GLN G 198 ? N GLN G 219 O TYR G 220 ? O TYR G 241 
AA8 1 2 O VAL H 96  ? O VAL H 117 N LEU H 46  ? N LEU H 67  
AA8 2 3 N SER H 45  ? N SER H 66  O ARG H 132 ? O ARG H 153 
AA8 3 4 N VAL H 135 ? N VAL H 156 O ALA H 288 ? O ALA H 309 
AA8 4 5 O VAL H 286 ? O VAL H 307 N VAL H 244 ? N VAL H 265 
AA8 5 6 O ASP H 249 ? O ASP H 270 N LEU H 163 ? N LEU H 184 
AA8 6 7 N HIS H 162 ? N HIS H 183 O LEU H 197 ? O LEU H 218 
AA8 7 8 N GLN H 198 ? N GLN H 219 O TYR H 220 ? O TYR H 241 
AA9 1 2 O GLY I 97  ? O GLY I 118 N GLY I 48  ? N GLY I 69  
AA9 2 3 N VAL I 49  ? N VAL I 70  O LEU I 136 ? O LEU I 157 
AA9 3 4 N VAL I 135 ? N VAL I 156 O ALA I 288 ? O ALA I 309 
AA9 4 5 O VAL I 286 ? O VAL I 307 N VAL I 244 ? N VAL I 265 
AA9 5 6 O ASP I 249 ? O ASP I 270 N LEU I 163 ? N LEU I 184 
AA9 6 7 N HIS I 162 ? N HIS I 183 O LEU I 197 ? O LEU I 218 
AA9 7 8 N GLN I 198 ? N GLN I 219 O TYR I 220 ? O TYR I 241 
AB1 1 2 O GLY J 97  ? O GLY J 118 N GLY J 48  ? N GLY J 69  
AB1 2 3 N VAL J 49  ? N VAL J 70  O LEU J 136 ? O LEU J 157 
AB1 3 4 N VAL J 135 ? N VAL J 156 O ALA J 288 ? O ALA J 309 
AB1 4 5 O VAL J 286 ? O VAL J 307 N VAL J 244 ? N VAL J 265 
AB1 5 6 O ASP J 249 ? O ASP J 270 N LEU J 163 ? N LEU J 184 
AB1 6 7 N HIS J 162 ? N HIS J 183 O LEU J 197 ? O LEU J 218 
AB1 7 8 N GLN J 198 ? N GLN J 219 O TYR J 220 ? O TYR J 241 
AB2 1 2 O VAL K 96  ? O VAL K 117 N LEU K 46  ? N LEU K 67  
AB2 2 3 N LEU K 47  ? N LEU K 68  O LEU K 136 ? O LEU K 157 
AB2 3 4 N VAL K 135 ? N VAL K 156 O ALA K 288 ? O ALA K 309 
AB2 4 5 O ASP K 289 ? O ASP K 310 N ILE K 248 ? N ILE K 269 
AB2 5 6 O SER K 247 ? O SER K 268 N LEU K 163 ? N LEU K 184 
AB2 6 7 N HIS K 162 ? N HIS K 183 O LEU K 197 ? O LEU K 218 
AB2 7 8 N GLN K 198 ? N GLN K 219 O TYR K 220 ? O TYR K 241 
AB3 1 2 O VAL L 96  ? O VAL L 117 N LEU L 46  ? N LEU L 67  
AB3 2 3 N VAL L 49  ? N VAL L 70  O LEU L 136 ? O LEU L 157 
AB3 3 4 N VAL L 135 ? N VAL L 156 O ALA L 288 ? O ALA L 309 
AB3 4 5 O VAL L 286 ? O VAL L 307 N VAL L 244 ? N VAL L 265 
AB3 5 6 O ASP L 249 ? O ASP L 270 N LEU L 163 ? N LEU L 184 
AB3 6 7 N HIS L 162 ? N HIS L 183 O LEU L 197 ? O LEU L 218 
AB3 7 8 N GLN L 198 ? N GLN L 219 O TYR L 220 ? O TYR L 241 
AB4 1 2 O GLY M 97  ? O GLY M 118 N GLY M 48  ? N GLY M 69  
AB4 2 3 N SER M 45  ? N SER M 66  O ARG M 132 ? O ARG M 153 
AB4 3 4 N VAL M 135 ? N VAL M 156 O ALA M 288 ? O ALA M 309 
AB4 4 5 O ASP M 289 ? O ASP M 310 N ILE M 248 ? N ILE M 269 
AB4 5 6 O ASP M 249 ? O ASP M 270 N LEU M 163 ? N LEU M 184 
AB4 6 7 N HIS M 162 ? N HIS M 183 O LEU M 197 ? O LEU M 218 
AB4 7 8 N GLN M 198 ? N GLN M 219 O TYR M 220 ? O TYR M 241 
AB5 1 2 O GLY N 97  ? O GLY N 118 N GLY N 48  ? N GLY N 69  
AB5 2 3 N VAL N 49  ? N VAL N 70  O LEU N 136 ? O LEU N 157 
AB5 3 4 N VAL N 135 ? N VAL N 156 O ALA N 288 ? O ALA N 309 
AB5 4 5 O ASP N 289 ? O ASP N 310 N ILE N 248 ? N ILE N 269 
AB5 5 6 O ASP N 249 ? O ASP N 270 N LEU N 163 ? N LEU N 184 
AB5 6 7 N HIS N 162 ? N HIS N 183 O LEU N 197 ? O LEU N 218 
AB5 7 8 N GLN N 198 ? N GLN N 219 O TYR N 220 ? O TYR N 241 
AB6 1 2 O THR O 94  ? O THR O 115 N LEU O 46  ? N LEU O 67  
AB6 2 3 N VAL O 49  ? N VAL O 70  O LEU O 136 ? O LEU O 157 
AB6 3 4 N VAL O 135 ? N VAL O 156 O ALA O 288 ? O ALA O 309 
AB6 4 5 O VAL O 286 ? O VAL O 307 N VAL O 244 ? N VAL O 265 
AB6 5 6 O ASP O 249 ? O ASP O 270 N LEU O 163 ? N LEU O 184 
AB6 6 7 N HIS O 162 ? N HIS O 183 O LEU O 197 ? O LEU O 218 
AB6 7 8 N GLN O 198 ? N GLN O 219 O TYR O 220 ? O TYR O 241 
AB7 1 2 O VAL P 96  ? O VAL P 117 N LEU P 46  ? N LEU P 67  
AB7 2 3 N SER P 43  ? N SER P 64  O ARG P 132 ? O ARG P 153 
AB7 3 4 N VAL P 135 ? N VAL P 156 O ALA P 288 ? O ALA P 309 
AB7 4 5 O VAL P 286 ? O VAL P 307 N VAL P 244 ? N VAL P 265 
AB7 5 6 O ASP P 249 ? O ASP P 270 N LEU P 163 ? N LEU P 184 
AB7 6 7 N HIS P 162 ? N HIS P 183 O LEU P 197 ? O LEU P 218 
AB7 7 8 N GLN P 198 ? N GLN P 219 O TYR P 220 ? O TYR P 241 
AB8 1 2 O VAL Q 96  ? O VAL Q 117 N LEU Q 46  ? N LEU Q 67  
AB8 2 3 N SER Q 45  ? N SER Q 66  O ARG Q 132 ? O ARG Q 153 
AB8 3 4 N VAL Q 135 ? N VAL Q 156 O ALA Q 288 ? O ALA Q 309 
AB8 4 5 O VAL Q 286 ? O VAL Q 307 N VAL Q 244 ? N VAL Q 265 
AB8 5 6 O ASP Q 249 ? O ASP Q 270 N LEU Q 163 ? N LEU Q 184 
AB8 6 7 N HIS Q 162 ? N HIS Q 183 O LEU Q 197 ? O LEU Q 218 
AB8 7 8 N LEU Q 196 ? N LEU Q 217 O GLU Q 218 ? O GLU Q 239 
AB9 1 2 O VAL R 96  ? O VAL R 117 N LEU R 46  ? N LEU R 67  
AB9 2 3 N VAL R 49  ? N VAL R 70  O LEU R 136 ? O LEU R 157 
AB9 3 4 N GLY R 137 ? N GLY R 158 O VAL R 290 ? O VAL R 311 
AB9 4 5 O VAL R 291 ? O VAL R 312 N ILE R 248 ? N ILE R 269 
AB9 5 6 O SER R 247 ? O SER R 268 N LEU R 163 ? N LEU R 184 
AB9 6 7 N HIS R 162 ? N HIS R 183 O LEU R 197 ? O LEU R 218 
AB9 7 8 N GLN R 198 ? N GLN R 219 O TYR R 220 ? O TYR R 241 
AC1 1 2 O VAL S 96  ? O VAL S 117 N LEU S 46  ? N LEU S 67  
AC1 2 3 N VAL S 49  ? N VAL S 70  O LEU S 136 ? O LEU S 157 
AC1 3 4 N GLY S 137 ? N GLY S 158 O VAL S 290 ? O VAL S 311 
AC1 4 5 O VAL S 291 ? O VAL S 312 N ILE S 248 ? N ILE S 269 
AC1 5 6 O ASP S 249 ? O ASP S 270 N LEU S 163 ? N LEU S 184 
AC1 6 7 N HIS S 162 ? N HIS S 183 O LEU S 197 ? O LEU S 218 
AC1 7 8 N GLN S 198 ? N GLN S 219 O TYR S 220 ? O TYR S 241 
AC2 1 2 O VAL T 96  ? O VAL T 117 N LEU T 46  ? N LEU T 67  
AC2 2 3 N LEU T 47  ? N LEU T 68  O LEU T 134 ? O LEU T 155 
AC2 3 4 N VAL T 135 ? N VAL T 156 O ALA T 288 ? O ALA T 309 
AC2 4 5 O VAL T 286 ? O VAL T 307 N VAL T 244 ? N VAL T 265 
AC2 5 6 O SER T 247 ? O SER T 268 N LEU T 163 ? N LEU T 184 
AC2 6 7 N HIS T 162 ? N HIS T 183 O LEU T 197 ? O LEU T 218 
AC2 7 8 N LEU T 196 ? N LEU T 217 O GLU T 218 ? O GLU T 239 
AC3 1 2 O GLY U 97  ? O GLY U 118 N GLY U 48  ? N GLY U 69  
AC3 2 3 N LEU U 47  ? N LEU U 68  O LEU U 136 ? O LEU U 157 
AC3 3 4 N VAL U 135 ? N VAL U 156 O ALA U 288 ? O ALA U 309 
AC3 4 5 O VAL U 291 ? O VAL U 312 N ILE U 248 ? N ILE U 269 
AC3 5 6 O ASP U 249 ? O ASP U 270 N LEU U 163 ? N LEU U 184 
AC3 6 7 N HIS U 162 ? N HIS U 183 O LEU U 197 ? O LEU U 218 
AC3 7 8 N GLN U 198 ? N GLN U 219 O TYR U 220 ? O TYR U 241 
AC4 1 2 O THR V 94  ? O THR V 115 N LEU V 46  ? N LEU V 67  
AC4 2 3 N SER V 43  ? N SER V 64  O ARG V 132 ? O ARG V 153 
AC4 3 4 N VAL V 135 ? N VAL V 156 O ALA V 288 ? O ALA V 309 
AC4 4 5 O VAL V 291 ? O VAL V 312 N ILE V 248 ? N ILE V 269 
AC4 5 6 O SER V 247 ? O SER V 268 N LEU V 163 ? N LEU V 184 
AC4 6 7 N HIS V 162 ? N HIS V 183 O LEU V 197 ? O LEU V 218 
AC4 7 8 N LEU V 196 ? N LEU V 217 O GLU V 218 ? O GLU V 239 
AC5 1 2 O GLY W 97  ? O GLY W 118 N GLY W 48  ? N GLY W 69  
AC5 2 3 N VAL W 49  ? N VAL W 70  O LEU W 136 ? O LEU W 157 
AC5 3 4 N VAL W 135 ? N VAL W 156 O ALA W 288 ? O ALA W 309 
AC5 4 5 O VAL W 291 ? O VAL W 312 N ILE W 248 ? N ILE W 269 
AC5 5 6 O SER W 247 ? O SER W 268 N LEU W 163 ? N LEU W 184 
AC5 6 7 N HIS W 162 ? N HIS W 183 O LEU W 197 ? O LEU W 218 
AC5 7 8 N GLN W 198 ? N GLN W 219 O TYR W 220 ? O TYR W 241 
AC6 1 2 O VAL X 96  ? O VAL X 117 N LEU X 46  ? N LEU X 67  
AC6 2 3 N VAL X 49  ? N VAL X 70  O LEU X 136 ? O LEU X 157 
AC6 3 4 N GLY X 137 ? N GLY X 158 O VAL X 290 ? O VAL X 311 
AC6 4 5 O VAL X 286 ? O VAL X 307 N VAL X 244 ? N VAL X 265 
AC6 5 6 O ASP X 249 ? O ASP X 270 N LEU X 163 ? N LEU X 184 
AC6 6 7 N HIS X 162 ? N HIS X 183 O LEU X 197 ? O LEU X 218 
AC6 7 8 N GLN X 198 ? N GLN X 219 O TYR X 220 ? O TYR X 241 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN  401 ? 7  'binding site for residue MN A 401'  
AC2 Software A MN  402 ? 7  'binding site for residue MN A 402'  
AC3 Software A NA  403 ? 6  'binding site for residue NA A 403'  
AC4 Software A ORN 404 ? 13 'binding site for residue ORN A 404' 
AC5 Software B MN  401 ? 7  'binding site for residue MN B 401'  
AC6 Software B MN  402 ? 7  'binding site for residue MN B 402'  
AC7 Software B GOL 403 ? 5  'binding site for residue GOL B 403' 
AC8 Software B NA  404 ? 6  'binding site for residue NA B 404'  
AC9 Software B GOL 405 ? 6  'binding site for residue GOL B 405' 
AD1 Software C MN  401 ? 6  'binding site for residue MN C 401'  
AD2 Software C MN  402 ? 7  'binding site for residue MN C 402'  
AD3 Software C GOL 403 ? 5  'binding site for residue GOL C 403' 
AD4 Software C NA  404 ? 6  'binding site for residue NA C 404'  
AD5 Software C ORN 405 ? 8  'binding site for residue ORN C 405' 
AD6 Software D MN  401 ? 7  'binding site for residue MN D 401'  
AD7 Software D MN  402 ? 7  'binding site for residue MN D 402'  
AD8 Software D GOL 403 ? 7  'binding site for residue GOL D 403' 
AD9 Software D NA  404 ? 6  'binding site for residue NA D 404'  
AE1 Software D GOL 405 ? 9  'binding site for residue GOL D 405' 
AE2 Software E MN  401 ? 7  'binding site for residue MN E 401'  
AE3 Software E MN  402 ? 7  'binding site for residue MN E 402'  
AE4 Software E NA  403 ? 6  'binding site for residue NA E 403'  
AE5 Software E ORN 404 ? 13 'binding site for residue ORN E 404' 
AE6 Software E GOL 405 ? 3  'binding site for residue GOL E 405' 
AE7 Software E GOL 406 ? 4  'binding site for residue GOL E 406' 
AE8 Software F MN  401 ? 7  'binding site for residue MN F 401'  
AE9 Software F MN  402 ? 7  'binding site for residue MN F 402'  
AF1 Software F NA  403 ? 6  'binding site for residue NA F 403'  
AF2 Software F GOL 404 ? 3  'binding site for residue GOL F 404' 
AF3 Software F ORN 405 ? 13 'binding site for residue ORN F 405' 
AF4 Software G MN  401 ? 7  'binding site for residue MN G 401'  
AF5 Software G MN  402 ? 7  'binding site for residue MN G 402'  
AF6 Software G NA  403 ? 6  'binding site for residue NA G 403'  
AF7 Software G ORN 404 ? 12 'binding site for residue ORN G 404' 
AF8 Software G GOL 405 ? 8  'binding site for residue GOL G 405' 
AF9 Software G PEG 406 ? 2  'binding site for residue PEG G 406' 
AG1 Software G PEG 407 ? 5  'binding site for residue PEG G 407' 
AG2 Software G GOL 408 ? 3  'binding site for residue GOL G 408' 
AG3 Software H MN  401 ? 7  'binding site for residue MN H 401'  
AG4 Software H MN  402 ? 7  'binding site for residue MN H 402'  
AG5 Software H GOL 403 ? 4  'binding site for residue GOL H 403' 
AG6 Software H GOL 404 ? 7  'binding site for residue GOL H 404' 
AG7 Software H NA  405 ? 6  'binding site for residue NA H 405'  
AG8 Software I MN  401 ? 7  'binding site for residue MN I 401'  
AG9 Software I MN  402 ? 7  'binding site for residue MN I 402'  
AH1 Software I NA  403 ? 5  'binding site for residue NA I 403'  
AH2 Software I GOL 404 ? 6  'binding site for residue GOL I 404' 
AH3 Software I GOL 405 ? 5  'binding site for residue GOL I 405' 
AH4 Software J MN  401 ? 7  'binding site for residue MN J 401'  
AH5 Software J MN  402 ? 6  'binding site for residue MN J 402'  
AH6 Software J NA  403 ? 6  'binding site for residue NA J 403'  
AH7 Software J GOL 404 ? 6  'binding site for residue GOL J 404' 
AH8 Software J GOL 405 ? 4  'binding site for residue GOL J 405' 
AH9 Software K MN  401 ? 7  'binding site for residue MN K 401'  
AI1 Software K MN  402 ? 7  'binding site for residue MN K 402'  
AI2 Software K GOL 403 ? 5  'binding site for residue GOL K 403' 
AI3 Software K NA  404 ? 7  'binding site for residue NA K 404'  
AI4 Software K GOL 405 ? 5  'binding site for residue GOL K 405' 
AI5 Software K ORN 406 ? 15 'binding site for residue ORN K 406' 
AI6 Software L MN  401 ? 7  'binding site for residue MN L 401'  
AI7 Software L MN  402 ? 7  'binding site for residue MN L 402'  
AI8 Software L GOL 403 ? 9  'binding site for residue GOL L 403' 
AI9 Software L NA  404 ? 6  'binding site for residue NA L 404'  
AJ1 Software L GOL 405 ? 7  'binding site for residue GOL L 405' 
AJ2 Software L PEG 406 ? 4  'binding site for residue PEG L 406' 
AJ3 Software L PEG 407 ? 7  'binding site for residue PEG L 407' 
AJ4 Software L PEG 408 ? 6  'binding site for residue PEG L 408' 
AJ5 Software M MN  401 ? 6  'binding site for residue MN M 401'  
AJ6 Software M MN  402 ? 7  'binding site for residue MN M 402'  
AJ7 Software M NA  403 ? 6  'binding site for residue NA M 403'  
AJ8 Software N MN  401 ? 7  'binding site for residue MN N 401'  
AJ9 Software N MN  402 ? 7  'binding site for residue MN N 402'  
AK1 Software N GOL 403 ? 9  'binding site for residue GOL N 403' 
AK2 Software N NA  404 ? 6  'binding site for residue NA N 404'  
AK3 Software O MN  401 ? 7  'binding site for residue MN O 401'  
AK4 Software O MN  402 ? 6  'binding site for residue MN O 402'  
AK5 Software O NA  403 ? 5  'binding site for residue NA O 403'  
AK6 Software P MN  401 ? 7  'binding site for residue MN P 401'  
AK7 Software P MN  402 ? 7  'binding site for residue MN P 402'  
AK8 Software P GOL 403 ? 5  'binding site for residue GOL P 403' 
AK9 Software P NA  404 ? 5  'binding site for residue NA P 404'  
AL1 Software P ORN 405 ? 11 'binding site for residue ORN P 405' 
AL2 Software Q MN  401 ? 7  'binding site for residue MN Q 401'  
AL3 Software Q MN  402 ? 7  'binding site for residue MN Q 402'  
AL4 Software Q GOL 403 ? 5  'binding site for residue GOL Q 403' 
AL5 Software Q NA  404 ? 6  'binding site for residue NA Q 404'  
AL6 Software R MN  401 ? 7  'binding site for residue MN R 401'  
AL7 Software R MN  402 ? 7  'binding site for residue MN R 402'  
AL8 Software R NA  403 ? 6  'binding site for residue NA R 403'  
AL9 Software R GOL 404 ? 6  'binding site for residue GOL R 404' 
AM1 Software S MN  401 ? 7  'binding site for residue MN S 401'  
AM2 Software S MN  402 ? 7  'binding site for residue MN S 402'  
AM3 Software S GOL 403 ? 6  'binding site for residue GOL S 403' 
AM4 Software S NA  404 ? 6  'binding site for residue NA S 404'  
AM5 Software S GOL 405 ? 7  'binding site for residue GOL S 405' 
AM6 Software T MN  401 ? 7  'binding site for residue MN T 401'  
AM7 Software T MN  402 ? 7  'binding site for residue MN T 402'  
AM8 Software T NA  403 ? 6  'binding site for residue NA T 403'  
AM9 Software T GOL 404 ? 7  'binding site for residue GOL T 404' 
AN1 Software U MN  401 ? 7  'binding site for residue MN U 401'  
AN2 Software U MN  402 ? 7  'binding site for residue MN U 402'  
AN3 Software U GOL 403 ? 6  'binding site for residue GOL U 403' 
AN4 Software U NA  404 ? 6  'binding site for residue NA U 404'  
AN5 Software U ORN 405 ? 11 'binding site for residue ORN U 405' 
AN6 Software V MN  401 ? 6  'binding site for residue MN V 401'  
AN7 Software V MN  402 ? 7  'binding site for residue MN V 402'  
AN8 Software V NA  403 ? 6  'binding site for residue NA V 403'  
AN9 Software V ORN 404 ? 11 'binding site for residue ORN V 404' 
AO1 Software W MN  401 ? 6  'binding site for residue MN W 401'  
AO2 Software W MN  402 ? 7  'binding site for residue MN W 402'  
AO3 Software W GOL 403 ? 7  'binding site for residue GOL W 403' 
AO4 Software W NA  404 ? 6  'binding site for residue NA W 404'  
AO5 Software W GOL 405 ? 1  'binding site for residue GOL W 405' 
AO6 Software X MN  401 ? 7  'binding site for residue MN X 401'  
AO7 Software X MN  402 ? 7  'binding site for residue MN X 402'  
AO8 Software X NA  403 ? 5  'binding site for residue NA X 403'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 7  ASP A  164 ? ASP A 185 . ? 1_555 ? 
2   AC1 7  HIS A  166 ? HIS A 187 . ? 1_555 ? 
3   AC1 7  ASP A  249 ? ASP A 270 . ? 1_555 ? 
4   AC1 7  ASP A  251 ? ASP A 272 . ? 1_555 ? 
5   AC1 7  MN  Z  .   ? MN  A 402 . ? 1_555 ? 
6   AC1 7  HOH KE .   ? HOH A 517 . ? 1_555 ? 
7   AC1 7  HOH KE .   ? HOH A 582 . ? 1_555 ? 
8   AC2 7  HIS A  140 ? HIS A 161 . ? 1_555 ? 
9   AC2 7  ASP A  164 ? ASP A 185 . ? 1_555 ? 
10  AC2 7  ASP A  168 ? ASP A 189 . ? 1_555 ? 
11  AC2 7  ASP A  249 ? ASP A 270 . ? 1_555 ? 
12  AC2 7  MN  Y  .   ? MN  A 401 . ? 1_555 ? 
13  AC2 7  HOH KE .   ? HOH A 502 . ? 1_555 ? 
14  AC2 7  HOH KE .   ? HOH A 517 . ? 1_555 ? 
15  AC3 6  SER A  55  ? SER A 76  . ? 1_555 ? 
16  AC3 6  LEU A  58  ? LEU A 79  . ? 1_555 ? 
17  AC3 6  PRO A  61  ? PRO A 82  . ? 1_555 ? 
18  AC3 6  SER A  262 ? SER A 283 . ? 1_555 ? 
19  AC3 6  GLU A  292 ? GLU A 313 . ? 1_555 ? 
20  AC3 6  HOH KE .   ? HOH A 586 . ? 1_555 ? 
21  AC4 13 ASP A  168 ? ASP A 189 . ? 1_555 ? 
22  AC4 13 TYR A  170 ? TYR A 191 . ? 1_555 ? 
23  AC4 13 HIS A  180 ? HIS A 201 . ? 1_555 ? 
24  AC4 13 HOH KE .   ? HOH A 502 . ? 1_555 ? 
25  AC4 13 HOH KE .   ? HOH A 517 . ? 1_555 ? 
26  AC4 13 HOH KE .   ? HOH A 521 . ? 1_555 ? 
27  AC4 13 HOH KE .   ? HOH A 534 . ? 1_555 ? 
28  AC4 13 HOH KE .   ? HOH A 543 . ? 1_555 ? 
29  AC4 13 HOH KE .   ? HOH A 572 . ? 1_555 ? 
30  AC4 13 HOH KE .   ? HOH A 582 . ? 1_555 ? 
31  AC4 13 HOH KE .   ? HOH A 589 . ? 1_555 ? 
32  AC4 13 SER B  76  ? SER B 97  . ? 1_555 ? 
33  AC4 13 ASN B  78  ? ASN B 99  . ? 1_555 ? 
34  AC5 7  ASP B  164 ? ASP B 185 . ? 1_555 ? 
35  AC5 7  HIS B  166 ? HIS B 187 . ? 1_555 ? 
36  AC5 7  ASP B  249 ? ASP B 270 . ? 1_555 ? 
37  AC5 7  ASP B  251 ? ASP B 272 . ? 1_555 ? 
38  AC5 7  MN  DA .   ? MN  B 402 . ? 1_555 ? 
39  AC5 7  HOH LE .   ? HOH B 505 . ? 1_555 ? 
40  AC5 7  HOH LE .   ? HOH B 678 . ? 1_555 ? 
41  AC6 7  HIS B  140 ? HIS B 161 . ? 1_555 ? 
42  AC6 7  ASP B  164 ? ASP B 185 . ? 1_555 ? 
43  AC6 7  ASP B  168 ? ASP B 189 . ? 1_555 ? 
44  AC6 7  ASP B  249 ? ASP B 270 . ? 1_555 ? 
45  AC6 7  MN  CA .   ? MN  B 401 . ? 1_555 ? 
46  AC6 7  HOH LE .   ? HOH B 505 . ? 1_555 ? 
47  AC6 7  HOH LE .   ? HOH B 630 . ? 1_555 ? 
48  AC7 5  HIS B  166 ? HIS B 187 . ? 1_555 ? 
49  AC7 5  TYR B  170 ? TYR B 191 . ? 1_555 ? 
50  AC7 5  HOH LE .   ? HOH B 583 . ? 1_555 ? 
51  AC7 5  SER C  76  ? SER C 97  . ? 1_555 ? 
52  AC7 5  ASN C  78  ? ASN C 99  . ? 1_555 ? 
53  AC8 6  SER B  55  ? SER B 76  . ? 1_555 ? 
54  AC8 6  LEU B  58  ? LEU B 79  . ? 1_555 ? 
55  AC8 6  PRO B  61  ? PRO B 82  . ? 1_555 ? 
56  AC8 6  SER B  262 ? SER B 283 . ? 1_555 ? 
57  AC8 6  GLU B  292 ? GLU B 313 . ? 1_555 ? 
58  AC8 6  HOH LE .   ? HOH B 645 . ? 1_555 ? 
59  AC9 6  ARG B  132 ? ARG B 153 . ? 1_555 ? 
60  AC9 6  HOH LE .   ? HOH B 536 . ? 1_555 ? 
61  AC9 6  HOH LE .   ? HOH B 538 . ? 1_555 ? 
62  AC9 6  HOH LE .   ? HOH B 541 . ? 1_555 ? 
63  AC9 6  HOH LE .   ? HOH B 574 . ? 1_555 ? 
64  AC9 6  HOH LE .   ? HOH B 616 . ? 1_555 ? 
65  AD1 6  ASP C  164 ? ASP C 185 . ? 1_555 ? 
66  AD1 6  HIS C  166 ? HIS C 187 . ? 1_555 ? 
67  AD1 6  ASP C  249 ? ASP C 270 . ? 1_555 ? 
68  AD1 6  ASP C  251 ? ASP C 272 . ? 1_555 ? 
69  AD1 6  MN  IA .   ? MN  C 402 . ? 1_555 ? 
70  AD1 6  HOH ME .   ? HOH C 534 . ? 1_555 ? 
71  AD2 7  HIS C  140 ? HIS C 161 . ? 1_555 ? 
72  AD2 7  ASP C  164 ? ASP C 185 . ? 1_555 ? 
73  AD2 7  ASP C  168 ? ASP C 189 . ? 1_555 ? 
74  AD2 7  ASP C  249 ? ASP C 270 . ? 1_555 ? 
75  AD2 7  MN  HA .   ? MN  C 401 . ? 1_555 ? 
76  AD2 7  HOH ME .   ? HOH C 534 . ? 1_555 ? 
77  AD2 7  HOH ME .   ? HOH C 569 . ? 1_555 ? 
78  AD3 5  ASP A  301 ? ASP A 322 . ? 1_555 ? 
79  AD3 5  GLN C  296 ? GLN C 317 . ? 1_555 ? 
80  AD3 5  ARG C  297 ? ARG C 318 . ? 1_555 ? 
81  AD3 5  ASP C  298 ? ASP C 319 . ? 1_555 ? 
82  AD3 5  VAL F  300 ? VAL F 321 . ? 1_555 ? 
83  AD4 6  SER C  55  ? SER C 76  . ? 1_555 ? 
84  AD4 6  LEU C  58  ? LEU C 79  . ? 1_555 ? 
85  AD4 6  HIS C  180 ? HIS C 201 . ? 1_555 ? 
86  AD4 6  SER C  262 ? SER C 283 . ? 1_555 ? 
87  AD4 6  GLU C  292 ? GLU C 313 . ? 1_555 ? 
88  AD4 6  HOH ME .   ? HOH C 544 . ? 1_555 ? 
89  AD5 8  SER A  76  ? SER A 97  . ? 1_555 ? 
90  AD5 8  THR A  77  ? THR A 98  . ? 1_555 ? 
91  AD5 8  ASN A  78  ? ASN A 99  . ? 1_555 ? 
92  AD5 8  ASP C  168 ? ASP C 189 . ? 1_555 ? 
93  AD5 8  TYR C  170 ? TYR C 191 . ? 1_555 ? 
94  AD5 8  HIS C  263 ? HIS C 284 . ? 1_555 ? 
95  AD5 8  HOH ME .   ? HOH C 534 . ? 1_555 ? 
96  AD5 8  HOH ME .   ? HOH C 569 . ? 1_555 ? 
97  AD6 7  ASP D  164 ? ASP D 185 . ? 1_555 ? 
98  AD6 7  HIS D  166 ? HIS D 187 . ? 1_555 ? 
99  AD6 7  ASP D  249 ? ASP D 270 . ? 1_555 ? 
100 AD6 7  ASP D  251 ? ASP D 272 . ? 1_555 ? 
101 AD6 7  MN  NA .   ? MN  D 402 . ? 1_555 ? 
102 AD6 7  HOH NE .   ? HOH D 525 . ? 1_555 ? 
103 AD6 7  HOH NE .   ? HOH D 660 . ? 1_555 ? 
104 AD7 7  HIS D  140 ? HIS D 161 . ? 1_555 ? 
105 AD7 7  ASP D  164 ? ASP D 185 . ? 1_555 ? 
106 AD7 7  ASP D  168 ? ASP D 189 . ? 1_555 ? 
107 AD7 7  ASP D  249 ? ASP D 270 . ? 1_555 ? 
108 AD7 7  MN  MA .   ? MN  D 401 . ? 1_555 ? 
109 AD7 7  HOH NE .   ? HOH D 525 . ? 1_555 ? 
110 AD7 7  HOH NE .   ? HOH D 695 . ? 1_555 ? 
111 AD8 7  TYR D  170 ? TYR D 191 . ? 1_555 ? 
112 AD8 7  HIS D  263 ? HIS D 284 . ? 1_555 ? 
113 AD8 7  HOH NE .   ? HOH D 536 . ? 1_555 ? 
114 AD8 7  HOH NE .   ? HOH D 567 . ? 1_555 ? 
115 AD8 7  HOH NE .   ? HOH D 609 . ? 1_555 ? 
116 AD8 7  SER F  76  ? SER F 97  . ? 1_555 ? 
117 AD8 7  ASN F  78  ? ASN F 99  . ? 1_555 ? 
118 AD9 6  SER D  55  ? SER D 76  . ? 1_555 ? 
119 AD9 6  LEU D  58  ? LEU D 79  . ? 1_555 ? 
120 AD9 6  PRO D  61  ? PRO D 82  . ? 1_555 ? 
121 AD9 6  SER D  262 ? SER D 283 . ? 1_555 ? 
122 AD9 6  GLU D  292 ? GLU D 313 . ? 1_555 ? 
123 AD9 6  HOH NE .   ? HOH D 633 . ? 1_555 ? 
124 AE1 9  GLU D  129 ? GLU D 150 . ? 1_555 ? 
125 AE1 9  ARG D  132 ? ARG D 153 . ? 1_555 ? 
126 AE1 9  LEU D  154 ? LEU D 175 . ? 1_555 ? 
127 AE1 9  HOH NE .   ? HOH D 530 . ? 1_555 ? 
128 AE1 9  HOH NE .   ? HOH D 533 . ? 1_555 ? 
129 AE1 9  HOH NE .   ? HOH D 548 . ? 1_555 ? 
130 AE1 9  HOH NE .   ? HOH D 589 . ? 1_555 ? 
131 AE1 9  HOH NE .   ? HOH D 603 . ? 1_555 ? 
132 AE1 9  HOH NE .   ? HOH D 613 . ? 1_555 ? 
133 AE2 7  ASP E  164 ? ASP E 185 . ? 1_555 ? 
134 AE2 7  HIS E  166 ? HIS E 187 . ? 1_555 ? 
135 AE2 7  ASP E  249 ? ASP E 270 . ? 1_555 ? 
136 AE2 7  ASP E  251 ? ASP E 272 . ? 1_555 ? 
137 AE2 7  MN  SA .   ? MN  E 402 . ? 1_555 ? 
138 AE2 7  HOH OE .   ? HOH E 507 . ? 1_555 ? 
139 AE2 7  HOH OE .   ? HOH E 540 . ? 1_555 ? 
140 AE3 7  HIS E  140 ? HIS E 161 . ? 1_555 ? 
141 AE3 7  ASP E  164 ? ASP E 185 . ? 1_555 ? 
142 AE3 7  ASP E  168 ? ASP E 189 . ? 1_555 ? 
143 AE3 7  ASP E  249 ? ASP E 270 . ? 1_555 ? 
144 AE3 7  MN  RA .   ? MN  E 401 . ? 1_555 ? 
145 AE3 7  HOH OE .   ? HOH E 507 . ? 1_555 ? 
146 AE3 7  HOH OE .   ? HOH E 521 . ? 1_555 ? 
147 AE4 6  SER E  55  ? SER E 76  . ? 1_555 ? 
148 AE4 6  LEU E  58  ? LEU E 79  . ? 1_555 ? 
149 AE4 6  PRO E  61  ? PRO E 82  . ? 1_555 ? 
150 AE4 6  SER E  262 ? SER E 283 . ? 1_555 ? 
151 AE4 6  GLU E  292 ? GLU E 313 . ? 1_555 ? 
152 AE4 6  HOH OE .   ? HOH E 671 . ? 1_555 ? 
153 AE5 13 SER D  76  ? SER D 97  . ? 1_555 ? 
154 AE5 13 THR D  77  ? THR D 98  . ? 1_555 ? 
155 AE5 13 ASN D  78  ? ASN D 99  . ? 1_555 ? 
156 AE5 13 HIS E  166 ? HIS E 187 . ? 1_555 ? 
157 AE5 13 ASP E  168 ? ASP E 189 . ? 1_555 ? 
158 AE5 13 TYR E  170 ? TYR E 191 . ? 1_555 ? 
159 AE5 13 HIS E  263 ? HIS E 284 . ? 1_555 ? 
160 AE5 13 HOH OE .   ? HOH E 506 . ? 1_555 ? 
161 AE5 13 HOH OE .   ? HOH E 507 . ? 1_555 ? 
162 AE5 13 HOH OE .   ? HOH E 521 . ? 1_555 ? 
163 AE5 13 HOH OE .   ? HOH E 533 . ? 1_555 ? 
164 AE5 13 HOH OE .   ? HOH E 540 . ? 1_555 ? 
165 AE5 13 HOH OE .   ? HOH E 621 . ? 1_555 ? 
166 AE6 3  GLN E  282 ? GLN E 303 . ? 1_555 ? 
167 AE6 3  ALA E  283 ? ALA E 304 . ? 1_555 ? 
168 AE6 3  LYS E  318 ? LYS E 339 . ? 1_555 ? 
169 AE7 4  GLU E  83  ? GLU E 104 . ? 1_555 ? 
170 AE7 4  HOH OE .   ? HOH E 661 . ? 1_555 ? 
171 AE7 4  ARG F  209 ? ARG F 230 . ? 1_555 ? 
172 AE7 4  ARG F  223 ? ARG F 244 . ? 1_555 ? 
173 AE8 7  ASP F  164 ? ASP F 185 . ? 1_555 ? 
174 AE8 7  HIS F  166 ? HIS F 187 . ? 1_555 ? 
175 AE8 7  ASP F  249 ? ASP F 270 . ? 1_555 ? 
176 AE8 7  ASP F  251 ? ASP F 272 . ? 1_555 ? 
177 AE8 7  MN  YA .   ? MN  F 402 . ? 1_555 ? 
178 AE8 7  HOH PE .   ? HOH F 538 . ? 1_555 ? 
179 AE8 7  HOH PE .   ? HOH F 593 . ? 1_555 ? 
180 AE9 7  HIS F  140 ? HIS F 161 . ? 1_555 ? 
181 AE9 7  ASP F  164 ? ASP F 185 . ? 1_555 ? 
182 AE9 7  ASP F  168 ? ASP F 189 . ? 1_555 ? 
183 AE9 7  ASP F  249 ? ASP F 270 . ? 1_555 ? 
184 AE9 7  MN  XA .   ? MN  F 401 . ? 1_555 ? 
185 AE9 7  HOH PE .   ? HOH F 501 . ? 1_555 ? 
186 AE9 7  HOH PE .   ? HOH F 538 . ? 1_555 ? 
187 AF1 6  SER F  55  ? SER F 76  . ? 1_555 ? 
188 AF1 6  LEU F  58  ? LEU F 79  . ? 1_555 ? 
189 AF1 6  PRO F  61  ? PRO F 82  . ? 1_555 ? 
190 AF1 6  SER F  262 ? SER F 283 . ? 1_555 ? 
191 AF1 6  GLU F  292 ? GLU F 313 . ? 1_555 ? 
192 AF1 6  HOH PE .   ? HOH F 661 . ? 1_555 ? 
193 AF2 3  SER F  55  ? SER F 76  . ? 1_555 ? 
194 AF2 3  PHE F  57  ? PHE F 78  . ? 1_555 ? 
195 AF2 3  GLN F  59  ? GLN F 80  . ? 1_555 ? 
196 AF3 13 SER E  76  ? SER E 97  . ? 1_555 ? 
197 AF3 13 ASN E  78  ? ASN E 99  . ? 1_555 ? 
198 AF3 13 HIS F  166 ? HIS F 187 . ? 1_555 ? 
199 AF3 13 ASP F  168 ? ASP F 189 . ? 1_555 ? 
200 AF3 13 TYR F  170 ? TYR F 191 . ? 1_555 ? 
201 AF3 13 HIS F  180 ? HIS F 201 . ? 1_555 ? 
202 AF3 13 HIS F  263 ? HIS F 284 . ? 1_555 ? 
203 AF3 13 HOH PE .   ? HOH F 501 . ? 1_555 ? 
204 AF3 13 HOH PE .   ? HOH F 538 . ? 1_555 ? 
205 AF3 13 HOH PE .   ? HOH F 563 . ? 1_555 ? 
206 AF3 13 HOH PE .   ? HOH F 591 . ? 1_555 ? 
207 AF3 13 HOH PE .   ? HOH F 593 . ? 1_555 ? 
208 AF3 13 HOH PE .   ? HOH F 605 . ? 1_555 ? 
209 AF4 7  ASP G  164 ? ASP G 185 . ? 1_555 ? 
210 AF4 7  HIS G  166 ? HIS G 187 . ? 1_555 ? 
211 AF4 7  ASP G  249 ? ASP G 270 . ? 1_555 ? 
212 AF4 7  ASP G  251 ? ASP G 272 . ? 1_555 ? 
213 AF4 7  MN  DB .   ? MN  G 402 . ? 1_555 ? 
214 AF4 7  HOH QE .   ? HOH G 658 . ? 1_555 ? 
215 AF4 7  HOH QE .   ? HOH G 710 . ? 1_555 ? 
216 AF5 7  HIS G  140 ? HIS G 161 . ? 1_555 ? 
217 AF5 7  ASP G  164 ? ASP G 185 . ? 1_555 ? 
218 AF5 7  ASP G  168 ? ASP G 189 . ? 1_555 ? 
219 AF5 7  ASP G  249 ? ASP G 270 . ? 1_555 ? 
220 AF5 7  MN  CB .   ? MN  G 401 . ? 1_555 ? 
221 AF5 7  HOH QE .   ? HOH G 658 . ? 1_555 ? 
222 AF5 7  HOH QE .   ? HOH G 695 . ? 1_555 ? 
223 AF6 6  SER G  55  ? SER G 76  . ? 1_555 ? 
224 AF6 6  LEU G  58  ? LEU G 79  . ? 1_555 ? 
225 AF6 6  PRO G  61  ? PRO G 82  . ? 1_555 ? 
226 AF6 6  SER G  262 ? SER G 283 . ? 1_555 ? 
227 AF6 6  GLU G  292 ? GLU G 313 . ? 1_555 ? 
228 AF6 6  HOH QE .   ? HOH G 598 . ? 1_555 ? 
229 AF7 12 SER G  76  ? SER G 97  . ? 1_555 ? 
230 AF7 12 ASN G  78  ? ASN G 99  . ? 1_555 ? 
231 AF7 12 HOH QE .   ? HOH G 503 . ? 1_555 ? 
232 AF7 12 HOH QE .   ? HOH G 507 . ? 1_555 ? 
233 AF7 12 HOH QE .   ? HOH G 606 . ? 1_555 ? 
234 AF7 12 HOH QE .   ? HOH G 663 . ? 1_555 ? 
235 AF7 12 HIS I  166 ? HIS I 187 . ? 1_555 ? 
236 AF7 12 ASP I  168 ? ASP I 189 . ? 1_555 ? 
237 AF7 12 TYR I  170 ? TYR I 191 . ? 1_555 ? 
238 AF7 12 HIS I  180 ? HIS I 201 . ? 1_555 ? 
239 AF7 12 HOH SE .   ? HOH I 561 . ? 1_555 ? 
240 AF7 12 HOH SE .   ? HOH I 667 . ? 1_555 ? 
241 AF8 8  GLU G  129 ? GLU G 150 . ? 1_555 ? 
242 AF8 8  ARG G  132 ? ARG G 153 . ? 1_555 ? 
243 AF8 8  HOH QE .   ? HOH G 538 . ? 1_555 ? 
244 AF8 8  HOH QE .   ? HOH G 543 . ? 1_555 ? 
245 AF8 8  HOH QE .   ? HOH G 567 . ? 1_555 ? 
246 AF8 8  HOH QE .   ? HOH G 571 . ? 1_555 ? 
247 AF8 8  HOH QE .   ? HOH G 609 . ? 1_555 ? 
248 AF8 8  HOH QE .   ? HOH G 615 . ? 1_555 ? 
249 AF9 2  GLU G  83  ? GLU G 104 . ? 1_555 ? 
250 AF9 2  ARG I  223 ? ARG I 244 . ? 1_555 ? 
251 AG1 5  GLU G  218 ? GLU G 239 . ? 1_555 ? 
252 AG1 5  GLN G  219 ? GLN G 240 . ? 1_555 ? 
253 AG1 5  THR G  224 ? THR G 245 . ? 1_555 ? 
254 AG1 5  ASP G  228 ? ASP G 249 . ? 1_555 ? 
255 AG1 5  HOH QE .   ? HOH G 694 . ? 1_555 ? 
256 AG2 3  ARG G  209 ? ARG G 230 . ? 1_555 ? 
257 AG2 3  ARG G  223 ? ARG G 244 . ? 1_555 ? 
258 AG2 3  GLU H  83  ? GLU H 104 . ? 1_555 ? 
259 AG3 7  ASP H  164 ? ASP H 185 . ? 1_555 ? 
260 AG3 7  HIS H  166 ? HIS H 187 . ? 1_555 ? 
261 AG3 7  ASP H  249 ? ASP H 270 . ? 1_555 ? 
262 AG3 7  ASP H  251 ? ASP H 272 . ? 1_555 ? 
263 AG3 7  MN  LB .   ? MN  H 402 . ? 1_555 ? 
264 AG3 7  HOH RE .   ? HOH H 609 . ? 1_555 ? 
265 AG3 7  HOH RE .   ? HOH H 698 . ? 1_555 ? 
266 AG4 7  HIS H  140 ? HIS H 161 . ? 1_555 ? 
267 AG4 7  ASP H  164 ? ASP H 185 . ? 1_555 ? 
268 AG4 7  ASP H  168 ? ASP H 189 . ? 1_555 ? 
269 AG4 7  ASP H  249 ? ASP H 270 . ? 1_555 ? 
270 AG4 7  MN  KB .   ? MN  H 401 . ? 1_555 ? 
271 AG4 7  HOH RE .   ? HOH H 609 . ? 1_555 ? 
272 AG4 7  HOH RE .   ? HOH H 702 . ? 1_555 ? 
273 AG5 4  TYR G  170 ? TYR G 191 . ? 1_555 ? 
274 AG5 4  HOH QE .   ? HOH G 628 . ? 1_555 ? 
275 AG5 4  ASN H  78  ? ASN H 99  . ? 1_555 ? 
276 AG5 4  HOH RE .   ? HOH H 566 . ? 1_555 ? 
277 AG6 7  TYR H  170 ? TYR H 191 . ? 1_555 ? 
278 AG6 7  HIS H  263 ? HIS H 284 . ? 1_555 ? 
279 AG6 7  HOH RE .   ? HOH H 523 . ? 1_555 ? 
280 AG6 7  HOH RE .   ? HOH H 616 . ? 1_555 ? 
281 AG6 7  HOH RE .   ? HOH H 625 . ? 1_555 ? 
282 AG6 7  SER I  76  ? SER I 97  . ? 1_555 ? 
283 AG6 7  ASN I  78  ? ASN I 99  . ? 1_555 ? 
284 AG7 6  SER H  55  ? SER H 76  . ? 1_555 ? 
285 AG7 6  LEU H  58  ? LEU H 79  . ? 1_555 ? 
286 AG7 6  PRO H  61  ? PRO H 82  . ? 1_555 ? 
287 AG7 6  SER H  262 ? SER H 283 . ? 1_555 ? 
288 AG7 6  GLU H  292 ? GLU H 313 . ? 1_555 ? 
289 AG7 6  HOH RE .   ? HOH H 635 . ? 1_555 ? 
290 AG8 7  HOH QE .   ? HOH G 503 . ? 1_555 ? 
291 AG8 7  HOH QE .   ? HOH G 663 . ? 1_555 ? 
292 AG8 7  ASP I  164 ? ASP I 185 . ? 1_555 ? 
293 AG8 7  HIS I  166 ? HIS I 187 . ? 1_555 ? 
294 AG8 7  ASP I  249 ? ASP I 270 . ? 1_555 ? 
295 AG8 7  ASP I  251 ? ASP I 272 . ? 1_555 ? 
296 AG8 7  MN  QB .   ? MN  I 402 . ? 1_555 ? 
297 AG9 7  HOH QE .   ? HOH G 503 . ? 1_555 ? 
298 AG9 7  HOH QE .   ? HOH G 507 . ? 1_555 ? 
299 AG9 7  HIS I  140 ? HIS I 161 . ? 1_555 ? 
300 AG9 7  ASP I  164 ? ASP I 185 . ? 1_555 ? 
301 AG9 7  ASP I  168 ? ASP I 189 . ? 1_555 ? 
302 AG9 7  ASP I  249 ? ASP I 270 . ? 1_555 ? 
303 AG9 7  MN  PB .   ? MN  I 401 . ? 1_555 ? 
304 AH1 5  SER I  55  ? SER I 76  . ? 1_555 ? 
305 AH1 5  LEU I  58  ? LEU I 79  . ? 1_555 ? 
306 AH1 5  SER I  262 ? SER I 283 . ? 1_555 ? 
307 AH1 5  GLU I  292 ? GLU I 313 . ? 1_555 ? 
308 AH1 5  HOH SE .   ? HOH I 617 . ? 1_555 ? 
309 AH2 6  ARG I  132 ? ARG I 153 . ? 1_555 ? 
310 AH2 6  LEU I  154 ? LEU I 175 . ? 1_555 ? 
311 AH2 6  HOH SE .   ? HOH I 538 . ? 1_555 ? 
312 AH2 6  HOH SE .   ? HOH I 552 . ? 1_555 ? 
313 AH2 6  HOH SE .   ? HOH I 597 . ? 1_555 ? 
314 AH2 6  HOH SE .   ? HOH I 606 . ? 1_555 ? 
315 AH3 5  ARG I  195 ? ARG I 216 . ? 1_555 ? 
316 AH3 5  MET I  231 ? MET I 252 . ? 1_555 ? 
317 AH3 5  LEU I  235 ? LEU I 256 . ? 1_555 ? 
318 AH3 5  LYS I  236 ? LYS I 257 . ? 1_555 ? 
319 AH3 5  HOH SE .   ? HOH I 644 . ? 1_555 ? 
320 AH4 7  ASP J  164 ? ASP J 185 . ? 1_555 ? 
321 AH4 7  HIS J  166 ? HIS J 187 . ? 1_555 ? 
322 AH4 7  ASP J  249 ? ASP J 270 . ? 1_555 ? 
323 AH4 7  ASP J  251 ? ASP J 272 . ? 1_555 ? 
324 AH4 7  MN  VB .   ? MN  J 402 . ? 1_555 ? 
325 AH4 7  HOH TE .   ? HOH J 533 . ? 1_555 ? 
326 AH4 7  HOH TE .   ? HOH J 728 . ? 1_555 ? 
327 AH5 6  HIS J  140 ? HIS J 161 . ? 1_555 ? 
328 AH5 6  ASP J  164 ? ASP J 185 . ? 1_555 ? 
329 AH5 6  ASP J  168 ? ASP J 189 . ? 1_555 ? 
330 AH5 6  ASP J  249 ? ASP J 270 . ? 1_555 ? 
331 AH5 6  MN  UB .   ? MN  J 401 . ? 1_555 ? 
332 AH5 6  HOH TE .   ? HOH J 533 . ? 1_555 ? 
333 AH6 6  SER J  55  ? SER J 76  . ? 1_555 ? 
334 AH6 6  LEU J  58  ? LEU J 79  . ? 1_555 ? 
335 AH6 6  PRO J  61  ? PRO J 82  . ? 1_555 ? 
336 AH6 6  SER J  262 ? SER J 283 . ? 1_555 ? 
337 AH6 6  GLU J  292 ? GLU J 313 . ? 1_555 ? 
338 AH6 6  HOH TE .   ? HOH J 680 . ? 1_555 ? 
339 AH7 6  GLU J  129 ? GLU J 150 . ? 1_555 ? 
340 AH7 6  ARG J  132 ? ARG J 153 . ? 1_555 ? 
341 AH7 6  HOH TE .   ? HOH J 551 . ? 1_555 ? 
342 AH7 6  HOH TE .   ? HOH J 579 . ? 1_555 ? 
343 AH7 6  HOH TE .   ? HOH J 594 . ? 1_555 ? 
344 AH7 6  HOH TE .   ? HOH J 670 . ? 1_555 ? 
345 AH8 4  SER J  55  ? SER J 76  . ? 1_555 ? 
346 AH8 4  PHE J  57  ? PHE J 78  . ? 1_555 ? 
347 AH8 4  GLN J  59  ? GLN J 80  . ? 1_555 ? 
348 AH8 4  HOH TE .   ? HOH J 512 . ? 1_555 ? 
349 AH9 7  ASP K  164 ? ASP K 185 . ? 1_555 ? 
350 AH9 7  HIS K  166 ? HIS K 187 . ? 1_555 ? 
351 AH9 7  ASP K  249 ? ASP K 270 . ? 1_555 ? 
352 AH9 7  ASP K  251 ? ASP K 272 . ? 1_555 ? 
353 AH9 7  MN  AC .   ? MN  K 402 . ? 1_555 ? 
354 AH9 7  HOH UE .   ? HOH K 507 . ? 1_555 ? 
355 AH9 7  HOH UE .   ? HOH K 590 . ? 1_555 ? 
356 AI1 7  HIS K  140 ? HIS K 161 . ? 1_555 ? 
357 AI1 7  ASP K  164 ? ASP K 185 . ? 1_555 ? 
358 AI1 7  ASP K  168 ? ASP K 189 . ? 1_555 ? 
359 AI1 7  ASP K  249 ? ASP K 270 . ? 1_555 ? 
360 AI1 7  MN  ZB .   ? MN  K 401 . ? 1_555 ? 
361 AI1 7  HOH UE .   ? HOH K 507 . ? 1_555 ? 
362 AI1 7  HOH UE .   ? HOH K 509 . ? 1_555 ? 
363 AI2 5  SER K  76  ? SER K 97  . ? 1_555 ? 
364 AI2 5  ASN K  78  ? ASN K 99  . ? 1_555 ? 
365 AI2 5  HOH UE .   ? HOH K 563 . ? 1_555 ? 
366 AI2 5  SER L  56  ? SER L 77  . ? 1_555 ? 
367 AI2 5  TYR L  170 ? TYR L 191 . ? 1_555 ? 
368 AI3 7  SER K  55  ? SER K 76  . ? 1_555 ? 
369 AI3 7  LEU K  58  ? LEU K 79  . ? 1_555 ? 
370 AI3 7  PRO K  61  ? PRO K 82  . ? 1_555 ? 
371 AI3 7  HIS K  180 ? HIS K 201 . ? 1_555 ? 
372 AI3 7  SER K  262 ? SER K 283 . ? 1_555 ? 
373 AI3 7  GLU K  292 ? GLU K 313 . ? 1_555 ? 
374 AI3 7  HOH UE .   ? HOH K 627 . ? 1_555 ? 
375 AI4 5  ARG K  195 ? ARG K 216 . ? 1_555 ? 
376 AI4 5  MET K  231 ? MET K 252 . ? 1_555 ? 
377 AI4 5  LEU K  235 ? LEU K 256 . ? 1_555 ? 
378 AI4 5  LYS K  236 ? LYS K 257 . ? 1_555 ? 
379 AI4 5  HOH UE .   ? HOH K 600 . ? 1_555 ? 
380 AI5 15 SER J  76  ? SER J 97  . ? 1_555 ? 
381 AI5 15 THR J  77  ? THR J 98  . ? 1_555 ? 
382 AI5 15 ASN J  78  ? ASN J 99  . ? 1_555 ? 
383 AI5 15 ASP K  168 ? ASP K 189 . ? 1_555 ? 
384 AI5 15 TYR K  170 ? TYR K 191 . ? 1_555 ? 
385 AI5 15 HIS K  180 ? HIS K 201 . ? 1_555 ? 
386 AI5 15 HIS K  263 ? HIS K 284 . ? 1_555 ? 
387 AI5 15 HOH UE .   ? HOH K 507 . ? 1_555 ? 
388 AI5 15 HOH UE .   ? HOH K 509 . ? 1_555 ? 
389 AI5 15 HOH UE .   ? HOH K 535 . ? 1_555 ? 
390 AI5 15 HOH UE .   ? HOH K 559 . ? 1_555 ? 
391 AI5 15 HOH UE .   ? HOH K 564 . ? 1_555 ? 
392 AI5 15 HOH UE .   ? HOH K 590 . ? 1_555 ? 
393 AI5 15 HOH UE .   ? HOH K 634 . ? 1_555 ? 
394 AI5 15 HOH UE .   ? HOH K 663 . ? 1_555 ? 
395 AI6 7  ASP L  164 ? ASP L 185 . ? 1_555 ? 
396 AI6 7  HIS L  166 ? HIS L 187 . ? 1_555 ? 
397 AI6 7  ASP L  249 ? ASP L 270 . ? 1_555 ? 
398 AI6 7  ASP L  251 ? ASP L 272 . ? 1_555 ? 
399 AI6 7  MN  GC .   ? MN  L 402 . ? 1_555 ? 
400 AI6 7  HOH VE .   ? HOH L 615 . ? 1_555 ? 
401 AI6 7  HOH VE .   ? HOH L 681 . ? 1_555 ? 
402 AI7 7  HIS L  140 ? HIS L 161 . ? 1_555 ? 
403 AI7 7  ASP L  164 ? ASP L 185 . ? 1_555 ? 
404 AI7 7  ASP L  168 ? ASP L 189 . ? 1_555 ? 
405 AI7 7  ASP L  249 ? ASP L 270 . ? 1_555 ? 
406 AI7 7  MN  FC .   ? MN  L 401 . ? 1_555 ? 
407 AI7 7  HOH VE .   ? HOH L 615 . ? 1_555 ? 
408 AI7 7  HOH VE .   ? HOH L 641 . ? 1_555 ? 
409 AI8 9  HIS J  166 ? HIS J 187 . ? 1_555 ? 
410 AI8 9  TYR J  170 ? TYR J 191 . ? 1_555 ? 
411 AI8 9  HIS J  263 ? HIS J 284 . ? 1_555 ? 
412 AI8 9  HOH TE .   ? HOH J 578 . ? 1_555 ? 
413 AI8 9  SER L  76  ? SER L 97  . ? 1_555 ? 
414 AI8 9  ASN L  78  ? ASN L 99  . ? 1_555 ? 
415 AI8 9  HOH VE .   ? HOH L 594 . ? 1_555 ? 
416 AI8 9  HOH VE .   ? HOH L 595 . ? 1_555 ? 
417 AI8 9  HOH VE .   ? HOH L 646 . ? 1_555 ? 
418 AI9 6  SER L  55  ? SER L 76  . ? 1_555 ? 
419 AI9 6  LEU L  58  ? LEU L 79  . ? 1_555 ? 
420 AI9 6  PRO L  61  ? PRO L 82  . ? 1_555 ? 
421 AI9 6  SER L  262 ? SER L 283 . ? 1_555 ? 
422 AI9 6  GLU L  292 ? GLU L 313 . ? 1_555 ? 
423 AI9 6  HOH VE .   ? HOH L 590 . ? 1_555 ? 
424 AJ1 7  ARG L  132 ? ARG L 153 . ? 1_555 ? 
425 AJ1 7  LEU L  154 ? LEU L 175 . ? 1_555 ? 
426 AJ1 7  HOH VE .   ? HOH L 524 . ? 1_555 ? 
427 AJ1 7  HOH VE .   ? HOH L 531 . ? 1_555 ? 
428 AJ1 7  HOH VE .   ? HOH L 539 . ? 1_555 ? 
429 AJ1 7  HOH VE .   ? HOH L 541 . ? 1_555 ? 
430 AJ1 7  HOH VE .   ? HOH L 631 . ? 1_555 ? 
431 AJ2 4  GLU K  83  ? GLU K 104 . ? 1_555 ? 
432 AJ2 4  GLY K  84  ? GLY K 105 . ? 1_555 ? 
433 AJ2 4  HOH UE .   ? HOH K 669 . ? 1_555 ? 
434 AJ2 4  ARG L  223 ? ARG L 244 . ? 1_555 ? 
435 AJ3 7  GLY L  240 ? GLY L 261 . ? 1_555 ? 
436 AJ3 7  VAL L  241 ? VAL L 262 . ? 1_555 ? 
437 AJ3 7  LYS L  242 ? LYS L 263 . ? 1_555 ? 
438 AJ3 7  HOH VE .   ? HOH L 707 . ? 1_555 ? 
439 AJ3 7  LYS U  213 ? LYS U 234 . ? 1_555 ? 
440 AJ3 7  ARG U  214 ? ARG U 235 . ? 1_555 ? 
441 AJ3 7  GLY U  216 ? GLY U 237 . ? 1_555 ? 
442 AJ4 6  GLU L  218 ? GLU L 239 . ? 1_555 ? 
443 AJ4 6  GLN L  219 ? GLN L 240 . ? 1_555 ? 
444 AJ4 6  THR L  224 ? THR L 245 . ? 1_555 ? 
445 AJ4 6  ASP L  228 ? ASP L 249 . ? 1_555 ? 
446 AJ4 6  HOH VE .   ? HOH L 537 . ? 1_555 ? 
447 AJ4 6  HOH VE .   ? HOH L 608 . ? 1_555 ? 
448 AJ5 6  ASP M  164 ? ASP M 185 . ? 1_555 ? 
449 AJ5 6  HIS M  166 ? HIS M 187 . ? 1_555 ? 
450 AJ5 6  ASP M  249 ? ASP M 270 . ? 1_555 ? 
451 AJ5 6  ASP M  251 ? ASP M 272 . ? 1_555 ? 
452 AJ5 6  MN  OC .   ? MN  M 402 . ? 1_555 ? 
453 AJ5 6  HOH WE .   ? HOH M 504 . ? 1_555 ? 
454 AJ6 7  HIS M  140 ? HIS M 161 . ? 1_555 ? 
455 AJ6 7  ASP M  164 ? ASP M 185 . ? 1_555 ? 
456 AJ6 7  ASP M  168 ? ASP M 189 . ? 1_555 ? 
457 AJ6 7  ASP M  249 ? ASP M 270 . ? 1_555 ? 
458 AJ6 7  MN  NC .   ? MN  M 401 . ? 1_555 ? 
459 AJ6 7  HOH WE .   ? HOH M 501 . ? 1_555 ? 
460 AJ6 7  HOH WE .   ? HOH M 504 . ? 1_555 ? 
461 AJ7 6  SER M  55  ? SER M 76  . ? 1_555 ? 
462 AJ7 6  LEU M  58  ? LEU M 79  . ? 1_555 ? 
463 AJ7 6  PRO M  61  ? PRO M 82  . ? 1_555 ? 
464 AJ7 6  SER M  262 ? SER M 283 . ? 1_555 ? 
465 AJ7 6  GLU M  292 ? GLU M 313 . ? 1_555 ? 
466 AJ7 6  HOH WE .   ? HOH M 508 . ? 1_555 ? 
467 AJ8 7  ASP N  164 ? ASP N 185 . ? 1_555 ? 
468 AJ8 7  HIS N  166 ? HIS N 187 . ? 1_555 ? 
469 AJ8 7  ASP N  249 ? ASP N 270 . ? 1_555 ? 
470 AJ8 7  ASP N  251 ? ASP N 272 . ? 1_555 ? 
471 AJ8 7  MN  RC .   ? MN  N 402 . ? 1_555 ? 
472 AJ8 7  HOH XE .   ? HOH N 609 . ? 1_555 ? 
473 AJ8 7  HOH XE .   ? HOH N 637 . ? 1_555 ? 
474 AJ9 7  HIS N  140 ? HIS N 161 . ? 1_555 ? 
475 AJ9 7  ASP N  164 ? ASP N 185 . ? 1_555 ? 
476 AJ9 7  ASP N  168 ? ASP N 189 . ? 1_555 ? 
477 AJ9 7  ASP N  249 ? ASP N 270 . ? 1_555 ? 
478 AJ9 7  MN  QC .   ? MN  N 401 . ? 1_555 ? 
479 AJ9 7  HOH XE .   ? HOH N 596 . ? 1_555 ? 
480 AJ9 7  HOH XE .   ? HOH N 609 . ? 1_555 ? 
481 AK1 9  SER M  56  ? SER M 77  . ? 1_555 ? 
482 AK1 9  TYR M  170 ? TYR M 191 . ? 1_555 ? 
483 AK1 9  HOH WE .   ? HOH M 505 . ? 1_555 ? 
484 AK1 9  HOH WE .   ? HOH M 541 . ? 1_555 ? 
485 AK1 9  SER N  76  ? SER N 97  . ? 1_555 ? 
486 AK1 9  ASN N  78  ? ASN N 99  . ? 1_555 ? 
487 AK1 9  HOH XE .   ? HOH N 585 . ? 1_555 ? 
488 AK1 9  HOH XE .   ? HOH N 604 . ? 1_555 ? 
489 AK1 9  HOH XE .   ? HOH N 630 . ? 1_555 ? 
490 AK2 6  SER N  55  ? SER N 76  . ? 1_555 ? 
491 AK2 6  LEU N  58  ? LEU N 79  . ? 1_555 ? 
492 AK2 6  PRO N  61  ? PRO N 82  . ? 1_555 ? 
493 AK2 6  SER N  262 ? SER N 283 . ? 1_555 ? 
494 AK2 6  GLU N  292 ? GLU N 313 . ? 1_555 ? 
495 AK2 6  HOH XE .   ? HOH N 594 . ? 1_555 ? 
496 AK3 7  ASP O  164 ? ASP O 185 . ? 1_555 ? 
497 AK3 7  HIS O  166 ? HIS O 187 . ? 1_555 ? 
498 AK3 7  ASP O  249 ? ASP O 270 . ? 1_555 ? 
499 AK3 7  ASP O  251 ? ASP O 272 . ? 1_555 ? 
500 AK3 7  MN  VC .   ? MN  O 402 . ? 1_555 ? 
501 AK3 7  HOH YE .   ? HOH O 509 . ? 1_555 ? 
502 AK3 7  HOH YE .   ? HOH O 521 . ? 1_555 ? 
503 AK4 6  HIS O  140 ? HIS O 161 . ? 1_555 ? 
504 AK4 6  ASP O  164 ? ASP O 185 . ? 1_555 ? 
505 AK4 6  ASP O  168 ? ASP O 189 . ? 1_555 ? 
506 AK4 6  ASP O  249 ? ASP O 270 . ? 1_555 ? 
507 AK4 6  MN  UC .   ? MN  O 401 . ? 1_555 ? 
508 AK4 6  HOH YE .   ? HOH O 521 . ? 1_555 ? 
509 AK5 5  SER O  55  ? SER O 76  . ? 1_555 ? 
510 AK5 5  LEU O  58  ? LEU O 79  . ? 1_555 ? 
511 AK5 5  SER O  262 ? SER O 283 . ? 1_555 ? 
512 AK5 5  GLU O  292 ? GLU O 313 . ? 1_555 ? 
513 AK5 5  HOH YE .   ? HOH O 532 . ? 1_555 ? 
514 AK6 7  ASP P  164 ? ASP P 185 . ? 1_555 ? 
515 AK6 7  HIS P  166 ? HIS P 187 . ? 1_555 ? 
516 AK6 7  ASP P  249 ? ASP P 270 . ? 1_555 ? 
517 AK6 7  ASP P  251 ? ASP P 272 . ? 1_555 ? 
518 AK6 7  MN  YC .   ? MN  P 402 . ? 1_555 ? 
519 AK6 7  HOH ZE .   ? HOH P 505 . ? 1_555 ? 
520 AK6 7  HOH ZE .   ? HOH P 623 . ? 1_555 ? 
521 AK7 7  HIS P  140 ? HIS P 161 . ? 1_555 ? 
522 AK7 7  ASP P  164 ? ASP P 185 . ? 1_555 ? 
523 AK7 7  ASP P  168 ? ASP P 189 . ? 1_555 ? 
524 AK7 7  ASP P  249 ? ASP P 270 . ? 1_555 ? 
525 AK7 7  MN  XC .   ? MN  P 401 . ? 1_555 ? 
526 AK7 7  HOH ZE .   ? HOH P 504 . ? 1_555 ? 
527 AK7 7  HOH ZE .   ? HOH P 505 . ? 1_555 ? 
528 AK8 5  SER P  76  ? SER P 97  . ? 1_555 ? 
529 AK8 5  ASN P  78  ? ASN P 99  . ? 1_555 ? 
530 AK8 5  HOH ZE .   ? HOH P 602 . ? 1_555 ? 
531 AK8 5  TYR Q  170 ? TYR Q 191 . ? 1_555 ? 
532 AK8 5  HOH AF .   ? HOH Q 605 . ? 1_555 ? 
533 AK9 5  SER P  55  ? SER P 76  . ? 1_555 ? 
534 AK9 5  LEU P  58  ? LEU P 79  . ? 1_555 ? 
535 AK9 5  SER P  262 ? SER P 283 . ? 1_555 ? 
536 AK9 5  GLU P  292 ? GLU P 313 . ? 1_555 ? 
537 AK9 5  HOH ZE .   ? HOH P 592 . ? 1_555 ? 
538 AL1 11 ASP P  168 ? ASP P 189 . ? 1_555 ? 
539 AL1 11 TYR P  170 ? TYR P 191 . ? 1_555 ? 
540 AL1 11 HIS P  180 ? HIS P 201 . ? 1_555 ? 
541 AL1 11 HIS P  263 ? HIS P 284 . ? 1_555 ? 
542 AL1 11 HOH ZE .   ? HOH P 504 . ? 1_555 ? 
543 AL1 11 HOH ZE .   ? HOH P 505 . ? 1_555 ? 
544 AL1 11 HOH ZE .   ? HOH P 515 . ? 1_555 ? 
545 AL1 11 HOH ZE .   ? HOH P 520 . ? 1_555 ? 
546 AL1 11 HOH ZE .   ? HOH P 572 . ? 1_555 ? 
547 AL1 11 HOH ZE .   ? HOH P 623 . ? 1_555 ? 
548 AL1 11 ASN R  78  ? ASN R 99  . ? 1_555 ? 
549 AL2 7  ASP Q  164 ? ASP Q 185 . ? 1_555 ? 
550 AL2 7  HIS Q  166 ? HIS Q 187 . ? 1_555 ? 
551 AL2 7  ASP Q  249 ? ASP Q 270 . ? 1_555 ? 
552 AL2 7  ASP Q  251 ? ASP Q 272 . ? 1_555 ? 
553 AL2 7  MN  DD .   ? MN  Q 402 . ? 1_555 ? 
554 AL2 7  HOH AF .   ? HOH Q 627 . ? 1_555 ? 
555 AL2 7  HOH AF .   ? HOH Q 645 . ? 1_555 ? 
556 AL3 7  HIS Q  140 ? HIS Q 161 . ? 1_555 ? 
557 AL3 7  ASP Q  164 ? ASP Q 185 . ? 1_555 ? 
558 AL3 7  ASP Q  168 ? ASP Q 189 . ? 1_555 ? 
559 AL3 7  ASP Q  249 ? ASP Q 270 . ? 1_555 ? 
560 AL3 7  MN  CD .   ? MN  Q 401 . ? 1_555 ? 
561 AL3 7  HOH AF .   ? HOH Q 627 . ? 1_555 ? 
562 AL3 7  HOH AF .   ? HOH Q 647 . ? 1_555 ? 
563 AL4 5  ASN Q  78  ? ASN Q 99  . ? 1_555 ? 
564 AL4 5  HOH AF .   ? HOH Q 540 . ? 1_555 ? 
565 AL4 5  HIS R  166 ? HIS R 187 . ? 1_555 ? 
566 AL4 5  TYR R  170 ? TYR R 191 . ? 1_555 ? 
567 AL4 5  HOH BF .   ? HOH R 583 . ? 1_555 ? 
568 AL5 6  SER Q  55  ? SER Q 76  . ? 1_555 ? 
569 AL5 6  LEU Q  58  ? LEU Q 79  . ? 1_555 ? 
570 AL5 6  PRO Q  61  ? PRO Q 82  . ? 1_555 ? 
571 AL5 6  SER Q  262 ? SER Q 283 . ? 1_555 ? 
572 AL5 6  GLU Q  292 ? GLU Q 313 . ? 1_555 ? 
573 AL5 6  HOH AF .   ? HOH Q 595 . ? 1_555 ? 
574 AL6 7  ASP R  164 ? ASP R 185 . ? 1_555 ? 
575 AL6 7  HIS R  166 ? HIS R 187 . ? 1_555 ? 
576 AL6 7  ASP R  249 ? ASP R 270 . ? 1_555 ? 
577 AL6 7  ASP R  251 ? ASP R 272 . ? 1_555 ? 
578 AL6 7  MN  HD .   ? MN  R 402 . ? 1_555 ? 
579 AL6 7  HOH BF .   ? HOH R 598 . ? 1_555 ? 
580 AL6 7  HOH BF .   ? HOH R 611 . ? 1_555 ? 
581 AL7 7  HIS R  140 ? HIS R 161 . ? 1_555 ? 
582 AL7 7  ASP R  164 ? ASP R 185 . ? 1_555 ? 
583 AL7 7  ASP R  168 ? ASP R 189 . ? 1_555 ? 
584 AL7 7  ASP R  249 ? ASP R 270 . ? 1_555 ? 
585 AL7 7  MN  GD .   ? MN  R 401 . ? 1_555 ? 
586 AL7 7  HOH BF .   ? HOH R 598 . ? 1_555 ? 
587 AL7 7  HOH BF .   ? HOH R 642 . ? 1_555 ? 
588 AL8 6  SER R  55  ? SER R 76  . ? 1_555 ? 
589 AL8 6  LEU R  58  ? LEU R 79  . ? 1_555 ? 
590 AL8 6  PRO R  61  ? PRO R 82  . ? 1_555 ? 
591 AL8 6  SER R  262 ? SER R 283 . ? 1_555 ? 
592 AL8 6  GLU R  292 ? GLU R 313 . ? 1_555 ? 
593 AL8 6  HOH BF .   ? HOH R 587 . ? 1_555 ? 
594 AL9 6  ARG R  132 ? ARG R 153 . ? 1_555 ? 
595 AL9 6  LEU R  154 ? LEU R 175 . ? 1_555 ? 
596 AL9 6  HOH BF .   ? HOH R 527 . ? 1_555 ? 
597 AL9 6  HOH BF .   ? HOH R 543 . ? 1_555 ? 
598 AL9 6  HOH BF .   ? HOH R 546 . ? 1_555 ? 
599 AL9 6  HOH BF .   ? HOH R 572 . ? 1_555 ? 
600 AM1 7  ASP S  164 ? ASP S 185 . ? 1_555 ? 
601 AM1 7  HIS S  166 ? HIS S 187 . ? 1_555 ? 
602 AM1 7  ASP S  249 ? ASP S 270 . ? 1_555 ? 
603 AM1 7  ASP S  251 ? ASP S 272 . ? 1_555 ? 
604 AM1 7  MN  LD .   ? MN  S 402 . ? 1_555 ? 
605 AM1 7  HOH CF .   ? HOH S 515 . ? 1_555 ? 
606 AM1 7  HOH CF .   ? HOH S 626 . ? 1_555 ? 
607 AM2 7  HIS S  140 ? HIS S 161 . ? 1_555 ? 
608 AM2 7  ASP S  164 ? ASP S 185 . ? 1_555 ? 
609 AM2 7  ASP S  168 ? ASP S 189 . ? 1_555 ? 
610 AM2 7  ASP S  249 ? ASP S 270 . ? 1_555 ? 
611 AM2 7  MN  KD .   ? MN  S 401 . ? 1_555 ? 
612 AM2 7  HOH CF .   ? HOH S 515 . ? 1_555 ? 
613 AM2 7  HOH CF .   ? HOH S 531 . ? 1_555 ? 
614 AM3 6  HIS S  166 ? HIS S 187 . ? 1_555 ? 
615 AM3 6  TYR S  170 ? TYR S 191 . ? 1_555 ? 
616 AM3 6  HOH CF .   ? HOH S 530 . ? 1_555 ? 
617 AM3 6  HOH CF .   ? HOH S 559 . ? 1_555 ? 
618 AM3 6  HOH CF .   ? HOH S 628 . ? 1_555 ? 
619 AM3 6  ASN T  78  ? ASN T 99  . ? 1_555 ? 
620 AM4 6  SER S  55  ? SER S 76  . ? 1_555 ? 
621 AM4 6  LEU S  58  ? LEU S 79  . ? 1_555 ? 
622 AM4 6  PRO S  61  ? PRO S 82  . ? 1_555 ? 
623 AM4 6  SER S  262 ? SER S 283 . ? 1_555 ? 
624 AM4 6  GLU S  292 ? GLU S 313 . ? 1_555 ? 
625 AM4 6  HOH CF .   ? HOH S 615 . ? 1_555 ? 
626 AM5 7  ARG S  132 ? ARG S 153 . ? 1_555 ? 
627 AM5 7  LEU S  154 ? LEU S 175 . ? 1_555 ? 
628 AM5 7  HOH CF .   ? HOH S 505 . ? 1_555 ? 
629 AM5 7  HOH CF .   ? HOH S 506 . ? 1_555 ? 
630 AM5 7  HOH CF .   ? HOH S 562 . ? 1_555 ? 
631 AM5 7  HOH CF .   ? HOH S 576 . ? 1_555 ? 
632 AM5 7  HOH CF .   ? HOH S 586 . ? 1_555 ? 
633 AM6 7  ASP T  164 ? ASP T 185 . ? 1_555 ? 
634 AM6 7  HIS T  166 ? HIS T 187 . ? 1_555 ? 
635 AM6 7  ASP T  249 ? ASP T 270 . ? 1_555 ? 
636 AM6 7  ASP T  251 ? ASP T 272 . ? 1_555 ? 
637 AM6 7  MN  QD .   ? MN  T 402 . ? 1_555 ? 
638 AM6 7  HOH DF .   ? HOH T 603 . ? 1_555 ? 
639 AM6 7  HOH DF .   ? HOH T 616 . ? 1_555 ? 
640 AM7 7  HIS T  140 ? HIS T 161 . ? 1_555 ? 
641 AM7 7  ASP T  164 ? ASP T 185 . ? 1_555 ? 
642 AM7 7  ASP T  168 ? ASP T 189 . ? 1_555 ? 
643 AM7 7  ASP T  249 ? ASP T 270 . ? 1_555 ? 
644 AM7 7  MN  PD .   ? MN  T 401 . ? 1_555 ? 
645 AM7 7  HOH DF .   ? HOH T 603 . ? 1_555 ? 
646 AM7 7  HOH DF .   ? HOH T 648 . ? 1_555 ? 
647 AM8 6  SER T  55  ? SER T 76  . ? 1_555 ? 
648 AM8 6  LEU T  58  ? LEU T 79  . ? 1_555 ? 
649 AM8 6  PRO T  61  ? PRO T 82  . ? 1_555 ? 
650 AM8 6  SER T  262 ? SER T 283 . ? 1_555 ? 
651 AM8 6  GLU T  292 ? GLU T 313 . ? 1_555 ? 
652 AM8 6  HOH DF .   ? HOH T 624 . ? 1_555 ? 
653 AM9 7  GLU T  129 ? GLU T 150 . ? 1_555 ? 
654 AM9 7  ARG T  132 ? ARG T 153 . ? 1_555 ? 
655 AM9 7  LEU T  154 ? LEU T 175 . ? 1_555 ? 
656 AM9 7  HOH DF .   ? HOH T 505 . ? 1_555 ? 
657 AM9 7  HOH DF .   ? HOH T 557 . ? 1_555 ? 
658 AM9 7  HOH DF .   ? HOH T 562 . ? 1_555 ? 
659 AM9 7  HOH DF .   ? HOH T 632 . ? 1_555 ? 
660 AN1 7  ASP U  164 ? ASP U 185 . ? 1_555 ? 
661 AN1 7  HIS U  166 ? HIS U 187 . ? 1_555 ? 
662 AN1 7  ASP U  249 ? ASP U 270 . ? 1_555 ? 
663 AN1 7  ASP U  251 ? ASP U 272 . ? 1_555 ? 
664 AN1 7  MN  UD .   ? MN  U 402 . ? 1_555 ? 
665 AN1 7  HOH EF .   ? HOH U 527 . ? 1_555 ? 
666 AN1 7  HOH EF .   ? HOH U 631 . ? 1_555 ? 
667 AN2 7  HIS U  140 ? HIS U 161 . ? 1_555 ? 
668 AN2 7  ASP U  164 ? ASP U 185 . ? 1_555 ? 
669 AN2 7  ASP U  168 ? ASP U 189 . ? 1_555 ? 
670 AN2 7  ASP U  249 ? ASP U 270 . ? 1_555 ? 
671 AN2 7  MN  TD .   ? MN  U 401 . ? 1_555 ? 
672 AN2 7  HOH EF .   ? HOH U 507 . ? 1_555 ? 
673 AN2 7  HOH EF .   ? HOH U 527 . ? 1_555 ? 
674 AN3 6  TYR T  170 ? TYR T 191 . ? 1_555 ? 
675 AN3 6  HOH DF .   ? HOH T 544 . ? 1_555 ? 
676 AN3 6  HOH DF .   ? HOH T 592 . ? 1_555 ? 
677 AN3 6  SER U  76  ? SER U 97  . ? 1_555 ? 
678 AN3 6  ASN U  78  ? ASN U 99  . ? 1_555 ? 
679 AN3 6  HOH EF .   ? HOH U 601 . ? 1_555 ? 
680 AN4 6  SER U  55  ? SER U 76  . ? 1_555 ? 
681 AN4 6  LEU U  58  ? LEU U 79  . ? 1_555 ? 
682 AN4 6  PRO U  61  ? PRO U 82  . ? 1_555 ? 
683 AN4 6  SER U  262 ? SER U 283 . ? 1_555 ? 
684 AN4 6  GLU U  292 ? GLU U 313 . ? 1_555 ? 
685 AN4 6  HOH EF .   ? HOH U 605 . ? 1_555 ? 
686 AN5 11 SER S  76  ? SER S 97  . ? 1_555 ? 
687 AN5 11 THR S  77  ? THR S 98  . ? 1_555 ? 
688 AN5 11 ASN S  78  ? ASN S 99  . ? 1_555 ? 
689 AN5 11 HIS U  166 ? HIS U 187 . ? 1_555 ? 
690 AN5 11 ASP U  168 ? ASP U 189 . ? 1_555 ? 
691 AN5 11 TYR U  170 ? TYR U 191 . ? 1_555 ? 
692 AN5 11 HOH EF .   ? HOH U 503 . ? 1_555 ? 
693 AN5 11 HOH EF .   ? HOH U 507 . ? 1_555 ? 
694 AN5 11 HOH EF .   ? HOH U 527 . ? 1_555 ? 
695 AN5 11 HOH EF .   ? HOH U 532 . ? 1_555 ? 
696 AN5 11 HOH EF .   ? HOH U 603 . ? 1_555 ? 
697 AN6 6  ASP V  164 ? ASP V 185 . ? 1_555 ? 
698 AN6 6  HIS V  166 ? HIS V 187 . ? 1_555 ? 
699 AN6 6  ASP V  249 ? ASP V 270 . ? 1_555 ? 
700 AN6 6  ASP V  251 ? ASP V 272 . ? 1_555 ? 
701 AN6 6  MN  ZD .   ? MN  V 402 . ? 1_555 ? 
702 AN6 6  HOH FF .   ? HOH V 504 . ? 1_555 ? 
703 AN7 7  HIS V  140 ? HIS V 161 . ? 1_555 ? 
704 AN7 7  ASP V  164 ? ASP V 185 . ? 1_555 ? 
705 AN7 7  ASP V  168 ? ASP V 189 . ? 1_555 ? 
706 AN7 7  ASP V  249 ? ASP V 270 . ? 1_555 ? 
707 AN7 7  MN  YD .   ? MN  V 401 . ? 1_555 ? 
708 AN7 7  HOH FF .   ? HOH V 504 . ? 1_555 ? 
709 AN7 7  HOH FF .   ? HOH V 515 . ? 1_555 ? 
710 AN8 6  SER V  55  ? SER V 76  . ? 1_555 ? 
711 AN8 6  LEU V  58  ? LEU V 79  . ? 1_555 ? 
712 AN8 6  HIS V  180 ? HIS V 201 . ? 1_555 ? 
713 AN8 6  SER V  262 ? SER V 283 . ? 1_555 ? 
714 AN8 6  GLU V  292 ? GLU V 313 . ? 1_555 ? 
715 AN8 6  HOH FF .   ? HOH V 522 . ? 1_555 ? 
716 AN9 11 HIS V  166 ? HIS V 187 . ? 1_555 ? 
717 AN9 11 ASP V  168 ? ASP V 189 . ? 1_555 ? 
718 AN9 11 TYR V  170 ? TYR V 191 . ? 1_555 ? 
719 AN9 11 HIS V  180 ? HIS V 201 . ? 1_555 ? 
720 AN9 11 HIS V  263 ? HIS V 284 . ? 1_555 ? 
721 AN9 11 HOH FF .   ? HOH V 504 . ? 1_555 ? 
722 AN9 11 HOH FF .   ? HOH V 515 . ? 1_555 ? 
723 AN9 11 SER X  76  ? SER X 97  . ? 1_555 ? 
724 AN9 11 THR X  77  ? THR X 98  . ? 1_555 ? 
725 AN9 11 ASN X  78  ? ASN X 99  . ? 1_555 ? 
726 AN9 11 HOH HF .   ? HOH X 537 . ? 1_555 ? 
727 AO1 6  ASP W  164 ? ASP W 185 . ? 1_555 ? 
728 AO1 6  HIS W  166 ? HIS W 187 . ? 1_555 ? 
729 AO1 6  ASP W  249 ? ASP W 270 . ? 1_555 ? 
730 AO1 6  ASP W  251 ? ASP W 272 . ? 1_555 ? 
731 AO1 6  MN  DE .   ? MN  W 402 . ? 1_555 ? 
732 AO1 6  HOH GF .   ? HOH W 556 . ? 1_555 ? 
733 AO2 7  HIS W  140 ? HIS W 161 . ? 1_555 ? 
734 AO2 7  ASP W  164 ? ASP W 185 . ? 1_555 ? 
735 AO2 7  ASP W  168 ? ASP W 189 . ? 1_555 ? 
736 AO2 7  ASP W  249 ? ASP W 270 . ? 1_555 ? 
737 AO2 7  MN  CE .   ? MN  W 401 . ? 1_555 ? 
738 AO2 7  HOH GF .   ? HOH W 556 . ? 1_555 ? 
739 AO2 7  HOH GF .   ? HOH W 577 . ? 1_555 ? 
740 AO3 7  SER W  76  ? SER W 97  . ? 1_555 ? 
741 AO3 7  ASN W  78  ? ASN W 99  . ? 1_555 ? 
742 AO3 7  HOH GF .   ? HOH W 557 . ? 1_555 ? 
743 AO3 7  HIS X  166 ? HIS X 187 . ? 1_555 ? 
744 AO3 7  TYR X  170 ? TYR X 191 . ? 1_555 ? 
745 AO3 7  HOH HF .   ? HOH X 578 . ? 1_555 ? 
746 AO3 7  HOH HF .   ? HOH X 583 . ? 1_555 ? 
747 AO4 6  SER W  55  ? SER W 76  . ? 1_555 ? 
748 AO4 6  LEU W  58  ? LEU W 79  . ? 1_555 ? 
749 AO4 6  PRO W  61  ? PRO W 82  . ? 1_555 ? 
750 AO4 6  SER W  262 ? SER W 283 . ? 1_555 ? 
751 AO4 6  GLU W  292 ? GLU W 313 . ? 1_555 ? 
752 AO4 6  HOH GF .   ? HOH W 551 . ? 1_555 ? 
753 AO5 1  ASP W  106 ? ASP W 127 . ? 1_555 ? 
754 AO6 7  ASP X  164 ? ASP X 185 . ? 1_555 ? 
755 AO6 7  HIS X  166 ? HIS X 187 . ? 1_555 ? 
756 AO6 7  ASP X  249 ? ASP X 270 . ? 1_555 ? 
757 AO6 7  ASP X  251 ? ASP X 272 . ? 1_555 ? 
758 AO6 7  MN  IE .   ? MN  X 402 . ? 1_555 ? 
759 AO6 7  HOH HF .   ? HOH X 511 . ? 1_555 ? 
760 AO6 7  HOH HF .   ? HOH X 609 . ? 1_555 ? 
761 AO7 7  HIS X  140 ? HIS X 161 . ? 1_555 ? 
762 AO7 7  ASP X  164 ? ASP X 185 . ? 1_555 ? 
763 AO7 7  ASP X  168 ? ASP X 189 . ? 1_555 ? 
764 AO7 7  ASP X  249 ? ASP X 270 . ? 1_555 ? 
765 AO7 7  MN  HE .   ? MN  X 401 . ? 1_555 ? 
766 AO7 7  HOH HF .   ? HOH X 511 . ? 1_555 ? 
767 AO7 7  HOH HF .   ? HOH X 583 . ? 1_555 ? 
768 AO8 5  SER X  55  ? SER X 76  . ? 1_555 ? 
769 AO8 5  LEU X  58  ? LEU X 79  . ? 1_555 ? 
770 AO8 5  SER X  262 ? SER X 283 . ? 1_555 ? 
771 AO8 5  GLU X  292 ? GLU X 313 . ? 1_555 ? 
772 AO8 5  HOH HF .   ? HOH X 582 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6VSU 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.003741 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003741 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003804 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . SER A  1 6   ? 114.293 118.901 138.782 1.00 121.17 ? 27  SER A N   1 
ATOM   2     C  CA  . SER A  1 6   ? 114.303 120.387 138.596 1.00 115.26 ? 27  SER A CA  1 
ATOM   3     C  C   . SER A  1 6   ? 113.267 120.758 137.530 1.00 114.61 ? 27  SER A C   1 
ATOM   4     O  O   . SER A  1 6   ? 113.678 121.202 136.446 1.00 114.66 ? 27  SER A O   1 
ATOM   5     C  CB  . SER A  1 6   ? 115.686 120.876 138.239 1.00 113.19 ? 27  SER A CB  1 
ATOM   6     O  OG  . SER A  1 6   ? 115.694 122.279 138.066 1.00 108.52 ? 27  SER A OG  1 
ATOM   7     N  N   . SER A  1 7   ? 111.980 120.539 137.836 1.00 114.26 ? 28  SER A N   1 
ATOM   8     C  CA  . SER A  1 7   ? 110.796 120.980 137.047 1.00 111.92 ? 28  SER A CA  1 
ATOM   9     C  C   . SER A  1 7   ? 110.517 122.474 137.294 1.00 107.41 ? 28  SER A C   1 
ATOM   10    O  O   . SER A  1 7   ? 109.452 122.954 136.837 1.00 107.29 ? 28  SER A O   1 
ATOM   11    C  CB  . SER A  1 7   ? 109.577 120.145 137.369 1.00 114.23 ? 28  SER A CB  1 
ATOM   12    O  OG  . SER A  1 7   ? 108.409 120.956 137.406 1.00 110.61 ? 28  SER A OG  1 
ATOM   13    N  N   . ILE A  1 8   ? 111.409 123.188 137.996 1.00 103.51 ? 29  ILE A N   1 
ATOM   14    C  CA  . ILE A  1 8   ? 111.316 124.671 138.176 1.00 98.22  ? 29  ILE A CA  1 
ATOM   15    C  C   . ILE A  1 8   ? 111.808 125.354 136.895 1.00 95.17  ? 29  ILE A C   1 
ATOM   16    O  O   . ILE A  1 8   ? 111.518 126.565 136.724 1.00 91.96  ? 29  ILE A O   1 
ATOM   17    C  CB  . ILE A  1 8   ? 112.065 125.177 139.436 1.00 97.09  ? 29  ILE A CB  1 
ATOM   18    C  CG1 . ILE A  1 8   ? 113.430 124.509 139.653 1.00 99.47  ? 29  ILE A CG1 1 
ATOM   19    C  CG2 . ILE A  1 8   ? 111.174 125.029 140.662 1.00 97.25  ? 29  ILE A CG2 1 
ATOM   20    C  CD1 . ILE A  1 8   ? 114.271 125.151 140.758 1.00 97.11  ? 29  ILE A CD1 1 
ATOM   21    N  N   . GLU A  1 9   ? 112.514 124.612 136.033 1.00 95.55  ? 30  GLU A N   1 
ATOM   22    C  CA  . GLU A  1 9   ? 113.139 125.152 134.799 1.00 93.52  ? 30  GLU A CA  1 
ATOM   23    C  C   . GLU A  1 9   ? 112.051 125.341 133.741 1.00 91.94  ? 30  GLU A C   1 
ATOM   24    O  O   . GLU A  1 9   ? 112.010 126.423 133.150 1.00 89.99  ? 30  GLU A O   1 
ATOM   25    C  CB  . GLU A  1 9   ? 114.296 124.258 134.351 1.00 97.06  ? 30  GLU A CB  1 
ATOM   26    C  CG  . GLU A  1 9   ? 115.667 124.800 134.755 1.00 95.87  ? 30  GLU A CG  1 
ATOM   27    C  CD  . GLU A  1 9   ? 115.761 125.493 136.113 1.00 92.79  ? 30  GLU A CD  1 
ATOM   28    O  OE1 . GLU A  1 9   ? 115.258 124.922 137.113 1.00 94.47  ? 30  GLU A OE1 1 
ATOM   29    O  OE2 . GLU A  1 9   ? 116.347 126.590 136.176 1.00 87.97  ? 30  GLU A OE2 1 
ATOM   30    N  N   . LYS A  1 10  ? 111.191 124.343 133.557 1.00 93.42  ? 31  LYS A N   1 
ATOM   31    C  CA  . LYS A  1 10  ? 110.000 124.365 132.652 1.00 93.43  ? 31  LYS A CA  1 
ATOM   32    C  C   . LYS A  1 10  ? 109.046 125.470 133.123 1.00 88.90  ? 31  LYS A C   1 
ATOM   33    O  O   . LYS A  1 10  ? 108.338 126.062 132.280 1.00 87.87  ? 31  LYS A O   1 
ATOM   34    C  CB  . LYS A  1 10  ? 109.253 123.020 132.681 1.00 97.17  ? 31  LYS A CB  1 
ATOM   35    C  CG  . LYS A  1 10  ? 108.719 122.500 131.348 1.00 100.30 ? 31  LYS A CG  1 
ATOM   36    C  CD  . LYS A  1 10  ? 107.758 123.437 130.656 1.00 98.53  ? 31  LYS A CD  1 
ATOM   37    C  CE  . LYS A  1 10  ? 107.209 122.871 129.368 1.00 101.76 ? 31  LYS A CE  1 
ATOM   38    N  NZ  . LYS A  1 10  ? 106.294 121.737 129.634 1.00 105.20 ? 31  LYS A NZ  1 
ATOM   39    N  N   . GLY A  1 11  ? 108.981 125.670 134.444 1.00 86.43  ? 32  GLY A N   1 
ATOM   40    C  CA  . GLY A  1 11  ? 108.176 126.727 135.079 1.00 82.30  ? 32  GLY A CA  1 
ATOM   41    C  C   . GLY A  1 11  ? 108.816 128.073 134.830 1.00 78.12  ? 32  GLY A C   1 
ATOM   42    O  O   . GLY A  1 11  ? 108.186 128.914 134.153 1.00 76.24  ? 32  GLY A O   1 
ATOM   43    N  N   . GLN A  1 12  ? 110.045 128.256 135.328 1.00 76.59  ? 33  GLN A N   1 
ATOM   44    C  CA  . GLN A  1 12  ? 110.798 129.521 135.157 1.00 73.40  ? 33  GLN A CA  1 
ATOM   45    C  C   . GLN A  1 12  ? 110.693 129.917 133.687 1.00 73.63  ? 33  GLN A C   1 
ATOM   46    O  O   . GLN A  1 12  ? 110.371 131.109 133.441 1.00 71.64  ? 33  GLN A O   1 
ATOM   47    C  CB  . GLN A  1 12  ? 112.235 129.377 135.646 1.00 73.14  ? 33  GLN A CB  1 
ATOM   48    C  CG  . GLN A  1 12  ? 112.339 129.363 137.163 1.00 72.15  ? 33  GLN A CG  1 
ATOM   49    C  CD  . GLN A  1 12  ? 113.776 129.285 137.603 1.00 72.15  ? 33  GLN A CD  1 
ATOM   50    O  OE1 . GLN A  1 12  ? 114.643 128.955 136.808 1.00 74.87  ? 33  GLN A OE1 1 
ATOM   51    N  NE2 . GLN A  1 12  ? 114.049 129.564 138.863 1.00 70.26  ? 33  GLN A NE2 1 
ATOM   52    N  N   . ASN A  1 13  ? 110.862 128.937 132.787 1.00 76.19  ? 34  ASN A N   1 
ATOM   53    C  CA  . ASN A  1 13  ? 110.878 129.142 131.318 1.00 77.45  ? 34  ASN A CA  1 
ATOM   54    C  C   . ASN A  1 13  ? 109.497 129.573 130.834 1.00 77.28  ? 34  ASN A C   1 
ATOM   55    O  O   . ASN A  1 13  ? 109.442 130.462 129.964 1.00 76.59  ? 34  ASN A O   1 
ATOM   56    C  CB  . ASN A  1 13  ? 111.312 127.910 130.509 1.00 81.20  ? 34  ASN A CB  1 
ATOM   57    C  CG  . ASN A  1 13  ? 112.803 127.812 130.260 1.00 81.57  ? 34  ASN A CG  1 
ATOM   58    O  OD1 . ASN A  1 13  ? 113.535 128.780 130.416 1.00 78.88  ? 34  ASN A OD1 1 
ATOM   59    N  ND2 . ASN A  1 13  ? 113.254 126.641 129.831 1.00 85.50  ? 34  ASN A ND2 1 
ATOM   60    N  N   . ARG A  1 14  ? 108.414 128.946 131.289 1.00 78.80  ? 35  ARG A N   1 
ATOM   61    C  CA  . ARG A  1 14  ? 107.096 129.280 130.684 1.00 79.61  ? 35  ARG A CA  1 
ATOM   62    C  C   . ARG A  1 14  ? 106.553 130.544 131.337 1.00 75.88  ? 35  ARG A C   1 
ATOM   63    O  O   . ARG A  1 14  ? 105.826 131.289 130.645 1.00 74.91  ? 35  ARG A O   1 
ATOM   64    C  CB  . ARG A  1 14  ? 106.131 128.101 130.668 1.00 83.48  ? 35  ARG A CB  1 
ATOM   65    C  CG  . ARG A  1 14  ? 106.378 127.210 129.463 1.00 87.55  ? 35  ARG A CG  1 
ATOM   66    C  CD  . ARG A  1 14  ? 105.187 126.342 129.133 1.00 91.54  ? 35  ARG A CD  1 
ATOM   67    N  NE  . ARG A  1 14  ? 104.833 125.509 130.262 1.00 92.97  ? 35  ARG A NE  1 
ATOM   68    C  CZ  . ARG A  1 14  ? 104.142 124.388 130.193 1.00 96.83  ? 35  ARG A CZ  1 
ATOM   69    N  NH1 . ARG A  1 14  ? 103.875 123.756 131.319 1.00 98.35  ? 35  ARG A NH1 1 
ATOM   70    N  NH2 . ARG A  1 14  ? 103.700 123.909 129.039 1.00 100.28 ? 35  ARG A NH2 1 
ATOM   71    N  N   . VAL A  1 15  ? 106.965 130.809 132.578 1.00 74.01  ? 36  VAL A N   1 
ATOM   72    C  CA  . VAL A  1 15  ? 106.700 132.113 133.246 1.00 70.54  ? 36  VAL A CA  1 
ATOM   73    C  C   . VAL A  1 15  ? 107.327 133.197 132.365 1.00 68.90  ? 36  VAL A C   1 
ATOM   74    O  O   . VAL A  1 15  ? 106.611 134.169 132.017 1.00 67.99  ? 36  VAL A O   1 
ATOM   75    C  CB  . VAL A  1 15  ? 107.238 132.173 134.688 1.00 69.40  ? 36  VAL A CB  1 
ATOM   76    C  CG1 . VAL A  1 15  ? 107.179 133.599 135.237 1.00 66.13  ? 36  VAL A CG1 1 
ATOM   77    C  CG2 . VAL A  1 15  ? 106.515 131.217 135.631 1.00 70.90  ? 36  VAL A CG2 1 
ATOM   78    N  N   . ILE A  1 16  ? 108.603 133.028 131.990 1.00 68.52  ? 37  ILE A N   1 
ATOM   79    C  CA  . ILE A  1 16  ? 109.330 134.020 131.150 1.00 66.50  ? 37  ILE A CA  1 
ATOM   80    C  C   . ILE A  1 16  ? 108.635 134.098 129.787 1.00 67.98  ? 37  ILE A C   1 
ATOM   81    O  O   . ILE A  1 16  ? 108.286 135.227 129.359 1.00 66.21  ? 37  ILE A O   1 
ATOM   82    C  CB  . ILE A  1 16  ? 110.827 133.676 131.081 1.00 66.83  ? 37  ILE A CB  1 
ATOM   83    C  CG1 . ILE A  1 16  ? 111.445 133.881 132.468 1.00 64.92  ? 37  ILE A CG1 1 
ATOM   84    C  CG2 . ILE A  1 16  ? 111.518 134.506 130.007 1.00 66.33  ? 37  ILE A CG2 1 
ATOM   85    C  CD1 . ILE A  1 16  ? 112.887 133.487 132.609 1.00 65.47  ? 37  ILE A CD1 1 
ATOM   86    N  N   . ASP A  1 17  ? 108.364 132.957 129.152 1.00 70.74  ? 38  ASP A N   1 
ATOM   87    C  CA  . ASP A  1 17  ? 107.736 132.973 127.805 1.00 72.77  ? 38  ASP A CA  1 
ATOM   88    C  C   . ASP A  1 17  ? 106.385 133.692 127.886 1.00 71.50  ? 38  ASP A C   1 
ATOM   89    O  O   . ASP A  1 17  ? 106.119 134.569 127.026 1.00 70.64  ? 38  ASP A O   1 
ATOM   90    C  CB  . ASP A  1 17  ? 107.647 131.585 127.165 1.00 76.73  ? 38  ASP A CB  1 
ATOM   91    C  CG  . ASP A  1 17  ? 108.985 130.973 126.774 1.00 78.23  ? 38  ASP A CG  1 
ATOM   92    O  OD1 . ASP A  1 17  ? 110.056 131.597 127.060 1.00 76.26  ? 38  ASP A OD1 1 
ATOM   93    O  OD2 . ASP A  1 17  ? 108.946 129.861 126.193 1.00 81.83  ? 38  ASP A OD2 1 
ATOM   94    N  N   . ALA A  1 18  ? 105.586 133.419 128.921 1.00 71.33  ? 39  ALA A N   1 
ATOM   95    C  CA  . ALA A  1 18  ? 104.234 134.006 129.040 1.00 70.84  ? 39  ALA A CA  1 
ATOM   96    C  C   . ALA A  1 18  ? 104.348 135.517 129.267 1.00 68.15  ? 39  ALA A C   1 
ATOM   97    O  O   . ALA A  1 18  ? 103.458 136.241 128.744 1.00 68.52  ? 39  ALA A O   1 
ATOM   98    C  CB  . ALA A  1 18  ? 103.452 133.293 130.097 1.00 71.64  ? 39  ALA A CB  1 
ATOM   99    N  N   . SER A  1 19  ? 105.420 135.975 129.946 1.00 65.79  ? 40  SER A N   1 
ATOM   100   C  CA  . SER A  1 19  ? 105.716 137.406 130.227 1.00 63.02  ? 40  SER A CA  1 
ATOM   101   C  C   . SER A  1 19  ? 106.012 138.097 128.905 1.00 63.94  ? 40  SER A C   1 
ATOM   102   O  O   . SER A  1 19  ? 105.353 139.108 128.593 1.00 63.65  ? 40  SER A O   1 
ATOM   103   C  CB  . SER A  1 19  ? 106.865 137.609 131.209 1.00 60.94  ? 40  SER A CB  1 
ATOM   104   O  OG  . SER A  1 19  ? 106.675 136.865 132.408 1.00 60.98  ? 40  SER A OG  1 
ATOM   105   N  N   . LEU A  1 20  ? 106.965 137.541 128.152 1.00 65.77  ? 41  LEU A N   1 
ATOM   106   C  CA  . LEU A  1 20  ? 107.323 138.033 126.801 1.00 66.72  ? 41  LEU A CA  1 
ATOM   107   C  C   . LEU A  1 20  ? 106.082 137.987 125.906 1.00 68.97  ? 41  LEU A C   1 
ATOM   108   O  O   . LEU A  1 20  ? 105.799 139.004 125.243 1.00 68.27  ? 41  LEU A O   1 
ATOM   109   C  CB  . LEU A  1 20  ? 108.467 137.186 126.245 1.00 68.70  ? 41  LEU A CB  1 
ATOM   110   C  CG  . LEU A  1 20  ? 109.733 137.139 127.103 1.00 67.52  ? 41  LEU A CG  1 
ATOM   111   C  CD1 . LEU A  1 20  ? 110.846 136.461 126.337 1.00 70.04  ? 41  LEU A CD1 1 
ATOM   112   C  CD2 . LEU A  1 20  ? 110.197 138.525 127.530 1.00 64.55  ? 41  LEU A CD2 1 
ATOM   113   N  N   . THR A  1 21  ? 105.335 136.878 125.894 1.00 71.60  ? 42  THR A N   1 
ATOM   114   C  CA  . THR A  1 21  ? 104.126 136.793 125.036 1.00 74.79  ? 42  THR A CA  1 
ATOM   115   C  C   . THR A  1 21  ? 103.279 138.042 125.303 1.00 74.36  ? 42  THR A C   1 
ATOM   116   O  O   . THR A  1 21  ? 102.881 138.714 124.317 1.00 76.22  ? 42  THR A O   1 
ATOM   117   C  CB  . THR A  1 21  ? 103.325 135.500 125.215 1.00 76.97  ? 42  THR A CB  1 
ATOM   118   O  OG1 . THR A  1 21  ? 104.074 134.327 124.872 1.00 78.46  ? 42  THR A OG1 1 
ATOM   119   C  CG2 . THR A  1 21  ? 102.076 135.512 124.361 1.00 79.76  ? 42  THR A CG2 1 
ATOM   120   N  N   . LEU A  1 22  ? 103.068 138.362 126.584 1.00 72.68  ? 43  LEU A N   1 
ATOM   121   C  CA  . LEU A  1 22  ? 102.111 139.391 127.052 1.00 72.41  ? 43  LEU A CA  1 
ATOM   122   C  C   . LEU A  1 22  ? 102.466 140.749 126.423 1.00 71.98  ? 43  LEU A C   1 
ATOM   123   O  O   . LEU A  1 22  ? 101.543 141.542 126.075 1.00 73.59  ? 43  LEU A O   1 
ATOM   124   C  CB  . LEU A  1 22  ? 102.165 139.418 128.591 1.00 70.37  ? 43  LEU A CB  1 
ATOM   125   C  CG  . LEU A  1 22  ? 100.918 139.904 129.323 1.00 69.53  ? 43  LEU A CG  1 
ATOM   126   C  CD1 . LEU A  1 22  ? 99.702  139.058 128.985 1.00 71.94  ? 43  LEU A CD1 1 
ATOM   127   C  CD2 . LEU A  1 22  ? 101.162 139.944 130.834 1.00 67.23  ? 43  LEU A CD2 1 
ATOM   128   N  N   . ILE A  1 23  ? 103.757 141.006 126.249 1.00 70.20  ? 44  ILE A N   1 
ATOM   129   C  CA  . ILE A  1 23  ? 104.270 142.283 125.671 1.00 68.87  ? 44  ILE A CA  1 
ATOM   130   C  C   . ILE A  1 23  ? 104.188 142.213 124.135 1.00 71.15  ? 44  ILE A C   1 
ATOM   131   O  O   . ILE A  1 23  ? 103.817 143.234 123.494 1.00 71.19  ? 44  ILE A O   1 
ATOM   132   C  CB  . ILE A  1 23  ? 105.714 142.526 126.135 1.00 66.46  ? 44  ILE A CB  1 
ATOM   133   C  CG1 . ILE A  1 23  ? 105.863 142.324 127.644 1.00 64.76  ? 44  ILE A CG1 1 
ATOM   134   C  CG2 . ILE A  1 23  ? 106.170 143.894 125.673 1.00 65.50  ? 44  ILE A CG2 1 
ATOM   135   C  CD1 . ILE A  1 23  ? 105.136 143.351 128.478 1.00 62.97  ? 44  ILE A CD1 1 
ATOM   136   N  N   . ARG A  1 24  ? 104.584 141.079 123.551 1.00 72.58  ? 45  ARG A N   1 
ATOM   137   C  CA  . ARG A  1 24  ? 104.485 140.868 122.084 1.00 74.93  ? 45  ARG A CA  1 
ATOM   138   C  C   . ARG A  1 24  ? 103.049 141.183 121.674 1.00 76.18  ? 45  ARG A C   1 
ATOM   139   O  O   . ARG A  1 24  ? 102.843 142.150 120.932 1.00 76.53  ? 45  ARG A O   1 
ATOM   140   C  CB  . ARG A  1 24  ? 104.871 139.450 121.670 1.00 77.15  ? 45  ARG A CB  1 
ATOM   141   C  CG  . ARG A  1 24  ? 105.122 139.324 120.170 1.00 80.12  ? 45  ARG A CG  1 
ATOM   142   C  CD  . ARG A  1 24  ? 105.528 137.928 119.732 1.00 82.86  ? 45  ARG A CD  1 
ATOM   143   N  NE  . ARG A  1 24  ? 106.651 137.444 120.525 1.00 81.68  ? 45  ARG A NE  1 
ATOM   144   C  CZ  . ARG A  1 24  ? 106.560 136.641 121.591 1.00 81.55  ? 45  ARG A CZ  1 
ATOM   145   N  NH1 . ARG A  1 24  ? 105.392 136.170 122.006 1.00 81.88  ? 45  ARG A NH1 1 
ATOM   146   N  NH2 . ARG A  1 24  ? 107.663 136.302 122.239 1.00 80.82  ? 45  ARG A NH2 1 
ATOM   147   N  N   . GLU A  1 25  ? 102.089 140.452 122.233 1.00 77.08  ? 46  GLU A N   1 
ATOM   148   C  CA  . GLU A  1 25  ? 100.641 140.618 121.919 1.00 79.05  ? 46  GLU A CA  1 
ATOM   149   C  C   . GLU A  1 25  ? 100.260 142.109 121.956 1.00 78.61  ? 46  GLU A C   1 
ATOM   150   O  O   . GLU A  1 25  ? 99.671  142.583 120.957 1.00 80.34  ? 46  GLU A O   1 
ATOM   151   C  CB  . GLU A  1 25  ? 99.804  139.734 122.845 1.00 78.57  ? 46  GLU A CB  1 
ATOM   152   C  CG  . GLU A  1 25  ? 99.850  138.263 122.464 1.00 80.48  ? 46  GLU A CG  1 
ATOM   153   C  CD  . GLU A  1 25  ? 99.699  137.974 120.974 1.00 83.35  ? 46  GLU A CD  1 
ATOM   154   O  OE1 . GLU A  1 25  ? 98.895  138.658 120.279 1.00 84.04  ? 46  GLU A OE1 1 
ATOM   155   O  OE2 . GLU A  1 25  ? 100.404 137.079 120.511 1.00 84.30  ? 46  GLU A OE2 1 
ATOM   156   N  N   . ARG A  1 26  ? 100.628 142.852 123.011 1.00 76.87  ? 47  ARG A N   1 
ATOM   157   C  CA  . ARG A  1 26  ? 100.153 144.255 123.175 1.00 77.12  ? 47  ARG A CA  1 
ATOM   158   C  C   . ARG A  1 26  ? 100.913 145.196 122.225 1.00 77.37  ? 47  ARG A C   1 
ATOM   159   O  O   . ARG A  1 26  ? 100.260 146.087 121.602 1.00 79.66  ? 47  ARG A O   1 
ATOM   160   C  CB  . ARG A  1 26  ? 100.223 144.713 124.628 1.00 75.68  ? 47  ARG A CB  1 
ATOM   161   C  CG  . ARG A  1 26  ? 99.454  146.002 124.869 1.00 76.53  ? 47  ARG A CG  1 
ATOM   162   C  CD  . ARG A  1 26  ? 99.241  146.225 126.354 1.00 75.57  ? 47  ARG A CD  1 
ATOM   163   N  NE  . ARG A  1 26  ? 99.101  147.632 126.720 1.00 74.88  ? 47  ARG A NE  1 
ATOM   164   C  CZ  . ARG A  1 26  ? 98.932  148.069 127.961 1.00 71.89  ? 47  ARG A CZ  1 
ATOM   165   N  NH1 . ARG A  1 26  ? 98.911  147.209 128.960 1.00 71.83  ? 47  ARG A NH1 1 
ATOM   166   N  NH2 . ARG A  1 26  ? 98.786  149.360 128.193 1.00 70.74  ? 47  ARG A NH2 1 
ATOM   167   N  N   . ALA A  1 27  ? 102.216 144.991 122.034 1.00 75.48  ? 48  ALA A N   1 
ATOM   168   C  CA  . ALA A  1 27  ? 102.954 145.636 120.924 1.00 75.56  ? 48  ALA A CA  1 
ATOM   169   C  C   . ALA A  1 27  ? 102.222 145.364 119.590 1.00 78.99  ? 48  ALA A C   1 
ATOM   170   O  O   . ALA A  1 27  ? 102.001 146.334 118.821 1.00 80.62  ? 48  ALA A O   1 
ATOM   171   C  CB  . ALA A  1 27  ? 104.399 145.180 120.919 1.00 74.26  ? 48  ALA A CB  1 
ATOM   172   N  N   . LYS A  1 28  ? 101.822 144.118 119.290 1.00 80.32  ? 49  LYS A N   1 
ATOM   173   C  CA  . LYS A  1 28  ? 101.219 143.799 117.966 1.00 83.05  ? 49  LYS A CA  1 
ATOM   174   C  C   . LYS A  1 28  ? 100.001 144.701 117.765 1.00 83.76  ? 49  LYS A C   1 
ATOM   175   O  O   . LYS A  1 28  ? 99.850  145.230 116.642 1.00 85.66  ? 49  LYS A O   1 
ATOM   176   C  CB  . LYS A  1 28  ? 100.814 142.329 117.808 1.00 85.45  ? 49  LYS A CB  1 
ATOM   177   C  CG  . LYS A  1 28  ? 100.193 142.002 116.439 1.00 89.84  ? 49  LYS A CG  1 
ATOM   178   C  CD  . LYS A  1 28  ? 99.750  140.551 116.217 1.00 92.37  ? 49  LYS A CD  1 
ATOM   179   C  CE  . LYS A  1 28  ? 98.342  140.422 115.661 1.00 95.79  ? 49  LYS A CE  1 
ATOM   180   N  NZ  . LYS A  1 28  ? 97.290  140.648 116.696 1.00 95.19  ? 49  LYS A NZ  1 
ATOM   181   N  N   . LEU A  1 29  ? 99.188  144.869 118.822 1.00 81.76  ? 50  LEU A N   1 
ATOM   182   C  CA  . LEU A  1 29  ? 97.909  145.631 118.794 1.00 82.65  ? 50  LEU A CA  1 
ATOM   183   C  C   . LEU A  1 29  ? 98.213  147.118 118.641 1.00 81.37  ? 50  LEU A C   1 
ATOM   184   O  O   . LEU A  1 29  ? 97.538  147.817 117.847 1.00 83.52  ? 50  LEU A O   1 
ATOM   185   C  CB  . LEU A  1 29  ? 97.146  145.389 120.097 1.00 81.45  ? 50  LEU A CB  1 
ATOM   186   C  CG  . LEU A  1 29  ? 96.638  143.969 120.339 1.00 82.87  ? 50  LEU A CG  1 
ATOM   187   C  CD1 . LEU A  1 29  ? 95.789  143.923 121.613 1.00 81.61  ? 50  LEU A CD1 1 
ATOM   188   C  CD2 . LEU A  1 29  ? 95.849  143.474 119.131 1.00 87.24  ? 50  LEU A CD2 1 
ATOM   189   N  N   . LYS A  1 30  ? 99.195  147.579 119.401 1.00 77.97  ? 51  LYS A N   1 
ATOM   190   C  CA  . LYS A  1 30  ? 99.603  148.995 119.400 1.00 77.06  ? 51  LYS A CA  1 
ATOM   191   C  C   . LYS A  1 30  ? 100.188 149.331 118.021 1.00 79.68  ? 51  LYS A C   1 
ATOM   192   O  O   . LYS A  1 30  ? 99.767  150.354 117.448 1.00 81.67  ? 51  LYS A O   1 
ATOM   193   C  CB  . LYS A  1 30  ? 100.550 149.256 120.580 1.00 73.06  ? 51  LYS A CB  1 
ATOM   194   C  CG  . LYS A  1 30  ? 99.939  149.162 121.982 1.00 70.93  ? 51  LYS A CG  1 
ATOM   195   C  CD  . LYS A  1 30  ? 98.554  149.780 122.174 1.00 72.08  ? 51  LYS A CD  1 
ATOM   196   C  CE  . LYS A  1 30  ? 97.859  149.213 123.395 1.00 71.20  ? 51  LYS A CE  1 
ATOM   197   N  NZ  . LYS A  1 30  ? 96.524  149.812 123.616 1.00 72.75  ? 51  LYS A NZ  1 
ATOM   198   N  N   . GLY A  1 31  ? 101.084 148.499 117.478 1.00 80.60  ? 52  GLY A N   1 
ATOM   199   C  CA  . GLY A  1 31  ? 101.641 148.713 116.129 1.00 83.35  ? 52  GLY A CA  1 
ATOM   200   C  C   . GLY A  1 31  ? 100.524 148.844 115.118 1.00 87.64  ? 52  GLY A C   1 
ATOM   201   O  O   . GLY A  1 31  ? 100.422 149.894 114.465 1.00 89.46  ? 52  GLY A O   1 
ATOM   202   N  N   . GLU A  1 32  ? 99.677  147.819 115.040 1.00 90.12  ? 53  GLU A N   1 
ATOM   203   C  CA  . GLU A  1 32  ? 98.517  147.770 114.116 1.00 94.41  ? 53  GLU A CA  1 
ATOM   204   C  C   . GLU A  1 32  ? 97.728  149.079 114.211 1.00 94.93  ? 53  GLU A C   1 
ATOM   205   O  O   . GLU A  1 32  ? 97.443  149.653 113.155 1.00 98.41  ? 53  GLU A O   1 
ATOM   206   C  CB  . GLU A  1 32  ? 97.637  146.559 114.420 1.00 95.94  ? 53  GLU A CB  1 
ATOM   207   C  CG  . GLU A  1 32  ? 98.174  145.264 113.830 1.00 97.67  ? 53  GLU A CG  1 
ATOM   208   C  CD  . GLU A  1 32  ? 97.147  144.154 113.860 1.00 99.88  ? 53  GLU A CD  1 
ATOM   209   O  OE1 . GLU A  1 32  ? 96.942  143.539 112.817 1.00 103.67 ? 53  GLU A OE1 1 
ATOM   210   O  OE2 . GLU A  1 32  ? 96.522  143.947 114.927 1.00 98.92  ? 53  GLU A OE2 1 
ATOM   211   N  N   . LEU A  1 33  ? 97.418  149.541 115.425 1.00 92.53  ? 54  LEU A N   1 
ATOM   212   C  CA  . LEU A  1 33  ? 96.544  150.725 115.647 1.00 93.02  ? 54  LEU A CA  1 
ATOM   213   C  C   . LEU A  1 33  ? 97.198  151.958 115.012 1.00 93.07  ? 54  LEU A C   1 
ATOM   214   O  O   . LEU A  1 33  ? 96.468  152.748 114.381 1.00 95.91  ? 54  LEU A O   1 
ATOM   215   C  CB  . LEU A  1 33  ? 96.295  150.904 117.150 1.00 89.99  ? 54  LEU A CB  1 
ATOM   216   C  CG  . LEU A  1 33  ? 95.415  152.093 117.552 1.00 90.67  ? 54  LEU A CG  1 
ATOM   217   C  CD1 . LEU A  1 33  ? 94.087  152.143 116.795 1.00 94.73  ? 54  LEU A CD1 1 
ATOM   218   C  CD2 . LEU A  1 33  ? 95.177  152.069 119.056 1.00 88.26  ? 54  LEU A CD2 1 
ATOM   219   N  N   . VAL A  1 34  ? 98.524  152.071 115.137 1.00 90.85  ? 55  VAL A N   1 
ATOM   220   C  CA  . VAL A  1 34  ? 99.348  153.221 114.650 1.00 90.84  ? 55  VAL A CA  1 
ATOM   221   C  C   . VAL A  1 34  ? 99.343  153.221 113.118 1.00 95.15  ? 55  VAL A C   1 
ATOM   222   O  O   . VAL A  1 34  ? 98.959  154.240 112.510 1.00 97.51  ? 55  VAL A O   1 
ATOM   223   C  CB  . VAL A  1 34  ? 100.790 153.171 115.197 1.00 86.96  ? 55  VAL A CB  1 
ATOM   224   C  CG1 . VAL A  1 34  ? 101.661 154.257 114.589 1.00 87.27  ? 55  VAL A CG1 1 
ATOM   225   C  CG2 . VAL A  1 34  ? 100.825 153.279 116.712 1.00 83.44  ? 55  VAL A CG2 1 
ATOM   226   N  N   . ARG A  1 35  ? 99.779  152.132 112.501 1.00 96.51  ? 56  ARG A N   1 
ATOM   227   C  CA  . ARG A  1 35  ? 99.870  152.098 111.027 1.00 101.59 ? 56  ARG A CA  1 
ATOM   228   C  C   . ARG A  1 35  ? 98.453  152.210 110.446 1.00 105.52 ? 56  ARG A C   1 
ATOM   229   O  O   . ARG A  1 35  ? 98.326  152.895 109.423 1.00 108.11 ? 56  ARG A O   1 
ATOM   230   C  CB  . ARG A  1 35  ? 100.640 150.853 110.575 1.00 102.61 ? 56  ARG A CB  1 
ATOM   231   C  CG  . ARG A  1 35  ? 102.100 150.826 111.020 1.00 99.38  ? 56  ARG A CG  1 
ATOM   232   C  CD  . ARG A  1 35  ? 102.800 149.526 110.644 1.00 99.94  ? 56  ARG A CD  1 
ATOM   233   N  NE  . ARG A  1 35  ? 102.082 148.373 111.192 1.00 99.95  ? 56  ARG A NE  1 
ATOM   234   C  CZ  . ARG A  1 35  ? 102.342 147.754 112.352 1.00 96.93  ? 56  ARG A CZ  1 
ATOM   235   N  NH1 . ARG A  1 35  ? 103.355 148.127 113.119 1.00 93.36  ? 56  ARG A NH1 1 
ATOM   236   N  NH2 . ARG A  1 35  ? 101.593 146.728 112.728 1.00 97.39  ? 56  ARG A NH2 1 
ATOM   237   N  N   . LEU A  1 36  ? 97.442  151.629 111.115 1.00 106.31 ? 57  LEU A N   1 
ATOM   238   C  CA  . LEU A  1 36  ? 96.017  151.607 110.668 1.00 110.88 ? 57  LEU A CA  1 
ATOM   239   C  C   . LEU A  1 36  ? 95.613  152.983 110.103 1.00 114.11 ? 57  LEU A C   1 
ATOM   240   O  O   . LEU A  1 36  ? 95.112  152.986 108.938 1.00 119.18 ? 57  LEU A O   1 
ATOM   241   C  CB  . LEU A  1 36  ? 95.061  151.126 111.777 1.00 109.53 ? 57  LEU A CB  1 
ATOM   242   C  CG  . LEU A  1 36  ? 94.283  149.832 111.476 1.00 112.15 ? 57  LEU A CG  1 
ATOM   243   C  CD1 . LEU A  1 36  ? 95.211  148.633 111.293 1.00 111.37 ? 57  LEU A CD1 1 
ATOM   244   C  CD2 . LEU A  1 36  ? 93.243  149.525 112.552 1.00 111.03 ? 57  LEU A CD2 1 
ATOM   245   N  N   . LEU A  1 37  ? 95.794  154.101 110.829 1.00 112.00 ? 58  LEU A N   1 
ATOM   246   C  CA  . LEU A  1 37  ? 95.712  155.456 110.195 1.00 114.85 ? 58  LEU A CA  1 
ATOM   247   C  C   . LEU A  1 37  ? 97.053  156.137 110.416 1.00 111.72 ? 58  LEU A C   1 
ATOM   248   O  O   . LEU A  1 37  ? 97.212  156.706 111.494 1.00 109.29 ? 58  LEU A O   1 
ATOM   249   C  CB  . LEU A  1 37  ? 94.545  156.314 110.725 1.00 116.19 ? 58  LEU A CB  1 
ATOM   250   C  CG  . LEU A  1 37  ? 93.302  156.485 109.822 1.00 120.95 ? 58  LEU A CG  1 
ATOM   251   C  CD1 . LEU A  1 37  ? 92.649  157.845 110.050 1.00 122.07 ? 58  LEU A CD1 1 
ATOM   252   C  CD2 . LEU A  1 37  ? 93.591  156.310 108.326 1.00 124.46 ? 58  LEU A CD2 1 
ATOM   253   N  N   . GLY A  1 38  ? 97.938  156.054 109.413 1.00 112.89 ? 59  GLY A N   1 
ATOM   254   C  CA  . GLY A  1 38  ? 99.399  156.229 109.531 1.00 111.04 ? 59  GLY A CA  1 
ATOM   255   C  C   . GLY A  1 38  ? 99.878  157.584 109.024 1.00 112.50 ? 59  GLY A C   1 
ATOM   256   O  O   . GLY A  1 38  ? 99.131  158.568 109.209 1.00 114.00 ? 59  GLY A O   1 
ATOM   257   N  N   . GLY A  1 39  ? 101.058 157.624 108.377 1.00 111.92 ? 60  GLY A N   1 
ATOM   258   C  CA  . GLY A  1 39  ? 101.945 158.804 108.331 1.00 110.17 ? 60  GLY A CA  1 
ATOM   259   C  C   . GLY A  1 39  ? 102.521 159.106 109.713 1.00 105.05 ? 60  GLY A C   1 
ATOM   260   O  O   . GLY A  1 39  ? 102.212 160.178 110.239 1.00 104.81 ? 60  GLY A O   1 
ATOM   261   N  N   . ALA A  1 40  ? 103.282 158.172 110.307 1.00 100.78 ? 61  ALA A N   1 
ATOM   262   C  CA  . ALA A  1 40  ? 104.220 158.410 111.437 1.00 95.57  ? 61  ALA A CA  1 
ATOM   263   C  C   . ALA A  1 40  ? 105.561 157.676 111.205 1.00 93.73  ? 61  ALA A C   1 
ATOM   264   O  O   . ALA A  1 40  ? 105.534 156.375 111.100 1.00 93.69  ? 61  ALA A O   1 
ATOM   265   C  CB  . ALA A  1 40  ? 103.596 157.959 112.738 1.00 92.67  ? 61  ALA A CB  1 
ATOM   266   N  N   . LYS A  1 41  ? 106.681 158.441 111.188 1.00 91.73  ? 62  LYS A N   1 
ATOM   267   C  CA  . LYS A  1 41  ? 108.092 157.943 111.201 1.00 89.41  ? 62  LYS A CA  1 
ATOM   268   C  C   . LYS A  1 41  ? 108.437 157.295 112.556 1.00 84.58  ? 62  LYS A C   1 
ATOM   269   O  O   . LYS A  1 41  ? 109.114 156.247 112.560 1.00 84.56  ? 62  LYS A O   1 
ATOM   270   C  CB  . LYS A  1 41  ? 109.084 159.086 110.941 1.00 90.22  ? 62  LYS A CB  1 
ATOM   271   C  CG  . LYS A  1 41  ? 109.174 159.573 109.496 1.00 94.91  ? 62  LYS A CG  1 
ATOM   272   C  CD  . LYS A  1 41  ? 108.147 160.607 109.100 1.00 97.30  ? 62  LYS A CD  1 
ATOM   273   C  CE  . LYS A  1 41  ? 108.259 160.976 107.639 1.00 102.26 ? 62  LYS A CE  1 
ATOM   274   N  NZ  . LYS A  1 41  ? 107.141 161.845 107.197 1.00 105.32 ? 62  LYS A NZ  1 
ATOM   275   N  N   . ALA A  1 42  ? 108.033 157.883 113.687 1.00 80.21  ? 63  ALA A N   1 
ATOM   276   C  CA  . ALA A  1 42  ? 108.259 157.275 115.022 1.00 75.46  ? 63  ALA A CA  1 
ATOM   277   C  C   . ALA A  1 42  ? 107.024 157.439 115.921 1.00 73.17  ? 63  ALA A C   1 
ATOM   278   O  O   . ALA A  1 42  ? 106.365 158.489 115.862 1.00 73.70  ? 63  ALA A O   1 
ATOM   279   C  CB  . ALA A  1 42  ? 109.500 157.862 115.642 1.00 73.03  ? 63  ALA A CB  1 
ATOM   280   N  N   . SER A  1 43  ? 106.723 156.413 116.718 1.00 70.67  ? 64  SER A N   1 
ATOM   281   C  CA  . SER A  1 43  ? 105.637 156.432 117.735 1.00 69.16  ? 64  SER A CA  1 
ATOM   282   C  C   . SER A  1 43  ? 106.124 155.907 119.099 1.00 65.16  ? 64  SER A C   1 
ATOM   283   O  O   . SER A  1 43  ? 106.567 154.745 119.197 1.00 64.27  ? 64  SER A O   1 
ATOM   284   C  CB  . SER A  1 43  ? 104.434 155.702 117.213 1.00 71.35  ? 64  SER A CB  1 
ATOM   285   O  OG  . SER A  1 43  ? 103.970 156.371 116.047 1.00 74.88  ? 64  SER A OG  1 
ATOM   286   N  N   . THR A  1 44  ? 106.052 156.756 120.122 1.00 62.88  ? 65  THR A N   1 
ATOM   287   C  CA  . THR A  1 44  ? 106.510 156.422 121.501 1.00 59.67  ? 65  THR A CA  1 
ATOM   288   C  C   . THR A  1 44  ? 105.593 155.317 122.058 1.00 58.92  ? 65  THR A C   1 
ATOM   289   O  O   . THR A  1 44  ? 104.372 155.533 122.015 1.00 59.66  ? 65  THR A O   1 
ATOM   290   C  CB  . THR A  1 44  ? 106.516 157.671 122.398 1.00 58.14  ? 65  THR A CB  1 
ATOM   291   O  OG1 . THR A  1 44  ? 107.208 158.730 121.738 1.00 58.99  ? 65  THR A OG1 1 
ATOM   292   C  CG2 . THR A  1 44  ? 107.131 157.419 123.761 1.00 55.02  ? 65  THR A CG2 1 
ATOM   293   N  N   . SER A  1 45  ? 106.158 154.183 122.507 1.00 57.40  ? 66  SER A N   1 
ATOM   294   C  CA  . SER A  1 45  ? 105.446 153.130 123.282 1.00 56.86  ? 66  SER A CA  1 
ATOM   295   C  C   . SER A  1 45  ? 106.107 152.932 124.657 1.00 54.07  ? 66  SER A C   1 
ATOM   296   O  O   . SER A  1 45  ? 107.321 152.532 124.733 1.00 52.62  ? 66  SER A O   1 
ATOM   297   C  CB  . SER A  1 45  ? 105.301 151.824 122.545 1.00 58.54  ? 66  SER A CB  1 
ATOM   298   O  OG  . SER A  1 45  ? 103.986 151.293 122.706 1.00 59.66  ? 66  SER A OG  1 
ATOM   299   N  N   . LEU A  1 46  ? 105.301 153.171 125.706 1.00 53.13  ? 67  LEU A N   1 
ATOM   300   C  CA  . LEU A  1 46  ? 105.688 153.011 127.137 1.00 50.93  ? 67  LEU A CA  1 
ATOM   301   C  C   . LEU A  1 46  ? 105.861 151.523 127.440 1.00 51.54  ? 67  LEU A C   1 
ATOM   302   O  O   . LEU A  1 46  ? 104.995 150.713 126.996 1.00 53.61  ? 67  LEU A O   1 
ATOM   303   C  CB  . LEU A  1 46  ? 104.631 153.628 128.051 1.00 49.91  ? 67  LEU A CB  1 
ATOM   304   C  CG  . LEU A  1 46  ? 104.268 155.078 127.753 1.00 50.38  ? 67  LEU A CG  1 
ATOM   305   C  CD1 . LEU A  1 46  ? 103.251 155.600 128.759 1.00 49.77  ? 67  LEU A CD1 1 
ATOM   306   C  CD2 . LEU A  1 46  ? 105.517 155.956 127.724 1.00 49.33  ? 67  LEU A CD2 1 
ATOM   307   N  N   . LEU A  1 47  ? 106.948 151.196 128.140 1.00 50.54  ? 68  LEU A N   1 
ATOM   308   C  CA  . LEU A  1 47  ? 107.188 149.867 128.745 1.00 51.11  ? 68  LEU A CA  1 
ATOM   309   C  C   . LEU A  1 47  ? 107.616 150.024 130.210 1.00 49.76  ? 68  LEU A C   1 
ATOM   310   O  O   . LEU A  1 47  ? 108.737 150.512 130.466 1.00 49.12  ? 68  LEU A O   1 
ATOM   311   C  CB  . LEU A  1 47  ? 108.282 149.184 127.934 1.00 52.06  ? 68  LEU A CB  1 
ATOM   312   C  CG  . LEU A  1 47  ? 108.735 147.831 128.456 1.00 51.89  ? 68  LEU A CG  1 
ATOM   313   C  CD1 . LEU A  1 47  ? 107.595 146.845 128.448 1.00 53.21  ? 68  LEU A CD1 1 
ATOM   314   C  CD2 . LEU A  1 47  ? 109.881 147.303 127.624 1.00 53.32  ? 68  LEU A CD2 1 
ATOM   315   N  N   . GLY A  1 48  ? 106.774 149.607 131.149 1.00 50.22  ? 69  GLY A N   1 
ATOM   316   C  CA  . GLY A  1 48  ? 107.133 149.623 132.582 1.00 49.26  ? 69  GLY A CA  1 
ATOM   317   C  C   . GLY A  1 48  ? 108.076 148.486 132.959 1.00 49.57  ? 69  GLY A C   1 
ATOM   318   O  O   . GLY A  1 48  ? 107.830 147.338 132.503 1.00 52.83  ? 69  GLY A O   1 
ATOM   319   N  N   . VAL A  1 49  ? 109.110 148.782 133.757 1.00 47.08  ? 70  VAL A N   1 
ATOM   320   C  CA  . VAL A  1 49  ? 109.984 147.779 134.430 1.00 45.52  ? 70  VAL A CA  1 
ATOM   321   C  C   . VAL A  1 49  ? 109.888 148.048 135.924 1.00 43.66  ? 70  VAL A C   1 
ATOM   322   O  O   . VAL A  1 49  ? 110.669 148.818 136.474 1.00 42.49  ? 70  VAL A O   1 
ATOM   323   C  CB  . VAL A  1 49  ? 111.427 147.847 133.910 1.00 45.36  ? 70  VAL A CB  1 
ATOM   324   C  CG1 . VAL A  1 49  ? 112.281 146.695 134.404 1.00 45.33  ? 70  VAL A CG1 1 
ATOM   325   C  CG2 . VAL A  1 49  ? 111.474 147.894 132.401 1.00 47.01  ? 70  VAL A CG2 1 
ATOM   326   N  N   . PRO A  1 50  ? 108.884 147.472 136.611 1.00 43.92  ? 71  PRO A N   1 
ATOM   327   C  CA  . PRO A  1 50  ? 108.676 147.701 138.042 1.00 43.10  ? 71  PRO A CA  1 
ATOM   328   C  C   . PRO A  1 50  ? 109.698 146.963 138.926 1.00 42.67  ? 71  PRO A C   1 
ATOM   329   O  O   . PRO A  1 50  ? 109.350 146.041 139.658 1.00 43.56  ? 71  PRO A O   1 
ATOM   330   C  CB  . PRO A  1 50  ? 107.233 147.211 138.272 1.00 43.54  ? 71  PRO A CB  1 
ATOM   331   C  CG  . PRO A  1 50  ? 107.068 146.115 137.262 1.00 45.40  ? 71  PRO A CG  1 
ATOM   332   C  CD  . PRO A  1 50  ? 107.836 146.606 136.046 1.00 45.91  ? 71  PRO A CD  1 
ATOM   333   N  N   . LEU A  1 51  ? 110.935 147.430 138.877 1.00 42.05  ? 72  LEU A N   1 
ATOM   334   C  CA  . LEU A  1 51  ? 112.093 146.784 139.535 1.00 41.91  ? 72  LEU A CA  1 
ATOM   335   C  C   . LEU A  1 51  ? 112.750 147.782 140.491 1.00 40.08  ? 72  LEU A C   1 
ATOM   336   O  O   . LEU A  1 51  ? 113.164 148.860 140.019 1.00 39.36  ? 72  LEU A O   1 
ATOM   337   C  CB  . LEU A  1 51  ? 113.066 146.364 138.438 1.00 42.59  ? 72  LEU A CB  1 
ATOM   338   C  CG  . LEU A  1 51  ? 114.279 145.591 138.940 1.00 43.69  ? 72  LEU A CG  1 
ATOM   339   C  CD1 . LEU A  1 51  ? 114.826 144.695 137.854 1.00 46.00  ? 72  LEU A CD1 1 
ATOM   340   C  CD2 . LEU A  1 51  ? 115.382 146.518 139.433 1.00 42.77  ? 72  LEU A CD2 1 
ATOM   341   N  N   . GLY A  1 52  ? 112.898 147.415 141.765 1.00 39.26  ? 73  GLY A N   1 
ATOM   342   C  CA  . GLY A  1 52  ? 113.548 148.275 142.773 1.00 37.11  ? 73  GLY A CA  1 
ATOM   343   C  C   . GLY A  1 52  ? 114.593 147.584 143.626 1.00 36.64  ? 73  GLY A C   1 
ATOM   344   O  O   . GLY A  1 52  ? 115.152 148.256 144.483 1.00 35.35  ? 73  GLY A O   1 
ATOM   345   N  N   . HIS A  1 53  ? 114.929 146.325 143.391 1.00 37.72  ? 74  HIS A N   1 
ATOM   346   C  CA  . HIS A  1 53  ? 115.759 145.575 144.361 1.00 38.42  ? 74  HIS A CA  1 
ATOM   347   C  C   . HIS A  1 53  ? 117.250 145.838 144.129 1.00 38.64  ? 74  HIS A C   1 
ATOM   348   O  O   . HIS A  1 53  ? 118.028 145.271 144.902 1.00 39.59  ? 74  HIS A O   1 
ATOM   349   C  CB  . HIS A  1 53  ? 115.400 144.084 144.364 1.00 40.66  ? 74  HIS A CB  1 
ATOM   350   C  CG  . HIS A  1 53  ? 115.700 143.372 143.090 1.00 41.95  ? 74  HIS A CG  1 
ATOM   351   N  ND1 . HIS A  1 53  ? 114.877 143.504 141.957 1.00 42.35  ? 74  HIS A ND1 1 
ATOM   352   C  CD2 . HIS A  1 53  ? 116.701 142.519 142.773 1.00 43.21  ? 74  HIS A CD2 1 
ATOM   353   C  CE1 . HIS A  1 53  ? 115.389 142.773 140.977 1.00 43.98  ? 74  HIS A CE1 1 
ATOM   354   N  NE2 . HIS A  1 53  ? 116.516 142.156 141.460 1.00 44.89  ? 74  HIS A NE2 1 
ATOM   355   N  N   . ASN A  1 54  ? 117.643 146.640 143.121 1.00 38.39  ? 75  ASN A N   1 
ATOM   356   C  CA  . ASN A  1 54  ? 119.056 147.060 142.902 1.00 38.52  ? 75  ASN A CA  1 
ATOM   357   C  C   . ASN A  1 54  ? 119.306 148.459 143.500 1.00 36.61  ? 75  ASN A C   1 
ATOM   358   O  O   . ASN A  1 54  ? 120.453 148.964 143.449 1.00 36.33  ? 75  ASN A O   1 
ATOM   359   C  CB  . ASN A  1 54  ? 119.440 146.955 141.424 1.00 39.46  ? 75  ASN A CB  1 
ATOM   360   C  CG  . ASN A  1 54  ? 119.385 145.522 140.916 1.00 40.94  ? 75  ASN A CG  1 
ATOM   361   O  OD1 . ASN A  1 54  ? 119.758 144.588 141.626 1.00 41.06  ? 75  ASN A OD1 1 
ATOM   362   N  ND2 . ASN A  1 54  ? 118.973 145.361 139.661 1.00 41.65  ? 75  ASN A ND2 1 
ATOM   363   N  N   . SER A  1 55  ? 118.292 149.056 144.106 1.00 35.67  ? 76  SER A N   1 
ATOM   364   C  CA  . SER A  1 55  ? 118.437 150.283 144.946 1.00 34.60  ? 76  SER A CA  1 
ATOM   365   C  C   . SER A  1 55  ? 119.344 149.998 146.160 1.00 34.61  ? 76  SER A C   1 
ATOM   366   O  O   . SER A  1 55  ? 119.282 148.873 146.713 1.00 35.03  ? 76  SER A O   1 
ATOM   367   C  CB  . SER A  1 55  ? 117.093 150.796 145.393 1.00 33.44  ? 76  SER A CB  1 
ATOM   368   O  OG  . SER A  1 55  ? 116.251 151.041 144.281 1.00 33.47  ? 76  SER A OG  1 
ATOM   369   N  N   . SER A  1 56  ? 120.053 151.029 146.617 1.00 34.32  ? 77  SER A N   1 
ATOM   370   C  CA  . SER A  1 56  ? 121.042 151.010 147.731 1.00 35.07  ? 77  SER A CA  1 
ATOM   371   C  C   . SER A  1 56  ? 120.385 151.526 149.024 1.00 34.07  ? 77  SER A C   1 
ATOM   372   O  O   . SER A  1 56  ? 120.950 151.300 150.123 1.00 34.85  ? 77  SER A O   1 
ATOM   373   C  CB  . SER A  1 56  ? 122.268 151.816 147.397 1.00 34.99  ? 77  SER A CB  1 
ATOM   374   O  OG  . SER A  1 56  ? 121.898 153.154 147.047 1.00 34.44  ? 77  SER A OG  1 
ATOM   375   N  N   . PHE A  1 57  ? 119.204 152.135 148.932 1.00 33.09  ? 78  PHE A N   1 
ATOM   376   C  CA  . PHE A  1 57  ? 118.600 152.827 150.099 1.00 31.98  ? 78  PHE A CA  1 
ATOM   377   C  C   . PHE A  1 57  ? 117.122 152.458 150.269 1.00 31.26  ? 78  PHE A C   1 
ATOM   378   O  O   . PHE A  1 57  ? 116.764 152.014 151.372 1.00 31.65  ? 78  PHE A O   1 
ATOM   379   C  CB  . PHE A  1 57  ? 118.874 154.332 149.991 1.00 31.35  ? 78  PHE A CB  1 
ATOM   380   C  CG  . PHE A  1 57  ? 118.531 155.075 151.249 1.00 31.14  ? 78  PHE A CG  1 
ATOM   381   C  CD1 . PHE A  1 57  ? 119.186 154.787 152.434 1.00 31.72  ? 78  PHE A CD1 1 
ATOM   382   C  CD2 . PHE A  1 57  ? 117.493 156.006 151.260 1.00 31.49  ? 78  PHE A CD2 1 
ATOM   383   C  CE1 . PHE A  1 57  ? 118.822 155.435 153.600 1.00 32.13  ? 78  PHE A CE1 1 
ATOM   384   C  CE2 . PHE A  1 57  ? 117.143 156.677 152.426 1.00 31.01  ? 78  PHE A CE2 1 
ATOM   385   C  CZ  . PHE A  1 57  ? 117.826 156.399 153.587 1.00 31.34  ? 78  PHE A CZ  1 
ATOM   386   N  N   . LEU A  1 58  ? 116.293 152.734 149.269 1.00 30.20  ? 79  LEU A N   1 
ATOM   387   C  CA  . LEU A  1 58  ? 114.846 152.391 149.272 1.00 30.53  ? 79  LEU A CA  1 
ATOM   388   C  C   . LEU A  1 58  ? 114.489 151.784 147.897 1.00 30.07  ? 79  LEU A C   1 
ATOM   389   O  O   . LEU A  1 58  ? 115.105 152.218 146.886 1.00 29.26  ? 79  LEU A O   1 
ATOM   390   C  CB  . LEU A  1 58  ? 114.023 153.656 149.551 1.00 29.98  ? 79  LEU A CB  1 
ATOM   391   C  CG  . LEU A  1 58  ? 114.251 154.359 150.889 1.00 30.14  ? 79  LEU A CG  1 
ATOM   392   C  CD1 . LEU A  1 58  ? 113.585 155.731 150.869 1.00 29.67  ? 79  LEU A CD1 1 
ATOM   393   C  CD2 . LEU A  1 58  ? 113.680 153.549 152.085 1.00 30.49  ? 79  LEU A CD2 1 
ATOM   394   N  N   . GLN A  1 59  ? 113.542 150.842 147.886 1.00 30.14  ? 80  GLN A N   1 
ATOM   395   C  CA  . GLN A  1 59  ? 113.112 150.047 146.694 1.00 30.61  ? 80  GLN A CA  1 
ATOM   396   C  C   . GLN A  1 59  ? 111.797 150.576 146.095 1.00 29.83  ? 80  GLN A C   1 
ATOM   397   O  O   . GLN A  1 59  ? 111.330 149.972 145.028 1.00 31.03  ? 80  GLN A O   1 
ATOM   398   C  CB  . GLN A  1 59  ? 112.943 148.592 147.116 1.00 32.06  ? 80  GLN A CB  1 
ATOM   399   C  CG  . GLN A  1 59  ? 114.232 147.984 147.652 1.00 33.24  ? 80  GLN A CG  1 
ATOM   400   C  CD  . GLN A  1 59  ? 114.182 146.468 147.706 1.00 35.79  ? 80  GLN A CD  1 
ATOM   401   O  OE1 . GLN A  1 59  ? 113.572 145.780 146.868 1.00 37.08  ? 80  GLN A OE1 1 
ATOM   402   N  NE2 . GLN A  1 59  ? 114.824 145.934 148.729 1.00 36.85  ? 80  GLN A NE2 1 
ATOM   403   N  N   . GLY A  1 60  ? 111.236 151.630 146.705 1.00 47.08  ? 81  GLY A N   1 
ATOM   404   C  CA  . GLY A  1 60  ? 109.978 152.279 146.335 1.00 45.72  ? 81  GLY A CA  1 
ATOM   405   C  C   . GLY A  1 60  ? 109.786 152.460 144.828 1.00 43.78  ? 81  GLY A C   1 
ATOM   406   O  O   . GLY A  1 60  ? 108.658 152.464 144.372 1.00 42.98  ? 81  GLY A O   1 
ATOM   407   N  N   . PRO A  1 61  ? 110.835 152.666 144.003 1.00 42.88  ? 82  PRO A N   1 
ATOM   408   C  CA  . PRO A  1 61  ? 110.648 152.768 142.554 1.00 42.24  ? 82  PRO A CA  1 
ATOM   409   C  C   . PRO A  1 61  ? 110.037 151.553 141.827 1.00 42.92  ? 82  PRO A C   1 
ATOM   410   O  O   . PRO A  1 61  ? 109.567 151.705 140.664 1.00 42.72  ? 82  PRO A O   1 
ATOM   411   C  CB  . PRO A  1 61  ? 112.034 153.036 142.018 1.00 41.76  ? 82  PRO A CB  1 
ATOM   412   C  CG  . PRO A  1 61  ? 112.711 153.700 143.179 1.00 42.00  ? 82  PRO A CG  1 
ATOM   413   C  CD  . PRO A  1 61  ? 112.203 152.988 144.398 1.00 42.89  ? 82  PRO A CD  1 
ATOM   414   N  N   . ALA A  1 62  ? 110.026 150.400 142.477 1.00 44.12  ? 83  ALA A N   1 
ATOM   415   C  CA  . ALA A  1 62  ? 109.271 149.212 142.027 1.00 45.24  ? 83  ALA A CA  1 
ATOM   416   C  C   . ALA A  1 62  ? 107.824 149.598 141.753 1.00 45.32  ? 83  ALA A C   1 
ATOM   417   O  O   . ALA A  1 62  ? 107.297 149.156 140.705 1.00 45.67  ? 83  ALA A O   1 
ATOM   418   C  CB  . ALA A  1 62  ? 109.357 148.121 143.061 1.00 46.69  ? 83  ALA A CB  1 
ATOM   419   N  N   . PHE A  1 63  ? 107.222 150.421 142.611 1.00 45.27  ? 84  PHE A N   1 
ATOM   420   C  CA  . PHE A  1 63  ? 105.803 150.831 142.498 1.00 45.46  ? 84  PHE A CA  1 
ATOM   421   C  C   . PHE A  1 63  ? 105.569 151.978 141.518 1.00 44.26  ? 84  PHE A C   1 
ATOM   422   O  O   . PHE A  1 63  ? 104.455 152.303 141.300 1.00 44.85  ? 84  PHE A O   1 
ATOM   423   C  CB  . PHE A  1 63  ? 105.277 151.253 143.862 1.00 46.16  ? 84  PHE A CB  1 
ATOM   424   C  CG  . PHE A  1 63  ? 105.502 150.213 144.914 1.00 47.69  ? 84  PHE A CG  1 
ATOM   425   C  CD1 . PHE A  1 63  ? 104.684 149.093 144.992 1.00 49.04  ? 84  PHE A CD1 1 
ATOM   426   C  CD2 . PHE A  1 63  ? 106.527 150.344 145.816 1.00 47.96  ? 84  PHE A CD2 1 
ATOM   427   C  CE1 . PHE A  1 63  ? 104.906 148.113 145.941 1.00 50.62  ? 84  PHE A CE1 1 
ATOM   428   C  CE2 . PHE A  1 63  ? 106.716 149.376 146.789 1.00 49.78  ? 84  PHE A CE2 1 
ATOM   429   C  CZ  . PHE A  1 63  ? 105.894 148.275 146.857 1.00 51.16  ? 84  PHE A CZ  1 
ATOM   430   N  N   . ALA A  1 64  ? 106.557 152.561 140.879 1.00 43.54  ? 85  ALA A N   1 
ATOM   431   C  CA  . ALA A  1 64  ? 106.363 153.803 140.089 1.00 42.55  ? 85  ALA A CA  1 
ATOM   432   C  C   . ALA A  1 64  ? 105.509 153.623 138.819 1.00 43.04  ? 85  ALA A C   1 
ATOM   433   O  O   . ALA A  1 64  ? 104.625 154.450 138.531 1.00 42.76  ? 85  ALA A O   1 
ATOM   434   C  CB  . ALA A  1 64  ? 107.708 154.390 139.767 1.00 41.89  ? 85  ALA A CB  1 
ATOM   435   N  N   . PRO A  1 65  ? 105.789 152.659 137.906 1.00 43.50  ? 86  PRO A N   1 
ATOM   436   C  CA  . PRO A  1 65  ? 105.160 152.719 136.587 1.00 43.61  ? 86  PRO A CA  1 
ATOM   437   C  C   . PRO A  1 65  ? 103.635 152.843 136.596 1.00 43.94  ? 86  PRO A C   1 
ATOM   438   O  O   . PRO A  1 65  ? 103.103 153.710 135.893 1.00 43.55  ? 86  PRO A O   1 
ATOM   439   C  CB  . PRO A  1 65  ? 105.680 151.445 135.932 1.00 44.55  ? 86  PRO A CB  1 
ATOM   440   C  CG  . PRO A  1 65  ? 106.999 151.223 136.596 1.00 44.46  ? 86  PRO A CG  1 
ATOM   441   C  CD  . PRO A  1 65  ? 106.699 151.514 138.047 1.00 43.97  ? 86  PRO A CD  1 
ATOM   442   N  N   . PRO A  1 66  ? 102.861 152.071 137.389 1.00 44.83  ? 87  PRO A N   1 
ATOM   443   C  CA  . PRO A  1 66  ? 101.424 152.305 137.436 1.00 45.76  ? 87  PRO A CA  1 
ATOM   444   C  C   . PRO A  1 66  ? 101.078 153.737 137.890 1.00 45.51  ? 87  PRO A C   1 
ATOM   445   O  O   . PRO A  1 66  ? 100.046 154.237 137.439 1.00 45.84  ? 87  PRO A O   1 
ATOM   446   C  CB  . PRO A  1 66  ? 100.854 151.213 138.381 1.00 46.59  ? 87  PRO A CB  1 
ATOM   447   C  CG  . PRO A  1 66  ? 102.006 150.224 138.567 1.00 46.77  ? 87  PRO A CG  1 
ATOM   448   C  CD  . PRO A  1 66  ? 103.274 151.007 138.325 1.00 45.55  ? 87  PRO A CD  1 
ATOM   449   N  N   . ARG A  1 67  ? 101.879 154.359 138.771 1.00 45.77  ? 88  ARG A N   1 
ATOM   450   C  CA  . ARG A  1 67  ? 101.586 155.721 139.311 1.00 46.35  ? 88  ARG A CA  1 
ATOM   451   C  C   . ARG A  1 67  ? 101.837 156.759 138.215 1.00 45.17  ? 88  ARG A C   1 
ATOM   452   O  O   . ARG A  1 67  ? 101.061 157.729 138.117 1.00 44.90  ? 88  ARG A O   1 
ATOM   453   C  CB  . ARG A  1 67  ? 102.417 156.129 140.533 1.00 47.39  ? 88  ARG A CB  1 
ATOM   454   C  CG  . ARG A  1 67  ? 102.138 155.288 141.744 1.00 50.47  ? 88  ARG A CG  1 
ATOM   455   C  CD  . ARG A  1 67  ? 100.706 155.345 142.233 1.00 53.98  ? 88  ARG A CD  1 
ATOM   456   N  NE  . ARG A  1 67  ? 100.617 154.455 143.394 1.00 58.02  ? 88  ARG A NE  1 
ATOM   457   C  CZ  . ARG A  1 67  ? 100.371 154.816 144.656 1.00 61.75  ? 88  ARG A CZ  1 
ATOM   458   N  NH1 . ARG A  1 67  ? 100.100 156.083 144.948 1.00 63.75  ? 88  ARG A NH1 1 
ATOM   459   N  NH2 . ARG A  1 67  ? 100.333 153.890 145.607 1.00 63.03  ? 88  ARG A NH2 1 
ATOM   460   N  N   . ILE A  1 68  ? 102.882 156.570 137.426 1.00 44.94  ? 89  ILE A N   1 
ATOM   461   C  CA  . ILE A  1 68  ? 103.191 157.493 136.294 1.00 44.97  ? 89  ILE A CA  1 
ATOM   462   C  C   . ILE A  1 68  ? 102.046 157.461 135.276 1.00 45.76  ? 89  ILE A C   1 
ATOM   463   O  O   . ILE A  1 68  ? 101.651 158.542 134.815 1.00 45.59  ? 89  ILE A O   1 
ATOM   464   C  CB  . ILE A  1 68  ? 104.537 157.144 135.664 1.00 44.94  ? 89  ILE A CB  1 
ATOM   465   C  CG1 . ILE A  1 68  ? 105.665 157.277 136.699 1.00 44.29  ? 89  ILE A CG1 1 
ATOM   466   C  CG2 . ILE A  1 68  ? 104.758 157.992 134.410 1.00 45.60  ? 89  ILE A CG2 1 
ATOM   467   C  CD1 . ILE A  1 68  ? 107.020 156.813 136.236 1.00 44.22  ? 89  ILE A CD1 1 
ATOM   468   N  N   . ARG A  1 69  ? 101.523 156.276 134.964 1.00 47.28  ? 90  ARG A N   1 
ATOM   469   C  CA  . ARG A  1 69  ? 100.394 156.132 134.007 1.00 49.17  ? 90  ARG A CA  1 
ATOM   470   C  C   . ARG A  1 69  ? 99.184  156.900 134.510 1.00 48.43  ? 90  ARG A C   1 
ATOM   471   O  O   . ARG A  1 69  ? 98.604  157.620 133.703 1.00 48.25  ? 90  ARG A O   1 
ATOM   472   C  CB  . ARG A  1 69  ? 99.962  154.684 133.809 1.00 51.84  ? 90  ARG A CB  1 
ATOM   473   C  CG  . ARG A  1 69  ? 101.004 153.899 133.046 1.00 54.09  ? 90  ARG A CG  1 
ATOM   474   C  CD  . ARG A  1 69  ? 100.521 152.520 132.683 1.00 57.10  ? 90  ARG A CD  1 
ATOM   475   N  NE  . ARG A  1 69  ? 101.657 151.885 132.018 1.00 58.63  ? 90  ARG A NE  1 
ATOM   476   C  CZ  . ARG A  1 69  ? 102.527 151.081 132.601 1.00 58.84  ? 90  ARG A CZ  1 
ATOM   477   N  NH1 . ARG A  1 69  ? 102.417 150.781 133.888 1.00 59.36  ? 90  ARG A NH1 1 
ATOM   478   N  NH2 . ARG A  1 69  ? 103.493 150.564 131.870 1.00 59.62  ? 90  ARG A NH2 1 
ATOM   479   N  N   . GLU A  1 70  ? 98.843  156.753 135.793 1.00 47.80  ? 91  GLU A N   1 
ATOM   480   C  CA  . GLU A  1 70  ? 97.658  157.420 136.363 1.00 48.04  ? 91  GLU A CA  1 
ATOM   481   C  C   . GLU A  1 70  ? 97.825  158.940 136.199 1.00 46.91  ? 91  GLU A C   1 
ATOM   482   O  O   . GLU A  1 70  ? 96.812  159.603 135.886 1.00 47.38  ? 91  GLU A O   1 
ATOM   483   C  CB  . GLU A  1 70  ? 97.448  157.070 137.827 1.00 49.18  ? 91  GLU A CB  1 
ATOM   484   C  CG  . GLU A  1 70  ? 96.378  157.928 138.481 1.00 49.70  ? 91  GLU A CG  1 
ATOM   485   C  CD  . GLU A  1 70  ? 96.154  157.644 139.953 1.00 50.34  ? 91  GLU A CD  1 
ATOM   486   O  OE1 . GLU A  1 70  ? 94.968  157.687 140.343 1.00 52.19  ? 91  GLU A OE1 1 
ATOM   487   O  OE2 . GLU A  1 70  ? 97.150  157.417 140.701 1.00 49.12  ? 91  GLU A OE2 1 
ATOM   488   N  N   . ALA A  1 71  ? 99.035  159.466 136.458 1.00 45.65  ? 92  ALA A N   1 
ATOM   489   C  CA  . ALA A  1 71  ? 99.318  160.927 136.355 1.00 45.12  ? 92  ALA A CA  1 
ATOM   490   C  C   . ALA A  1 71  ? 99.278  161.418 134.872 1.00 45.88  ? 92  ALA A C   1 
ATOM   491   O  O   . ALA A  1 71  ? 98.839  162.541 134.644 1.00 45.81  ? 92  ALA A O   1 
ATOM   492   C  CB  . ALA A  1 71  ? 100.599 161.272 137.086 1.00 44.08  ? 92  ALA A CB  1 
ATOM   493   N  N   . ILE A  1 72  ? 99.655  160.610 133.879 1.00 46.52  ? 93  ILE A N   1 
ATOM   494   C  CA  . ILE A  1 72  ? 99.682  161.044 132.456 1.00 48.03  ? 93  ILE A CA  1 
ATOM   495   C  C   . ILE A  1 72  ? 98.247  161.365 132.051 1.00 49.41  ? 93  ILE A C   1 
ATOM   496   O  O   . ILE A  1 72  ? 98.047  162.336 131.351 1.00 50.12  ? 93  ILE A O   1 
ATOM   497   C  CB  . ILE A  1 72  ? 100.255 159.947 131.555 1.00 48.94  ? 93  ILE A CB  1 
ATOM   498   C  CG1 . ILE A  1 72  ? 101.741 159.736 131.836 1.00 48.80  ? 93  ILE A CG1 1 
ATOM   499   C  CG2 . ILE A  1 72  ? 99.975  160.245 130.080 1.00 50.54  ? 93  ILE A CG2 1 
ATOM   500   C  CD1 . ILE A  1 72  ? 102.366 158.603 131.068 1.00 49.95  ? 93  ILE A CD1 1 
ATOM   501   N  N   . TRP A  1 73  ? 97.302  160.558 132.516 1.00 49.58  ? 94  TRP A N   1 
ATOM   502   C  CA  . TRP A  1 73  ? 95.889  160.598 132.096 1.00 50.88  ? 94  TRP A CA  1 
ATOM   503   C  C   . TRP A  1 73  ? 95.009  161.189 133.197 1.00 49.94  ? 94  TRP A C   1 
ATOM   504   O  O   . TRP A  1 73  ? 93.816  160.946 133.121 1.00 51.31  ? 94  TRP A O   1 
ATOM   505   C  CB  . TRP A  1 73  ? 95.433  159.189 131.724 1.00 52.16  ? 94  TRP A CB  1 
ATOM   506   C  CG  . TRP A  1 73  ? 96.273  158.572 130.654 1.00 53.16  ? 94  TRP A CG  1 
ATOM   507   C  CD1 . TRP A  1 73  ? 97.070  157.471 130.763 1.00 53.08  ? 94  TRP A CD1 1 
ATOM   508   C  CD2 . TRP A  1 73  ? 96.370  159.011 129.292 1.00 54.81  ? 94  TRP A CD2 1 
ATOM   509   N  NE1 . TRP A  1 73  ? 97.675  157.206 129.564 1.00 54.45  ? 94  TRP A NE1 1 
ATOM   510   C  CE2 . TRP A  1 73  ? 97.253  158.125 128.639 1.00 55.35  ? 94  TRP A CE2 1 
ATOM   511   C  CE3 . TRP A  1 73  ? 95.807  160.069 128.564 1.00 56.07  ? 94  TRP A CE3 1 
ATOM   512   C  CZ2 . TRP A  1 73  ? 97.580  158.269 127.295 1.00 56.40  ? 94  TRP A CZ2 1 
ATOM   513   C  CZ3 . TRP A  1 73  ? 96.122  160.210 127.234 1.00 56.97  ? 94  TRP A CZ3 1 
ATOM   514   C  CH2 . TRP A  1 73  ? 97.002  159.321 126.625 1.00 57.69  ? 94  TRP A CH2 1 
ATOM   515   N  N   . CYS A  1 74  ? 95.561  161.941 134.152 1.00 48.36  ? 95  CYS A N   1 
ATOM   516   C  CA  . CYS A  1 74  ? 94.815  162.573 135.273 1.00 47.59  ? 95  CYS A CA  1 
ATOM   517   C  C   . CYS A  1 74  ? 93.788  163.543 134.686 1.00 48.64  ? 95  CYS A C   1 
ATOM   518   O  O   . CYS A  1 74  ? 94.129  164.264 133.750 1.00 49.29  ? 95  CYS A O   1 
ATOM   519   C  CB  . CYS A  1 74  ? 95.736  163.334 136.233 1.00 46.35  ? 95  CYS A CB  1 
ATOM   520   S  SG  . CYS A  1 74  ? 94.805  164.163 137.561 1.00 45.87  ? 95  CYS A SG  1 
ATOM   521   N  N   . GLY A  1 75  ? 92.586  163.578 135.255 1.00 49.55  ? 96  GLY A N   1 
ATOM   522   C  CA  . GLY A  1 75  ? 91.461  164.432 134.823 1.00 50.29  ? 96  GLY A CA  1 
ATOM   523   C  C   . GLY A  1 75  ? 91.814  165.904 134.961 1.00 50.44  ? 96  GLY A C   1 
ATOM   524   O  O   . GLY A  1 75  ? 91.237  166.720 134.187 1.00 51.37  ? 96  GLY A O   1 
ATOM   525   N  N   . SER A  1 76  ? 92.766  166.243 135.841 1.00 49.42  ? 97  SER A N   1 
ATOM   526   C  CA  . SER A  1 76  ? 93.228  167.645 136.090 1.00 50.13  ? 97  SER A CA  1 
ATOM   527   C  C   . SER A  1 76  ? 94.014  168.231 134.866 1.00 50.87  ? 97  SER A C   1 
ATOM   528   O  O   . SER A  1 76  ? 94.260  169.446 134.768 1.00 51.98  ? 97  SER A O   1 
ATOM   529   C  CB  . SER A  1 76  ? 94.105  167.756 137.353 1.00 49.28  ? 97  SER A CB  1 
ATOM   530   O  OG  . SER A  1 76  ? 95.430  167.228 137.003 1.00 49.26  ? 97  SER A OG  1 
ATOM   531   N  N   . THR A  1 77  ? 94.412  167.348 133.929 1.00 51.24  ? 98  THR A N   1 
ATOM   532   C  CA  . THR A  1 77  ? 95.406  167.688 132.864 1.00 53.29  ? 98  THR A CA  1 
ATOM   533   C  C   . THR A  1 77  ? 94.697  167.680 131.508 1.00 54.99  ? 98  THR A C   1 
ATOM   534   O  O   . THR A  1 77  ? 93.560  167.160 131.413 1.00 55.96  ? 98  THR A O   1 
ATOM   535   C  CB  . THR A  1 77  ? 96.624  166.752 132.868 1.00 52.60  ? 98  THR A CB  1 
ATOM   536   O  OG1 . THR A  1 77  ? 96.170  165.433 132.503 1.00 53.48  ? 98  THR A OG1 1 
ATOM   537   C  CG2 . THR A  1 77  ? 97.330  166.710 134.205 1.00 51.68  ? 98  THR A CG2 1 
ATOM   538   N  N   . ASN A  1 78  ? 95.331  168.242 130.489 1.00 57.53  ? 99  ASN A N   1 
ATOM   539   C  CA  . ASN A  1 78  ? 94.831  168.039 129.100 1.00 59.62  ? 99  ASN A CA  1 
ATOM   540   C  C   . ASN A  1 78  ? 95.770  167.069 128.407 1.00 59.04  ? 99  ASN A C   1 
ATOM   541   O  O   . ASN A  1 78  ? 96.819  166.760 128.968 1.00 58.47  ? 99  ASN A O   1 
ATOM   542   C  CB  . ASN A  1 78  ? 94.570  169.326 128.334 1.00 62.27  ? 99  ASN A CB  1 
ATOM   543   C  CG  . ASN A  1 78  ? 95.786  170.131 127.960 1.00 64.30  ? 99  ASN A CG  1 
ATOM   544   O  OD1 . ASN A  1 78  ? 96.919  169.860 128.363 1.00 65.68  ? 99  ASN A OD1 1 
ATOM   545   N  ND2 . ASN A  1 78  ? 95.536  171.140 127.146 1.00 67.55  ? 99  ASN A ND2 1 
ATOM   546   N  N   . SER A  1 79  ? 95.311  166.527 127.297 1.00 60.02  ? 100 SER A N   1 
ATOM   547   C  CA  . SER A  1 79  ? 95.978  165.437 126.565 1.00 60.12  ? 100 SER A CA  1 
ATOM   548   C  C   . SER A  1 79  ? 97.015  166.026 125.604 1.00 60.44  ? 100 SER A C   1 
ATOM   549   O  O   . SER A  1 79  ? 97.556  165.213 124.853 1.00 61.66  ? 100 SER A O   1 
ATOM   550   C  CB  . SER A  1 79  ? 94.941  164.625 125.845 1.00 62.15  ? 100 SER A CB  1 
ATOM   551   O  OG  . SER A  1 79  ? 94.228  165.455 124.921 1.00 65.06  ? 100 SER A OG  1 
ATOM   552   N  N   . ALA A  1 80  ? 97.301  167.347 125.634 1.00 59.80  ? 101 ALA A N   1 
ATOM   553   C  CA  . ALA A  1 80  ? 98.278  168.014 124.720 1.00 60.85  ? 101 ALA A CA  1 
ATOM   554   C  C   . ALA A  1 80  ? 99.568  168.374 125.459 1.00 59.28  ? 101 ALA A C   1 
ATOM   555   O  O   . ALA A  1 80  ? 99.524  168.817 126.640 1.00 57.42  ? 101 ALA A O   1 
ATOM   556   C  CB  . ALA A  1 80  ? 97.710  169.245 124.054 1.00 62.54  ? 101 ALA A CB  1 
ATOM   557   N  N   . THR A  1 81  ? 100.677 168.207 124.747 1.00 59.94  ? 102 THR A N   1 
ATOM   558   C  CA  . THR A  1 81  ? 102.046 168.476 125.233 1.00 58.92  ? 102 THR A CA  1 
ATOM   559   C  C   . THR A  1 81  ? 102.353 169.931 124.942 1.00 60.08  ? 102 THR A C   1 
ATOM   560   O  O   . THR A  1 81  ? 101.665 170.539 124.097 1.00 62.43  ? 102 THR A O   1 
ATOM   561   C  CB  . THR A  1 81  ? 103.086 167.545 124.600 1.00 59.67  ? 102 THR A CB  1 
ATOM   562   O  OG1 . THR A  1 81  ? 103.416 167.919 123.255 1.00 62.05  ? 102 THR A OG1 1 
ATOM   563   C  CG2 . THR A  1 81  ? 102.610 166.110 124.615 1.00 58.98  ? 102 THR A CG2 1 
ATOM   564   N  N   . GLU A  1 82  ? 103.379 170.433 125.603 1.00 59.29  ? 103 GLU A N   1 
ATOM   565   C  CA  . GLU A  1 82  ? 103.724 171.869 125.597 1.00 60.99  ? 103 GLU A CA  1 
ATOM   566   C  C   . GLU A  1 82  ? 103.834 172.373 124.157 1.00 64.20  ? 103 GLU A C   1 
ATOM   567   O  O   . GLU A  1 82  ? 103.479 173.538 123.934 1.00 65.04  ? 103 GLU A O   1 
ATOM   568   C  CB  . GLU A  1 82  ? 105.042 172.117 126.330 1.00 60.04  ? 103 GLU A CB  1 
ATOM   569   C  CG  . GLU A  1 82  ? 104.965 171.845 127.813 1.00 57.17  ? 103 GLU A CG  1 
ATOM   570   C  CD  . GLU A  1 82  ? 105.847 172.755 128.659 1.00 56.82  ? 103 GLU A CD  1 
ATOM   571   O  OE1 . GLU A  1 82  ? 106.764 173.410 128.085 1.00 57.86  ? 103 GLU A OE1 1 
ATOM   572   O  OE2 . GLU A  1 82  ? 105.579 172.836 129.874 1.00 54.49  ? 103 GLU A OE2 1 
ATOM   573   N  N   . GLU A  1 83  ? 104.424 171.552 123.288 1.00 66.20  ? 104 GLU A N   1 
ATOM   574   C  CA  . GLU A  1 83  ? 104.560 171.863 121.842 1.00 70.77  ? 104 GLU A CA  1 
ATOM   575   C  C   . GLU A  1 83  ? 103.206 171.798 121.122 1.00 72.05  ? 104 GLU A C   1 
ATOM   576   O  O   . GLU A  1 83  ? 103.027 172.588 120.189 1.00 74.33  ? 104 GLU A O   1 
ATOM   577   C  CB  . GLU A  1 83  ? 105.770 171.167 121.221 1.00 72.04  ? 104 GLU A CB  1 
ATOM   578   C  CG  . GLU A  1 83  ? 107.041 171.959 121.469 1.00 73.37  ? 104 GLU A CG  1 
ATOM   579   C  CD  . GLU A  1 83  ? 108.338 171.174 121.461 1.00 72.73  ? 104 GLU A CD  1 
ATOM   580   O  OE1 . GLU A  1 83  ? 108.284 169.939 121.601 1.00 71.07  ? 104 GLU A OE1 1 
ATOM   581   O  OE2 . GLU A  1 83  ? 109.395 171.806 121.315 1.00 73.91  ? 104 GLU A OE2 1 
ATOM   582   N  N   . GLY A  1 84  ? 102.330 170.851 121.492 1.00 70.71  ? 105 GLY A N   1 
ATOM   583   C  CA  . GLY A  1 84  ? 101.001 170.753 120.868 1.00 71.96  ? 105 GLY A CA  1 
ATOM   584   C  C   . GLY A  1 84  ? 100.746 169.388 120.279 1.00 72.51  ? 105 GLY A C   1 
ATOM   585   O  O   . GLY A  1 84  ? 99.829  169.284 119.471 1.00 75.19  ? 105 GLY A O   1 
ATOM   586   N  N   . LYS A  1 85  ? 101.459 168.344 120.693 1.00 71.24  ? 106 LYS A N   1 
ATOM   587   C  CA  . LYS A  1 85  ? 101.123 166.971 120.224 1.00 71.68  ? 106 LYS A CA  1 
ATOM   588   C  C   . LYS A  1 85  ? 100.025 166.335 121.098 1.00 69.62  ? 106 LYS A C   1 
ATOM   589   O  O   . LYS A  1 85  ? 99.989  166.590 122.337 1.00 67.24  ? 106 LYS A O   1 
ATOM   590   C  CB  . LYS A  1 85  ? 102.398 166.143 120.109 1.00 71.47  ? 106 LYS A CB  1 
ATOM   591   C  CG  . LYS A  1 85  ? 103.271 166.557 118.928 1.00 74.77  ? 106 LYS A CG  1 
ATOM   592   C  CD  . LYS A  1 85  ? 104.404 165.599 118.731 1.00 74.78  ? 106 LYS A CD  1 
ATOM   593   C  CE  . LYS A  1 85  ? 105.184 165.787 117.458 1.00 77.71  ? 106 LYS A CE  1 
ATOM   594   N  NZ  . LYS A  1 85  ? 106.075 164.617 117.289 1.00 77.46  ? 106 LYS A NZ  1 
ATOM   595   N  N   . GLU A  1 86  ? 99.170  165.522 120.462 1.00 70.92  ? 107 GLU A N   1 
ATOM   596   C  CA  . GLU A  1 86  ? 97.963  164.876 121.055 1.00 70.14  ? 107 GLU A CA  1 
ATOM   597   C  C   . GLU A  1 86  ? 98.358  163.474 121.567 1.00 68.78  ? 107 GLU A C   1 
ATOM   598   O  O   . GLU A  1 86  ? 98.689  162.618 120.752 1.00 70.14  ? 107 GLU A O   1 
ATOM   599   C  CB  . GLU A  1 86  ? 96.848  164.903 119.994 1.00 73.07  ? 107 GLU A CB  1 
ATOM   600   C  CG  . GLU A  1 86  ? 95.481  164.405 120.446 1.00 73.00  ? 107 GLU A CG  1 
ATOM   601   C  CD  . GLU A  1 86  ? 95.053  164.841 121.840 1.00 71.14  ? 107 GLU A CD  1 
ATOM   602   O  OE1 . GLU A  1 86  ? 94.866  166.074 122.038 1.00 71.53  ? 107 GLU A OE1 1 
ATOM   603   O  OE2 . GLU A  1 86  ? 94.996  163.960 122.747 1.00 69.19  ? 107 GLU A OE2 1 
ATOM   604   N  N   . LEU A  1 87  ? 98.333  163.237 122.882 1.00 66.55  ? 108 LEU A N   1 
ATOM   605   C  CA  . LEU A  1 87  ? 98.755  161.951 123.517 1.00 64.84  ? 108 LEU A CA  1 
ATOM   606   C  C   . LEU A  1 87  ? 97.680  160.843 123.361 1.00 65.43  ? 108 LEU A C   1 
ATOM   607   O  O   . LEU A  1 87  ? 97.966  159.599 123.537 1.00 64.67  ? 108 LEU A O   1 
ATOM   608   C  CB  . LEU A  1 87  ? 98.998  162.203 125.007 1.00 62.46  ? 108 LEU A CB  1 
ATOM   609   C  CG  . LEU A  1 87  ? 100.062 163.225 125.393 1.00 61.56  ? 108 LEU A CG  1 
ATOM   610   C  CD1 . LEU A  1 87  ? 99.872  163.624 126.855 1.00 59.93  ? 108 LEU A CD1 1 
ATOM   611   C  CD2 . LEU A  1 87  ? 101.453 162.658 125.187 1.00 61.60  ? 108 LEU A CD2 1 
ATOM   612   N  N   . LYS A  1 88  ? 96.448  161.265 122.978 1.00 66.63  ? 109 LYS A N   1 
ATOM   613   C  CA  . LYS A  1 88  ? 95.373  160.280 122.721 1.00 68.01  ? 109 LYS A CA  1 
ATOM   614   C  C   . LYS A  1 88  ? 95.609  159.706 121.330 1.00 70.54  ? 109 LYS A C   1 
ATOM   615   O  O   . LYS A  1 88  ? 94.954  158.719 120.995 1.00 72.66  ? 109 LYS A O   1 
ATOM   616   C  CB  . LYS A  1 88  ? 93.975  160.888 122.767 1.00 69.29  ? 109 LYS A CB  1 
ATOM   617   C  CG  . LYS A  1 88  ? 93.384  161.213 124.127 1.00 67.71  ? 109 LYS A CG  1 
ATOM   618   C  CD  . LYS A  1 88  ? 92.161  162.092 123.922 1.00 70.04  ? 109 LYS A CD  1 
ATOM   619   C  CE  . LYS A  1 88  ? 91.081  161.887 124.957 1.00 70.09  ? 109 LYS A CE  1 
ATOM   620   N  NZ  . LYS A  1 88  ? 91.636  162.079 126.310 1.00 68.40  ? 109 LYS A NZ  1 
ATOM   621   N  N   . ASP A  1 89  ? 96.525  160.309 120.573 1.00 71.19  ? 110 ASP A N   1 
ATOM   622   C  CA  . ASP A  1 89  ? 96.828  159.797 119.215 1.00 73.42  ? 110 ASP A CA  1 
ATOM   623   C  C   . ASP A  1 89  ? 97.879  158.700 119.373 1.00 72.75  ? 110 ASP A C   1 
ATOM   624   O  O   . ASP A  1 89  ? 99.007  159.014 119.759 1.00 70.74  ? 110 ASP A O   1 
ATOM   625   C  CB  . ASP A  1 89  ? 97.277  160.937 118.297 1.00 74.79  ? 110 ASP A CB  1 
ATOM   626   C  CG  . ASP A  1 89  ? 97.518  160.540 116.851 1.00 77.85  ? 110 ASP A CG  1 
ATOM   627   O  OD1 . ASP A  1 89  ? 97.568  159.332 116.570 1.00 78.23  ? 110 ASP A OD1 1 
ATOM   628   O  OD2 . ASP A  1 89  ? 97.663  161.452 116.023 1.00 79.43  ? 110 ASP A OD2 1 
ATOM   629   N  N   . PRO A  1 90  ? 97.546  157.428 119.090 1.00 74.56  ? 111 PRO A N   1 
ATOM   630   C  CA  . PRO A  1 90  ? 98.507  156.325 119.217 1.00 74.14  ? 111 PRO A CA  1 
ATOM   631   C  C   . PRO A  1 90  ? 99.805  156.538 118.421 1.00 75.24  ? 111 PRO A C   1 
ATOM   632   O  O   . PRO A  1 90  ? 100.809 155.962 118.769 1.00 74.26  ? 111 PRO A O   1 
ATOM   633   C  CB  . PRO A  1 90  ? 97.746  155.135 118.601 1.00 76.36  ? 111 PRO A CB  1 
ATOM   634   C  CG  . PRO A  1 90  ? 96.293  155.491 118.800 1.00 76.40  ? 111 PRO A CG  1 
ATOM   635   C  CD  . PRO A  1 90  ? 96.250  156.983 118.553 1.00 76.49  ? 111 PRO A CD  1 
ATOM   636   N  N   . ARG A  1 91  ? 99.740  157.321 117.336 1.00 77.44  ? 112 ARG A N   1 
ATOM   637   C  CA  . ARG A  1 91  ? 100.936 157.704 116.538 1.00 78.57  ? 112 ARG A CA  1 
ATOM   638   C  C   . ARG A  1 91  ? 101.924 158.469 117.434 1.00 75.77  ? 112 ARG A C   1 
ATOM   639   O  O   . ARG A  1 91  ? 103.140 158.432 117.155 1.00 75.86  ? 112 ARG A O   1 
ATOM   640   C  CB  . ARG A  1 91  ? 100.536 158.517 115.308 1.00 81.51  ? 112 ARG A CB  1 
ATOM   641   C  CG  . ARG A  1 91  ? 99.930  157.648 114.220 1.00 84.94  ? 112 ARG A CG  1 
ATOM   642   C  CD  . ARG A  1 91  ? 99.344  158.443 113.084 1.00 88.34  ? 112 ARG A CD  1 
ATOM   643   N  NE  . ARG A  1 91  ? 98.485  159.510 113.564 1.00 87.22  ? 112 ARG A NE  1 
ATOM   644   C  CZ  . ARG A  1 91  ? 97.875  160.375 112.774 1.00 89.78  ? 112 ARG A CZ  1 
ATOM   645   N  NH1 . ARG A  1 91  ? 98.012  160.285 111.466 1.00 93.96  ? 112 ARG A NH1 1 
ATOM   646   N  NH2 . ARG A  1 91  ? 97.114  161.324 113.288 1.00 88.73  ? 112 ARG A NH2 1 
ATOM   647   N  N   . VAL A  1 92  ? 101.400 159.153 118.447 1.00 73.07  ? 113 VAL A N   1 
ATOM   648   C  CA  . VAL A  1 92  ? 102.163 160.023 119.388 1.00 70.81  ? 113 VAL A CA  1 
ATOM   649   C  C   . VAL A  1 92  ? 102.556 159.204 120.624 1.00 67.57  ? 113 VAL A C   1 
ATOM   650   O  O   . VAL A  1 92  ? 103.723 159.357 121.076 1.00 66.08  ? 113 VAL A O   1 
ATOM   651   C  CB  . VAL A  1 92  ? 101.326 161.264 119.751 1.00 70.43  ? 113 VAL A CB  1 
ATOM   652   C  CG1 . VAL A  1 92  ? 101.966 162.100 120.832 1.00 68.63  ? 113 VAL A CG1 1 
ATOM   653   C  CG2 . VAL A  1 92  ? 101.017 162.114 118.529 1.00 73.75  ? 113 VAL A CG2 1 
ATOM   654   N  N   . LEU A  1 93  ? 101.625 158.394 121.157 1.00 65.62  ? 114 LEU A N   1 
ATOM   655   C  CA  . LEU A  1 93  ? 101.809 157.616 122.417 1.00 62.04  ? 114 LEU A CA  1 
ATOM   656   C  C   . LEU A  1 93  ? 100.940 156.364 122.414 1.00 62.61  ? 114 LEU A C   1 
ATOM   657   O  O   . LEU A  1 93  ? 99.725  156.513 122.326 1.00 64.69  ? 114 LEU A O   1 
ATOM   658   C  CB  . LEU A  1 93  ? 101.450 158.479 123.635 1.00 59.77  ? 114 LEU A CB  1 
ATOM   659   C  CG  . LEU A  1 93  ? 101.668 157.820 125.011 1.00 56.45  ? 114 LEU A CG  1 
ATOM   660   C  CD1 . LEU A  1 93  ? 103.085 157.260 125.160 1.00 54.66  ? 114 LEU A CD1 1 
ATOM   661   C  CD2 . LEU A  1 93  ? 101.403 158.807 126.142 1.00 54.17  ? 114 LEU A CD2 1 
ATOM   662   N  N   . THR A  1 94  ? 101.560 155.198 122.591 1.00 61.48  ? 115 THR A N   1 
ATOM   663   C  CA  . THR A  1 94  ? 100.909 153.893 122.866 1.00 62.22  ? 115 THR A CA  1 
ATOM   664   C  C   . THR A  1 94  ? 101.496 153.368 124.187 1.00 58.96  ? 115 THR A C   1 
ATOM   665   O  O   . THR A  1 94  ? 102.390 154.039 124.732 1.00 58.03  ? 115 THR A O   1 
ATOM   666   C  CB  . THR A  1 94  ? 100.999 152.991 121.623 1.00 65.76  ? 115 THR A CB  1 
ATOM   667   O  OG1 . THR A  1 94  ? 102.307 152.910 121.040 1.00 65.82  ? 115 THR A OG1 1 
ATOM   668   C  CG2 . THR A  1 94  ? 100.052 153.469 120.537 1.00 69.86  ? 115 THR A CG2 1 
ATOM   669   N  N   . ASP A  1 95  ? 100.995 152.268 124.746 1.00 58.73  ? 116 ASP A N   1 
ATOM   670   C  CA  . ASP A  1 95  ? 101.465 151.779 126.076 1.00 55.78  ? 116 ASP A CA  1 
ATOM   671   C  C   . ASP A  1 95  ? 101.372 150.254 126.068 1.00 56.76  ? 116 ASP A C   1 
ATOM   672   O  O   . ASP A  1 95  ? 100.270 149.767 125.829 1.00 58.81  ? 116 ASP A O   1 
ATOM   673   C  CB  . ASP A  1 95  ? 100.640 152.432 127.188 1.00 54.06  ? 116 ASP A CB  1 
ATOM   674   C  CG  . ASP A  1 95  ? 101.119 152.233 128.624 1.00 51.79  ? 116 ASP A CG  1 
ATOM   675   O  OD1 . ASP A  1 95  ? 102.089 151.463 128.844 1.00 51.21  ? 116 ASP A OD1 1 
ATOM   676   O  OD2 . ASP A  1 95  ? 100.482 152.833 129.534 1.00 50.41  ? 116 ASP A OD2 1 
ATOM   677   N  N   . VAL A  1 96  ? 102.484 149.537 126.228 1.00 55.42  ? 117 VAL A N   1 
ATOM   678   C  CA  . VAL A  1 96  ? 102.478 148.048 126.173 1.00 57.42  ? 117 VAL A CA  1 
ATOM   679   C  C   . VAL A  1 96  ? 102.560 147.475 127.599 1.00 55.60  ? 117 VAL A C   1 
ATOM   680   O  O   . VAL A  1 96  ? 102.806 146.273 127.754 1.00 57.08  ? 117 VAL A O   1 
ATOM   681   C  CB  . VAL A  1 96  ? 103.584 147.508 125.233 1.00 59.31  ? 117 VAL A CB  1 
ATOM   682   C  CG1 . VAL A  1 96  ? 103.555 148.181 123.862 1.00 61.89  ? 117 VAL A CG1 1 
ATOM   683   C  CG2 . VAL A  1 96  ? 104.979 147.618 125.804 1.00 56.99  ? 117 VAL A CG2 1 
ATOM   684   N  N   . GLY A  1 97  ? 102.330 148.276 128.632 1.00 53.32  ? 118 GLY A N   1 
ATOM   685   C  CA  . GLY A  1 97  ? 102.205 147.728 129.989 1.00 52.11  ? 118 GLY A CA  1 
ATOM   686   C  C   . GLY A  1 97  ? 103.555 147.396 130.620 1.00 50.25  ? 118 GLY A C   1 
ATOM   687   O  O   . GLY A  1 97  ? 104.562 147.920 130.176 1.00 50.51  ? 118 GLY A O   1 
ATOM   688   N  N   . ASP A  1 98  ? 103.546 146.541 131.638 1.00 49.75  ? 119 ASP A N   1 
ATOM   689   C  CA  . ASP A  1 98  ? 104.666 146.330 132.579 1.00 47.83  ? 119 ASP A CA  1 
ATOM   690   C  C   . ASP A  1 98  ? 105.176 144.911 132.413 1.00 48.92  ? 119 ASP A C   1 
ATOM   691   O  O   . ASP A  1 98  ? 104.361 143.987 132.332 1.00 51.52  ? 119 ASP A O   1 
ATOM   692   C  CB  . ASP A  1 98  ? 104.245 146.540 134.045 1.00 46.53  ? 119 ASP A CB  1 
ATOM   693   C  CG  . ASP A  1 98  ? 104.045 147.985 134.470 1.00 44.16  ? 119 ASP A CG  1 
ATOM   694   O  OD1 . ASP A  1 98  ? 104.499 148.896 133.748 1.00 42.58  ? 119 ASP A OD1 1 
ATOM   695   O  OD2 . ASP A  1 98  ? 103.367 148.189 135.486 1.00 45.44  ? 119 ASP A OD2 1 
ATOM   696   N  N   . VAL A  1 99  ? 106.491 144.777 132.364 1.00 48.20  ? 120 VAL A N   1 
ATOM   697   C  CA  . VAL A  1 99  ? 107.211 143.482 132.498 1.00 49.07  ? 120 VAL A CA  1 
ATOM   698   C  C   . VAL A  1 99  ? 106.829 142.971 133.872 1.00 48.05  ? 120 VAL A C   1 
ATOM   699   O  O   . VAL A  1 99  ? 106.883 143.730 134.825 1.00 46.84  ? 120 VAL A O   1 
ATOM   700   C  CB  . VAL A  1 99  ? 108.727 143.722 132.393 1.00 48.25  ? 120 VAL A CB  1 
ATOM   701   C  CG1 . VAL A  1 99  ? 109.538 142.495 132.769 1.00 49.80  ? 120 VAL A CG1 1 
ATOM   702   C  CG2 . VAL A  1 99  ? 109.114 144.272 131.029 1.00 49.18  ? 120 VAL A CG2 1 
ATOM   703   N  N   . PRO A  1 100 ? 106.356 141.730 134.028 1.00 50.08  ? 121 PRO A N   1 
ATOM   704   C  CA  . PRO A  1 100 ? 105.999 141.218 135.348 1.00 49.81  ? 121 PRO A CA  1 
ATOM   705   C  C   . PRO A  1 100 ? 107.253 140.852 136.139 1.00 48.88  ? 121 PRO A C   1 
ATOM   706   O  O   . PRO A  1 100 ? 107.547 139.691 136.244 1.00 50.78  ? 121 PRO A O   1 
ATOM   707   C  CB  . PRO A  1 100 ? 105.123 139.995 135.058 1.00 52.90  ? 121 PRO A CB  1 
ATOM   708   C  CG  . PRO A  1 100 ? 105.554 139.565 133.707 1.00 55.16  ? 121 PRO A CG  1 
ATOM   709   C  CD  . PRO A  1 100 ? 105.992 140.811 132.956 1.00 53.12  ? 121 PRO A CD  1 
ATOM   710   N  N   . VAL A  1 101 ? 107.926 141.853 136.693 1.00 45.78  ? 122 VAL A N   1 
ATOM   711   C  CA  . VAL A  1 101 ? 109.250 141.654 137.345 1.00 45.61  ? 122 VAL A CA  1 
ATOM   712   C  C   . VAL A  1 101 ? 109.057 140.866 138.640 1.00 46.63  ? 122 VAL A C   1 
ATOM   713   O  O   . VAL A  1 101 ? 109.814 139.960 138.863 1.00 48.21  ? 122 VAL A O   1 
ATOM   714   C  CB  . VAL A  1 101 ? 109.968 142.997 137.544 1.00 43.10  ? 122 VAL A CB  1 
ATOM   715   C  CG1 . VAL A  1 101 ? 111.274 142.877 138.340 1.00 43.12  ? 122 VAL A CG1 1 
ATOM   716   C  CG2 . VAL A  1 101 ? 110.206 143.637 136.188 1.00 43.04  ? 122 VAL A CG2 1 
ATOM   717   N  N   . GLN A  1 102 ? 108.095 141.190 139.492 1.00 46.67  ? 123 GLN A N   1 
ATOM   718   C  CA  . GLN A  1 102 ? 108.062 140.546 140.834 1.00 48.52  ? 123 GLN A CA  1 
ATOM   719   C  C   . GLN A  1 102 ? 107.720 139.069 140.651 1.00 52.67  ? 123 GLN A C   1 
ATOM   720   O  O   . GLN A  1 102 ? 108.093 138.240 141.525 1.00 54.80  ? 123 GLN A O   1 
ATOM   721   C  CB  . GLN A  1 102 ? 107.108 141.289 141.770 1.00 47.53  ? 123 GLN A CB  1 
ATOM   722   C  CG  . GLN A  1 102 ? 107.431 142.771 141.891 1.00 45.11  ? 123 GLN A CG  1 
ATOM   723   C  CD  . GLN A  1 102 ? 108.905 142.975 142.150 1.00 44.57  ? 123 GLN A CD  1 
ATOM   724   O  OE1 . GLN A  1 102 ? 109.494 142.277 142.983 1.00 45.71  ? 123 GLN A OE1 1 
ATOM   725   N  NE2 . GLN A  1 102 ? 109.510 143.897 141.410 1.00 41.95  ? 123 GLN A NE2 1 
ATOM   726   N  N   . GLU A  1 103 ? 106.956 138.771 139.589 1.00 54.80  ? 124 GLU A N   1 
ATOM   727   C  CA  . GLU A  1 103 ? 106.524 137.395 139.207 1.00 59.72  ? 124 GLU A CA  1 
ATOM   728   C  C   . GLU A  1 103 ? 107.726 136.543 138.775 1.00 61.13  ? 124 GLU A C   1 
ATOM   729   O  O   . GLU A  1 103 ? 107.855 135.415 139.262 1.00 63.80  ? 124 GLU A O   1 
ATOM   730   C  CB  . GLU A  1 103 ? 105.511 137.481 138.063 1.00 61.62  ? 124 GLU A CB  1 
ATOM   731   C  CG  . GLU A  1 103 ? 104.121 137.904 138.506 1.00 62.17  ? 124 GLU A CG  1 
ATOM   732   C  CD  . GLU A  1 103 ? 103.934 139.356 138.920 1.00 59.00  ? 124 GLU A CD  1 
ATOM   733   O  OE1 . GLU A  1 103 ? 104.498 140.234 138.245 1.00 56.10  ? 124 GLU A OE1 1 
ATOM   734   O  OE2 . GLU A  1 103 ? 103.213 139.599 139.912 1.00 57.25  ? 124 GLU A OE2 1 
ATOM   735   N  N   . ILE A  1 104 ? 108.584 137.089 137.913 1.00 59.57  ? 125 ILE A N   1 
ATOM   736   C  CA  . ILE A  1 104 ? 109.841 136.422 137.484 1.00 61.56  ? 125 ILE A CA  1 
ATOM   737   C  C   . ILE A  1 104 ? 110.779 136.263 138.685 1.00 61.29  ? 125 ILE A C   1 
ATOM   738   O  O   . ILE A  1 104 ? 111.520 135.268 138.687 1.00 64.14  ? 125 ILE A O   1 
ATOM   739   C  CB  . ILE A  1 104 ? 110.504 137.242 136.381 1.00 60.37  ? 125 ILE A CB  1 
ATOM   740   C  CG1 . ILE A  1 104 ? 109.633 137.257 135.126 1.00 61.51  ? 125 ILE A CG1 1 
ATOM   741   C  CG2 . ILE A  1 104 ? 111.917 136.743 136.129 1.00 62.15  ? 125 ILE A CG2 1 
ATOM   742   C  CD1 . ILE A  1 104 ? 110.094 138.289 134.142 1.00 60.23  ? 125 ILE A CD1 1 
ATOM   743   N  N   . ARG A  1 105 ? 110.782 137.219 139.628 1.00 58.06  ? 126 ARG A N   1 
ATOM   744   C  CA  . ARG A  1 105 ? 111.682 137.206 140.816 1.00 57.65  ? 126 ARG A CA  1 
ATOM   745   C  C   . ARG A  1 105 ? 111.254 136.042 141.713 1.00 60.73  ? 126 ARG A C   1 
ATOM   746   O  O   . ARG A  1 105 ? 112.127 135.341 142.255 1.00 62.30  ? 126 ARG A O   1 
ATOM   747   C  CB  . ARG A  1 105 ? 111.632 138.523 141.597 1.00 53.77  ? 126 ARG A CB  1 
ATOM   748   C  CG  . ARG A  1 105 ? 112.412 139.670 140.961 1.00 51.57  ? 126 ARG A CG  1 
ATOM   749   C  CD  . ARG A  1 105 ? 112.464 140.912 141.860 1.00 48.39  ? 126 ARG A CD  1 
ATOM   750   N  NE  . ARG A  1 105 ? 113.225 140.665 143.089 1.00 48.77  ? 126 ARG A NE  1 
ATOM   751   C  CZ  . ARG A  1 105 ? 113.051 141.275 144.249 1.00 47.25  ? 126 ARG A CZ  1 
ATOM   752   N  NH1 . ARG A  1 105 ? 112.106 142.178 144.396 1.00 45.57  ? 126 ARG A NH1 1 
ATOM   753   N  NH2 . ARG A  1 105 ? 113.818 140.974 145.275 1.00 48.22  ? 126 ARG A NH2 1 
ATOM   754   N  N   . ASP A  1 106 ? 109.941 135.868 141.857 1.00 62.05  ? 127 ASP A N   1 
ATOM   755   C  CA  . ASP A  1 106 ? 109.321 134.997 142.889 1.00 65.23  ? 127 ASP A CA  1 
ATOM   756   C  C   . ASP A  1 106 ? 109.572 133.528 142.519 1.00 69.01  ? 127 ASP A C   1 
ATOM   757   O  O   . ASP A  1 106 ? 109.583 132.679 143.427 1.00 71.47  ? 127 ASP A O   1 
ATOM   758   C  CB  . ASP A  1 106 ? 107.868 135.423 143.091 1.00 65.24  ? 127 ASP A CB  1 
ATOM   759   C  CG  . ASP A  1 106 ? 106.995 134.406 143.786 1.00 70.06  ? 127 ASP A CG  1 
ATOM   760   O  OD1 . ASP A  1 106 ? 106.593 133.404 143.105 1.00 73.82  ? 127 ASP A OD1 1 
ATOM   761   O  OD2 . ASP A  1 106 ? 106.681 134.625 144.991 1.00 71.67  ? 127 ASP A OD2 1 
ATOM   762   N  N   . CYS A  1 107 ? 109.817 133.212 141.248 1.00 69.96  ? 128 CYS A N   1 
ATOM   763   C  CA  . CYS A  1 107 ? 110.006 131.794 140.823 1.00 75.11  ? 128 CYS A CA  1 
ATOM   764   C  C   . CYS A  1 107 ? 111.497 131.423 140.886 1.00 75.96  ? 128 CYS A C   1 
ATOM   765   O  O   . CYS A  1 107 ? 111.830 130.314 140.433 1.00 79.27  ? 128 CYS A O   1 
ATOM   766   C  CB  . CYS A  1 107 ? 109.359 131.495 139.469 1.00 76.62  ? 128 CYS A CB  1 
ATOM   767   S  SG  . CYS A  1 107 ? 109.942 132.474 138.051 1.00 75.20  ? 128 CYS A SG  1 
ATOM   768   N  N   . GLY A  1 108 ? 112.330 132.310 141.459 1.00 73.45  ? 129 GLY A N   1 
ATOM   769   C  CA  . GLY A  1 108 ? 113.744 132.077 141.844 1.00 74.52  ? 129 GLY A CA  1 
ATOM   770   C  C   . GLY A  1 108 ? 114.743 132.421 140.744 1.00 73.71  ? 129 GLY A C   1 
ATOM   771   O  O   . GLY A  1 108 ? 115.920 132.081 140.917 1.00 75.27  ? 129 GLY A O   1 
ATOM   772   N  N   . VAL A  1 109 ? 114.293 133.059 139.657 1.00 71.71  ? 130 VAL A N   1 
ATOM   773   C  CA  . VAL A  1 109 ? 115.113 133.447 138.463 1.00 71.48  ? 130 VAL A CA  1 
ATOM   774   C  C   . VAL A  1 109 ? 116.188 134.459 138.903 1.00 68.69  ? 130 VAL A C   1 
ATOM   775   O  O   . VAL A  1 109 ? 115.917 135.320 139.766 1.00 65.48  ? 130 VAL A O   1 
ATOM   776   C  CB  . VAL A  1 109 ? 114.216 134.001 137.330 1.00 70.08  ? 130 VAL A CB  1 
ATOM   777   C  CG1 . VAL A  1 109 ? 114.990 134.700 136.224 1.00 69.28  ? 130 VAL A CG1 1 
ATOM   778   C  CG2 . VAL A  1 109 ? 113.335 132.925 136.724 1.00 73.50  ? 130 VAL A CG2 1 
ATOM   779   N  N   . ASP A  1 110 ? 117.373 134.373 138.309 1.00 70.13  ? 131 ASP A N   1 
ATOM   780   C  CA  . ASP A  1 110 ? 118.548 135.158 138.768 1.00 68.88  ? 131 ASP A CA  1 
ATOM   781   C  C   . ASP A  1 110 ? 118.586 136.483 137.991 1.00 65.31  ? 131 ASP A C   1 
ATOM   782   O  O   . ASP A  1 110 ? 117.885 136.630 136.960 1.00 64.05  ? 131 ASP A O   1 
ATOM   783   C  CB  . ASP A  1 110 ? 119.826 134.297 138.725 1.00 72.28  ? 131 ASP A CB  1 
ATOM   784   C  CG  . ASP A  1 110 ? 120.418 134.053 137.347 1.00 74.20  ? 131 ASP A CG  1 
ATOM   785   O  OD1 . ASP A  1 110 ? 119.927 134.631 136.357 1.00 72.52  ? 131 ASP A OD1 1 
ATOM   786   O  OD2 . ASP A  1 110 ? 121.383 133.287 137.277 1.00 78.35  ? 131 ASP A OD2 1 
ATOM   787   N  N   . ASP A  1 111 ? 119.376 137.423 138.492 1.00 63.83  ? 132 ASP A N   1 
ATOM   788   C  CA  . ASP A  1 111 ? 119.351 138.833 138.030 1.00 61.14  ? 132 ASP A CA  1 
ATOM   789   C  C   . ASP A  1 111 ? 119.808 138.859 136.566 1.00 61.89  ? 132 ASP A C   1 
ATOM   790   O  O   . ASP A  1 111 ? 119.168 139.580 135.771 1.00 60.36  ? 132 ASP A O   1 
ATOM   791   C  CB  . ASP A  1 111 ? 120.115 139.738 139.006 1.00 60.36  ? 132 ASP A CB  1 
ATOM   792   C  CG  . ASP A  1 111 ? 119.196 140.350 140.063 1.00 58.98  ? 132 ASP A CG  1 
ATOM   793   O  OD1 . ASP A  1 111 ? 118.417 141.297 139.728 1.00 57.92  ? 132 ASP A OD1 1 
ATOM   794   O  OD2 . ASP A  1 111 ? 119.224 139.874 141.205 1.00 60.67  ? 132 ASP A OD2 1 
ATOM   795   N  N   . ASP A  1 112 ? 120.839 138.083 136.218 1.00 64.72  ? 133 ASP A N   1 
ATOM   796   C  CA  . ASP A  1 112 ? 121.322 137.912 134.820 1.00 66.72  ? 133 ASP A CA  1 
ATOM   797   C  C   . ASP A  1 112 ? 120.113 137.653 133.917 1.00 66.80  ? 133 ASP A C   1 
ATOM   798   O  O   . ASP A  1 112 ? 119.853 138.456 132.986 1.00 65.15  ? 133 ASP A O   1 
ATOM   799   C  CB  . ASP A  1 112 ? 122.365 136.794 134.730 1.00 70.91  ? 133 ASP A CB  1 
ATOM   800   C  CG  . ASP A  1 112 ? 123.726 137.213 135.266 1.00 71.82  ? 133 ASP A CG  1 
ATOM   801   O  OD1 . ASP A  1 112 ? 124.018 138.415 135.204 1.00 69.60  ? 133 ASP A OD1 1 
ATOM   802   O  OD2 . ASP A  1 112 ? 124.478 136.355 135.760 1.00 74.84  ? 133 ASP A OD2 1 
ATOM   803   N  N   . ARG A  1 113 ? 119.361 136.595 134.204 1.00 68.19  ? 134 ARG A N   1 
ATOM   804   C  CA  . ARG A  1 113 ? 118.219 136.223 133.345 1.00 69.12  ? 134 ARG A CA  1 
ATOM   805   C  C   . ARG A  1 113 ? 117.161 137.325 133.425 1.00 64.22  ? 134 ARG A C   1 
ATOM   806   O  O   . ARG A  1 113 ? 116.640 137.719 132.373 1.00 63.48  ? 134 ARG A O   1 
ATOM   807   C  CB  . ARG A  1 113 ? 117.645 134.864 133.731 1.00 72.80  ? 134 ARG A CB  1 
ATOM   808   C  CG  . ARG A  1 113 ? 116.578 134.388 132.757 1.00 75.18  ? 134 ARG A CG  1 
ATOM   809   C  CD  . ARG A  1 113 ? 117.101 133.590 131.587 1.00 80.03  ? 134 ARG A CD  1 
ATOM   810   N  NE  . ARG A  1 113 ? 116.032 132.760 131.010 1.00 83.40  ? 134 ARG A NE  1 
ATOM   811   C  CZ  . ARG A  1 113 ? 115.636 131.556 131.471 1.00 86.66  ? 134 ARG A CZ  1 
ATOM   812   N  NH1 . ARG A  1 113 ? 114.670 130.885 130.858 1.00 88.77  ? 134 ARG A NH1 1 
ATOM   813   N  NH2 . ARG A  1 113 ? 116.200 131.026 132.548 1.00 87.61  ? 134 ARG A NH2 1 
ATOM   814   N  N   . LEU A  1 114 ? 116.874 137.853 134.612 1.00 60.66  ? 135 LEU A N   1 
ATOM   815   C  CA  . LEU A  1 114 ? 115.821 138.887 134.721 1.00 56.70  ? 135 LEU A CA  1 
ATOM   816   C  C   . LEU A  1 114 ? 116.152 140.065 133.784 1.00 55.06  ? 135 LEU A C   1 
ATOM   817   O  O   . LEU A  1 114 ? 115.254 140.546 133.012 1.00 53.98  ? 135 LEU A O   1 
ATOM   818   C  CB  . LEU A  1 114 ? 115.708 139.326 136.176 1.00 54.57  ? 135 LEU A CB  1 
ATOM   819   C  CG  . LEU A  1 114 ? 114.748 140.500 136.378 1.00 51.03  ? 135 LEU A CG  1 
ATOM   820   C  CD1 . LEU A  1 114 ? 113.407 140.143 135.785 1.00 51.53  ? 135 LEU A CD1 1 
ATOM   821   C  CD2 . LEU A  1 114 ? 114.634 140.870 137.851 1.00 49.17  ? 135 LEU A CD2 1 
ATOM   822   N  N   . MET A  1 115 ? 117.399 140.540 133.836 1.00 54.58  ? 136 MET A N   1 
ATOM   823   C  CA  A MET A  1 115 ? 117.867 141.678 132.996 0.46 53.53  ? 136 MET A CA  1 
ATOM   824   C  CA  B MET A  1 115 ? 117.845 141.684 133.002 0.54 53.55  ? 136 MET A CA  1 
ATOM   825   C  C   . MET A  1 115 ? 117.754 141.311 131.505 1.00 56.02  ? 136 MET A C   1 
ATOM   826   O  O   . MET A  1 115 ? 117.381 142.193 130.704 1.00 54.77  ? 136 MET A O   1 
ATOM   827   C  CB  A MET A  1 115 ? 119.306 142.084 133.344 0.46 53.51  ? 136 MET A CB  1 
ATOM   828   C  CB  B MET A  1 115 ? 119.251 142.131 133.428 0.54 53.38  ? 136 MET A CB  1 
ATOM   829   C  CG  A MET A  1 115 ? 119.444 142.821 134.696 0.46 50.74  ? 136 MET A CG  1 
ATOM   830   C  CG  B MET A  1 115 ? 119.354 142.569 134.932 0.54 51.02  ? 136 MET A CG  1 
ATOM   831   S  SD  A MET A  1 115 ? 118.339 144.273 134.934 0.46 46.35  ? 136 MET A SD  1 
ATOM   832   S  SD  B MET A  1 115 ? 117.859 143.386 135.679 0.54 46.90  ? 136 MET A SD  1 
ATOM   833   C  CE  A MET A  1 115 ? 119.296 145.234 136.100 0.46 44.71  ? 136 MET A CE  1 
ATOM   834   C  CE  B MET A  1 115 ? 118.174 143.199 137.436 0.54 45.83  ? 136 MET A CE  1 
ATOM   835   N  N   . ASN A  1 116 ? 118.004 140.048 131.136 1.00 59.77  ? 137 ASN A N   1 
ATOM   836   C  CA  . ASN A  1 116 ? 117.817 139.544 129.736 1.00 62.95  ? 137 ASN A CA  1 
ATOM   837   C  C   . ASN A  1 116 ? 116.327 139.703 129.339 1.00 61.67  ? 137 ASN A C   1 
ATOM   838   O  O   . ASN A  1 116 ? 115.995 140.187 128.225 1.00 61.23  ? 137 ASN A O   1 
ATOM   839   C  CB  . ASN A  1 116 ? 118.307 138.092 129.574 1.00 67.22  ? 137 ASN A CB  1 
ATOM   840   C  CG  . ASN A  1 116 ? 119.815 137.931 129.685 1.00 69.68  ? 137 ASN A CG  1 
ATOM   841   O  OD1 . ASN A  1 116 ? 120.551 138.931 129.730 1.00 68.32  ? 137 ASN A OD1 1 
ATOM   842   N  ND2 . ASN A  1 116 ? 120.286 136.686 129.750 1.00 72.40  ? 137 ASN A ND2 1 
ATOM   843   N  N   . VAL A  1 117 ? 115.431 139.342 130.242 1.00 60.69  ? 138 VAL A N   1 
ATOM   844   C  CA  . VAL A  1 117 ? 113.967 139.485 129.992 1.00 60.58  ? 138 VAL A CA  1 
ATOM   845   C  C   . VAL A  1 117 ? 113.687 140.965 129.701 1.00 57.64  ? 138 VAL A C   1 
ATOM   846   O  O   . VAL A  1 117 ? 113.021 141.285 128.661 1.00 58.74  ? 138 VAL A O   1 
ATOM   847   C  CB  . VAL A  1 117 ? 113.100 138.939 131.145 1.00 59.77  ? 138 VAL A CB  1 
ATOM   848   C  CG1 . VAL A  1 117 ? 111.627 138.958 130.775 1.00 60.19  ? 138 VAL A CG1 1 
ATOM   849   C  CG2 . VAL A  1 117 ? 113.491 137.523 131.524 1.00 62.97  ? 138 VAL A CG2 1 
ATOM   850   N  N   . ILE A  1 118 ? 114.240 141.851 130.521 1.00 54.35  ? 139 ILE A N   1 
ATOM   851   C  CA  . ILE A  1 118 ? 114.022 143.309 130.330 1.00 51.75  ? 139 ILE A CA  1 
ATOM   852   C  C   . ILE A  1 118 ? 114.472 143.702 128.914 1.00 53.56  ? 139 ILE A C   1 
ATOM   853   O  O   . ILE A  1 118 ? 113.670 144.365 128.200 1.00 53.33  ? 139 ILE A O   1 
ATOM   854   C  CB  . ILE A  1 118 ? 114.692 144.086 131.474 1.00 49.28  ? 139 ILE A CB  1 
ATOM   855   C  CG1 . ILE A  1 118 ? 113.960 143.779 132.792 1.00 47.93  ? 139 ILE A CG1 1 
ATOM   856   C  CG2 . ILE A  1 118 ? 114.733 145.575 131.156 1.00 47.37  ? 139 ILE A CG2 1 
ATOM   857   C  CD1 . ILE A  1 118 ? 114.671 144.239 134.047 1.00 46.25  ? 139 ILE A CD1 1 
ATOM   858   N  N   . SER A  1 119 ? 115.664 143.266 128.504 1.00 55.74  ? 140 SER A N   1 
ATOM   859   C  CA  . SER A  1 119 ? 116.221 143.438 127.133 1.00 59.14  ? 140 SER A CA  1 
ATOM   860   C  C   . SER A  1 119 ? 115.272 142.862 126.065 1.00 62.33  ? 140 SER A C   1 
ATOM   861   O  O   . SER A  1 119 ? 114.866 143.615 125.129 1.00 62.84  ? 140 SER A O   1 
ATOM   862   C  CB  . SER A  1 119 ? 117.595 142.817 127.037 1.00 61.25  ? 140 SER A CB  1 
ATOM   863   O  OG  . SER A  1 119 ? 118.540 143.580 127.788 1.00 59.53  ? 140 SER A OG  1 
ATOM   864   N  N   . GLU A  1 120 ? 114.931 141.576 126.180 1.00 64.66  ? 141 GLU A N   1 
ATOM   865   C  CA  . GLU A  1 120 ? 114.023 140.904 125.222 1.00 68.29  ? 141 GLU A CA  1 
ATOM   866   C  C   . GLU A  1 120 ? 112.770 141.774 125.072 1.00 66.73  ? 141 GLU A C   1 
ATOM   867   O  O   . GLU A  1 120 ? 112.389 142.082 123.932 1.00 68.63  ? 141 GLU A O   1 
ATOM   868   C  CB  . GLU A  1 120 ? 113.699 139.491 125.706 1.00 70.91  ? 141 GLU A CB  1 
ATOM   869   C  CG  . GLU A  1 120 ? 114.907 138.565 125.743 1.00 74.27  ? 141 GLU A CG  1 
ATOM   870   C  CD  . GLU A  1 120 ? 115.476 138.178 124.388 1.00 79.49  ? 141 GLU A CD  1 
ATOM   871   O  OE1 . GLU A  1 120 ? 114.697 138.167 123.400 1.00 82.09  ? 141 GLU A OE1 1 
ATOM   872   O  OE2 . GLU A  1 120 ? 116.693 137.857 124.327 1.00 81.74  ? 141 GLU A OE2 1 
ATOM   873   N  N   . SER A  1 121 ? 112.197 142.217 126.196 1.00 63.68  ? 142 SER A N   1 
ATOM   874   C  CA  . SER A  1 121 ? 110.903 142.945 126.252 1.00 62.33  ? 142 SER A CA  1 
ATOM   875   C  C   . SER A  1 121 ? 110.998 144.268 125.482 1.00 61.49  ? 142 SER A C   1 
ATOM   876   O  O   . SER A  1 121 ? 110.001 144.630 124.811 1.00 62.41  ? 142 SER A O   1 
ATOM   877   C  CB  . SER A  1 121 ? 110.458 143.165 127.686 1.00 60.09  ? 142 SER A CB  1 
ATOM   878   O  OG  . SER A  1 121 ? 110.154 141.929 128.334 1.00 61.44  ? 142 SER A OG  1 
ATOM   879   N  N   . VAL A  1 122 ? 112.139 144.964 125.576 1.00 60.00  ? 143 VAL A N   1 
ATOM   880   C  CA  . VAL A  1 122 ? 112.408 146.232 124.832 1.00 59.45  ? 143 VAL A CA  1 
ATOM   881   C  C   . VAL A  1 122 ? 112.442 145.952 123.323 1.00 62.87  ? 143 VAL A C   1 
ATOM   882   O  O   . VAL A  1 122 ? 111.813 146.717 122.554 1.00 63.07  ? 143 VAL A O   1 
ATOM   883   C  CB  . VAL A  1 122 ? 113.711 146.877 125.321 1.00 58.23  ? 143 VAL A CB  1 
ATOM   884   C  CG1 . VAL A  1 122 ? 114.193 147.982 124.380 1.00 59.57  ? 143 VAL A CG1 1 
ATOM   885   C  CG2 . VAL A  1 122 ? 113.546 147.392 126.743 1.00 54.54  ? 143 VAL A CG2 1 
ATOM   886   N  N   . LYS A  1 123 ? 113.124 144.888 122.919 1.00 65.18  ? 144 LYS A N   1 
ATOM   887   C  CA  . LYS A  1 123 ? 113.234 144.513 121.491 1.00 70.13  ? 144 LYS A CA  1 
ATOM   888   C  C   . LYS A  1 123 ? 111.837 144.223 120.930 1.00 72.51  ? 144 LYS A C   1 
ATOM   889   O  O   . LYS A  1 123 ? 111.657 144.400 119.698 1.00 76.73  ? 144 LYS A O   1 
ATOM   890   C  CB  . LYS A  1 123 ? 114.158 143.306 121.326 1.00 72.63  ? 144 LYS A CB  1 
ATOM   891   C  CG  . LYS A  1 123 ? 115.566 143.548 121.833 1.00 71.75  ? 144 LYS A CG  1 
ATOM   892   C  CD  . LYS A  1 123 ? 116.633 142.613 121.306 1.00 75.94  ? 144 LYS A CD  1 
ATOM   893   C  CE  . LYS A  1 123 ? 118.002 143.250 121.431 1.00 75.68  ? 144 LYS A CE  1 
ATOM   894   N  NZ  . LYS A  1 123 ? 119.102 142.351 121.030 1.00 79.69  ? 144 LYS A NZ  1 
ATOM   895   N  N   . LEU A  1 124 ? 110.892 143.752 121.761 1.00 71.03  ? 145 LEU A N   1 
ATOM   896   C  CA  . LEU A  1 124 ? 109.527 143.365 121.288 1.00 72.97  ? 145 LEU A CA  1 
ATOM   897   C  C   . LEU A  1 124 ? 108.805 144.634 120.827 1.00 72.16  ? 145 LEU A C   1 
ATOM   898   O  O   . LEU A  1 124 ? 108.148 144.637 119.780 1.00 75.91  ? 145 LEU A O   1 
ATOM   899   C  CB  . LEU A  1 124 ? 108.773 142.624 122.400 1.00 71.15  ? 145 LEU A CB  1 
ATOM   900   C  CG  . LEU A  1 124 ? 108.784 141.091 122.336 1.00 74.63  ? 145 LEU A CG  1 
ATOM   901   C  CD1 . LEU A  1 124 ? 109.901 140.532 121.471 1.00 77.92  ? 145 LEU A CD1 1 
ATOM   902   C  CD2 . LEU A  1 124 ? 108.864 140.483 123.725 1.00 72.21  ? 145 LEU A CD2 1 
ATOM   903   N  N   . VAL A  1 125 ? 109.030 145.718 121.539 1.00 69.27  ? 146 VAL A N   1 
ATOM   904   C  CA  . VAL A  1 125 ? 108.473 147.047 121.175 1.00 68.86  ? 146 VAL A CA  1 
ATOM   905   C  C   . VAL A  1 125 ? 109.126 147.535 119.875 1.00 72.58  ? 146 VAL A C   1 
ATOM   906   O  O   . VAL A  1 125 ? 108.380 148.031 119.000 1.00 75.47  ? 146 VAL A O   1 
ATOM   907   C  CB  . VAL A  1 125 ? 108.677 148.021 122.336 1.00 64.16  ? 146 VAL A CB  1 
ATOM   908   C  CG1 . VAL A  1 125 ? 108.055 149.377 122.047 1.00 63.76  ? 146 VAL A CG1 1 
ATOM   909   C  CG2 . VAL A  1 125 ? 108.120 147.417 123.609 1.00 61.52  ? 146 VAL A CG2 1 
ATOM   910   N  N   . MET A  1 126 ? 110.448 147.385 119.733 1.00 72.69  ? 147 MET A N   1 
ATOM   911   C  CA  . MET A  1 126 ? 111.187 147.897 118.552 1.00 75.79  ? 147 MET A CA  1 
ATOM   912   C  C   . MET A  1 126 ? 110.851 147.018 117.329 1.00 80.87  ? 147 MET A C   1 
ATOM   913   O  O   . MET A  1 126 ? 110.605 147.597 116.243 1.00 82.90  ? 147 MET A O   1 
ATOM   914   C  CB  . MET A  1 126 ? 112.698 147.921 118.803 1.00 74.86  ? 147 MET A CB  1 
ATOM   915   C  CG  . MET A  1 126 ? 113.083 148.630 120.075 1.00 70.29  ? 147 MET A CG  1 
ATOM   916   S  SD  . MET A  1 126 ? 114.852 148.557 120.403 1.00 69.87  ? 147 MET A SD  1 
ATOM   917   C  CE  . MET A  1 126 ? 115.415 149.609 119.062 1.00 72.91  ? 147 MET A CE  1 
ATOM   918   N  N   . GLU A  1 127 ? 110.801 145.689 117.524 1.00 82.35  ? 148 GLU A N   1 
ATOM   919   C  CA  . GLU A  1 127 ? 110.494 144.681 116.473 1.00 88.21  ? 148 GLU A CA  1 
ATOM   920   C  C   . GLU A  1 127 ? 109.164 145.046 115.822 1.00 89.17  ? 148 GLU A C   1 
ATOM   921   O  O   . GLU A  1 127 ? 108.951 144.619 114.697 1.00 94.26  ? 148 GLU A O   1 
ATOM   922   C  CB  . GLU A  1 127 ? 110.498 143.245 117.020 1.00 89.51  ? 148 GLU A CB  1 
ATOM   923   C  CG  . GLU A  1 127 ? 111.912 142.707 117.247 1.00 90.79  ? 148 GLU A CG  1 
ATOM   924   C  CD  . GLU A  1 127 ? 112.090 141.210 117.471 1.00 93.34  ? 148 GLU A CD  1 
ATOM   925   O  OE1 . GLU A  1 127 ? 111.839 140.444 116.523 1.00 98.46  ? 148 GLU A OE1 1 
ATOM   926   O  OE2 . GLU A  1 127 ? 112.533 140.815 118.580 1.00 90.95  ? 148 GLU A OE2 1 
ATOM   927   N  N   . GLU A  1 128 ? 108.336 145.832 116.500 1.00 89.56  ? 149 GLU A N   1 
ATOM   928   C  CA  . GLU A  1 128 ? 106.991 146.242 116.024 1.00 91.30  ? 149 GLU A CA  1 
ATOM   929   C  C   . GLU A  1 128 ? 107.042 147.690 115.509 1.00 90.14  ? 149 GLU A C   1 
ATOM   930   O  O   . GLU A  1 128 ? 106.691 148.608 116.254 1.00 87.45  ? 149 GLU A O   1 
ATOM   931   C  CB  . GLU A  1 128 ? 106.008 146.028 117.176 1.00 90.21  ? 149 GLU A CB  1 
ATOM   932   C  CG  . GLU A  1 128 ? 104.612 145.648 116.720 1.00 93.97  ? 149 GLU A CG  1 
ATOM   933   C  CD  . GLU A  1 128 ? 104.392 144.186 116.367 1.00 97.30  ? 149 GLU A CD  1 
ATOM   934   O  OE1 . GLU A  1 128 ? 104.028 143.924 115.225 1.00 100.80 ? 149 GLU A OE1 1 
ATOM   935   O  OE2 . GLU A  1 128 ? 104.520 143.324 117.264 1.00 97.04  ? 149 GLU A OE2 1 
ATOM   936   N  N   . GLU A  1 129 ? 107.479 147.886 114.268 1.00 92.22  ? 150 GLU A N   1 
ATOM   937   C  CA  . GLU A  1 129 ? 107.607 149.205 113.572 1.00 92.47  ? 150 GLU A CA  1 
ATOM   938   C  C   . GLU A  1 129 ? 106.287 149.978 113.684 1.00 91.83  ? 150 GLU A C   1 
ATOM   939   O  O   . GLU A  1 129 ? 105.236 149.349 113.665 1.00 93.86  ? 150 GLU A O   1 
ATOM   940   C  CB  . GLU A  1 129 ? 108.004 148.898 112.118 1.00 97.12  ? 150 GLU A CB  1 
ATOM   941   C  CG  . GLU A  1 129 ? 108.490 150.068 111.281 1.00 98.06  ? 150 GLU A CG  1 
ATOM   942   C  CD  . GLU A  1 129 ? 109.991 150.129 111.047 1.00 97.67  ? 150 GLU A CD  1 
ATOM   943   O  OE1 . GLU A  1 129 ? 110.555 149.228 110.361 1.00 100.92 ? 150 GLU A OE1 1 
ATOM   944   O  OE2 . GLU A  1 129 ? 110.591 151.106 111.515 1.00 95.07  ? 150 GLU A OE2 1 
ATOM   945   N  N   . PRO A  1 130 ? 106.230 151.335 113.800 1.00 89.61  ? 151 PRO A N   1 
ATOM   946   C  CA  . PRO A  1 130 ? 107.380 152.216 114.031 1.00 86.83  ? 151 PRO A CA  1 
ATOM   947   C  C   . PRO A  1 130 ? 107.582 152.611 115.500 1.00 82.19  ? 151 PRO A C   1 
ATOM   948   O  O   . PRO A  1 130 ? 107.887 153.765 115.759 1.00 79.78  ? 151 PRO A O   1 
ATOM   949   C  CB  . PRO A  1 130 ? 106.977 153.474 113.246 1.00 88.36  ? 151 PRO A CB  1 
ATOM   950   C  CG  . PRO A  1 130 ? 105.461 153.552 113.422 1.00 89.39  ? 151 PRO A CG  1 
ATOM   951   C  CD  . PRO A  1 130 ? 104.994 152.121 113.622 1.00 90.47  ? 151 PRO A CD  1 
ATOM   952   N  N   . LEU A  1 131 ? 107.389 151.653 116.410 1.00 80.89  ? 152 LEU A N   1 
ATOM   953   C  CA  . LEU A  1 131 ? 107.347 151.908 117.873 1.00 77.22  ? 152 LEU A CA  1 
ATOM   954   C  C   . LEU A  1 131 ? 108.768 152.195 118.339 1.00 74.66  ? 152 LEU A C   1 
ATOM   955   O  O   . LEU A  1 131 ? 109.706 151.641 117.735 1.00 77.07  ? 152 LEU A O   1 
ATOM   956   C  CB  . LEU A  1 131 ? 106.733 150.707 118.598 1.00 77.20  ? 152 LEU A CB  1 
ATOM   957   C  CG  . LEU A  1 131 ? 105.254 150.466 118.301 1.00 79.72  ? 152 LEU A CG  1 
ATOM   958   C  CD1 . LEU A  1 131 ? 104.722 149.256 119.067 1.00 79.76  ? 152 LEU A CD1 1 
ATOM   959   C  CD2 . LEU A  1 131 ? 104.431 151.710 118.602 1.00 78.95  ? 152 LEU A CD2 1 
ATOM   960   N  N   . ARG A  1 132 ? 108.916 153.146 119.246 1.00 70.96  ? 153 ARG A N   1 
ATOM   961   C  CA  . ARG A  1 132 ? 110.205 153.474 119.883 1.00 68.39  ? 153 ARG A CA  1 
ATOM   962   C  C   . ARG A  1 132 ? 109.969 153.450 121.393 1.00 65.55  ? 153 ARG A C   1 
ATOM   963   O  O   . ARG A  1 132 ? 108.971 153.979 121.896 1.00 64.13  ? 153 ARG A O   1 
ATOM   964   C  CB  . ARG A  1 132 ? 110.736 154.795 119.316 1.00 68.31  ? 153 ARG A CB  1 
ATOM   965   C  CG  . ARG A  1 132 ? 111.126 154.748 117.843 1.00 71.31  ? 153 ARG A CG  1 
ATOM   966   C  CD  . ARG A  1 132 ? 112.363 155.599 117.539 1.00 70.82  ? 153 ARG A CD  1 
ATOM   967   N  NE  . ARG A  1 132 ? 112.497 155.914 116.123 1.00 73.75  ? 153 ARG A NE  1 
ATOM   968   C  CZ  . ARG A  1 132 ? 113.408 156.720 115.577 1.00 74.06  ? 153 ARG A CZ  1 
ATOM   969   N  NH1 . ARG A  1 132 ? 114.311 157.342 116.305 1.00 71.92  ? 153 ARG A NH1 1 
ATOM   970   N  NH2 . ARG A  1 132 ? 113.400 156.931 114.285 1.00 76.96  ? 153 ARG A NH2 1 
ATOM   971   N  N   . PRO A  1 133 ? 110.825 152.721 122.135 1.00 64.48  ? 154 PRO A N   1 
ATOM   972   C  CA  . PRO A  1 133 ? 110.587 152.442 123.549 1.00 62.21  ? 154 PRO A CA  1 
ATOM   973   C  C   . PRO A  1 133 ? 110.930 153.569 124.529 1.00 59.34  ? 154 PRO A C   1 
ATOM   974   O  O   . PRO A  1 133 ? 112.042 154.069 124.524 1.00 59.41  ? 154 PRO A O   1 
ATOM   975   C  CB  . PRO A  1 133 ? 111.553 151.294 123.841 1.00 62.56  ? 154 PRO A CB  1 
ATOM   976   C  CG  . PRO A  1 133 ? 112.694 151.545 122.879 1.00 63.71  ? 154 PRO A CG  1 
ATOM   977   C  CD  . PRO A  1 133 ? 112.030 152.051 121.611 1.00 65.75  ? 154 PRO A CD  1 
ATOM   978   N  N   . LEU A  1 134 ? 109.963 153.923 125.356 1.00 57.19  ? 155 LEU A N   1 
ATOM   979   C  CA  . LEU A  1 134 ? 110.159 154.793 126.514 1.00 54.05  ? 155 LEU A CA  1 
ATOM   980   C  C   . LEU A  1 134 ? 109.791 153.967 127.754 1.00 52.60  ? 155 LEU A C   1 
ATOM   981   O  O   . LEU A  1 134 ? 108.593 153.673 127.943 1.00 53.12  ? 155 LEU A O   1 
ATOM   982   C  CB  . LEU A  1 134 ? 109.278 156.029 126.347 1.00 54.37  ? 155 LEU A CB  1 
ATOM   983   C  CG  . LEU A  1 134 ? 109.618 157.183 127.291 1.00 52.38  ? 155 LEU A CG  1 
ATOM   984   C  CD1 . LEU A  1 134 ? 108.882 158.440 126.883 1.00 53.42  ? 155 LEU A CD1 1 
ATOM   985   C  CD2 . LEU A  1 134 ? 109.272 156.851 128.739 1.00 50.46  ? 155 LEU A CD2 1 
ATOM   986   N  N   . VAL A  1 135 ? 110.806 153.598 128.532 1.00 50.77  ? 156 VAL A N   1 
ATOM   987   C  CA  . VAL A  1 135 ? 110.752 152.698 129.709 1.00 49.71  ? 156 VAL A CA  1 
ATOM   988   C  C   . VAL A  1 135 ? 110.468 153.534 130.955 1.00 47.37  ? 156 VAL A C   1 
ATOM   989   O  O   . VAL A  1 135 ? 111.161 154.566 131.154 1.00 45.35  ? 156 VAL A O   1 
ATOM   990   C  CB  . VAL A  1 135 ? 112.086 151.963 129.853 1.00 50.27  ? 156 VAL A CB  1 
ATOM   991   C  CG1 . VAL A  1 135 ? 112.223 151.345 131.219 1.00 49.30  ? 156 VAL A CG1 1 
ATOM   992   C  CG2 . VAL A  1 135 ? 112.282 150.934 128.750 1.00 53.43  ? 156 VAL A CG2 1 
ATOM   993   N  N   . LEU A  1 136 ? 109.452 153.138 131.726 1.00 46.92  ? 157 LEU A N   1 
ATOM   994   C  CA  . LEU A  1 136 ? 109.149 153.747 133.038 1.00 45.05  ? 157 LEU A CA  1 
ATOM   995   C  C   . LEU A  1 136 ? 109.781 152.831 134.075 1.00 43.99  ? 157 LEU A C   1 
ATOM   996   O  O   . LEU A  1 136 ? 109.289 151.681 134.203 1.00 45.58  ? 157 LEU A O   1 
ATOM   997   C  CB  . LEU A  1 136 ? 107.640 153.826 133.292 1.00 46.06  ? 157 LEU A CB  1 
ATOM   998   C  CG  . LEU A  1 136 ? 106.771 154.394 132.177 1.00 48.26  ? 157 LEU A CG  1 
ATOM   999   C  CD1 . LEU A  1 136 ? 105.396 154.709 132.701 1.00 48.68  ? 157 LEU A CD1 1 
ATOM   1000  C  CD2 . LEU A  1 136 ? 107.399 155.645 131.589 1.00 48.19  ? 157 LEU A CD2 1 
ATOM   1001  N  N   . GLY A  1 137 ? 110.784 153.303 134.805 1.00 41.20  ? 158 GLY A N   1 
ATOM   1002  C  CA  . GLY A  1 137 ? 111.328 152.511 135.910 1.00 40.37  ? 158 GLY A CA  1 
ATOM   1003  C  C   . GLY A  1 137 ? 110.461 152.717 137.139 1.00 38.92  ? 158 GLY A C   1 
ATOM   1004  O  O   . GLY A  1 137 ? 109.518 153.478 137.064 1.00 38.57  ? 158 GLY A O   1 
ATOM   1005  N  N   . GLY A  1 138 ? 110.807 152.103 138.274 1.00 38.39  ? 159 GLY A N   1 
ATOM   1006  C  CA  . GLY A  1 138 ? 111.954 151.227 138.423 1.00 38.93  ? 159 GLY A CA  1 
ATOM   1007  C  C   . GLY A  1 138 ? 113.205 152.012 138.768 1.00 37.93  ? 159 GLY A C   1 
ATOM   1008  O  O   . GLY A  1 138 ? 113.284 153.236 138.483 1.00 37.27  ? 159 GLY A O   1 
ATOM   1009  N  N   . ASP A  1 139 ? 114.181 151.349 139.373 1.00 38.18  ? 160 ASP A N   1 
ATOM   1010  C  CA  . ASP A  1 139 ? 115.465 151.982 139.755 1.00 37.30  ? 160 ASP A CA  1 
ATOM   1011  C  C   . ASP A  1 139 ? 116.373 152.068 138.530 1.00 38.65  ? 160 ASP A C   1 
ATOM   1012  O  O   . ASP A  1 139 ? 116.049 151.489 137.498 1.00 40.77  ? 160 ASP A O   1 
ATOM   1013  C  CB  . ASP A  1 139 ? 116.102 151.257 140.943 1.00 37.22  ? 160 ASP A CB  1 
ATOM   1014  C  CG  . ASP A  1 139 ? 116.648 149.872 140.685 1.00 39.03  ? 160 ASP A CG  1 
ATOM   1015  O  OD1 . ASP A  1 139 ? 117.359 149.690 139.674 1.00 40.16  ? 160 ASP A OD1 1 
ATOM   1016  O  OD2 . ASP A  1 139 ? 116.397 148.997 141.538 1.00 39.61  ? 160 ASP A OD2 1 
ATOM   1017  N  N   . HIS A  1 140 ? 117.517 152.703 138.679 1.00 38.31  ? 161 HIS A N   1 
ATOM   1018  C  CA  . HIS A  1 140 ? 118.367 153.076 137.540 1.00 39.74  ? 161 HIS A CA  1 
ATOM   1019  C  C   . HIS A  1 140 ? 119.086 151.847 136.980 1.00 42.24  ? 161 HIS A C   1 
ATOM   1020  O  O   . HIS A  1 140 ? 119.610 151.959 135.858 1.00 43.61  ? 161 HIS A O   1 
ATOM   1021  C  CB  . HIS A  1 140 ? 119.325 154.221 137.931 1.00 39.15  ? 161 HIS A CB  1 
ATOM   1022  C  CG  . HIS A  1 140 ? 119.522 155.181 136.813 1.00 39.57  ? 161 HIS A CG  1 
ATOM   1023  N  ND1 . HIS A  1 140 ? 119.725 156.512 137.032 1.00 38.68  ? 161 HIS A ND1 1 
ATOM   1024  C  CD2 . HIS A  1 140 ? 119.461 154.991 135.469 1.00 41.43  ? 161 HIS A CD2 1 
ATOM   1025  C  CE1 . HIS A  1 140 ? 119.815 157.127 135.877 1.00 40.07  ? 161 HIS A CE1 1 
ATOM   1026  N  NE2 . HIS A  1 140 ? 119.651 156.205 134.878 1.00 41.70  ? 161 HIS A NE2 1 
ATOM   1027  N  N   . SER A  1 141 ? 119.111 150.701 137.676 1.00 42.89  ? 162 SER A N   1 
ATOM   1028  C  CA  . SER A  1 141 ? 119.756 149.482 137.131 1.00 44.59  ? 162 SER A CA  1 
ATOM   1029  C  C   . SER A  1 141 ? 119.125 149.145 135.779 1.00 46.36  ? 162 SER A C   1 
ATOM   1030  O  O   . SER A  1 141 ? 119.825 148.588 134.932 1.00 47.70  ? 162 SER A O   1 
ATOM   1031  C  CB  . SER A  1 141 ? 119.715 148.327 138.093 1.00 45.10  ? 162 SER A CB  1 
ATOM   1032  O  OG  . SER A  1 141 ? 118.382 147.958 138.418 1.00 44.53  ? 162 SER A OG  1 
ATOM   1033  N  N   . ILE A  1 142 ? 117.848 149.467 135.559 1.00 46.73  ? 163 ILE A N   1 
ATOM   1034  C  CA  . ILE A  1 142 ? 117.129 148.959 134.349 1.00 49.22  ? 163 ILE A CA  1 
ATOM   1035  C  C   . ILE A  1 142 ? 117.727 149.585 133.082 1.00 50.02  ? 163 ILE A C   1 
ATOM   1036  O  O   . ILE A  1 142 ? 117.545 148.997 132.016 1.00 51.44  ? 163 ILE A O   1 
ATOM   1037  C  CB  . ILE A  1 142 ? 115.605 149.190 134.395 1.00 49.33  ? 163 ILE A CB  1 
ATOM   1038  C  CG1 . ILE A  1 142 ? 115.266 150.672 134.301 1.00 48.21  ? 163 ILE A CG1 1 
ATOM   1039  C  CG2 . ILE A  1 142 ? 114.949 148.521 135.596 1.00 48.76  ? 163 ILE A CG2 1 
ATOM   1040  C  CD1 . ILE A  1 142 ? 113.793 150.914 134.223 1.00 48.92  ? 163 ILE A CD1 1 
ATOM   1041  N  N   . SER A  1 143 ? 118.425 150.720 133.185 1.00 49.45  ? 164 SER A N   1 
ATOM   1042  C  CA  . SER A  1 143 ? 119.029 151.416 132.011 1.00 50.37  ? 164 SER A CA  1 
ATOM   1043  C  C   . SER A  1 143 ? 120.073 150.551 131.267 1.00 51.93  ? 164 SER A C   1 
ATOM   1044  O  O   . SER A  1 143 ? 120.149 150.632 130.015 1.00 53.06  ? 164 SER A O   1 
ATOM   1045  C  CB  . SER A  1 143 ? 119.551 152.748 132.421 1.00 48.81  ? 164 SER A CB  1 
ATOM   1046  O  OG  . SER A  1 143 ? 118.432 153.617 132.548 1.00 48.43  ? 164 SER A OG  1 
ATOM   1047  N  N   . TYR A  1 144 ? 120.831 149.713 131.966 1.00 51.71  ? 165 TYR A N   1 
ATOM   1048  C  CA  . TYR A  1 144 ? 121.846 148.841 131.328 1.00 53.84  ? 165 TYR A CA  1 
ATOM   1049  C  C   . TYR A  1 144 ? 121.162 147.922 130.296 1.00 55.48  ? 165 TYR A C   1 
ATOM   1050  O  O   . TYR A  1 144 ? 121.414 147.979 129.091 1.00 56.35  ? 165 TYR A O   1 
ATOM   1051  C  CB  . TYR A  1 144 ? 122.667 148.144 132.420 1.00 54.10  ? 165 TYR A CB  1 
ATOM   1052  C  CG  . TYR A  1 144 ? 123.518 146.999 131.933 1.00 57.13  ? 165 TYR A CG  1 
ATOM   1053  C  CD1 . TYR A  1 144 ? 124.142 147.035 130.697 1.00 58.94  ? 165 TYR A CD1 1 
ATOM   1054  C  CD2 . TYR A  1 144 ? 123.742 145.892 132.735 1.00 58.33  ? 165 TYR A CD2 1 
ATOM   1055  C  CE1 . TYR A  1 144 ? 124.916 145.968 130.249 1.00 62.27  ? 165 TYR A CE1 1 
ATOM   1056  C  CE2 . TYR A  1 144 ? 124.499 144.814 132.299 1.00 61.35  ? 165 TYR A CE2 1 
ATOM   1057  C  CZ  . TYR A  1 144 ? 125.108 144.851 131.053 1.00 63.50  ? 165 TYR A CZ  1 
ATOM   1058  O  OH  . TYR A  1 144 ? 125.898 143.799 130.642 1.00 66.68  ? 165 TYR A OH  1 
ATOM   1059  N  N   . PRO A  1 145 ? 120.265 147.021 130.710 1.00 55.54  ? 166 PRO A N   1 
ATOM   1060  C  CA  . PRO A  1 145 ? 119.599 146.155 129.751 1.00 58.16  ? 166 PRO A CA  1 
ATOM   1061  C  C   . PRO A  1 145 ? 118.789 146.893 128.671 1.00 58.28  ? 166 PRO A C   1 
ATOM   1062  O  O   . PRO A  1 145 ? 118.769 146.450 127.562 1.00 60.47  ? 166 PRO A O   1 
ATOM   1063  C  CB  . PRO A  1 145 ? 118.669 145.295 130.622 1.00 58.16  ? 166 PRO A CB  1 
ATOM   1064  C  CG  . PRO A  1 145 ? 118.564 146.024 131.923 1.00 55.39  ? 166 PRO A CG  1 
ATOM   1065  C  CD  . PRO A  1 145 ? 119.882 146.744 132.094 1.00 54.40  ? 166 PRO A CD  1 
ATOM   1066  N  N   . VAL A  1 146 ? 118.134 148.000 129.003 1.00 56.42  ? 167 VAL A N   1 
ATOM   1067  C  CA  . VAL A  1 146 ? 117.379 148.786 127.986 1.00 56.75  ? 167 VAL A CA  1 
ATOM   1068  C  C   . VAL A  1 146 ? 118.350 149.318 126.917 1.00 57.98  ? 167 VAL A C   1 
ATOM   1069  O  O   . VAL A  1 146 ? 118.069 149.152 125.703 1.00 60.12  ? 167 VAL A O   1 
ATOM   1070  C  CB  . VAL A  1 146 ? 116.568 149.911 128.641 1.00 54.24  ? 167 VAL A CB  1 
ATOM   1071  C  CG1 . VAL A  1 146 ? 115.922 150.800 127.592 1.00 54.95  ? 167 VAL A CG1 1 
ATOM   1072  C  CG2 . VAL A  1 146 ? 115.508 149.342 129.568 1.00 53.52  ? 167 VAL A CG2 1 
ATOM   1073  N  N   . VAL A  1 147 ? 119.470 149.913 127.324 1.00 56.88  ? 168 VAL A N   1 
ATOM   1074  C  CA  . VAL A  1 147 ? 120.443 150.479 126.356 1.00 57.66  ? 168 VAL A CA  1 
ATOM   1075  C  C   . VAL A  1 147 ? 121.101 149.320 125.599 1.00 60.57  ? 168 VAL A C   1 
ATOM   1076  O  O   . VAL A  1 147 ? 121.203 149.413 124.359 1.00 62.58  ? 168 VAL A O   1 
ATOM   1077  C  CB  . VAL A  1 147 ? 121.438 151.394 127.078 1.00 56.31  ? 168 VAL A CB  1 
ATOM   1078  C  CG1 . VAL A  1 147 ? 122.611 151.747 126.182 1.00 57.79  ? 168 VAL A CG1 1 
ATOM   1079  C  CG2 . VAL A  1 147 ? 120.730 152.645 127.627 1.00 54.02  ? 168 VAL A CG2 1 
ATOM   1080  N  N   . ARG A  1 148 ? 121.474 148.235 126.278 1.00 60.98  ? 169 ARG A N   1 
ATOM   1081  C  CA  . ARG A  1 148 ? 121.948 146.997 125.598 1.00 63.92  ? 169 ARG A CA  1 
ATOM   1082  C  C   . ARG A  1 148 ? 120.967 146.675 124.459 1.00 65.84  ? 169 ARG A C   1 
ATOM   1083  O  O   . ARG A  1 148 ? 121.385 146.654 123.305 1.00 67.93  ? 169 ARG A O   1 
ATOM   1084  C  CB  . ARG A  1 148 ? 122.086 145.856 126.612 1.00 64.16  ? 169 ARG A CB  1 
ATOM   1085  C  CG  . ARG A  1 148 ? 122.681 144.565 126.076 1.00 67.54  ? 169 ARG A CG  1 
ATOM   1086  C  CD  . ARG A  1 148 ? 122.985 143.580 127.197 1.00 68.01  ? 169 ARG A CD  1 
ATOM   1087  N  NE  . ARG A  1 148 ? 121.769 143.113 127.864 1.00 67.49  ? 169 ARG A NE  1 
ATOM   1088  C  CZ  . ARG A  1 148 ? 121.713 142.409 129.000 1.00 67.32  ? 169 ARG A CZ  1 
ATOM   1089  N  NH1 . ARG A  1 148 ? 122.822 142.068 129.630 1.00 68.16  ? 169 ARG A NH1 1 
ATOM   1090  N  NH2 . ARG A  1 148 ? 120.547 142.061 129.517 1.00 66.44  ? 169 ARG A NH2 1 
ATOM   1091  N  N   . ALA A  1 149 ? 119.683 146.506 124.748 1.00 65.46  ? 170 ALA A N   1 
ATOM   1092  C  CA  . ALA A  1 149 ? 118.683 146.110 123.734 1.00 68.40  ? 170 ALA A CA  1 
ATOM   1093  C  C   . ALA A  1 149 ? 118.644 147.119 122.573 1.00 69.32  ? 170 ALA A C   1 
ATOM   1094  O  O   . ALA A  1 149 ? 118.671 146.680 121.423 1.00 71.91  ? 170 ALA A O   1 
ATOM   1095  C  CB  . ALA A  1 149 ? 117.319 145.934 124.366 1.00 67.51  ? 170 ALA A CB  1 
ATOM   1096  N  N   . VAL A  1 150 ? 118.548 148.418 122.848 1.00 67.64  ? 171 VAL A N   1 
ATOM   1097  C  CA  . VAL A  1 150 ? 118.425 149.445 121.772 1.00 68.92  ? 171 VAL A CA  1 
ATOM   1098  C  C   . VAL A  1 150 ? 119.687 149.408 120.900 1.00 71.53  ? 171 VAL A C   1 
ATOM   1099  O  O   . VAL A  1 150 ? 119.567 149.384 119.658 1.00 74.59  ? 171 VAL A O   1 
ATOM   1100  C  CB  . VAL A  1 150 ? 118.152 150.842 122.355 1.00 65.99  ? 171 VAL A CB  1 
ATOM   1101  C  CG1 . VAL A  1 150 ? 118.230 151.935 121.304 1.00 66.91  ? 171 VAL A CG1 1 
ATOM   1102  C  CG2 . VAL A  1 150 ? 116.797 150.867 123.002 1.00 65.09  ? 171 VAL A CG2 1 
ATOM   1103  N  N   . SER A  1 151 ? 120.868 149.372 121.514 1.00 71.31  ? 172 SER A N   1 
ATOM   1104  C  CA  . SER A  1 151 ? 122.148 149.353 120.767 1.00 73.09  ? 172 SER A CA  1 
ATOM   1105  C  C   . SER A  1 151 ? 122.226 148.076 119.936 1.00 76.31  ? 172 SER A C   1 
ATOM   1106  O  O   . SER A  1 151 ? 122.538 148.218 118.753 1.00 79.43  ? 172 SER A O   1 
ATOM   1107  C  CB  . SER A  1 151 ? 123.350 149.508 121.656 1.00 71.63  ? 172 SER A CB  1 
ATOM   1108  O  OG  . SER A  1 151 ? 124.531 149.509 120.876 1.00 73.33  ? 172 SER A OG  1 
ATOM   1109  N  N   . GLU A  1 152 ? 121.977 146.892 120.507 1.00 76.58  ? 173 GLU A N   1 
ATOM   1110  C  CA  . GLU A  1 152 ? 122.141 145.609 119.758 1.00 80.49  ? 173 GLU A CA  1 
ATOM   1111  C  C   . GLU A  1 152 ? 121.182 145.601 118.564 1.00 82.44  ? 173 GLU A C   1 
ATOM   1112  O  O   . GLU A  1 152 ? 121.612 145.262 117.446 1.00 85.96  ? 173 GLU A O   1 
ATOM   1113  C  CB  . GLU A  1 152 ? 121.840 144.376 120.604 1.00 81.06  ? 173 GLU A CB  1 
ATOM   1114  C  CG  . GLU A  1 152 ? 122.862 144.087 121.686 1.00 80.30  ? 173 GLU A CG  1 
ATOM   1115  C  CD  . GLU A  1 152 ? 122.367 143.087 122.727 1.00 80.33  ? 173 GLU A CD  1 
ATOM   1116  O  OE1 . GLU A  1 152 ? 121.136 143.069 123.014 1.00 79.98  ? 173 GLU A OE1 1 
ATOM   1117  O  OE2 . GLU A  1 152 ? 123.203 142.328 123.259 1.00 81.45  ? 173 GLU A OE2 1 
ATOM   1118  N  N   . LYS A  1 153 ? 119.935 145.993 118.810 1.00 81.14  ? 174 LYS A N   1 
ATOM   1119  C  CA  . LYS A  1 153 ? 118.864 146.047 117.793 1.00 83.06  ? 174 LYS A CA  1 
ATOM   1120  C  C   . LYS A  1 153 ? 119.305 146.984 116.662 1.00 83.95  ? 174 LYS A C   1 
ATOM   1121  O  O   . LYS A  1 153 ? 119.150 146.580 115.507 1.00 87.51  ? 174 LYS A O   1 
ATOM   1122  C  CB  . LYS A  1 153 ? 117.545 146.456 118.448 1.00 81.21  ? 174 LYS A CB  1 
ATOM   1123  C  CG  . LYS A  1 153 ? 116.336 146.476 117.528 1.00 83.71  ? 174 LYS A CG  1 
ATOM   1124  C  CD  . LYS A  1 153 ? 115.954 145.138 116.956 1.00 86.99  ? 174 LYS A CD  1 
ATOM   1125  C  CE  . LYS A  1 153 ? 114.812 145.313 115.989 1.00 89.42  ? 174 LYS A CE  1 
ATOM   1126  N  NZ  . LYS A  1 153 ? 114.451 144.035 115.333 1.00 93.58  ? 174 LYS A NZ  1 
ATOM   1127  N  N   . LEU A  1 154 ? 119.880 148.157 116.953 1.00 81.22  ? 175 LEU A N   1 
ATOM   1128  C  CA  . LEU A  1 154 ? 120.260 149.138 115.889 1.00 81.84  ? 175 LEU A CA  1 
ATOM   1129  C  C   . LEU A  1 154 ? 121.660 148.836 115.307 1.00 83.33  ? 175 LEU A C   1 
ATOM   1130  O  O   . LEU A  1 154 ? 121.995 149.436 114.263 1.00 84.16  ? 175 LEU A O   1 
ATOM   1131  C  CB  . LEU A  1 154 ? 120.139 150.557 116.451 1.00 78.99  ? 175 LEU A CB  1 
ATOM   1132  C  CG  . LEU A  1 154 ? 118.767 150.940 117.019 1.00 77.36  ? 175 LEU A CG  1 
ATOM   1133  C  CD1 . LEU A  1 154 ? 118.805 152.339 117.616 1.00 74.91  ? 175 LEU A CD1 1 
ATOM   1134  C  CD2 . LEU A  1 154 ? 117.655 150.852 115.979 1.00 79.84  ? 175 LEU A CD2 1 
ATOM   1135  N  N   . GLY A  1 155 ? 122.409 147.916 115.938 1.00 83.04  ? 176 GLY A N   1 
ATOM   1136  C  CA  . GLY A  1 155 ? 123.720 147.386 115.517 1.00 84.87  ? 176 GLY A CA  1 
ATOM   1137  C  C   . GLY A  1 155 ? 124.805 148.447 115.506 1.00 83.79  ? 176 GLY A C   1 
ATOM   1138  O  O   . GLY A  1 155 ? 125.428 148.647 114.465 1.00 86.17  ? 176 GLY A O   1 
ATOM   1139  N  N   . GLY A  1 156 ? 125.053 149.095 116.638 1.00 80.45  ? 177 GLY A N   1 
ATOM   1140  C  CA  . GLY A  1 156 ? 125.968 150.243 116.726 1.00 79.21  ? 177 GLY A CA  1 
ATOM   1141  C  C   . GLY A  1 156 ? 125.761 151.030 118.011 1.00 75.66  ? 177 GLY A C   1 
ATOM   1142  O  O   . GLY A  1 156 ? 124.762 150.891 118.720 1.00 73.67  ? 177 GLY A O   1 
ATOM   1143  N  N   . PRO A  1 157 ? 126.705 151.914 118.357 1.00 75.00  ? 178 PRO A N   1 
ATOM   1144  C  CA  . PRO A  1 157 ? 126.592 152.663 119.604 1.00 71.97  ? 178 PRO A CA  1 
ATOM   1145  C  C   . PRO A  1 157 ? 125.615 153.840 119.457 1.00 70.64  ? 178 PRO A C   1 
ATOM   1146  O  O   . PRO A  1 157 ? 125.274 154.175 118.353 1.00 72.71  ? 178 PRO A O   1 
ATOM   1147  C  CB  . PRO A  1 157 ? 128.021 153.133 119.825 1.00 72.07  ? 178 PRO A CB  1 
ATOM   1148  C  CG  . PRO A  1 157 ? 128.575 153.309 118.411 1.00 75.22  ? 178 PRO A CG  1 
ATOM   1149  C  CD  . PRO A  1 157 ? 127.866 152.291 117.544 1.00 77.24  ? 178 PRO A CD  1 
ATOM   1150  N  N   . VAL A  1 158 ? 125.173 154.424 120.574 1.00 68.28  ? 179 VAL A N   1 
ATOM   1151  C  CA  . VAL A  1 158 ? 124.345 155.670 120.595 1.00 66.38  ? 179 VAL A CA  1 
ATOM   1152  C  C   . VAL A  1 158 ? 125.075 156.732 121.438 1.00 64.14  ? 179 VAL A C   1 
ATOM   1153  O  O   . VAL A  1 158 ? 125.999 156.377 122.208 1.00 63.89  ? 179 VAL A O   1 
ATOM   1154  C  CB  . VAL A  1 158 ? 122.921 155.394 121.111 1.00 65.02  ? 179 VAL A CB  1 
ATOM   1155  C  CG1 . VAL A  1 158 ? 122.065 154.673 120.091 1.00 67.68  ? 179 VAL A CG1 1 
ATOM   1156  C  CG2 . VAL A  1 158 ? 122.932 154.613 122.409 1.00 63.75  ? 179 VAL A CG2 1 
ATOM   1157  N  N   . ASP A  1 159 ? 124.703 158.000 121.268 1.00 62.81  ? 180 ASP A N   1 
ATOM   1158  C  CA  . ASP A  1 159 ? 125.054 159.085 122.213 1.00 60.25  ? 180 ASP A CA  1 
ATOM   1159  C  C   . ASP A  1 159 ? 123.940 159.099 123.247 1.00 58.27  ? 180 ASP A C   1 
ATOM   1160  O  O   . ASP A  1 159 ? 122.761 158.888 122.844 1.00 59.47  ? 180 ASP A O   1 
ATOM   1161  C  CB  . ASP A  1 159 ? 125.201 160.446 121.534 1.00 60.55  ? 180 ASP A CB  1 
ATOM   1162  C  CG  . ASP A  1 159 ? 126.454 160.610 120.691 1.00 62.44  ? 180 ASP A CG  1 
ATOM   1163  O  OD1 . ASP A  1 159 ? 127.418 159.844 120.892 1.00 62.88  ? 180 ASP A OD1 1 
ATOM   1164  O  OD2 . ASP A  1 159 ? 126.450 161.510 119.850 1.00 63.23  ? 180 ASP A OD2 1 
ATOM   1165  N  N   . ILE A  1 160 ? 124.317 159.305 124.505 1.00 55.90  ? 181 ILE A N   1 
ATOM   1166  C  CA  . ILE A  1 160 ? 123.441 159.192 125.690 1.00 53.77  ? 181 ILE A CA  1 
ATOM   1167  C  C   . ILE A  1 160 ? 123.532 160.504 126.465 1.00 52.04  ? 181 ILE A C   1 
ATOM   1168  O  O   . ILE A  1 160 ? 124.648 160.864 126.892 1.00 51.95  ? 181 ILE A O   1 
ATOM   1169  C  CB  . ILE A  1 160 ? 123.817 157.995 126.584 1.00 53.37  ? 181 ILE A CB  1 
ATOM   1170  C  CG1 . ILE A  1 160 ? 123.913 156.678 125.810 1.00 55.95  ? 181 ILE A CG1 1 
ATOM   1171  C  CG2 . ILE A  1 160 ? 122.813 157.895 127.709 1.00 51.10  ? 181 ILE A CG2 1 
ATOM   1172  C  CD1 . ILE A  1 160 ? 123.948 155.444 126.693 1.00 55.68  ? 181 ILE A CD1 1 
ATOM   1173  N  N   . LEU A  1 161 ? 122.383 161.156 126.624 1.00 50.64  ? 182 LEU A N   1 
ATOM   1174  C  CA  . LEU A  1 161 ? 122.142 162.244 127.581 1.00 48.89  ? 182 LEU A CA  1 
ATOM   1175  C  C   . LEU A  1 161 ? 121.609 161.610 128.858 1.00 46.92  ? 182 LEU A C   1 
ATOM   1176  O  O   . LEU A  1 161 ? 120.523 161.029 128.815 1.00 47.13  ? 182 LEU A O   1 
ATOM   1177  C  CB  . LEU A  1 161 ? 121.099 163.213 127.024 1.00 49.11  ? 182 LEU A CB  1 
ATOM   1178  C  CG  . LEU A  1 161 ? 120.721 164.341 127.974 1.00 47.30  ? 182 LEU A CG  1 
ATOM   1179  C  CD1 . LEU A  1 161 ? 121.949 165.102 128.465 1.00 46.75  ? 182 LEU A CD1 1 
ATOM   1180  C  CD2 . LEU A  1 161 ? 119.748 165.283 127.300 1.00 48.54  ? 182 LEU A CD2 1 
ATOM   1181  N  N   . HIS A  1 162 ? 122.358 161.731 129.936 1.00 45.50  ? 183 HIS A N   1 
ATOM   1182  C  CA  . HIS A  1 162 ? 122.073 161.067 131.227 1.00 43.68  ? 183 HIS A CA  1 
ATOM   1183  C  C   . HIS A  1 162 ? 121.813 162.172 132.233 1.00 42.18  ? 183 HIS A C   1 
ATOM   1184  O  O   . HIS A  1 162 ? 122.795 162.780 132.645 1.00 43.25  ? 183 HIS A O   1 
ATOM   1185  C  CB  . HIS A  1 162 ? 123.235 160.129 131.591 1.00 43.60  ? 183 HIS A CB  1 
ATOM   1186  C  CG  . HIS A  1 162 ? 123.165 159.604 132.975 1.00 41.81  ? 183 HIS A CG  1 
ATOM   1187  N  ND1 . HIS A  1 162 ? 124.299 159.234 133.685 1.00 41.72  ? 183 HIS A ND1 1 
ATOM   1188  C  CD2 . HIS A  1 162 ? 122.106 159.402 133.792 1.00 40.28  ? 183 HIS A CD2 1 
ATOM   1189  C  CE1 . HIS A  1 162 ? 123.925 158.831 134.887 1.00 40.52  ? 183 HIS A CE1 1 
ATOM   1190  N  NE2 . HIS A  1 162 ? 122.592 158.931 134.980 1.00 39.34  ? 183 HIS A NE2 1 
ATOM   1191  N  N   . LEU A  1 163 ? 120.553 162.428 132.581 1.00 40.67  ? 184 LEU A N   1 
ATOM   1192  C  CA  . LEU A  1 163 ? 120.186 163.446 133.598 1.00 38.73  ? 184 LEU A CA  1 
ATOM   1193  C  C   . LEU A  1 163 ? 120.061 162.799 134.993 1.00 37.49  ? 184 LEU A C   1 
ATOM   1194  O  O   . LEU A  1 163 ? 119.180 161.939 135.205 1.00 36.53  ? 184 LEU A O   1 
ATOM   1195  C  CB  . LEU A  1 163 ? 118.878 164.099 133.148 1.00 38.86  ? 184 LEU A CB  1 
ATOM   1196  C  CG  . LEU A  1 163 ? 118.968 164.975 131.892 1.00 40.16  ? 184 LEU A CG  1 
ATOM   1197  C  CD1 . LEU A  1 163 ? 117.607 165.176 131.254 1.00 40.78  ? 184 LEU A CD1 1 
ATOM   1198  C  CD2 . LEU A  1 163 ? 119.540 166.310 132.251 1.00 39.95  ? 184 LEU A CD2 1 
ATOM   1199  N  N   . ASP A  1 164 ? 120.897 163.220 135.946 1.00 36.81  ? 185 ASP A N   1 
ATOM   1200  C  CA  . ASP A  1 164 ? 120.969 162.560 137.266 1.00 35.46  ? 185 ASP A CA  1 
ATOM   1201  C  C   . ASP A  1 164 ? 121.801 163.413 138.227 1.00 34.63  ? 185 ASP A C   1 
ATOM   1202  O  O   . ASP A  1 164 ? 122.760 164.048 137.776 1.00 34.89  ? 185 ASP A O   1 
ATOM   1203  C  CB  . ASP A  1 164 ? 121.569 161.177 137.060 1.00 36.69  ? 185 ASP A CB  1 
ATOM   1204  C  CG  . ASP A  1 164 ? 121.260 160.160 138.143 1.00 36.55  ? 185 ASP A CG  1 
ATOM   1205  O  OD1 . ASP A  1 164 ? 121.129 160.546 139.316 1.00 35.65  ? 185 ASP A OD1 1 
ATOM   1206  O  OD2 . ASP A  1 164 ? 121.125 158.977 137.778 1.00 38.03  ? 185 ASP A OD2 1 
ATOM   1207  N  N   . ALA A  1 165 ? 121.418 163.458 139.506 1.00 33.04  ? 186 ALA A N   1 
ATOM   1208  C  CA  . ALA A  1 165 ? 122.292 163.963 140.586 1.00 32.52  ? 186 ALA A CA  1 
ATOM   1209  C  C   . ALA A  1 165 ? 123.576 163.139 140.671 1.00 33.13  ? 186 ALA A C   1 
ATOM   1210  O  O   . ALA A  1 165 ? 124.616 163.698 141.115 1.00 33.11  ? 186 ALA A O   1 
ATOM   1211  C  CB  . ALA A  1 165 ? 121.598 163.945 141.913 1.00 31.51  ? 186 ALA A CB  1 
ATOM   1212  N  N   . HIS A  1 166 ? 123.502 161.864 140.287 1.00 33.53  ? 187 HIS A N   1 
ATOM   1213  C  CA  . HIS A  1 166 ? 124.576 160.856 140.517 1.00 34.29  ? 187 HIS A CA  1 
ATOM   1214  C  C   . HIS A  1 166 ? 125.094 160.318 139.182 1.00 35.64  ? 187 HIS A C   1 
ATOM   1215  O  O   . HIS A  1 166 ? 124.331 160.157 138.226 1.00 36.16  ? 187 HIS A O   1 
ATOM   1216  C  CB  . HIS A  1 166 ? 124.017 159.704 141.393 1.00 33.80  ? 187 HIS A CB  1 
ATOM   1217  C  CG  . HIS A  1 166 ? 123.244 160.150 142.600 1.00 32.36  ? 187 HIS A CG  1 
ATOM   1218  N  ND1 . HIS A  1 166 ? 121.889 160.353 142.541 1.00 31.15  ? 187 HIS A ND1 1 
ATOM   1219  C  CD2 . HIS A  1 166 ? 123.644 160.424 143.875 1.00 31.80  ? 187 HIS A CD2 1 
ATOM   1220  C  CE1 . HIS A  1 166 ? 121.487 160.756 143.737 1.00 30.77  ? 187 HIS A CE1 1 
ATOM   1221  N  NE2 . HIS A  1 166 ? 122.550 160.787 144.580 1.00 30.63  ? 187 HIS A NE2 1 
ATOM   1222  N  N   . PRO A  1 167 ? 126.391 159.947 139.068 1.00 37.08  ? 188 PRO A N   1 
ATOM   1223  C  CA  . PRO A  1 167 ? 126.891 159.426 137.796 1.00 38.86  ? 188 PRO A CA  1 
ATOM   1224  C  C   . PRO A  1 167 ? 126.604 157.928 137.551 1.00 39.91  ? 188 PRO A C   1 
ATOM   1225  O  O   . PRO A  1 167 ? 126.662 157.522 136.402 1.00 40.63  ? 188 PRO A O   1 
ATOM   1226  C  CB  . PRO A  1 167 ? 128.377 159.769 137.853 1.00 39.79  ? 188 PRO A CB  1 
ATOM   1227  C  CG  . PRO A  1 167 ? 128.728 159.840 139.323 1.00 39.29  ? 188 PRO A CG  1 
ATOM   1228  C  CD  . PRO A  1 167 ? 127.448 160.131 140.070 1.00 37.13  ? 188 PRO A CD  1 
ATOM   1229  N  N   . ASP A  1 168 ? 126.282 157.163 138.602 1.00 39.76  ? 189 ASP A N   1 
ATOM   1230  C  CA  . ASP A  1 168 ? 125.870 155.731 138.509 1.00 41.15  ? 189 ASP A CA  1 
ATOM   1231  C  C   . ASP A  1 168 ? 126.941 154.951 137.733 1.00 43.12  ? 189 ASP A C   1 
ATOM   1232  O  O   . ASP A  1 168 ? 126.631 154.162 136.830 1.00 43.89  ? 189 ASP A O   1 
ATOM   1233  C  CB  . ASP A  1 168 ? 124.460 155.598 137.917 1.00 40.87  ? 189 ASP A CB  1 
ATOM   1234  C  CG  . ASP A  1 168 ? 123.390 156.199 138.815 1.00 39.75  ? 189 ASP A CG  1 
ATOM   1235  O  OD1 . ASP A  1 168 ? 123.686 156.484 140.003 1.00 38.87  ? 189 ASP A OD1 1 
ATOM   1236  O  OD2 . ASP A  1 168 ? 122.240 156.342 138.328 1.00 40.94  ? 189 ASP A OD2 1 
ATOM   1237  N  N   . ILE A  1 169 ? 128.190 155.132 138.124 1.00 44.40  ? 190 ILE A N   1 
ATOM   1238  C  CA  . ILE A  1 169 ? 129.334 154.616 137.327 1.00 46.78  ? 190 ILE A CA  1 
ATOM   1239  C  C   . ILE A  1 169 ? 130.387 153.970 138.230 1.00 47.78  ? 190 ILE A C   1 
ATOM   1240  O  O   . ILE A  1 169 ? 131.471 153.747 137.735 1.00 49.49  ? 190 ILE A O   1 
ATOM   1241  C  CB  . ILE A  1 169 ? 129.870 155.771 136.470 1.00 47.12  ? 190 ILE A CB  1 
ATOM   1242  C  CG1 . ILE A  1 169 ? 130.473 155.227 135.187 1.00 49.80  ? 190 ILE A CG1 1 
ATOM   1243  C  CG2 . ILE A  1 169 ? 130.822 156.682 137.244 1.00 46.80  ? 190 ILE A CG2 1 
ATOM   1244  C  CD1 . ILE A  1 169 ? 130.826 156.295 134.205 1.00 50.76  ? 190 ILE A CD1 1 
ATOM   1245  N  N   . TYR A  1 170 ? 130.064 153.687 139.500 1.00 47.32  ? 191 TYR A N   1 
ATOM   1246  C  CA  . TYR A  1 170 ? 130.835 152.784 140.403 1.00 48.98  ? 191 TYR A CA  1 
ATOM   1247  C  C   . TYR A  1 170 ? 131.046 151.415 139.739 1.00 51.27  ? 191 TYR A C   1 
ATOM   1248  O  O   . TYR A  1 170 ? 130.148 150.864 139.058 1.00 50.68  ? 191 TYR A O   1 
ATOM   1249  C  CB  . TYR A  1 170 ? 130.075 152.446 141.682 1.00 48.01  ? 191 TYR A CB  1 
ATOM   1250  C  CG  . TYR A  1 170 ? 129.914 153.550 142.675 1.00 46.33  ? 191 TYR A CG  1 
ATOM   1251  C  CD1 . TYR A  1 170 ? 130.889 153.793 143.622 1.00 47.32  ? 191 TYR A CD1 1 
ATOM   1252  C  CD2 . TYR A  1 170 ? 128.788 154.339 142.684 1.00 44.19  ? 191 TYR A CD2 1 
ATOM   1253  C  CE1 . TYR A  1 170 ? 130.733 154.778 144.582 1.00 45.79  ? 191 TYR A CE1 1 
ATOM   1254  C  CE2 . TYR A  1 170 ? 128.638 155.369 143.611 1.00 42.90  ? 191 TYR A CE2 1 
ATOM   1255  C  CZ  . TYR A  1 170 ? 129.609 155.579 144.567 1.00 43.31  ? 191 TYR A CZ  1 
ATOM   1256  O  OH  . TYR A  1 170 ? 129.453 156.561 145.483 1.00 42.24  ? 191 TYR A OH  1 
ATOM   1257  N  N   . ASP A  1 171 ? 132.192 150.817 139.987 1.00 53.61  ? 192 ASP A N   1 
ATOM   1258  C  CA  . ASP A  1 171 ? 132.542 149.547 139.319 1.00 56.86  ? 192 ASP A CA  1 
ATOM   1259  C  C   . ASP A  1 171 ? 131.632 148.430 139.832 1.00 57.81  ? 192 ASP A C   1 
ATOM   1260  O  O   . ASP A  1 171 ? 131.198 147.579 139.029 1.00 58.91  ? 192 ASP A O   1 
ATOM   1261  C  CB  . ASP A  1 171 ? 134.009 149.191 139.545 1.00 59.13  ? 192 ASP A CB  1 
ATOM   1262  C  CG  . ASP A  1 171 ? 134.325 147.799 139.047 1.00 61.69  ? 192 ASP A CG  1 
ATOM   1263  O  OD1 . ASP A  1 171 ? 133.929 147.487 137.893 1.00 61.31  ? 192 ASP A OD1 1 
ATOM   1264  O  OD2 . ASP A  1 171 ? 134.948 147.055 139.836 1.00 63.51  ? 192 ASP A OD2 1 
ATOM   1265  N  N   . CYS A  1 172 ? 131.387 148.411 141.137 1.00 58.43  ? 193 CYS A N   1 
ATOM   1266  C  CA  . CYS A  1 172 ? 130.576 147.345 141.770 1.00 60.07  ? 193 CYS A CA  1 
ATOM   1267  C  C   . CYS A  1 172 ? 129.950 147.824 143.075 1.00 56.65  ? 193 CYS A C   1 
ATOM   1268  O  O   . CYS A  1 172 ? 130.501 147.500 144.129 1.00 58.83  ? 193 CYS A O   1 
ATOM   1269  C  CB  . CYS A  1 172 ? 131.440 146.114 142.034 1.00 64.73  ? 193 CYS A CB  1 
ATOM   1270  S  SG  . CYS A  1 172 ? 130.382 144.660 142.238 1.00 68.30  ? 193 CYS A SG  1 
ATOM   1271  N  N   . PHE A  1 173 ? 128.861 148.574 143.035 1.00 63.50  ? 194 PHE A N   1 
ATOM   1272  C  CA  . PHE A  1 173 ? 128.399 149.234 144.279 1.00 62.55  ? 194 PHE A CA  1 
ATOM   1273  C  C   . PHE A  1 173 ? 127.935 148.147 145.245 1.00 63.62  ? 194 PHE A C   1 
ATOM   1274  O  O   . PHE A  1 173 ? 127.045 147.394 144.836 1.00 63.38  ? 194 PHE A O   1 
ATOM   1275  C  CB  . PHE A  1 173 ? 127.333 150.296 144.024 1.00 59.75  ? 194 PHE A CB  1 
ATOM   1276  C  CG  . PHE A  1 173 ? 127.114 151.192 145.210 1.00 59.57  ? 194 PHE A CG  1 
ATOM   1277  C  CD1 . PHE A  1 173 ? 128.078 152.108 145.599 1.00 60.23  ? 194 PHE A CD1 1 
ATOM   1278  C  CD2 . PHE A  1 173 ? 125.958 151.089 145.961 1.00 59.34  ? 194 PHE A CD2 1 
ATOM   1279  C  CE1 . PHE A  1 173 ? 127.872 152.938 146.693 1.00 61.05  ? 194 PHE A CE1 1 
ATOM   1280  C  CE2 . PHE A  1 173 ? 125.744 151.926 147.054 1.00 60.03  ? 194 PHE A CE2 1 
ATOM   1281  C  CZ  . PHE A  1 173 ? 126.697 152.858 147.414 1.00 60.92  ? 194 PHE A CZ  1 
ATOM   1282  N  N   . GLU A  1 174 ? 128.552 148.061 146.431 1.00 65.25  ? 195 GLU A N   1 
ATOM   1283  C  CA  . GLU A  1 174 ? 128.186 147.117 147.518 1.00 66.84  ? 195 GLU A CA  1 
ATOM   1284  C  C   . GLU A  1 174 ? 128.132 145.673 147.004 1.00 66.66  ? 195 GLU A C   1 
ATOM   1285  O  O   . GLU A  1 174 ? 127.335 144.912 147.550 1.00 67.02  ? 195 GLU A O   1 
ATOM   1286  C  CB  . GLU A  1 174 ? 126.819 147.490 148.092 1.00 66.49  ? 195 GLU A CB  1 
ATOM   1287  C  CG  . GLU A  1 174 ? 126.833 148.748 148.937 1.00 67.46  ? 195 GLU A CG  1 
ATOM   1288  C  CD  . GLU A  1 174 ? 125.454 149.159 149.429 1.00 67.23  ? 195 GLU A CD  1 
ATOM   1289  O  OE1 . GLU A  1 174 ? 125.401 149.913 150.441 1.00 69.07  ? 195 GLU A OE1 1 
ATOM   1290  O  OE2 . GLU A  1 174 ? 124.437 148.757 148.780 1.00 65.69  ? 195 GLU A OE2 1 
ATOM   1291  N  N   . GLY A  1 175 ? 128.930 145.314 145.995 1.00 66.11  ? 196 GLY A N   1 
ATOM   1292  C  CA  . GLY A  1 175 ? 129.069 143.932 145.496 1.00 66.92  ? 196 GLY A CA  1 
ATOM   1293  C  C   . GLY A  1 175 ? 128.018 143.557 144.452 1.00 64.63  ? 196 GLY A C   1 
ATOM   1294  O  O   . GLY A  1 175 ? 128.082 142.420 143.943 1.00 65.72  ? 196 GLY A O   1 
ATOM   1295  N  N   . ASN A  1 176 ? 127.112 144.466 144.084 1.00 61.41  ? 197 ASN A N   1 
ATOM   1296  C  CA  . ASN A  1 176 ? 126.042 144.156 143.089 1.00 59.74  ? 197 ASN A CA  1 
ATOM   1297  C  C   . ASN A  1 176 ? 126.375 144.830 141.745 1.00 58.77  ? 197 ASN A C   1 
ATOM   1298  O  O   . ASN A  1 176 ? 126.232 146.081 141.656 1.00 57.09  ? 197 ASN A O   1 
ATOM   1299  C  CB  . ASN A  1 176 ? 124.648 144.512 143.616 1.00 57.75  ? 197 ASN A CB  1 
ATOM   1300  C  CG  . ASN A  1 176 ? 123.571 144.342 142.566 1.00 56.37  ? 197 ASN A CG  1 
ATOM   1301  O  OD1 . ASN A  1 176 ? 123.826 143.750 141.521 1.00 56.65  ? 197 ASN A OD1 1 
ATOM   1302  N  ND2 . ASN A  1 176 ? 122.380 144.881 142.810 1.00 54.70  ? 197 ASN A ND2 1 
ATOM   1303  N  N   . LYS A  1 177 ? 126.771 144.040 140.735 1.00 59.86  ? 198 LYS A N   1 
ATOM   1304  C  CA  . LYS A  1 177 ? 127.135 144.543 139.389 1.00 59.56  ? 198 LYS A CA  1 
ATOM   1305  C  C   . LYS A  1 177 ? 125.908 145.160 138.713 1.00 57.82  ? 198 LYS A C   1 
ATOM   1306  O  O   . LYS A  1 177 ? 126.090 146.029 137.836 1.00 57.34  ? 198 LYS A O   1 
ATOM   1307  C  CB  . LYS A  1 177 ? 127.754 143.439 138.539 1.00 62.08  ? 198 LYS A CB  1 
ATOM   1308  C  CG  . LYS A  1 177 ? 126.826 142.319 138.103 1.00 63.29  ? 198 LYS A CG  1 
ATOM   1309  C  CD  . LYS A  1 177 ? 127.464 141.373 137.073 1.00 66.01  ? 198 LYS A CD  1 
ATOM   1310  C  CE  . LYS A  1 177 ? 126.466 140.321 136.625 1.00 67.31  ? 198 LYS A CE  1 
ATOM   1311  N  NZ  . LYS A  1 177 ? 127.053 139.454 135.585 1.00 70.58  ? 198 LYS A NZ  1 
ATOM   1312  N  N   . TYR A  1 178 ? 124.706 144.739 139.107 1.00 57.11  ? 199 TYR A N   1 
ATOM   1313  C  CA  . TYR A  1 178 ? 123.425 145.364 138.685 1.00 55.59  ? 199 TYR A CA  1 
ATOM   1314  C  C   . TYR A  1 178 ? 122.987 146.477 139.656 1.00 53.53  ? 199 TYR A C   1 
ATOM   1315  O  O   . TYR A  1 178 ? 121.808 146.863 139.618 1.00 52.84  ? 199 TYR A O   1 
ATOM   1316  C  CB  . TYR A  1 178 ? 122.353 144.279 138.584 1.00 56.50  ? 199 TYR A CB  1 
ATOM   1317  C  CG  . TYR A  1 178 ? 122.629 143.268 137.503 1.00 58.38  ? 199 TYR A CG  1 
ATOM   1318  C  CD1 . TYR A  1 178 ? 122.513 143.618 136.171 1.00 58.70  ? 199 TYR A CD1 1 
ATOM   1319  C  CD2 . TYR A  1 178 ? 122.985 141.965 137.797 1.00 60.49  ? 199 TYR A CD2 1 
ATOM   1320  C  CE1 . TYR A  1 178 ? 122.766 142.709 135.149 1.00 60.99  ? 199 TYR A CE1 1 
ATOM   1321  C  CE2 . TYR A  1 178 ? 123.233 141.042 136.788 1.00 62.60  ? 199 TYR A CE2 1 
ATOM   1322  C  CZ  . TYR A  1 178 ? 123.111 141.408 135.454 1.00 62.83  ? 199 TYR A CZ  1 
ATOM   1323  O  OH  . TYR A  1 178 ? 123.325 140.526 134.424 1.00 65.40  ? 199 TYR A OH  1 
ATOM   1324  N  N   . SER A  1 179 ? 123.867 146.989 140.516 1.00 52.94  ? 200 SER A N   1 
ATOM   1325  C  CA  . SER A  1 179 ? 123.513 148.129 141.404 1.00 51.63  ? 200 SER A CA  1 
ATOM   1326  C  C   . SER A  1 179 ? 122.940 149.251 140.541 1.00 50.02  ? 200 SER A C   1 
ATOM   1327  O  O   . SER A  1 179 ? 123.408 149.438 139.435 1.00 50.26  ? 200 SER A O   1 
ATOM   1328  C  CB  . SER A  1 179 ? 124.659 148.620 142.228 1.00 52.10  ? 200 SER A CB  1 
ATOM   1329  O  OG  . SER A  1 179 ? 124.221 149.691 143.058 1.00 51.38  ? 200 SER A OG  1 
ATOM   1330  N  N   . HIS A  1 180 ? 121.931 149.944 141.000 1.00 48.89  ? 201 HIS A N   1 
ATOM   1331  C  CA  . HIS A  1 180 ? 121.440 151.163 140.314 1.00 48.05  ? 201 HIS A CA  1 
ATOM   1332  C  C   . HIS A  1 180 ? 122.563 152.217 140.232 1.00 48.25  ? 201 HIS A C   1 
ATOM   1333  O  O   . HIS A  1 180 ? 122.383 153.217 139.513 1.00 48.29  ? 201 HIS A O   1 
ATOM   1334  C  CB  . HIS A  1 180 ? 120.189 151.698 141.020 1.00 47.28  ? 201 HIS A CB  1 
ATOM   1335  C  CG  . HIS A  1 180 ? 120.366 152.304 142.372 1.00 47.20  ? 201 HIS A CG  1 
ATOM   1336  N  ND1 . HIS A  1 180 ? 119.398 153.143 142.914 1.00 46.97  ? 201 HIS A ND1 1 
ATOM   1337  C  CD2 . HIS A  1 180 ? 121.317 152.197 143.312 1.00 47.79  ? 201 HIS A CD2 1 
ATOM   1338  C  CE1 . HIS A  1 180 ? 119.774 153.544 144.115 1.00 47.60  ? 201 HIS A CE1 1 
ATOM   1339  N  NE2 . HIS A  1 180 ? 120.939 153.004 144.378 1.00 48.16  ? 201 HIS A NE2 1 
ATOM   1340  N  N   . ALA A  1 181 ? 123.637 152.049 140.997 1.00 48.76  ? 202 ALA A N   1 
ATOM   1341  C  CA  . ALA A  1 181 ? 124.762 152.987 141.057 1.00 49.05  ? 202 ALA A CA  1 
ATOM   1342  C  C   . ALA A  1 181 ? 125.880 152.498 140.149 1.00 49.61  ? 202 ALA A C   1 
ATOM   1343  O  O   . ALA A  1 181 ? 126.928 153.105 140.249 1.00 50.27  ? 202 ALA A O   1 
ATOM   1344  C  CB  . ALA A  1 181 ? 125.238 153.144 142.478 1.00 49.96  ? 202 ALA A CB  1 
ATOM   1345  N  N   . SER A  1 182 ? 125.675 151.450 139.339 1.00 49.70  ? 203 SER A N   1 
ATOM   1346  C  CA  . SER A  1 182 ? 126.683 150.931 138.388 1.00 50.62  ? 203 SER A CA  1 
ATOM   1347  C  C   . SER A  1 182 ? 126.131 150.786 136.959 1.00 50.73  ? 203 SER A C   1 
ATOM   1348  O  O   . SER A  1 182 ? 126.876 150.345 136.082 1.00 51.51  ? 203 SER A O   1 
ATOM   1349  C  CB  . SER A  1 182 ? 127.287 149.655 138.914 1.00 51.87  ? 203 SER A CB  1 
ATOM   1350  O  OG  . SER A  1 182 ? 127.891 149.856 140.186 1.00 52.23  ? 203 SER A OG  1 
ATOM   1351  N  N   . SER A  1 183 ? 124.907 151.226 136.679 1.00 50.51  ? 204 SER A N   1 
ATOM   1352  C  CA  . SER A  1 183 ? 124.257 151.012 135.356 1.00 51.51  ? 204 SER A CA  1 
ATOM   1353  C  C   . SER A  1 183 ? 125.163 151.550 134.244 1.00 52.42  ? 204 SER A C   1 
ATOM   1354  O  O   . SER A  1 183 ? 125.241 150.940 133.198 1.00 53.43  ? 204 SER A O   1 
ATOM   1355  C  CB  . SER A  1 183 ? 122.873 151.631 135.247 1.00 50.96  ? 204 SER A CB  1 
ATOM   1356  O  OG  . SER A  1 183 ? 122.207 151.603 136.492 1.00 50.77  ? 204 SER A OG  1 
ATOM   1357  N  N   . PHE A  1 184 ? 125.790 152.700 134.481 1.00 52.52  ? 205 PHE A N   1 
ATOM   1358  C  CA  . PHE A  1 184 ? 126.550 153.453 133.451 1.00 53.46  ? 205 PHE A CA  1 
ATOM   1359  C  C   . PHE A  1 184 ? 127.958 152.863 133.304 1.00 54.64  ? 205 PHE A C   1 
ATOM   1360  O  O   . PHE A  1 184 ? 128.456 152.897 132.192 1.00 55.57  ? 205 PHE A O   1 
ATOM   1361  C  CB  . PHE A  1 184 ? 126.407 154.954 133.699 1.00 52.69  ? 205 PHE A CB  1 
ATOM   1362  C  CG  . PHE A  1 184 ? 125.026 155.404 133.310 1.00 52.51  ? 205 PHE A CG  1 
ATOM   1363  C  CD1 . PHE A  1 184 ? 124.708 155.651 131.984 1.00 53.66  ? 205 PHE A CD1 1 
ATOM   1364  C  CD2 . PHE A  1 184 ? 124.013 155.426 134.237 1.00 51.64  ? 205 PHE A CD2 1 
ATOM   1365  C  CE1 . PHE A  1 184 ? 123.419 155.991 131.610 1.00 53.90  ? 205 PHE A CE1 1 
ATOM   1366  C  CE2 . PHE A  1 184 ? 122.730 155.789 133.875 1.00 51.86  ? 205 PHE A CE2 1 
ATOM   1367  C  CZ  . PHE A  1 184 ? 122.430 156.072 132.565 1.00 53.14  ? 205 PHE A CZ  1 
ATOM   1368  N  N   . ALA A  1 185 ? 128.533 152.264 134.341 1.00 55.06  ? 206 ALA A N   1 
ATOM   1369  C  CA  . ALA A  1 185 ? 129.764 151.453 134.214 1.00 56.93  ? 206 ALA A CA  1 
ATOM   1370  C  C   . ALA A  1 185 ? 129.500 150.251 133.292 1.00 58.56  ? 206 ALA A C   1 
ATOM   1371  O  O   . ALA A  1 185 ? 130.288 150.003 132.346 1.00 60.57  ? 206 ALA A O   1 
ATOM   1372  C  CB  . ALA A  1 185 ? 130.228 151.031 135.583 1.00 57.17  ? 206 ALA A CB  1 
ATOM   1373  N  N   . ARG A  1 186 ? 128.397 149.549 133.516 1.00 58.45  ? 207 ARG A N   1 
ATOM   1374  C  CA  . ARG A  1 186 ? 128.003 148.387 132.683 1.00 60.18  ? 207 ARG A CA  1 
ATOM   1375  C  C   . ARG A  1 186 ? 127.838 148.821 131.222 1.00 61.28  ? 207 ARG A C   1 
ATOM   1376  O  O   . ARG A  1 186 ? 128.377 148.137 130.346 1.00 63.95  ? 207 ARG A O   1 
ATOM   1377  C  CB  . ARG A  1 186 ? 126.691 147.802 133.216 1.00 59.40  ? 207 ARG A CB  1 
ATOM   1378  C  CG  . ARG A  1 186 ? 126.821 147.183 134.599 1.00 58.91  ? 207 ARG A CG  1 
ATOM   1379  C  CD  . ARG A  1 186 ? 127.794 146.028 134.616 1.00 60.60  ? 207 ARG A CD  1 
ATOM   1380  N  NE  . ARG A  1 186 ? 129.153 146.442 134.906 1.00 60.85  ? 207 ARG A NE  1 
ATOM   1381  C  CZ  . ARG A  1 186 ? 129.583 146.768 136.106 1.00 60.29  ? 207 ARG A CZ  1 
ATOM   1382  N  NH1 . ARG A  1 186 ? 128.741 146.830 137.122 1.00 59.41  ? 207 ARG A NH1 1 
ATOM   1383  N  NH2 . ARG A  1 186 ? 130.835 147.124 136.290 1.00 60.93  ? 207 ARG A NH2 1 
ATOM   1384  N  N   . ILE A  1 187 ? 127.070 149.889 130.971 1.00 60.31  ? 208 ILE A N   1 
ATOM   1385  C  CA  . ILE A  1 187 ? 126.805 150.423 129.601 1.00 61.21  ? 208 ILE A CA  1 
ATOM   1386  C  C   . ILE A  1 187 ? 128.133 150.773 128.918 1.00 62.36  ? 208 ILE A C   1 
ATOM   1387  O  O   . ILE A  1 187 ? 128.312 150.355 127.772 1.00 64.71  ? 208 ILE A O   1 
ATOM   1388  C  CB  . ILE A  1 187 ? 125.889 151.654 129.644 1.00 59.89  ? 208 ILE A CB  1 
ATOM   1389  C  CG1 . ILE A  1 187 ? 124.524 151.309 130.257 1.00 59.19  ? 208 ILE A CG1 1 
ATOM   1390  C  CG2 . ILE A  1 187 ? 125.767 152.236 128.239 1.00 61.48  ? 208 ILE A CG2 1 
ATOM   1391  C  CD1 . ILE A  1 187 ? 123.556 152.449 130.395 1.00 57.91  ? 208 ILE A CD1 1 
ATOM   1392  N  N   . MET A  1 188 ? 129.000 151.541 129.582 1.00 61.04  ? 209 MET A N   1 
ATOM   1393  C  CA  . MET A  1 188 ? 130.255 152.045 128.984 1.00 62.23  ? 209 MET A CA  1 
ATOM   1394  C  C   . MET A  1 188 ? 131.165 150.849 128.689 1.00 64.62  ? 209 MET A C   1 
ATOM   1395  O  O   . MET A  1 188 ? 131.686 150.786 127.543 1.00 66.81  ? 209 MET A O   1 
ATOM   1396  C  CB  . MET A  1 188 ? 130.986 153.043 129.888 1.00 60.52  ? 209 MET A CB  1 
ATOM   1397  C  CG  . MET A  1 188 ? 130.315 154.384 130.014 1.00 59.13  ? 209 MET A CG  1 
ATOM   1398  S  SD  . MET A  1 188 ? 129.512 155.009 128.518 1.00 60.31  ? 209 MET A SD  1 
ATOM   1399  C  CE  . MET A  1 188 ? 130.998 155.315 127.557 1.00 62.24  ? 209 MET A CE  1 
ATOM   1400  N  N   . GLU A  1 189 ? 131.312 149.913 129.635 1.00 65.06  ? 210 GLU A N   1 
ATOM   1401  C  CA  . GLU A  1 189 ? 132.096 148.656 129.409 1.00 68.02  ? 210 GLU A CA  1 
ATOM   1402  C  C   . GLU A  1 189 ? 131.590 147.899 128.171 1.00 69.85  ? 210 GLU A C   1 
ATOM   1403  O  O   . GLU A  1 189 ? 132.277 147.064 127.727 1.00 71.72  ? 210 GLU A O   1 
ATOM   1404  C  CB  . GLU A  1 189 ? 131.980 147.652 130.560 1.00 68.37  ? 210 GLU A CB  1 
ATOM   1405  C  CG  . GLU A  1 189 ? 132.838 147.936 131.777 1.00 68.07  ? 210 GLU A CG  1 
ATOM   1406  C  CD  . GLU A  1 189 ? 132.143 147.530 133.072 1.00 67.55  ? 210 GLU A CD  1 
ATOM   1407  O  OE1 . GLU A  1 189 ? 131.267 146.626 133.020 1.00 68.21  ? 210 GLU A OE1 1 
ATOM   1408  O  OE2 . GLU A  1 189 ? 132.456 148.136 134.142 1.00 67.16  ? 210 GLU A OE2 1 
ATOM   1409  N  N   . GLY A  1 190 ? 130.359 148.104 127.712 1.00 69.95  ? 211 GLY A N   1 
ATOM   1410  C  CA  . GLY A  1 190 ? 129.787 147.245 126.656 1.00 72.36  ? 211 GLY A CA  1 
ATOM   1411  C  C   . GLY A  1 190 ? 129.928 147.863 125.283 1.00 73.93  ? 211 GLY A C   1 
ATOM   1412  O  O   . GLY A  1 190 ? 129.587 147.190 124.320 1.00 76.40  ? 211 GLY A O   1 
ATOM   1413  N  N   . GLY A  1 191 ? 130.327 149.135 125.201 1.00 72.79  ? 212 GLY A N   1 
ATOM   1414  C  CA  . GLY A  1 191 ? 130.500 149.837 123.912 1.00 74.36  ? 212 GLY A CA  1 
ATOM   1415  C  C   . GLY A  1 191 ? 129.171 150.275 123.305 1.00 74.46  ? 212 GLY A C   1 
ATOM   1416  O  O   . GLY A  1 191 ? 129.113 150.411 122.062 1.00 77.36  ? 212 GLY A O   1 
ATOM   1417  N  N   . TYR A  1 192 ? 128.137 150.519 124.122 1.00 71.56  ? 213 TYR A N   1 
ATOM   1418  C  CA  . TYR A  1 192 ? 126.772 150.826 123.618 1.00 71.81  ? 213 TYR A CA  1 
ATOM   1419  C  C   . TYR A  1 192 ? 126.643 152.335 123.388 1.00 70.94  ? 213 TYR A C   1 
ATOM   1420  O  O   . TYR A  1 192 ? 125.807 152.766 122.557 1.00 72.57  ? 213 TYR A O   1 
ATOM   1421  C  CB  . TYR A  1 192 ? 125.693 150.290 124.563 1.00 69.87  ? 213 TYR A CB  1 
ATOM   1422  C  CG  . TYR A  1 192 ? 125.789 148.812 124.818 1.00 70.68  ? 213 TYR A CG  1 
ATOM   1423  C  CD1 . TYR A  1 192 ? 125.693 147.898 123.783 1.00 73.79  ? 213 TYR A CD1 1 
ATOM   1424  C  CD2 . TYR A  1 192 ? 126.006 148.327 126.095 1.00 68.67  ? 213 TYR A CD2 1 
ATOM   1425  C  CE1 . TYR A  1 192 ? 125.801 146.536 124.013 1.00 75.08  ? 213 TYR A CE1 1 
ATOM   1426  C  CE2 . TYR A  1 192 ? 126.123 146.966 126.336 1.00 69.92  ? 213 TYR A CE2 1 
ATOM   1427  C  CZ  . TYR A  1 192 ? 126.031 146.067 125.292 1.00 72.98  ? 213 TYR A CZ  1 
ATOM   1428  O  OH  . TYR A  1 192 ? 126.149 144.733 125.538 1.00 74.35  ? 213 TYR A OH  1 
ATOM   1429  N  N   . ALA A  1 193 ? 127.515 153.097 124.040 1.00 68.62  ? 214 ALA A N   1 
ATOM   1430  C  CA  . ALA A  1 193 ? 127.475 154.564 123.903 1.00 68.08  ? 214 ALA A CA  1 
ATOM   1431  C  C   . ALA A  1 193 ? 128.822 155.093 123.404 1.00 69.43  ? 214 ALA A C   1 
ATOM   1432  O  O   . ALA A  1 193 ? 129.868 154.628 123.874 1.00 68.98  ? 214 ALA A O   1 
ATOM   1433  C  CB  . ALA A  1 193 ? 127.111 155.173 125.230 1.00 65.35  ? 214 ALA A CB  1 
ATOM   1434  N  N   . ARG A  1 194 ? 128.751 156.027 122.462 1.00 70.86  ? 215 ARG A N   1 
ATOM   1435  C  CA  . ARG A  1 194 ? 129.909 156.758 121.909 1.00 71.11  ? 215 ARG A CA  1 
ATOM   1436  C  C   . ARG A  1 194 ? 130.079 157.856 122.960 1.00 67.74  ? 215 ARG A C   1 
ATOM   1437  O  O   . ARG A  1 194 ? 130.811 157.624 123.918 1.00 65.88  ? 215 ARG A O   1 
ATOM   1438  C  CB  . ARG A  1 194 ? 129.535 157.333 120.536 1.00 74.19  ? 215 ARG A CB  1 
ATOM   1439  C  CG  . ARG A  1 194 ? 130.531 158.312 119.926 1.00 75.07  ? 215 ARG A CG  1 
ATOM   1440  C  CD  . ARG A  1 194 ? 130.182 158.889 118.559 1.00 78.26  ? 215 ARG A CD  1 
ATOM   1441  N  NE  . ARG A  1 194 ? 129.232 159.987 118.528 1.00 78.17  ? 215 ARG A NE  1 
ATOM   1442  C  CZ  . ARG A  1 194 ? 128.755 160.584 117.441 1.00 81.26  ? 215 ARG A CZ  1 
ATOM   1443  N  NH1 . ARG A  1 194 ? 127.887 161.573 117.556 1.00 81.16  ? 215 ARG A NH1 1 
ATOM   1444  N  NH2 . ARG A  1 194 ? 129.152 160.217 116.238 1.00 84.69  ? 215 ARG A NH2 1 
ATOM   1445  N  N   . ARG A  1 195 ? 129.241 158.885 122.901 1.00 67.09  ? 216 ARG A N   1 
ATOM   1446  C  CA  . ARG A  1 195 ? 129.230 159.946 123.946 1.00 64.93  ? 216 ARG A CA  1 
ATOM   1447  C  C   . ARG A  1 195 ? 128.222 159.594 125.059 1.00 63.00  ? 216 ARG A C   1 
ATOM   1448  O  O   . ARG A  1 195 ? 127.164 159.003 124.754 1.00 62.98  ? 216 ARG A O   1 
ATOM   1449  C  CB  . ARG A  1 195 ? 128.928 161.322 123.332 1.00 65.88  ? 216 ARG A CB  1 
ATOM   1450  C  CG  . ARG A  1 195 ? 129.993 161.853 122.369 1.00 67.54  ? 216 ARG A CG  1 
ATOM   1451  C  CD  . ARG A  1 195 ? 129.660 163.186 121.680 1.00 68.94  ? 216 ARG A CD  1 
ATOM   1452  N  NE  . ARG A  1 195 ? 129.711 164.364 122.551 1.00 67.30  ? 216 ARG A NE  1 
ATOM   1453  C  CZ  . ARG A  1 195 ? 129.192 165.571 122.274 1.00 68.33  ? 216 ARG A CZ  1 
ATOM   1454  N  NH1 . ARG A  1 195 ? 129.264 166.545 123.169 1.00 67.17  ? 216 ARG A NH1 1 
ATOM   1455  N  NH2 . ARG A  1 195 ? 128.606 165.832 121.120 1.00 70.83  ? 216 ARG A NH2 1 
ATOM   1456  N  N   . LEU A  1 196 ? 128.578 159.947 126.306 1.00 47.76  ? 217 LEU A N   1 
ATOM   1457  C  CA  . LEU A  1 196 ? 127.714 159.968 127.524 1.00 46.05  ? 217 LEU A CA  1 
ATOM   1458  C  C   . LEU A  1 196 ? 127.875 161.327 128.204 1.00 45.22  ? 217 LEU A C   1 
ATOM   1459  O  O   . LEU A  1 196 ? 128.975 161.627 128.700 1.00 45.10  ? 217 LEU A O   1 
ATOM   1460  C  CB  . LEU A  1 196 ? 128.102 158.841 128.486 1.00 45.29  ? 217 LEU A CB  1 
ATOM   1461  C  CG  . LEU A  1 196 ? 127.416 158.839 129.851 1.00 42.94  ? 217 LEU A CG  1 
ATOM   1462  C  CD1 . LEU A  1 196 ? 125.935 158.575 129.748 1.00 42.51  ? 217 LEU A CD1 1 
ATOM   1463  C  CD2 . LEU A  1 196 ? 128.018 157.794 130.749 1.00 42.92  ? 217 LEU A CD2 1 
ATOM   1464  N  N   . LEU A  1 197 ? 126.815 162.120 128.175 1.00 45.10  ? 218 LEU A N   1 
ATOM   1465  C  CA  . LEU A  1 197 ? 126.729 163.414 128.885 1.00 44.65  ? 218 LEU A CA  1 
ATOM   1466  C  C   . LEU A  1 197 ? 125.939 163.220 130.174 1.00 42.46  ? 218 LEU A C   1 
ATOM   1467  O  O   . LEU A  1 197 ? 124.789 162.800 130.069 1.00 42.39  ? 218 LEU A O   1 
ATOM   1468  C  CB  . LEU A  1 197 ? 126.064 164.456 127.979 1.00 46.25  ? 218 LEU A CB  1 
ATOM   1469  C  CG  . LEU A  1 197 ? 126.992 165.100 126.946 1.00 48.87  ? 218 LEU A CG  1 
ATOM   1470  C  CD1 . LEU A  1 197 ? 127.506 164.077 125.952 1.00 51.03  ? 218 LEU A CD1 1 
ATOM   1471  C  CD2 . LEU A  1 197 ? 126.322 166.261 126.213 1.00 50.17  ? 218 LEU A CD2 1 
ATOM   1472  N  N   . GLN A  1 198 ? 126.567 163.490 131.320 1.00 41.43  ? 219 GLN A N   1 
ATOM   1473  C  CA  . GLN A  1 198 ? 125.932 163.421 132.653 1.00 39.61  ? 219 GLN A CA  1 
ATOM   1474  C  C   . GLN A  1 198 ? 125.654 164.864 133.070 1.00 39.38  ? 219 GLN A C   1 
ATOM   1475  O  O   . GLN A  1 198 ? 126.576 165.682 133.168 1.00 40.34  ? 219 GLN A O   1 
ATOM   1476  C  CB  . GLN A  1 198 ? 126.805 162.611 133.605 1.00 39.20  ? 219 GLN A CB  1 
ATOM   1477  C  CG  . GLN A  1 198 ? 127.145 161.247 133.020 1.00 40.62  ? 219 GLN A CG  1 
ATOM   1478  C  CD  . GLN A  1 198 ? 127.716 160.293 134.028 1.00 40.11  ? 219 GLN A CD  1 
ATOM   1479  O  OE1 . GLN A  1 198 ? 128.715 160.585 134.673 1.00 39.66  ? 219 GLN A OE1 1 
ATOM   1480  N  NE2 . GLN A  1 198 ? 127.046 159.157 134.177 1.00 40.32  ? 219 GLN A NE2 1 
ATOM   1481  N  N   . VAL A  1 199 ? 124.382 165.164 133.253 1.00 38.42  ? 220 VAL A N   1 
ATOM   1482  C  CA  . VAL A  1 199 ? 123.899 166.534 133.479 1.00 37.61  ? 220 VAL A CA  1 
ATOM   1483  C  C   . VAL A  1 199 ? 123.082 166.524 134.753 1.00 36.13  ? 220 VAL A C   1 
ATOM   1484  O  O   . VAL A  1 199 ? 122.268 165.619 134.942 1.00 35.64  ? 220 VAL A O   1 
ATOM   1485  C  CB  . VAL A  1 199 ? 123.130 166.990 132.247 1.00 38.65  ? 220 VAL A CB  1 
ATOM   1486  C  CG1 . VAL A  1 199 ? 122.592 168.387 132.425 1.00 38.43  ? 220 VAL A CG1 1 
ATOM   1487  C  CG2 . VAL A  1 199 ? 124.036 166.878 131.033 1.00 40.48  ? 220 VAL A CG2 1 
ATOM   1488  N  N   . GLY A  1 200 ? 123.396 167.491 135.608 1.00 36.10  ? 221 GLY A N   1 
ATOM   1489  C  CA  . GLY A  1 200 ? 122.821 167.692 136.940 1.00 34.47  ? 221 GLY A CA  1 
ATOM   1490  C  C   . GLY A  1 200 ? 123.635 167.043 138.046 1.00 33.78  ? 221 GLY A C   1 
ATOM   1491  O  O   . GLY A  1 200 ? 123.115 167.011 139.162 1.00 33.25  ? 221 GLY A O   1 
ATOM   1492  N  N   . ILE A  1 201 ? 124.859 166.568 137.788 1.00 34.99  ? 222 ILE A N   1 
ATOM   1493  C  CA  . ILE A  1 201 ? 125.666 165.833 138.804 1.00 34.66  ? 222 ILE A CA  1 
ATOM   1494  C  C   . ILE A  1 201 ? 125.967 166.779 139.974 1.00 34.15  ? 222 ILE A C   1 
ATOM   1495  O  O   . ILE A  1 201 ? 126.374 167.948 139.735 1.00 34.74  ? 222 ILE A O   1 
ATOM   1496  C  CB  . ILE A  1 201 ? 126.948 165.246 138.210 1.00 36.79  ? 222 ILE A CB  1 
ATOM   1497  C  CG1 . ILE A  1 201 ? 126.654 164.299 137.046 1.00 37.63  ? 222 ILE A CG1 1 
ATOM   1498  C  CG2 . ILE A  1 201 ? 127.775 164.559 139.299 1.00 37.03  ? 222 ILE A CG2 1 
ATOM   1499  C  CD1 . ILE A  1 201 ? 125.848 163.080 137.444 1.00 36.88  ? 222 ILE A CD1 1 
ATOM   1500  N  N   . ARG A  1 202 ? 125.753 166.306 141.201 1.00 32.70  ? 223 ARG A N   1 
ATOM   1501  C  CA  . ARG A  1 202 ? 126.122 167.082 142.407 1.00 32.77  ? 223 ARG A CA  1 
ATOM   1502  C  C   . ARG A  1 202 ? 126.425 166.162 143.597 1.00 32.18  ? 223 ARG A C   1 
ATOM   1503  O  O   . ARG A  1 202 ? 126.584 166.677 144.680 1.00 32.34  ? 223 ARG A O   1 
ATOM   1504  C  CB  . ARG A  1 202 ? 124.968 168.042 142.699 1.00 32.38  ? 223 ARG A CB  1 
ATOM   1505  C  CG  . ARG A  1 202 ? 123.620 167.343 142.899 1.00 31.79  ? 223 ARG A CG  1 
ATOM   1506  C  CD  . ARG A  1 202 ? 122.493 168.328 142.797 1.00 31.51  ? 223 ARG A CD  1 
ATOM   1507  N  NE  . ARG A  1 202 ? 121.141 167.844 143.042 1.00 30.37  ? 223 ARG A NE  1 
ATOM   1508  C  CZ  . ARG A  1 202 ? 120.319 167.386 142.112 1.00 30.49  ? 223 ARG A CZ  1 
ATOM   1509  N  NH1 . ARG A  1 202 ? 120.704 167.253 140.847 1.00 31.60  ? 223 ARG A NH1 1 
ATOM   1510  N  NH2 . ARG A  1 202 ? 119.111 167.027 142.474 1.00 29.38  ? 223 ARG A NH2 1 
ATOM   1511  N  N   . SER A  1 203 ? 126.482 164.848 143.396 1.00 32.78  ? 224 SER A N   1 
ATOM   1512  C  CA  . SER A  1 203 ? 126.871 163.803 144.380 1.00 33.01  ? 224 SER A CA  1 
ATOM   1513  C  C   . SER A  1 203 ? 127.752 162.816 143.649 1.00 33.80  ? 224 SER A C   1 
ATOM   1514  O  O   . SER A  1 203 ? 127.203 161.970 142.964 1.00 33.96  ? 224 SER A O   1 
ATOM   1515  C  CB  . SER A  1 203 ? 125.659 163.090 144.973 1.00 32.59  ? 224 SER A CB  1 
ATOM   1516  O  OG  . SER A  1 203 ? 126.068 162.098 145.892 1.00 33.66  ? 224 SER A OG  1 
ATOM   1517  N  N   . ILE A  1 204 ? 129.047 163.016 143.743 1.00 34.99  ? 225 ILE A N   1 
ATOM   1518  C  CA  . ILE A  1 204 ? 130.109 162.284 143.002 1.00 37.11  ? 225 ILE A CA  1 
ATOM   1519  C  C   . ILE A  1 204 ? 131.331 162.258 143.922 1.00 37.69  ? 225 ILE A C   1 
ATOM   1520  O  O   . ILE A  1 204 ? 131.566 163.255 144.622 1.00 36.35  ? 225 ILE A O   1 
ATOM   1521  C  CB  . ILE A  1 204 ? 130.402 162.944 141.622 1.00 38.58  ? 225 ILE A CB  1 
ATOM   1522  C  CG1 . ILE A  1 204 ? 131.469 162.210 140.810 1.00 40.77  ? 225 ILE A CG1 1 
ATOM   1523  C  CG2 . ILE A  1 204 ? 130.797 164.419 141.735 1.00 39.25  ? 225 ILE A CG2 1 
ATOM   1524  C  CD1 . ILE A  1 204 ? 131.541 162.656 139.347 1.00 41.50  ? 225 ILE A CD1 1 
ATOM   1525  N  N   . ASN A  1 205 ? 132.060 161.145 143.929 1.00 39.44  ? 226 ASN A N   1 
ATOM   1526  C  CA  . ASN A  1 205 ? 133.283 160.969 144.749 1.00 41.71  ? 226 ASN A CA  1 
ATOM   1527  C  C   . ASN A  1 205 ? 134.466 160.711 143.811 1.00 44.12  ? 226 ASN A C   1 
ATOM   1528  O  O   . ASN A  1 205 ? 134.302 160.817 142.575 1.00 44.06  ? 226 ASN A O   1 
ATOM   1529  C  CB  . ASN A  1 205 ? 133.077 159.881 145.817 1.00 42.60  ? 226 ASN A CB  1 
ATOM   1530  C  CG  . ASN A  1 205 ? 132.904 158.451 145.318 1.00 42.81  ? 226 ASN A CG  1 
ATOM   1531  O  OD1 . ASN A  1 205 ? 132.820 158.184 144.121 1.00 42.59  ? 226 ASN A OD1 1 
ATOM   1532  N  ND2 . ASN A  1 205 ? 132.797 157.525 146.257 1.00 43.45  ? 226 ASN A ND2 1 
ATOM   1533  N  N   . GLN A  1 206 ? 135.622 160.385 144.381 1.00 47.00  ? 227 GLN A N   1 
ATOM   1534  C  CA  . GLN A  1 206 ? 136.839 160.092 143.602 1.00 50.07  ? 227 GLN A CA  1 
ATOM   1535  C  C   . GLN A  1 206 ? 136.553 158.990 142.569 1.00 49.51  ? 227 GLN A C   1 
ATOM   1536  O  O   . GLN A  1 206 ? 136.883 159.221 141.415 1.00 50.04  ? 227 GLN A O   1 
ATOM   1537  C  CB  . GLN A  1 206 ? 137.996 159.750 144.529 1.00 53.61  ? 227 GLN A CB  1 
ATOM   1538  C  CG  . GLN A  1 206 ? 139.283 159.542 143.755 1.00 57.88  ? 227 GLN A CG  1 
ATOM   1539  C  CD  . GLN A  1 206 ? 140.460 159.270 144.658 1.00 62.40  ? 227 GLN A CD  1 
ATOM   1540  O  OE1 . GLN A  1 206 ? 140.843 160.105 145.481 1.00 66.15  ? 227 GLN A OE1 1 
ATOM   1541  N  NE2 . GLN A  1 206 ? 141.055 158.100 144.504 1.00 64.25  ? 227 GLN A NE2 1 
ATOM   1542  N  N   . GLU A  1 207 ? 135.975 157.851 142.965 1.00 48.88  ? 228 GLU A N   1 
ATOM   1543  C  CA  . GLU A  1 207 ? 135.664 156.720 142.042 1.00 49.31  ? 228 GLU A CA  1 
ATOM   1544  C  C   . GLU A  1 207 ? 134.784 157.224 140.883 1.00 48.07  ? 228 GLU A C   1 
ATOM   1545  O  O   . GLU A  1 207 ? 135.076 156.866 139.735 1.00 49.69  ? 228 GLU A O   1 
ATOM   1546  C  CB  . GLU A  1 207 ? 135.011 155.544 142.776 1.00 49.40  ? 228 GLU A CB  1 
ATOM   1547  C  CG  . GLU A  1 207 ? 134.794 154.336 141.879 1.00 50.86  ? 228 GLU A CG  1 
ATOM   1548  C  CD  . GLU A  1 207 ? 134.353 153.042 142.546 1.00 52.07  ? 228 GLU A CD  1 
ATOM   1549  O  OE1 . GLU A  1 207 ? 134.142 153.055 143.776 1.00 53.56  ? 228 GLU A OE1 1 
ATOM   1550  O  OE2 . GLU A  1 207 ? 134.164 152.034 141.829 1.00 52.69  ? 228 GLU A OE2 1 
ATOM   1551  N  N   . GLY A  1 208 ? 133.745 158.020 141.165 1.00 45.65  ? 229 GLY A N   1 
ATOM   1552  C  CA  . GLY A  1 208 ? 132.901 158.691 140.159 1.00 44.28  ? 229 GLY A CA  1 
ATOM   1553  C  C   . GLY A  1 208 ? 133.707 159.479 139.127 1.00 45.43  ? 229 GLY A C   1 
ATOM   1554  O  O   . GLY A  1 208 ? 133.389 159.381 137.924 1.00 44.45  ? 229 GLY A O   1 
ATOM   1555  N  N   . ARG A  1 209 ? 134.700 160.260 139.559 1.00 46.61  ? 230 ARG A N   1 
ATOM   1556  C  CA  . ARG A  1 209 ? 135.508 161.100 138.637 1.00 48.38  ? 230 ARG A CA  1 
ATOM   1557  C  C   . ARG A  1 209 ? 136.465 160.189 137.847 1.00 50.13  ? 230 ARG A C   1 
ATOM   1558  O  O   . ARG A  1 209 ? 136.542 160.330 136.621 1.00 50.42  ? 230 ARG A O   1 
ATOM   1559  C  CB  . ARG A  1 209 ? 136.214 162.216 139.419 1.00 49.76  ? 230 ARG A CB  1 
ATOM   1560  C  CG  . ARG A  1 209 ? 135.260 163.179 140.114 1.00 49.18  ? 230 ARG A CG  1 
ATOM   1561  C  CD  . ARG A  1 209 ? 135.739 164.626 140.126 1.00 50.91  ? 230 ARG A CD  1 
ATOM   1562  N  NE  . ARG A  1 209 ? 134.723 165.605 140.564 1.00 48.47  ? 230 ARG A NE  1 
ATOM   1563  C  CZ  . ARG A  1 209 ? 134.434 165.804 141.840 1.00 49.37  ? 230 ARG A CZ  1 
ATOM   1564  N  NH1 . ARG A  1 209 ? 135.049 165.073 142.772 1.00 51.29  ? 230 ARG A NH1 1 
ATOM   1565  N  NH2 . ARG A  1 209 ? 133.513 166.688 142.197 1.00 47.02  ? 230 ARG A NH2 1 
ATOM   1566  N  N   . GLU A  1 210 ? 137.146 159.256 138.507 1.00 51.53  ? 231 GLU A N   1 
ATOM   1567  C  CA  . GLU A  1 210 ? 138.105 158.333 137.847 1.00 54.44  ? 231 GLU A CA  1 
ATOM   1568  C  C   . GLU A  1 210 ? 137.366 157.477 136.807 1.00 53.36  ? 231 GLU A C   1 
ATOM   1569  O  O   . GLU A  1 210 ? 137.835 157.376 135.683 1.00 54.43  ? 231 GLU A O   1 
ATOM   1570  C  CB  . GLU A  1 210 ? 138.798 157.410 138.851 1.00 57.41  ? 231 GLU A CB  1 
ATOM   1571  C  CG  . GLU A  1 210 ? 139.704 158.133 139.835 1.00 59.96  ? 231 GLU A CG  1 
ATOM   1572  C  CD  . GLU A  1 210 ? 140.172 157.313 141.039 1.00 62.82  ? 231 GLU A CD  1 
ATOM   1573  O  OE1 . GLU A  1 210 ? 139.543 156.237 141.320 1.00 64.29  ? 231 GLU A OE1 1 
ATOM   1574  O  OE2 . GLU A  1 210 ? 141.141 157.759 141.724 1.00 63.95  ? 231 GLU A OE2 1 
ATOM   1575  N  N   . GLN A  1 211 ? 136.260 156.844 137.177 1.00 50.61  ? 232 GLN A N   1 
ATOM   1576  C  CA  . GLN A  1 211 ? 135.483 156.035 136.209 1.00 50.44  ? 232 GLN A CA  1 
ATOM   1577  C  C   . GLN A  1 211 ? 135.111 156.913 135.007 1.00 49.95  ? 232 GLN A C   1 
ATOM   1578  O  O   . GLN A  1 211 ? 135.207 156.430 133.878 1.00 50.67  ? 232 GLN A O   1 
ATOM   1579  C  CB  . GLN A  1 211 ? 134.255 155.417 136.893 1.00 48.31  ? 232 GLN A CB  1 
ATOM   1580  C  CG  . GLN A  1 211 ? 134.616 154.261 137.821 1.00 48.92  ? 232 GLN A CG  1 
ATOM   1581  C  CD  . GLN A  1 211 ? 134.804 152.961 137.076 1.00 50.48  ? 232 GLN A CD  1 
ATOM   1582  O  OE1 . GLN A  1 211 ? 135.859 152.670 136.479 1.00 51.12  ? 232 GLN A OE1 1 
ATOM   1583  N  NE2 . GLN A  1 211 ? 133.732 152.184 137.099 1.00 49.85  ? 232 GLN A NE2 1 
ATOM   1584  N  N   . GLY A  1 212 ? 134.633 158.130 135.269 1.00 48.83  ? 233 GLY A N   1 
ATOM   1585  C  CA  . GLY A  1 212 ? 134.295 159.121 134.234 1.00 49.20  ? 233 GLY A CA  1 
ATOM   1586  C  C   . GLY A  1 212 ? 135.468 159.346 133.292 1.00 51.72  ? 233 GLY A C   1 
ATOM   1587  O  O   . GLY A  1 212 ? 135.249 159.299 132.048 1.00 52.38  ? 233 GLY A O   1 
ATOM   1588  N  N   . LYS A  1 213 ? 136.654 159.610 133.848 1.00 53.14  ? 234 LYS A N   1 
ATOM   1589  C  CA  . LYS A  1 213 ? 137.867 159.903 133.039 1.00 57.12  ? 234 LYS A CA  1 
ATOM   1590  C  C   . LYS A  1 213 ? 138.196 158.649 132.197 1.00 57.63  ? 234 LYS A C   1 
ATOM   1591  O  O   . LYS A  1 213 ? 138.588 158.812 131.002 1.00 59.46  ? 234 LYS A O   1 
ATOM   1592  C  CB  . LYS A  1 213 ? 139.014 160.445 133.920 1.00 59.90  ? 234 LYS A CB  1 
ATOM   1593  C  CG  . LYS A  1 213 ? 140.414 159.997 133.488 1.00 65.44  ? 234 LYS A CG  1 
ATOM   1594  C  CD  . LYS A  1 213 ? 141.650 160.781 134.039 1.00 69.41  ? 234 LYS A CD  1 
ATOM   1595  C  CE  . LYS A  1 213 ? 141.965 160.540 135.514 1.00 70.72  ? 234 LYS A CE  1 
ATOM   1596  N  NZ  . LYS A  1 213 ? 140.916 161.063 136.446 1.00 69.44  ? 234 LYS A NZ  1 
ATOM   1597  N  N   . ARG A  1 214 ? 138.024 157.460 132.782 1.00 56.25  ? 235 ARG A N   1 
ATOM   1598  C  CA  . ARG A  1 214 ? 138.346 156.131 132.193 1.00 57.55  ? 235 ARG A CA  1 
ATOM   1599  C  C   . ARG A  1 214 ? 137.425 155.812 131.009 1.00 57.34  ? 235 ARG A C   1 
ATOM   1600  O  O   . ARG A  1 214 ? 137.851 155.125 130.089 1.00 59.19  ? 235 ARG A O   1 
ATOM   1601  C  CB  . ARG A  1 214 ? 138.217 155.035 133.255 1.00 57.10  ? 235 ARG A CB  1 
ATOM   1602  C  CG  . ARG A  1 214 ? 138.373 153.616 132.731 1.00 58.87  ? 235 ARG A CG  1 
ATOM   1603  C  CD  . ARG A  1 214 ? 138.098 152.568 133.783 1.00 58.95  ? 235 ARG A CD  1 
ATOM   1604  N  NE  . ARG A  1 214 ? 137.838 151.263 133.182 1.00 60.99  ? 235 ARG A NE  1 
ATOM   1605  C  CZ  . ARG A  1 214 ? 137.046 150.308 133.673 1.00 60.92  ? 235 ARG A CZ  1 
ATOM   1606  N  NH1 . ARG A  1 214 ? 136.376 150.481 134.798 1.00 59.12  ? 235 ARG A NH1 1 
ATOM   1607  N  NH2 . ARG A  1 214 ? 136.920 149.167 133.020 1.00 63.04  ? 235 ARG A NH2 1 
ATOM   1608  N  N   . PHE A  1 215 ? 136.187 156.253 131.018 1.00 55.23  ? 236 PHE A N   1 
ATOM   1609  C  CA  . PHE A  1 215 ? 135.231 155.885 129.944 1.00 55.91  ? 236 PHE A CA  1 
ATOM   1610  C  C   . PHE A  1 215 ? 135.009 157.053 128.972 1.00 55.79  ? 236 PHE A C   1 
ATOM   1611  O  O   . PHE A  1 215 ? 134.235 156.848 128.036 1.00 57.18  ? 236 PHE A O   1 
ATOM   1612  C  CB  . PHE A  1 215 ? 133.928 155.373 130.575 1.00 54.22  ? 236 PHE A CB  1 
ATOM   1613  C  CG  . PHE A  1 215 ? 134.049 154.008 131.215 1.00 54.93  ? 236 PHE A CG  1 
ATOM   1614  C  CD1 . PHE A  1 215 ? 134.543 152.921 130.492 1.00 57.22  ? 236 PHE A CD1 1 
ATOM   1615  C  CD2 . PHE A  1 215 ? 133.658 153.799 132.535 1.00 53.40  ? 236 PHE A CD2 1 
ATOM   1616  C  CE1 . PHE A  1 215 ? 134.647 151.665 131.072 1.00 58.06  ? 236 PHE A CE1 1 
ATOM   1617  C  CE2 . PHE A  1 215 ? 133.751 152.534 133.106 1.00 54.57  ? 236 PHE A CE2 1 
ATOM   1618  C  CZ  . PHE A  1 215 ? 134.253 151.472 132.377 1.00 56.70  ? 236 PHE A CZ  1 
ATOM   1619  N  N   . GLY A  1 216 ? 135.665 158.203 129.166 1.00 55.15  ? 237 GLY A N   1 
ATOM   1620  C  CA  . GLY A  1 216 ? 135.525 159.378 128.286 1.00 55.17  ? 237 GLY A CA  1 
ATOM   1621  C  C   . GLY A  1 216 ? 134.192 160.058 128.527 1.00 52.54  ? 237 GLY A C   1 
ATOM   1622  O  O   . GLY A  1 216 ? 133.635 160.691 127.643 1.00 52.32  ? 237 GLY A O   1 
ATOM   1623  N  N   . VAL A  1 217 ? 133.679 159.943 129.726 1.00 50.90  ? 238 VAL A N   1 
ATOM   1624  C  CA  . VAL A  1 217 ? 132.327 160.480 130.062 1.00 48.99  ? 238 VAL A CA  1 
ATOM   1625  C  C   . VAL A  1 217 ? 132.423 161.986 130.267 1.00 48.81  ? 238 VAL A C   1 
ATOM   1626  O  O   . VAL A  1 217 ? 133.387 162.432 130.984 1.00 48.43  ? 238 VAL A O   1 
ATOM   1627  C  CB  . VAL A  1 217 ? 131.788 159.837 131.333 1.00 47.07  ? 238 VAL A CB  1 
ATOM   1628  C  CG1 . VAL A  1 217 ? 130.426 160.396 131.647 1.00 45.72  ? 238 VAL A CG1 1 
ATOM   1629  C  CG2 . VAL A  1 217 ? 131.759 158.338 131.204 1.00 48.13  ? 238 VAL A CG2 1 
ATOM   1630  N  N   . GLU A  1 218 ? 131.437 162.722 129.736 1.00 48.80  ? 239 GLU A N   1 
ATOM   1631  C  CA  . GLU A  1 218 ? 131.381 164.204 129.866 1.00 48.97  ? 239 GLU A CA  1 
ATOM   1632  C  C   . GLU A  1 218 ? 130.481 164.518 131.064 1.00 46.31  ? 239 GLU A C   1 
ATOM   1633  O  O   . GLU A  1 218 ? 129.273 164.446 130.921 1.00 45.89  ? 239 GLU A O   1 
ATOM   1634  C  CB  . GLU A  1 218 ? 130.920 164.859 128.562 1.00 50.66  ? 239 GLU A CB  1 
ATOM   1635  C  CG  . GLU A  1 218 ? 131.851 164.606 127.367 1.00 53.56  ? 239 GLU A CG  1 
ATOM   1636  C  CD  . GLU A  1 218 ? 131.152 164.915 126.050 1.00 55.32  ? 239 GLU A CD  1 
ATOM   1637  O  OE1 . GLU A  1 218 ? 130.515 165.988 125.986 1.00 55.70  ? 239 GLU A OE1 1 
ATOM   1638  O  OE2 . GLU A  1 218 ? 131.167 164.059 125.134 1.00 57.07  ? 239 GLU A OE2 1 
ATOM   1639  N  N   . GLN A  1 219 ? 131.081 164.859 132.198 1.00 45.45  ? 240 GLN A N   1 
ATOM   1640  C  CA  . GLN A  1 219 ? 130.403 165.028 133.507 1.00 43.69  ? 240 GLN A CA  1 
ATOM   1641  C  C   . GLN A  1 219 ? 130.154 166.521 133.781 1.00 43.39  ? 240 GLN A C   1 
ATOM   1642  O  O   . GLN A  1 219 ? 131.130 167.205 134.144 1.00 43.83  ? 240 GLN A O   1 
ATOM   1643  C  CB  . GLN A  1 219 ? 131.258 164.320 134.573 1.00 43.43  ? 240 GLN A CB  1 
ATOM   1644  C  CG  . GLN A  1 219 ? 131.210 162.791 134.457 1.00 43.47  ? 240 GLN A CG  1 
ATOM   1645  C  CD  . GLN A  1 219 ? 131.805 162.038 135.629 1.00 42.90  ? 240 GLN A CD  1 
ATOM   1646  O  OE1 . GLN A  1 219 ? 132.795 162.454 136.222 1.00 43.13  ? 240 GLN A OE1 1 
ATOM   1647  N  NE2 . GLN A  1 219 ? 131.203 160.905 135.965 1.00 41.82  ? 240 GLN A NE2 1 
ATOM   1648  N  N   . TYR A  1 220 ? 128.898 166.988 133.627 1.00 42.66  ? 241 TYR A N   1 
ATOM   1649  C  CA  . TYR A  1 220 ? 128.433 168.376 133.921 1.00 42.85  ? 241 TYR A CA  1 
ATOM   1650  C  C   . TYR A  1 220 ? 127.935 168.435 135.382 1.00 40.24  ? 241 TYR A C   1 
ATOM   1651  O  O   . TYR A  1 220 ? 126.906 167.906 135.761 1.00 38.16  ? 241 TYR A O   1 
ATOM   1652  C  CB  . TYR A  1 220 ? 127.415 168.860 132.869 1.00 44.46  ? 241 TYR A CB  1 
ATOM   1653  C  CG  . TYR A  1 220 ? 128.030 168.978 131.497 1.00 48.69  ? 241 TYR A CG  1 
ATOM   1654  C  CD1 . TYR A  1 220 ? 128.224 167.865 130.690 1.00 50.04  ? 241 TYR A CD1 1 
ATOM   1655  C  CD2 . TYR A  1 220 ? 128.580 170.174 131.068 1.00 51.32  ? 241 TYR A CD2 1 
ATOM   1656  C  CE1 . TYR A  1 220 ? 128.886 167.945 129.472 1.00 52.93  ? 241 TYR A CE1 1 
ATOM   1657  C  CE2 . TYR A  1 220 ? 129.220 170.276 129.847 1.00 54.78  ? 241 TYR A CE2 1 
ATOM   1658  C  CZ  . TYR A  1 220 ? 129.390 169.157 129.040 1.00 55.80  ? 241 TYR A CZ  1 
ATOM   1659  O  OH  . TYR A  1 220 ? 130.064 169.277 127.841 1.00 60.64  ? 241 TYR A OH  1 
ATOM   1660  N  N   . GLU A  1 221 ? 128.727 169.069 136.224 1.00 40.22  ? 242 GLU A N   1 
ATOM   1661  C  CA  . GLU A  1 221 ? 128.427 169.266 137.657 1.00 38.90  ? 242 GLU A CA  1 
ATOM   1662  C  C   . GLU A  1 221 ? 127.628 170.557 137.849 1.00 38.25  ? 242 GLU A C   1 
ATOM   1663  O  O   . GLU A  1 221 ? 127.967 171.593 137.242 1.00 39.65  ? 242 GLU A O   1 
ATOM   1664  C  CB  . GLU A  1 221 ? 129.729 169.277 138.457 1.00 39.42  ? 242 GLU A CB  1 
ATOM   1665  C  CG  . GLU A  1 221 ? 130.467 167.953 138.375 1.00 40.32  ? 242 GLU A CG  1 
ATOM   1666  C  CD  . GLU A  1 221 ? 131.752 167.940 139.175 1.00 41.54  ? 242 GLU A CD  1 
ATOM   1667  O  OE1 . GLU A  1 221 ? 131.698 168.270 140.380 1.00 41.00  ? 242 GLU A OE1 1 
ATOM   1668  O  OE2 . GLU A  1 221 ? 132.818 167.667 138.572 1.00 44.70  ? 242 GLU A OE2 1 
ATOM   1669  N  N   . MET A  1 222 ? 126.651 170.520 138.741 1.00 36.16  ? 243 MET A N   1 
ATOM   1670  C  CA  . MET A  1 222 ? 125.843 171.720 139.032 1.00 36.05  ? 243 MET A CA  1 
ATOM   1671  C  C   . MET A  1 222 ? 126.722 172.892 139.482 1.00 36.84  ? 243 MET A C   1 
ATOM   1672  O  O   . MET A  1 222 ? 126.325 174.030 139.169 1.00 37.38  ? 243 MET A O   1 
ATOM   1673  C  CB  . MET A  1 222 ? 124.764 171.413 140.062 1.00 34.49  ? 243 MET A CB  1 
ATOM   1674  C  CG  . MET A  1 222 ? 123.689 170.518 139.470 1.00 33.95  ? 243 MET A CG  1 
ATOM   1675  S  SD  . MET A  1 222 ? 122.750 171.187 138.056 1.00 35.45  ? 243 MET A SD  1 
ATOM   1676  C  CE  . MET A  1 222 ? 122.126 172.720 138.758 1.00 35.85  ? 243 MET A CE  1 
ATOM   1677  N  N   . ARG A  1 223 ? 127.885 172.658 140.087 1.00 36.83  ? 244 ARG A N   1 
ATOM   1678  C  CA  . ARG A  1 223 ? 128.717 173.782 140.583 1.00 38.91  ? 244 ARG A CA  1 
ATOM   1679  C  C   . ARG A  1 223 ? 129.252 174.637 139.407 1.00 40.35  ? 244 ARG A C   1 
ATOM   1680  O  O   . ARG A  1 223 ? 129.736 175.758 139.688 1.00 40.03  ? 244 ARG A O   1 
ATOM   1681  C  CB  . ARG A  1 223 ? 129.831 173.294 141.528 1.00 40.23  ? 244 ARG A CB  1 
ATOM   1682  C  CG  . ARG A  1 223 ? 130.835 172.357 140.876 1.00 42.67  ? 244 ARG A CG  1 
ATOM   1683  C  CD  . ARG A  1 223 ? 131.755 171.719 141.893 1.00 44.21  ? 244 ARG A CD  1 
ATOM   1684  N  NE  . ARG A  1 223 ? 132.527 170.699 141.214 1.00 45.34  ? 244 ARG A NE  1 
ATOM   1685  C  CZ  . ARG A  1 223 ? 133.715 170.871 140.675 1.00 47.90  ? 244 ARG A CZ  1 
ATOM   1686  N  NH1 . ARG A  1 223 ? 134.313 172.043 140.761 1.00 50.38  ? 244 ARG A NH1 1 
ATOM   1687  N  NH2 . ARG A  1 223 ? 134.292 169.872 140.021 1.00 49.39  ? 244 ARG A NH2 1 
ATOM   1688  N  N   . THR A  1 224 ? 129.178 174.156 138.145 1.00 40.85  ? 245 THR A N   1 
ATOM   1689  C  CA  . THR A  1 224 ? 129.555 174.952 136.931 1.00 43.08  ? 245 THR A CA  1 
ATOM   1690  C  C   . THR A  1 224 ? 128.323 175.172 136.048 1.00 43.98  ? 245 THR A C   1 
ATOM   1691  O  O   . THR A  1 224 ? 128.485 175.518 134.888 1.00 46.03  ? 245 THR A O   1 
ATOM   1692  C  CB  . THR A  1 224 ? 130.709 174.331 136.120 1.00 44.02  ? 245 THR A CB  1 
ATOM   1693  O  OG1 . THR A  1 224 ? 130.335 173.087 135.499 1.00 42.91  ? 245 THR A OG1 1 
ATOM   1694  C  CG2 . THR A  1 224 ? 131.957 174.141 136.954 1.00 43.94  ? 245 THR A CG2 1 
ATOM   1695  N  N   . PHE A  1 225 ? 127.112 175.026 136.570 1.00 43.81  ? 246 PHE A N   1 
ATOM   1696  C  CA  . PHE A  1 225 ? 125.899 175.059 135.716 1.00 45.20  ? 246 PHE A CA  1 
ATOM   1697  C  C   . PHE A  1 225 ? 125.675 176.480 135.199 1.00 48.05  ? 246 PHE A C   1 
ATOM   1698  O  O   . PHE A  1 225 ? 125.167 176.602 134.075 1.00 49.23  ? 246 PHE A O   1 
ATOM   1699  C  CB  . PHE A  1 225 ? 124.656 174.521 136.425 1.00 43.16  ? 246 PHE A CB  1 
ATOM   1700  C  CG  . PHE A  1 225 ? 123.438 174.469 135.530 1.00 43.85  ? 246 PHE A CG  1 
ATOM   1701  C  CD1 . PHE A  1 225 ? 123.425 173.670 134.380 1.00 44.44  ? 246 PHE A CD1 1 
ATOM   1702  C  CD2 . PHE A  1 225 ? 122.315 175.240 135.809 1.00 43.73  ? 246 PHE A CD2 1 
ATOM   1703  C  CE1 . PHE A  1 225 ? 122.306 173.597 133.564 1.00 44.62  ? 246 PHE A CE1 1 
ATOM   1704  C  CE2 . PHE A  1 225 ? 121.196 175.161 134.991 1.00 44.38  ? 246 PHE A CE2 1 
ATOM   1705  C  CZ  . PHE A  1 225 ? 121.192 174.339 133.880 1.00 44.69  ? 246 PHE A CZ  1 
ATOM   1706  N  N   . SER A  1 226 ? 126.041 177.494 135.987 1.00 50.31  ? 247 SER A N   1 
ATOM   1707  C  CA  . SER A  1 226 ? 125.985 178.928 135.594 1.00 54.02  ? 247 SER A CA  1 
ATOM   1708  C  C   . SER A  1 226 ? 126.697 179.106 134.252 1.00 56.62  ? 247 SER A C   1 
ATOM   1709  O  O   . SER A  1 226 ? 126.134 179.691 133.338 1.00 58.20  ? 247 SER A O   1 
ATOM   1710  C  CB  . SER A  1 226 ? 126.606 179.824 136.643 1.00 56.21  ? 247 SER A CB  1 
ATOM   1711  O  OG  . SER A  1 226 ? 125.718 179.981 137.754 1.00 55.91  ? 247 SER A OG  1 
ATOM   1712  N  N   . LYS A  1 227 ? 127.896 178.567 134.134 1.00 57.11  ? 248 LYS A N   1 
ATOM   1713  C  CA  . LYS A  1 227 ? 128.721 178.745 132.922 1.00 59.16  ? 248 LYS A CA  1 
ATOM   1714  C  C   . LYS A  1 227 ? 128.279 177.755 131.815 1.00 56.60  ? 248 LYS A C   1 
ATOM   1715  O  O   . LYS A  1 227 ? 128.360 178.142 130.632 1.00 59.94  ? 248 LYS A O   1 
ATOM   1716  C  CB  . LYS A  1 227 ? 130.192 178.733 133.361 1.00 62.41  ? 248 LYS A CB  1 
ATOM   1717  C  CG  . LYS A  1 227 ? 131.023 177.526 132.935 1.00 64.96  ? 248 LYS A CG  1 
ATOM   1718  C  CD  . LYS A  1 227 ? 132.303 177.908 132.211 1.00 70.26  ? 248 LYS A CD  1 
ATOM   1719  C  CE  . LYS A  1 227 ? 133.468 176.974 132.505 1.00 71.77  ? 248 LYS A CE  1 
ATOM   1720  N  NZ  . LYS A  1 227 ? 134.723 177.450 131.869 1.00 74.36  ? 248 LYS A NZ  1 
ATOM   1721  N  N   . ASP A  1 228 ? 127.801 176.555 132.144 1.00 52.42  ? 249 ASP A N   1 
ATOM   1722  C  CA  . ASP A  1 228 ? 127.445 175.487 131.167 1.00 51.42  ? 249 ASP A CA  1 
ATOM   1723  C  C   . ASP A  1 228 ? 126.025 175.635 130.579 1.00 51.28  ? 249 ASP A C   1 
ATOM   1724  O  O   . ASP A  1 228 ? 125.781 175.085 129.474 1.00 50.41  ? 249 ASP A O   1 
ATOM   1725  C  CB  . ASP A  1 228 ? 127.575 174.106 131.807 1.00 49.30  ? 249 ASP A CB  1 
ATOM   1726  C  CG  . ASP A  1 228 ? 128.964 173.749 132.325 1.00 49.20  ? 249 ASP A CG  1 
ATOM   1727  O  OD1 . ASP A  1 228 ? 129.931 174.361 131.894 1.00 50.88  ? 249 ASP A OD1 1 
ATOM   1728  O  OD2 . ASP A  1 228 ? 129.043 172.855 133.204 1.00 48.34  ? 249 ASP A OD2 1 
ATOM   1729  N  N   . ARG A  1 229 ? 125.098 176.291 131.292 1.00 50.60  ? 250 ARG A N   1 
ATOM   1730  C  CA  . ARG A  1 229 ? 123.695 176.477 130.836 1.00 51.48  ? 250 ARG A CA  1 
ATOM   1731  C  C   . ARG A  1 229 ? 123.608 176.808 129.338 1.00 54.42  ? 250 ARG A C   1 
ATOM   1732  O  O   . ARG A  1 229 ? 122.887 176.107 128.618 1.00 54.43  ? 250 ARG A O   1 
ATOM   1733  C  CB  . ARG A  1 229 ? 122.958 177.559 131.628 1.00 51.74  ? 250 ARG A CB  1 
ATOM   1734  C  CG  . ARG A  1 229 ? 121.517 177.744 131.168 1.00 52.80  ? 250 ARG A CG  1 
ATOM   1735  C  CD  . ARG A  1 229 ? 120.841 178.960 131.776 1.00 53.50  ? 250 ARG A CD  1 
ATOM   1736  N  NE  . ARG A  1 229 ? 120.534 178.752 133.175 1.00 50.38  ? 250 ARG A NE  1 
ATOM   1737  C  CZ  . ARG A  1 229 ? 119.475 178.071 133.639 1.00 50.36  ? 250 ARG A CZ  1 
ATOM   1738  N  NH1 . ARG A  1 229 ? 118.611 177.493 132.806 1.00 50.70  ? 250 ARG A NH1 1 
ATOM   1739  N  NH2 . ARG A  1 229 ? 119.259 177.997 134.957 1.00 47.64  ? 250 ARG A NH2 1 
ATOM   1740  N  N   . PRO A  1 230 ? 124.249 177.882 128.802 1.00 57.10  ? 251 PRO A N   1 
ATOM   1741  C  CA  . PRO A  1 230 ? 124.070 178.254 127.390 1.00 60.50  ? 251 PRO A CA  1 
ATOM   1742  C  C   . PRO A  1 230 ? 124.313 177.084 126.398 1.00 61.46  ? 251 PRO A C   1 
ATOM   1743  O  O   . PRO A  1 230 ? 123.607 176.945 125.327 1.00 64.06  ? 251 PRO A O   1 
ATOM   1744  C  CB  . PRO A  1 230 ? 125.147 179.323 127.138 1.00 62.79  ? 251 PRO A CB  1 
ATOM   1745  C  CG  . PRO A  1 230 ? 125.357 179.945 128.500 1.00 61.55  ? 251 PRO A CG  1 
ATOM   1746  C  CD  . PRO A  1 230 ? 125.160 178.807 129.497 1.00 57.54  ? 251 PRO A CD  1 
ATOM   1747  N  N   . MET A  1 231 ? 125.311 176.277 126.791 1.00 61.27  ? 252 MET A N   1 
ATOM   1748  C  CA  . MET A  1 231 ? 125.755 175.071 126.065 1.00 63.10  ? 252 MET A CA  1 
ATOM   1749  C  C   . MET A  1 231 ? 124.783 173.897 126.314 1.00 59.97  ? 252 MET A C   1 
ATOM   1750  O  O   . MET A  1 231 ? 124.400 173.188 125.340 1.00 60.05  ? 252 MET A O   1 
ATOM   1751  C  CB  . MET A  1 231 ? 127.192 174.762 126.496 1.00 66.19  ? 252 MET A CB  1 
ATOM   1752  C  CG  . MET A  1 231 ? 127.852 173.683 125.677 1.00 70.98  ? 252 MET A CG  1 
ATOM   1753  S  SD  . MET A  1 231 ? 127.588 172.064 126.474 1.00 76.18  ? 252 MET A SD  1 
ATOM   1754  C  CE  . MET A  1 231 ? 128.490 171.036 125.301 1.00 77.65  ? 252 MET A CE  1 
ATOM   1755  N  N   . LEU A  1 232 ? 124.338 173.670 127.545 1.00 55.84  ? 253 LEU A N   1 
ATOM   1756  C  CA  . LEU A  1 232 ? 123.467 172.500 127.806 1.00 54.13  ? 253 LEU A CA  1 
ATOM   1757  C  C   . LEU A  1 232 ? 122.084 172.704 127.156 1.00 54.48  ? 253 LEU A C   1 
ATOM   1758  O  O   . LEU A  1 232 ? 121.452 171.676 126.756 1.00 53.62  ? 253 LEU A O   1 
ATOM   1759  C  CB  . LEU A  1 232 ? 123.379 172.284 129.319 1.00 52.15  ? 253 LEU A CB  1 
ATOM   1760  C  CG  . LEU A  1 232 ? 124.614 171.629 129.933 1.00 51.48  ? 253 LEU A CG  1 
ATOM   1761  C  CD1 . LEU A  1 232 ? 124.541 171.712 131.439 1.00 50.15  ? 253 LEU A CD1 1 
ATOM   1762  C  CD2 . LEU A  1 232 ? 124.756 170.191 129.459 1.00 51.27  ? 253 LEU A CD2 1 
ATOM   1763  N  N   . GLU A  1 233 ? 121.661 173.968 126.999 1.00 55.34  ? 254 GLU A N   1 
ATOM   1764  C  CA  . GLU A  1 233 ? 120.359 174.348 126.382 1.00 56.30  ? 254 GLU A CA  1 
ATOM   1765  C  C   . GLU A  1 233 ? 120.478 174.397 124.851 1.00 59.26  ? 254 GLU A C   1 
ATOM   1766  O  O   . GLU A  1 233 ? 119.537 174.859 124.225 1.00 60.80  ? 254 GLU A O   1 
ATOM   1767  C  CB  . GLU A  1 233 ? 119.878 175.666 126.993 1.00 56.34  ? 254 GLU A CB  1 
ATOM   1768  C  CG  . GLU A  1 233 ? 119.435 175.491 128.443 1.00 53.90  ? 254 GLU A CG  1 
ATOM   1769  C  CD  . GLU A  1 233 ? 118.647 176.624 129.101 1.00 54.16  ? 254 GLU A CD  1 
ATOM   1770  O  OE1 . GLU A  1 233 ? 118.554 177.736 128.553 1.00 56.59  ? 254 GLU A OE1 1 
ATOM   1771  O  OE2 . GLU A  1 233 ? 118.120 176.387 130.180 1.00 53.53  ? 254 GLU A OE2 1 
ATOM   1772  N  N   . ASN A  1 234 ? 121.586 173.946 124.254 1.00 60.59  ? 255 ASN A N   1 
ATOM   1773  C  CA  . ASN A  1 234 ? 121.743 173.924 122.774 1.00 64.19  ? 255 ASN A CA  1 
ATOM   1774  C  C   . ASN A  1 234 ? 122.584 172.726 122.348 1.00 63.81  ? 255 ASN A C   1 
ATOM   1775  O  O   . ASN A  1 234 ? 123.469 172.924 121.450 1.00 64.93  ? 255 ASN A O   1 
ATOM   1776  C  CB  . ASN A  1 234 ? 122.361 175.207 122.202 1.00 68.14  ? 255 ASN A CB  1 
ATOM   1777  C  CG  . ASN A  1 234 ? 121.346 176.326 122.066 1.00 70.37  ? 255 ASN A CG  1 
ATOM   1778  O  OD1 . ASN A  1 234 ? 120.810 176.541 120.968 1.00 73.50  ? 255 ASN A OD1 1 
ATOM   1779  N  ND2 . ASN A  1 234 ? 121.064 177.008 123.178 1.00 68.20  ? 255 ASN A ND2 1 
ATOM   1780  N  N   . LEU A  1 235 ? 122.274 171.549 122.916 1.00 60.86  ? 256 LEU A N   1 
ATOM   1781  C  CA  . LEU A  1 235 ? 122.958 170.263 122.614 1.00 60.86  ? 256 LEU A CA  1 
ATOM   1782  C  C   . LEU A  1 235 ? 122.584 169.793 121.218 1.00 63.85  ? 256 LEU A C   1 
ATOM   1783  O  O   . LEU A  1 235 ? 121.592 170.263 120.655 1.00 65.52  ? 256 LEU A O   1 
ATOM   1784  C  CB  . LEU A  1 235 ? 122.593 169.188 123.640 1.00 57.86  ? 256 LEU A CB  1 
ATOM   1785  C  CG  . LEU A  1 235 ? 123.083 169.464 125.068 1.00 55.47  ? 256 LEU A CG  1 
ATOM   1786  C  CD1 . LEU A  1 235 ? 122.550 168.435 126.060 1.00 52.24  ? 256 LEU A CD1 1 
ATOM   1787  C  CD2 . LEU A  1 235 ? 124.619 169.540 125.103 1.00 55.85  ? 256 LEU A CD2 1 
ATOM   1788  N  N   . LYS A  1 236 ? 123.419 168.902 120.706 1.00 65.40  ? 257 LYS A N   1 
ATOM   1789  C  CA  . LYS A  1 236 ? 123.287 168.180 119.415 1.00 68.40  ? 257 LYS A CA  1 
ATOM   1790  C  C   . LYS A  1 236 ? 124.036 166.860 119.597 1.00 66.50  ? 257 LYS A C   1 
ATOM   1791  O  O   . LYS A  1 236 ? 125.222 166.897 119.970 1.00 65.27  ? 257 LYS A O   1 
ATOM   1792  C  CB  . LYS A  1 236 ? 123.866 168.983 118.242 1.00 73.13  ? 257 LYS A CB  1 
ATOM   1793  C  CG  . LYS A  1 236 ? 123.143 170.290 117.926 1.00 76.04  ? 257 LYS A CG  1 
ATOM   1794  C  CD  . LYS A  1 236 ? 123.917 171.265 117.055 1.00 79.79  ? 257 LYS A CD  1 
ATOM   1795  C  CE  . LYS A  1 236 ? 123.478 172.708 117.262 1.00 81.18  ? 257 LYS A CE  1 
ATOM   1796  N  NZ  . LYS A  1 236 ? 124.221 173.635 116.368 1.00 85.19  ? 257 LYS A NZ  1 
ATOM   1797  N  N   . LEU A  1 237 ? 123.348 165.741 119.431 1.00 65.65  ? 258 LEU A N   1 
ATOM   1798  C  CA  . LEU A  1 237 ? 123.947 164.419 119.701 1.00 64.60  ? 258 LEU A CA  1 
ATOM   1799  C  C   . LEU A  1 237 ? 123.519 163.478 118.570 1.00 67.00  ? 258 LEU A C   1 
ATOM   1800  O  O   . LEU A  1 237 ? 122.617 163.856 117.795 1.00 69.30  ? 258 LEU A O   1 
ATOM   1801  C  CB  . LEU A  1 237 ? 123.470 163.966 121.092 1.00 61.45  ? 258 LEU A CB  1 
ATOM   1802  C  CG  . LEU A  1 237 ? 124.006 164.782 122.279 1.00 58.94  ? 258 LEU A CG  1 
ATOM   1803  C  CD1 . LEU A  1 237 ? 123.395 164.320 123.597 1.00 55.90  ? 258 LEU A CD1 1 
ATOM   1804  C  CD2 . LEU A  1 237 ? 125.523 164.684 122.344 1.00 59.01  ? 258 LEU A CD2 1 
ATOM   1805  N  N   . GLY A  1 238 ? 124.169 162.322 118.456 1.00 66.94  ? 259 GLY A N   1 
ATOM   1806  C  CA  . GLY A  1 238 ? 123.713 161.229 117.585 1.00 68.99  ? 259 GLY A CA  1 
ATOM   1807  C  C   . GLY A  1 238 ? 124.294 161.335 116.197 1.00 72.73  ? 259 GLY A C   1 
ATOM   1808  O  O   . GLY A  1 238 ? 124.324 160.279 115.527 1.00 73.87  ? 259 GLY A O   1 
ATOM   1809  N  N   . GLU A  1 239 ? 124.759 162.529 115.785 1.00 74.24  ? 260 GLU A N   1 
ATOM   1810  C  CA  . GLU A  1 239 ? 125.230 162.768 114.386 1.00 78.52  ? 260 GLU A CA  1 
ATOM   1811  C  C   . GLU A  1 239 ? 126.387 161.813 114.060 1.00 79.08  ? 260 GLU A C   1 
ATOM   1812  O  O   . GLU A  1 239 ? 127.440 161.926 114.726 1.00 77.30  ? 260 GLU A O   1 
ATOM   1813  C  CB  . GLU A  1 239 ? 125.658 164.213 114.110 1.00 80.10  ? 260 GLU A CB  1 
ATOM   1814  C  CG  . GLU A  1 239 ? 125.538 164.543 112.627 1.00 85.22  ? 260 GLU A CG  1 
ATOM   1815  C  CD  . GLU A  1 239 ? 126.573 165.494 112.044 1.00 88.21  ? 260 GLU A CD  1 
ATOM   1816  O  OE1 . GLU A  1 239 ? 127.100 165.218 110.929 1.00 92.21  ? 260 GLU A OE1 1 
ATOM   1817  O  OE2 . GLU A  1 239 ? 126.841 166.521 112.687 1.00 88.08  ? 260 GLU A OE2 1 
ATOM   1818  N  N   . GLY A  1 240 ? 126.172 160.901 113.102 1.00 81.53  ? 261 GLY A N   1 
ATOM   1819  C  CA  . GLY A  1 240 ? 127.159 159.895 112.688 1.00 83.33  ? 261 GLY A CA  1 
ATOM   1820  C  C   . GLY A  1 240 ? 126.905 158.511 113.251 1.00 82.65  ? 261 GLY A C   1 
ATOM   1821  O  O   . GLY A  1 240 ? 127.307 157.559 112.606 1.00 85.37  ? 261 GLY A O   1 
ATOM   1822  N  N   . VAL A  1 241 ? 126.310 158.380 114.431 1.00 81.14  ? 262 VAL A N   1 
ATOM   1823  C  CA  . VAL A  1 241 ? 126.070 157.061 115.106 1.00 80.64  ? 262 VAL A CA  1 
ATOM   1824  C  C   . VAL A  1 241 ? 124.570 156.725 115.025 1.00 81.61  ? 262 VAL A C   1 
ATOM   1825  O  O   . VAL A  1 241 ? 123.850 157.457 114.321 1.00 84.57  ? 262 VAL A O   1 
ATOM   1826  C  CB  . VAL A  1 241 ? 126.588 157.058 116.557 1.00 77.65  ? 262 VAL A CB  1 
ATOM   1827  C  CG1 . VAL A  1 241 ? 128.101 157.200 116.613 1.00 77.97  ? 262 VAL A CG1 1 
ATOM   1828  C  CG2 . VAL A  1 241 ? 125.905 158.118 117.424 1.00 75.41  ? 262 VAL A CG2 1 
ATOM   1829  N  N   . LYS A  1 242 ? 124.107 155.658 115.691 1.00 80.16  ? 263 LYS A N   1 
ATOM   1830  C  CA  . LYS A  1 242 ? 122.788 155.029 115.399 1.00 81.00  ? 263 LYS A CA  1 
ATOM   1831  C  C   . LYS A  1 242 ? 121.642 155.926 115.892 1.00 78.53  ? 263 LYS A C   1 
ATOM   1832  O  O   . LYS A  1 242 ? 120.532 155.861 115.296 1.00 79.12  ? 263 LYS A O   1 
ATOM   1833  C  CB  . LYS A  1 242 ? 122.776 153.586 115.922 1.00 81.26  ? 263 LYS A CB  1 
ATOM   1834  C  CG  . LYS A  1 242 ? 123.513 152.594 115.020 1.00 84.90  ? 263 LYS A CG  1 
ATOM   1835  C  CD  . LYS A  1 242 ? 122.983 152.556 113.583 1.00 88.47  ? 263 LYS A CD  1 
ATOM   1836  C  CE  . LYS A  1 242 ? 123.770 151.665 112.640 1.00 92.18  ? 263 LYS A CE  1 
ATOM   1837  N  NZ  . LYS A  1 242 ? 124.820 152.402 111.894 1.00 93.60  ? 263 LYS A NZ  1 
ATOM   1838  N  N   . GLY A  1 243 ? 121.905 156.773 116.891 1.00 75.11  ? 264 GLY A N   1 
ATOM   1839  C  CA  . GLY A  1 243 ? 120.930 157.764 117.384 1.00 73.06  ? 264 GLY A CA  1 
ATOM   1840  C  C   . GLY A  1 243 ? 121.204 158.186 118.819 1.00 69.19  ? 264 GLY A C   1 
ATOM   1841  O  O   . GLY A  1 243 ? 122.324 157.952 119.315 1.00 67.85  ? 264 GLY A O   1 
ATOM   1842  N  N   . VAL A  1 244 ? 120.193 158.741 119.486 1.00 66.41  ? 265 VAL A N   1 
ATOM   1843  C  CA  . VAL A  1 244 ? 120.344 159.328 120.839 1.00 62.85  ? 265 VAL A CA  1 
ATOM   1844  C  C   . VAL A  1 244 ? 119.399 158.631 121.830 1.00 60.40  ? 265 VAL A C   1 
ATOM   1845  O  O   . VAL A  1 244 ? 118.200 158.547 121.519 1.00 61.63  ? 265 VAL A O   1 
ATOM   1846  C  CB  . VAL A  1 244 ? 120.101 160.840 120.744 1.00 62.82  ? 265 VAL A CB  1 
ATOM   1847  C  CG1 . VAL A  1 244 ? 120.232 161.514 122.111 1.00 60.51  ? 265 VAL A CG1 1 
ATOM   1848  C  CG2 . VAL A  1 244 ? 121.029 161.456 119.713 1.00 64.69  ? 265 VAL A CG2 1 
ATOM   1849  N  N   . TYR A  1 245 ? 119.936 158.125 122.952 1.00 57.32  ? 266 TYR A N   1 
ATOM   1850  C  CA  . TYR A  1 245 ? 119.176 157.636 124.136 1.00 54.93  ? 266 TYR A CA  1 
ATOM   1851  C  C   . TYR A  1 245 ? 119.218 158.690 125.248 1.00 52.09  ? 266 TYR A C   1 
ATOM   1852  O  O   . TYR A  1 245 ? 120.289 159.228 125.559 1.00 50.72  ? 266 TYR A O   1 
ATOM   1853  C  CB  . TYR A  1 245 ? 119.737 156.337 124.715 1.00 54.44  ? 266 TYR A CB  1 
ATOM   1854  C  CG  . TYR A  1 245 ? 118.835 155.653 125.702 1.00 53.05  ? 266 TYR A CG  1 
ATOM   1855  C  CD1 . TYR A  1 245 ? 117.795 154.851 125.279 1.00 54.80  ? 266 TYR A CD1 1 
ATOM   1856  C  CD2 . TYR A  1 245 ? 119.007 155.809 127.064 1.00 50.82  ? 266 TYR A CD2 1 
ATOM   1857  C  CE1 . TYR A  1 245 ? 116.952 154.221 126.182 1.00 53.78  ? 266 TYR A CE1 1 
ATOM   1858  C  CE2 . TYR A  1 245 ? 118.171 155.194 127.984 1.00 49.84  ? 266 TYR A CE2 1 
ATOM   1859  C  CZ  . TYR A  1 245 ? 117.136 154.383 127.544 1.00 51.24  ? 266 TYR A CZ  1 
ATOM   1860  O  OH  . TYR A  1 245 ? 116.293 153.759 128.426 1.00 49.59  ? 266 TYR A OH  1 
ATOM   1861  N  N   . ILE A  1 246 ? 118.062 158.963 125.863 1.00 50.94  ? 267 ILE A N   1 
ATOM   1862  C  CA  . ILE A  1 246 ? 117.967 159.900 127.012 1.00 47.89  ? 267 ILE A CA  1 
ATOM   1863  C  C   . ILE A  1 246 ? 117.548 159.059 128.203 1.00 46.72  ? 267 ILE A C   1 
ATOM   1864  O  O   . ILE A  1 246 ? 116.444 158.442 128.090 1.00 47.00  ? 267 ILE A O   1 
ATOM   1865  C  CB  . ILE A  1 246 ? 116.988 161.037 126.687 1.00 48.17  ? 267 ILE A CB  1 
ATOM   1866  C  CG1 . ILE A  1 246 ? 117.374 161.724 125.368 1.00 50.50  ? 267 ILE A CG1 1 
ATOM   1867  C  CG2 . ILE A  1 246 ? 116.888 162.022 127.837 1.00 45.86  ? 267 ILE A CG2 1 
ATOM   1868  C  CD1 . ILE A  1 246 ? 116.319 162.630 124.782 1.00 51.61  ? 267 ILE A CD1 1 
ATOM   1869  N  N   . SER A  1 247 ? 118.396 159.017 129.258 1.00 44.59  ? 268 SER A N   1 
ATOM   1870  C  CA  . SER A  1 247 ? 118.042 158.451 130.588 1.00 42.48  ? 268 SER A CA  1 
ATOM   1871  C  C   . SER A  1 247 ? 117.749 159.587 131.566 1.00 40.39  ? 268 SER A C   1 
ATOM   1872  O  O   . SER A  1 247 ? 118.608 160.449 131.740 1.00 40.79  ? 268 SER A O   1 
ATOM   1873  C  CB  . SER A  1 247 ? 119.112 157.554 131.124 1.00 42.22  ? 268 SER A CB  1 
ATOM   1874  O  OG  . SER A  1 247 ? 118.736 157.093 132.414 1.00 40.77  ? 268 SER A OG  1 
ATOM   1875  N  N   . ILE A  1 248 ? 116.602 159.598 132.223 1.00 39.27  ? 269 ILE A N   1 
ATOM   1876  C  CA  . ILE A  1 248 ? 116.302 160.690 133.192 1.00 37.72  ? 269 ILE A CA  1 
ATOM   1877  C  C   . ILE A  1 248 ? 116.026 160.100 134.568 1.00 36.50  ? 269 ILE A C   1 
ATOM   1878  O  O   . ILE A  1 248 ? 115.019 159.400 134.725 1.00 36.73  ? 269 ILE A O   1 
ATOM   1879  C  CB  . ILE A  1 248 ? 115.125 161.551 132.728 1.00 38.03  ? 269 ILE A CB  1 
ATOM   1880  C  CG1 . ILE A  1 248 ? 115.361 162.046 131.297 1.00 39.57  ? 269 ILE A CG1 1 
ATOM   1881  C  CG2 . ILE A  1 248 ? 114.899 162.687 133.730 1.00 36.01  ? 269 ILE A CG2 1 
ATOM   1882  C  CD1 . ILE A  1 248 ? 114.263 162.926 130.809 1.00 40.20  ? 269 ILE A CD1 1 
ATOM   1883  N  N   . ASP A  1 249 ? 116.945 160.340 135.494 1.00 35.86  ? 270 ASP A N   1 
ATOM   1884  C  CA  . ASP A  1 249 ? 116.748 160.101 136.947 1.00 34.71  ? 270 ASP A CA  1 
ATOM   1885  C  C   . ASP A  1 249 ? 116.011 161.336 137.474 1.00 34.06  ? 270 ASP A C   1 
ATOM   1886  O  O   . ASP A  1 249 ? 116.560 162.479 137.404 1.00 34.51  ? 270 ASP A O   1 
ATOM   1887  C  CB  . ASP A  1 249 ? 118.081 159.882 137.664 1.00 33.46  ? 270 ASP A CB  1 
ATOM   1888  C  CG  . ASP A  1 249 ? 117.971 159.509 139.136 1.00 32.43  ? 270 ASP A CG  1 
ATOM   1889  O  OD1 . ASP A  1 249 ? 116.966 159.962 139.793 1.00 30.39  ? 270 ASP A OD1 1 
ATOM   1890  O  OD2 . ASP A  1 249 ? 118.923 158.836 139.625 1.00 31.75  ? 270 ASP A OD2 1 
ATOM   1891  N  N   . VAL A  1 250 ? 114.797 161.130 137.911 1.00 33.17  ? 271 VAL A N   1 
ATOM   1892  C  CA  . VAL A  1 250 ? 113.973 162.195 138.518 1.00 32.73  ? 271 VAL A CA  1 
ATOM   1893  C  C   . VAL A  1 250 ? 114.798 163.017 139.547 1.00 30.95  ? 271 VAL A C   1 
ATOM   1894  O  O   . VAL A  1 250 ? 114.559 164.250 139.632 1.00 29.05  ? 271 VAL A O   1 
ATOM   1895  C  CB  . VAL A  1 250 ? 112.717 161.523 139.088 1.00 33.07  ? 271 VAL A CB  1 
ATOM   1896  C  CG1 . VAL A  1 250 ? 111.965 162.400 140.055 1.00 32.97  ? 271 VAL A CG1 1 
ATOM   1897  C  CG2 . VAL A  1 250 ? 111.811 161.123 137.945 1.00 35.20  ? 271 VAL A CG2 1 
ATOM   1898  N  N   . ASP A  1 251 ? 115.804 162.443 140.218 1.00 30.67  ? 272 ASP A N   1 
ATOM   1899  C  CA  . ASP A  1 251 ? 116.634 163.240 141.185 1.00 29.99  ? 272 ASP A CA  1 
ATOM   1900  C  C   . ASP A  1 251 ? 117.592 164.201 140.439 1.00 30.60  ? 272 ASP A C   1 
ATOM   1901  O  O   . ASP A  1 251 ? 118.411 164.902 141.141 1.00 30.27  ? 272 ASP A O   1 
ATOM   1902  C  CB  . ASP A  1 251 ? 117.341 162.354 142.214 1.00 30.01  ? 272 ASP A CB  1 
ATOM   1903  C  CG  . ASP A  1 251 ? 118.482 161.506 141.686 1.00 31.81  ? 272 ASP A CG  1 
ATOM   1904  O  OD1 . ASP A  1 251 ? 119.118 161.909 140.683 1.00 30.96  ? 272 ASP A OD1 1 
ATOM   1905  O  OD2 . ASP A  1 251 ? 118.684 160.386 142.273 1.00 34.85  ? 272 ASP A OD2 1 
ATOM   1906  N  N   . CYS A  1 252 ? 117.507 164.317 139.101 1.00 30.28  ? 273 CYS A N   1 
ATOM   1907  C  CA  . CYS A  1 252 ? 118.232 165.399 138.393 1.00 31.16  ? 273 CYS A CA  1 
ATOM   1908  C  C   . CYS A  1 252 ? 117.651 166.742 138.829 1.00 30.61  ? 273 CYS A C   1 
ATOM   1909  O  O   . CYS A  1 252 ? 118.406 167.734 138.853 1.00 31.34  ? 273 CYS A O   1 
ATOM   1910  C  CB  . CYS A  1 252 ? 118.236 165.274 136.874 1.00 32.85  ? 273 CYS A CB  1 
ATOM   1911  S  SG  . CYS A  1 252 ? 116.639 165.549 136.066 1.00 35.77  ? 273 CYS A SG  1 
ATOM   1912  N  N   . LEU A  1 253 ? 116.351 166.760 139.107 1.00 30.09  ? 274 LEU A N   1 
ATOM   1913  C  CA  . LEU A  1 253 ? 115.578 167.920 139.591 1.00 29.38  ? 274 LEU A CA  1 
ATOM   1914  C  C   . LEU A  1 253 ? 115.908 168.224 141.054 1.00 27.79  ? 274 LEU A C   1 
ATOM   1915  O  O   . LEU A  1 253 ? 116.011 167.304 141.871 1.00 25.90  ? 274 LEU A O   1 
ATOM   1916  C  CB  . LEU A  1 253 ? 114.094 167.601 139.432 1.00 30.18  ? 274 LEU A CB  1 
ATOM   1917  C  CG  . LEU A  1 253 ? 113.612 167.484 137.983 1.00 32.77  ? 274 LEU A CG  1 
ATOM   1918  C  CD1 . LEU A  1 253 ? 112.232 166.856 137.951 1.00 33.43  ? 274 LEU A CD1 1 
ATOM   1919  C  CD2 . LEU A  1 253 ? 113.590 168.845 137.266 1.00 33.94  ? 274 LEU A CD2 1 
ATOM   1920  N  N   . ASP A  1 254 ? 115.999 169.508 141.402 1.00 27.78  ? 275 ASP A N   1 
ATOM   1921  C  CA  . ASP A  1 254 ? 116.115 169.857 142.833 1.00 26.64  ? 275 ASP A CA  1 
ATOM   1922  C  C   . ASP A  1 254 ? 114.994 169.141 143.570 1.00 25.91  ? 275 ASP A C   1 
ATOM   1923  O  O   . ASP A  1 254 ? 113.878 169.073 143.074 1.00 25.87  ? 275 ASP A O   1 
ATOM   1924  C  CB  . ASP A  1 254 ? 116.056 171.342 143.100 1.00 26.60  ? 275 ASP A CB  1 
ATOM   1925  C  CG  . ASP A  1 254 ? 116.546 171.675 144.487 1.00 26.00  ? 275 ASP A CG  1 
ATOM   1926  O  OD1 . ASP A  1 254 ? 115.711 171.600 145.408 1.00 24.74  ? 275 ASP A OD1 1 
ATOM   1927  O  OD2 . ASP A  1 254 ? 117.760 172.008 144.622 1.00 25.99  ? 275 ASP A OD2 1 
ATOM   1928  N  N   . PRO A  1 255 ? 115.229 168.597 144.785 1.00 25.41  ? 276 PRO A N   1 
ATOM   1929  C  CA  . PRO A  1 255 ? 114.119 168.030 145.568 1.00 24.85  ? 276 PRO A CA  1 
ATOM   1930  C  C   . PRO A  1 255 ? 112.921 168.979 145.803 1.00 24.68  ? 276 PRO A C   1 
ATOM   1931  O  O   . PRO A  1 255 ? 111.851 168.502 146.113 1.00 23.87  ? 276 PRO A O   1 
ATOM   1932  C  CB  . PRO A  1 255 ? 114.741 167.619 146.902 1.00 24.76  ? 276 PRO A CB  1 
ATOM   1933  C  CG  . PRO A  1 255 ? 116.187 168.089 146.884 1.00 25.63  ? 276 PRO A CG  1 
ATOM   1934  C  CD  . PRO A  1 255 ? 116.539 168.492 145.446 1.00 25.90  ? 276 PRO A CD  1 
ATOM   1935  N  N   . ALA A  1 256 ? 113.096 170.307 145.694 1.00 24.85  ? 277 ALA A N   1 
ATOM   1936  C  CA  . ALA A  1 256 ? 111.946 171.245 145.723 1.00 25.12  ? 277 ALA A CA  1 
ATOM   1937  C  C   . ALA A  1 256 ? 110.892 170.802 144.691 1.00 25.41  ? 277 ALA A C   1 
ATOM   1938  O  O   . ALA A  1 256 ? 109.719 170.914 145.006 1.00 24.47  ? 277 ALA A O   1 
ATOM   1939  C  CB  . ALA A  1 256 ? 112.397 172.682 145.485 1.00 26.03  ? 277 ALA A CB  1 
ATOM   1940  N  N   . PHE A  1 257 ? 111.322 170.335 143.507 1.00 26.03  ? 278 PHE A N   1 
ATOM   1941  C  CA  . PHE A  1 257 ? 110.473 169.953 142.351 1.00 27.16  ? 278 PHE A CA  1 
ATOM   1942  C  C   . PHE A  1 257 ? 110.120 168.464 142.419 1.00 27.39  ? 278 PHE A C   1 
ATOM   1943  O  O   . PHE A  1 257 ? 109.006 168.034 142.020 1.00 29.12  ? 278 PHE A O   1 
ATOM   1944  C  CB  . PHE A  1 257 ? 111.176 170.278 141.021 1.00 28.57  ? 278 PHE A CB  1 
ATOM   1945  C  CG  . PHE A  1 257 ? 111.629 171.716 140.902 1.00 29.04  ? 278 PHE A CG  1 
ATOM   1946  C  CD1 . PHE A  1 257 ? 110.733 172.730 140.618 1.00 29.99  ? 278 PHE A CD1 1 
ATOM   1947  C  CD2 . PHE A  1 257 ? 112.917 172.085 141.244 1.00 28.99  ? 278 PHE A CD2 1 
ATOM   1948  C  CE1 . PHE A  1 257 ? 111.119 174.063 140.629 1.00 30.55  ? 278 PHE A CE1 1 
ATOM   1949  C  CE2 . PHE A  1 257 ? 113.304 173.420 141.243 1.00 29.70  ? 278 PHE A CE2 1 
ATOM   1950  C  CZ  . PHE A  1 257 ? 112.401 174.404 140.941 1.00 30.39  ? 278 PHE A CZ  1 
ATOM   1951  N  N   . ALA A  1 258 ? 111.032 167.648 142.916 1.00 27.17  ? 279 ALA A N   1 
ATOM   1952  C  CA  . ALA A  1 258 ? 110.855 166.183 142.914 1.00 27.26  ? 279 ALA A CA  1 
ATOM   1953  C  C   . ALA A  1 258 ? 111.339 165.584 144.241 1.00 26.41  ? 279 ALA A C   1 
ATOM   1954  O  O   . ALA A  1 258 ? 112.437 165.027 144.353 1.00 26.19  ? 279 ALA A O   1 
ATOM   1955  C  CB  . ALA A  1 258 ? 111.496 165.582 141.691 1.00 28.11  ? 279 ALA A CB  1 
ATOM   1956  N  N   . PRO A  1 259 ? 110.489 165.664 145.276 1.00 25.31  ? 280 PRO A N   1 
ATOM   1957  C  CA  . PRO A  1 259 ? 110.805 165.057 146.570 1.00 24.79  ? 280 PRO A CA  1 
ATOM   1958  C  C   . PRO A  1 259 ? 110.648 163.529 146.598 1.00 24.81  ? 280 PRO A C   1 
ATOM   1959  O  O   . PRO A  1 259 ? 111.269 162.897 147.461 1.00 24.23  ? 280 PRO A O   1 
ATOM   1960  C  CB  . PRO A  1 259 ? 109.844 165.761 147.555 1.00 24.74  ? 280 PRO A CB  1 
ATOM   1961  C  CG  . PRO A  1 259 ? 108.667 166.226 146.687 1.00 25.80  ? 280 PRO A CG  1 
ATOM   1962  C  CD  . PRO A  1 259 ? 109.247 166.456 145.282 1.00 25.90  ? 280 PRO A CD  1 
ATOM   1963  N  N   . GLY A  1 260 ? 109.870 162.978 145.663 1.00 24.73  ? 281 GLY A N   1 
ATOM   1964  C  CA  . GLY A  1 260 ? 109.558 161.545 145.551 1.00 24.86  ? 281 GLY A CA  1 
ATOM   1965  C  C   . GLY A  1 260 ? 110.690 160.763 144.918 1.00 24.97  ? 281 GLY A C   1 
ATOM   1966  O  O   . GLY A  1 260 ? 110.514 160.222 143.854 1.00 25.47  ? 281 GLY A O   1 
ATOM   1967  N  N   . VAL A  1 261 ? 111.827 160.757 145.581 1.00 24.31  ? 282 VAL A N   1 
ATOM   1968  C  CA  . VAL A  1 261 ? 113.067 160.075 145.177 1.00 24.95  ? 282 VAL A CA  1 
ATOM   1969  C  C   . VAL A  1 261 ? 113.626 159.404 146.441 1.00 24.99  ? 282 VAL A C   1 
ATOM   1970  O  O   . VAL A  1 261 ? 113.300 159.830 147.532 1.00 23.90  ? 282 VAL A O   1 
ATOM   1971  C  CB  . VAL A  1 261 ? 114.057 161.091 144.546 1.00 24.78  ? 282 VAL A CB  1 
ATOM   1972  C  CG1 . VAL A  1 261 ? 113.551 161.657 143.211 1.00 25.06  ? 282 VAL A CG1 1 
ATOM   1973  C  CG2 . VAL A  1 261 ? 114.427 162.237 145.472 1.00 23.59  ? 282 VAL A CG2 1 
ATOM   1974  N  N   . SER A  1 262 ? 114.483 158.419 146.267 1.00 26.12  ? 283 SER A N   1 
ATOM   1975  C  CA  . SER A  1 262 ? 115.208 157.718 147.341 1.00 27.36  ? 283 SER A CA  1 
ATOM   1976  C  C   . SER A  1 262 ? 116.395 158.554 147.802 1.00 27.20  ? 283 SER A C   1 
ATOM   1977  O  O   . SER A  1 262 ? 116.771 158.401 148.970 1.00 28.31  ? 283 SER A O   1 
ATOM   1978  C  CB  . SER A  1 262 ? 115.643 156.392 146.861 1.00 28.92  ? 283 SER A CB  1 
ATOM   1979  O  OG  . SER A  1 262 ? 114.491 155.623 146.595 1.00 30.45  ? 283 SER A OG  1 
ATOM   1980  N  N   . HIS A  1 263 ? 116.977 159.379 146.921 1.00 27.24  ? 284 HIS A N   1 
ATOM   1981  C  CA  . HIS A  1 263 ? 118.176 160.193 147.249 1.00 27.35  ? 284 HIS A CA  1 
ATOM   1982  C  C   . HIS A  1 263 ? 117.901 161.688 147.155 1.00 26.54  ? 284 HIS A C   1 
ATOM   1983  O  O   . HIS A  1 263 ? 118.087 162.262 146.088 1.00 27.82  ? 284 HIS A O   1 
ATOM   1984  C  CB  . HIS A  1 263 ? 119.292 159.735 146.334 1.00 28.32  ? 284 HIS A CB  1 
ATOM   1985  C  CG  . HIS A  1 263 ? 119.541 158.283 146.508 1.00 29.66  ? 284 HIS A CG  1 
ATOM   1986  N  ND1 . HIS A  1 263 ? 120.464 157.805 147.403 1.00 30.25  ? 284 HIS A ND1 1 
ATOM   1987  C  CD2 . HIS A  1 263 ? 118.954 157.208 145.920 1.00 31.05  ? 284 HIS A CD2 1 
ATOM   1988  C  CE1 . HIS A  1 263 ? 120.418 156.477 147.379 1.00 32.31  ? 284 HIS A CE1 1 
ATOM   1989  N  NE2 . HIS A  1 263 ? 119.478 156.081 146.481 1.00 32.07  ? 284 HIS A NE2 1 
ATOM   1990  N  N   . ILE A  1 264 ? 117.544 162.314 148.262 1.00 26.99  ? 285 ILE A N   1 
ATOM   1991  C  CA  . ILE A  1 264 ? 117.350 163.799 148.358 1.00 26.52  ? 285 ILE A CA  1 
ATOM   1992  C  C   . ILE A  1 264 ? 118.739 164.456 148.262 1.00 26.47  ? 285 ILE A C   1 
ATOM   1993  O  O   . ILE A  1 264 ? 119.624 164.183 149.154 1.00 24.69  ? 285 ILE A O   1 
ATOM   1994  C  CB  . ILE A  1 264 ? 116.647 164.211 149.659 1.00 26.56  ? 285 ILE A CB  1 
ATOM   1995  C  CG1 . ILE A  1 264 ? 115.297 163.518 149.839 1.00 27.65  ? 285 ILE A CG1 1 
ATOM   1996  C  CG2 . ILE A  1 264 ? 116.532 165.731 149.785 1.00 25.82  ? 285 ILE A CG2 1 
ATOM   1997  C  CD1 . ILE A  1 264 ? 114.323 163.958 148.815 1.00 29.06  ? 285 ILE A CD1 1 
ATOM   1998  N  N   . GLU A  1 265 ? 118.942 165.237 147.191 1.00 26.42  ? 286 GLU A N   1 
ATOM   1999  C  CA  . GLU A  1 265 ? 120.251 165.887 146.940 1.00 28.13  ? 286 GLU A CA  1 
ATOM   2000  C  C   . GLU A  1 265 ? 120.015 167.348 146.554 1.00 27.80  ? 286 GLU A C   1 
ATOM   2001  O  O   . GLU A  1 265 ? 119.746 167.650 145.390 1.00 27.96  ? 286 GLU A O   1 
ATOM   2002  C  CB  . GLU A  1 265 ? 120.976 165.054 145.887 1.00 30.64  ? 286 GLU A CB  1 
ATOM   2003  C  CG  . GLU A  1 265 ? 122.453 165.379 145.768 1.00 32.90  ? 286 GLU A CG  1 
ATOM   2004  C  CD  . GLU A  1 265 ? 123.264 165.173 147.030 1.00 34.04  ? 286 GLU A CD  1 
ATOM   2005  O  OE1 . GLU A  1 265 ? 123.083 164.069 147.667 1.00 33.09  ? 286 GLU A OE1 1 
ATOM   2006  O  OE2 . GLU A  1 265 ? 124.090 166.122 147.353 1.00 34.97  ? 286 GLU A OE2 1 
ATOM   2007  N  N   . PRO A  1 266 ? 120.015 168.269 147.546 1.00 26.91  ? 287 PRO A N   1 
ATOM   2008  C  CA  . PRO A  1 266 ? 119.787 169.682 147.302 1.00 26.09  ? 287 PRO A CA  1 
ATOM   2009  C  C   . PRO A  1 266 ? 120.745 170.253 146.245 1.00 26.06  ? 287 PRO A C   1 
ATOM   2010  O  O   . PRO A  1 266 ? 121.841 169.780 146.112 1.00 25.85  ? 287 PRO A O   1 
ATOM   2011  C  CB  . PRO A  1 266 ? 120.075 170.322 148.664 1.00 26.40  ? 287 PRO A CB  1 
ATOM   2012  C  CG  . PRO A  1 266 ? 119.705 169.226 149.633 1.00 26.38  ? 287 PRO A CG  1 
ATOM   2013  C  CD  . PRO A  1 266 ? 120.305 168.007 148.975 1.00 26.79  ? 287 PRO A CD  1 
ATOM   2014  N  N   . GLY A  1 267 ? 120.243 171.256 145.529 1.00 25.98  ? 288 GLY A N   1 
ATOM   2015  C  CA  . GLY A  1 267 ? 120.945 172.113 144.554 1.00 27.17  ? 288 GLY A CA  1 
ATOM   2016  C  C   . GLY A  1 267 ? 120.850 171.535 143.154 1.00 27.43  ? 288 GLY A C   1 
ATOM   2017  O  O   . GLY A  1 267 ? 121.863 171.523 142.453 1.00 29.81  ? 288 GLY A O   1 
ATOM   2018  N  N   . GLY A  1 268 ? 119.685 171.070 142.739 1.00 26.67  ? 289 GLY A N   1 
ATOM   2019  C  CA  . GLY A  1 268 ? 119.490 170.483 141.402 1.00 27.39  ? 289 GLY A CA  1 
ATOM   2020  C  C   . GLY A  1 268 ? 118.869 171.434 140.384 1.00 28.25  ? 289 GLY A C   1 
ATOM   2021  O  O   . GLY A  1 268 ? 118.826 172.650 140.621 1.00 28.87  ? 289 GLY A O   1 
ATOM   2022  N  N   . LEU A  1 269 ? 118.465 170.873 139.263 1.00 28.84  ? 290 LEU A N   1 
ATOM   2023  C  CA  . LEU A  1 269 ? 117.837 171.591 138.134 1.00 31.36  ? 290 LEU A CA  1 
ATOM   2024  C  C   . LEU A  1 269 ? 116.361 171.882 138.452 1.00 31.48  ? 290 LEU A C   1 
ATOM   2025  O  O   . LEU A  1 269 ? 115.719 171.060 139.168 1.00 30.61  ? 290 LEU A O   1 
ATOM   2026  C  CB  . LEU A  1 269 ? 117.888 170.695 136.903 1.00 32.44  ? 290 LEU A CB  1 
ATOM   2027  C  CG  . LEU A  1 269 ? 119.268 170.413 136.347 1.00 33.31  ? 290 LEU A CG  1 
ATOM   2028  C  CD1 . LEU A  1 269 ? 119.295 169.090 135.614 1.00 33.86  ? 290 LEU A CD1 1 
ATOM   2029  C  CD2 . LEU A  1 269 ? 119.683 171.525 135.414 1.00 35.55  ? 290 LEU A CD2 1 
ATOM   2030  N  N   . SER A  1 270 ? 115.808 172.921 137.838 1.00 32.46  ? 291 SER A N   1 
ATOM   2031  C  CA  . SER A  1 270 ? 114.352 173.185 137.861 1.00 32.73  ? 291 SER A CA  1 
ATOM   2032  C  C   . SER A  1 270 ? 113.691 172.253 136.848 1.00 33.46  ? 291 SER A C   1 
ATOM   2033  O  O   . SER A  1 270 ? 114.399 171.723 135.954 1.00 35.47  ? 291 SER A O   1 
ATOM   2034  C  CB  . SER A  1 270 ? 114.055 174.663 137.613 1.00 34.15  ? 291 SER A CB  1 
ATOM   2035  O  OG  . SER A  1 270 ? 114.046 175.039 136.231 1.00 36.22  ? 291 SER A OG  1 
ATOM   2036  N  N   . PHE A  1 271 ? 112.385 172.095 136.934 1.00 32.85  ? 292 PHE A N   1 
ATOM   2037  C  CA  . PHE A  1 271 ? 111.602 171.402 135.885 1.00 33.88  ? 292 PHE A CA  1 
ATOM   2038  C  C   . PHE A  1 271 ? 111.742 172.127 134.537 1.00 35.70  ? 292 PHE A C   1 
ATOM   2039  O  O   . PHE A  1 271 ? 111.878 171.449 133.522 1.00 37.14  ? 292 PHE A O   1 
ATOM   2040  C  CB  . PHE A  1 271 ? 110.128 171.249 136.283 1.00 33.88  ? 292 PHE A CB  1 
ATOM   2041  C  CG  . PHE A  1 271 ? 109.477 170.161 135.470 1.00 34.97  ? 292 PHE A CG  1 
ATOM   2042  C  CD1 . PHE A  1 271 ? 108.911 170.447 134.242 1.00 37.50  ? 292 PHE A CD1 1 
ATOM   2043  C  CD2 . PHE A  1 271 ? 109.598 168.840 135.848 1.00 33.88  ? 292 PHE A CD2 1 
ATOM   2044  C  CE1 . PHE A  1 271 ? 108.419 169.431 133.448 1.00 39.24  ? 292 PHE A CE1 1 
ATOM   2045  C  CE2 . PHE A  1 271 ? 109.069 167.835 135.068 1.00 35.50  ? 292 PHE A CE2 1 
ATOM   2046  C  CZ  . PHE A  1 271 ? 108.495 168.122 133.863 1.00 37.98  ? 292 PHE A CZ  1 
ATOM   2047  N  N   . ARG A  1 272 ? 111.655 173.456 134.512 1.00 36.17  ? 293 ARG A N   1 
ATOM   2048  C  CA  . ARG A  1 272 ? 111.796 174.263 133.263 1.00 38.56  ? 293 ARG A CA  1 
ATOM   2049  C  C   . ARG A  1 272 ? 113.238 174.149 132.725 1.00 38.54  ? 293 ARG A C   1 
ATOM   2050  O  O   . ARG A  1 272 ? 113.358 174.155 131.497 1.00 40.21  ? 293 ARG A O   1 
ATOM   2051  C  CB  . ARG A  1 272 ? 111.388 175.721 133.490 1.00 39.74  ? 293 ARG A CB  1 
ATOM   2052  C  CG  . ARG A  1 272 ? 111.401 176.578 132.228 1.00 42.92  ? 293 ARG A CG  1 
ATOM   2053  C  CD  . ARG A  1 272 ? 110.580 175.958 131.106 1.00 44.61  ? 293 ARG A CD  1 
ATOM   2054  N  NE  . ARG A  1 272 ? 109.244 175.517 131.519 1.00 44.15  ? 293 ARG A NE  1 
ATOM   2055  C  CZ  . ARG A  1 272 ? 108.374 174.866 130.739 1.00 45.14  ? 293 ARG A CZ  1 
ATOM   2056  N  NH1 . ARG A  1 272 ? 108.689 174.548 129.494 1.00 46.51  ? 293 ARG A NH1 1 
ATOM   2057  N  NH2 . ARG A  1 272 ? 107.188 174.525 131.224 1.00 44.49  ? 293 ARG A NH2 1 
ATOM   2058  N  N   . ASP A  1 273 ? 114.263 173.976 133.588 1.00 36.65  ? 294 ASP A N   1 
ATOM   2059  C  CA  . ASP A  1 273 ? 115.672 173.762 133.143 1.00 37.35  ? 294 ASP A CA  1 
ATOM   2060  C  C   . ASP A  1 273 ? 115.743 172.497 132.284 1.00 37.69  ? 294 ASP A C   1 
ATOM   2061  O  O   . ASP A  1 273 ? 116.299 172.511 131.222 1.00 38.65  ? 294 ASP A O   1 
ATOM   2062  C  CB  . ASP A  1 273 ? 116.694 173.606 134.279 1.00 35.65  ? 294 ASP A CB  1 
ATOM   2063  C  CG  . ASP A  1 273 ? 116.918 174.865 135.082 1.00 36.03  ? 294 ASP A CG  1 
ATOM   2064  O  OD1 . ASP A  1 273 ? 116.757 175.944 134.481 1.00 38.34  ? 294 ASP A OD1 1 
ATOM   2065  O  OD2 . ASP A  1 273 ? 117.264 174.771 136.314 1.00 34.53  ? 294 ASP A OD2 1 
ATOM   2066  N  N   . VAL A  1 274 ? 115.164 171.430 132.779 1.00 36.87  ? 295 VAL A N   1 
ATOM   2067  C  CA  . VAL A  1 274 ? 115.143 170.138 132.067 1.00 37.75  ? 295 VAL A CA  1 
ATOM   2068  C  C   . VAL A  1 274 ? 114.377 170.329 130.777 1.00 40.36  ? 295 VAL A C   1 
ATOM   2069  O  O   . VAL A  1 274 ? 114.807 169.796 129.753 1.00 42.04  ? 295 VAL A O   1 
ATOM   2070  C  CB  . VAL A  1 274 ? 114.527 169.045 132.943 1.00 36.19  ? 295 VAL A CB  1 
ATOM   2071  C  CG1 . VAL A  1 274 ? 114.270 167.755 132.174 1.00 37.37  ? 295 VAL A CG1 1 
ATOM   2072  C  CG2 . VAL A  1 274 ? 115.439 168.787 134.116 1.00 34.42  ? 295 VAL A CG2 1 
ATOM   2073  N  N   . LEU A  1 275 ? 113.279 171.052 130.810 1.00 40.97  ? 296 LEU A N   1 
ATOM   2074  C  CA  . LEU A  1 275 ? 112.525 171.181 129.550 1.00 44.01  ? 296 LEU A CA  1 
ATOM   2075  C  C   . LEU A  1 275 ? 113.318 172.035 128.559 1.00 46.54  ? 296 LEU A C   1 
ATOM   2076  O  O   . LEU A  1 275 ? 113.272 171.708 127.367 1.00 48.70  ? 296 LEU A O   1 
ATOM   2077  C  CB  . LEU A  1 275 ? 111.132 171.727 129.860 1.00 44.36  ? 296 LEU A CB  1 
ATOM   2078  C  CG  . LEU A  1 275 ? 110.179 170.724 130.509 1.00 42.41  ? 296 LEU A CG  1 
ATOM   2079  C  CD1 . LEU A  1 275 ? 108.767 171.273 130.421 1.00 43.75  ? 296 LEU A CD1 1 
ATOM   2080  C  CD2 . LEU A  1 275 ? 110.254 169.332 129.860 1.00 42.66  ? 296 LEU A CD2 1 
ATOM   2081  N  N   . ASN A  1 276 ? 114.071 173.015 129.035 1.00 46.79  ? 297 ASN A N   1 
ATOM   2082  C  CA  . ASN A  1 276 ? 114.906 173.847 128.137 1.00 49.34  ? 297 ASN A CA  1 
ATOM   2083  C  C   . ASN A  1 276 ? 115.914 172.930 127.453 1.00 49.25  ? 297 ASN A C   1 
ATOM   2084  O  O   . ASN A  1 276 ? 116.097 173.078 126.266 1.00 51.18  ? 297 ASN A O   1 
ATOM   2085  C  CB  . ASN A  1 276 ? 115.591 174.973 128.897 1.00 49.64  ? 297 ASN A CB  1 
ATOM   2086  C  CG  . ASN A  1 276 ? 114.613 176.034 129.322 1.00 50.56  ? 297 ASN A CG  1 
ATOM   2087  O  OD1 . ASN A  1 276 ? 113.457 175.982 128.962 1.00 52.48  ? 297 ASN A OD1 1 
ATOM   2088  N  ND2 . ASN A  1 276 ? 115.073 177.001 130.081 1.00 50.32  ? 297 ASN A ND2 1 
ATOM   2089  N  N   . ILE A  1 277 ? 116.456 171.960 128.185 1.00 47.07  ? 298 ILE A N   1 
ATOM   2090  C  CA  . ILE A  1 277 ? 117.481 171.004 127.662 1.00 47.51  ? 298 ILE A CA  1 
ATOM   2091  C  C   . ILE A  1 277 ? 116.803 170.062 126.657 1.00 48.89  ? 298 ILE A C   1 
ATOM   2092  O  O   . ILE A  1 277 ? 117.382 169.881 125.516 1.00 50.73  ? 298 ILE A O   1 
ATOM   2093  C  CB  . ILE A  1 277 ? 118.228 170.232 128.768 1.00 45.27  ? 298 ILE A CB  1 
ATOM   2094  C  CG1 . ILE A  1 277 ? 119.020 171.168 129.680 1.00 44.64  ? 298 ILE A CG1 1 
ATOM   2095  C  CG2 . ILE A  1 277 ? 119.154 169.190 128.172 1.00 45.84  ? 298 ILE A CG2 1 
ATOM   2096  C  CD1 . ILE A  1 277 ? 119.600 170.470 130.875 1.00 42.47  ? 298 ILE A CD1 1 
ATOM   2097  N  N   . LEU A  1 278 ? 115.616 169.537 126.992 1.00 47.76  ? 299 LEU A N   1 
ATOM   2098  C  CA  . LEU A  1 278 ? 114.925 168.559 126.093 1.00 49.51  ? 299 LEU A CA  1 
ATOM   2099  C  C   . LEU A  1 278 ? 114.369 169.238 124.837 1.00 51.86  ? 299 LEU A C   1 
ATOM   2100  O  O   . LEU A  1 278 ? 114.597 168.667 123.774 1.00 53.68  ? 299 LEU A O   1 
ATOM   2101  C  CB  . LEU A  1 278 ? 113.835 167.790 126.834 1.00 48.22  ? 299 LEU A CB  1 
ATOM   2102  C  CG  . LEU A  1 278 ? 114.367 167.006 128.019 1.00 46.34  ? 299 LEU A CG  1 
ATOM   2103  C  CD1 . LEU A  1 278 ? 113.232 166.456 128.839 1.00 45.43  ? 299 LEU A CD1 1 
ATOM   2104  C  CD2 . LEU A  1 278 ? 115.287 165.887 127.557 1.00 47.16  ? 299 LEU A CD2 1 
ATOM   2105  N  N   . HIS A  1 279 ? 113.682 170.376 124.965 1.00 52.03  ? 300 HIS A N   1 
ATOM   2106  C  CA  . HIS A  1 279 ? 113.020 171.081 123.838 1.00 55.45  ? 300 HIS A CA  1 
ATOM   2107  C  C   . HIS A  1 279 ? 114.061 171.524 122.799 1.00 58.50  ? 300 HIS A C   1 
ATOM   2108  O  O   . HIS A  1 279 ? 113.756 171.408 121.600 1.00 60.59  ? 300 HIS A O   1 
ATOM   2109  C  CB  . HIS A  1 279 ? 112.121 172.208 124.341 1.00 55.01  ? 300 HIS A CB  1 
ATOM   2110  C  CG  . HIS A  1 279 ? 110.874 171.661 124.937 1.00 53.85  ? 300 HIS A CG  1 
ATOM   2111  N  ND1 . HIS A  1 279 ? 110.092 172.395 125.796 1.00 52.67  ? 300 HIS A ND1 1 
ATOM   2112  C  CD2 . HIS A  1 279 ? 110.307 170.430 124.841 1.00 53.37  ? 300 HIS A CD2 1 
ATOM   2113  C  CE1 . HIS A  1 279 ? 109.068 171.653 126.166 1.00 52.00  ? 300 HIS A CE1 1 
ATOM   2114  N  NE2 . HIS A  1 279 ? 109.180 170.442 125.604 1.00 52.37  ? 300 HIS A NE2 1 
ATOM   2115  N  N   . ASN A  1 280 ? 115.253 171.936 123.241 1.00 58.50  ? 301 ASN A N   1 
ATOM   2116  C  CA  . ASN A  1 280 ? 116.347 172.439 122.363 1.00 61.49  ? 301 ASN A CA  1 
ATOM   2117  C  C   . ASN A  1 280 ? 117.331 171.331 121.980 1.00 61.24  ? 301 ASN A C   1 
ATOM   2118  O  O   . ASN A  1 280 ? 118.144 171.570 121.097 1.00 64.37  ? 301 ASN A O   1 
ATOM   2119  C  CB  . ASN A  1 280 ? 117.076 173.605 123.027 1.00 61.64  ? 301 ASN A CB  1 
ATOM   2120  C  CG  . ASN A  1 280 ? 116.165 174.785 123.312 1.00 62.83  ? 301 ASN A CG  1 
ATOM   2121  O  OD1 . ASN A  1 280 ? 115.632 175.430 122.394 1.00 66.65  ? 301 ASN A OD1 1 
ATOM   2122  N  ND2 . ASN A  1 280 ? 116.039 175.121 124.581 1.00 60.40  ? 301 ASN A ND2 1 
ATOM   2123  N  N   . LEU A  1 281 ? 117.263 170.145 122.569 1.00 53.50  ? 302 LEU A N   1 
ATOM   2124  C  CA  . LEU A  1 281 ? 118.187 169.045 122.176 1.00 53.64  ? 302 LEU A CA  1 
ATOM   2125  C  C   . LEU A  1 281 ? 117.906 168.673 120.723 1.00 56.25  ? 302 LEU A C   1 
ATOM   2126  O  O   . LEU A  1 281 ? 116.783 168.233 120.409 1.00 57.04  ? 302 LEU A O   1 
ATOM   2127  C  CB  . LEU A  1 281 ? 118.041 167.817 123.079 1.00 51.22  ? 302 LEU A CB  1 
ATOM   2128  C  CG  . LEU A  1 281 ? 118.748 166.550 122.582 1.00 51.75  ? 302 LEU A CG  1 
ATOM   2129  C  CD1 . LEU A  1 281 ? 120.244 166.748 122.470 1.00 52.63  ? 302 LEU A CD1 1 
ATOM   2130  C  CD2 . LEU A  1 281 ? 118.449 165.370 123.502 1.00 49.61  ? 302 LEU A CD2 1 
ATOM   2131  N  N   . GLN A  1 282 ? 118.897 168.827 119.862 1.00 58.18  ? 303 GLN A N   1 
ATOM   2132  C  CA  . GLN A  1 282 ? 118.773 168.402 118.447 1.00 60.74  ? 303 GLN A CA  1 
ATOM   2133  C  C   . GLN A  1 282 ? 119.349 166.974 118.343 1.00 59.44  ? 303 GLN A C   1 
ATOM   2134  O  O   . GLN A  1 282 ? 120.563 166.723 118.667 1.00 59.31  ? 303 GLN A O   1 
ATOM   2135  C  CB  . GLN A  1 282 ? 119.420 169.444 117.544 1.00 64.00  ? 303 GLN A CB  1 
ATOM   2136  C  CG  . GLN A  1 282 ? 118.917 169.360 116.123 1.00 67.82  ? 303 GLN A CG  1 
ATOM   2137  C  CD  . GLN A  1 282 ? 119.602 170.372 115.243 1.00 71.49  ? 303 GLN A CD  1 
ATOM   2138  O  OE1 . GLN A  1 282 ? 119.739 170.168 114.036 1.00 74.40  ? 303 GLN A OE1 1 
ATOM   2139  N  NE2 . GLN A  1 282 ? 120.028 171.473 115.854 1.00 71.90  ? 303 GLN A NE2 1 
ATOM   2140  N  N   . ALA A  1 283 ? 118.491 166.032 117.993 1.00 58.73  ? 304 ALA A N   1 
ATOM   2141  C  CA  . ALA A  1 283 ? 118.841 164.611 118.072 1.00 58.19  ? 304 ALA A CA  1 
ATOM   2142  C  C   . ALA A  1 283 ? 117.713 163.781 117.487 1.00 59.65  ? 304 ALA A C   1 
ATOM   2143  O  O   . ALA A  1 283 ? 116.540 164.123 117.718 1.00 60.74  ? 304 ALA A O   1 
ATOM   2144  C  CB  . ALA A  1 283 ? 119.047 164.265 119.511 1.00 55.84  ? 304 ALA A CB  1 
ATOM   2145  N  N   . ASP A  1 284 ? 118.083 162.708 116.801 1.00 61.00  ? 305 ASP A N   1 
ATOM   2146  C  CA  . ASP A  1 284 ? 117.179 161.590 116.452 1.00 61.94  ? 305 ASP A CA  1 
ATOM   2147  C  C   . ASP A  1 284 ? 117.108 160.695 117.687 1.00 59.59  ? 305 ASP A C   1 
ATOM   2148  O  O   . ASP A  1 284 ? 118.087 159.959 117.908 1.00 59.21  ? 305 ASP A O   1 
ATOM   2149  C  CB  . ASP A  1 284 ? 117.715 160.788 115.270 1.00 64.49  ? 305 ASP A CB  1 
ATOM   2150  C  CG  . ASP A  1 284 ? 116.808 159.639 114.882 1.00 66.00  ? 305 ASP A CG  1 
ATOM   2151  O  OD1 . ASP A  1 284 ? 115.693 159.573 115.442 1.00 65.21  ? 305 ASP A OD1 1 
ATOM   2152  O  OD2 . ASP A  1 284 ? 117.196 158.852 114.001 1.00 68.46  ? 305 ASP A OD2 1 
ATOM   2153  N  N   . VAL A  1 285 ? 116.042 160.798 118.481 1.00 58.38  ? 306 VAL A N   1 
ATOM   2154  C  CA  . VAL A  1 285 ? 115.917 160.056 119.779 1.00 56.38  ? 306 VAL A CA  1 
ATOM   2155  C  C   . VAL A  1 285 ? 115.270 158.685 119.530 1.00 57.59  ? 306 VAL A C   1 
ATOM   2156  O  O   . VAL A  1 285 ? 114.126 158.668 119.041 1.00 60.34  ? 306 VAL A O   1 
ATOM   2157  C  CB  . VAL A  1 285 ? 115.136 160.871 120.823 1.00 54.29  ? 306 VAL A CB  1 
ATOM   2158  C  CG1 . VAL A  1 285 ? 115.058 160.136 122.155 1.00 52.38  ? 306 VAL A CG1 1 
ATOM   2159  C  CG2 . VAL A  1 285 ? 115.727 162.263 121.024 1.00 53.60  ? 306 VAL A CG2 1 
ATOM   2160  N  N   . VAL A  1 286 ? 115.979 157.592 119.841 1.00 57.28  ? 307 VAL A N   1 
ATOM   2161  C  CA  . VAL A  1 286 ? 115.599 156.192 119.474 1.00 59.26  ? 307 VAL A CA  1 
ATOM   2162  C  C   . VAL A  1 286 ? 115.089 155.451 120.707 1.00 58.54  ? 307 VAL A C   1 
ATOM   2163  O  O   . VAL A  1 286 ? 114.649 154.292 120.564 1.00 60.73  ? 307 VAL A O   1 
ATOM   2164  C  CB  . VAL A  1 286 ? 116.772 155.416 118.847 1.00 61.04  ? 307 VAL A CB  1 
ATOM   2165  C  CG1 . VAL A  1 286 ? 117.290 156.085 117.581 1.00 62.94  ? 307 VAL A CG1 1 
ATOM   2166  C  CG2 . VAL A  1 286 ? 117.904 155.188 119.824 1.00 59.08  ? 307 VAL A CG2 1 
ATOM   2167  N  N   . GLY A  1 287 ? 115.202 156.069 121.880 1.00 56.14  ? 308 GLY A N   1 
ATOM   2168  C  CA  . GLY A  1 287 ? 114.808 155.436 123.149 1.00 55.14  ? 308 GLY A CA  1 
ATOM   2169  C  C   . GLY A  1 287 ? 115.005 156.386 124.308 1.00 52.36  ? 308 GLY A C   1 
ATOM   2170  O  O   . GLY A  1 287 ? 115.749 157.385 124.156 1.00 52.40  ? 308 GLY A O   1 
ATOM   2171  N  N   . ALA A  1 288 ? 114.359 156.114 125.431 1.00 50.79  ? 309 ALA A N   1 
ATOM   2172  C  CA  . ALA A  1 288 ? 114.457 156.985 126.616 1.00 47.90  ? 309 ALA A CA  1 
ATOM   2173  C  C   . ALA A  1 288 ? 113.900 156.238 127.816 1.00 46.62  ? 309 ALA A C   1 
ATOM   2174  O  O   . ALA A  1 288 ? 113.184 155.283 127.589 1.00 47.59  ? 309 ALA A O   1 
ATOM   2175  C  CB  . ALA A  1 288 ? 113.739 158.291 126.350 1.00 47.90  ? 309 ALA A CB  1 
ATOM   2176  N  N   . ASP A  1 289 ? 114.258 156.652 129.028 1.00 44.10  ? 310 ASP A N   1 
ATOM   2177  C  CA  . ASP A  1 289 ? 113.682 156.084 130.270 1.00 43.38  ? 310 ASP A CA  1 
ATOM   2178  C  C   . ASP A  1 289 ? 113.451 157.224 131.280 1.00 40.99  ? 310 ASP A C   1 
ATOM   2179  O  O   . ASP A  1 289 ? 114.054 158.305 131.168 1.00 41.32  ? 310 ASP A O   1 
ATOM   2180  C  CB  . ASP A  1 289 ? 114.525 154.906 130.805 1.00 44.38  ? 310 ASP A CB  1 
ATOM   2181  C  CG  . ASP A  1 289 ? 115.927 155.268 131.290 1.00 44.14  ? 310 ASP A CG  1 
ATOM   2182  O  OD1 . ASP A  1 289 ? 116.035 156.200 132.106 1.00 42.22  ? 310 ASP A OD1 1 
ATOM   2183  O  OD2 . ASP A  1 289 ? 116.910 154.647 130.808 1.00 47.52  ? 310 ASP A OD2 1 
ATOM   2184  N  N   . VAL A  1 290 ? 112.565 156.996 132.234 1.00 39.57  ? 311 VAL A N   1 
ATOM   2185  C  CA  . VAL A  1 290 ? 112.298 157.962 133.328 1.00 36.96  ? 311 VAL A CA  1 
ATOM   2186  C  C   . VAL A  1 290 ? 112.252 157.085 134.566 1.00 35.75  ? 311 VAL A C   1 
ATOM   2187  O  O   . VAL A  1 290 ? 111.293 156.273 134.645 1.00 36.33  ? 311 VAL A O   1 
ATOM   2188  C  CB  . VAL A  1 290 ? 111.009 158.791 133.130 1.00 36.87  ? 311 VAL A CB  1 
ATOM   2189  C  CG1 . VAL A  1 290 ? 110.696 159.633 134.355 1.00 35.19  ? 311 VAL A CG1 1 
ATOM   2190  C  CG2 . VAL A  1 290 ? 111.090 159.701 131.919 1.00 37.78  ? 311 VAL A CG2 1 
ATOM   2191  N  N   . VAL A  1 291 ? 113.283 157.188 135.416 1.00 33.70  ? 312 VAL A N   1 
ATOM   2192  C  CA  . VAL A  1 291 ? 113.561 156.165 136.460 1.00 33.46  ? 312 VAL A CA  1 
ATOM   2193  C  C   . VAL A  1 291 ? 113.655 156.872 137.805 1.00 31.54  ? 312 VAL A C   1 
ATOM   2194  O  O   . VAL A  1 291 ? 113.737 158.091 137.825 1.00 29.93  ? 312 VAL A O   1 
ATOM   2195  C  CB  . VAL A  1 291 ? 114.844 155.374 136.174 1.00 34.52  ? 312 VAL A CB  1 
ATOM   2196  C  CG1 . VAL A  1 291 ? 114.840 154.745 134.792 1.00 36.42  ? 312 VAL A CG1 1 
ATOM   2197  C  CG2 . VAL A  1 291 ? 116.066 156.241 136.335 1.00 34.25  ? 312 VAL A CG2 1 
ATOM   2198  N  N   . GLU A  1 292 ? 113.619 156.090 138.871 1.00 31.19  ? 313 GLU A N   1 
ATOM   2199  C  CA  . GLU A  1 292 ? 113.912 156.506 140.273 1.00 30.59  ? 313 GLU A CA  1 
ATOM   2200  C  C   . GLU A  1 292 ? 112.835 157.432 140.852 1.00 28.71  ? 313 GLU A C   1 
ATOM   2201  O  O   . GLU A  1 292 ? 113.095 158.037 141.884 1.00 29.00  ? 313 GLU A O   1 
ATOM   2202  C  CB  . GLU A  1 292 ? 115.283 157.156 140.383 1.00 29.71  ? 313 GLU A CB  1 
ATOM   2203  C  CG  . GLU A  1 292 ? 116.388 156.176 140.195 1.00 31.82  ? 313 GLU A CG  1 
ATOM   2204  C  CD  . GLU A  1 292 ? 116.627 155.148 141.275 1.00 33.07  ? 313 GLU A CD  1 
ATOM   2205  O  OE1 . GLU A  1 292 ? 115.996 155.258 142.349 1.00 32.67  ? 313 GLU A OE1 1 
ATOM   2206  O  OE2 . GLU A  1 292 ? 117.460 154.215 141.023 1.00 35.69  ? 313 GLU A OE2 1 
ATOM   2207  N  N   . PHE A  1 293 ? 111.675 157.540 140.240 1.00 28.10  ? 314 PHE A N   1 
ATOM   2208  C  CA  . PHE A  1 293 ? 110.490 158.081 140.938 1.00 27.12  ? 314 PHE A CA  1 
ATOM   2209  C  C   . PHE A  1 293 ? 110.120 157.108 142.056 1.00 26.85  ? 314 PHE A C   1 
ATOM   2210  O  O   . PHE A  1 293 ? 109.924 155.953 141.790 1.00 27.67  ? 314 PHE A O   1 
ATOM   2211  C  CB  . PHE A  1 293 ? 109.339 158.320 139.971 1.00 27.72  ? 314 PHE A CB  1 
ATOM   2212  C  CG  . PHE A  1 293 ? 107.999 158.506 140.602 1.00 27.50  ? 314 PHE A CG  1 
ATOM   2213  C  CD1 . PHE A  1 293 ? 107.854 159.259 141.749 1.00 27.12  ? 314 PHE A CD1 1 
ATOM   2214  C  CD2 . PHE A  1 293 ? 106.864 157.968 140.012 1.00 29.43  ? 314 PHE A CD2 1 
ATOM   2215  C  CE1 . PHE A  1 293 ? 106.616 159.429 142.330 1.00 27.19  ? 314 PHE A CE1 1 
ATOM   2216  C  CE2 . PHE A  1 293 ? 105.607 158.144 140.584 1.00 29.47  ? 314 PHE A CE2 1 
ATOM   2217  C  CZ  . PHE A  1 293 ? 105.495 158.869 141.747 1.00 28.90  ? 314 PHE A CZ  1 
ATOM   2218  N  N   . ASN A  1 294 ? 110.068 157.588 143.289 1.00 26.00  ? 315 ASN A N   1 
ATOM   2219  C  CA  . ASN A  1 294 ? 109.752 156.746 144.467 1.00 26.65  ? 315 ASN A CA  1 
ATOM   2220  C  C   . ASN A  1 294 ? 108.443 157.227 145.091 1.00 26.63  ? 315 ASN A C   1 
ATOM   2221  O  O   . ASN A  1 294 ? 108.426 158.212 145.843 1.00 24.83  ? 315 ASN A O   1 
ATOM   2222  C  CB  . ASN A  1 294 ? 110.912 156.714 145.454 1.00 26.27  ? 315 ASN A CB  1 
ATOM   2223  C  CG  . ASN A  1 294 ? 110.571 155.818 146.621 1.00 26.39  ? 315 ASN A CG  1 
ATOM   2224  O  OD1 . ASN A  1 294 ? 109.364 155.614 146.873 1.00 25.83  ? 315 ASN A OD1 1 
ATOM   2225  N  ND2 . ASN A  1 294 ? 111.593 155.312 147.302 1.00 25.90  ? 315 ASN A ND2 1 
ATOM   2226  N  N   . PRO A  1 295 ? 107.304 156.573 144.741 1.00 28.11  ? 316 PRO A N   1 
ATOM   2227  C  CA  . PRO A  1 295 ? 105.993 157.035 145.171 1.00 28.52  ? 316 PRO A CA  1 
ATOM   2228  C  C   . PRO A  1 295 ? 105.886 157.054 146.701 1.00 28.76  ? 316 PRO A C   1 
ATOM   2229  O  O   . PRO A  1 295 ? 105.132 157.889 147.203 1.00 27.98  ? 316 PRO A O   1 
ATOM   2230  C  CB  . PRO A  1 295 ? 105.021 156.002 144.586 1.00 30.57  ? 316 PRO A CB  1 
ATOM   2231  C  CG  . PRO A  1 295 ? 105.757 155.432 143.420 1.00 31.16  ? 316 PRO A CG  1 
ATOM   2232  C  CD  . PRO A  1 295 ? 107.212 155.412 143.849 1.00 29.80  ? 316 PRO A CD  1 
ATOM   2233  N  N   . GLN A  1 296 ? 106.670 156.217 147.391 1.00 29.33  ? 317 GLN A N   1 
ATOM   2234  C  CA  . GLN A  1 296 ? 106.609 156.136 148.878 1.00 31.37  ? 317 GLN A CA  1 
ATOM   2235  C  C   . GLN A  1 296 ? 107.264 157.356 149.513 1.00 30.31  ? 317 GLN A C   1 
ATOM   2236  O  O   . GLN A  1 296 ? 107.000 157.558 150.688 1.00 31.33  ? 317 GLN A O   1 
ATOM   2237  C  CB  . GLN A  1 296 ? 107.190 154.835 149.426 1.00 32.79  ? 317 GLN A CB  1 
ATOM   2238  C  CG  . GLN A  1 296 ? 106.498 153.640 148.806 1.00 35.31  ? 317 GLN A CG  1 
ATOM   2239  C  CD  . GLN A  1 296 ? 107.015 152.309 149.290 1.00 37.71  ? 317 GLN A CD  1 
ATOM   2240  O  OE1 . GLN A  1 296 ? 108.178 151.949 149.023 1.00 37.63  ? 317 GLN A OE1 1 
ATOM   2241  N  NE2 . GLN A  1 296 ? 106.116 151.584 149.967 1.00 38.05  ? 317 GLN A NE2 1 
ATOM   2242  N  N   . ARG A  1 297 ? 108.017 158.147 148.749 1.00 29.26  ? 318 ARG A N   1 
ATOM   2243  C  CA  . ARG A  1 297 ? 108.662 159.377 149.275 1.00 28.80  ? 318 ARG A CA  1 
ATOM   2244  C  C   . ARG A  1 297 ? 107.985 160.621 148.686 1.00 27.03  ? 318 ARG A C   1 
ATOM   2245  O  O   . ARG A  1 297 ? 108.476 161.724 148.936 1.00 26.10  ? 318 ARG A O   1 
ATOM   2246  C  CB  . ARG A  1 297 ? 110.152 159.353 148.920 1.00 31.31  ? 318 ARG A CB  1 
ATOM   2247  C  CG  . ARG A  1 297 ? 110.991 158.443 149.803 1.00 34.05  ? 318 ARG A CG  1 
ATOM   2248  C  CD  . ARG A  1 297 ? 110.957 158.981 151.216 1.00 37.44  ? 318 ARG A CD  1 
ATOM   2249  N  NE  . ARG A  1 297 ? 112.141 158.746 152.028 1.00 41.55  ? 318 ARG A NE  1 
ATOM   2250  C  CZ  . ARG A  1 297 ? 113.349 159.232 151.772 1.00 42.87  ? 318 ARG A CZ  1 
ATOM   2251  N  NH1 . ARG A  1 297 ? 113.561 159.969 150.696 1.00 41.31  ? 318 ARG A NH1 1 
ATOM   2252  N  NH2 . ARG A  1 297 ? 114.346 158.968 152.593 1.00 43.69  ? 318 ARG A NH2 1 
ATOM   2253  N  N   . ASP A  1 298 ? 106.864 160.445 147.985 1.00 26.23  ? 319 ASP A N   1 
ATOM   2254  C  CA  . ASP A  1 298 ? 106.203 161.551 147.248 1.00 25.74  ? 319 ASP A CA  1 
ATOM   2255  C  C   . ASP A  1 298 ? 105.261 162.266 148.198 1.00 25.49  ? 319 ASP A C   1 
ATOM   2256  O  O   . ASP A  1 298 ? 104.930 161.712 149.244 1.00 24.83  ? 319 ASP A O   1 
ATOM   2257  C  CB  . ASP A  1 298 ? 105.372 161.029 146.077 1.00 27.06  ? 319 ASP A CB  1 
ATOM   2258  C  CG  . ASP A  1 298 ? 105.086 162.035 144.975 1.00 27.15  ? 319 ASP A CG  1 
ATOM   2259  O  OD1 . ASP A  1 298 ? 105.603 163.176 145.007 1.00 26.18  ? 319 ASP A OD1 1 
ATOM   2260  O  OD2 . ASP A  1 298 ? 104.362 161.648 144.073 1.00 28.63  ? 319 ASP A OD2 1 
ATOM   2261  N  N   . THR A  1 299 ? 104.835 163.466 147.848 1.00 25.44  ? 320 THR A N   1 
ATOM   2262  C  CA  . THR A  1 299 ? 103.837 164.223 148.647 1.00 25.70  ? 320 THR A CA  1 
ATOM   2263  C  C   . THR A  1 299 ? 102.503 163.466 148.669 1.00 26.48  ? 320 THR A C   1 
ATOM   2264  O  O   . THR A  1 299 ? 102.294 162.592 147.826 1.00 26.66  ? 320 THR A O   1 
ATOM   2265  C  CB  . THR A  1 299 ? 103.659 165.616 148.031 1.00 26.24  ? 320 THR A CB  1 
ATOM   2266  O  OG1 . THR A  1 299 ? 102.997 165.539 146.763 1.00 26.40  ? 320 THR A OG1 1 
ATOM   2267  C  CG2 . THR A  1 299 ? 104.983 166.301 147.867 1.00 25.73  ? 320 THR A CG2 1 
ATOM   2268  N  N   . VAL A  1 300 ? 101.560 163.826 149.546 1.00 27.56  ? 321 VAL A N   1 
ATOM   2269  C  CA  . VAL A  1 300 ? 100.276 163.070 149.639 1.00 28.38  ? 321 VAL A CA  1 
ATOM   2270  C  C   . VAL A  1 300 ? 99.453  163.223 148.365 1.00 29.87  ? 321 VAL A C   1 
ATOM   2271  O  O   . VAL A  1 300 ? 98.558  162.381 148.144 1.00 31.33  ? 321 VAL A O   1 
ATOM   2272  C  CB  . VAL A  1 300 ? 99.498  163.423 150.910 1.00 29.26  ? 321 VAL A CB  1 
ATOM   2273  C  CG1 . VAL A  1 300 ? 100.333 163.103 152.159 1.00 28.44  ? 321 VAL A CG1 1 
ATOM   2274  C  CG2 . VAL A  1 300 ? 99.049  164.863 150.964 1.00 29.94  ? 321 VAL A CG2 1 
ATOM   2275  N  N   . ASP A  1 301 ? 99.681  164.254 147.573 1.00 30.54  ? 322 ASP A N   1 
ATOM   2276  C  CA  . ASP A  1 301 ? 98.830  164.510 146.374 1.00 33.45  ? 322 ASP A CA  1 
ATOM   2277  C  C   . ASP A  1 301 ? 99.556  164.070 145.093 1.00 32.86  ? 322 ASP A C   1 
ATOM   2278  O  O   . ASP A  1 301 ? 99.033  164.287 144.041 1.00 35.57  ? 322 ASP A O   1 
ATOM   2279  C  CB  . ASP A  1 301 ? 98.433  165.989 146.266 1.00 35.60  ? 322 ASP A CB  1 
ATOM   2280  C  CG  . ASP A  1 301 ? 97.646  166.515 147.465 1.00 36.74  ? 322 ASP A CG  1 
ATOM   2281  O  OD1 . ASP A  1 301 ? 96.740  165.830 147.913 1.00 38.24  ? 322 ASP A OD1 1 
ATOM   2282  O  OD2 . ASP A  1 301 ? 97.948  167.637 147.936 1.00 38.58  ? 322 ASP A OD2 1 
ATOM   2283  N  N   . GLY A  1 302 ? 100.734 163.487 145.189 1.00 31.41  ? 323 GLY A N   1 
ATOM   2284  C  CA  . GLY A  1 302 ? 101.459 162.894 144.054 1.00 31.60  ? 323 GLY A CA  1 
ATOM   2285  C  C   . GLY A  1 302 ? 102.137 163.910 143.162 1.00 31.31  ? 323 GLY A C   1 
ATOM   2286  O  O   . GLY A  1 302 ? 102.152 163.657 141.923 1.00 32.57  ? 323 GLY A O   1 
ATOM   2287  N  N   . MET A  1 303 ? 102.715 164.984 143.721 1.00 30.65  ? 324 MET A N   1 
ATOM   2288  C  CA  . MET A  1 303 ? 103.449 165.986 142.903 1.00 31.34  ? 324 MET A CA  1 
ATOM   2289  C  C   . MET A  1 303 ? 104.507 165.318 141.992 1.00 30.68  ? 324 MET A C   1 
ATOM   2290  O  O   . MET A  1 303 ? 104.572 165.636 140.776 1.00 31.81  ? 324 MET A O   1 
ATOM   2291  C  CB  . MET A  1 303 ? 104.152 167.015 143.780 1.00 31.67  ? 324 MET A CB  1 
ATOM   2292  C  CG  . MET A  1 303 ? 104.775 168.109 142.944 1.00 32.87  ? 324 MET A CG  1 
ATOM   2293  S  SD  . MET A  1 303 ? 105.180 169.517 143.928 1.00 35.64  ? 324 MET A SD  1 
ATOM   2294  C  CE  . MET A  1 303 ? 106.581 168.922 144.889 1.00 33.56  ? 324 MET A CE  1 
ATOM   2295  N  N   . THR A  1 304 ? 105.349 164.467 142.550 1.00 28.41  ? 325 THR A N   1 
ATOM   2296  C  CA  . THR A  1 304 ? 106.459 163.837 141.804 1.00 27.88  ? 325 THR A CA  1 
ATOM   2297  C  C   . THR A  1 304 ? 105.865 162.903 140.730 1.00 29.14  ? 325 THR A C   1 
ATOM   2298  O  O   . THR A  1 304 ? 106.501 162.765 139.633 1.00 28.81  ? 325 THR A O   1 
ATOM   2299  C  CB  . THR A  1 304 ? 107.430 163.138 142.755 1.00 26.02  ? 325 THR A CB  1 
ATOM   2300  O  OG1 . THR A  1 304 ? 107.803 164.003 143.839 1.00 25.71  ? 325 THR A OG1 1 
ATOM   2301  C  CG2 . THR A  1 304 ? 108.675 162.704 142.047 1.00 26.33  ? 325 THR A CG2 1 
ATOM   2302  N  N   . ALA A  1 305 ? 104.733 162.247 141.010 1.00 29.00  ? 326 ALA A N   1 
ATOM   2303  C  CA  . ALA A  1 305 ? 104.049 161.453 139.968 1.00 30.93  ? 326 ALA A CA  1 
ATOM   2304  C  C   . ALA A  1 305 ? 103.763 162.356 138.747 1.00 32.70  ? 326 ALA A C   1 
ATOM   2305  O  O   . ALA A  1 305 ? 103.988 161.880 137.581 1.00 33.96  ? 326 ALA A O   1 
ATOM   2306  C  CB  . ALA A  1 305 ? 102.796 160.783 140.488 1.00 30.95  ? 326 ALA A CB  1 
ATOM   2307  N  N   . MET A  1 306 ? 103.267 163.584 138.973 1.00 33.31  ? 327 MET A N   1 
ATOM   2308  C  CA  . MET A  1 306 ? 102.881 164.523 137.894 1.00 35.17  ? 327 MET A CA  1 
ATOM   2309  C  C   . MET A  1 306 ? 104.171 164.929 137.174 1.00 34.59  ? 327 MET A C   1 
ATOM   2310  O  O   . MET A  1 306 ? 104.197 164.980 135.910 1.00 34.43  ? 327 MET A O   1 
ATOM   2311  C  CB  . MET A  1 306 ? 102.150 165.754 138.432 1.00 37.18  ? 327 MET A CB  1 
ATOM   2312  C  CG  . MET A  1 306 ? 100.827 165.423 139.162 1.00 39.91  ? 327 MET A CG  1 
ATOM   2313  S  SD  . MET A  1 306 ? 99.579  164.612 138.069 1.00 46.11  ? 327 MET A SD  1 
ATOM   2314  C  CE  . MET A  1 306 ? 99.555  165.779 136.720 1.00 47.33  ? 327 MET A CE  1 
ATOM   2315  N  N   . VAL A  1 307 ? 105.213 165.177 137.961 1.00 32.66  ? 328 VAL A N   1 
ATOM   2316  C  CA  . VAL A  1 307 ? 106.565 165.512 137.447 1.00 33.42  ? 328 VAL A CA  1 
ATOM   2317  C  C   . VAL A  1 307 ? 107.082 164.391 136.530 1.00 34.39  ? 328 VAL A C   1 
ATOM   2318  O  O   . VAL A  1 307 ? 107.512 164.721 135.405 1.00 33.20  ? 328 VAL A O   1 
ATOM   2319  C  CB  . VAL A  1 307 ? 107.551 165.794 138.583 1.00 31.85  ? 328 VAL A CB  1 
ATOM   2320  C  CG1 . VAL A  1 307 ? 108.975 165.572 138.124 1.00 31.51  ? 328 VAL A CG1 1 
ATOM   2321  C  CG2 . VAL A  1 307 ? 107.320 167.200 139.135 1.00 32.36  ? 328 VAL A CG2 1 
ATOM   2322  N  N   . ALA A  1 308 ? 107.036 163.118 136.967 1.00 33.60  ? 329 ALA A N   1 
ATOM   2323  C  CA  . ALA A  1 308 ? 107.500 162.026 136.088 1.00 34.77  ? 329 ALA A CA  1 
ATOM   2324  C  C   . ALA A  1 308 ? 106.566 161.921 134.865 1.00 36.84  ? 329 ALA A C   1 
ATOM   2325  O  O   . ALA A  1 308 ? 107.062 161.732 133.771 1.00 38.66  ? 329 ALA A O   1 
ATOM   2326  C  CB  . ALA A  1 308 ? 107.613 160.737 136.864 1.00 34.98  ? 329 ALA A CB  1 
ATOM   2327  N  N   . ALA A  1 309 ? 105.251 162.045 135.024 1.00 37.25  ? 330 ALA A N   1 
ATOM   2328  C  CA  . ALA A  1 309 ? 104.331 161.936 133.878 1.00 39.67  ? 330 ALA A CA  1 
ATOM   2329  C  C   . ALA A  1 309 ? 104.663 163.017 132.829 1.00 40.48  ? 330 ALA A C   1 
ATOM   2330  O  O   . ALA A  1 309 ? 104.638 162.687 131.648 1.00 42.33  ? 330 ALA A O   1 
ATOM   2331  C  CB  . ALA A  1 309 ? 102.897 162.025 134.323 1.00 40.95  ? 330 ALA A CB  1 
ATOM   2332  N  N   . LYS A  1 310 ? 104.934 164.254 133.225 1.00 39.04  ? 331 LYS A N   1 
ATOM   2333  C  CA  . LYS A  1 310 ? 105.135 165.340 132.248 1.00 40.74  ? 331 LYS A CA  1 
ATOM   2334  C  C   . LYS A  1 310 ? 106.500 165.150 131.541 1.00 41.39  ? 331 LYS A C   1 
ATOM   2335  O  O   . LYS A  1 310 ? 106.582 165.479 130.346 1.00 40.97  ? 331 LYS A O   1 
ATOM   2336  C  CB  . LYS A  1 310 ? 104.956 166.735 132.854 1.00 40.64  ? 331 LYS A CB  1 
ATOM   2337  C  CG  . LYS A  1 310 ? 105.033 167.847 131.790 1.00 43.16  ? 331 LYS A CG  1 
ATOM   2338  C  CD  . LYS A  1 310 ? 104.677 169.222 132.304 1.00 43.93  ? 331 LYS A CD  1 
ATOM   2339  C  CE  . LYS A  1 310 ? 104.681 170.299 131.246 1.00 45.92  ? 331 LYS A CE  1 
ATOM   2340  N  NZ  . LYS A  1 310 ? 104.164 171.575 131.797 1.00 47.01  ? 331 LYS A NZ  1 
ATOM   2341  N  N   . LEU A  1 311 ? 107.537 164.628 132.218 1.00 39.77  ? 332 LEU A N   1 
ATOM   2342  C  CA  . LEU A  1 311 ? 108.774 164.190 131.532 1.00 39.40  ? 332 LEU A CA  1 
ATOM   2343  C  C   . LEU A  1 311 ? 108.400 163.112 130.500 1.00 41.50  ? 332 LEU A C   1 
ATOM   2344  O  O   . LEU A  1 311 ? 108.839 163.168 129.369 1.00 44.06  ? 332 LEU A O   1 
ATOM   2345  C  CB  . LEU A  1 311 ? 109.741 163.608 132.559 1.00 37.68  ? 332 LEU A CB  1 
ATOM   2346  C  CG  . LEU A  1 311 ? 110.339 164.582 133.557 1.00 36.77  ? 332 LEU A CG  1 
ATOM   2347  C  CD1 . LEU A  1 311 ? 111.148 163.830 134.622 1.00 35.48  ? 332 LEU A CD1 1 
ATOM   2348  C  CD2 . LEU A  1 311 ? 111.191 165.623 132.862 1.00 37.95  ? 332 LEU A CD2 1 
ATOM   2349  N  N   . VAL A  1 312 ? 107.608 162.120 130.867 1.00 41.53  ? 333 VAL A N   1 
ATOM   2350  C  CA  . VAL A  1 312 ? 107.249 161.064 129.886 1.00 43.50  ? 333 VAL A CA  1 
ATOM   2351  C  C   . VAL A  1 312 ? 106.556 161.718 128.672 1.00 45.23  ? 333 VAL A C   1 
ATOM   2352  O  O   . VAL A  1 312 ? 107.000 161.484 127.571 1.00 48.01  ? 333 VAL A O   1 
ATOM   2353  C  CB  . VAL A  1 312 ? 106.368 159.992 130.545 1.00 43.52  ? 333 VAL A CB  1 
ATOM   2354  C  CG1 . VAL A  1 312 ? 105.780 159.041 129.515 1.00 46.44  ? 333 VAL A CG1 1 
ATOM   2355  C  CG2 . VAL A  1 312 ? 107.157 159.229 131.569 1.00 41.76  ? 333 VAL A CG2 1 
ATOM   2356  N  N   . ARG A  1 313 ? 105.490 162.489 128.891 1.00 44.36  ? 334 ARG A N   1 
ATOM   2357  C  CA  . ARG A  1 313 ? 104.696 163.199 127.856 1.00 46.18  ? 334 ARG A CA  1 
ATOM   2358  C  C   . ARG A  1 313 ? 105.591 164.064 126.938 1.00 46.84  ? 334 ARG A C   1 
ATOM   2359  O  O   . ARG A  1 313 ? 105.387 164.004 125.695 1.00 49.24  ? 334 ARG A O   1 
ATOM   2360  C  CB  . ARG A  1 313 ? 103.643 164.080 128.534 1.00 45.57  ? 334 ARG A CB  1 
ATOM   2361  C  CG  . ARG A  1 313 ? 102.562 163.325 129.296 1.00 44.95  ? 334 ARG A CG  1 
ATOM   2362  C  CD  . ARG A  1 313 ? 101.774 164.253 130.209 1.00 44.15  ? 334 ARG A CD  1 
ATOM   2363  N  NE  . ARG A  1 313 ? 101.220 165.375 129.456 1.00 46.91  ? 334 ARG A NE  1 
ATOM   2364  C  CZ  . ARG A  1 313 ? 99.926  165.655 129.301 1.00 48.94  ? 334 ARG A CZ  1 
ATOM   2365  N  NH1 . ARG A  1 313 ? 98.982  164.943 129.896 1.00 49.04  ? 334 ARG A NH1 1 
ATOM   2366  N  NH2 . ARG A  1 313 ? 99.584  166.697 128.586 1.00 51.23  ? 334 ARG A NH2 1 
ATOM   2367  N  N   . GLU A  1 314 ? 106.513 164.864 127.493 1.00 45.00  ? 335 GLU A N   1 
ATOM   2368  C  CA  . GLU A  1 314 ? 107.437 165.722 126.704 1.00 46.35  ? 335 GLU A CA  1 
ATOM   2369  C  C   . GLU A  1 314 ? 108.425 164.850 125.926 1.00 47.07  ? 335 GLU A C   1 
ATOM   2370  O  O   . GLU A  1 314 ? 108.604 165.121 124.720 1.00 49.52  ? 335 GLU A O   1 
ATOM   2371  C  CB  . GLU A  1 314 ? 108.148 166.744 127.579 1.00 44.67  ? 335 GLU A CB  1 
ATOM   2372  C  CG  . GLU A  1 314 ? 107.187 167.818 128.067 1.00 45.42  ? 335 GLU A CG  1 
ATOM   2373  C  CD  . GLU A  1 314 ? 106.346 168.464 126.988 1.00 48.59  ? 335 GLU A CD  1 
ATOM   2374  O  OE1 . GLU A  1 314 ? 106.929 168.782 125.948 1.00 49.94  ? 335 GLU A OE1 1 
ATOM   2375  O  OE2 . GLU A  1 314 ? 105.113 168.659 127.199 1.00 49.61  ? 335 GLU A OE2 1 
ATOM   2376  N  N   . LEU A  1 315 ? 109.042 163.852 126.563 1.00 45.59  ? 336 LEU A N   1 
ATOM   2377  C  CA  . LEU A  1 315 ? 109.849 162.834 125.831 1.00 46.13  ? 336 LEU A CA  1 
ATOM   2378  C  C   . LEU A  1 315 ? 109.032 162.222 124.679 1.00 48.81  ? 336 LEU A C   1 
ATOM   2379  O  O   . LEU A  1 315 ? 109.560 162.075 123.558 1.00 50.87  ? 336 LEU A O   1 
ATOM   2380  C  CB  . LEU A  1 315 ? 110.300 161.743 126.802 1.00 44.53  ? 336 LEU A CB  1 
ATOM   2381  C  CG  . LEU A  1 315 ? 111.538 162.070 127.635 1.00 42.82  ? 336 LEU A CG  1 
ATOM   2382  C  CD1 . LEU A  1 315 ? 111.824 160.949 128.627 1.00 41.54  ? 336 LEU A CD1 1 
ATOM   2383  C  CD2 . LEU A  1 315 ? 112.752 162.301 126.739 1.00 43.74  ? 336 LEU A CD2 1 
ATOM   2384  N  N   . ALA A  1 316 ? 107.781 161.853 124.889 1.00 49.09  ? 337 ALA A N   1 
ATOM   2385  C  CA  . ALA A  1 316 ? 107.034 161.167 123.805 1.00 52.45  ? 337 ALA A CA  1 
ATOM   2386  C  C   . ALA A  1 316 ? 106.821 162.139 122.619 1.00 54.73  ? 337 ALA A C   1 
ATOM   2387  O  O   . ALA A  1 316 ? 106.719 161.686 121.494 1.00 56.86  ? 337 ALA A O   1 
ATOM   2388  C  CB  . ALA A  1 316 ? 105.748 160.605 124.348 1.00 52.47  ? 337 ALA A CB  1 
ATOM   2389  N  N   . ALA A  1 317 ? 106.744 163.441 122.888 1.00 54.98  ? 338 ALA A N   1 
ATOM   2390  C  CA  . ALA A  1 317 ? 106.462 164.506 121.901 1.00 58.55  ? 338 ALA A CA  1 
ATOM   2391  C  C   . ALA A  1 317 ? 107.725 164.721 121.071 1.00 59.69  ? 338 ALA A C   1 
ATOM   2392  O  O   . ALA A  1 317 ? 107.624 165.208 119.937 1.00 61.80  ? 338 ALA A O   1 
ATOM   2393  C  CB  . ALA A  1 317 ? 106.033 165.784 122.602 1.00 57.99  ? 338 ALA A CB  1 
ATOM   2394  N  N   . LYS A  1 318 ? 108.867 164.383 121.660 1.00 57.60  ? 339 LYS A N   1 
ATOM   2395  C  CA  . LYS A  1 318 ? 110.179 164.504 120.999 1.00 59.10  ? 339 LYS A CA  1 
ATOM   2396  C  C   . LYS A  1 318 ? 110.464 163.249 120.181 1.00 60.66  ? 339 LYS A C   1 
ATOM   2397  O  O   . LYS A  1 318 ? 111.094 163.384 119.109 1.00 64.80  ? 339 LYS A O   1 
ATOM   2398  C  CB  . LYS A  1 318 ? 111.275 164.719 122.046 1.00 56.65  ? 339 LYS A CB  1 
ATOM   2399  C  CG  . LYS A  1 318 ? 112.550 165.295 121.463 1.00 57.29  ? 339 LYS A CG  1 
ATOM   2400  C  CD  . LYS A  1 318 ? 113.547 165.600 122.504 1.00 55.39  ? 339 LYS A CD  1 
ATOM   2401  C  CE  . LYS A  1 318 ? 114.808 166.173 121.918 1.00 56.27  ? 339 LYS A CE  1 
ATOM   2402  N  NZ  . LYS A  1 318 ? 114.572 167.563 121.479 1.00 58.12  ? 339 LYS A NZ  1 
ATOM   2403  N  N   . ILE A  1 319 ? 110.041 162.082 120.668 1.00 59.91  ? 340 ILE A N   1 
ATOM   2404  C  CA  . ILE A  1 319 ? 110.401 160.770 120.057 1.00 61.20  ? 340 ILE A CA  1 
ATOM   2405  C  C   . ILE A  1 319 ? 109.458 160.494 118.892 1.00 64.78  ? 340 ILE A C   1 
ATOM   2406  O  O   . ILE A  1 319 ? 109.920 160.003 117.869 1.00 66.85  ? 340 ILE A O   1 
ATOM   2407  C  CB  . ILE A  1 319 ? 110.375 159.628 121.083 1.00 59.24  ? 340 ILE A CB  1 
ATOM   2408  C  CG1 . ILE A  1 319 ? 111.498 159.779 122.109 1.00 57.09  ? 340 ILE A CG1 1 
ATOM   2409  C  CG2 . ILE A  1 319 ? 110.455 158.282 120.384 1.00 61.85  ? 340 ILE A CG2 1 
ATOM   2410  C  CD1 . ILE A  1 319 ? 111.276 158.964 123.367 1.00 55.39  ? 340 ILE A CD1 1 
ATOM   2411  N  N   . SER A  1 320 ? 108.174 160.779 119.073 1.00 65.77  ? 341 SER A N   1 
ATOM   2412  C  CA  . SER A  1 320 ? 107.149 160.564 118.025 1.00 69.72  ? 341 SER A CA  1 
ATOM   2413  C  C   . SER A  1 320 ? 107.366 161.592 116.903 1.00 71.19  ? 341 SER A C   1 
ATOM   2414  O  O   . SER A  1 320 ? 107.897 162.683 117.190 1.00 68.72  ? 341 SER A O   1 
ATOM   2415  C  CB  . SER A  1 320 ? 105.762 160.571 118.641 1.00 70.39  ? 341 SER A CB  1 
ATOM   2416  O  OG  . SER A  1 320 ? 105.666 159.575 119.669 1.00 68.22  ? 341 SER A OG  1 
ATOM   2417  N  N   . LYS A  1 321 ? 107.105 161.187 115.657 1.00 74.96  ? 342 LYS A N   1 
ATOM   2418  C  CA  . LYS A  1 321 ? 107.216 162.027 114.430 1.00 78.07  ? 342 LYS A CA  1 
ATOM   2419  C  C   . LYS A  1 321 ? 106.710 161.232 113.214 1.00 81.55  ? 342 LYS A C   1 
ATOM   2420  O  O   . LYS A  1 321 ? 106.290 160.070 113.286 1.00 81.02  ? 342 LYS A O   1 
ATOM   2421  C  CB  . LYS A  1 321 ? 108.656 162.514 114.222 1.00 77.84  ? 342 LYS A CB  1 
ATOM   2422  C  CG  . LYS A  1 321 ? 109.711 161.443 113.951 1.00 78.39  ? 342 LYS A CG  1 
ATOM   2423  C  CD  . LYS A  1 321 ? 111.105 161.839 114.449 1.00 76.08  ? 342 LYS A CD  1 
ATOM   2424  C  CE  . LYS A  1 321 ? 112.175 160.794 114.192 1.00 76.20  ? 342 LYS A CE  1 
ATOM   2425  N  NZ  . LYS A  1 321 ? 113.469 161.196 114.802 1.00 74.07  ? 342 LYS A NZ  1 
ATOM   2426  O  OXT . LYS A  1 321 ? 106.712 161.737 112.094 1.00 85.11  ? 342 LYS A OXT 1 
ATOM   2427  N  N   . ALA B  1 5   ? 119.137 181.532 199.236 1.00 92.18  ? 26  ALA B N   1 
ATOM   2428  C  CA  . ALA B  1 5   ? 119.975 182.775 199.270 1.00 96.79  ? 26  ALA B CA  1 
ATOM   2429  C  C   . ALA B  1 5   ? 120.754 182.882 197.950 1.00 96.76  ? 26  ALA B C   1 
ATOM   2430  O  O   . ALA B  1 5   ? 120.092 183.062 196.903 1.00 91.76  ? 26  ALA B O   1 
ATOM   2431  C  CB  . ALA B  1 5   ? 120.881 182.767 200.491 1.00 99.48  ? 26  ALA B CB  1 
ATOM   2432  N  N   . SER B  1 6   ? 122.097 182.791 198.019 1.00 99.56  ? 27  SER B N   1 
ATOM   2433  C  CA  . SER B  1 6   ? 123.060 182.675 196.885 1.00 93.14  ? 27  SER B CA  1 
ATOM   2434  C  C   . SER B  1 6   ? 123.539 181.219 196.762 1.00 85.23  ? 27  SER B C   1 
ATOM   2435  O  O   . SER B  1 6   ? 124.407 180.956 195.904 1.00 80.50  ? 27  SER B O   1 
ATOM   2436  C  CB  . SER B  1 6   ? 124.225 183.635 197.070 1.00 97.34  ? 27  SER B CB  1 
ATOM   2437  O  OG  . SER B  1 6   ? 124.744 184.053 195.816 1.00 97.39  ? 27  SER B OG  1 
ATOM   2438  N  N   . SER B  1 7   ? 123.002 180.314 197.592 1.00 80.02  ? 28  SER B N   1 
ATOM   2439  C  CA  . SER B  1 7   ? 123.036 178.841 197.368 1.00 76.71  ? 28  SER B CA  1 
ATOM   2440  C  C   . SER B  1 7   ? 122.451 178.508 195.978 1.00 72.65  ? 28  SER B C   1 
ATOM   2441  O  O   . SER B  1 7   ? 122.754 177.409 195.422 1.00 71.15  ? 28  SER B O   1 
ATOM   2442  C  CB  . SER B  1 7   ? 122.289 178.124 198.471 1.00 76.42  ? 28  SER B CB  1 
ATOM   2443  O  OG  . SER B  1 7   ? 122.267 176.727 198.253 1.00 72.75  ? 28  SER B OG  1 
ATOM   2444  N  N   . ILE B  1 8   ? 121.612 179.402 195.436 1.00 69.39  ? 29  ILE B N   1 
ATOM   2445  C  CA  . ILE B  1 8   ? 120.929 179.176 194.130 1.00 64.89  ? 29  ILE B CA  1 
ATOM   2446  C  C   . ILE B  1 8   ? 121.962 179.430 193.026 1.00 60.31  ? 29  ILE B C   1 
ATOM   2447  O  O   . ILE B  1 8   ? 122.192 178.509 192.192 1.00 54.32  ? 29  ILE B O   1 
ATOM   2448  C  CB  . ILE B  1 8   ? 119.648 180.030 193.970 1.00 65.74  ? 29  ILE B CB  1 
ATOM   2449  C  CG1 . ILE B  1 8   ? 118.507 179.522 194.867 1.00 66.64  ? 29  ILE B CG1 1 
ATOM   2450  C  CG2 . ILE B  1 8   ? 119.220 180.109 192.500 1.00 64.44  ? 29  ILE B CG2 1 
ATOM   2451  C  CD1 . ILE B  1 8   ? 117.922 178.146 194.506 1.00 64.43  ? 29  ILE B CD1 1 
ATOM   2452  N  N   . GLU B  1 9   ? 122.551 180.626 193.023 1.00 59.04  ? 30  GLU B N   1 
ATOM   2453  C  CA  . GLU B  1 9   ? 123.462 181.030 191.924 1.00 57.15  ? 30  GLU B CA  1 
ATOM   2454  C  C   . GLU B  1 9   ? 124.695 180.108 191.912 1.00 53.29  ? 30  GLU B C   1 
ATOM   2455  O  O   . GLU B  1 9   ? 125.155 179.762 190.808 1.00 52.26  ? 30  GLU B O   1 
ATOM   2456  C  CB  . GLU B  1 9   ? 123.861 182.496 192.016 1.00 60.78  ? 30  GLU B CB  1 
ATOM   2457  C  CG  . GLU B  1 9   ? 124.386 182.999 190.685 1.00 61.95  ? 30  GLU B CG  1 
ATOM   2458  C  CD  . GLU B  1 9   ? 124.580 184.500 190.579 1.00 67.98  ? 30  GLU B CD  1 
ATOM   2459  O  OE1 . GLU B  1 9   ? 124.280 185.200 191.584 1.00 71.61  ? 30  GLU B OE1 1 
ATOM   2460  O  OE2 . GLU B  1 9   ? 125.033 184.967 189.498 1.00 68.37  ? 30  GLU B OE2 1 
ATOM   2461  N  N   . LYS B  1 10  ? 125.185 179.706 193.083 1.00 51.40  ? 31  LYS B N   1 
ATOM   2462  C  CA  . LYS B  1 10  ? 126.374 178.829 193.230 1.00 49.45  ? 31  LYS B CA  1 
ATOM   2463  C  C   . LYS B  1 10  ? 126.063 177.420 192.699 1.00 44.12  ? 31  LYS B C   1 
ATOM   2464  O  O   . LYS B  1 10  ? 126.970 176.835 192.103 1.00 41.86  ? 31  LYS B O   1 
ATOM   2465  C  CB  . LYS B  1 10  ? 126.855 178.795 194.689 1.00 53.10  ? 31  LYS B CB  1 
ATOM   2466  C  CG  . LYS B  1 10  ? 128.372 178.746 194.817 1.00 55.91  ? 31  LYS B CG  1 
ATOM   2467  C  CD  . LYS B  1 10  ? 128.967 179.187 196.134 1.00 61.04  ? 31  LYS B CD  1 
ATOM   2468  C  CE  . LYS B  1 10  ? 130.456 178.882 196.149 1.00 63.71  ? 31  LYS B CE  1 
ATOM   2469  N  NZ  . LYS B  1 10  ? 131.112 179.203 197.437 1.00 69.37  ? 31  LYS B NZ  1 
ATOM   2470  N  N   . GLY B  1 11  ? 124.850 176.894 192.936 1.00 41.35  ? 32  GLY B N   1 
ATOM   2471  C  CA  . GLY B  1 11  ? 124.377 175.599 192.410 1.00 38.27  ? 32  GLY B CA  1 
ATOM   2472  C  C   . GLY B  1 11  ? 124.300 175.627 190.889 1.00 35.40  ? 32  GLY B C   1 
ATOM   2473  O  O   . GLY B  1 11  ? 124.790 174.651 190.225 1.00 33.39  ? 32  GLY B O   1 
ATOM   2474  N  N   . GLN B  1 12  ? 123.763 176.732 190.349 1.00 34.75  ? 33  GLN B N   1 
ATOM   2475  C  CA  . GLN B  1 12  ? 123.675 176.989 188.898 1.00 33.75  ? 33  GLN B CA  1 
ATOM   2476  C  C   . GLN B  1 12  ? 125.084 176.918 188.332 1.00 33.40  ? 33  GLN B C   1 
ATOM   2477  O  O   . GLN B  1 12  ? 125.290 176.329 187.247 1.00 32.09  ? 33  GLN B O   1 
ATOM   2478  C  CB  . GLN B  1 12  ? 123.041 178.347 188.653 1.00 35.27  ? 33  GLN B CB  1 
ATOM   2479  C  CG  . GLN B  1 12  ? 121.553 178.320 188.929 1.00 36.19  ? 33  GLN B CG  1 
ATOM   2480  C  CD  . GLN B  1 12  ? 120.873 179.652 188.764 1.00 38.73  ? 33  GLN B CD  1 
ATOM   2481  O  OE1 . GLN B  1 12  ? 121.496 180.654 188.493 1.00 40.89  ? 33  GLN B OE1 1 
ATOM   2482  N  NE2 . GLN B  1 12  ? 119.571 179.679 188.904 1.00 39.88  ? 33  GLN B NE2 1 
ATOM   2483  N  N   . ASN B  1 13  ? 126.025 177.508 189.063 1.00 35.15  ? 34  ASN B N   1 
ATOM   2484  C  CA  . ASN B  1 13  ? 127.429 177.664 188.616 1.00 35.95  ? 34  ASN B CA  1 
ATOM   2485  C  C   . ASN B  1 13  ? 128.046 176.275 188.473 1.00 34.38  ? 34  ASN B C   1 
ATOM   2486  O  O   . ASN B  1 13  ? 128.855 176.095 187.562 1.00 33.10  ? 34  ASN B O   1 
ATOM   2487  C  CB  . ASN B  1 13  ? 128.218 178.589 189.551 1.00 39.19  ? 34  ASN B CB  1 
ATOM   2488  C  CG  . ASN B  1 13  ? 127.933 180.058 189.301 1.00 41.97  ? 34  ASN B CG  1 
ATOM   2489  O  OD1 . ASN B  1 13  ? 127.455 180.447 188.232 1.00 41.78  ? 34  ASN B OD1 1 
ATOM   2490  N  ND2 . ASN B  1 13  ? 128.279 180.889 190.267 1.00 45.58  ? 34  ASN B ND2 1 
ATOM   2491  N  N   . ARG B  1 14  ? 127.680 175.344 189.354 1.00 35.17  ? 35  ARG B N   1 
ATOM   2492  C  CA  . ARG B  1 14  ? 128.285 173.991 189.361 1.00 36.17  ? 35  ARG B CA  1 
ATOM   2493  C  C   . ARG B  1 14  ? 127.824 173.260 188.090 1.00 33.50  ? 35  ARG B C   1 
ATOM   2494  O  O   . ARG B  1 14  ? 128.647 172.530 187.469 1.00 31.72  ? 35  ARG B O   1 
ATOM   2495  C  CB  . ARG B  1 14  ? 127.958 173.260 190.667 1.00 39.66  ? 35  ARG B CB  1 
ATOM   2496  C  CG  . ARG B  1 14  ? 128.456 173.987 191.906 1.00 43.92  ? 35  ARG B CG  1 
ATOM   2497  C  CD  . ARG B  1 14  ? 129.174 173.111 192.901 1.00 49.86  ? 35  ARG B CD  1 
ATOM   2498  N  NE  . ARG B  1 14  ? 130.438 172.436 192.458 1.00 53.85  ? 35  ARG B NE  1 
ATOM   2499  C  CZ  . ARG B  1 14  ? 131.681 172.536 193.050 1.00 58.67  ? 35  ARG B CZ  1 
ATOM   2500  N  NH1 . ARG B  1 14  ? 131.916 173.337 194.089 1.00 61.94  ? 35  ARG B NH1 1 
ATOM   2501  N  NH2 . ARG B  1 14  ? 132.698 171.816 192.587 1.00 59.67  ? 35  ARG B NH2 1 
ATOM   2502  N  N   . VAL B  1 15  ? 126.577 173.511 187.695 1.00 32.62  ? 36  VAL B N   1 
ATOM   2503  C  CA  . VAL B  1 15  ? 125.962 172.912 186.478 1.00 32.28  ? 36  VAL B CA  1 
ATOM   2504  C  C   . VAL B  1 15  ? 126.608 173.526 185.232 1.00 31.24  ? 36  VAL B C   1 
ATOM   2505  O  O   . VAL B  1 15  ? 126.908 172.767 184.293 1.00 29.67  ? 36  VAL B O   1 
ATOM   2506  C  CB  . VAL B  1 15  ? 124.440 173.076 186.471 1.00 33.00  ? 36  VAL B CB  1 
ATOM   2507  C  CG1 . VAL B  1 15  ? 123.869 172.738 185.104 1.00 33.86  ? 36  VAL B CG1 1 
ATOM   2508  C  CG2 . VAL B  1 15  ? 123.819 172.202 187.545 1.00 34.40  ? 36  VAL B CG2 1 
ATOM   2509  N  N   . ILE B  1 16  ? 126.772 174.853 185.230 1.00 31.95  ? 37  ILE B N   1 
ATOM   2510  C  CA  . ILE B  1 16  ? 127.427 175.592 184.109 1.00 31.82  ? 37  ILE B CA  1 
ATOM   2511  C  C   . ILE B  1 16  ? 128.861 175.050 183.983 1.00 31.69  ? 37  ILE B C   1 
ATOM   2512  O  O   . ILE B  1 16  ? 129.255 174.712 182.887 1.00 29.95  ? 37  ILE B O   1 
ATOM   2513  C  CB  . ILE B  1 16  ? 127.383 177.113 184.367 1.00 33.30  ? 37  ILE B CB  1 
ATOM   2514  C  CG1 . ILE B  1 16  ? 125.942 177.597 184.224 1.00 34.17  ? 37  ILE B CG1 1 
ATOM   2515  C  CG2 . ILE B  1 16  ? 128.370 177.859 183.451 1.00 34.49  ? 37  ILE B CG2 1 
ATOM   2516  C  CD1 . ILE B  1 16  ? 125.705 179.046 184.566 1.00 37.07  ? 37  ILE B CD1 1 
ATOM   2517  N  N   . ASP B  1 17  ? 129.603 174.980 185.096 1.00 33.83  ? 38  ASP B N   1 
ATOM   2518  C  CA  . ASP B  1 17  ? 131.015 174.534 185.094 1.00 35.74  ? 38  ASP B CA  1 
ATOM   2519  C  C   . ASP B  1 17  ? 131.099 173.099 184.538 1.00 33.46  ? 38  ASP B C   1 
ATOM   2520  O  O   . ASP B  1 17  ? 131.981 172.856 183.690 1.00 33.37  ? 38  ASP B O   1 
ATOM   2521  C  CB  . ASP B  1 17  ? 131.645 174.734 186.475 1.00 39.89  ? 38  ASP B CB  1 
ATOM   2522  C  CG  . ASP B  1 17  ? 131.818 176.221 186.788 1.00 44.51  ? 38  ASP B CG  1 
ATOM   2523  O  OD1 . ASP B  1 17  ? 131.541 177.067 185.876 1.00 45.98  ? 38  ASP B OD1 1 
ATOM   2524  O  OD2 . ASP B  1 17  ? 132.198 176.542 187.940 1.00 49.95  ? 38  ASP B OD2 1 
ATOM   2525  N  N   . ALA B  1 18  ? 130.242 172.195 184.991 1.00 31.04  ? 39  ALA B N   1 
ATOM   2526  C  CA  . ALA B  1 18  ? 130.226 170.798 184.525 1.00 31.08  ? 39  ALA B CA  1 
ATOM   2527  C  C   . ALA B  1 18  ? 129.866 170.743 183.029 1.00 29.59  ? 39  ALA B C   1 
ATOM   2528  O  O   . ALA B  1 18  ? 130.397 169.824 182.312 1.00 28.69  ? 39  ALA B O   1 
ATOM   2529  C  CB  . ALA B  1 18  ? 129.244 169.981 185.361 1.00 32.21  ? 39  ALA B CB  1 
ATOM   2530  N  N   . SER B  1 19  ? 128.939 171.623 182.597 1.00 28.65  ? 40  SER B N   1 
ATOM   2531  C  CA  . SER B  1 19  ? 128.527 171.738 181.176 1.00 29.01  ? 40  SER B CA  1 
ATOM   2532  C  C   . SER B  1 19  ? 129.758 172.130 180.366 1.00 28.31  ? 40  SER B C   1 
ATOM   2533  O  O   . SER B  1 19  ? 130.057 171.446 179.382 1.00 27.34  ? 40  SER B O   1 
ATOM   2534  C  CB  . SER B  1 19  ? 127.391 172.698 180.937 1.00 29.66  ? 40  SER B CB  1 
ATOM   2535  O  OG  . SER B  1 19  ? 126.219 172.279 181.619 1.00 30.34  ? 40  SER B OG  1 
ATOM   2536  N  N   . LEU B  1 20  ? 130.478 173.149 180.816 1.00 28.99  ? 41  LEU B N   1 
ATOM   2537  C  CA  . LEU B  1 20  ? 131.691 173.604 180.082 1.00 29.89  ? 41  LEU B CA  1 
ATOM   2538  C  C   . LEU B  1 20  ? 132.788 172.538 180.135 1.00 29.41  ? 41  LEU B C   1 
ATOM   2539  O  O   . LEU B  1 20  ? 133.360 172.263 179.077 1.00 29.01  ? 41  LEU B O   1 
ATOM   2540  C  CB  . LEU B  1 20  ? 132.181 174.933 180.633 1.00 31.68  ? 41  LEU B CB  1 
ATOM   2541  C  CG  . LEU B  1 20  ? 131.249 176.087 180.331 1.00 33.20  ? 41  LEU B CG  1 
ATOM   2542  C  CD1 . LEU B  1 20  ? 131.684 177.296 181.137 1.00 35.80  ? 41  LEU B CD1 1 
ATOM   2543  C  CD2 . LEU B  1 20  ? 131.229 176.372 178.831 1.00 34.44  ? 41  LEU B CD2 1 
ATOM   2544  N  N   . THR B  1 21  ? 133.016 171.901 181.280 1.00 29.67  ? 42  THR B N   1 
ATOM   2545  C  CA  . THR B  1 21  ? 134.032 170.829 181.374 1.00 30.47  ? 42  THR B CA  1 
ATOM   2546  C  C   . THR B  1 21  ? 133.697 169.763 180.307 1.00 30.82  ? 42  THR B C   1 
ATOM   2547  O  O   . THR B  1 21  ? 134.612 169.235 179.639 1.00 30.52  ? 42  THR B O   1 
ATOM   2548  C  CB  . THR B  1 21  ? 134.113 170.267 182.793 1.00 31.34  ? 42  THR B CB  1 
ATOM   2549  O  OG1 . THR B  1 21  ? 134.614 171.281 183.654 1.00 32.97  ? 42  THR B OG1 1 
ATOM   2550  C  CG2 . THR B  1 21  ? 134.993 169.042 182.888 1.00 32.99  ? 42  THR B CG2 1 
ATOM   2551  N  N   . LEU B  1 22  ? 132.418 169.406 180.143 1.00 31.05  ? 43  LEU B N   1 
ATOM   2552  C  CA  . LEU B  1 22  ? 132.110 168.313 179.175 1.00 31.39  ? 43  LEU B CA  1 
ATOM   2553  C  C   . LEU B  1 22  ? 132.495 168.744 177.736 1.00 30.44  ? 43  LEU B C   1 
ATOM   2554  O  O   . LEU B  1 22  ? 133.007 167.919 176.986 1.00 30.70  ? 43  LEU B O   1 
ATOM   2555  C  CB  . LEU B  1 22  ? 130.634 167.947 179.367 1.00 32.20  ? 43  LEU B CB  1 
ATOM   2556  C  CG  . LEU B  1 22  ? 130.043 166.924 178.413 1.00 33.66  ? 43  LEU B CG  1 
ATOM   2557  C  CD1 . LEU B  1 22  ? 130.843 165.634 178.398 1.00 35.34  ? 43  LEU B CD1 1 
ATOM   2558  C  CD2 . LEU B  1 22  ? 128.617 166.666 178.819 1.00 35.95  ? 43  LEU B CD2 1 
ATOM   2559  N  N   . ILE B  1 23  ? 132.268 169.994 177.345 1.00 30.98  ? 44  ILE B N   1 
ATOM   2560  C  CA  . ILE B  1 23  ? 132.667 170.477 175.986 1.00 31.59  ? 44  ILE B CA  1 
ATOM   2561  C  C   . ILE B  1 23  ? 134.188 170.440 175.896 1.00 31.44  ? 44  ILE B C   1 
ATOM   2562  O  O   . ILE B  1 23  ? 134.686 170.045 174.813 1.00 31.54  ? 44  ILE B O   1 
ATOM   2563  C  CB  . ILE B  1 23  ? 132.128 171.878 175.661 1.00 32.70  ? 44  ILE B CB  1 
ATOM   2564  C  CG1 . ILE B  1 23  ? 130.604 171.927 175.787 1.00 33.53  ? 44  ILE B CG1 1 
ATOM   2565  C  CG2 . ILE B  1 23  ? 132.620 172.337 174.280 1.00 33.11  ? 44  ILE B CG2 1 
ATOM   2566  C  CD1 . ILE B  1 23  ? 129.919 170.923 174.881 1.00 35.23  ? 44  ILE B CD1 1 
ATOM   2567  N  N   . ARG B  1 24  ? 134.871 170.820 176.980 1.00 30.97  ? 45  ARG B N   1 
ATOM   2568  C  CA  . ARG B  1 24  ? 136.357 170.840 177.004 1.00 32.24  ? 45  ARG B CA  1 
ATOM   2569  C  C   . ARG B  1 24  ? 136.869 169.426 176.724 1.00 30.48  ? 45  ARG B C   1 
ATOM   2570  O  O   . ARG B  1 24  ? 137.736 169.300 175.872 1.00 28.36  ? 45  ARG B O   1 
ATOM   2571  C  CB  . ARG B  1 24  ? 136.914 171.286 178.354 1.00 35.33  ? 45  ARG B CB  1 
ATOM   2572  C  CG  . ARG B  1 24  ? 138.435 171.390 178.441 1.00 39.20  ? 45  ARG B CG  1 
ATOM   2573  C  CD  . ARG B  1 24  ? 138.911 171.797 179.836 1.00 43.50  ? 45  ARG B CD  1 
ATOM   2574  N  NE  . ARG B  1 24  ? 138.124 172.947 180.304 1.00 46.30  ? 45  ARG B NE  1 
ATOM   2575  C  CZ  . ARG B  1 24  ? 137.330 172.973 181.395 1.00 46.94  ? 45  ARG B CZ  1 
ATOM   2576  N  NH1 . ARG B  1 24  ? 136.602 174.049 181.620 1.00 47.19  ? 45  ARG B NH1 1 
ATOM   2577  N  NH2 . ARG B  1 24  ? 137.265 171.942 182.239 1.00 47.04  ? 45  ARG B NH2 1 
ATOM   2578  N  N   . GLU B  1 25  ? 136.340 168.407 177.421 1.00 30.05  ? 46  GLU B N   1 
ATOM   2579  C  CA  . GLU B  1 25  ? 136.886 167.021 177.328 1.00 31.23  ? 46  GLU B CA  1 
ATOM   2580  C  C   . GLU B  1 25  ? 136.655 166.485 175.916 1.00 30.80  ? 46  GLU B C   1 
ATOM   2581  O  O   . GLU B  1 25  ? 137.557 165.875 175.407 1.00 30.84  ? 46  GLU B O   1 
ATOM   2582  C  CB  . GLU B  1 25  ? 136.285 166.060 178.349 1.00 33.07  ? 46  GLU B CB  1 
ATOM   2583  C  CG  . GLU B  1 25  ? 136.566 166.460 179.802 1.00 34.89  ? 46  GLU B CG  1 
ATOM   2584  C  CD  . GLU B  1 25  ? 138.035 166.501 180.230 1.00 37.03  ? 46  GLU B CD  1 
ATOM   2585  O  OE1 . GLU B  1 25  ? 138.937 166.100 179.394 1.00 37.56  ? 46  GLU B OE1 1 
ATOM   2586  O  OE2 . GLU B  1 25  ? 138.269 166.825 181.422 1.00 38.18  ? 46  GLU B OE2 1 
ATOM   2587  N  N   . ARG B  1 26  ? 135.496 166.768 175.324 1.00 30.46  ? 47  ARG B N   1 
ATOM   2588  C  CA  . ARG B  1 26  ? 135.096 166.334 173.961 1.00 32.33  ? 47  ARG B CA  1 
ATOM   2589  C  C   . ARG B  1 26  ? 135.982 167.032 172.915 1.00 31.13  ? 47  ARG B C   1 
ATOM   2590  O  O   . ARG B  1 26  ? 136.435 166.342 171.992 1.00 31.59  ? 47  ARG B O   1 
ATOM   2591  C  CB  . ARG B  1 26  ? 133.591 166.567 173.751 1.00 33.80  ? 47  ARG B CB  1 
ATOM   2592  C  CG  . ARG B  1 26  ? 132.752 165.404 174.255 1.00 37.66  ? 47  ARG B CG  1 
ATOM   2593  C  CD  . ARG B  1 26  ? 131.343 165.697 174.714 1.00 41.15  ? 47  ARG B CD  1 
ATOM   2594  N  NE  . ARG B  1 26  ? 130.520 166.742 174.066 1.00 42.77  ? 47  ARG B NE  1 
ATOM   2595  C  CZ  . ARG B  1 26  ? 129.262 167.066 174.417 1.00 43.99  ? 47  ARG B CZ  1 
ATOM   2596  N  NH1 . ARG B  1 26  ? 128.618 166.383 175.355 1.00 46.05  ? 47  ARG B NH1 1 
ATOM   2597  N  NH2 . ARG B  1 26  ? 128.633 168.052 173.802 1.00 44.57  ? 47  ARG B NH2 1 
ATOM   2598  N  N   . ALA B  1 27  ? 136.177 168.341 173.040 1.00 29.86  ? 48  ALA B N   1 
ATOM   2599  C  CA  . ALA B  1 27  ? 136.982 169.176 172.131 1.00 30.52  ? 48  ALA B CA  1 
ATOM   2600  C  C   . ALA B  1 27  ? 138.440 168.667 172.156 1.00 31.34  ? 48  ALA B C   1 
ATOM   2601  O  O   . ALA B  1 27  ? 139.091 168.588 171.070 1.00 30.30  ? 48  ALA B O   1 
ATOM   2602  C  CB  . ALA B  1 27  ? 136.859 170.605 172.593 1.00 30.85  ? 48  ALA B CB  1 
ATOM   2603  N  N   . LYS B  1 28  ? 138.925 168.283 173.350 1.00 31.75  ? 49  LYS B N   1 
ATOM   2604  C  CA  . LYS B  1 28  ? 140.300 167.775 173.489 1.00 34.36  ? 49  LYS B CA  1 
ATOM   2605  C  C   . LYS B  1 28  ? 140.409 166.532 172.600 1.00 33.47  ? 49  LYS B C   1 
ATOM   2606  O  O   . LYS B  1 28  ? 141.402 166.448 171.859 1.00 34.32  ? 49  LYS B O   1 
ATOM   2607  C  CB  . LYS B  1 28  ? 140.756 167.480 174.932 1.00 37.68  ? 49  LYS B CB  1 
ATOM   2608  C  CG  . LYS B  1 28  ? 142.108 166.777 174.964 1.00 41.77  ? 49  LYS B CG  1 
ATOM   2609  C  CD  . LYS B  1 28  ? 142.991 167.074 176.154 1.00 48.72  ? 49  LYS B CD  1 
ATOM   2610  C  CE  . LYS B  1 28  ? 142.524 166.444 177.470 1.00 51.05  ? 49  LYS B CE  1 
ATOM   2611  N  NZ  . LYS B  1 28  ? 143.393 165.319 177.907 1.00 53.06  ? 49  LYS B NZ  1 
ATOM   2612  N  N   . LEU B  1 29  ? 139.494 165.575 172.698 1.00 31.60  ? 50  LEU B N   1 
ATOM   2613  C  CA  . LEU B  1 29  ? 139.692 164.314 171.933 1.00 33.31  ? 50  LEU B CA  1 
ATOM   2614  C  C   . LEU B  1 29  ? 139.690 164.590 170.430 1.00 32.31  ? 50  LEU B C   1 
ATOM   2615  O  O   . LEU B  1 29  ? 140.381 163.876 169.682 1.00 32.87  ? 50  LEU B O   1 
ATOM   2616  C  CB  . LEU B  1 29  ? 138.626 163.271 172.255 1.00 34.50  ? 50  LEU B CB  1 
ATOM   2617  C  CG  . LEU B  1 29  ? 138.563 162.809 173.704 1.00 36.31  ? 50  LEU B CG  1 
ATOM   2618  C  CD1 . LEU B  1 29  ? 137.595 161.632 173.839 1.00 38.43  ? 50  LEU B CD1 1 
ATOM   2619  C  CD2 . LEU B  1 29  ? 139.935 162.442 174.231 1.00 38.24  ? 50  LEU B CD2 1 
ATOM   2620  N  N   . LYS B  1 30  ? 138.849 165.519 169.992 1.00 31.16  ? 51  LYS B N   1 
ATOM   2621  C  CA  . LYS B  1 30  ? 138.759 165.847 168.559 1.00 31.62  ? 51  LYS B CA  1 
ATOM   2622  C  C   . LYS B  1 30  ? 140.055 166.548 168.147 1.00 32.00  ? 51  LYS B C   1 
ATOM   2623  O  O   . LYS B  1 30  ? 140.576 166.201 167.057 1.00 32.81  ? 51  LYS B O   1 
ATOM   2624  C  CB  . LYS B  1 30  ? 137.491 166.659 168.304 1.00 31.59  ? 51  LYS B CB  1 
ATOM   2625  C  CG  . LYS B  1 30  ? 136.188 165.920 168.575 1.00 31.79  ? 51  LYS B CG  1 
ATOM   2626  C  CD  . LYS B  1 30  ? 136.189 164.498 168.086 1.00 33.68  ? 51  LYS B CD  1 
ATOM   2627  C  CE  . LYS B  1 30  ? 134.894 163.840 168.459 1.00 35.38  ? 51  LYS B CE  1 
ATOM   2628  N  NZ  . LYS B  1 30  ? 134.715 162.583 167.745 1.00 38.58  ? 51  LYS B NZ  1 
ATOM   2629  N  N   . GLY B  1 31  ? 140.511 167.511 168.962 1.00 32.04  ? 52  GLY B N   1 
ATOM   2630  C  CA  . GLY B  1 31  ? 141.793 168.207 168.790 1.00 33.73  ? 52  GLY B CA  1 
ATOM   2631  C  C   . GLY B  1 31  ? 142.932 167.217 168.599 1.00 34.88  ? 52  GLY B C   1 
ATOM   2632  O  O   . GLY B  1 31  ? 143.662 167.328 167.592 1.00 35.88  ? 52  GLY B O   1 
ATOM   2633  N  N   . GLU B  1 32  ? 143.052 166.253 169.502 1.00 36.50  ? 53  GLU B N   1 
ATOM   2634  C  CA  . GLU B  1 32  ? 144.155 165.248 169.514 1.00 40.61  ? 53  GLU B CA  1 
ATOM   2635  C  C   . GLU B  1 32  ? 144.063 164.357 168.256 1.00 40.83  ? 53  GLU B C   1 
ATOM   2636  O  O   . GLU B  1 32  ? 145.104 164.059 167.667 1.00 41.79  ? 53  GLU B O   1 
ATOM   2637  C  CB  . GLU B  1 32  ? 144.142 164.457 170.830 1.00 44.74  ? 53  GLU B CB  1 
ATOM   2638  C  CG  . GLU B  1 32  ? 145.151 164.964 171.878 1.00 50.37  ? 53  GLU B CG  1 
ATOM   2639  C  CD  . GLU B  1 32  ? 144.736 164.757 173.340 1.00 57.13  ? 53  GLU B CD  1 
ATOM   2640  O  OE1 . GLU B  1 32  ? 145.139 165.610 174.236 1.00 62.49  ? 53  GLU B OE1 1 
ATOM   2641  O  OE2 . GLU B  1 32  ? 143.969 163.752 173.622 1.00 62.38  ? 53  GLU B OE2 1 
ATOM   2642  N  N   . LEU B  1 33  ? 142.863 163.983 167.810 1.00 38.83  ? 54  LEU B N   1 
ATOM   2643  C  CA  . LEU B  1 33  ? 142.684 163.212 166.556 1.00 39.81  ? 54  LEU B CA  1 
ATOM   2644  C  C   . LEU B  1 33  ? 143.236 164.013 165.358 1.00 38.90  ? 54  LEU B C   1 
ATOM   2645  O  O   . LEU B  1 33  ? 143.976 163.488 164.566 1.00 38.21  ? 54  LEU B O   1 
ATOM   2646  C  CB  . LEU B  1 33  ? 141.181 162.954 166.452 1.00 40.54  ? 54  LEU B CB  1 
ATOM   2647  C  CG  . LEU B  1 33  ? 140.666 161.992 165.393 1.00 43.81  ? 54  LEU B CG  1 
ATOM   2648  C  CD1 . LEU B  1 33  ? 141.415 160.654 165.400 1.00 46.87  ? 54  LEU B CD1 1 
ATOM   2649  C  CD2 . LEU B  1 33  ? 139.180 161.765 165.619 1.00 44.25  ? 54  LEU B CD2 1 
ATOM   2650  N  N   . VAL B  1 34  ? 142.824 165.267 165.207 1.00 38.40  ? 55  VAL B N   1 
ATOM   2651  C  CA  . VAL B  1 34  ? 143.193 166.093 164.032 1.00 39.43  ? 55  VAL B CA  1 
ATOM   2652  C  C   . VAL B  1 34  ? 144.700 166.297 164.049 1.00 40.17  ? 55  VAL B C   1 
ATOM   2653  O  O   . VAL B  1 34  ? 145.276 166.154 162.954 1.00 41.10  ? 55  VAL B O   1 
ATOM   2654  C  CB  . VAL B  1 34  ? 142.468 167.445 163.998 1.00 40.03  ? 55  VAL B CB  1 
ATOM   2655  C  CG1 . VAL B  1 34  ? 143.149 168.426 163.051 1.00 41.69  ? 55  VAL B CG1 1 
ATOM   2656  C  CG2 . VAL B  1 34  ? 140.995 167.274 163.650 1.00 40.55  ? 55  VAL B CG2 1 
ATOM   2657  N  N   . ARG B  1 35  ? 145.296 166.570 165.229 1.00 39.65  ? 56  ARG B N   1 
ATOM   2658  C  CA  . ARG B  1 35  ? 146.764 166.884 165.350 1.00 41.68  ? 56  ARG B CA  1 
ATOM   2659  C  C   . ARG B  1 35  ? 147.534 165.605 164.999 1.00 42.60  ? 56  ARG B C   1 
ATOM   2660  O  O   . ARG B  1 35  ? 148.468 165.692 164.230 1.00 45.00  ? 56  ARG B O   1 
ATOM   2661  C  CB  . ARG B  1 35  ? 147.156 167.504 166.704 1.00 41.63  ? 56  ARG B CB  1 
ATOM   2662  C  CG  . ARG B  1 35  ? 146.682 168.941 166.918 1.00 41.75  ? 56  ARG B CG  1 
ATOM   2663  C  CD  . ARG B  1 35  ? 147.198 169.537 168.218 1.00 43.74  ? 56  ARG B CD  1 
ATOM   2664  N  NE  . ARG B  1 35  ? 146.574 168.909 169.389 1.00 42.47  ? 56  ARG B NE  1 
ATOM   2665  C  CZ  . ARG B  1 35  ? 145.463 169.321 169.991 1.00 41.57  ? 56  ARG B CZ  1 
ATOM   2666  N  NH1 . ARG B  1 35  ? 144.810 170.397 169.583 1.00 41.85  ? 56  ARG B NH1 1 
ATOM   2667  N  NH2 . ARG B  1 35  ? 144.958 168.623 170.989 1.00 41.54  ? 56  ARG B NH2 1 
ATOM   2668  N  N   . LEU B  1 36  ? 147.048 164.445 165.408 1.00 42.30  ? 57  LEU B N   1 
ATOM   2669  C  CA  . LEU B  1 36  ? 147.764 163.156 165.265 1.00 45.49  ? 57  LEU B CA  1 
ATOM   2670  C  C   . LEU B  1 36  ? 147.811 162.688 163.797 1.00 45.23  ? 57  LEU B C   1 
ATOM   2671  O  O   . LEU B  1 36  ? 148.780 162.086 163.379 1.00 47.77  ? 57  LEU B O   1 
ATOM   2672  C  CB  . LEU B  1 36  ? 147.046 162.168 166.182 1.00 47.57  ? 57  LEU B CB  1 
ATOM   2673  C  CG  . LEU B  1 36  ? 147.589 160.754 166.171 1.00 53.18  ? 57  LEU B CG  1 
ATOM   2674  C  CD1 . LEU B  1 36  ? 147.449 160.169 167.558 1.00 56.71  ? 57  LEU B CD1 1 
ATOM   2675  C  CD2 . LEU B  1 36  ? 146.890 159.899 165.113 1.00 55.04  ? 57  LEU B CD2 1 
ATOM   2676  N  N   . LEU B  1 37  ? 146.782 162.952 163.030 1.00 43.91  ? 58  LEU B N   1 
ATOM   2677  C  CA  . LEU B  1 37  ? 146.789 162.797 161.560 1.00 45.19  ? 58  LEU B CA  1 
ATOM   2678  C  C   . LEU B  1 37  ? 147.724 163.804 160.883 1.00 45.82  ? 58  LEU B C   1 
ATOM   2679  O  O   . LEU B  1 37  ? 148.216 163.420 159.824 1.00 48.32  ? 58  LEU B O   1 
ATOM   2680  C  CB  . LEU B  1 37  ? 145.357 162.990 161.062 1.00 44.97  ? 58  LEU B CB  1 
ATOM   2681  C  CG  . LEU B  1 37  ? 144.398 161.844 161.371 1.00 45.46  ? 58  LEU B CG  1 
ATOM   2682  C  CD1 . LEU B  1 37  ? 143.019 162.132 160.781 1.00 46.52  ? 58  LEU B CD1 1 
ATOM   2683  C  CD2 . LEU B  1 37  ? 144.927 160.542 160.793 1.00 48.06  ? 58  LEU B CD2 1 
ATOM   2684  N  N   . GLY B  1 38  ? 147.896 165.033 161.406 1.00 49.58  ? 59  GLY B N   1 
ATOM   2685  C  CA  . GLY B  1 38  ? 148.847 166.055 160.903 1.00 50.86  ? 59  GLY B CA  1 
ATOM   2686  C  C   . GLY B  1 38  ? 148.417 166.710 159.581 1.00 49.88  ? 59  GLY B C   1 
ATOM   2687  O  O   . GLY B  1 38  ? 147.595 166.121 158.822 1.00 48.02  ? 59  GLY B O   1 
ATOM   2688  N  N   . GLY B  1 39  ? 148.958 167.905 159.289 1.00 51.40  ? 60  GLY B N   1 
ATOM   2689  C  CA  . GLY B  1 39  ? 148.854 168.616 157.991 1.00 50.93  ? 60  GLY B CA  1 
ATOM   2690  C  C   . GLY B  1 39  ? 147.676 169.578 157.920 1.00 49.01  ? 60  GLY B C   1 
ATOM   2691  O  O   . GLY B  1 39  ? 147.619 170.327 156.963 1.00 49.53  ? 60  GLY B O   1 
ATOM   2692  N  N   . ALA B  1 40  ? 146.768 169.621 158.896 1.00 47.00  ? 61  ALA B N   1 
ATOM   2693  C  CA  . ALA B  1 40  ? 145.623 170.570 158.829 1.00 45.71  ? 61  ALA B CA  1 
ATOM   2694  C  C   . ALA B  1 40  ? 146.056 171.984 159.255 1.00 47.58  ? 61  ALA B C   1 
ATOM   2695  O  O   . ALA B  1 40  ? 146.740 172.119 160.299 1.00 49.19  ? 61  ALA B O   1 
ATOM   2696  C  CB  . ALA B  1 40  ? 144.465 170.069 159.652 1.00 43.45  ? 61  ALA B CB  1 
ATOM   2697  N  N   . LYS B  1 41  ? 145.666 173.001 158.474 1.00 47.82  ? 62  LYS B N   1 
ATOM   2698  C  CA  . LYS B  1 41  ? 145.722 174.431 158.881 1.00 49.08  ? 62  LYS B CA  1 
ATOM   2699  C  C   . LYS B  1 41  ? 144.450 174.804 159.632 1.00 45.34  ? 62  LYS B C   1 
ATOM   2700  O  O   . LYS B  1 41  ? 144.504 175.661 160.483 1.00 45.16  ? 62  LYS B O   1 
ATOM   2701  C  CB  . LYS B  1 41  ? 145.922 175.347 157.671 1.00 52.69  ? 62  LYS B CB  1 
ATOM   2702  C  CG  . LYS B  1 41  ? 147.155 175.003 156.846 1.00 57.65  ? 62  LYS B CG  1 
ATOM   2703  C  CD  . LYS B  1 41  ? 147.511 176.074 155.826 1.00 62.63  ? 62  LYS B CD  1 
ATOM   2704  C  CE  . LYS B  1 41  ? 148.779 175.751 155.048 1.00 66.37  ? 62  LYS B CE  1 
ATOM   2705  N  NZ  . LYS B  1 41  ? 148.504 174.679 154.056 1.00 66.15  ? 62  LYS B NZ  1 
ATOM   2706  N  N   . ALA B  1 42  ? 143.337 174.164 159.299 1.00 42.32  ? 63  ALA B N   1 
ATOM   2707  C  CA  . ALA B  1 42  ? 142.003 174.483 159.827 1.00 39.50  ? 63  ALA B CA  1 
ATOM   2708  C  C   . ALA B  1 42  ? 141.136 173.254 159.696 1.00 36.70  ? 63  ALA B C   1 
ATOM   2709  O  O   . ALA B  1 42  ? 141.178 172.609 158.669 1.00 36.14  ? 63  ALA B O   1 
ATOM   2710  C  CB  . ALA B  1 42  ? 141.406 175.641 159.059 1.00 39.51  ? 63  ALA B CB  1 
ATOM   2711  N  N   . SER B  1 43  ? 140.323 172.993 160.707 1.00 35.33  ? 64  SER B N   1 
ATOM   2712  C  CA  . SER B  1 43  ? 139.473 171.784 160.774 1.00 32.76  ? 64  SER B CA  1 
ATOM   2713  C  C   . SER B  1 43  ? 138.145 172.197 161.381 1.00 31.24  ? 64  SER B C   1 
ATOM   2714  O  O   . SER B  1 43  ? 138.135 172.630 162.535 1.00 31.03  ? 64  SER B O   1 
ATOM   2715  C  CB  . SER B  1 43  ? 140.169 170.692 161.530 1.00 33.15  ? 64  SER B CB  1 
ATOM   2716  O  OG  . SER B  1 43  ? 141.356 170.319 160.837 1.00 34.42  ? 64  SER B OG  1 
ATOM   2717  N  N   . THR B  1 44  ? 137.117 172.165 160.545 1.00 30.10  ? 65  THR B N   1 
ATOM   2718  C  CA  . THR B  1 44  ? 135.723 172.414 160.896 1.00 28.85  ? 65  THR B CA  1 
ATOM   2719  C  C   . THR B  1 44  ? 135.381 171.488 162.064 1.00 28.69  ? 65  THR B C   1 
ATOM   2720  O  O   . THR B  1 44  ? 135.568 170.287 161.974 1.00 28.08  ? 65  THR B O   1 
ATOM   2721  C  CB  . THR B  1 44  ? 134.806 172.226 159.679 1.00 28.26  ? 65  THR B CB  1 
ATOM   2722  O  OG1 . THR B  1 44  ? 135.216 173.166 158.694 1.00 28.68  ? 65  THR B OG1 1 
ATOM   2723  C  CG2 . THR B  1 44  ? 133.341 172.512 159.986 1.00 27.20  ? 65  THR B CG2 1 
ATOM   2724  N  N   . SER B  1 45  ? 134.871 172.050 163.144 1.00 29.01  ? 66  SER B N   1 
ATOM   2725  C  CA  . SER B  1 45  ? 134.328 171.263 164.272 1.00 28.72  ? 66  SER B CA  1 
ATOM   2726  C  C   . SER B  1 45  ? 132.937 171.739 164.590 1.00 26.48  ? 66  SER B C   1 
ATOM   2727  O  O   . SER B  1 45  ? 132.793 172.941 164.830 1.00 25.88  ? 66  SER B O   1 
ATOM   2728  C  CB  . SER B  1 45  ? 135.209 171.331 165.479 1.00 30.94  ? 66  SER B CB  1 
ATOM   2729  O  OG  . SER B  1 45  ? 134.849 170.243 166.308 1.00 32.15  ? 66  SER B OG  1 
ATOM   2730  N  N   . LEU B  1 46  ? 131.969 170.819 164.602 1.00 25.72  ? 67  LEU B N   1 
ATOM   2731  C  CA  . LEU B  1 46  ? 130.543 171.148 164.831 1.00 24.53  ? 67  LEU B CA  1 
ATOM   2732  C  C   . LEU B  1 46  ? 130.348 171.352 166.323 1.00 25.60  ? 67  LEU B C   1 
ATOM   2733  O  O   . LEU B  1 46  ? 130.893 170.536 167.105 1.00 27.07  ? 67  LEU B O   1 
ATOM   2734  C  CB  . LEU B  1 46  ? 129.635 170.020 164.329 1.00 24.13  ? 67  LEU B CB  1 
ATOM   2735  C  CG  . LEU B  1 46  ? 129.784 169.644 162.855 1.00 24.05  ? 67  LEU B CG  1 
ATOM   2736  C  CD1 . LEU B  1 46  ? 128.755 168.612 162.443 1.00 23.80  ? 67  LEU B CD1 1 
ATOM   2737  C  CD2 . LEU B  1 46  ? 129.656 170.880 161.967 1.00 24.31  ? 67  LEU B CD2 1 
ATOM   2738  N  N   . LEU B  1 47  ? 129.597 172.389 166.676 1.00 25.15  ? 68  LEU B N   1 
ATOM   2739  C  CA  . LEU B  1 47  ? 129.087 172.642 168.032 1.00 25.56  ? 68  LEU B CA  1 
ATOM   2740  C  C   . LEU B  1 47  ? 127.579 172.897 167.925 1.00 24.72  ? 68  LEU B C   1 
ATOM   2741  O  O   . LEU B  1 47  ? 127.156 173.866 167.291 1.00 25.20  ? 68  LEU B O   1 
ATOM   2742  C  CB  . LEU B  1 47  ? 129.850 173.816 168.650 1.00 26.74  ? 68  LEU B CB  1 
ATOM   2743  C  CG  . LEU B  1 47  ? 129.498 174.173 170.102 1.00 28.20  ? 68  LEU B CG  1 
ATOM   2744  C  CD1 . LEU B  1 47  ? 129.945 173.091 171.063 1.00 28.55  ? 68  LEU B CD1 1 
ATOM   2745  C  CD2 . LEU B  1 47  ? 130.154 175.502 170.508 1.00 29.66  ? 68  LEU B CD2 1 
ATOM   2746  N  N   . GLY B  1 48  ? 126.762 172.047 168.522 1.00 24.17  ? 69  GLY B N   1 
ATOM   2747  C  CA  . GLY B  1 48  ? 125.324 172.320 168.516 1.00 23.39  ? 69  GLY B CA  1 
ATOM   2748  C  C   . GLY B  1 48  ? 124.949 173.206 169.693 1.00 24.44  ? 69  GLY B C   1 
ATOM   2749  O  O   . GLY B  1 48  ? 125.572 173.067 170.785 1.00 24.66  ? 69  GLY B O   1 
ATOM   2750  N  N   . VAL B  1 49  ? 123.937 174.057 169.480 1.00 24.03  ? 70  VAL B N   1 
ATOM   2751  C  CA  . VAL B  1 49  ? 123.370 174.955 170.512 1.00 24.70  ? 70  VAL B CA  1 
ATOM   2752  C  C   . VAL B  1 49  ? 121.874 174.817 170.339 1.00 23.69  ? 70  VAL B C   1 
ATOM   2753  O  O   . VAL B  1 49  ? 121.234 175.542 169.572 1.00 23.01  ? 70  VAL B O   1 
ATOM   2754  C  CB  . VAL B  1 49  ? 123.882 176.400 170.338 1.00 26.80  ? 70  VAL B CB  1 
ATOM   2755  C  CG1 . VAL B  1 49  ? 123.331 177.334 171.408 1.00 27.63  ? 70  VAL B CG1 1 
ATOM   2756  C  CG2 . VAL B  1 49  ? 125.411 176.428 170.297 1.00 27.44  ? 70  VAL B CG2 1 
ATOM   2757  N  N   . PRO B  1 50  ? 121.310 173.795 171.002 1.00 23.45  ? 71  PRO B N   1 
ATOM   2758  C  CA  . PRO B  1 50  ? 119.892 173.470 170.847 1.00 23.58  ? 71  PRO B CA  1 
ATOM   2759  C  C   . PRO B  1 50  ? 119.022 174.456 171.642 1.00 24.06  ? 71  PRO B C   1 
ATOM   2760  O  O   . PRO B  1 50  ? 118.622 174.122 172.763 1.00 24.58  ? 71  PRO B O   1 
ATOM   2761  C  CB  . PRO B  1 50  ? 119.788 172.017 171.375 1.00 23.65  ? 71  PRO B CB  1 
ATOM   2762  C  CG  . PRO B  1 50  ? 120.970 171.842 172.290 1.00 24.39  ? 71  PRO B CG  1 
ATOM   2763  C  CD  . PRO B  1 50  ? 122.044 172.793 171.781 1.00 23.89  ? 71  PRO B CD  1 
ATOM   2764  N  N   . LEU B  1 51  ? 118.819 175.652 171.082 1.00 23.88  ? 72  LEU B N   1 
ATOM   2765  C  CA  . LEU B  1 51  ? 118.186 176.799 171.783 1.00 24.60  ? 72  LEU B CA  1 
ATOM   2766  C  C   . LEU B  1 51  ? 117.124 177.382 170.878 1.00 24.11  ? 72  LEU B C   1 
ATOM   2767  O  O   . LEU B  1 51  ? 117.439 177.728 169.725 1.00 24.69  ? 72  LEU B O   1 
ATOM   2768  C  CB  . LEU B  1 51  ? 119.279 177.800 172.167 1.00 25.53  ? 72  LEU B CB  1 
ATOM   2769  C  CG  . LEU B  1 51  ? 118.859 178.954 173.066 1.00 27.30  ? 72  LEU B CG  1 
ATOM   2770  C  CD1 . LEU B  1 51  ? 120.079 179.677 173.624 1.00 29.17  ? 72  LEU B CD1 1 
ATOM   2771  C  CD2 . LEU B  1 51  ? 117.973 179.967 172.321 1.00 27.27  ? 72  LEU B CD2 1 
ATOM   2772  N  N   . GLY B  1 52  ? 115.885 177.429 171.374 1.00 24.97  ? 73  GLY B N   1 
ATOM   2773  C  CA  . GLY B  1 52  ? 114.716 177.909 170.612 1.00 25.25  ? 73  GLY B CA  1 
ATOM   2774  C  C   . GLY B  1 52  ? 113.960 179.029 171.307 1.00 26.17  ? 73  GLY B C   1 
ATOM   2775  O  O   . GLY B  1 52  ? 113.030 179.563 170.705 1.00 27.61  ? 73  GLY B O   1 
ATOM   2776  N  N   . HIS B  1 53  ? 114.301 179.389 172.531 1.00 26.34  ? 74  HIS B N   1 
ATOM   2777  C  CA  . HIS B  1 53  ? 113.333 180.121 173.370 1.00 28.40  ? 74  HIS B CA  1 
ATOM   2778  C  C   . HIS B  1 53  ? 113.400 181.617 173.047 1.00 29.11  ? 74  HIS B C   1 
ATOM   2779  O  O   . HIS B  1 53  ? 112.618 182.337 173.612 1.00 29.78  ? 74  HIS B O   1 
ATOM   2780  C  CB  . HIS B  1 53  ? 113.478 179.768 174.858 1.00 28.78  ? 74  HIS B CB  1 
ATOM   2781  C  CG  . HIS B  1 53  ? 114.725 180.281 175.457 1.00 29.60  ? 74  HIS B CG  1 
ATOM   2782  N  ND1 . HIS B  1 53  ? 115.928 179.615 175.304 1.00 28.50  ? 74  HIS B ND1 1 
ATOM   2783  C  CD2 . HIS B  1 53  ? 114.952 181.395 176.200 1.00 30.67  ? 74  HIS B CD2 1 
ATOM   2784  C  CE1 . HIS B  1 53  ? 116.847 180.273 175.983 1.00 29.88  ? 74  HIS B CE1 1 
ATOM   2785  N  NE2 . HIS B  1 53  ? 116.266 181.365 176.560 1.00 30.87  ? 74  HIS B NE2 1 
ATOM   2786  N  N   . ASN B  1 54  ? 114.298 182.042 172.167 1.00 29.30  ? 75  ASN B N   1 
ATOM   2787  C  CA  . ASN B  1 54  ? 114.420 183.474 171.775 1.00 31.10  ? 75  ASN B CA  1 
ATOM   2788  C  C   . ASN B  1 54  ? 113.613 183.713 170.490 1.00 32.49  ? 75  ASN B C   1 
ATOM   2789  O  O   . ASN B  1 54  ? 113.589 184.878 170.048 1.00 33.46  ? 75  ASN B O   1 
ATOM   2790  C  CB  . ASN B  1 54  ? 115.893 183.881 171.674 1.00 30.55  ? 75  ASN B CB  1 
ATOM   2791  C  CG  . ASN B  1 54  ? 116.526 184.051 173.047 1.00 30.50  ? 75  ASN B CG  1 
ATOM   2792  O  OD1 . ASN B  1 54  ? 115.881 184.596 173.950 1.00 30.14  ? 75  ASN B OD1 1 
ATOM   2793  N  ND2 . ASN B  1 54  ? 117.769 183.596 173.192 1.00 29.11  ? 75  ASN B ND2 1 
ATOM   2794  N  N   . SER B  1 55  ? 112.999 182.654 169.901 1.00 31.94  ? 76  SER B N   1 
ATOM   2795  C  CA  . SER B  1 55  ? 112.107 182.781 168.706 1.00 31.98  ? 76  SER B CA  1 
ATOM   2796  C  C   . SER B  1 55  ? 110.862 183.636 169.047 1.00 33.00  ? 76  SER B C   1 
ATOM   2797  O  O   . SER B  1 55  ? 110.381 183.603 170.192 1.00 32.60  ? 76  SER B O   1 
ATOM   2798  C  CB  . SER B  1 55  ? 111.682 181.430 168.177 1.00 31.09  ? 76  SER B CB  1 
ATOM   2799  O  OG  . SER B  1 55  ? 112.802 180.578 167.863 1.00 30.42  ? 76  SER B OG  1 
ATOM   2800  N  N   . SER B  1 56  ? 110.308 184.267 168.023 1.00 33.39  ? 77  SER B N   1 
ATOM   2801  C  CA  . SER B  1 56  ? 109.122 185.143 168.050 1.00 35.09  ? 77  SER B CA  1 
ATOM   2802  C  C   . SER B  1 56  ? 107.865 184.338 167.742 1.00 34.61  ? 77  SER B C   1 
ATOM   2803  O  O   . SER B  1 56  ? 106.777 184.816 167.974 1.00 36.17  ? 77  SER B O   1 
ATOM   2804  C  CB  . SER B  1 56  ? 109.302 186.290 167.045 1.00 36.45  ? 77  SER B CB  1 
ATOM   2805  O  OG  . SER B  1 56  ? 109.590 185.833 165.720 1.00 35.78  ? 77  SER B OG  1 
ATOM   2806  N  N   . PHE B  1 57  ? 108.001 183.173 167.152 1.00 33.00  ? 78  PHE B N   1 
ATOM   2807  C  CA  . PHE B  1 57  ? 106.855 182.462 166.543 1.00 32.83  ? 78  PHE B CA  1 
ATOM   2808  C  C   . PHE B  1 57  ? 106.877 180.955 166.892 1.00 31.32  ? 78  PHE B C   1 
ATOM   2809  O  O   . PHE B  1 57  ? 105.879 180.462 167.443 1.00 32.59  ? 78  PHE B O   1 
ATOM   2810  C  CB  . PHE B  1 57  ? 106.854 182.736 165.043 1.00 32.57  ? 78  PHE B CB  1 
ATOM   2811  C  CG  . PHE B  1 57  ? 105.589 182.228 164.407 1.00 32.69  ? 78  PHE B CG  1 
ATOM   2812  C  CD1 . PHE B  1 57  ? 104.368 182.795 164.742 1.00 33.69  ? 78  PHE B CD1 1 
ATOM   2813  C  CD2 . PHE B  1 57  ? 105.624 181.151 163.525 1.00 31.56  ? 78  PHE B CD2 1 
ATOM   2814  C  CE1 . PHE B  1 57  ? 103.190 182.313 164.187 1.00 34.57  ? 78  PHE B CE1 1 
ATOM   2815  C  CE2 . PHE B  1 57  ? 104.443 180.698 162.945 1.00 32.76  ? 78  PHE B CE2 1 
ATOM   2816  C  CZ  . PHE B  1 57  ? 103.230 181.278 163.277 1.00 34.04  ? 78  PHE B CZ  1 
ATOM   2817  N  N   . LEU B  1 58  ? 107.939 180.220 166.599 1.00 29.24  ? 79  LEU B N   1 
ATOM   2818  C  CA  . LEU B  1 58  ? 107.983 178.764 166.932 1.00 28.16  ? 79  LEU B CA  1 
ATOM   2819  C  C   . LEU B  1 58  ? 109.368 178.450 167.484 1.00 27.08  ? 79  LEU B C   1 
ATOM   2820  O  O   . LEU B  1 58  ? 110.322 178.974 166.944 1.00 26.62  ? 79  LEU B O   1 
ATOM   2821  C  CB  . LEU B  1 58  ? 107.655 177.941 165.677 1.00 27.49  ? 79  LEU B CB  1 
ATOM   2822  C  CG  . LEU B  1 58  ? 106.211 178.075 165.198 1.00 29.50  ? 79  LEU B CG  1 
ATOM   2823  C  CD1 . LEU B  1 58  ? 106.023 177.557 163.773 1.00 29.84  ? 79  LEU B CD1 1 
ATOM   2824  C  CD2 . LEU B  1 58  ? 105.216 177.404 166.171 1.00 30.32  ? 79  LEU B CD2 1 
ATOM   2825  N  N   . GLN B  1 59  ? 109.471 177.597 168.499 1.00 27.39  ? 80  GLN B N   1 
ATOM   2826  C  CA  . GLN B  1 59  ? 110.770 177.238 169.134 1.00 26.14  ? 80  GLN B CA  1 
ATOM   2827  C  C   . GLN B  1 59  ? 111.369 175.965 168.558 1.00 25.18  ? 80  GLN B C   1 
ATOM   2828  O  O   . GLN B  1 59  ? 112.449 175.559 169.043 1.00 24.50  ? 80  GLN B O   1 
ATOM   2829  C  CB  . GLN B  1 59  ? 110.598 177.059 170.635 1.00 26.98  ? 80  GLN B CB  1 
ATOM   2830  C  CG  . GLN B  1 59  ? 110.017 178.287 171.296 1.00 27.89  ? 80  GLN B CG  1 
ATOM   2831  C  CD  . GLN B  1 59  ? 110.096 178.246 172.797 1.00 28.81  ? 80  GLN B CD  1 
ATOM   2832  O  OE1 . GLN B  1 59  ? 111.041 177.758 173.448 1.00 28.61  ? 80  GLN B OE1 1 
ATOM   2833  N  NE2 . GLN B  1 59  ? 109.096 178.875 173.346 1.00 29.78  ? 80  GLN B NE2 1 
ATOM   2834  N  N   . GLY B  1 60  ? 110.788 175.404 167.499 1.00 25.35  ? 81  GLY B N   1 
ATOM   2835  C  CA  . GLY B  1 60  ? 111.281 174.123 166.959 1.00 24.52  ? 81  GLY B CA  1 
ATOM   2836  C  C   . GLY B  1 60  ? 112.788 174.050 166.672 1.00 23.22  ? 81  GLY B C   1 
ATOM   2837  O  O   . GLY B  1 60  ? 113.362 172.971 166.681 1.00 22.68  ? 81  GLY B O   1 
ATOM   2838  N  N   . PRO B  1 61  ? 113.500 175.134 166.300 1.00 23.05  ? 82  PRO B N   1 
ATOM   2839  C  CA  . PRO B  1 61  ? 114.940 175.040 166.090 1.00 22.16  ? 82  PRO B CA  1 
ATOM   2840  C  C   . PRO B  1 61  ? 115.709 174.499 167.277 1.00 22.36  ? 82  PRO B C   1 
ATOM   2841  O  O   . PRO B  1 61  ? 116.810 174.087 167.091 1.00 22.11  ? 82  PRO B O   1 
ATOM   2842  C  CB  . PRO B  1 61  ? 115.377 176.474 165.755 1.00 22.85  ? 82  PRO B CB  1 
ATOM   2843  C  CG  . PRO B  1 61  ? 114.134 177.043 165.068 1.00 23.38  ? 82  PRO B CG  1 
ATOM   2844  C  CD  . PRO B  1 61  ? 112.978 176.462 165.901 1.00 23.75  ? 82  PRO B CD  1 
ATOM   2845  N  N   . ALA B  1 62  ? 115.108 174.479 168.453 1.00 23.79  ? 83  ALA B N   1 
ATOM   2846  C  CA  . ALA B  1 62  ? 115.741 173.850 169.636 1.00 24.33  ? 83  ALA B CA  1 
ATOM   2847  C  C   . ALA B  1 62  ? 116.096 172.372 169.331 1.00 24.05  ? 83  ALA B C   1 
ATOM   2848  O  O   . ALA B  1 62  ? 117.049 171.825 169.983 1.00 23.67  ? 83  ALA B O   1 
ATOM   2849  C  CB  . ALA B  1 62  ? 114.846 173.990 170.848 1.00 24.88  ? 83  ALA B CB  1 
ATOM   2850  N  N   . PHE B  1 63  ? 115.369 171.735 168.406 1.00 23.39  ? 84  PHE B N   1 
ATOM   2851  C  CA  . PHE B  1 63  ? 115.493 170.279 168.129 1.00 23.11  ? 84  PHE B CA  1 
ATOM   2852  C  C   . PHE B  1 63  ? 116.400 170.038 166.903 1.00 22.11  ? 84  PHE B C   1 
ATOM   2853  O  O   . PHE B  1 63  ? 116.614 168.884 166.567 1.00 21.53  ? 84  PHE B O   1 
ATOM   2854  C  CB  . PHE B  1 63  ? 114.096 169.682 167.926 1.00 24.95  ? 84  PHE B CB  1 
ATOM   2855  C  CG  . PHE B  1 63  ? 113.139 169.867 169.084 1.00 25.78  ? 84  PHE B CG  1 
ATOM   2856  C  CD1 . PHE B  1 63  ? 113.255 169.148 170.249 1.00 27.32  ? 84  PHE B CD1 1 
ATOM   2857  C  CD2 . PHE B  1 63  ? 112.106 170.765 169.002 1.00 27.01  ? 84  PHE B CD2 1 
ATOM   2858  C  CE1 . PHE B  1 63  ? 112.374 169.330 171.309 1.00 29.55  ? 84  PHE B CE1 1 
ATOM   2859  C  CE2 . PHE B  1 63  ? 111.200 170.921 170.046 1.00 29.49  ? 84  PHE B CE2 1 
ATOM   2860  C  CZ  . PHE B  1 63  ? 111.343 170.224 171.215 1.00 29.19  ? 84  PHE B CZ  1 
ATOM   2861  N  N   . ALA B  1 64  ? 116.949 171.068 166.254 1.00 20.57  ? 85  ALA B N   1 
ATOM   2862  C  CA  . ALA B  1 64  ? 117.563 170.880 164.928 1.00 20.65  ? 85  ALA B CA  1 
ATOM   2863  C  C   . ALA B  1 64  ? 118.868 170.093 164.990 1.00 21.20  ? 85  ALA B C   1 
ATOM   2864  O  O   . ALA B  1 64  ? 119.072 169.232 164.143 1.00 22.59  ? 85  ALA B O   1 
ATOM   2865  C  CB  . ALA B  1 64  ? 117.800 172.191 164.238 1.00 20.09  ? 85  ALA B CB  1 
ATOM   2866  N  N   . PRO B  1 65  ? 119.839 170.421 165.875 1.00 20.94  ? 86  PRO B N   1 
ATOM   2867  C  CA  . PRO B  1 65  ? 121.192 169.924 165.706 1.00 21.15  ? 86  PRO B CA  1 
ATOM   2868  C  C   . PRO B  1 65  ? 121.274 168.408 165.650 1.00 21.58  ? 86  PRO B C   1 
ATOM   2869  O  O   . PRO B  1 65  ? 121.977 167.895 164.804 1.00 22.40  ? 86  PRO B O   1 
ATOM   2870  C  CB  . PRO B  1 65  ? 121.967 170.513 166.879 1.00 22.08  ? 86  PRO B CB  1 
ATOM   2871  C  CG  . PRO B  1 65  ? 121.168 171.784 167.219 1.00 22.07  ? 86  PRO B CG  1 
ATOM   2872  C  CD  . PRO B  1 65  ? 119.726 171.344 167.014 1.00 21.93  ? 86  PRO B CD  1 
ATOM   2873  N  N   . PRO B  1 66  ? 120.537 167.621 166.449 1.00 21.77  ? 87  PRO B N   1 
ATOM   2874  C  CA  . PRO B  1 66  ? 120.587 166.182 166.253 1.00 22.49  ? 87  PRO B CA  1 
ATOM   2875  C  C   . PRO B  1 66  ? 120.097 165.775 164.852 1.00 22.85  ? 87  PRO B C   1 
ATOM   2876  O  O   . PRO B  1 66  ? 120.686 164.893 164.273 1.00 22.67  ? 87  PRO B O   1 
ATOM   2877  C  CB  . PRO B  1 66  ? 119.732 165.664 167.421 1.00 23.73  ? 87  PRO B CB  1 
ATOM   2878  C  CG  . PRO B  1 66  ? 119.816 166.769 168.471 1.00 23.54  ? 87  PRO B CG  1 
ATOM   2879  C  CD  . PRO B  1 66  ? 119.798 168.030 167.650 1.00 22.17  ? 87  PRO B CD  1 
ATOM   2880  N  N   . ARG B  1 67  ? 119.085 166.444 164.305 1.00 23.25  ? 88  ARG B N   1 
ATOM   2881  C  CA  . ARG B  1 67  ? 118.519 166.066 162.986 1.00 24.60  ? 88  ARG B CA  1 
ATOM   2882  C  C   . ARG B  1 67  ? 119.513 166.399 161.878 1.00 22.74  ? 88  ARG B C   1 
ATOM   2883  O  O   . ARG B  1 67  ? 119.577 165.654 160.894 1.00 22.57  ? 88  ARG B O   1 
ATOM   2884  C  CB  . ARG B  1 67  ? 117.181 166.725 162.664 1.00 26.70  ? 88  ARG B CB  1 
ATOM   2885  C  CG  . ARG B  1 67  ? 116.160 166.518 163.745 1.00 31.33  ? 88  ARG B CG  1 
ATOM   2886  C  CD  . ARG B  1 67  ? 116.119 165.082 164.273 1.00 38.59  ? 88  ARG B CD  1 
ATOM   2887  N  NE  . ARG B  1 67  ? 114.924 164.869 165.098 1.00 43.45  ? 88  ARG B NE  1 
ATOM   2888  C  CZ  . ARG B  1 67  ? 113.692 164.671 164.620 1.00 49.04  ? 88  ARG B CZ  1 
ATOM   2889  N  NH1 . ARG B  1 67  ? 113.487 164.646 163.298 1.00 50.51  ? 88  ARG B NH1 1 
ATOM   2890  N  NH2 . ARG B  1 67  ? 112.683 164.494 165.480 1.00 50.90  ? 88  ARG B NH2 1 
ATOM   2891  N  N   . ILE B  1 68  ? 120.235 167.479 162.018 1.00 21.51  ? 89  ILE B N   1 
ATOM   2892  C  CA  . ILE B  1 68  ? 121.242 167.872 160.996 1.00 21.61  ? 89  ILE B CA  1 
ATOM   2893  C  C   . ILE B  1 68  ? 122.342 166.802 160.972 1.00 22.34  ? 89  ILE B C   1 
ATOM   2894  O  O   . ILE B  1 68  ? 122.695 166.296 159.853 1.00 20.62  ? 89  ILE B O   1 
ATOM   2895  C  CB  . ILE B  1 68  ? 121.785 169.269 161.306 1.00 21.46  ? 89  ILE B CB  1 
ATOM   2896  C  CG1 . ILE B  1 68  ? 120.658 170.295 161.368 1.00 21.53  ? 89  ILE B CG1 1 
ATOM   2897  C  CG2 . ILE B  1 68  ? 122.869 169.661 160.307 1.00 21.94  ? 89  ILE B CG2 1 
ATOM   2898  C  CD1 . ILE B  1 68  ? 121.159 171.712 161.669 1.00 22.05  ? 89  ILE B CD1 1 
ATOM   2899  N  N   . ARG B  1 69  ? 122.820 166.385 162.148 1.00 23.32  ? 90  ARG B N   1 
ATOM   2900  C  CA  . ARG B  1 69  ? 123.882 165.337 162.180 1.00 25.12  ? 90  ARG B CA  1 
ATOM   2901  C  C   . ARG B  1 69  ? 123.381 164.086 161.487 1.00 25.61  ? 90  ARG B C   1 
ATOM   2902  O  O   . ARG B  1 69  ? 124.119 163.504 160.708 1.00 27.21  ? 90  ARG B O   1 
ATOM   2903  C  CB  . ARG B  1 69  ? 124.271 164.908 163.592 1.00 26.19  ? 90  ARG B CB  1 
ATOM   2904  C  CG  . ARG B  1 69  ? 124.939 166.024 164.357 1.00 26.39  ? 90  ARG B CG  1 
ATOM   2905  C  CD  . ARG B  1 69  ? 125.365 165.530 165.742 1.00 28.16  ? 90  ARG B CD  1 
ATOM   2906  N  NE  . ARG B  1 69  ? 126.096 166.665 166.311 1.00 28.76  ? 90  ARG B NE  1 
ATOM   2907  C  CZ  . ARG B  1 69  ? 125.574 167.601 167.098 1.00 30.10  ? 90  ARG B CZ  1 
ATOM   2908  N  NH1 . ARG B  1 69  ? 124.333 167.481 167.546 1.00 31.27  ? 90  ARG B NH1 1 
ATOM   2909  N  NH2 . ARG B  1 69  ? 126.340 168.591 167.534 1.00 31.20  ? 90  ARG B NH2 1 
ATOM   2910  N  N   . GLU B  1 70  ? 122.166 163.643 161.788 1.00 26.19  ? 91  GLU B N   1 
ATOM   2911  C  CA  . GLU B  1 70  ? 121.633 162.435 161.121 1.00 26.58  ? 91  GLU B CA  1 
ATOM   2912  C  C   . GLU B  1 70  ? 121.747 162.628 159.598 1.00 25.12  ? 91  GLU B C   1 
ATOM   2913  O  O   . GLU B  1 70  ? 122.125 161.658 158.916 1.00 26.61  ? 91  GLU B O   1 
ATOM   2914  C  CB  . GLU B  1 70  ? 120.199 162.171 161.577 1.00 28.39  ? 91  GLU B CB  1 
ATOM   2915  C  CG  . GLU B  1 70  ? 119.666 160.822 161.158 1.00 31.61  ? 91  GLU B CG  1 
ATOM   2916  C  CD  . GLU B  1 70  ? 118.148 160.617 161.194 1.00 34.60  ? 91  GLU B CD  1 
ATOM   2917  O  OE1 . GLU B  1 70  ? 117.774 159.481 161.006 1.00 40.15  ? 91  GLU B OE1 1 
ATOM   2918  O  OE2 . GLU B  1 70  ? 117.332 161.571 161.372 1.00 33.36  ? 91  GLU B OE2 1 
ATOM   2919  N  N   . ALA B  1 71  ? 121.359 163.788 159.050 1.00 22.86  ? 92  ALA B N   1 
ATOM   2920  C  CA  . ALA B  1 71  ? 121.259 164.012 157.593 1.00 22.57  ? 92  ALA B CA  1 
ATOM   2921  C  C   . ALA B  1 71  ? 122.658 164.034 156.958 1.00 22.89  ? 92  ALA B C   1 
ATOM   2922  O  O   . ALA B  1 71  ? 122.802 163.519 155.818 1.00 23.23  ? 92  ALA B O   1 
ATOM   2923  C  CB  . ALA B  1 71  ? 120.484 165.260 157.287 1.00 22.46  ? 92  ALA B CB  1 
ATOM   2924  N  N   . ILE B  1 72  ? 123.657 164.545 157.676 1.00 22.24  ? 93  ILE B N   1 
ATOM   2925  C  CA  . ILE B  1 72  ? 125.052 164.583 157.180 1.00 23.54  ? 93  ILE B CA  1 
ATOM   2926  C  C   . ILE B  1 72  ? 125.490 163.147 156.836 1.00 24.82  ? 93  ILE B C   1 
ATOM   2927  O  O   . ILE B  1 72  ? 126.127 162.955 155.795 1.00 24.30  ? 93  ILE B O   1 
ATOM   2928  C  CB  . ILE B  1 72  ? 125.972 165.266 158.214 1.00 23.22  ? 93  ILE B CB  1 
ATOM   2929  C  CG1 . ILE B  1 72  ? 125.671 166.749 158.382 1.00 22.49  ? 93  ILE B CG1 1 
ATOM   2930  C  CG2 . ILE B  1 72  ? 127.420 165.051 157.838 1.00 24.17  ? 93  ILE B CG2 1 
ATOM   2931  C  CD1 . ILE B  1 72  ? 126.336 167.352 159.581 1.00 23.02  ? 93  ILE B CD1 1 
ATOM   2932  N  N   . TRP B  1 73  ? 125.120 162.175 157.688 1.00 26.28  ? 94  TRP B N   1 
ATOM   2933  C  CA  . TRP B  1 73  ? 125.614 160.777 157.628 1.00 27.49  ? 94  TRP B CA  1 
ATOM   2934  C  C   . TRP B  1 73  ? 124.535 159.872 157.047 1.00 27.27  ? 94  TRP B C   1 
ATOM   2935  O  O   . TRP B  1 73  ? 124.761 158.723 157.003 1.00 28.81  ? 94  TRP B O   1 
ATOM   2936  C  CB  . TRP B  1 73  ? 126.122 160.310 159.008 1.00 29.08  ? 94  TRP B CB  1 
ATOM   2937  C  CG  . TRP B  1 73  ? 127.220 161.209 159.489 1.00 29.56  ? 94  TRP B CG  1 
ATOM   2938  C  CD1 . TRP B  1 73  ? 127.163 162.102 160.526 1.00 30.07  ? 94  TRP B CD1 1 
ATOM   2939  C  CD2 . TRP B  1 73  ? 128.487 161.419 158.847 1.00 30.49  ? 94  TRP B CD2 1 
ATOM   2940  N  NE1 . TRP B  1 73  ? 128.335 162.813 160.617 1.00 31.27  ? 94  TRP B NE1 1 
ATOM   2941  C  CE2 . TRP B  1 73  ? 129.158 162.430 159.582 1.00 31.52  ? 94  TRP B CE2 1 
ATOM   2942  C  CE3 . TRP B  1 73  ? 129.135 160.828 157.762 1.00 32.13  ? 94  TRP B CE3 1 
ATOM   2943  C  CZ2 . TRP B  1 73  ? 130.443 162.863 159.253 1.00 31.78  ? 94  TRP B CZ2 1 
ATOM   2944  C  CZ3 . TRP B  1 73  ? 130.404 161.258 157.432 1.00 33.71  ? 94  TRP B CZ3 1 
ATOM   2945  C  CH2 . TRP B  1 73  ? 131.048 162.263 158.168 1.00 32.19  ? 94  TRP B CH2 1 
ATOM   2946  N  N   . CYS B  1 74  ? 123.410 160.359 156.569 1.00 26.08  ? 95  CYS B N   1 
ATOM   2947  C  CA  . CYS B  1 74  ? 122.390 159.463 155.978 1.00 26.79  ? 95  CYS B CA  1 
ATOM   2948  C  C   . CYS B  1 74  ? 123.056 158.515 154.939 1.00 27.99  ? 95  CYS B C   1 
ATOM   2949  O  O   . CYS B  1 74  ? 123.920 158.943 154.205 1.00 27.48  ? 95  CYS B O   1 
ATOM   2950  C  CB  . CYS B  1 74  ? 121.270 160.318 155.406 1.00 26.18  ? 95  CYS B CB  1 
ATOM   2951  S  SG  . CYS B  1 74  ? 120.032 159.404 154.463 1.00 28.25  ? 95  CYS B SG  1 
ATOM   2952  N  N   . GLY B  1 75  ? 122.694 157.227 154.936 1.00 29.99  ? 96  GLY B N   1 
ATOM   2953  C  CA  . GLY B  1 75  ? 123.130 156.196 153.959 1.00 31.37  ? 96  GLY B CA  1 
ATOM   2954  C  C   . GLY B  1 75  ? 122.681 156.484 152.529 1.00 31.66  ? 96  GLY B C   1 
ATOM   2955  O  O   . GLY B  1 75  ? 123.184 155.867 151.638 1.00 33.44  ? 96  GLY B O   1 
ATOM   2956  N  N   . SER B  1 76  ? 121.789 157.439 152.278 1.00 30.72  ? 97  SER B N   1 
ATOM   2957  C  CA  . SER B  1 76  ? 121.365 157.820 150.900 1.00 31.15  ? 97  SER B CA  1 
ATOM   2958  C  C   . SER B  1 76  ? 122.451 158.698 150.259 1.00 30.71  ? 97  SER B C   1 
ATOM   2959  O  O   . SER B  1 76  ? 122.423 158.829 149.024 1.00 30.90  ? 97  SER B O   1 
ATOM   2960  C  CB  . SER B  1 76  ? 120.007 158.523 150.909 1.00 30.44  ? 97  SER B CB  1 
ATOM   2961  O  OG  . SER B  1 76  ? 120.131 159.778 151.518 1.00 27.42  ? 97  SER B OG  1 
ATOM   2962  N  N   . THR B  1 77  ? 123.376 159.224 151.072 1.00 30.11  ? 98  THR B N   1 
ATOM   2963  C  CA  . THR B  1 77  ? 124.402 160.214 150.669 1.00 31.46  ? 98  THR B CA  1 
ATOM   2964  C  C   . THR B  1 77  ? 125.775 159.557 150.565 1.00 33.29  ? 98  THR B C   1 
ATOM   2965  O  O   . THR B  1 77  ? 126.021 158.539 151.205 1.00 35.11  ? 98  THR B O   1 
ATOM   2966  C  CB  . THR B  1 77  ? 124.473 161.411 151.634 1.00 29.91  ? 98  THR B CB  1 
ATOM   2967  O  OG1 . THR B  1 77  ? 124.823 161.042 152.981 1.00 30.13  ? 98  THR B OG1 1 
ATOM   2968  C  CG2 . THR B  1 77  ? 123.169 162.158 151.640 1.00 29.53  ? 98  THR B CG2 1 
ATOM   2969  N  N   . ASN B  1 78  ? 126.712 160.182 149.879 1.00 35.20  ? 99  ASN B N   1 
ATOM   2970  C  CA  . ASN B  1 78  ? 128.126 159.755 150.096 1.00 36.20  ? 99  ASN B CA  1 
ATOM   2971  C  C   . ASN B  1 78  ? 128.802 160.842 150.915 1.00 32.66  ? 99  ASN B C   1 
ATOM   2972  O  O   . ASN B  1 78  ? 128.165 161.880 151.128 1.00 31.39  ? 99  ASN B O   1 
ATOM   2973  C  CB  . ASN B  1 78  ? 128.866 159.356 148.815 1.00 39.21  ? 99  ASN B CB  1 
ATOM   2974  C  CG  . ASN B  1 78  ? 129.013 160.505 147.865 1.00 40.19  ? 99  ASN B CG  1 
ATOM   2975  O  OD1 . ASN B  1 78  ? 129.360 161.580 148.297 1.00 40.55  ? 99  ASN B OD1 1 
ATOM   2976  N  ND2 . ASN B  1 78  ? 128.773 160.272 146.586 1.00 45.22  ? 99  ASN B ND2 1 
ATOM   2977  N  N   . SER B  1 79  ? 130.027 160.566 151.365 1.00 31.45  ? 100 SER B N   1 
ATOM   2978  C  CA  . SER B  1 79  ? 130.811 161.399 152.295 1.00 29.42  ? 100 SER B CA  1 
ATOM   2979  C  C   . SER B  1 79  ? 131.658 162.437 151.546 1.00 29.18  ? 100 SER B C   1 
ATOM   2980  O  O   . SER B  1 79  ? 132.455 163.124 152.223 1.00 29.69  ? 100 SER B O   1 
ATOM   2981  C  CB  . SER B  1 79  ? 131.661 160.514 153.148 1.00 30.33  ? 100 SER B CB  1 
ATOM   2982  O  OG  . SER B  1 79  ? 132.498 159.663 152.369 1.00 32.40  ? 100 SER B OG  1 
ATOM   2983  N  N   . ALA B  1 80  ? 131.524 162.581 150.225 1.00 29.11  ? 101 ALA B N   1 
ATOM   2984  C  CA  . ALA B  1 80  ? 132.258 163.603 149.447 1.00 29.58  ? 101 ALA B CA  1 
ATOM   2985  C  C   . ALA B  1 80  ? 131.463 164.909 149.416 1.00 29.08  ? 101 ALA B C   1 
ATOM   2986  O  O   . ALA B  1 80  ? 130.282 164.844 149.131 1.00 29.62  ? 101 ALA B O   1 
ATOM   2987  C  CB  . ALA B  1 80  ? 132.487 163.103 148.061 1.00 31.33  ? 101 ALA B CB  1 
ATOM   2988  N  N   . THR B  1 81  ? 132.089 166.057 149.682 1.00 28.65  ? 102 THR B N   1 
ATOM   2989  C  CA  . THR B  1 81  ? 131.515 167.382 149.332 1.00 28.60  ? 102 THR B CA  1 
ATOM   2990  C  C   . THR B  1 81  ? 131.555 167.586 147.806 1.00 29.69  ? 102 THR B C   1 
ATOM   2991  O  O   . THR B  1 81  ? 132.277 166.845 147.105 1.00 31.19  ? 102 THR B O   1 
ATOM   2992  C  CB  . THR B  1 81  ? 132.213 168.500 150.125 1.00 28.62  ? 102 THR B CB  1 
ATOM   2993  O  OG1 . THR B  1 81  ? 133.484 168.838 149.570 1.00 28.84  ? 102 THR B OG1 1 
ATOM   2994  C  CG2 . THR B  1 81  ? 132.384 168.119 151.578 1.00 27.79  ? 102 THR B CG2 1 
ATOM   2995  N  N   . GLU B  1 82  ? 130.816 168.566 147.310 1.00 29.64  ? 103 GLU B N   1 
ATOM   2996  C  CA  . GLU B  1 82  ? 130.664 168.866 145.867 1.00 31.56  ? 103 GLU B CA  1 
ATOM   2997  C  C   . GLU B  1 82  ? 132.044 169.101 145.230 1.00 33.80  ? 103 GLU B C   1 
ATOM   2998  O  O   . GLU B  1 82  ? 132.210 168.749 144.061 1.00 33.96  ? 103 GLU B O   1 
ATOM   2999  C  CB  . GLU B  1 82  ? 129.758 170.093 145.688 1.00 31.40  ? 103 GLU B CB  1 
ATOM   3000  C  CG  . GLU B  1 82  ? 128.273 169.834 145.845 1.00 30.62  ? 103 GLU B CG  1 
ATOM   3001  C  CD  . GLU B  1 82  ? 127.343 170.773 145.095 1.00 31.82  ? 103 GLU B CD  1 
ATOM   3002  O  OE1 . GLU B  1 82  ? 127.807 171.779 144.422 1.00 33.09  ? 103 GLU B OE1 1 
ATOM   3003  O  OE2 . GLU B  1 82  ? 126.143 170.474 145.137 1.00 31.51  ? 103 GLU B OE2 1 
ATOM   3004  N  N   . GLU B  1 83  ? 132.975 169.749 145.951 1.00 35.40  ? 104 GLU B N   1 
ATOM   3005  C  CA  . GLU B  1 83  ? 134.330 170.079 145.414 1.00 38.57  ? 104 GLU B CA  1 
ATOM   3006  C  C   . GLU B  1 83  ? 135.341 169.010 145.858 1.00 38.64  ? 104 GLU B C   1 
ATOM   3007  O  O   . GLU B  1 83  ? 136.538 169.188 145.587 1.00 39.28  ? 104 GLU B O   1 
ATOM   3008  C  CB  . GLU B  1 83  ? 134.776 171.485 145.825 1.00 40.83  ? 104 GLU B CB  1 
ATOM   3009  C  CG  . GLU B  1 83  ? 133.795 172.547 145.350 1.00 43.51  ? 104 GLU B CG  1 
ATOM   3010  C  CD  . GLU B  1 83  ? 134.290 173.977 145.177 1.00 46.69  ? 104 GLU B CD  1 
ATOM   3011  O  OE1 . GLU B  1 83  ? 134.677 174.596 146.204 1.00 47.28  ? 104 GLU B OE1 1 
ATOM   3012  O  OE2 . GLU B  1 83  ? 134.237 174.493 144.017 1.00 50.02  ? 104 GLU B OE2 1 
ATOM   3013  N  N   . GLY B  1 84  ? 134.874 167.933 146.489 1.00 37.54  ? 105 GLY B N   1 
ATOM   3014  C  CA  . GLY B  1 84  ? 135.613 166.655 146.561 1.00 38.41  ? 105 GLY B CA  1 
ATOM   3015  C  C   . GLY B  1 84  ? 136.343 166.432 147.881 1.00 37.37  ? 105 GLY B C   1 
ATOM   3016  O  O   . GLY B  1 84  ? 137.179 165.584 147.897 1.00 37.67  ? 105 GLY B O   1 
ATOM   3017  N  N   . LYS B  1 85  ? 136.015 167.121 148.970 1.00 36.60  ? 106 LYS B N   1 
ATOM   3018  C  CA  . LYS B  1 85  ? 136.640 166.813 150.283 1.00 36.36  ? 106 LYS B CA  1 
ATOM   3019  C  C   . LYS B  1 85  ? 135.933 165.632 150.921 1.00 35.64  ? 106 LYS B C   1 
ATOM   3020  O  O   . LYS B  1 85  ? 134.733 165.451 150.692 1.00 34.38  ? 106 LYS B O   1 
ATOM   3021  C  CB  . LYS B  1 85  ? 136.617 167.993 151.236 1.00 35.98  ? 106 LYS B CB  1 
ATOM   3022  C  CG  . LYS B  1 85  ? 137.440 169.146 150.702 1.00 38.32  ? 106 LYS B CG  1 
ATOM   3023  C  CD  . LYS B  1 85  ? 138.055 170.006 151.739 1.00 38.88  ? 106 LYS B CD  1 
ATOM   3024  C  CE  . LYS B  1 85  ? 139.003 171.020 151.124 1.00 40.55  ? 106 LYS B CE  1 
ATOM   3025  N  NZ  . LYS B  1 85  ? 139.100 172.175 152.046 1.00 40.99  ? 106 LYS B NZ  1 
ATOM   3026  N  N   . GLU B  1 86  ? 136.687 164.886 151.721 1.00 35.68  ? 107 GLU B N   1 
ATOM   3027  C  CA  . GLU B  1 86  ? 136.235 163.641 152.359 1.00 35.48  ? 107 GLU B CA  1 
ATOM   3028  C  C   . GLU B  1 86  ? 135.771 163.988 153.788 1.00 33.51  ? 107 GLU B C   1 
ATOM   3029  O  O   . GLU B  1 86  ? 136.613 164.250 154.672 1.00 32.73  ? 107 GLU B O   1 
ATOM   3030  C  CB  . GLU B  1 86  ? 137.352 162.595 152.206 1.00 38.38  ? 107 GLU B CB  1 
ATOM   3031  C  CG  . GLU B  1 86  ? 137.002 161.227 152.800 1.00 39.90  ? 107 GLU B CG  1 
ATOM   3032  C  CD  . GLU B  1 86  ? 135.614 160.685 152.453 1.00 40.68  ? 107 GLU B CD  1 
ATOM   3033  O  OE1 . GLU B  1 86  ? 135.415 160.263 151.235 1.00 43.27  ? 107 GLU B OE1 1 
ATOM   3034  O  OE2 . GLU B  1 86  ? 134.717 160.718 153.381 1.00 37.92  ? 107 GLU B OE2 1 
ATOM   3035  N  N   . LEU B  1 87  ? 134.459 163.952 154.029 1.00 31.82  ? 108 LEU B N   1 
ATOM   3036  C  CA  . LEU B  1 87  ? 133.896 164.284 155.366 1.00 30.85  ? 108 LEU B CA  1 
ATOM   3037  C  C   . LEU B  1 87  ? 134.300 163.254 156.440 1.00 30.97  ? 108 LEU B C   1 
ATOM   3038  O  O   . LEU B  1 87  ? 134.263 163.616 157.620 1.00 30.54  ? 108 LEU B O   1 
ATOM   3039  C  CB  . LEU B  1 87  ? 132.393 164.389 155.235 1.00 29.68  ? 108 LEU B CB  1 
ATOM   3040  C  CG  . LEU B  1 87  ? 131.895 165.532 154.374 1.00 28.99  ? 108 LEU B CG  1 
ATOM   3041  C  CD1 . LEU B  1 87  ? 130.475 165.279 154.015 1.00 28.46  ? 108 LEU B CD1 1 
ATOM   3042  C  CD2 . LEU B  1 87  ? 132.011 166.846 155.128 1.00 29.65  ? 108 LEU B CD2 1 
ATOM   3043  N  N   . LYS B  1 88  ? 134.692 162.037 156.080 1.00 32.40  ? 109 LYS B N   1 
ATOM   3044  C  CA  . LYS B  1 88  ? 135.149 161.032 157.087 1.00 34.34  ? 109 LYS B CA  1 
ATOM   3045  C  C   . LYS B  1 88  ? 136.562 161.362 157.577 1.00 33.56  ? 109 LYS B C   1 
ATOM   3046  O  O   . LYS B  1 88  ? 136.953 160.756 158.571 1.00 34.99  ? 109 LYS B O   1 
ATOM   3047  C  CB  . LYS B  1 88  ? 135.115 159.600 156.533 1.00 37.16  ? 109 LYS B CB  1 
ATOM   3048  C  CG  . LYS B  1 88  ? 133.694 159.053 156.437 1.00 38.87  ? 109 LYS B CG  1 
ATOM   3049  C  CD  . LYS B  1 88  ? 133.662 157.794 155.621 1.00 41.97  ? 109 LYS B CD  1 
ATOM   3050  C  CE  . LYS B  1 88  ? 132.279 157.248 155.330 1.00 43.34  ? 109 LYS B CE  1 
ATOM   3051  N  NZ  . LYS B  1 88  ? 132.453 156.002 154.532 1.00 45.59  ? 109 LYS B NZ  1 
ATOM   3052  N  N   . ASP B  1 89  ? 137.307 162.244 156.903 1.00 32.78  ? 110 ASP B N   1 
ATOM   3053  C  CA  . ASP B  1 89  ? 138.630 162.748 157.399 1.00 33.26  ? 110 ASP B CA  1 
ATOM   3054  C  C   . ASP B  1 89  ? 138.368 163.722 158.538 1.00 31.17  ? 110 ASP B C   1 
ATOM   3055  O  O   . ASP B  1 89  ? 137.736 164.720 158.323 1.00 29.70  ? 110 ASP B O   1 
ATOM   3056  C  CB  . ASP B  1 89  ? 139.425 163.426 156.288 1.00 34.09  ? 110 ASP B CB  1 
ATOM   3057  C  CG  . ASP B  1 89  ? 140.861 163.817 156.609 1.00 35.78  ? 110 ASP B CG  1 
ATOM   3058  O  OD1 . ASP B  1 89  ? 141.233 163.846 157.797 1.00 35.83  ? 110 ASP B OD1 1 
ATOM   3059  O  OD2 . ASP B  1 89  ? 141.619 164.065 155.638 1.00 36.73  ? 110 ASP B OD2 1 
ATOM   3060  N  N   . PRO B  1 90  ? 138.761 163.440 159.787 1.00 31.36  ? 111 PRO B N   1 
ATOM   3061  C  CA  . PRO B  1 90  ? 138.492 164.333 160.911 1.00 30.81  ? 111 PRO B CA  1 
ATOM   3062  C  C   . PRO B  1 90  ? 139.078 165.725 160.680 1.00 30.54  ? 111 PRO B C   1 
ATOM   3063  O  O   . PRO B  1 90  ? 138.577 166.668 161.226 1.00 29.56  ? 111 PRO B O   1 
ATOM   3064  C  CB  . PRO B  1 90  ? 139.218 163.699 162.102 1.00 32.31  ? 111 PRO B CB  1 
ATOM   3065  C  CG  . PRO B  1 90  ? 139.298 162.244 161.737 1.00 33.33  ? 111 PRO B CG  1 
ATOM   3066  C  CD  . PRO B  1 90  ? 139.420 162.209 160.219 1.00 33.19  ? 111 PRO B CD  1 
ATOM   3067  N  N   . ARG B  1 91  ? 140.129 165.789 159.876 1.00 31.44  ? 112 ARG B N   1 
ATOM   3068  C  CA  . ARG B  1 91  ? 140.761 167.064 159.464 1.00 32.51  ? 112 ARG B CA  1 
ATOM   3069  C  C   . ARG B  1 91  ? 139.798 167.935 158.657 1.00 30.94  ? 112 ARG B C   1 
ATOM   3070  O  O   . ARG B  1 91  ? 140.090 169.115 158.540 1.00 31.71  ? 112 ARG B O   1 
ATOM   3071  C  CB  . ARG B  1 91  ? 142.026 166.803 158.643 1.00 34.41  ? 112 ARG B CB  1 
ATOM   3072  C  CG  . ARG B  1 91  ? 143.128 166.209 159.514 1.00 36.48  ? 112 ARG B CG  1 
ATOM   3073  C  CD  . ARG B  1 91  ? 144.343 165.774 158.747 1.00 38.28  ? 112 ARG B CD  1 
ATOM   3074  N  NE  . ARG B  1 91  ? 143.958 164.830 157.693 1.00 37.83  ? 112 ARG B NE  1 
ATOM   3075  C  CZ  . ARG B  1 91  ? 144.828 164.149 156.971 1.00 39.05  ? 112 ARG B CZ  1 
ATOM   3076  N  NH1 . ARG B  1 91  ? 146.124 164.264 157.205 1.00 40.70  ? 112 ARG B NH1 1 
ATOM   3077  N  NH2 . ARG B  1 91  ? 144.382 163.346 156.039 1.00 38.86  ? 112 ARG B NH2 1 
ATOM   3078  N  N   . VAL B  1 92  ? 138.775 167.345 158.059 1.00 29.72  ? 113 VAL B N   1 
ATOM   3079  C  CA  . VAL B  1 92  ? 137.728 168.036 157.264 1.00 29.14  ? 113 VAL B CA  1 
ATOM   3080  C  C   . VAL B  1 92  ? 136.533 168.299 158.183 1.00 28.41  ? 113 VAL B C   1 
ATOM   3081  O  O   . VAL B  1 92  ? 136.000 169.400 158.168 1.00 28.47  ? 113 VAL B O   1 
ATOM   3082  C  CB  . VAL B  1 92  ? 137.309 167.199 156.039 1.00 28.82  ? 113 VAL B CB  1 
ATOM   3083  C  CG1 . VAL B  1 92  ? 136.136 167.858 155.328 1.00 27.92  ? 113 VAL B CG1 1 
ATOM   3084  C  CG2 . VAL B  1 92  ? 138.457 166.940 155.079 1.00 29.81  ? 113 VAL B CG2 1 
ATOM   3085  N  N   . LEU B  1 93  ? 136.138 167.314 158.988 1.00 28.54  ? 114 LEU B N   1 
ATOM   3086  C  CA  . LEU B  1 93  ? 135.016 167.505 159.894 1.00 28.13  ? 114 LEU B CA  1 
ATOM   3087  C  C   . LEU B  1 93  ? 135.209 166.666 161.154 1.00 29.74  ? 114 LEU B C   1 
ATOM   3088  O  O   . LEU B  1 93  ? 135.483 165.432 161.015 1.00 30.89  ? 114 LEU B O   1 
ATOM   3089  C  CB  . LEU B  1 93  ? 133.742 167.103 159.148 1.00 27.37  ? 114 LEU B CB  1 
ATOM   3090  C  CG  . LEU B  1 93  ? 132.460 167.299 159.943 1.00 25.79  ? 114 LEU B CG  1 
ATOM   3091  C  CD1 . LEU B  1 93  ? 132.285 168.750 160.312 1.00 25.54  ? 114 LEU B CD1 1 
ATOM   3092  C  CD2 . LEU B  1 93  ? 131.275 166.828 159.144 1.00 25.30  ? 114 LEU B CD2 1 
ATOM   3093  N  N   . THR B  1 94  ? 134.954 167.296 162.310 1.00 29.29  ? 115 THR B N   1 
ATOM   3094  C  CA  . THR B  1 94  ? 134.744 166.627 163.618 1.00 29.42  ? 115 THR B CA  1 
ATOM   3095  C  C   . THR B  1 94  ? 133.502 167.245 164.242 1.00 28.42  ? 115 THR B C   1 
ATOM   3096  O  O   . THR B  1 94  ? 133.022 168.294 163.700 1.00 26.83  ? 115 THR B O   1 
ATOM   3097  C  CB  . THR B  1 94  ? 135.882 166.838 164.633 1.00 30.45  ? 115 THR B CB  1 
ATOM   3098  O  OG1 . THR B  1 94  ? 136.220 168.227 164.724 1.00 30.29  ? 115 THR B OG1 1 
ATOM   3099  C  CG2 . THR B  1 94  ? 137.104 166.027 164.323 1.00 32.11  ? 115 THR B CG2 1 
ATOM   3100  N  N   . ASP B  1 95  ? 133.114 166.713 165.405 1.00 28.46  ? 116 ASP B N   1 
ATOM   3101  C  CA  . ASP B  1 95  ? 131.891 167.133 166.102 1.00 28.46  ? 116 ASP B CA  1 
ATOM   3102  C  C   . ASP B  1 95  ? 132.146 167.063 167.606 1.00 28.97  ? 116 ASP B C   1 
ATOM   3103  O  O   . ASP B  1 95  ? 132.413 165.942 168.113 1.00 30.43  ? 116 ASP B O   1 
ATOM   3104  C  CB  . ASP B  1 95  ? 130.756 166.230 165.619 1.00 28.68  ? 116 ASP B CB  1 
ATOM   3105  C  CG  . ASP B  1 95  ? 129.390 166.609 166.161 1.00 28.73  ? 116 ASP B CG  1 
ATOM   3106  O  OD1 . ASP B  1 95  ? 129.287 167.626 166.840 1.00 28.30  ? 116 ASP B OD1 1 
ATOM   3107  O  OD2 . ASP B  1 95  ? 128.440 165.871 165.878 1.00 31.54  ? 116 ASP B OD2 1 
ATOM   3108  N  N   . VAL B  1 96  ? 132.054 168.190 168.299 1.00 28.49  ? 117 VAL B N   1 
ATOM   3109  C  CA  . VAL B  1 96  ? 132.209 168.208 169.772 1.00 30.07  ? 117 VAL B CA  1 
ATOM   3110  C  C   . VAL B  1 96  ? 130.825 168.117 170.420 1.00 29.10  ? 117 VAL B C   1 
ATOM   3111  O  O   . VAL B  1 96  ? 130.769 168.086 171.639 1.00 29.99  ? 117 VAL B O   1 
ATOM   3112  C  CB  . VAL B  1 96  ? 133.044 169.380 170.322 1.00 32.55  ? 117 VAL B CB  1 
ATOM   3113  C  CG1 . VAL B  1 96  ? 134.332 169.598 169.538 1.00 32.97  ? 117 VAL B CG1 1 
ATOM   3114  C  CG2 . VAL B  1 96  ? 132.252 170.657 170.391 1.00 33.78  ? 117 VAL B CG2 1 
ATOM   3115  N  N   . GLY B  1 97  ? 129.762 167.982 169.642 1.00 27.46  ? 118 GLY B N   1 
ATOM   3116  C  CA  . GLY B  1 97  ? 128.420 167.710 170.169 1.00 27.32  ? 118 GLY B CA  1 
ATOM   3117  C  C   . GLY B  1 97  ? 127.719 168.986 170.612 1.00 27.13  ? 118 GLY B C   1 
ATOM   3118  O  O   . GLY B  1 97  ? 127.959 170.021 170.028 1.00 26.85  ? 118 GLY B O   1 
ATOM   3119  N  N   . ASP B  1 98  ? 126.770 168.846 171.516 1.00 27.33  ? 119 ASP B N   1 
ATOM   3120  C  CA  . ASP B  1 98  ? 125.734 169.849 171.846 1.00 27.58  ? 119 ASP B CA  1 
ATOM   3121  C  C   . ASP B  1 98  ? 126.021 170.471 173.227 1.00 27.50  ? 119 ASP B C   1 
ATOM   3122  O  O   . ASP B  1 98  ? 126.375 169.784 174.138 1.00 27.31  ? 119 ASP B O   1 
ATOM   3123  C  CB  . ASP B  1 98  ? 124.342 169.200 171.799 1.00 28.45  ? 119 ASP B CB  1 
ATOM   3124  C  CG  . ASP B  1 98  ? 123.730 169.064 170.410 1.00 28.59  ? 119 ASP B CG  1 
ATOM   3125  O  OD1 . ASP B  1 98  ? 124.378 169.519 169.419 1.00 27.59  ? 119 ASP B OD1 1 
ATOM   3126  O  OD2 . ASP B  1 98  ? 122.575 168.535 170.320 1.00 30.30  ? 119 ASP B OD2 1 
ATOM   3127  N  N   . VAL B  1 99  ? 125.936 171.788 173.301 1.00 27.35  ? 120 VAL B N   1 
ATOM   3128  C  CA  . VAL B  1 99  ? 125.856 172.540 174.575 1.00 28.71  ? 120 VAL B CA  1 
ATOM   3129  C  C   . VAL B  1 99  ? 124.569 172.087 175.225 1.00 28.26  ? 120 VAL B C   1 
ATOM   3130  O  O   . VAL B  1 99  ? 123.515 172.187 174.628 1.00 26.72  ? 120 VAL B O   1 
ATOM   3131  C  CB  . VAL B  1 99  ? 125.824 174.072 174.305 1.00 28.53  ? 120 VAL B CB  1 
ATOM   3132  C  CG1 . VAL B  1 99  ? 125.569 174.860 175.584 1.00 29.89  ? 120 VAL B CG1 1 
ATOM   3133  C  CG2 . VAL B  1 99  ? 127.100 174.553 173.642 1.00 28.23  ? 120 VAL B CG2 1 
ATOM   3134  N  N   . PRO B  1 100 ? 124.585 171.602 176.462 1.00 28.18  ? 121 PRO B N   1 
ATOM   3135  C  CA  . PRO B  1 100 ? 123.343 171.200 177.131 1.00 29.50  ? 121 PRO B CA  1 
ATOM   3136  C  C   . PRO B  1 100 ? 122.519 172.403 177.647 1.00 30.26  ? 121 PRO B C   1 
ATOM   3137  O  O   . PRO B  1 100 ? 122.322 172.631 178.849 1.00 31.19  ? 121 PRO B O   1 
ATOM   3138  C  CB  . PRO B  1 100 ? 123.888 170.231 178.201 1.00 30.99  ? 121 PRO B CB  1 
ATOM   3139  C  CG  . PRO B  1 100 ? 125.238 170.849 178.561 1.00 31.34  ? 121 PRO B CG  1 
ATOM   3140  C  CD  . PRO B  1 100 ? 125.790 171.390 177.263 1.00 29.91  ? 121 PRO B CD  1 
ATOM   3141  N  N   . VAL B  1 101 ? 121.950 173.118 176.681 1.00 30.02  ? 122 VAL B N   1 
ATOM   3142  C  CA  . VAL B  1 101 ? 121.190 174.386 176.873 1.00 29.47  ? 122 VAL B CA  1 
ATOM   3143  C  C   . VAL B  1 101 ? 119.964 174.124 177.733 1.00 29.25  ? 122 VAL B C   1 
ATOM   3144  O  O   . VAL B  1 101 ? 119.718 174.863 178.642 1.00 30.32  ? 122 VAL B O   1 
ATOM   3145  C  CB  . VAL B  1 101 ? 120.795 174.915 175.488 1.00 29.13  ? 122 VAL B CB  1 
ATOM   3146  C  CG1 . VAL B  1 101 ? 119.681 175.959 175.553 1.00 29.91  ? 122 VAL B CG1 1 
ATOM   3147  C  CG2 . VAL B  1 101 ? 122.035 175.397 174.764 1.00 28.41  ? 122 VAL B CG2 1 
ATOM   3148  N  N   . GLN B  1 102 ? 119.175 173.117 177.445 1.00 29.52  ? 123 GLN B N   1 
ATOM   3149  C  CA  . GLN B  1 102 ? 117.861 172.993 178.120 1.00 31.11  ? 123 GLN B CA  1 
ATOM   3150  C  C   . GLN B  1 102 ? 118.075 172.764 179.616 1.00 32.62  ? 123 GLN B C   1 
ATOM   3151  O  O   . GLN B  1 102 ? 117.251 173.279 180.420 1.00 34.45  ? 123 GLN B O   1 
ATOM   3152  C  CB  . GLN B  1 102 ? 116.982 171.947 177.447 1.00 31.55  ? 123 GLN B CB  1 
ATOM   3153  C  CG  . GLN B  1 102 ? 116.705 172.314 175.995 1.00 32.85  ? 123 GLN B CG  1 
ATOM   3154  C  CD  . GLN B  1 102 ? 116.115 173.696 175.814 1.00 33.55  ? 123 GLN B CD  1 
ATOM   3155  O  OE1 . GLN B  1 102 ? 115.208 174.101 176.568 1.00 35.78  ? 123 GLN B OE1 1 
ATOM   3156  N  NE2 . GLN B  1 102 ? 116.669 174.428 174.855 1.00 31.75  ? 123 GLN B NE2 1 
ATOM   3157  N  N   . GLU B  1 103 ? 119.138 172.050 179.971 1.00 31.74  ? 124 GLU B N   1 
ATOM   3158  C  CA  . GLU B  1 103 ? 119.380 171.605 181.348 1.00 32.86  ? 124 GLU B CA  1 
ATOM   3159  C  C   . GLU B  1 103 ? 119.922 172.799 182.113 1.00 32.48  ? 124 GLU B C   1 
ATOM   3160  O  O   . GLU B  1 103 ? 119.612 172.949 183.272 1.00 33.19  ? 124 GLU B O   1 
ATOM   3161  C  CB  . GLU B  1 103 ? 120.308 170.391 181.305 1.00 33.64  ? 124 GLU B CB  1 
ATOM   3162  C  CG  . GLU B  1 103 ? 119.628 169.123 180.812 1.00 33.37  ? 124 GLU B CG  1 
ATOM   3163  C  CD  . GLU B  1 103 ? 119.812 168.783 179.342 1.00 33.24  ? 124 GLU B CD  1 
ATOM   3164  O  OE1 . GLU B  1 103 ? 120.344 169.676 178.557 1.00 33.06  ? 124 GLU B OE1 1 
ATOM   3165  O  OE2 . GLU B  1 103 ? 119.443 167.592 178.976 1.00 32.18  ? 124 GLU B OE2 1 
ATOM   3166  N  N   . ILE B  1 104 ? 120.655 173.650 181.439 1.00 30.54  ? 125 ILE B N   1 
ATOM   3167  C  CA  . ILE B  1 104 ? 121.069 174.936 182.036 1.00 31.67  ? 125 ILE B CA  1 
ATOM   3168  C  C   . ILE B  1 104 ? 119.852 175.840 182.303 1.00 31.66  ? 125 ILE B C   1 
ATOM   3169  O  O   . ILE B  1 104 ? 119.759 176.378 183.412 1.00 32.83  ? 125 ILE B O   1 
ATOM   3170  C  CB  . ILE B  1 104 ? 122.141 175.602 181.164 1.00 31.28  ? 125 ILE B CB  1 
ATOM   3171  C  CG1 . ILE B  1 104 ? 123.408 174.740 181.105 1.00 31.22  ? 125 ILE B CG1 1 
ATOM   3172  C  CG2 . ILE B  1 104 ? 122.409 176.988 181.712 1.00 31.98  ? 125 ILE B CG2 1 
ATOM   3173  C  CD1 . ILE B  1 104 ? 124.431 175.242 180.064 1.00 31.17  ? 125 ILE B CD1 1 
ATOM   3174  N  N   . ARG B  1 105 ? 118.960 176.001 181.336 1.00 30.83  ? 126 ARG B N   1 
ATOM   3175  C  CA  . ARG B  1 105 ? 117.663 176.716 181.501 1.00 31.77  ? 126 ARG B CA  1 
ATOM   3176  C  C   . ARG B  1 105 ? 116.856 176.136 182.662 1.00 32.35  ? 126 ARG B C   1 
ATOM   3177  O  O   . ARG B  1 105 ? 116.255 176.919 183.412 1.00 31.93  ? 126 ARG B O   1 
ATOM   3178  C  CB  . ARG B  1 105 ? 116.801 176.632 180.249 1.00 31.26  ? 126 ARG B CB  1 
ATOM   3179  C  CG  . ARG B  1 105 ? 117.388 177.404 179.082 1.00 31.66  ? 126 ARG B CG  1 
ATOM   3180  C  CD  . ARG B  1 105 ? 116.366 177.360 177.960 1.00 32.13  ? 126 ARG B CD  1 
ATOM   3181  N  NE  . ARG B  1 105 ? 115.139 178.155 178.157 1.00 33.80  ? 126 ARG B NE  1 
ATOM   3182  C  CZ  . ARG B  1 105 ? 113.932 177.783 177.714 1.00 33.82  ? 126 ARG B CZ  1 
ATOM   3183  N  NH1 . ARG B  1 105 ? 113.807 176.610 177.112 1.00 32.56  ? 126 ARG B NH1 1 
ATOM   3184  N  NH2 . ARG B  1 105 ? 112.867 178.562 177.902 1.00 33.94  ? 126 ARG B NH2 1 
ATOM   3185  N  N   . ASP B  1 106 ? 116.832 174.815 182.790 1.00 33.06  ? 127 ASP B N   1 
ATOM   3186  C  CA  . ASP B  1 106 ? 115.912 174.141 183.740 1.00 35.26  ? 127 ASP B CA  1 
ATOM   3187  C  C   . ASP B  1 106 ? 116.388 174.420 185.179 1.00 35.79  ? 127 ASP B C   1 
ATOM   3188  O  O   . ASP B  1 106 ? 115.626 174.218 186.076 1.00 37.24  ? 127 ASP B O   1 
ATOM   3189  C  CB  . ASP B  1 106 ? 115.773 172.644 183.449 1.00 36.81  ? 127 ASP B CB  1 
ATOM   3190  C  CG  . ASP B  1 106 ? 114.485 172.066 184.023 1.00 40.22  ? 127 ASP B CG  1 
ATOM   3191  O  OD1 . ASP B  1 106 ? 113.400 172.553 183.612 1.00 45.97  ? 127 ASP B OD1 1 
ATOM   3192  O  OD2 . ASP B  1 106 ? 114.549 171.190 184.908 1.00 42.21  ? 127 ASP B OD2 1 
ATOM   3193  N  N   . CYS B  1 107 ? 117.590 174.904 185.430 1.00 35.19  ? 128 CYS B N   1 
ATOM   3194  C  CA  . CYS B  1 107 ? 117.991 175.094 186.838 1.00 37.64  ? 128 CYS B CA  1 
ATOM   3195  C  C   . CYS B  1 107 ? 117.954 176.596 187.156 1.00 38.18  ? 128 CYS B C   1 
ATOM   3196  O  O   . CYS B  1 107 ? 118.456 176.980 188.193 1.00 39.51  ? 128 CYS B O   1 
ATOM   3197  C  CB  . CYS B  1 107 ? 119.313 174.371 187.105 1.00 38.33  ? 128 CYS B CB  1 
ATOM   3198  S  SG  . CYS B  1 107 ? 120.754 175.175 186.371 1.00 39.15  ? 128 CYS B SG  1 
ATOM   3199  N  N   . GLY B  1 108 ? 117.365 177.396 186.258 1.00 36.88  ? 129 GLY B N   1 
ATOM   3200  C  CA  . GLY B  1 108 ? 116.948 178.781 186.502 1.00 37.72  ? 129 GLY B CA  1 
ATOM   3201  C  C   . GLY B  1 108 ? 117.961 179.778 186.002 1.00 37.39  ? 129 GLY B C   1 
ATOM   3202  O  O   . GLY B  1 108 ? 117.785 180.898 186.317 1.00 39.28  ? 129 GLY B O   1 
ATOM   3203  N  N   . VAL B  1 109 ? 118.999 179.379 185.273 1.00 35.92  ? 130 VAL B N   1 
ATOM   3204  C  CA  . VAL B  1 109 ? 120.036 180.306 184.738 1.00 35.81  ? 130 VAL B CA  1 
ATOM   3205  C  C   . VAL B  1 109 ? 119.403 181.343 183.803 1.00 35.69  ? 130 VAL B C   1 
ATOM   3206  O  O   . VAL B  1 109 ? 118.664 180.968 182.876 1.00 33.94  ? 130 VAL B O   1 
ATOM   3207  C  CB  . VAL B  1 109 ? 121.157 179.506 184.060 1.00 34.60  ? 130 VAL B CB  1 
ATOM   3208  C  CG1 . VAL B  1 109 ? 122.120 180.360 183.271 1.00 34.52  ? 130 VAL B CG1 1 
ATOM   3209  C  CG2 . VAL B  1 109 ? 121.910 178.685 185.074 1.00 35.23  ? 130 VAL B CG2 1 
ATOM   3210  N  N   . ASP B  1 110 ? 119.723 182.615 184.027 1.00 37.31  ? 131 ASP B N   1 
ATOM   3211  C  CA  . ASP B  1 110 ? 119.179 183.723 183.204 1.00 38.21  ? 131 ASP B CA  1 
ATOM   3212  C  C   . ASP B  1 110 ? 119.858 183.707 181.821 1.00 36.44  ? 131 ASP B C   1 
ATOM   3213  O  O   . ASP B  1 110 ? 120.831 182.981 181.633 1.00 34.67  ? 131 ASP B O   1 
ATOM   3214  C  CB  . ASP B  1 110 ? 119.300 185.045 183.947 1.00 40.89  ? 131 ASP B CB  1 
ATOM   3215  C  CG  . ASP B  1 110 ? 120.730 185.551 184.067 1.00 42.69  ? 131 ASP B CG  1 
ATOM   3216  O  OD1 . ASP B  1 110 ? 121.543 185.447 183.095 1.00 41.95  ? 131 ASP B OD1 1 
ATOM   3217  O  OD2 . ASP B  1 110 ? 121.021 186.096 185.126 1.00 47.46  ? 131 ASP B OD2 1 
ATOM   3218  N  N   . ASP B  1 111 ? 119.334 184.498 180.886 1.00 36.63  ? 132 ASP B N   1 
ATOM   3219  C  CA  . ASP B  1 111 ? 119.782 184.545 179.476 1.00 35.55  ? 132 ASP B CA  1 
ATOM   3220  C  C   . ASP B  1 111 ? 121.173 185.132 179.374 1.00 35.76  ? 132 ASP B C   1 
ATOM   3221  O  O   . ASP B  1 111 ? 121.870 184.727 178.521 1.00 34.81  ? 132 ASP B O   1 
ATOM   3222  C  CB  . ASP B  1 111 ? 118.773 185.291 178.601 1.00 36.26  ? 132 ASP B CB  1 
ATOM   3223  C  CG  . ASP B  1 111 ? 117.524 184.458 178.262 1.00 35.96  ? 132 ASP B CG  1 
ATOM   3224  O  OD1 . ASP B  1 111 ? 117.657 183.177 178.143 1.00 34.18  ? 132 ASP B OD1 1 
ATOM   3225  O  OD2 . ASP B  1 111 ? 116.421 185.079 178.131 1.00 36.64  ? 132 ASP B OD2 1 
ATOM   3226  N  N   . ASP B  1 112 ? 121.567 186.105 180.184 1.00 38.95  ? 133 ASP B N   1 
ATOM   3227  C  CA  . ASP B  1 112 ? 122.938 186.694 180.093 1.00 39.22  ? 133 ASP B CA  1 
ATOM   3228  C  C   . ASP B  1 112 ? 123.972 185.568 180.320 1.00 38.79  ? 133 ASP B C   1 
ATOM   3229  O  O   . ASP B  1 112 ? 124.906 185.408 179.496 1.00 38.07  ? 133 ASP B O   1 
ATOM   3230  C  CB  . ASP B  1 112 ? 123.146 187.779 181.138 1.00 41.74  ? 133 ASP B CB  1 
ATOM   3231  C  CG  . ASP B  1 112 ? 122.539 189.136 180.832 1.00 43.48  ? 133 ASP B CG  1 
ATOM   3232  O  OD1 . ASP B  1 112 ? 122.398 189.494 179.651 1.00 42.84  ? 133 ASP B OD1 1 
ATOM   3233  O  OD2 . ASP B  1 112 ? 122.273 189.848 181.806 1.00 46.09  ? 133 ASP B OD2 1 
ATOM   3234  N  N   . ARG B  1 113 ? 123.839 184.840 181.431 1.00 38.86  ? 134 ARG B N   1 
ATOM   3235  C  CA  . ARG B  1 113 ? 124.772 183.746 181.796 1.00 38.48  ? 134 ARG B CA  1 
ATOM   3236  C  C   . ARG B  1 113 ? 124.597 182.604 180.810 1.00 35.07  ? 134 ARG B C   1 
ATOM   3237  O  O   . ARG B  1 113 ? 125.567 181.958 180.495 1.00 34.25  ? 134 ARG B O   1 
ATOM   3238  C  CB  . ARG B  1 113 ? 124.542 183.300 183.237 1.00 40.78  ? 134 ARG B CB  1 
ATOM   3239  C  CG  . ARG B  1 113 ? 124.933 184.362 184.244 1.00 44.93  ? 134 ARG B CG  1 
ATOM   3240  C  CD  . ARG B  1 113 ? 124.224 184.129 185.555 1.00 48.78  ? 134 ARG B CD  1 
ATOM   3241  N  NE  . ARG B  1 113 ? 124.717 182.954 186.274 1.00 49.89  ? 134 ARG B NE  1 
ATOM   3242  C  CZ  . ARG B  1 113 ? 123.967 182.221 187.072 1.00 51.75  ? 134 ARG B CZ  1 
ATOM   3243  N  NH1 . ARG B  1 113 ? 122.675 182.514 187.203 1.00 53.39  ? 134 ARG B NH1 1 
ATOM   3244  N  NH2 . ARG B  1 113 ? 124.495 181.180 187.703 1.00 51.96  ? 134 ARG B NH2 1 
ATOM   3245  N  N   . LEU B  1 114 ? 123.399 182.355 180.312 1.00 33.98  ? 135 LEU B N   1 
ATOM   3246  C  CA  . LEU B  1 114 ? 123.250 181.272 179.314 1.00 32.16  ? 135 LEU B CA  1 
ATOM   3247  C  C   . LEU B  1 114 ? 124.039 181.661 178.048 1.00 31.92  ? 135 LEU B C   1 
ATOM   3248  O  O   . LEU B  1 114 ? 124.802 180.806 177.548 1.00 30.74  ? 135 LEU B O   1 
ATOM   3249  C  CB  . LEU B  1 114 ? 121.783 180.949 179.020 1.00 31.31  ? 135 LEU B CB  1 
ATOM   3250  C  CG  . LEU B  1 114 ? 121.565 180.056 177.783 1.00 29.67  ? 135 LEU B CG  1 
ATOM   3251  C  CD1 . LEU B  1 114 ? 122.310 178.742 177.898 1.00 29.16  ? 135 LEU B CD1 1 
ATOM   3252  C  CD2 . LEU B  1 114 ? 120.105 179.799 177.518 1.00 29.13  ? 135 LEU B CD2 1 
ATOM   3253  N  N   . MET B  1 115 ? 123.904 182.891 177.548 1.00 32.80  ? 136 MET B N   1 
ATOM   3254  C  CA  . MET B  1 115 ? 124.639 183.298 176.313 1.00 33.04  ? 136 MET B CA  1 
ATOM   3255  C  C   . MET B  1 115 ? 126.155 183.308 176.587 1.00 33.58  ? 136 MET B C   1 
ATOM   3256  O  O   . MET B  1 115 ? 126.914 183.059 175.637 1.00 32.68  ? 136 MET B O   1 
ATOM   3257  C  CB  . MET B  1 115 ? 124.197 184.687 175.830 1.00 34.61  ? 136 MET B CB  1 
ATOM   3258  C  CG  . MET B  1 115 ? 122.748 184.756 175.321 1.00 34.86  ? 136 MET B CG  1 
ATOM   3259  S  SD  . MET B  1 115 ? 122.184 183.297 174.353 1.00 33.77  ? 136 MET B SD  1 
ATOM   3260  C  CE  . MET B  1 115 ? 121.492 184.072 172.891 1.00 33.56  ? 136 MET B CE  1 
ATOM   3261  N  N   . ASN B  1 116 ? 126.587 183.570 177.831 1.00 34.47  ? 137 ASN B N   1 
ATOM   3262  C  CA  . ASN B  1 116 ? 128.013 183.481 178.244 1.00 35.31  ? 137 ASN B CA  1 
ATOM   3263  C  C   . ASN B  1 116 ? 128.526 182.050 178.075 1.00 34.07  ? 137 ASN B C   1 
ATOM   3264  O  O   . ASN B  1 116 ? 129.629 181.872 177.505 1.00 33.32  ? 137 ASN B O   1 
ATOM   3265  C  CB  . ASN B  1 116 ? 128.212 184.032 179.649 1.00 38.07  ? 137 ASN B CB  1 
ATOM   3266  C  CG  . ASN B  1 116 ? 128.004 185.538 179.631 1.00 40.88  ? 137 ASN B CG  1 
ATOM   3267  O  OD1 . ASN B  1 116 ? 127.834 186.162 178.554 1.00 40.53  ? 137 ASN B OD1 1 
ATOM   3268  N  ND2 . ASN B  1 116 ? 127.967 186.120 180.820 1.00 43.20  ? 137 ASN B ND2 1 
ATOM   3269  N  N   . VAL B  1 117 ? 127.720 181.057 178.465 1.00 33.52  ? 138 VAL B N   1 
ATOM   3270  C  CA  . VAL B  1 117 ? 128.096 179.616 178.333 1.00 32.20  ? 138 VAL B CA  1 
ATOM   3271  C  C   . VAL B  1 117 ? 128.322 179.322 176.855 1.00 29.67  ? 138 VAL B C   1 
ATOM   3272  O  O   . VAL B  1 117 ? 129.315 178.661 176.560 1.00 28.84  ? 138 VAL B O   1 
ATOM   3273  C  CB  . VAL B  1 117 ? 127.040 178.691 178.963 1.00 32.49  ? 138 VAL B CB  1 
ATOM   3274  C  CG1 . VAL B  1 117 ? 127.339 177.222 178.708 1.00 32.41  ? 138 VAL B CG1 1 
ATOM   3275  C  CG2 . VAL B  1 117 ? 126.922 178.949 180.442 1.00 34.12  ? 138 VAL B CG2 1 
ATOM   3276  N  N   . ILE B  1 118 ? 127.476 179.861 175.978 1.00 28.47  ? 139 ILE B N   1 
ATOM   3277  C  CA  . ILE B  1 118 ? 127.555 179.538 174.535 1.00 27.42  ? 139 ILE B CA  1 
ATOM   3278  C  C   . ILE B  1 118 ? 128.901 180.077 174.038 1.00 28.01  ? 139 ILE B C   1 
ATOM   3279  O  O   . ILE B  1 118 ? 129.654 179.350 173.404 1.00 27.05  ? 139 ILE B O   1 
ATOM   3280  C  CB  . ILE B  1 118 ? 126.330 180.063 173.773 1.00 26.92  ? 139 ILE B CB  1 
ATOM   3281  C  CG1 . ILE B  1 118 ? 125.073 179.316 174.185 1.00 27.39  ? 139 ILE B CG1 1 
ATOM   3282  C  CG2 . ILE B  1 118 ? 126.562 179.964 172.272 1.00 26.24  ? 139 ILE B CG2 1 
ATOM   3283  C  CD1 . ILE B  1 118 ? 123.792 179.880 173.630 1.00 27.89  ? 139 ILE B CD1 1 
ATOM   3284  N  N   . SER B  1 119 ? 129.197 181.330 174.357 1.00 29.95  ? 140 SER B N   1 
ATOM   3285  C  CA  . SER B  1 119 ? 130.467 181.998 174.010 1.00 31.46  ? 140 SER B CA  1 
ATOM   3286  C  C   . SER B  1 119 ? 131.618 181.153 174.533 1.00 31.97  ? 140 SER B C   1 
ATOM   3287  O  O   . SER B  1 119 ? 132.553 180.899 173.762 1.00 31.88  ? 140 SER B O   1 
ATOM   3288  C  CB  . SER B  1 119 ? 130.531 183.377 174.581 1.00 33.00  ? 140 SER B CB  1 
ATOM   3289  O  OG  . SER B  1 119 ? 129.517 184.167 174.007 1.00 33.38  ? 140 SER B OG  1 
ATOM   3290  N  N   . GLU B  1 120 ? 131.564 180.789 175.806 1.00 32.91  ? 141 GLU B N   1 
ATOM   3291  C  CA  . GLU B  1 120 ? 132.691 180.057 176.449 1.00 34.46  ? 141 GLU B CA  1 
ATOM   3292  C  C   . GLU B  1 120 ? 132.861 178.706 175.739 1.00 32.74  ? 141 GLU B C   1 
ATOM   3293  O  O   . GLU B  1 120 ? 133.997 178.260 175.611 1.00 33.98  ? 141 GLU B O   1 
ATOM   3294  C  CB  . GLU B  1 120 ? 132.469 179.928 177.964 1.00 37.40  ? 141 GLU B CB  1 
ATOM   3295  C  CG  . GLU B  1 120 ? 132.556 181.237 178.757 1.00 40.26  ? 141 GLU B CG  1 
ATOM   3296  C  CD  . GLU B  1 120 ? 133.931 181.869 178.706 1.00 44.53  ? 141 GLU B CD  1 
ATOM   3297  O  OE1 . GLU B  1 120 ? 134.950 181.099 178.580 1.00 45.97  ? 141 GLU B OE1 1 
ATOM   3298  O  OE2 . GLU B  1 120 ? 134.009 183.142 178.785 1.00 50.06  ? 141 GLU B OE2 1 
ATOM   3299  N  N   . SER B  1 121 ? 131.784 178.096 175.245 1.00 30.30  ? 142 SER B N   1 
ATOM   3300  C  CA  . SER B  1 121 ? 131.841 176.778 174.574 1.00 29.57  ? 142 SER B CA  1 
ATOM   3301  C  C   . SER B  1 121 ? 132.555 176.940 173.231 1.00 29.26  ? 142 SER B C   1 
ATOM   3302  O  O   . SER B  1 121 ? 133.367 176.072 172.859 1.00 28.05  ? 142 SER B O   1 
ATOM   3303  C  CB  . SER B  1 121 ? 130.480 176.193 174.397 1.00 28.31  ? 142 SER B CB  1 
ATOM   3304  O  OG  . SER B  1 121 ? 129.868 176.017 175.661 1.00 29.18  ? 142 SER B OG  1 
ATOM   3305  N  N   . VAL B  1 122 ? 132.295 178.063 172.557 1.00 29.71  ? 143 VAL B N   1 
ATOM   3306  C  CA  . VAL B  1 122 ? 132.931 178.369 171.247 1.00 29.39  ? 143 VAL B CA  1 
ATOM   3307  C  C   . VAL B  1 122 ? 134.450 178.538 171.460 1.00 31.10  ? 143 VAL B C   1 
ATOM   3308  O  O   . VAL B  1 122 ? 135.236 177.991 170.649 1.00 30.81  ? 143 VAL B O   1 
ATOM   3309  C  CB  . VAL B  1 122 ? 132.285 179.612 170.623 1.00 29.25  ? 143 VAL B CB  1 
ATOM   3310  C  CG1 . VAL B  1 122 ? 133.093 180.135 169.432 1.00 29.67  ? 143 VAL B CG1 1 
ATOM   3311  C  CG2 . VAL B  1 122 ? 130.857 179.300 170.213 1.00 28.63  ? 143 VAL B CG2 1 
ATOM   3312  N  N   . LYS B  1 123 ? 134.838 179.235 172.531 1.00 31.55  ? 144 LYS B N   1 
ATOM   3313  C  CA  . LYS B  1 123 ? 136.256 179.493 172.836 1.00 32.86  ? 144 LYS B CA  1 
ATOM   3314  C  C   . LYS B  1 123 ? 136.970 178.165 173.082 1.00 32.63  ? 144 LYS B C   1 
ATOM   3315  O  O   . LYS B  1 123 ? 138.111 177.987 172.634 1.00 32.61  ? 144 LYS B O   1 
ATOM   3316  C  CB  . LYS B  1 123 ? 136.342 180.467 174.017 1.00 34.07  ? 144 LYS B CB  1 
ATOM   3317  C  CG  . LYS B  1 123 ? 135.910 181.878 173.657 1.00 34.04  ? 144 LYS B CG  1 
ATOM   3318  C  CD  . LYS B  1 123 ? 136.087 182.898 174.748 1.00 35.39  ? 144 LYS B CD  1 
ATOM   3319  C  CE  . LYS B  1 123 ? 135.631 184.271 174.299 1.00 35.41  ? 144 LYS B CE  1 
ATOM   3320  N  NZ  . LYS B  1 123 ? 136.114 185.322 175.221 1.00 37.01  ? 144 LYS B NZ  1 
ATOM   3321  N  N   . LEU B  1 124 ? 136.314 177.279 173.800 1.00 32.15  ? 145 LEU B N   1 
ATOM   3322  C  CA  . LEU B  1 124 ? 136.866 175.957 174.165 1.00 32.46  ? 145 LEU B CA  1 
ATOM   3323  C  C   . LEU B  1 124 ? 137.193 175.155 172.883 1.00 31.11  ? 145 LEU B C   1 
ATOM   3324  O  O   . LEU B  1 124 ? 138.244 174.511 172.842 1.00 30.95  ? 145 LEU B O   1 
ATOM   3325  C  CB  . LEU B  1 124 ? 135.783 175.297 175.021 1.00 32.15  ? 145 LEU B CB  1 
ATOM   3326  C  CG  . LEU B  1 124 ? 136.035 175.018 176.506 1.00 33.26  ? 145 LEU B CG  1 
ATOM   3327  C  CD1 . LEU B  1 124 ? 137.012 175.914 177.192 1.00 34.59  ? 145 LEU B CD1 1 
ATOM   3328  C  CD2 . LEU B  1 124 ? 134.688 174.960 177.248 1.00 32.99  ? 145 LEU B CD2 1 
ATOM   3329  N  N   . VAL B  1 125 ? 136.371 175.234 171.841 1.00 30.38  ? 146 VAL B N   1 
ATOM   3330  C  CA  . VAL B  1 125 ? 136.664 174.632 170.485 1.00 30.38  ? 146 VAL B CA  1 
ATOM   3331  C  C   . VAL B  1 125 ? 137.874 175.316 169.844 1.00 30.99  ? 146 VAL B C   1 
ATOM   3332  O  O   . VAL B  1 125 ? 138.777 174.622 169.331 1.00 31.62  ? 146 VAL B O   1 
ATOM   3333  C  CB  . VAL B  1 125 ? 135.436 174.731 169.556 1.00 30.11  ? 146 VAL B CB  1 
ATOM   3334  C  CG1 . VAL B  1 125 ? 135.757 174.286 168.151 1.00 30.94  ? 146 VAL B CG1 1 
ATOM   3335  C  CG2 . VAL B  1 125 ? 134.239 173.965 170.076 1.00 29.34  ? 146 VAL B CG2 1 
ATOM   3336  N  N   . MET B  1 126 ? 137.905 176.650 169.868 1.00 31.39  ? 147 MET B N   1 
ATOM   3337  C  CA  . MET B  1 126 ? 138.921 177.483 169.180 1.00 31.69  ? 147 MET B CA  1 
ATOM   3338  C  C   . MET B  1 126 ? 140.281 177.237 169.829 1.00 33.53  ? 147 MET B C   1 
ATOM   3339  O  O   . MET B  1 126 ? 141.329 177.311 169.122 1.00 32.87  ? 147 MET B O   1 
ATOM   3340  C  CB  . MET B  1 126 ? 138.554 178.959 169.250 1.00 32.45  ? 147 MET B CB  1 
ATOM   3341  C  CG  . MET B  1 126 ? 137.311 179.295 168.414 1.00 31.75  ? 147 MET B CG  1 
ATOM   3342  S  SD  . MET B  1 126 ? 136.908 181.060 168.444 1.00 32.94  ? 147 MET B SD  1 
ATOM   3343  C  CE  . MET B  1 126 ? 138.125 181.632 167.251 1.00 34.32  ? 147 MET B CE  1 
ATOM   3344  N  N   . GLU B  1 127 ? 140.257 176.817 171.105 1.00 34.80  ? 148 GLU B N   1 
ATOM   3345  C  CA  . GLU B  1 127 ? 141.466 176.672 171.965 1.00 36.70  ? 148 GLU B CA  1 
ATOM   3346  C  C   . GLU B  1 127 ? 142.095 175.288 171.757 1.00 36.82  ? 148 GLU B C   1 
ATOM   3347  O  O   . GLU B  1 127 ? 143.151 175.036 172.330 1.00 40.47  ? 148 GLU B O   1 
ATOM   3348  C  CB  . GLU B  1 127 ? 141.108 176.961 173.431 1.00 37.44  ? 148 GLU B CB  1 
ATOM   3349  C  CG  . GLU B  1 127 ? 141.024 178.449 173.747 1.00 38.51  ? 148 GLU B CG  1 
ATOM   3350  C  CD  . GLU B  1 127 ? 140.339 178.877 175.050 1.00 39.28  ? 148 GLU B CD  1 
ATOM   3351  O  OE1 . GLU B  1 127 ? 139.930 178.001 175.909 1.00 38.83  ? 148 GLU B OE1 1 
ATOM   3352  O  OE2 . GLU B  1 127 ? 140.181 180.117 175.214 1.00 40.70  ? 148 GLU B OE2 1 
ATOM   3353  N  N   . GLU B  1 128 ? 141.434 174.392 171.049 1.00 35.95  ? 149 GLU B N   1 
ATOM   3354  C  CA  . GLU B  1 128 ? 142.025 173.149 170.491 1.00 36.64  ? 149 GLU B CA  1 
ATOM   3355  C  C   . GLU B  1 128 ? 142.396 173.438 169.040 1.00 36.42  ? 149 GLU B C   1 
ATOM   3356  O  O   . GLU B  1 128 ? 141.559 173.250 168.159 1.00 35.73  ? 149 GLU B O   1 
ATOM   3357  C  CB  . GLU B  1 128 ? 141.051 171.974 170.583 1.00 35.63  ? 149 GLU B CB  1 
ATOM   3358  C  CG  . GLU B  1 128 ? 140.799 171.482 171.993 1.00 35.82  ? 149 GLU B CG  1 
ATOM   3359  C  CD  . GLU B  1 128 ? 142.018 170.865 172.613 1.00 37.60  ? 149 GLU B CD  1 
ATOM   3360  O  OE1 . GLU B  1 128 ? 142.957 170.491 171.842 1.00 38.30  ? 149 GLU B OE1 1 
ATOM   3361  O  OE2 . GLU B  1 128 ? 142.016 170.753 173.848 1.00 38.61  ? 149 GLU B OE2 1 
ATOM   3362  N  N   . GLU B  1 129 ? 143.599 173.924 168.804 1.00 38.46  ? 150 GLU B N   1 
ATOM   3363  C  CA  . GLU B  1 129 ? 144.092 174.197 167.428 1.00 39.69  ? 150 GLU B CA  1 
ATOM   3364  C  C   . GLU B  1 129 ? 144.244 172.875 166.698 1.00 37.59  ? 150 GLU B C   1 
ATOM   3365  O  O   . GLU B  1 129 ? 144.727 171.916 167.282 1.00 38.14  ? 150 GLU B O   1 
ATOM   3366  C  CB  . GLU B  1 129 ? 145.416 174.968 167.483 1.00 44.38  ? 150 GLU B CB  1 
ATOM   3367  C  CG  . GLU B  1 129 ? 145.238 176.333 168.153 1.00 47.44  ? 150 GLU B CG  1 
ATOM   3368  C  CD  . GLU B  1 129 ? 146.409 177.293 168.174 1.00 51.98  ? 150 GLU B CD  1 
ATOM   3369  O  OE1 . GLU B  1 129 ? 146.133 178.489 168.402 1.00 56.96  ? 150 GLU B OE1 1 
ATOM   3370  O  OE2 . GLU B  1 129 ? 147.583 176.858 167.989 1.00 55.20  ? 150 GLU B OE2 1 
ATOM   3371  N  N   . PRO B  1 130 ? 143.924 172.791 165.397 1.00 35.71  ? 151 PRO B N   1 
ATOM   3372  C  CA  . PRO B  1 130 ? 143.394 173.912 164.627 1.00 34.78  ? 151 PRO B CA  1 
ATOM   3373  C  C   . PRO B  1 130 ? 141.887 173.880 164.349 1.00 32.74  ? 151 PRO B C   1 
ATOM   3374  O  O   . PRO B  1 130 ? 141.459 174.263 163.237 1.00 31.89  ? 151 PRO B O   1 
ATOM   3375  C  CB  . PRO B  1 130 ? 144.172 173.725 163.306 1.00 35.34  ? 151 PRO B CB  1 
ATOM   3376  C  CG  . PRO B  1 130 ? 144.279 172.218 163.135 1.00 35.41  ? 151 PRO B CG  1 
ATOM   3377  C  CD  . PRO B  1 130 ? 144.265 171.648 164.538 1.00 35.76  ? 151 PRO B CD  1 
ATOM   3378  N  N   . LEU B  1 131 ? 141.093 173.438 165.325 1.00 31.82  ? 152 LEU B N   1 
ATOM   3379  C  CA  . LEU B  1 131 ? 139.605 173.464 165.209 1.00 29.86  ? 152 LEU B CA  1 
ATOM   3380  C  C   . LEU B  1 131 ? 139.091 174.892 164.938 1.00 29.23  ? 152 LEU B C   1 
ATOM   3381  O  O   . LEU B  1 131 ? 139.544 175.868 165.625 1.00 29.63  ? 152 LEU B O   1 
ATOM   3382  C  CB  . LEU B  1 131 ? 138.955 172.903 166.479 1.00 29.63  ? 152 LEU B CB  1 
ATOM   3383  C  CG  . LEU B  1 131 ? 139.355 171.474 166.857 1.00 30.94  ? 152 LEU B CG  1 
ATOM   3384  C  CD1 . LEU B  1 131 ? 138.484 170.959 167.990 1.00 30.89  ? 152 LEU B CD1 1 
ATOM   3385  C  CD2 . LEU B  1 131 ? 139.367 170.509 165.672 1.00 30.36  ? 152 LEU B CD2 1 
ATOM   3386  N  N   . ARG B  1 132 ? 138.140 174.998 164.005 1.00 28.50  ? 153 ARG B N   1 
ATOM   3387  C  CA  . ARG B  1 132 ? 137.286 176.201 163.772 1.00 29.08  ? 153 ARG B CA  1 
ATOM   3388  C  C   . ARG B  1 132 ? 135.799 175.844 163.867 1.00 28.01  ? 153 ARG B C   1 
ATOM   3389  O  O   . ARG B  1 132 ? 135.310 174.849 163.341 1.00 26.38  ? 153 ARG B O   1 
ATOM   3390  C  CB  . ARG B  1 132 ? 137.563 176.845 162.409 1.00 29.58  ? 153 ARG B CB  1 
ATOM   3391  C  CG  . ARG B  1 132 ? 139.037 177.123 162.183 1.00 31.60  ? 153 ARG B CG  1 
ATOM   3392  C  CD  . ARG B  1 132 ? 139.304 178.048 161.024 1.00 32.41  ? 153 ARG B CD  1 
ATOM   3393  N  NE  . ARG B  1 132 ? 140.706 178.450 161.011 1.00 33.66  ? 153 ARG B NE  1 
ATOM   3394  C  CZ  . ARG B  1 132 ? 141.187 179.436 160.249 1.00 34.67  ? 153 ARG B CZ  1 
ATOM   3395  N  NH1 . ARG B  1 132 ? 140.377 180.141 159.473 1.00 34.36  ? 153 ARG B NH1 1 
ATOM   3396  N  NH2 . ARG B  1 132 ? 142.465 179.747 160.293 1.00 35.69  ? 153 ARG B NH2 1 
ATOM   3397  N  N   . PRO B  1 133 ? 135.040 176.647 164.626 1.00 28.00  ? 154 PRO B N   1 
ATOM   3398  C  CA  . PRO B  1 133 ? 133.675 176.285 164.973 1.00 27.12  ? 154 PRO B CA  1 
ATOM   3399  C  C   . PRO B  1 133 ? 132.686 176.532 163.845 1.00 27.16  ? 154 PRO B C   1 
ATOM   3400  O  O   . PRO B  1 133 ? 132.650 177.625 163.293 1.00 26.83  ? 154 PRO B O   1 
ATOM   3401  C  CB  . PRO B  1 133 ? 133.349 177.217 166.138 1.00 27.64  ? 154 PRO B CB  1 
ATOM   3402  C  CG  . PRO B  1 133 ? 134.229 178.437 165.878 1.00 28.55  ? 154 PRO B CG  1 
ATOM   3403  C  CD  . PRO B  1 133 ? 135.516 177.836 165.347 1.00 29.07  ? 154 PRO B CD  1 
ATOM   3404  N  N   . LEU B  1 134 ? 131.870 175.517 163.587 1.00 26.13  ? 155 LEU B N   1 
ATOM   3405  C  CA  . LEU B  1 134 ? 130.648 175.630 162.759 1.00 25.07  ? 155 LEU B CA  1 
ATOM   3406  C  C   . LEU B  1 134 ? 129.497 175.299 163.703 1.00 24.10  ? 155 LEU B C   1 
ATOM   3407  O  O   . LEU B  1 134 ? 129.420 174.165 164.200 1.00 25.07  ? 155 LEU B O   1 
ATOM   3408  C  CB  . LEU B  1 134 ? 130.791 174.686 161.574 1.00 24.83  ? 155 LEU B CB  1 
ATOM   3409  C  CG  . LEU B  1 134 ? 129.810 174.912 160.432 1.00 25.87  ? 155 LEU B CG  1 
ATOM   3410  C  CD1 . LEU B  1 134 ? 130.174 174.062 159.191 1.00 25.30  ? 155 LEU B CD1 1 
ATOM   3411  C  CD2 . LEU B  1 134 ? 128.380 174.653 160.886 1.00 25.01  ? 155 LEU B CD2 1 
ATOM   3412  N  N   . VAL B  1 135 ? 128.712 176.283 164.062 1.00 24.02  ? 156 VAL B N   1 
ATOM   3413  C  CA  . VAL B  1 135 ? 127.680 176.102 165.098 1.00 24.69  ? 156 VAL B CA  1 
ATOM   3414  C  C   . VAL B  1 135 ? 126.390 175.668 164.402 1.00 24.84  ? 156 VAL B C   1 
ATOM   3415  O  O   . VAL B  1 135 ? 126.122 176.201 163.325 1.00 25.25  ? 156 VAL B O   1 
ATOM   3416  C  CB  . VAL B  1 135 ? 127.553 177.380 165.915 1.00 25.93  ? 156 VAL B CB  1 
ATOM   3417  C  CG1 . VAL B  1 135 ? 126.343 177.321 166.853 1.00 27.58  ? 156 VAL B CG1 1 
ATOM   3418  C  CG2 . VAL B  1 135 ? 128.817 177.658 166.695 1.00 25.89  ? 156 VAL B CG2 1 
ATOM   3419  N  N   . LEU B  1 136 ? 125.718 174.634 164.927 1.00 24.02  ? 157 LEU B N   1 
ATOM   3420  C  CA  . LEU B  1 136 ? 124.377 174.183 164.504 1.00 23.28  ? 157 LEU B CA  1 
ATOM   3421  C  C   . LEU B  1 136 ? 123.357 174.782 165.455 1.00 23.89  ? 157 LEU B C   1 
ATOM   3422  O  O   . LEU B  1 136 ? 123.349 174.430 166.716 1.00 23.74  ? 157 LEU B O   1 
ATOM   3423  C  CB  . LEU B  1 136 ? 124.281 172.664 164.575 1.00 23.90  ? 157 LEU B CB  1 
ATOM   3424  C  CG  . LEU B  1 136 ? 125.342 171.837 163.849 1.00 24.14  ? 157 LEU B CG  1 
ATOM   3425  C  CD1 . LEU B  1 136 ? 124.971 170.358 163.869 1.00 24.11  ? 157 LEU B CD1 1 
ATOM   3426  C  CD2 . LEU B  1 136 ? 125.522 172.302 162.419 1.00 25.17  ? 157 LEU B CD2 1 
ATOM   3427  N  N   . GLY B  1 137 ? 122.552 175.707 164.924 1.00 23.88  ? 158 GLY B N   1 
ATOM   3428  C  CA  . GLY B  1 137 ? 121.384 176.206 165.656 1.00 23.41  ? 158 GLY B CA  1 
ATOM   3429  C  C   . GLY B  1 137 ? 120.249 175.195 165.594 1.00 23.44  ? 158 GLY B C   1 
ATOM   3430  O  O   . GLY B  1 137 ? 120.306 174.196 164.844 1.00 22.63  ? 158 GLY B O   1 
ATOM   3431  N  N   . GLY B  1 138 ? 119.201 175.462 166.402 1.00 23.84  ? 159 GLY B N   1 
ATOM   3432  C  CA  . GLY B  1 138 ? 119.059 176.646 167.246 1.00 23.65  ? 159 GLY B CA  1 
ATOM   3433  C  C   . GLY B  1 138 ? 118.560 177.882 166.510 1.00 23.68  ? 159 GLY B C   1 
ATOM   3434  O  O   . GLY B  1 138 ? 118.763 177.988 165.294 1.00 22.79  ? 159 GLY B O   1 
ATOM   3435  N  N   . ASP B  1 139 ? 117.996 178.849 167.247 1.00 24.70  ? 160 ASP B N   1 
ATOM   3436  C  CA  . ASP B  1 139 ? 117.437 180.089 166.655 1.00 25.11  ? 160 ASP B CA  1 
ATOM   3437  C  C   . ASP B  1 139 ? 118.568 181.080 166.529 1.00 25.41  ? 160 ASP B C   1 
ATOM   3438  O  O   . ASP B  1 139 ? 119.679 180.823 166.995 1.00 25.93  ? 160 ASP B O   1 
ATOM   3439  C  CB  . ASP B  1 139 ? 116.247 180.673 167.400 1.00 26.46  ? 160 ASP B CB  1 
ATOM   3440  C  CG  . ASP B  1 139 ? 116.545 181.224 168.792 1.00 27.49  ? 160 ASP B CG  1 
ATOM   3441  O  OD1 . ASP B  1 139 ? 117.492 181.998 168.907 1.00 26.80  ? 160 ASP B OD1 1 
ATOM   3442  O  OD2 . ASP B  1 139 ? 115.773 180.864 169.749 1.00 28.27  ? 160 ASP B OD2 1 
ATOM   3443  N  N   . HIS B  1 140 ? 118.303 182.124 165.784 1.00 25.49  ? 161 HIS B N   1 
ATOM   3444  C  CA  . HIS B  1 140 ? 119.349 183.048 165.288 1.00 25.36  ? 161 HIS B CA  1 
ATOM   3445  C  C   . HIS B  1 140 ? 119.917 183.864 166.441 1.00 25.88  ? 161 HIS B C   1 
ATOM   3446  O  O   . HIS B  1 140 ? 120.890 184.554 166.207 1.00 25.88  ? 161 HIS B O   1 
ATOM   3447  C  CB  . HIS B  1 140 ? 118.761 183.953 164.179 1.00 25.78  ? 161 HIS B CB  1 
ATOM   3448  C  CG  . HIS B  1 140 ? 119.751 184.156 163.087 1.00 24.92  ? 161 HIS B CG  1 
ATOM   3449  N  ND1 . HIS B  1 140 ? 119.383 184.444 161.804 1.00 24.79  ? 161 HIS B ND1 1 
ATOM   3450  C  CD2 . HIS B  1 140 ? 121.092 184.031 163.109 1.00 24.30  ? 161 HIS B CD2 1 
ATOM   3451  C  CE1 . HIS B  1 140 ? 120.491 184.491 161.071 1.00 25.29  ? 161 HIS B CE1 1 
ATOM   3452  N  NE2 . HIS B  1 140 ? 121.568 184.270 161.855 1.00 24.31  ? 161 HIS B NE2 1 
ATOM   3453  N  N   . SER B  1 141 ? 119.302 183.811 167.633 1.00 26.75  ? 162 SER B N   1 
ATOM   3454  C  CA  . SER B  1 141 ? 119.822 184.508 168.845 1.00 27.63  ? 162 SER B CA  1 
ATOM   3455  C  C   . SER B  1 141 ? 121.258 184.050 169.079 1.00 27.49  ? 162 SER B C   1 
ATOM   3456  O  O   . SER B  1 141 ? 122.041 184.829 169.606 1.00 28.20  ? 162 SER B O   1 
ATOM   3457  C  CB  . SER B  1 141 ? 118.977 184.362 170.091 1.00 27.72  ? 162 SER B CB  1 
ATOM   3458  O  OG  . SER B  1 141 ? 119.004 183.061 170.643 1.00 26.49  ? 162 SER B OG  1 
ATOM   3459  N  N   . ILE B  1 142 ? 121.570 182.810 168.732 1.00 26.86  ? 163 ILE B N   1 
ATOM   3460  C  CA  . ILE B  1 142 ? 122.872 182.228 169.142 1.00 26.99  ? 163 ILE B CA  1 
ATOM   3461  C  C   . ILE B  1 142 ? 124.012 182.909 168.365 1.00 27.21  ? 163 ILE B C   1 
ATOM   3462  O  O   . ILE B  1 142 ? 125.124 182.789 168.791 1.00 26.46  ? 163 ILE B O   1 
ATOM   3463  C  CB  . ILE B  1 142 ? 122.876 180.719 168.913 1.00 26.68  ? 163 ILE B CB  1 
ATOM   3464  C  CG1 . ILE B  1 142 ? 122.955 180.414 167.426 1.00 26.42  ? 163 ILE B CG1 1 
ATOM   3465  C  CG2 . ILE B  1 142 ? 121.674 180.057 169.590 1.00 27.00  ? 163 ILE B CG2 1 
ATOM   3466  C  CD1 . ILE B  1 142 ? 122.788 178.960 167.190 1.00 27.57  ? 163 ILE B CD1 1 
ATOM   3467  N  N   . SER B  1 143 ? 123.776 183.534 167.210 1.00 27.80  ? 164 SER B N   1 
ATOM   3468  C  CA  . SER B  1 143 ? 124.917 184.092 166.437 1.00 28.34  ? 164 SER B CA  1 
ATOM   3469  C  C   . SER B  1 143 ? 125.603 185.203 167.276 1.00 28.74  ? 164 SER B C   1 
ATOM   3470  O  O   . SER B  1 143 ? 126.766 185.466 167.099 1.00 27.87  ? 164 SER B O   1 
ATOM   3471  C  CB  . SER B  1 143 ? 124.445 184.598 165.095 1.00 28.89  ? 164 SER B CB  1 
ATOM   3472  O  OG  . SER B  1 143 ? 123.943 183.535 164.307 1.00 28.62  ? 164 SER B OG  1 
ATOM   3473  N  N   . TYR B  1 144 ? 124.871 185.867 168.159 1.00 30.55  ? 165 TYR B N   1 
ATOM   3474  C  CA  . TYR B  1 144 ? 125.429 186.990 168.967 1.00 32.64  ? 165 TYR B CA  1 
ATOM   3475  C  C   . TYR B  1 144 ? 126.520 186.417 169.866 1.00 31.54  ? 165 TYR B C   1 
ATOM   3476  O  O   . TYR B  1 144 ? 127.660 186.802 169.711 1.00 31.48  ? 165 TYR B O   1 
ATOM   3477  C  CB  . TYR B  1 144 ? 124.361 187.835 169.678 1.00 34.32  ? 165 TYR B CB  1 
ATOM   3478  C  CG  . TYR B  1 144 ? 124.923 188.776 170.729 1.00 36.30  ? 165 TYR B CG  1 
ATOM   3479  C  CD1 . TYR B  1 144 ? 126.057 189.536 170.480 1.00 37.23  ? 165 TYR B CD1 1 
ATOM   3480  C  CD2 . TYR B  1 144 ? 124.359 188.876 171.994 1.00 36.90  ? 165 TYR B CD2 1 
ATOM   3481  C  CE1 . TYR B  1 144 ? 126.604 190.383 171.440 1.00 38.88  ? 165 TYR B CE1 1 
ATOM   3482  C  CE2 . TYR B  1 144 ? 124.901 189.700 172.970 1.00 38.74  ? 165 TYR B CE2 1 
ATOM   3483  C  CZ  . TYR B  1 144 ? 126.033 190.464 172.700 1.00 40.02  ? 165 TYR B CZ  1 
ATOM   3484  O  OH  . TYR B  1 144 ? 126.585 191.309 173.649 1.00 41.78  ? 165 TYR B OH  1 
ATOM   3485  N  N   . PRO B  1 145 ? 126.252 185.463 170.782 1.00 30.77  ? 166 PRO B N   1 
ATOM   3486  C  CA  . PRO B  1 145 ? 127.308 184.926 171.647 1.00 30.41  ? 166 PRO B CA  1 
ATOM   3487  C  C   . PRO B  1 145 ? 128.410 184.200 170.858 1.00 29.61  ? 166 PRO B C   1 
ATOM   3488  O  O   . PRO B  1 145 ? 129.559 184.202 171.303 1.00 29.25  ? 166 PRO B O   1 
ATOM   3489  C  CB  . PRO B  1 145 ? 126.581 184.020 172.643 1.00 30.35  ? 166 PRO B CB  1 
ATOM   3490  C  CG  . PRO B  1 145 ? 125.260 183.692 171.934 1.00 30.09  ? 166 PRO B CG  1 
ATOM   3491  C  CD  . PRO B  1 145 ? 124.931 184.894 171.071 1.00 30.72  ? 166 PRO B CD  1 
ATOM   3492  N  N   . VAL B  1 146 ? 128.080 183.637 169.691 1.00 28.57  ? 167 VAL B N   1 
ATOM   3493  C  CA  . VAL B  1 146 ? 129.097 182.931 168.865 1.00 28.22  ? 167 VAL B CA  1 
ATOM   3494  C  C   . VAL B  1 146 ? 130.037 183.954 168.227 1.00 29.11  ? 167 VAL B C   1 
ATOM   3495  O  O   . VAL B  1 146 ? 131.291 183.757 168.311 1.00 29.40  ? 167 VAL B O   1 
ATOM   3496  C  CB  . VAL B  1 146 ? 128.455 181.981 167.832 1.00 27.48  ? 167 VAL B CB  1 
ATOM   3497  C  CG1 . VAL B  1 146 ? 129.465 181.328 166.894 1.00 26.84  ? 167 VAL B CG1 1 
ATOM   3498  C  CG2 . VAL B  1 146 ? 127.647 180.888 168.529 1.00 26.57  ? 167 VAL B CG2 1 
ATOM   3499  N  N   . VAL B  1 147 ? 129.502 185.016 167.620 1.00 29.66  ? 168 VAL B N   1 
ATOM   3500  C  CA  . VAL B  1 147 ? 130.361 185.995 166.896 1.00 29.61  ? 168 VAL B CA  1 
ATOM   3501  C  C   . VAL B  1 147 ? 131.168 186.762 167.947 1.00 30.68  ? 168 VAL B C   1 
ATOM   3502  O  O   . VAL B  1 147 ? 132.346 187.037 167.724 1.00 30.99  ? 168 VAL B O   1 
ATOM   3503  C  CB  . VAL B  1 147 ? 129.529 186.872 165.936 1.00 30.25  ? 168 VAL B CB  1 
ATOM   3504  C  CG1 . VAL B  1 147 ? 130.309 188.066 165.391 1.00 31.18  ? 168 VAL B CG1 1 
ATOM   3505  C  CG2 . VAL B  1 147 ? 128.960 186.038 164.780 1.00 29.08  ? 168 VAL B CG2 1 
ATOM   3506  N  N   . ARG B  1 148 ? 130.563 187.109 169.073 1.00 31.55  ? 169 ARG B N   1 
ATOM   3507  C  CA  . ARG B  1 148 ? 131.263 187.791 170.203 1.00 33.28  ? 169 ARG B CA  1 
ATOM   3508  C  C   . ARG B  1 148 ? 132.511 186.998 170.598 1.00 33.63  ? 169 ARG B C   1 
ATOM   3509  O  O   . ARG B  1 148 ? 133.591 187.568 170.700 1.00 34.70  ? 169 ARG B O   1 
ATOM   3510  C  CB  . ARG B  1 148 ? 130.379 187.844 171.448 1.00 33.59  ? 169 ARG B CB  1 
ATOM   3511  C  CG  . ARG B  1 148 ? 131.071 188.396 172.690 1.00 34.97  ? 169 ARG B CG  1 
ATOM   3512  C  CD  . ARG B  1 148 ? 130.034 188.716 173.745 1.00 35.30  ? 169 ARG B CD  1 
ATOM   3513  N  NE  . ARG B  1 148 ? 129.425 187.481 174.194 1.00 34.22  ? 169 ARG B NE  1 
ATOM   3514  C  CZ  . ARG B  1 148 ? 128.414 187.408 175.036 1.00 34.59  ? 169 ARG B CZ  1 
ATOM   3515  N  NH1 . ARG B  1 148 ? 127.902 188.513 175.538 1.00 35.61  ? 169 ARG B NH1 1 
ATOM   3516  N  NH2 . ARG B  1 148 ? 127.946 186.227 175.418 1.00 34.02  ? 169 ARG B NH2 1 
ATOM   3517  N  N   . ALA B  1 149 ? 132.329 185.698 170.817 1.00 33.73  ? 170 ALA B N   1 
ATOM   3518  C  CA  . ALA B  1 149 ? 133.368 184.715 171.230 1.00 33.95  ? 170 ALA B CA  1 
ATOM   3519  C  C   . ALA B  1 149 ? 134.446 184.655 170.151 1.00 33.75  ? 170 ALA B C   1 
ATOM   3520  O  O   . ALA B  1 149 ? 135.587 184.731 170.496 1.00 35.46  ? 170 ALA B O   1 
ATOM   3521  C  CB  . ALA B  1 149 ? 132.754 183.352 171.538 1.00 32.55  ? 170 ALA B CB  1 
ATOM   3522  N  N   . VAL B  1 150 ? 134.095 184.605 168.878 1.00 33.78  ? 171 VAL B N   1 
ATOM   3523  C  CA  . VAL B  1 150 ? 135.143 184.470 167.820 1.00 33.78  ? 171 VAL B CA  1 
ATOM   3524  C  C   . VAL B  1 150 ? 135.966 185.745 167.742 1.00 35.39  ? 171 VAL B C   1 
ATOM   3525  O  O   . VAL B  1 150 ? 137.198 185.637 167.617 1.00 36.23  ? 171 VAL B O   1 
ATOM   3526  C  CB  . VAL B  1 150 ? 134.519 184.160 166.463 1.00 32.78  ? 171 VAL B CB  1 
ATOM   3527  C  CG1 . VAL B  1 150 ? 135.549 184.241 165.334 1.00 33.03  ? 171 VAL B CG1 1 
ATOM   3528  C  CG2 . VAL B  1 150 ? 133.874 182.797 166.492 1.00 31.73  ? 171 VAL B CG2 1 
ATOM   3529  N  N   . SER B  1 151 ? 135.292 186.902 167.760 1.00 36.00  ? 172 SER B N   1 
ATOM   3530  C  CA  . SER B  1 151 ? 135.930 188.242 167.665 1.00 37.75  ? 172 SER B CA  1 
ATOM   3531  C  C   . SER B  1 151 ? 136.898 188.473 168.841 1.00 38.93  ? 172 SER B C   1 
ATOM   3532  O  O   . SER B  1 151 ? 138.013 188.952 168.614 1.00 39.06  ? 172 SER B O   1 
ATOM   3533  C  CB  . SER B  1 151 ? 134.857 189.337 167.607 1.00 38.10  ? 172 SER B CB  1 
ATOM   3534  O  OG  . SER B  1 151 ? 135.439 190.642 167.656 1.00 39.11  ? 172 SER B OG  1 
ATOM   3535  N  N   . GLU B  1 152 ? 136.432 188.187 170.066 1.00 39.85  ? 173 GLU B N   1 
ATOM   3536  C  CA  . GLU B  1 152 ? 137.187 188.354 171.339 1.00 41.40  ? 173 GLU B CA  1 
ATOM   3537  C  C   . GLU B  1 152 ? 138.416 187.457 171.265 1.00 41.83  ? 173 GLU B C   1 
ATOM   3538  O  O   . GLU B  1 152 ? 139.503 187.891 171.622 1.00 44.62  ? 173 GLU B O   1 
ATOM   3539  C  CB  . GLU B  1 152 ? 136.345 187.956 172.557 1.00 41.12  ? 173 GLU B CB  1 
ATOM   3540  C  CG  . GLU B  1 152 ? 135.374 189.029 173.040 1.00 41.57  ? 173 GLU B CG  1 
ATOM   3541  C  CD  . GLU B  1 152 ? 134.443 188.567 174.156 1.00 41.09  ? 173 GLU B CD  1 
ATOM   3542  O  OE1 . GLU B  1 152 ? 134.465 187.367 174.494 1.00 39.90  ? 173 GLU B OE1 1 
ATOM   3543  O  OE2 . GLU B  1 152 ? 133.662 189.386 174.652 1.00 41.82  ? 173 GLU B OE2 1 
ATOM   3544  N  N   . LYS B  1 153 ? 138.245 186.248 170.759 1.00 40.92  ? 174 LYS B N   1 
ATOM   3545  C  CA  . LYS B  1 153 ? 139.342 185.267 170.744 1.00 41.87  ? 174 LYS B CA  1 
ATOM   3546  C  C   . LYS B  1 153 ? 140.381 185.673 169.692 1.00 41.21  ? 174 LYS B C   1 
ATOM   3547  O  O   . LYS B  1 153 ? 141.551 185.529 169.982 1.00 40.56  ? 174 LYS B O   1 
ATOM   3548  C  CB  . LYS B  1 153 ? 138.778 183.879 170.456 1.00 42.39  ? 174 LYS B CB  1 
ATOM   3549  C  CG  . LYS B  1 153 ? 139.819 182.792 170.641 1.00 45.55  ? 174 LYS B CG  1 
ATOM   3550  C  CD  . LYS B  1 153 ? 140.081 182.511 172.101 1.00 48.56  ? 174 LYS B CD  1 
ATOM   3551  C  CE  . LYS B  1 153 ? 141.396 181.820 172.342 1.00 50.26  ? 174 LYS B CE  1 
ATOM   3552  N  NZ  . LYS B  1 153 ? 141.588 181.683 173.800 1.00 52.06  ? 174 LYS B NZ  1 
ATOM   3553  N  N   . LEU B  1 154 ? 139.947 186.137 168.520 1.00 39.47  ? 175 LEU B N   1 
ATOM   3554  C  CA  . LEU B  1 154 ? 140.871 186.551 167.428 1.00 40.26  ? 175 LEU B CA  1 
ATOM   3555  C  C   . LEU B  1 154 ? 141.353 187.981 167.659 1.00 40.68  ? 175 LEU B C   1 
ATOM   3556  O  O   . LEU B  1 154 ? 142.283 188.439 166.907 1.00 41.58  ? 175 LEU B O   1 
ATOM   3557  C  CB  . LEU B  1 154 ? 140.169 186.440 166.069 1.00 39.34  ? 175 LEU B CB  1 
ATOM   3558  C  CG  . LEU B  1 154 ? 139.658 185.047 165.727 1.00 37.88  ? 175 LEU B CG  1 
ATOM   3559  C  CD1 . LEU B  1 154 ? 139.031 185.047 164.358 1.00 36.78  ? 175 LEU B CD1 1 
ATOM   3560  C  CD2 . LEU B  1 154 ? 140.808 184.049 165.821 1.00 38.97  ? 175 LEU B CD2 1 
ATOM   3561  N  N   . GLY B  1 155 ? 140.709 188.689 168.582 1.00 40.49  ? 176 GLY B N   1 
ATOM   3562  C  CA  . GLY B  1 155 ? 141.164 190.038 169.008 1.00 42.29  ? 176 GLY B CA  1 
ATOM   3563  C  C   . GLY B  1 155 ? 140.803 191.110 167.989 1.00 42.27  ? 176 GLY B C   1 
ATOM   3564  O  O   . GLY B  1 155 ? 141.520 192.090 167.881 1.00 44.11  ? 176 GLY B O   1 
ATOM   3565  N  N   . GLY B  1 156 ? 139.734 190.939 167.214 1.00 40.72  ? 177 GLY B N   1 
ATOM   3566  C  CA  . GLY B  1 156 ? 139.276 192.047 166.362 1.00 41.15  ? 177 GLY B CA  1 
ATOM   3567  C  C   . GLY B  1 156 ? 137.958 191.732 165.673 1.00 39.29  ? 177 GLY B C   1 
ATOM   3568  O  O   . GLY B  1 156 ? 137.399 190.634 165.781 1.00 36.90  ? 177 GLY B O   1 
ATOM   3569  N  N   . PRO B  1 157 ? 137.418 192.736 164.958 1.00 39.85  ? 178 PRO B N   1 
ATOM   3570  C  CA  . PRO B  1 157 ? 136.193 192.526 164.200 1.00 38.80  ? 178 PRO B CA  1 
ATOM   3571  C  C   . PRO B  1 157 ? 136.434 191.520 163.061 1.00 37.79  ? 178 PRO B C   1 
ATOM   3572  O  O   . PRO B  1 157 ? 137.578 191.324 162.614 1.00 38.36  ? 178 PRO B O   1 
ATOM   3573  C  CB  . PRO B  1 157 ? 135.840 193.937 163.701 1.00 40.45  ? 178 PRO B CB  1 
ATOM   3574  C  CG  . PRO B  1 157 ? 137.184 194.698 163.685 1.00 41.95  ? 178 PRO B CG  1 
ATOM   3575  C  CD  . PRO B  1 157 ? 137.998 194.076 164.800 1.00 41.76  ? 178 PRO B CD  1 
ATOM   3576  N  N   . VAL B  1 158 ? 135.355 190.882 162.639 1.00 36.21  ? 179 VAL B N   1 
ATOM   3577  C  CA  . VAL B  1 158 ? 135.299 190.058 161.414 1.00 35.73  ? 179 VAL B CA  1 
ATOM   3578  C  C   . VAL B  1 158 ? 134.352 190.748 160.449 1.00 36.39  ? 179 VAL B C   1 
ATOM   3579  O  O   . VAL B  1 158 ? 133.545 191.616 160.890 1.00 37.50  ? 179 VAL B O   1 
ATOM   3580  C  CB  . VAL B  1 158 ? 134.828 188.631 161.713 1.00 34.72  ? 179 VAL B CB  1 
ATOM   3581  C  CG1 . VAL B  1 158 ? 135.802 187.952 162.664 1.00 35.26  ? 179 VAL B CG1 1 
ATOM   3582  C  CG2 . VAL B  1 158 ? 133.403 188.552 162.290 1.00 34.10  ? 179 VAL B CG2 1 
ATOM   3583  N  N   . ASP B  1 159 ? 134.480 190.401 159.166 1.00 35.99  ? 180 ASP B N   1 
ATOM   3584  C  CA  . ASP B  1 159 ? 133.409 190.631 158.171 1.00 34.62  ? 180 ASP B CA  1 
ATOM   3585  C  C   . ASP B  1 159 ? 132.420 189.467 158.311 1.00 32.91  ? 180 ASP B C   1 
ATOM   3586  O  O   . ASP B  1 159 ? 132.866 188.361 158.509 1.00 31.84  ? 180 ASP B O   1 
ATOM   3587  C  CB  . ASP B  1 159 ? 133.956 190.769 156.757 1.00 34.11  ? 180 ASP B CB  1 
ATOM   3588  C  CG  . ASP B  1 159 ? 134.621 192.089 156.444 1.00 35.55  ? 180 ASP B CG  1 
ATOM   3589  O  OD1 . ASP B  1 159 ? 134.616 192.982 157.313 1.00 36.20  ? 180 ASP B OD1 1 
ATOM   3590  O  OD2 . ASP B  1 159 ? 135.116 192.211 155.298 1.00 35.06  ? 180 ASP B OD2 1 
ATOM   3591  N  N   . ILE B  1 160 ? 131.135 189.736 158.122 1.00 32.94  ? 181 ILE B N   1 
ATOM   3592  C  CA  . ILE B  1 160 ? 130.060 188.722 158.193 1.00 32.33  ? 181 ILE B CA  1 
ATOM   3593  C  C   . ILE B  1 160 ? 129.295 188.708 156.870 1.00 31.95  ? 181 ILE B C   1 
ATOM   3594  O  O   . ILE B  1 160 ? 128.827 189.772 156.418 1.00 32.60  ? 181 ILE B O   1 
ATOM   3595  C  CB  . ILE B  1 160 ? 129.136 189.011 159.396 1.00 33.24  ? 181 ILE B CB  1 
ATOM   3596  C  CG1 . ILE B  1 160 ? 129.927 189.109 160.702 1.00 34.12  ? 181 ILE B CG1 1 
ATOM   3597  C  CG2 . ILE B  1 160 ? 128.013 187.981 159.511 1.00 32.11  ? 181 ILE B CG2 1 
ATOM   3598  C  CD1 . ILE B  1 160 ? 129.026 189.218 161.923 1.00 34.82  ? 181 ILE B CD1 1 
ATOM   3599  N  N   . LEU B  1 161 ? 129.156 187.523 156.294 1.00 31.09  ? 182 LEU B N   1 
ATOM   3600  C  CA  . LEU B  1 161 ? 128.099 187.229 155.294 1.00 31.41  ? 182 LEU B CA  1 
ATOM   3601  C  C   . LEU B  1 161 ? 126.907 186.594 156.034 1.00 30.63  ? 182 LEU B C   1 
ATOM   3602  O  O   . LEU B  1 161 ? 127.084 185.465 156.650 1.00 29.04  ? 182 LEU B O   1 
ATOM   3603  C  CB  . LEU B  1 161 ? 128.650 186.282 154.236 1.00 30.92  ? 182 LEU B CB  1 
ATOM   3604  C  CG  . LEU B  1 161 ? 127.592 185.830 153.243 1.00 31.83  ? 182 LEU B CG  1 
ATOM   3605  C  CD1 . LEU B  1 161 ? 127.085 187.045 152.426 1.00 33.33  ? 182 LEU B CD1 1 
ATOM   3606  C  CD2 . LEU B  1 161 ? 128.131 184.739 152.312 1.00 31.29  ? 182 LEU B CD2 1 
ATOM   3607  N  N   . HIS B  1 162 ? 125.742 187.235 155.931 1.00 30.76  ? 183 HIS B N   1 
ATOM   3608  C  CA  . HIS B  1 162 ? 124.497 186.894 156.676 1.00 30.80  ? 183 HIS B CA  1 
ATOM   3609  C  C   . HIS B  1 162 ? 123.460 186.537 155.635 1.00 30.95  ? 183 HIS B C   1 
ATOM   3610  O  O   . HIS B  1 162 ? 123.137 187.454 154.881 1.00 34.22  ? 183 HIS B O   1 
ATOM   3611  C  CB  . HIS B  1 162 ? 124.059 188.106 157.520 1.00 32.06  ? 183 HIS B CB  1 
ATOM   3612  C  CG  . HIS B  1 162 ? 122.768 187.935 158.217 1.00 32.37  ? 183 HIS B CG  1 
ATOM   3613  N  ND1 . HIS B  1 162 ? 122.099 189.001 158.772 1.00 33.67  ? 183 HIS B ND1 1 
ATOM   3614  C  CD2 . HIS B  1 162 ? 122.031 186.829 158.478 1.00 31.18  ? 183 HIS B CD2 1 
ATOM   3615  C  CE1 . HIS B  1 162 ? 120.998 188.553 159.333 1.00 32.85  ? 183 HIS B CE1 1 
ATOM   3616  N  NE2 . HIS B  1 162 ? 120.939 187.223 159.181 1.00 31.04  ? 183 HIS B NE2 1 
ATOM   3617  N  N   . LEU B  1 163 ? 123.136 185.266 155.464 1.00 29.71  ? 184 LEU B N   1 
ATOM   3618  C  CA  . LEU B  1 163 ? 122.149 184.822 154.458 1.00 30.06  ? 184 LEU B CA  1 
ATOM   3619  C  C   . LEU B  1 163 ? 120.834 184.595 155.180 1.00 29.95  ? 184 LEU B C   1 
ATOM   3620  O  O   . LEU B  1 163 ? 120.809 183.776 156.135 1.00 28.18  ? 184 LEU B O   1 
ATOM   3621  C  CB  . LEU B  1 163 ? 122.638 183.528 153.828 1.00 30.06  ? 184 LEU B CB  1 
ATOM   3622  C  CG  . LEU B  1 163 ? 123.710 183.704 152.762 1.00 30.79  ? 184 LEU B CG  1 
ATOM   3623  C  CD1 . LEU B  1 163 ? 124.463 182.409 152.544 1.00 30.11  ? 184 LEU B CD1 1 
ATOM   3624  C  CD2 . LEU B  1 163 ? 123.081 184.193 151.475 1.00 32.35  ? 184 LEU B CD2 1 
ATOM   3625  N  N   . ASP B  1 164 ? 119.827 185.401 154.853 1.00 30.70  ? 185 ASP B N   1 
ATOM   3626  C  CA  . ASP B  1 164 ? 118.601 185.446 155.673 1.00 30.16  ? 185 ASP B CA  1 
ATOM   3627  C  C   . ASP B  1 164 ? 117.547 186.217 154.897 1.00 32.20  ? 185 ASP B C   1 
ATOM   3628  O  O   . ASP B  1 164 ? 117.888 187.188 154.197 1.00 32.96  ? 185 ASP B O   1 
ATOM   3629  C  CB  . ASP B  1 164 ? 118.938 186.111 156.984 1.00 29.98  ? 185 ASP B CB  1 
ATOM   3630  C  CG  . ASP B  1 164 ? 118.012 185.743 158.126 1.00 29.99  ? 185 ASP B CG  1 
ATOM   3631  O  OD1 . ASP B  1 164 ? 116.801 185.693 157.887 1.00 31.18  ? 185 ASP B OD1 1 
ATOM   3632  O  OD2 . ASP B  1 164 ? 118.510 185.556 159.220 1.00 27.75  ? 185 ASP B OD2 1 
ATOM   3633  N  N   . ALA B  1 165 ? 116.294 185.786 154.994 1.00 33.12  ? 186 ALA B N   1 
ATOM   3634  C  CA  . ALA B  1 165 ? 115.120 186.568 154.522 1.00 34.07  ? 186 ALA B CA  1 
ATOM   3635  C  C   . ALA B  1 165 ? 114.950 187.819 155.398 1.00 34.42  ? 186 ALA B C   1 
ATOM   3636  O  O   . ALA B  1 165 ? 114.430 188.778 154.941 1.00 36.85  ? 186 ALA B O   1 
ATOM   3637  C  CB  . ALA B  1 165 ? 113.909 185.684 154.526 1.00 33.93  ? 186 ALA B CB  1 
ATOM   3638  N  N   . HIS B  1 166 ? 115.414 187.794 156.623 1.00 34.17  ? 187 HIS B N   1 
ATOM   3639  C  CA  . HIS B  1 166 ? 115.231 188.839 157.654 1.00 34.98  ? 187 HIS B CA  1 
ATOM   3640  C  C   . HIS B  1 166 ? 116.577 189.454 158.046 1.00 34.46  ? 187 HIS B C   1 
ATOM   3641  O  O   . HIS B  1 166 ? 117.594 188.790 158.148 1.00 33.49  ? 187 HIS B O   1 
ATOM   3642  C  CB  . HIS B  1 166 ? 114.570 188.181 158.859 1.00 34.52  ? 187 HIS B CB  1 
ATOM   3643  C  CG  . HIS B  1 166 ? 113.360 187.368 158.534 1.00 35.01  ? 187 HIS B CG  1 
ATOM   3644  N  ND1 . HIS B  1 166 ? 113.396 185.991 158.436 1.00 33.85  ? 187 HIS B ND1 1 
ATOM   3645  C  CD2 . HIS B  1 166 ? 112.057 187.727 158.413 1.00 37.34  ? 187 HIS B CD2 1 
ATOM   3646  C  CE1 . HIS B  1 166 ? 112.178 185.545 158.211 1.00 34.99  ? 187 HIS B CE1 1 
ATOM   3647  N  NE2 . HIS B  1 166 ? 111.304 186.599 158.209 1.00 36.65  ? 187 HIS B NE2 1 
ATOM   3648  N  N   . PRO B  1 167 ? 116.648 190.766 158.307 1.00 35.91  ? 188 PRO B N   1 
ATOM   3649  C  CA  . PRO B  1 167 ? 117.898 191.356 158.774 1.00 36.07  ? 188 PRO B CA  1 
ATOM   3650  C  C   . PRO B  1 167 ? 118.193 191.175 160.274 1.00 36.25  ? 188 PRO B C   1 
ATOM   3651  O  O   . PRO B  1 167 ? 119.349 191.265 160.638 1.00 35.71  ? 188 PRO B O   1 
ATOM   3652  C  CB  . PRO B  1 167 ? 117.700 192.809 158.358 1.00 37.78  ? 188 PRO B CB  1 
ATOM   3653  C  CG  . PRO B  1 167 ? 116.215 193.053 158.450 1.00 38.82  ? 188 PRO B CG  1 
ATOM   3654  C  CD  . PRO B  1 167 ? 115.573 191.739 158.067 1.00 37.39  ? 188 PRO B CD  1 
ATOM   3655  N  N   . ASP B  1 168 ? 117.183 190.934 161.126 1.00 37.13  ? 189 ASP B N   1 
ATOM   3656  C  CA  . ASP B  1 168 ? 117.431 190.576 162.549 1.00 37.27  ? 189 ASP B CA  1 
ATOM   3657  C  C   . ASP B  1 168 ? 118.244 191.681 163.243 1.00 38.36  ? 189 ASP B C   1 
ATOM   3658  O  O   . ASP B  1 168 ? 119.184 191.348 164.013 1.00 36.74  ? 189 ASP B O   1 
ATOM   3659  C  CB  . ASP B  1 168 ? 118.170 189.236 162.654 1.00 36.71  ? 189 ASP B CB  1 
ATOM   3660  C  CG  . ASP B  1 168 ? 117.381 188.032 162.166 1.00 36.77  ? 189 ASP B CG  1 
ATOM   3661  O  OD1 . ASP B  1 168 ? 116.140 188.147 161.984 1.00 38.05  ? 189 ASP B OD1 1 
ATOM   3662  O  OD2 . ASP B  1 168 ? 118.005 186.933 162.041 1.00 37.99  ? 189 ASP B OD2 1 
ATOM   3663  N  N   . ILE B  1 169 ? 117.842 192.947 163.050 1.00 41.25  ? 190 ILE B N   1 
ATOM   3664  C  CA  . ILE B  1 169 ? 118.519 194.146 163.652 1.00 44.29  ? 190 ILE B CA  1 
ATOM   3665  C  C   . ILE B  1 169 ? 117.523 195.055 164.354 1.00 45.47  ? 190 ILE B C   1 
ATOM   3666  O  O   . ILE B  1 169 ? 117.886 196.214 164.545 1.00 47.16  ? 190 ILE B O   1 
ATOM   3667  C  CB  . ILE B  1 169 ? 119.298 195.020 162.643 1.00 45.00  ? 190 ILE B CB  1 
ATOM   3668  C  CG1 . ILE B  1 169 ? 118.571 195.096 161.304 1.00 45.45  ? 190 ILE B CG1 1 
ATOM   3669  C  CG2 . ILE B  1 169 ? 120.749 194.587 162.531 1.00 44.69  ? 190 ILE B CG2 1 
ATOM   3670  C  CD1 . ILE B  1 169 ? 119.301 195.927 160.295 1.00 47.39  ? 190 ILE B CD1 1 
ATOM   3671  N  N   . TYR B  1 170 ? 116.351 194.570 164.728 1.00 46.01  ? 191 TYR B N   1 
ATOM   3672  C  CA  . TYR B  1 170 ? 115.509 195.248 165.749 1.00 48.12  ? 191 TYR B CA  1 
ATOM   3673  C  C   . TYR B  1 170 ? 116.386 195.569 166.957 1.00 48.33  ? 191 TYR B C   1 
ATOM   3674  O  O   . TYR B  1 170 ? 117.134 194.685 167.396 1.00 45.37  ? 191 TYR B O   1 
ATOM   3675  C  CB  . TYR B  1 170 ? 114.340 194.365 166.205 1.00 48.06  ? 191 TYR B CB  1 
ATOM   3676  C  CG  . TYR B  1 170 ? 113.273 194.199 165.156 1.00 48.62  ? 191 TYR B CG  1 
ATOM   3677  C  CD1 . TYR B  1 170 ? 112.261 195.144 165.001 1.00 50.99  ? 191 TYR B CD1 1 
ATOM   3678  C  CD2 . TYR B  1 170 ? 113.290 193.116 164.294 1.00 46.61  ? 191 TYR B CD2 1 
ATOM   3679  C  CE1 . TYR B  1 170 ? 111.249 194.967 164.065 1.00 51.72  ? 191 TYR B CE1 1 
ATOM   3680  C  CE2 . TYR B  1 170 ? 112.307 192.945 163.330 1.00 47.67  ? 191 TYR B CE2 1 
ATOM   3681  C  CZ  . TYR B  1 170 ? 111.280 193.876 163.204 1.00 50.16  ? 191 TYR B CZ  1 
ATOM   3682  O  OH  . TYR B  1 170 ? 110.315 193.707 162.235 1.00 50.25  ? 191 TYR B OH  1 
ATOM   3683  N  N   . ASP B  1 171 ? 116.302 196.797 167.470 1.00 51.95  ? 192 ASP B N   1 
ATOM   3684  C  CA  . ASP B  1 171 ? 117.002 197.184 168.721 1.00 54.24  ? 192 ASP B CA  1 
ATOM   3685  C  C   . ASP B  1 171 ? 116.562 196.251 169.867 1.00 55.05  ? 192 ASP B C   1 
ATOM   3686  O  O   . ASP B  1 171 ? 117.430 195.796 170.634 1.00 54.19  ? 192 ASP B O   1 
ATOM   3687  C  CB  . ASP B  1 171 ? 116.775 198.660 169.038 1.00 57.26  ? 192 ASP B CB  1 
ATOM   3688  C  CG  . ASP B  1 171 ? 117.200 199.046 170.443 1.00 58.26  ? 192 ASP B CG  1 
ATOM   3689  O  OD1 . ASP B  1 171 ? 118.392 198.851 170.784 1.00 56.90  ? 192 ASP B OD1 1 
ATOM   3690  O  OD2 . ASP B  1 171 ? 116.314 199.505 171.195 1.00 61.44  ? 192 ASP B OD2 1 
ATOM   3691  N  N   . CYS B  1 172 ? 115.278 195.940 170.005 1.00 57.58  ? 193 CYS B N   1 
ATOM   3692  C  CA  . CYS B  1 172 ? 114.802 195.097 171.146 1.00 59.02  ? 193 CYS B CA  1 
ATOM   3693  C  C   . CYS B  1 172 ? 113.466 194.455 170.793 1.00 58.17  ? 193 CYS B C   1 
ATOM   3694  O  O   . CYS B  1 172 ? 112.428 195.041 171.135 1.00 61.32  ? 193 CYS B O   1 
ATOM   3695  C  CB  . CYS B  1 172 ? 114.648 195.932 172.415 1.00 62.57  ? 193 CYS B CB  1 
ATOM   3696  S  SG  . CYS B  1 172 ? 114.794 194.924 173.910 1.00 63.46  ? 193 CYS B SG  1 
ATOM   3697  N  N   . PHE B  1 173 ? 113.482 193.351 170.051 1.00 56.01  ? 194 PHE B N   1 
ATOM   3698  C  CA  . PHE B  1 173 ? 112.235 192.816 169.454 1.00 55.71  ? 194 PHE B CA  1 
ATOM   3699  C  C   . PHE B  1 173 ? 111.368 192.264 170.593 1.00 54.99  ? 194 PHE B C   1 
ATOM   3700  O  O   . PHE B  1 173 ? 111.873 191.445 171.370 1.00 52.91  ? 194 PHE B O   1 
ATOM   3701  C  CB  . PHE B  1 173 ? 112.526 191.806 168.341 1.00 53.61  ? 194 PHE B CB  1 
ATOM   3702  C  CG  . PHE B  1 173 ? 111.290 191.397 167.570 1.00 54.44  ? 194 PHE B CG  1 
ATOM   3703  C  CD1 . PHE B  1 173 ? 110.726 192.234 166.619 1.00 56.15  ? 194 PHE B CD1 1 
ATOM   3704  C  CD2 . PHE B  1 173 ? 110.663 190.187 167.817 1.00 53.46  ? 194 PHE B CD2 1 
ATOM   3705  C  CE1 . PHE B  1 173 ? 109.582 191.861 165.920 1.00 56.87  ? 194 PHE B CE1 1 
ATOM   3706  C  CE2 . PHE B  1 173 ? 109.529 189.816 167.104 1.00 54.53  ? 194 PHE B CE2 1 
ATOM   3707  C  CZ  . PHE B  1 173 ? 108.996 190.641 166.145 1.00 55.04  ? 194 PHE B CZ  1 
ATOM   3708  N  N   . GLU B  1 174 ? 110.143 192.777 170.727 1.00 56.35  ? 195 GLU B N   1 
ATOM   3709  C  CA  . GLU B  1 174 ? 109.179 192.392 171.788 1.00 57.21  ? 195 GLU B CA  1 
ATOM   3710  C  C   . GLU B  1 174 ? 109.859 192.482 173.167 1.00 55.50  ? 195 GLU B C   1 
ATOM   3711  O  O   . GLU B  1 174 ? 109.530 191.684 174.019 1.00 56.37  ? 195 GLU B O   1 
ATOM   3712  C  CB  . GLU B  1 174 ? 108.644 190.983 171.481 1.00 57.87  ? 195 GLU B CB  1 
ATOM   3713  C  CG  . GLU B  1 174 ? 107.292 190.913 170.741 1.00 61.13  ? 195 GLU B CG  1 
ATOM   3714  C  CD  . GLU B  1 174 ? 107.149 189.803 169.685 1.00 61.19  ? 195 GLU B CD  1 
ATOM   3715  O  OE1 . GLU B  1 174 ? 107.003 190.167 168.486 1.00 63.25  ? 195 GLU B OE1 1 
ATOM   3716  O  OE2 . GLU B  1 174 ? 107.225 188.570 170.033 1.00 58.54  ? 195 GLU B OE2 1 
ATOM   3717  N  N   . GLY B  1 175 ? 110.784 193.410 173.399 1.00 54.73  ? 196 GLY B N   1 
ATOM   3718  C  CA  . GLY B  1 175 ? 111.377 193.655 174.738 1.00 54.42  ? 196 GLY B CA  1 
ATOM   3719  C  C   . GLY B  1 175 ? 112.468 192.653 175.132 1.00 51.21  ? 196 GLY B C   1 
ATOM   3720  O  O   . GLY B  1 175 ? 113.023 192.765 176.245 1.00 51.63  ? 196 GLY B O   1 
ATOM   3721  N  N   . ASN B  1 176 ? 112.804 191.706 174.269 1.00 47.36  ? 197 ASN B N   1 
ATOM   3722  C  CA  . ASN B  1 176 ? 113.852 190.682 174.549 1.00 45.42  ? 197 ASN B CA  1 
ATOM   3723  C  C   . ASN B  1 176 ? 115.096 191.070 173.742 1.00 44.74  ? 197 ASN B C   1 
ATOM   3724  O  O   . ASN B  1 176 ? 115.065 190.917 172.504 1.00 43.65  ? 197 ASN B O   1 
ATOM   3725  C  CB  . ASN B  1 176 ? 113.337 189.268 174.220 1.00 42.32  ? 197 ASN B CB  1 
ATOM   3726  C  CG  . ASN B  1 176 ? 114.365 188.157 174.272 1.00 39.88  ? 197 ASN B CG  1 
ATOM   3727  O  OD1 . ASN B  1 176 ? 115.495 188.335 174.741 1.00 38.88  ? 197 ASN B OD1 1 
ATOM   3728  N  ND2 . ASN B  1 176 ? 113.968 186.996 173.767 1.00 37.11  ? 197 ASN B ND2 1 
ATOM   3729  N  N   . LYS B  1 177 ? 116.150 191.525 174.412 1.00 45.56  ? 198 LYS B N   1 
ATOM   3730  C  CA  . LYS B  1 177 ? 117.403 191.934 173.731 1.00 46.08  ? 198 LYS B CA  1 
ATOM   3731  C  C   . LYS B  1 177 ? 118.069 190.724 173.086 1.00 42.47  ? 198 LYS B C   1 
ATOM   3732  O  O   . LYS B  1 177 ? 118.882 190.905 172.159 1.00 41.15  ? 198 LYS B O   1 
ATOM   3733  C  CB  . LYS B  1 177 ? 118.353 192.601 174.724 1.00 49.86  ? 198 LYS B CB  1 
ATOM   3734  C  CG  . LYS B  1 177 ? 118.976 191.673 175.744 1.00 51.42  ? 198 LYS B CG  1 
ATOM   3735  C  CD  . LYS B  1 177 ? 120.097 192.357 176.489 1.00 55.58  ? 198 LYS B CD  1 
ATOM   3736  C  CE  . LYS B  1 177 ? 120.383 191.626 177.787 1.00 58.32  ? 198 LYS B CE  1 
ATOM   3737  N  NZ  . LYS B  1 177 ? 121.511 192.240 178.522 1.00 61.54  ? 198 LYS B NZ  1 
ATOM   3738  N  N   . TYR B  1 178 ? 117.769 189.518 173.565 1.00 39.99  ? 199 TYR B N   1 
ATOM   3739  C  CA  . TYR B  1 178 ? 118.353 188.278 172.990 1.00 36.94  ? 199 TYR B CA  1 
ATOM   3740  C  C   . TYR B  1 178 ? 117.378 187.717 171.955 1.00 36.33  ? 199 TYR B C   1 
ATOM   3741  O  O   . TYR B  1 178 ? 117.538 186.545 171.538 1.00 34.75  ? 199 TYR B O   1 
ATOM   3742  C  CB  . TYR B  1 178 ? 118.712 187.266 174.077 1.00 35.44  ? 199 TYR B CB  1 
ATOM   3743  C  CG  . TYR B  1 178 ? 119.870 187.685 174.953 1.00 35.25  ? 199 TYR B CG  1 
ATOM   3744  C  CD1 . TYR B  1 178 ? 121.136 187.803 174.418 1.00 34.57  ? 199 TYR B CD1 1 
ATOM   3745  C  CD2 . TYR B  1 178 ? 119.722 187.917 176.310 1.00 36.13  ? 199 TYR B CD2 1 
ATOM   3746  C  CE1 . TYR B  1 178 ? 122.223 188.198 175.179 1.00 35.29  ? 199 TYR B CE1 1 
ATOM   3747  C  CE2 . TYR B  1 178 ? 120.799 188.292 177.103 1.00 37.09  ? 199 TYR B CE2 1 
ATOM   3748  C  CZ  . TYR B  1 178 ? 122.056 188.435 176.532 1.00 36.80  ? 199 TYR B CZ  1 
ATOM   3749  O  OH  . TYR B  1 178 ? 123.172 188.766 177.252 1.00 37.83  ? 199 TYR B OH  1 
ATOM   3750  N  N   . SER B  1 179 ? 116.432 188.528 171.484 1.00 36.65  ? 200 SER B N   1 
ATOM   3751  C  CA  . SER B  1 179 ? 115.507 188.062 170.420 1.00 35.86  ? 200 SER B CA  1 
ATOM   3752  C  C   . SER B  1 179 ? 116.315 187.601 169.189 1.00 34.21  ? 200 SER B C   1 
ATOM   3753  O  O   . SER B  1 179 ? 117.313 188.275 168.785 1.00 33.30  ? 200 SER B O   1 
ATOM   3754  C  CB  . SER B  1 179 ? 114.495 189.090 170.030 1.00 36.89  ? 200 SER B CB  1 
ATOM   3755  O  OG  . SER B  1 179 ? 113.787 188.627 168.891 1.00 36.07  ? 200 SER B OG  1 
ATOM   3756  N  N   . HIS B  1 180 ? 115.867 186.507 168.579 1.00 32.93  ? 201 HIS B N   1 
ATOM   3757  C  CA  . HIS B  1 180 ? 116.429 186.037 167.288 1.00 31.78  ? 201 HIS B CA  1 
ATOM   3758  C  C   . HIS B  1 180 ? 116.275 187.117 166.197 1.00 32.44  ? 201 HIS B C   1 
ATOM   3759  O  O   . HIS B  1 180 ? 116.915 186.949 165.128 1.00 32.17  ? 201 HIS B O   1 
ATOM   3760  C  CB  . HIS B  1 180 ? 115.846 184.669 166.934 1.00 30.62  ? 201 HIS B CB  1 
ATOM   3761  C  CG  . HIS B  1 180 ? 114.481 184.657 166.357 1.00 31.65  ? 201 HIS B CG  1 
ATOM   3762  N  ND1 . HIS B  1 180 ? 114.088 183.658 165.468 1.00 31.17  ? 201 HIS B ND1 1 
ATOM   3763  C  CD2 . HIS B  1 180 ? 113.400 185.454 166.568 1.00 33.07  ? 201 HIS B CD2 1 
ATOM   3764  C  CE1 . HIS B  1 180 ? 112.819 183.885 165.118 1.00 31.94  ? 201 HIS B CE1 1 
ATOM   3765  N  NE2 . HIS B  1 180 ? 112.376 184.982 165.788 1.00 32.91  ? 201 HIS B NE2 1 
ATOM   3766  N  N   . ALA B  1 181 ? 115.464 188.153 166.438 1.00 33.55  ? 202 ALA B N   1 
ATOM   3767  C  CA  . ALA B  1 181 ? 115.221 189.282 165.494 1.00 35.40  ? 202 ALA B CA  1 
ATOM   3768  C  C   . ALA B  1 181 ? 116.133 190.490 165.789 1.00 35.67  ? 202 ALA B C   1 
ATOM   3769  O  O   . ALA B  1 181 ? 115.949 191.536 165.104 1.00 37.02  ? 202 ALA B O   1 
ATOM   3770  C  CB  . ALA B  1 181 ? 113.751 189.682 165.525 1.00 36.58  ? 202 ALA B CB  1 
ATOM   3771  N  N   . SER B  1 182 ? 117.052 190.358 166.748 1.00 34.67  ? 203 SER B N   1 
ATOM   3772  C  CA  . SER B  1 182 ? 117.892 191.450 167.302 1.00 36.28  ? 203 SER B CA  1 
ATOM   3773  C  C   . SER B  1 182 ? 119.356 191.010 167.344 1.00 35.65  ? 203 SER B C   1 
ATOM   3774  O  O   . SER B  1 182 ? 120.175 191.890 167.662 1.00 37.06  ? 203 SER B O   1 
ATOM   3775  C  CB  . SER B  1 182 ? 117.447 191.944 168.708 1.00 37.35  ? 203 SER B CB  1 
ATOM   3776  O  OG  . SER B  1 182 ? 116.174 192.581 168.711 1.00 37.90  ? 203 SER B OG  1 
ATOM   3777  N  N   . SER B  1 183 ? 119.713 189.772 166.975 1.00 34.45  ? 204 SER B N   1 
ATOM   3778  C  CA  . SER B  1 183 ? 121.098 189.293 167.222 1.00 34.72  ? 204 SER B CA  1 
ATOM   3779  C  C   . SER B  1 183 ? 122.113 190.115 166.423 1.00 35.16  ? 204 SER B C   1 
ATOM   3780  O  O   . SER B  1 183 ? 123.197 190.300 166.980 1.00 34.59  ? 204 SER B O   1 
ATOM   3781  C  CB  . SER B  1 183 ? 121.321 187.829 167.023 1.00 34.23  ? 204 SER B CB  1 
ATOM   3782  O  OG  . SER B  1 183 ? 120.603 187.361 165.928 1.00 36.49  ? 204 SER B OG  1 
ATOM   3783  N  N   . PHE B  1 184 ? 121.780 190.678 165.247 1.00 35.53  ? 205 PHE B N   1 
ATOM   3784  C  CA  . PHE B  1 184 ? 122.804 191.434 164.464 1.00 35.99  ? 205 PHE B CA  1 
ATOM   3785  C  C   . PHE B  1 184 ? 122.844 192.908 164.893 1.00 37.90  ? 205 PHE B C   1 
ATOM   3786  O  O   . PHE B  1 184 ? 123.832 193.530 164.601 1.00 38.51  ? 205 PHE B O   1 
ATOM   3787  C  CB  . PHE B  1 184 ? 122.614 191.282 162.968 1.00 35.60  ? 205 PHE B CB  1 
ATOM   3788  C  CG  . PHE B  1 184 ? 122.987 189.895 162.532 1.00 34.57  ? 205 PHE B CG  1 
ATOM   3789  C  CD1 . PHE B  1 184 ? 122.053 188.877 162.545 1.00 33.80  ? 205 PHE B CD1 1 
ATOM   3790  C  CD2 . PHE B  1 184 ? 124.279 189.605 162.159 1.00 34.62  ? 205 PHE B CD2 1 
ATOM   3791  C  CE1 . PHE B  1 184 ? 122.435 187.585 162.235 1.00 32.62  ? 205 PHE B CE1 1 
ATOM   3792  C  CE2 . PHE B  1 184 ? 124.656 188.312 161.833 1.00 33.08  ? 205 PHE B CE2 1 
ATOM   3793  C  CZ  . PHE B  1 184 ? 123.721 187.313 161.838 1.00 31.97  ? 205 PHE B CZ  1 
ATOM   3794  N  N   . ALA B  1 185 ? 121.840 193.425 165.602 1.00 38.70  ? 206 ALA B N   1 
ATOM   3795  C  CA  . ALA B  1 185 ? 121.971 194.666 166.412 1.00 40.71  ? 206 ALA B CA  1 
ATOM   3796  C  C   . ALA B  1 185 ? 122.984 194.451 167.541 1.00 40.18  ? 206 ALA B C   1 
ATOM   3797  O  O   . ALA B  1 185 ? 123.928 195.247 167.704 1.00 41.18  ? 206 ALA B O   1 
ATOM   3798  C  CB  . ALA B  1 185 ? 120.641 195.072 166.981 1.00 42.21  ? 206 ALA B CB  1 
ATOM   3799  N  N   . ARG B  1 186 ? 122.802 193.389 168.310 1.00 39.17  ? 207 ARG B N   1 
ATOM   3800  C  CA  . ARG B  1 186 ? 123.728 193.043 169.422 1.00 38.86  ? 207 ARG B CA  1 
ATOM   3801  C  C   . ARG B  1 186 ? 125.161 192.962 168.863 1.00 38.76  ? 207 ARG B C   1 
ATOM   3802  O  O   . ARG B  1 186 ? 126.102 193.519 169.510 1.00 38.94  ? 207 ARG B O   1 
ATOM   3803  C  CB  . ARG B  1 186 ? 123.308 191.726 170.069 1.00 37.00  ? 207 ARG B CB  1 
ATOM   3804  C  CG  . ARG B  1 186 ? 121.926 191.767 170.700 1.00 37.44  ? 207 ARG B CG  1 
ATOM   3805  C  CD  . ARG B  1 186 ? 121.815 192.704 171.896 1.00 39.04  ? 207 ARG B CD  1 
ATOM   3806  N  NE  . ARG B  1 186 ? 121.473 194.068 171.508 1.00 40.88  ? 207 ARG B NE  1 
ATOM   3807  C  CZ  . ARG B  1 186 ? 120.242 194.498 171.233 1.00 41.47  ? 207 ARG B CZ  1 
ATOM   3808  N  NH1 . ARG B  1 186 ? 119.207 193.677 171.313 1.00 40.52  ? 207 ARG B NH1 1 
ATOM   3809  N  NH2 . ARG B  1 186 ? 120.043 195.763 170.902 1.00 42.75  ? 207 ARG B NH2 1 
ATOM   3810  N  N   . ILE B  1 187 ? 125.328 192.322 167.702 1.00 37.49  ? 208 ILE B N   1 
ATOM   3811  C  CA  . ILE B  1 187 ? 126.680 192.118 167.101 1.00 37.37  ? 208 ILE B CA  1 
ATOM   3812  C  C   . ILE B  1 187 ? 127.307 193.468 166.708 1.00 38.88  ? 208 ILE B C   1 
ATOM   3813  O  O   . ILE B  1 187 ? 128.476 193.650 167.000 1.00 38.97  ? 208 ILE B O   1 
ATOM   3814  C  CB  . ILE B  1 187 ? 126.611 191.138 165.923 1.00 35.45  ? 208 ILE B CB  1 
ATOM   3815  C  CG1 . ILE B  1 187 ? 126.363 189.722 166.436 1.00 34.39  ? 208 ILE B CG1 1 
ATOM   3816  C  CG2 . ILE B  1 187 ? 127.872 191.222 165.075 1.00 35.20  ? 208 ILE B CG2 1 
ATOM   3817  C  CD1 . ILE B  1 187 ? 125.992 188.680 165.368 1.00 33.09  ? 208 ILE B CD1 1 
ATOM   3818  N  N   . MET B  1 188 ? 126.574 194.347 166.031 1.00 40.32  ? 209 MET B N   1 
ATOM   3819  C  CA  . MET B  1 188 ? 127.129 195.592 165.431 1.00 42.69  ? 209 MET B CA  1 
ATOM   3820  C  C   . MET B  1 188 ? 127.388 196.617 166.537 1.00 45.00  ? 209 MET B C   1 
ATOM   3821  O  O   . MET B  1 188 ? 128.430 197.285 166.497 1.00 45.60  ? 209 MET B O   1 
ATOM   3822  C  CB  . MET B  1 188 ? 126.140 196.148 164.409 1.00 43.87  ? 209 MET B CB  1 
ATOM   3823  C  CG  . MET B  1 188 ? 125.870 195.136 163.300 1.00 42.54  ? 209 MET B CG  1 
ATOM   3824  S  SD  . MET B  1 188 ? 127.385 194.688 162.416 1.00 42.77  ? 209 MET B SD  1 
ATOM   3825  C  CE  . MET B  1 188 ? 127.858 196.291 161.766 1.00 44.06  ? 209 MET B CE  1 
ATOM   3826  N  N   . GLU B  1 189 ? 126.498 196.649 167.536 1.00 45.82  ? 210 GLU B N   1 
ATOM   3827  C  CA  . GLU B  1 189 ? 126.643 197.423 168.803 1.00 47.88  ? 210 GLU B CA  1 
ATOM   3828  C  C   . GLU B  1 189 ? 127.985 197.125 169.482 1.00 46.92  ? 210 GLU B C   1 
ATOM   3829  O  O   . GLU B  1 189 ? 128.578 198.081 169.988 1.00 47.72  ? 210 GLU B O   1 
ATOM   3830  C  CB  . GLU B  1 189 ? 125.529 197.057 169.798 1.00 48.54  ? 210 GLU B CB  1 
ATOM   3831  C  CG  . GLU B  1 189 ? 124.229 197.781 169.527 1.00 49.66  ? 210 GLU B CG  1 
ATOM   3832  C  CD  . GLU B  1 189 ? 123.046 197.364 170.390 1.00 49.53  ? 210 GLU B CD  1 
ATOM   3833  O  OE1 . GLU B  1 189 ? 123.173 196.425 171.229 1.00 48.15  ? 210 GLU B OE1 1 
ATOM   3834  O  OE2 . GLU B  1 189 ? 121.983 198.001 170.205 1.00 51.16  ? 210 GLU B OE2 1 
ATOM   3835  N  N   . GLY B  1 190 ? 128.411 195.850 169.532 1.00 44.14  ? 211 GLY B N   1 
ATOM   3836  C  CA  . GLY B  1 190 ? 129.629 195.425 170.263 1.00 44.23  ? 211 GLY B CA  1 
ATOM   3837  C  C   . GLY B  1 190 ? 130.918 195.613 169.474 1.00 44.48  ? 211 GLY B C   1 
ATOM   3838  O  O   . GLY B  1 190 ? 131.984 195.259 170.023 1.00 45.20  ? 211 GLY B O   1 
ATOM   3839  N  N   . GLY B  1 191 ? 130.832 196.088 168.223 1.00 44.22  ? 212 GLY B N   1 
ATOM   3840  C  CA  . GLY B  1 191 ? 131.974 196.233 167.297 1.00 44.81  ? 212 GLY B CA  1 
ATOM   3841  C  C   . GLY B  1 191 ? 132.630 194.905 166.973 1.00 43.03  ? 212 GLY B C   1 
ATOM   3842  O  O   . GLY B  1 191 ? 133.833 194.914 166.716 1.00 43.43  ? 212 GLY B O   1 
ATOM   3843  N  N   . TYR B  1 192 ? 131.899 193.786 167.014 1.00 41.43  ? 213 TYR B N   1 
ATOM   3844  C  CA  . TYR B  1 192 ? 132.464 192.461 166.650 1.00 40.18  ? 213 TYR B CA  1 
ATOM   3845  C  C   . TYR B  1 192 ? 132.501 192.294 165.123 1.00 39.57  ? 213 TYR B C   1 
ATOM   3846  O  O   . TYR B  1 192 ? 133.231 191.383 164.681 1.00 38.37  ? 213 TYR B O   1 
ATOM   3847  C  CB  . TYR B  1 192 ? 131.729 191.306 167.333 1.00 39.21  ? 213 TYR B CB  1 
ATOM   3848  C  CG  . TYR B  1 192 ? 131.604 191.492 168.826 1.00 40.39  ? 213 TYR B CG  1 
ATOM   3849  C  CD1 . TYR B  1 192 ? 132.713 191.576 169.659 1.00 41.48  ? 213 TYR B CD1 1 
ATOM   3850  C  CD2 . TYR B  1 192 ? 130.359 191.620 169.408 1.00 40.43  ? 213 TYR B CD2 1 
ATOM   3851  C  CE1 . TYR B  1 192 ? 132.585 191.766 171.034 1.00 42.71  ? 213 TYR B CE1 1 
ATOM   3852  C  CE2 . TYR B  1 192 ? 130.216 191.805 170.777 1.00 41.91  ? 213 TYR B CE2 1 
ATOM   3853  C  CZ  . TYR B  1 192 ? 131.325 191.895 171.602 1.00 42.64  ? 213 TYR B CZ  1 
ATOM   3854  O  OH  . TYR B  1 192 ? 131.107 192.108 172.943 1.00 43.39  ? 213 TYR B OH  1 
ATOM   3855  N  N   . ALA B  1 193 ? 131.789 193.124 164.338 1.00 39.59  ? 214 ALA B N   1 
ATOM   3856  C  CA  . ALA B  1 193 ? 131.741 192.975 162.860 1.00 38.83  ? 214 ALA B CA  1 
ATOM   3857  C  C   . ALA B  1 193 ? 132.165 194.271 162.198 1.00 40.39  ? 214 ALA B C   1 
ATOM   3858  O  O   . ALA B  1 193 ? 131.793 195.363 162.651 1.00 41.29  ? 214 ALA B O   1 
ATOM   3859  C  CB  . ALA B  1 193 ? 130.377 192.510 162.371 1.00 37.84  ? 214 ALA B CB  1 
ATOM   3860  N  N   . ARG B  1 194 ? 133.038 194.156 161.213 1.00 40.36  ? 215 ARG B N   1 
ATOM   3861  C  CA  . ARG B  1 194 ? 133.362 195.350 160.423 1.00 41.50  ? 215 ARG B CA  1 
ATOM   3862  C  C   . ARG B  1 194 ? 132.249 195.455 159.386 1.00 41.04  ? 215 ARG B C   1 
ATOM   3863  O  O   . ARG B  1 194 ? 131.398 196.308 159.582 1.00 42.84  ? 215 ARG B O   1 
ATOM   3864  C  CB  . ARG B  1 194 ? 134.775 195.348 159.847 1.00 42.25  ? 215 ARG B CB  1 
ATOM   3865  C  CG  . ARG B  1 194 ? 135.027 196.550 158.934 1.00 43.84  ? 215 ARG B CG  1 
ATOM   3866  C  CD  . ARG B  1 194 ? 136.385 196.507 158.289 1.00 44.12  ? 215 ARG B CD  1 
ATOM   3867  N  NE  . ARG B  1 194 ? 136.388 195.397 157.358 1.00 42.40  ? 215 ARG B NE  1 
ATOM   3868  C  CZ  . ARG B  1 194 ? 137.410 195.073 156.571 1.00 42.64  ? 215 ARG B CZ  1 
ATOM   3869  N  NH1 . ARG B  1 194 ? 137.309 194.025 155.759 1.00 41.37  ? 215 ARG B NH1 1 
ATOM   3870  N  NH2 . ARG B  1 194 ? 138.539 195.764 156.624 1.00 43.84  ? 215 ARG B NH2 1 
ATOM   3871  N  N   . ARG B  1 195 ? 132.258 194.647 158.330 1.00 39.61  ? 216 ARG B N   1 
ATOM   3872  C  CA  . ARG B  1 195 ? 131.217 194.714 157.267 1.00 39.47  ? 216 ARG B CA  1 
ATOM   3873  C  C   . ARG B  1 195 ? 130.169 193.659 157.652 1.00 37.19  ? 216 ARG B C   1 
ATOM   3874  O  O   . ARG B  1 195 ? 130.571 192.660 158.231 1.00 35.35  ? 216 ARG B O   1 
ATOM   3875  C  CB  . ARG B  1 195 ? 131.771 194.445 155.866 1.00 39.43  ? 216 ARG B CB  1 
ATOM   3876  C  CG  . ARG B  1 195 ? 132.844 195.427 155.400 1.00 42.42  ? 216 ARG B CG  1 
ATOM   3877  C  CD  . ARG B  1 195 ? 133.494 195.035 154.076 1.00 42.57  ? 216 ARG B CD  1 
ATOM   3878  N  NE  . ARG B  1 195 ? 132.503 195.069 153.018 1.00 43.40  ? 216 ARG B NE  1 
ATOM   3879  C  CZ  . ARG B  1 195 ? 132.686 194.695 151.751 1.00 44.10  ? 216 ARG B CZ  1 
ATOM   3880  N  NH1 . ARG B  1 195 ? 131.670 194.766 150.909 1.00 45.10  ? 216 ARG B NH1 1 
ATOM   3881  N  NH2 . ARG B  1 195 ? 133.848 194.250 151.314 1.00 43.32  ? 216 ARG B NH2 1 
ATOM   3882  N  N   . LEU B  1 196 ? 128.893 193.939 157.404 1.00 37.08  ? 217 LEU B N   1 
ATOM   3883  C  CA  . LEU B  1 196 ? 127.787 192.978 157.524 1.00 36.67  ? 217 LEU B CA  1 
ATOM   3884  C  C   . LEU B  1 196 ? 127.069 192.985 156.188 1.00 36.44  ? 217 LEU B C   1 
ATOM   3885  O  O   . LEU B  1 196 ? 126.434 194.003 155.905 1.00 37.70  ? 217 LEU B O   1 
ATOM   3886  C  CB  . LEU B  1 196 ? 126.859 193.357 158.696 1.00 37.22  ? 217 LEU B CB  1 
ATOM   3887  C  CG  . LEU B  1 196 ? 125.604 192.499 158.838 1.00 36.45  ? 217 LEU B CG  1 
ATOM   3888  C  CD1 . LEU B  1 196 ? 125.985 191.037 158.993 1.00 35.39  ? 217 LEU B CD1 1 
ATOM   3889  C  CD2 . LEU B  1 196 ? 124.755 192.917 160.023 1.00 37.47  ? 217 LEU B CD2 1 
ATOM   3890  N  N   . LEU B  1 197 ? 127.256 191.934 155.387 1.00 35.51  ? 218 LEU B N   1 
ATOM   3891  C  CA  . LEU B  1 197 ? 126.458 191.712 154.145 1.00 36.18  ? 218 LEU B CA  1 
ATOM   3892  C  C   . LEU B  1 197 ? 125.288 190.792 154.464 1.00 35.09  ? 218 LEU B C   1 
ATOM   3893  O  O   . LEU B  1 197 ? 125.536 189.634 154.872 1.00 35.02  ? 218 LEU B O   1 
ATOM   3894  C  CB  . LEU B  1 197 ? 127.262 191.096 153.006 1.00 35.87  ? 218 LEU B CB  1 
ATOM   3895  C  CG  . LEU B  1 197 ? 128.152 192.072 152.283 1.00 36.95  ? 218 LEU B CG  1 
ATOM   3896  C  CD1 . LEU B  1 197 ? 129.135 192.670 153.274 1.00 37.97  ? 218 LEU B CD1 1 
ATOM   3897  C  CD2 . LEU B  1 197 ? 128.876 191.393 151.154 1.00 36.64  ? 218 LEU B CD2 1 
ATOM   3898  N  N   . GLN B  1 198 ? 124.071 191.335 154.331 1.00 35.24  ? 219 GLN B N   1 
ATOM   3899  C  CA  . GLN B  1 198 ? 122.797 190.598 154.498 1.00 33.75  ? 219 GLN B CA  1 
ATOM   3900  C  C   . GLN B  1 198 ? 122.256 190.264 153.108 1.00 33.81  ? 219 GLN B C   1 
ATOM   3901  O  O   . GLN B  1 198 ? 122.069 191.194 152.240 1.00 35.30  ? 219 GLN B O   1 
ATOM   3902  C  CB  . GLN B  1 198 ? 121.874 191.466 155.345 1.00 34.51  ? 219 GLN B CB  1 
ATOM   3903  C  CG  . GLN B  1 198 ? 122.498 191.902 156.654 1.00 34.47  ? 219 GLN B CG  1 
ATOM   3904  C  CD  . GLN B  1 198 ? 121.453 192.469 157.599 1.00 35.56  ? 219 GLN B CD  1 
ATOM   3905  O  OE1 . GLN B  1 198 ? 120.808 193.483 157.289 1.00 36.99  ? 219 GLN B OE1 1 
ATOM   3906  N  NE2 . GLN B  1 198 ? 121.254 191.804 158.738 1.00 34.10  ? 219 GLN B NE2 1 
ATOM   3907  N  N   . VAL B  1 199 ? 122.133 188.985 152.819 1.00 32.51  ? 220 VAL B N   1 
ATOM   3908  C  CA  . VAL B  1 199 ? 121.810 188.516 151.443 1.00 32.66  ? 220 VAL B CA  1 
ATOM   3909  C  C   . VAL B  1 199 ? 120.585 187.622 151.527 1.00 32.07  ? 220 VAL B C   1 
ATOM   3910  O  O   . VAL B  1 199 ? 120.562 186.718 152.321 1.00 31.91  ? 220 VAL B O   1 
ATOM   3911  C  CB  . VAL B  1 199 ? 123.010 187.793 150.816 1.00 31.91  ? 220 VAL B CB  1 
ATOM   3912  C  CG1 . VAL B  1 199 ? 122.636 187.196 149.466 1.00 32.33  ? 220 VAL B CG1 1 
ATOM   3913  C  CG2 . VAL B  1 199 ? 124.202 188.746 150.686 1.00 32.93  ? 220 VAL B CG2 1 
ATOM   3914  N  N   . GLY B  1 200 ? 119.605 187.887 150.705 1.00 33.70  ? 221 GLY B N   1 
ATOM   3915  C  CA  . GLY B  1 200 ? 118.350 187.121 150.634 1.00 34.07  ? 221 GLY B CA  1 
ATOM   3916  C  C   . GLY B  1 200 ? 117.200 187.870 151.264 1.00 34.80  ? 221 GLY B C   1 
ATOM   3917  O  O   . GLY B  1 200 ? 116.128 187.259 151.422 1.00 35.04  ? 221 GLY B O   1 
ATOM   3918  N  N   . ILE B  1 201 ? 117.433 189.104 151.695 1.00 35.71  ? 222 ILE B N   1 
ATOM   3919  C  CA  . ILE B  1 201 ? 116.460 189.908 152.511 1.00 36.80  ? 222 ILE B CA  1 
ATOM   3920  C  C   . ILE B  1 201 ? 115.191 190.114 151.675 1.00 37.33  ? 222 ILE B C   1 
ATOM   3921  O  O   . ILE B  1 201 ? 115.297 190.581 150.536 1.00 37.65  ? 222 ILE B O   1 
ATOM   3922  C  CB  . ILE B  1 201 ? 117.047 191.273 152.957 1.00 38.42  ? 222 ILE B CB  1 
ATOM   3923  C  CG1 . ILE B  1 201 ? 118.313 191.131 153.806 1.00 37.31  ? 222 ILE B CG1 1 
ATOM   3924  C  CG2 . ILE B  1 201 ? 116.003 192.102 153.692 1.00 39.97  ? 222 ILE B CG2 1 
ATOM   3925  C  CD1 . ILE B  1 201 ? 118.070 190.594 155.170 1.00 36.66  ? 222 ILE B CD1 1 
ATOM   3926  N  N   . ARG B  1 202 ? 114.031 189.771 152.222 1.00 36.98  ? 223 ARG B N   1 
ATOM   3927  C  CA  . ARG B  1 202 ? 112.742 190.071 151.550 1.00 38.39  ? 223 ARG B CA  1 
ATOM   3928  C  C   . ARG B  1 202 ? 111.617 190.326 152.568 1.00 38.73  ? 223 ARG B C   1 
ATOM   3929  O  O   . ARG B  1 202 ? 110.465 190.344 152.171 1.00 39.11  ? 223 ARG B O   1 
ATOM   3930  C  CB  . ARG B  1 202 ? 112.432 188.896 150.630 1.00 38.07  ? 223 ARG B CB  1 
ATOM   3931  C  CG  . ARG B  1 202 ? 112.563 187.553 151.332 1.00 36.36  ? 223 ARG B CG  1 
ATOM   3932  C  CD  . ARG B  1 202 ? 112.366 186.477 150.305 1.00 36.02  ? 223 ARG B CD  1 
ATOM   3933  N  NE  . ARG B  1 202 ? 112.215 185.173 150.886 1.00 34.44  ? 223 ARG B NE  1 
ATOM   3934  C  CZ  . ARG B  1 202 ? 113.193 184.407 151.326 1.00 33.02  ? 223 ARG B CZ  1 
ATOM   3935  N  NH1 . ARG B  1 202 ? 114.457 184.798 151.307 1.00 32.78  ? 223 ARG B NH1 1 
ATOM   3936  N  NH2 . ARG B  1 202 ? 112.893 183.223 151.797 1.00 31.72  ? 223 ARG B NH2 1 
ATOM   3937  N  N   . SER B  1 203 ? 111.959 190.504 153.833 1.00 38.37  ? 224 SER B N   1 
ATOM   3938  C  CA  . SER B  1 203 ? 111.021 190.818 154.924 1.00 40.00  ? 224 SER B CA  1 
ATOM   3939  C  C   . SER B  1 203 ? 111.761 191.795 155.835 1.00 40.94  ? 224 SER B C   1 
ATOM   3940  O  O   . SER B  1 203 ? 112.592 191.375 156.645 1.00 39.21  ? 224 SER B O   1 
ATOM   3941  C  CB  . SER B  1 203 ? 110.541 189.584 155.642 1.00 39.09  ? 224 SER B CB  1 
ATOM   3942  O  OG  . SER B  1 203 ? 109.664 189.888 156.727 1.00 40.01  ? 224 SER B OG  1 
ATOM   3943  N  N   . ILE B  1 204 ? 111.467 193.072 155.664 1.00 44.00  ? 225 ILE B N   1 
ATOM   3944  C  CA  . ILE B  1 204 ? 112.209 194.172 156.336 1.00 45.82  ? 225 ILE B CA  1 
ATOM   3945  C  C   . ILE B  1 204 ? 111.257 195.361 156.447 1.00 48.88  ? 225 ILE B C   1 
ATOM   3946  O  O   . ILE B  1 204 ? 110.436 195.528 155.552 1.00 50.11  ? 225 ILE B O   1 
ATOM   3947  C  CB  . ILE B  1 204 ? 113.490 194.498 155.538 1.00 45.22  ? 225 ILE B CB  1 
ATOM   3948  C  CG1 . ILE B  1 204 ? 114.276 195.642 156.183 1.00 45.93  ? 225 ILE B CG1 1 
ATOM   3949  C  CG2 . ILE B  1 204 ? 113.162 194.769 154.070 1.00 46.65  ? 225 ILE B CG2 1 
ATOM   3950  C  CD1 . ILE B  1 204 ? 115.689 195.799 155.660 1.00 44.99  ? 225 ILE B CD1 1 
ATOM   3951  N  N   . ASN B  1 205 ? 111.352 196.081 157.564 1.00 50.85  ? 226 ASN B N   1 
ATOM   3952  C  CA  . ASN B  1 205 ? 110.474 197.235 157.892 1.00 54.56  ? 226 ASN B CA  1 
ATOM   3953  C  C   . ASN B  1 205 ? 111.339 198.487 158.074 1.00 57.10  ? 226 ASN B C   1 
ATOM   3954  O  O   . ASN B  1 205 ? 112.572 198.360 158.057 1.00 56.85  ? 226 ASN B O   1 
ATOM   3955  C  CB  . ASN B  1 205 ? 109.501 196.921 159.032 1.00 54.14  ? 226 ASN B CB  1 
ATOM   3956  C  CG  . ASN B  1 205 ? 110.152 196.876 160.394 1.00 52.52  ? 226 ASN B CG  1 
ATOM   3957  O  OD1 . ASN B  1 205 ? 111.368 196.931 160.508 1.00 51.29  ? 226 ASN B OD1 1 
ATOM   3958  N  ND2 . ASN B  1 205 ? 109.345 196.785 161.433 1.00 53.36  ? 226 ASN B ND2 1 
ATOM   3959  N  N   . GLN B  1 206 ? 110.711 199.653 158.229 1.00 62.16  ? 227 GLN B N   1 
ATOM   3960  C  CA  . GLN B  1 206 ? 111.498 200.915 158.253 1.00 64.81  ? 227 GLN B CA  1 
ATOM   3961  C  C   . GLN B  1 206 ? 112.618 200.758 159.304 1.00 61.62  ? 227 GLN B C   1 
ATOM   3962  O  O   . GLN B  1 206 ? 113.728 201.156 158.997 1.00 62.22  ? 227 GLN B O   1 
ATOM   3963  C  CB  . GLN B  1 206 ? 110.566 202.132 158.381 1.00 69.77  ? 227 GLN B CB  1 
ATOM   3964  C  CG  . GLN B  1 206 ? 111.040 203.415 157.660 1.00 74.58  ? 227 GLN B CG  1 
ATOM   3965  C  CD  . GLN B  1 206 ? 111.970 203.221 156.469 1.00 75.06  ? 227 GLN B CD  1 
ATOM   3966  O  OE1 . GLN B  1 206 ? 111.988 202.175 155.829 1.00 75.84  ? 227 GLN B OE1 1 
ATOM   3967  N  NE2 . GLN B  1 206 ? 112.785 204.219 156.155 1.00 75.64  ? 227 GLN B NE2 1 
ATOM   3968  N  N   . GLU B  1 207 ? 112.365 200.163 160.469 1.00 59.52  ? 228 GLU B N   1 
ATOM   3969  C  CA  . GLU B  1 207 ? 113.389 200.021 161.547 1.00 58.95  ? 228 GLU B CA  1 
ATOM   3970  C  C   . GLU B  1 207 ? 114.523 199.109 161.052 1.00 56.02  ? 228 GLU B C   1 
ATOM   3971  O  O   . GLU B  1 207 ? 115.690 199.341 161.414 1.00 54.73  ? 228 GLU B O   1 
ATOM   3972  C  CB  . GLU B  1 207 ? 112.794 199.457 162.857 1.00 58.41  ? 228 GLU B CB  1 
ATOM   3973  C  CG  . GLU B  1 207 ? 113.803 199.332 164.014 1.00 57.52  ? 228 GLU B CG  1 
ATOM   3974  C  CD  . GLU B  1 207 ? 113.279 198.681 165.331 1.00 57.54  ? 228 GLU B CD  1 
ATOM   3975  O  OE1 . GLU B  1 207 ? 112.016 198.568 165.495 1.00 56.63  ? 228 GLU B OE1 1 
ATOM   3976  O  OE2 . GLU B  1 207 ? 114.135 198.277 166.198 1.00 55.49  ? 228 GLU B OE2 1 
ATOM   3977  N  N   . GLY B  1 208 ? 114.165 198.058 160.318 1.00 54.10  ? 229 GLY B N   1 
ATOM   3978  C  CA  . GLY B  1 208 ? 115.141 197.209 159.625 1.00 51.82  ? 229 GLY B CA  1 
ATOM   3979  C  C   . GLY B  1 208 ? 116.075 198.085 158.826 1.00 51.76  ? 229 GLY B C   1 
ATOM   3980  O  O   . GLY B  1 208 ? 117.290 198.003 159.052 1.00 49.69  ? 229 GLY B O   1 
ATOM   3981  N  N   . ARG B  1 209 ? 115.518 198.948 157.980 1.00 53.51  ? 230 ARG B N   1 
ATOM   3982  C  CA  . ARG B  1 209 ? 116.324 199.788 157.045 1.00 55.46  ? 230 ARG B CA  1 
ATOM   3983  C  C   . ARG B  1 209 ? 117.086 200.891 157.809 1.00 56.61  ? 230 ARG B C   1 
ATOM   3984  O  O   . ARG B  1 209 ? 118.262 201.101 157.490 1.00 57.07  ? 230 ARG B O   1 
ATOM   3985  C  CB  . ARG B  1 209 ? 115.430 200.373 155.950 1.00 57.60  ? 230 ARG B CB  1 
ATOM   3986  C  CG  . ARG B  1 209 ? 114.575 199.342 155.224 1.00 56.91  ? 230 ARG B CG  1 
ATOM   3987  C  CD  . ARG B  1 209 ? 113.688 200.070 154.232 1.00 59.20  ? 230 ARG B CD  1 
ATOM   3988  N  NE  . ARG B  1 209 ? 112.828 199.139 153.519 1.00 58.58  ? 230 ARG B NE  1 
ATOM   3989  C  CZ  . ARG B  1 209 ? 113.200 198.465 152.440 1.00 57.42  ? 230 ARG B CZ  1 
ATOM   3990  N  NH1 . ARG B  1 209 ? 112.370 197.615 151.847 1.00 57.40  ? 230 ARG B NH1 1 
ATOM   3991  N  NH2 . ARG B  1 209 ? 114.411 198.651 151.953 1.00 57.28  ? 230 ARG B NH2 1 
ATOM   3992  N  N   . GLU B  1 210 ? 116.438 201.523 158.791 1.00 59.50  ? 231 GLU B N   1 
ATOM   3993  C  CA  . GLU B  1 210 ? 117.055 202.602 159.612 1.00 61.66  ? 231 GLU B CA  1 
ATOM   3994  C  C   . GLU B  1 210 ? 118.236 202.037 160.399 1.00 59.11  ? 231 GLU B C   1 
ATOM   3995  O  O   . GLU B  1 210 ? 119.254 202.725 160.496 1.00 59.60  ? 231 GLU B O   1 
ATOM   3996  C  CB  . GLU B  1 210 ? 116.043 203.191 160.596 1.00 63.96  ? 231 GLU B CB  1 
ATOM   3997  C  CG  . GLU B  1 210 ? 114.907 203.960 159.947 1.00 67.11  ? 231 GLU B CG  1 
ATOM   3998  C  CD  . GLU B  1 210 ? 113.698 204.183 160.842 1.00 69.37  ? 231 GLU B CD  1 
ATOM   3999  O  OE1 . GLU B  1 210 ? 113.610 203.527 161.900 1.00 67.73  ? 231 GLU B OE1 1 
ATOM   4000  O  OE2 . GLU B  1 210 ? 112.844 205.009 160.480 1.00 72.28  ? 231 GLU B OE2 1 
ATOM   4001  N  N   . GLN B  1 211 ? 118.084 200.830 160.946 1.00 56.26  ? 232 GLN B N   1 
ATOM   4002  C  CA  . GLN B  1 211 ? 119.156 200.169 161.737 1.00 54.39  ? 232 GLN B CA  1 
ATOM   4003  C  C   . GLN B  1 211 ? 120.278 199.724 160.768 1.00 52.91  ? 232 GLN B C   1 
ATOM   4004  O  O   . GLN B  1 211 ? 121.461 199.811 161.133 1.00 52.74  ? 232 GLN B O   1 
ATOM   4005  C  CB  . GLN B  1 211 ? 118.579 199.015 162.555 1.00 52.72  ? 232 GLN B CB  1 
ATOM   4006  C  CG  . GLN B  1 211 ? 117.742 199.455 163.749 1.00 54.54  ? 232 GLN B CG  1 
ATOM   4007  C  CD  . GLN B  1 211 ? 118.577 199.580 164.996 1.00 54.02  ? 232 GLN B CD  1 
ATOM   4008  O  OE1 . GLN B  1 211 ? 119.142 200.619 165.259 1.00 56.53  ? 232 GLN B OE1 1 
ATOM   4009  N  NE2 . GLN B  1 211 ? 118.699 198.511 165.761 1.00 51.91  ? 232 GLN B NE2 1 
ATOM   4010  N  N   . GLY B  1 212 ? 119.900 199.240 159.579 1.00 52.22  ? 233 GLY B N   1 
ATOM   4011  C  CA  . GLY B  1 212 ? 120.816 198.964 158.451 1.00 51.18  ? 233 GLY B CA  1 
ATOM   4012  C  C   . GLY B  1 212 ? 121.683 200.174 158.193 1.00 52.48  ? 233 GLY B C   1 
ATOM   4013  O  O   . GLY B  1 212 ? 122.880 200.063 158.404 1.00 50.68  ? 233 GLY B O   1 
ATOM   4014  N  N   . LYS B  1 213 ? 121.055 201.321 157.932 1.00 55.31  ? 234 LYS B N   1 
ATOM   4015  C  CA  . LYS B  1 213 ? 121.749 202.607 157.601 1.00 59.13  ? 234 LYS B CA  1 
ATOM   4016  C  C   . LYS B  1 213 ? 122.694 203.040 158.772 1.00 58.62  ? 234 LYS B C   1 
ATOM   4017  O  O   . LYS B  1 213 ? 123.893 203.516 158.512 1.00 58.33  ? 234 LYS B O   1 
ATOM   4018  C  CB  . LYS B  1 213 ? 120.686 203.615 157.157 1.00 63.06  ? 234 LYS B CB  1 
ATOM   4019  C  CG  . LYS B  1 213 ? 121.208 204.994 156.843 1.00 68.55  ? 234 LYS B CG  1 
ATOM   4020  C  CD  . LYS B  1 213 ? 120.150 206.099 156.828 1.00 73.54  ? 234 LYS B CD  1 
ATOM   4021  C  CE  . LYS B  1 213 ? 119.415 206.218 155.504 1.00 76.03  ? 234 LYS B CE  1 
ATOM   4022  N  NZ  . LYS B  1 213 ? 119.500 207.581 154.912 1.00 78.52  ? 234 LYS B NZ  1 
ATOM   4023  N  N   . ARG B  1 214 ? 122.180 202.945 160.036 1.00 58.87  ? 235 ARG B N   1 
ATOM   4024  C  CA  . ARG B  1 214 ? 122.917 203.282 161.292 1.00 58.91  ? 235 ARG B CA  1 
ATOM   4025  C  C   . ARG B  1 214 ? 124.216 202.477 161.414 1.00 56.53  ? 235 ARG B C   1 
ATOM   4026  O  O   . ARG B  1 214 ? 125.221 203.047 161.761 1.00 56.50  ? 235 ARG B O   1 
ATOM   4027  C  CB  . ARG B  1 214 ? 122.019 203.007 162.504 1.00 59.82  ? 235 ARG B CB  1 
ATOM   4028  C  CG  . ARG B  1 214 ? 122.661 203.256 163.865 1.00 60.95  ? 235 ARG B CG  1 
ATOM   4029  C  CD  . ARG B  1 214 ? 121.754 202.773 165.007 1.00 60.98  ? 235 ARG B CD  1 
ATOM   4030  N  NE  . ARG B  1 214 ? 122.407 202.880 166.320 1.00 61.70  ? 235 ARG B NE  1 
ATOM   4031  C  CZ  . ARG B  1 214 ? 122.137 202.137 167.395 1.00 60.51  ? 235 ARG B CZ  1 
ATOM   4032  N  NH1 . ARG B  1 214 ? 121.198 201.216 167.349 1.00 59.75  ? 235 ARG B NH1 1 
ATOM   4033  N  NH2 . ARG B  1 214 ? 122.821 202.298 168.512 1.00 60.68  ? 235 ARG B NH2 1 
ATOM   4034  N  N   . PHE B  1 215 ? 124.221 201.172 161.162 1.00 53.68  ? 236 PHE B N   1 
ATOM   4035  C  CA  . PHE B  1 215 ? 125.420 200.353 161.469 1.00 52.43  ? 236 PHE B CA  1 
ATOM   4036  C  C   . PHE B  1 215 ? 126.302 200.137 160.225 1.00 52.16  ? 236 PHE B C   1 
ATOM   4037  O  O   . PHE B  1 215 ? 127.283 199.376 160.347 1.00 52.13  ? 236 PHE B O   1 
ATOM   4038  C  CB  . PHE B  1 215 ? 124.967 199.044 162.093 1.00 50.06  ? 236 PHE B CB  1 
ATOM   4039  C  CG  . PHE B  1 215 ? 124.379 199.129 163.485 1.00 50.68  ? 236 PHE B CG  1 
ATOM   4040  C  CD1 . PHE B  1 215 ? 125.115 199.630 164.549 1.00 52.16  ? 236 PHE B CD1 1 
ATOM   4041  C  CD2 . PHE B  1 215 ? 123.124 198.606 163.759 1.00 49.57  ? 236 PHE B CD2 1 
ATOM   4042  C  CE1 . PHE B  1 215 ? 124.594 199.633 165.840 1.00 52.94  ? 236 PHE B CE1 1 
ATOM   4043  C  CE2 . PHE B  1 215 ? 122.598 198.623 165.048 1.00 50.35  ? 236 PHE B CE2 1 
ATOM   4044  C  CZ  . PHE B  1 215 ? 123.335 199.123 166.092 1.00 51.48  ? 236 PHE B CZ  1 
ATOM   4045  N  N   . GLY B  1 216 ? 125.994 200.786 159.091 1.00 52.63  ? 237 GLY B N   1 
ATOM   4046  C  CA  . GLY B  1 216 ? 126.721 200.657 157.808 1.00 51.94  ? 237 GLY B CA  1 
ATOM   4047  C  C   . GLY B  1 216 ? 126.508 199.293 157.151 1.00 49.92  ? 237 GLY B C   1 
ATOM   4048  O  O   . GLY B  1 216 ? 127.380 198.868 156.374 1.00 50.69  ? 237 GLY B O   1 
ATOM   4049  N  N   . VAL B  1 217 ? 125.351 198.661 157.368 1.00 47.59  ? 238 VAL B N   1 
ATOM   4050  C  CA  . VAL B  1 217 ? 125.045 197.274 156.919 1.00 45.68  ? 238 VAL B CA  1 
ATOM   4051  C  C   . VAL B  1 217 ? 124.817 197.268 155.405 1.00 44.91  ? 238 VAL B C   1 
ATOM   4052  O  O   . VAL B  1 217 ? 124.219 198.207 154.904 1.00 48.80  ? 238 VAL B O   1 
ATOM   4053  C  CB  . VAL B  1 217 ? 123.855 196.693 157.708 1.00 44.72  ? 238 VAL B CB  1 
ATOM   4054  C  CG1 . VAL B  1 217 ? 123.564 195.241 157.337 1.00 42.71  ? 238 VAL B CG1 1 
ATOM   4055  C  CG2 . VAL B  1 217 ? 124.064 196.826 159.206 1.00 44.80  ? 238 VAL B CG2 1 
ATOM   4056  N  N   . GLU B  1 218 ? 125.298 196.250 154.699 1.00 50.36  ? 239 GLU B N   1 
ATOM   4057  C  CA  . GLU B  1 218 ? 124.993 196.193 153.249 1.00 50.39  ? 239 GLU B CA  1 
ATOM   4058  C  C   . GLU B  1 218 ? 123.821 195.220 153.098 1.00 47.11  ? 239 GLU B C   1 
ATOM   4059  O  O   . GLU B  1 218 ? 124.027 194.014 153.273 1.00 45.61  ? 239 GLU B O   1 
ATOM   4060  C  CB  . GLU B  1 218 ? 126.240 195.839 152.443 1.00 51.76  ? 239 GLU B CB  1 
ATOM   4061  C  CG  . GLU B  1 218 ? 127.402 196.770 152.714 1.00 55.18  ? 239 GLU B CG  1 
ATOM   4062  C  CD  . GLU B  1 218 ? 128.754 196.224 152.299 1.00 56.29  ? 239 GLU B CD  1 
ATOM   4063  O  OE1 . GLU B  1 218 ? 128.886 195.825 151.135 1.00 57.54  ? 239 GLU B OE1 1 
ATOM   4064  O  OE2 . GLU B  1 218 ? 129.657 196.189 153.145 1.00 56.71  ? 239 GLU B OE2 1 
ATOM   4065  N  N   . GLN B  1 219 ? 122.649 195.757 152.763 1.00 46.56  ? 240 GLN B N   1 
ATOM   4066  C  CA  . GLN B  1 219 ? 121.377 195.012 152.683 1.00 44.72  ? 240 GLN B CA  1 
ATOM   4067  C  C   . GLN B  1 219 ? 121.023 194.800 151.213 1.00 45.71  ? 240 GLN B C   1 
ATOM   4068  O  O   . GLN B  1 219 ? 120.695 195.816 150.487 1.00 49.49  ? 240 GLN B O   1 
ATOM   4069  C  CB  . GLN B  1 219 ? 120.299 195.730 153.476 1.00 44.36  ? 240 GLN B CB  1 
ATOM   4070  C  CG  . GLN B  1 219 ? 120.701 195.913 154.926 1.00 44.18  ? 240 GLN B CG  1 
ATOM   4071  C  CD  . GLN B  1 219 ? 119.542 196.384 155.766 1.00 44.25  ? 240 GLN B CD  1 
ATOM   4072  O  OE1 . GLN B  1 219 ? 118.808 197.288 155.385 1.00 45.89  ? 240 GLN B OE1 1 
ATOM   4073  N  NE2 . GLN B  1 219 ? 119.375 195.773 156.930 1.00 42.93  ? 240 GLN B NE2 1 
ATOM   4074  N  N   . TYR B  1 220 ? 121.166 193.551 150.772 1.00 43.69  ? 241 TYR B N   1 
ATOM   4075  C  CA  . TYR B  1 220 ? 120.809 193.089 149.422 1.00 43.67  ? 241 TYR B CA  1 
ATOM   4076  C  C   . TYR B  1 220 ? 119.473 192.375 149.511 1.00 41.14  ? 241 TYR B C   1 
ATOM   4077  O  O   . TYR B  1 220 ? 119.383 191.228 150.050 1.00 38.44  ? 241 TYR B O   1 
ATOM   4078  C  CB  . TYR B  1 220 ? 121.881 192.169 148.857 1.00 44.53  ? 241 TYR B CB  1 
ATOM   4079  C  CG  . TYR B  1 220 ? 123.221 192.814 148.620 1.00 47.91  ? 241 TYR B CG  1 
ATOM   4080  C  CD1 . TYR B  1 220 ? 124.196 192.867 149.613 1.00 48.61  ? 241 TYR B CD1 1 
ATOM   4081  C  CD2 . TYR B  1 220 ? 123.540 193.322 147.372 1.00 50.95  ? 241 TYR B CD2 1 
ATOM   4082  C  CE1 . TYR B  1 220 ? 125.442 193.443 149.376 1.00 51.29  ? 241 TYR B CE1 1 
ATOM   4083  C  CE2 . TYR B  1 220 ? 124.782 193.887 147.118 1.00 54.28  ? 241 TYR B CE2 1 
ATOM   4084  C  CZ  . TYR B  1 220 ? 125.745 193.935 148.116 1.00 54.20  ? 241 TYR B CZ  1 
ATOM   4085  O  OH  . TYR B  1 220 ? 126.960 194.496 147.838 1.00 57.18  ? 241 TYR B OH  1 
ATOM   4086  N  N   . GLU B  1 221 ? 118.475 193.029 148.961 1.00 41.47  ? 242 GLU B N   1 
ATOM   4087  C  CA  . GLU B  1 221 ? 117.090 192.530 148.909 1.00 41.32  ? 242 GLU B CA  1 
ATOM   4088  C  C   . GLU B  1 221 ? 116.863 191.746 147.604 1.00 41.27  ? 242 GLU B C   1 
ATOM   4089  O  O   . GLU B  1 221 ? 117.445 192.051 146.552 1.00 42.59  ? 242 GLU B O   1 
ATOM   4090  C  CB  . GLU B  1 221 ? 116.122 193.716 149.058 1.00 42.89  ? 242 GLU B CB  1 
ATOM   4091  C  CG  . GLU B  1 221 ? 116.371 194.535 150.313 1.00 43.51  ? 242 GLU B CG  1 
ATOM   4092  C  CD  . GLU B  1 221 ? 115.533 195.795 150.460 1.00 45.68  ? 242 GLU B CD  1 
ATOM   4093  O  OE1 . GLU B  1 221 ? 114.283 195.737 150.360 1.00 45.57  ? 242 GLU B OE1 1 
ATOM   4094  O  OE2 . GLU B  1 221 ? 116.154 196.849 150.670 1.00 48.60  ? 242 GLU B OE2 1 
ATOM   4095  N  N   . MET B  1 222 ? 115.951 190.804 147.660 1.00 40.25  ? 243 MET B N   1 
ATOM   4096  C  CA  . MET B  1 222 ? 115.604 189.942 146.515 1.00 40.32  ? 243 MET B CA  1 
ATOM   4097  C  C   . MET B  1 222 ? 114.887 190.745 145.408 1.00 42.28  ? 243 MET B C   1 
ATOM   4098  O  O   . MET B  1 222 ? 114.997 190.348 144.246 1.00 42.99  ? 243 MET B O   1 
ATOM   4099  C  CB  . MET B  1 222 ? 114.753 188.787 147.029 1.00 38.37  ? 243 MET B CB  1 
ATOM   4100  C  CG  . MET B  1 222 ? 115.536 187.859 147.949 1.00 36.95  ? 243 MET B CG  1 
ATOM   4101  S  SD  . MET B  1 222 ? 116.896 187.000 147.090 1.00 36.91  ? 243 MET B SD  1 
ATOM   4102  C  CE  . MET B  1 222 ? 116.095 186.429 145.596 1.00 37.59  ? 243 MET B CE  1 
ATOM   4103  N  N   . ARG B  1 223 ? 114.250 191.880 145.686 1.00 43.78  ? 244 ARG B N   1 
ATOM   4104  C  CA  . ARG B  1 223 ? 113.579 192.660 144.599 1.00 46.17  ? 244 ARG B CA  1 
ATOM   4105  C  C   . ARG B  1 223 ? 114.622 193.240 143.617 1.00 47.72  ? 244 ARG B C   1 
ATOM   4106  O  O   . ARG B  1 223 ? 114.205 193.804 142.577 1.00 49.49  ? 244 ARG B O   1 
ATOM   4107  C  CB  . ARG B  1 223 ? 112.673 193.739 145.197 1.00 47.66  ? 244 ARG B CB  1 
ATOM   4108  C  CG  . ARG B  1 223 ? 113.451 194.887 145.816 1.00 49.54  ? 244 ARG B CG  1 
ATOM   4109  C  CD  . ARG B  1 223 ? 113.246 195.166 147.275 1.00 49.38  ? 244 ARG B CD  1 
ATOM   4110  N  NE  . ARG B  1 223 ? 112.604 196.436 147.494 1.00 51.86  ? 244 ARG B NE  1 
ATOM   4111  C  CZ  . ARG B  1 223 ? 113.224 197.604 147.432 1.00 56.38  ? 244 ARG B CZ  1 
ATOM   4112  N  NH1 . ARG B  1 223 ? 114.513 197.667 147.143 1.00 58.14  ? 244 ARG B NH1 1 
ATOM   4113  N  NH2 . ARG B  1 223 ? 112.553 198.731 147.596 1.00 59.41  ? 244 ARG B NH2 1 
ATOM   4114  N  N   . THR B  1 224 ? 115.923 193.112 143.917 1.00 47.16  ? 245 THR B N   1 
ATOM   4115  C  CA  . THR B  1 224 ? 117.062 193.563 143.059 1.00 48.97  ? 245 THR B CA  1 
ATOM   4116  C  C   . THR B  1 224 ? 118.064 192.416 142.823 1.00 47.81  ? 245 THR B C   1 
ATOM   4117  O  O   . THR B  1 224 ? 119.209 192.704 142.422 1.00 48.28  ? 245 THR B O   1 
ATOM   4118  C  CB  . THR B  1 224 ? 117.808 194.779 143.649 1.00 50.23  ? 245 THR B CB  1 
ATOM   4119  O  OG1 . THR B  1 224 ? 118.472 194.444 144.874 1.00 48.19  ? 245 THR B OG1 1 
ATOM   4120  C  CG2 . THR B  1 224 ? 116.898 195.970 143.859 1.00 51.76  ? 245 THR B CG2 1 
ATOM   4121  N  N   . PHE B  1 225 ? 117.659 191.157 142.985 1.00 45.76  ? 246 PHE B N   1 
ATOM   4122  C  CA  . PHE B  1 225 ? 118.624 190.033 142.870 1.00 45.22  ? 246 PHE B CA  1 
ATOM   4123  C  C   . PHE B  1 225 ? 119.139 189.869 141.427 1.00 46.71  ? 246 PHE B C   1 
ATOM   4124  O  O   . PHE B  1 225 ? 120.320 189.573 141.257 1.00 46.70  ? 246 PHE B O   1 
ATOM   4125  C  CB  . PHE B  1 225 ? 117.988 188.740 143.385 1.00 43.69  ? 246 PHE B CB  1 
ATOM   4126  C  CG  . PHE B  1 225 ? 118.977 187.614 143.516 1.00 43.11  ? 246 PHE B CG  1 
ATOM   4127  C  CD1 . PHE B  1 225 ? 120.083 187.731 144.361 1.00 42.97  ? 246 PHE B CD1 1 
ATOM   4128  C  CD2 . PHE B  1 225 ? 118.852 186.468 142.749 1.00 43.00  ? 246 PHE B CD2 1 
ATOM   4129  C  CE1 . PHE B  1 225 ? 121.000 186.695 144.492 1.00 42.34  ? 246 PHE B CE1 1 
ATOM   4130  C  CE2 . PHE B  1 225 ? 119.795 185.457 142.867 1.00 42.76  ? 246 PHE B CE2 1 
ATOM   4131  C  CZ  . PHE B  1 225 ? 120.857 185.566 143.743 1.00 41.99  ? 246 PHE B CZ  1 
ATOM   4132  N  N   . SER B  1 226 ? 118.276 190.005 140.416 1.00 48.26  ? 247 SER B N   1 
ATOM   4133  C  CA  . SER B  1 226 ? 118.643 189.984 138.976 1.00 51.45  ? 247 SER B CA  1 
ATOM   4134  C  C   . SER B  1 226 ? 119.906 190.826 138.734 1.00 53.98  ? 247 SER B C   1 
ATOM   4135  O  O   . SER B  1 226 ? 120.820 190.320 138.063 1.00 56.08  ? 247 SER B O   1 
ATOM   4136  C  CB  . SER B  1 226 ? 117.536 190.493 138.119 1.00 53.26  ? 247 SER B CB  1 
ATOM   4137  O  OG  . SER B  1 226 ? 116.337 189.787 138.401 1.00 52.78  ? 247 SER B OG  1 
ATOM   4138  N  N   . LYS B  1 227 ? 119.960 192.033 139.304 1.00 54.73  ? 248 LYS B N   1 
ATOM   4139  C  CA  . LYS B  1 227 ? 121.048 193.024 139.136 1.00 57.27  ? 248 LYS B CA  1 
ATOM   4140  C  C   . LYS B  1 227 ? 122.258 192.619 139.989 1.00 54.87  ? 248 LYS B C   1 
ATOM   4141  O  O   . LYS B  1 227 ? 123.424 192.732 139.528 1.00 56.28  ? 248 LYS B O   1 
ATOM   4142  C  CB  . LYS B  1 227 ? 120.517 194.408 139.527 1.00 60.04  ? 248 LYS B CB  1 
ATOM   4143  C  CG  . LYS B  1 227 ? 121.558 195.525 139.638 1.00 64.40  ? 248 LYS B CG  1 
ATOM   4144  C  CD  . LYS B  1 227 ? 120.985 196.857 140.197 1.00 67.35  ? 248 LYS B CD  1 
ATOM   4145  C  CE  . LYS B  1 227 ? 120.254 196.659 141.526 1.00 65.64  ? 248 LYS B CE  1 
ATOM   4146  N  NZ  . LYS B  1 227 ? 119.295 197.750 141.856 1.00 67.05  ? 248 LYS B NZ  1 
ATOM   4147  N  N   . ASP B  1 228 ? 122.005 192.194 141.206 1.00 51.56  ? 249 ASP B N   1 
ATOM   4148  C  CA  . ASP B  1 228 ? 123.054 192.035 142.240 1.00 50.81  ? 249 ASP B CA  1 
ATOM   4149  C  C   . ASP B  1 228 ? 123.773 190.649 142.177 1.00 49.73  ? 249 ASP B C   1 
ATOM   4150  O  O   . ASP B  1 228 ? 124.816 190.467 142.966 1.00 50.39  ? 249 ASP B O   1 
ATOM   4151  C  CB  . ASP B  1 228 ? 122.426 192.166 143.614 1.00 48.78  ? 249 ASP B CB  1 
ATOM   4152  C  CG  . ASP B  1 228 ? 121.930 193.558 143.912 1.00 49.87  ? 249 ASP B CG  1 
ATOM   4153  O  OD1 . ASP B  1 228 ? 122.439 194.488 143.257 1.00 53.68  ? 249 ASP B OD1 1 
ATOM   4154  O  OD2 . ASP B  1 228 ? 121.063 193.694 144.800 1.00 48.00  ? 249 ASP B OD2 1 
ATOM   4155  N  N   . ARG B  1 229 ? 123.217 189.734 141.380 1.00 49.40  ? 250 ARG B N   1 
ATOM   4156  C  CA  . ARG B  1 229 ? 123.659 188.317 141.336 1.00 48.84  ? 250 ARG B CA  1 
ATOM   4157  C  C   . ARG B  1 229 ? 125.127 188.211 140.943 1.00 49.99  ? 250 ARG B C   1 
ATOM   4158  O  O   . ARG B  1 229 ? 125.855 187.554 141.679 1.00 47.86  ? 250 ARG B O   1 
ATOM   4159  C  CB  . ARG B  1 229 ? 122.806 187.508 140.356 1.00 49.41  ? 250 ARG B CB  1 
ATOM   4160  C  CG  . ARG B  1 229 ? 123.312 186.090 140.141 1.00 49.15  ? 250 ARG B CG  1 
ATOM   4161  C  CD  . ARG B  1 229 ? 122.608 185.296 139.062 1.00 49.72  ? 250 ARG B CD  1 
ATOM   4162  N  NE  . ARG B  1 229 ? 121.286 184.835 139.449 1.00 48.83  ? 250 ARG B NE  1 
ATOM   4163  C  CZ  . ARG B  1 229 ? 121.037 183.728 140.140 1.00 48.28  ? 250 ARG B CZ  1 
ATOM   4164  N  NH1 . ARG B  1 229 ? 119.793 183.405 140.436 1.00 47.54  ? 250 ARG B NH1 1 
ATOM   4165  N  NH2 . ARG B  1 229 ? 122.023 182.947 140.534 1.00 48.04  ? 250 ARG B NH2 1 
ATOM   4166  N  N   . PRO B  1 230 ? 125.622 188.909 139.901 1.00 53.08  ? 251 PRO B N   1 
ATOM   4167  C  CA  . PRO B  1 230 ? 127.037 188.807 139.522 1.00 55.38  ? 251 PRO B CA  1 
ATOM   4168  C  C   . PRO B  1 230 ? 127.982 189.170 140.673 1.00 55.81  ? 251 PRO B C   1 
ATOM   4169  O  O   . PRO B  1 230 ? 128.989 188.518 140.878 1.00 55.79  ? 251 PRO B O   1 
ATOM   4170  C  CB  . PRO B  1 230 ? 127.221 189.807 138.363 1.00 58.08  ? 251 PRO B CB  1 
ATOM   4171  C  CG  . PRO B  1 230 ? 125.824 189.963 137.791 1.00 57.68  ? 251 PRO B CG  1 
ATOM   4172  C  CD  . PRO B  1 230 ? 124.892 189.794 138.982 1.00 55.15  ? 251 PRO B CD  1 
ATOM   4173  N  N   . MET B  1 231 ? 127.653 190.241 141.372 1.00 57.14  ? 252 MET B N   1 
ATOM   4174  C  CA  . MET B  1 231 ? 128.495 190.753 142.467 1.00 59.04  ? 252 MET B CA  1 
ATOM   4175  C  C   . MET B  1 231 ? 128.383 189.763 143.637 1.00 53.51  ? 252 MET B C   1 
ATOM   4176  O  O   . MET B  1 231 ? 129.412 189.425 144.209 1.00 52.15  ? 252 MET B O   1 
ATOM   4177  C  CB  . MET B  1 231 ? 128.055 192.177 142.822 1.00 64.96  ? 252 MET B CB  1 
ATOM   4178  C  CG  . MET B  1 231 ? 128.923 192.859 143.846 1.00 70.93  ? 252 MET B CG  1 
ATOM   4179  S  SD  . MET B  1 231 ? 128.048 193.183 145.420 1.00 79.94  ? 252 MET B SD  1 
ATOM   4180  C  CE  . MET B  1 231 ? 129.469 193.791 146.341 1.00 82.02  ? 252 MET B CE  1 
ATOM   4181  N  N   . LEU B  1 232 ? 127.192 189.231 143.916 1.00 49.46  ? 253 LEU B N   1 
ATOM   4182  C  CA  . LEU B  1 232 ? 126.991 188.264 145.044 1.00 46.21  ? 253 LEU B CA  1 
ATOM   4183  C  C   . LEU B  1 232 ? 127.633 186.893 144.750 1.00 44.73  ? 253 LEU B C   1 
ATOM   4184  O  O   . LEU B  1 232 ? 128.048 186.283 145.733 1.00 43.64  ? 253 LEU B O   1 
ATOM   4185  C  CB  . LEU B  1 232 ? 125.500 188.157 145.397 1.00 44.25  ? 253 LEU B CB  1 
ATOM   4186  C  CG  . LEU B  1 232 ? 124.888 189.450 145.933 1.00 44.72  ? 253 LEU B CG  1 
ATOM   4187  C  CD1 . LEU B  1 232 ? 123.390 189.387 145.960 1.00 43.60  ? 253 LEU B CD1 1 
ATOM   4188  C  CD2 . LEU B  1 232 ? 125.425 189.787 147.306 1.00 44.36  ? 253 LEU B CD2 1 
ATOM   4189  N  N   . GLU B  1 233 ? 127.809 186.472 143.491 1.00 45.18  ? 254 GLU B N   1 
ATOM   4190  C  CA  . GLU B  1 233 ? 128.503 185.208 143.125 1.00 45.00  ? 254 GLU B CA  1 
ATOM   4191  C  C   . GLU B  1 233 ? 130.005 185.465 142.953 1.00 47.73  ? 254 GLU B C   1 
ATOM   4192  O  O   . GLU B  1 233 ? 130.701 184.629 142.281 1.00 48.40  ? 254 GLU B O   1 
ATOM   4193  C  CB  . GLU B  1 233 ? 127.870 184.618 141.863 1.00 45.23  ? 254 GLU B CB  1 
ATOM   4194  C  CG  . GLU B  1 233 ? 126.408 184.224 142.076 1.00 43.09  ? 254 GLU B CG  1 
ATOM   4195  C  CD  . GLU B  1 233 ? 125.702 183.406 140.997 1.00 43.13  ? 254 GLU B CD  1 
ATOM   4196  O  OE1 . GLU B  1 233 ? 126.152 183.385 139.806 1.00 45.30  ? 254 GLU B OE1 1 
ATOM   4197  O  OE2 . GLU B  1 233 ? 124.678 182.801 141.346 1.00 41.56  ? 254 GLU B OE2 1 
ATOM   4198  N  N   . ASN B  1 234 ? 130.512 186.554 143.558 1.00 49.01  ? 255 ASN B N   1 
ATOM   4199  C  CA  . ASN B  1 234 ? 131.908 187.008 143.381 1.00 51.47  ? 255 ASN B CA  1 
ATOM   4200  C  C   . ASN B  1 234 ? 132.442 187.798 144.562 1.00 51.83  ? 255 ASN B C   1 
ATOM   4201  O  O   . ASN B  1 234 ? 133.391 188.598 144.365 1.00 53.83  ? 255 ASN B O   1 
ATOM   4202  C  CB  . ASN B  1 234 ? 131.983 187.856 142.130 1.00 54.81  ? 255 ASN B CB  1 
ATOM   4203  C  CG  . ASN B  1 234 ? 132.617 187.043 141.045 1.00 56.47  ? 255 ASN B CG  1 
ATOM   4204  O  OD1 . ASN B  1 234 ? 133.839 186.898 141.075 1.00 58.03  ? 255 ASN B OD1 1 
ATOM   4205  N  ND2 . ASN B  1 234 ? 131.778 186.466 140.188 1.00 55.99  ? 255 ASN B ND2 1 
ATOM   4206  N  N   . LEU B  1 235 ? 131.928 187.503 145.755 1.00 38.40  ? 256 LEU B N   1 
ATOM   4207  C  CA  . LEU B  1 235 ? 132.306 188.220 146.996 1.00 39.02  ? 256 LEU B CA  1 
ATOM   4208  C  C   . LEU B  1 235 ? 133.776 187.967 147.376 1.00 39.71  ? 256 LEU B C   1 
ATOM   4209  O  O   . LEU B  1 235 ? 134.313 186.924 147.080 1.00 38.03  ? 256 LEU B O   1 
ATOM   4210  C  CB  . LEU B  1 235 ? 131.343 187.799 148.120 1.00 37.81  ? 256 LEU B CB  1 
ATOM   4211  C  CG  . LEU B  1 235 ? 129.880 188.182 147.932 1.00 37.48  ? 256 LEU B CG  1 
ATOM   4212  C  CD1 . LEU B  1 235 ? 129.091 187.679 149.130 1.00 36.32  ? 256 LEU B CD1 1 
ATOM   4213  C  CD2 . LEU B  1 235 ? 129.707 189.689 147.758 1.00 39.35  ? 256 LEU B CD2 1 
ATOM   4214  N  N   . LYS B  1 236 ? 134.411 188.980 147.964 1.00 42.94  ? 257 LYS B N   1 
ATOM   4215  C  CA  . LYS B  1 236 ? 135.702 188.901 148.697 1.00 44.20  ? 257 LYS B CA  1 
ATOM   4216  C  C   . LYS B  1 236 ? 135.519 189.605 150.052 1.00 42.61  ? 257 LYS B C   1 
ATOM   4217  O  O   . LYS B  1 236 ? 135.107 190.760 150.058 1.00 43.51  ? 257 LYS B O   1 
ATOM   4218  C  CB  . LYS B  1 236 ? 136.767 189.569 147.840 1.00 48.01  ? 257 LYS B CB  1 
ATOM   4219  C  CG  . LYS B  1 236 ? 136.700 189.158 146.381 1.00 51.71  ? 257 LYS B CG  1 
ATOM   4220  C  CD  . LYS B  1 236 ? 137.831 189.729 145.514 1.00 57.18  ? 257 LYS B CD  1 
ATOM   4221  C  CE  . LYS B  1 236 ? 137.700 189.368 144.040 1.00 60.07  ? 257 LYS B CE  1 
ATOM   4222  N  NZ  . LYS B  1 236 ? 136.323 189.636 143.546 1.00 62.02  ? 257 LYS B NZ  1 
ATOM   4223  N  N   . LEU B  1 237 ? 135.755 188.939 151.168 1.00 40.06  ? 258 LEU B N   1 
ATOM   4224  C  CA  . LEU B  1 237 ? 135.536 189.565 152.504 1.00 38.93  ? 258 LEU B CA  1 
ATOM   4225  C  C   . LEU B  1 237 ? 136.763 189.347 153.383 1.00 38.42  ? 258 LEU B C   1 
ATOM   4226  O  O   . LEU B  1 237 ? 137.668 188.515 153.003 1.00 38.02  ? 258 LEU B O   1 
ATOM   4227  C  CB  . LEU B  1 237 ? 134.244 189.028 153.137 1.00 36.68  ? 258 LEU B CB  1 
ATOM   4228  C  CG  . LEU B  1 237 ? 132.982 189.418 152.377 1.00 36.71  ? 258 LEU B CG  1 
ATOM   4229  C  CD1 . LEU B  1 237 ? 131.747 188.740 152.895 1.00 35.19  ? 258 LEU B CD1 1 
ATOM   4230  C  CD2 . LEU B  1 237 ? 132.781 190.909 152.425 1.00 38.41  ? 258 LEU B CD2 1 
ATOM   4231  N  N   . GLY B  1 238 ? 136.827 190.147 154.453 1.00 38.57  ? 259 GLY B N   1 
ATOM   4232  C  CA  . GLY B  1 238 ? 137.786 189.988 155.565 1.00 39.13  ? 259 GLY B CA  1 
ATOM   4233  C  C   . GLY B  1 238 ? 139.156 190.621 155.358 1.00 40.81  ? 259 GLY B C   1 
ATOM   4234  O  O   . GLY B  1 238 ? 139.954 190.545 156.320 1.00 41.19  ? 259 GLY B O   1 
ATOM   4235  N  N   . GLU B  1 239 ? 139.467 191.211 154.198 1.00 42.65  ? 260 GLU B N   1 
ATOM   4236  C  CA  . GLU B  1 239 ? 140.829 191.790 154.007 1.00 45.36  ? 260 GLU B CA  1 
ATOM   4237  C  C   . GLU B  1 239 ? 141.051 192.914 155.031 1.00 45.24  ? 260 GLU B C   1 
ATOM   4238  O  O   . GLU B  1 239 ? 140.186 193.822 155.082 1.00 45.62  ? 260 GLU B O   1 
ATOM   4239  C  CB  . GLU B  1 239 ? 141.050 192.325 152.592 1.00 48.05  ? 260 GLU B CB  1 
ATOM   4240  C  CG  . GLU B  1 239 ? 142.495 192.691 152.312 1.00 51.12  ? 260 GLU B CG  1 
ATOM   4241  C  CD  . GLU B  1 239 ? 142.701 193.193 150.882 1.00 54.45  ? 260 GLU B CD  1 
ATOM   4242  O  OE1 . GLU B  1 239 ? 141.679 193.180 150.147 1.00 55.46  ? 260 GLU B OE1 1 
ATOM   4243  O  OE2 . GLU B  1 239 ? 143.873 193.583 150.501 1.00 55.77  ? 260 GLU B OE2 1 
ATOM   4244  N  N   . GLY B  1 240 ? 142.163 192.847 155.781 1.00 44.90  ? 261 GLY B N   1 
ATOM   4245  C  CA  . GLY B  1 240 ? 142.555 193.825 156.813 1.00 45.63  ? 261 GLY B CA  1 
ATOM   4246  C  C   . GLY B  1 240 ? 141.956 193.535 158.189 1.00 44.28  ? 261 GLY B C   1 
ATOM   4247  O  O   . GLY B  1 240 ? 142.254 194.266 159.142 1.00 44.81  ? 261 GLY B O   1 
ATOM   4248  N  N   . VAL B  1 241 ? 141.108 192.522 158.326 1.00 42.56  ? 262 VAL B N   1 
ATOM   4249  C  CA  . VAL B  1 241 ? 140.582 192.145 159.673 1.00 41.91  ? 262 VAL B CA  1 
ATOM   4250  C  C   . VAL B  1 241 ? 140.833 190.652 159.893 1.00 40.59  ? 262 VAL B C   1 
ATOM   4251  O  O   . VAL B  1 241 ? 141.373 189.963 159.017 1.00 39.94  ? 262 VAL B O   1 
ATOM   4252  C  CB  . VAL B  1 241 ? 139.102 192.533 159.879 1.00 41.29  ? 262 VAL B CB  1 
ATOM   4253  C  CG1 . VAL B  1 241 ? 138.868 194.021 159.797 1.00 43.21  ? 262 VAL B CG1 1 
ATOM   4254  C  CG2 . VAL B  1 241 ? 138.180 191.817 158.919 1.00 40.67  ? 262 VAL B CG2 1 
ATOM   4255  N  N   . LYS B  1 242 ? 140.351 190.153 161.013 1.00 40.36  ? 263 LYS B N   1 
ATOM   4256  C  CA  . LYS B  1 242 ? 140.748 188.835 161.546 1.00 40.02  ? 263 LYS B CA  1 
ATOM   4257  C  C   . LYS B  1 242 ? 140.078 187.710 160.759 1.00 38.55  ? 263 LYS B C   1 
ATOM   4258  O  O   . LYS B  1 242 ? 140.443 186.583 160.983 1.00 39.35  ? 263 LYS B O   1 
ATOM   4259  C  CB  . LYS B  1 242 ? 140.387 188.810 163.031 1.00 40.37  ? 263 LYS B CB  1 
ATOM   4260  C  CG  . LYS B  1 242 ? 141.010 189.934 163.849 1.00 41.93  ? 263 LYS B CG  1 
ATOM   4261  C  CD  . LYS B  1 242 ? 142.490 190.086 163.594 1.00 42.98  ? 263 LYS B CD  1 
ATOM   4262  C  CE  . LYS B  1 242 ? 143.094 191.022 164.611 1.00 44.59  ? 263 LYS B CE  1 
ATOM   4263  N  NZ  . LYS B  1 242 ? 144.561 190.935 164.563 1.00 46.23  ? 263 LYS B NZ  1 
ATOM   4264  N  N   . GLY B  1 243 ? 139.135 187.983 159.871 1.00 37.62  ? 264 GLY B N   1 
ATOM   4265  C  CA  . GLY B  1 243 ? 138.532 186.902 159.083 1.00 36.09  ? 264 GLY B CA  1 
ATOM   4266  C  C   . GLY B  1 243 ? 137.069 187.137 158.824 1.00 34.71  ? 264 GLY B C   1 
ATOM   4267  O  O   . GLY B  1 243 ? 136.613 188.276 158.915 1.00 35.16  ? 264 GLY B O   1 
ATOM   4268  N  N   . VAL B  1 244 ? 136.385 186.074 158.452 1.00 33.33  ? 265 VAL B N   1 
ATOM   4269  C  CA  . VAL B  1 244 ? 135.007 186.130 157.917 1.00 32.83  ? 265 VAL B CA  1 
ATOM   4270  C  C   . VAL B  1 244 ? 134.206 185.062 158.635 1.00 31.52  ? 265 VAL B C   1 
ATOM   4271  O  O   . VAL B  1 244 ? 134.714 183.959 158.813 1.00 30.80  ? 265 VAL B O   1 
ATOM   4272  C  CB  . VAL B  1 244 ? 134.990 185.935 156.388 1.00 33.31  ? 265 VAL B CB  1 
ATOM   4273  C  CG1 . VAL B  1 244 ? 133.574 185.923 155.862 1.00 32.90  ? 265 VAL B CG1 1 
ATOM   4274  C  CG2 . VAL B  1 244 ? 135.828 186.981 155.665 1.00 34.45  ? 265 VAL B CG2 1 
ATOM   4275  N  N   . TYR B  1 245 ? 133.014 185.439 159.059 1.00 31.16  ? 266 TYR B N   1 
ATOM   4276  C  CA  . TYR B  1 245 ? 132.033 184.563 159.715 1.00 29.68  ? 266 TYR B CA  1 
ATOM   4277  C  C   . TYR B  1 245 ? 130.852 184.533 158.771 1.00 29.40  ? 266 TYR B C   1 
ATOM   4278  O  O   . TYR B  1 245 ? 130.470 185.622 158.205 1.00 29.35  ? 266 TYR B O   1 
ATOM   4279  C  CB  . TYR B  1 245 ? 131.622 185.154 161.060 1.00 30.84  ? 266 TYR B CB  1 
ATOM   4280  C  CG  . TYR B  1 245 ? 130.722 184.276 161.880 1.00 30.09  ? 266 TYR B CG  1 
ATOM   4281  C  CD1 . TYR B  1 245 ? 129.350 184.312 161.713 1.00 29.61  ? 266 TYR B CD1 1 
ATOM   4282  C  CD2 . TYR B  1 245 ? 131.260 183.360 162.749 1.00 29.98  ? 266 TYR B CD2 1 
ATOM   4283  C  CE1 . TYR B  1 245 ? 128.508 183.507 162.447 1.00 29.27  ? 266 TYR B CE1 1 
ATOM   4284  C  CE2 . TYR B  1 245 ? 130.436 182.510 163.470 1.00 29.93  ? 266 TYR B CE2 1 
ATOM   4285  C  CZ  . TYR B  1 245 ? 129.061 182.587 163.315 1.00 29.56  ? 266 TYR B CZ  1 
ATOM   4286  O  OH  . TYR B  1 245 ? 128.261 181.783 164.063 1.00 29.75  ? 266 TYR B OH  1 
ATOM   4287  N  N   . ILE B  1 246 ? 130.322 183.327 158.565 1.00 28.53  ? 267 ILE B N   1 
ATOM   4288  C  CA  . ILE B  1 246 ? 129.147 183.125 157.685 1.00 28.24  ? 267 ILE B CA  1 
ATOM   4289  C  C   . ILE B  1 246 ? 127.966 182.661 158.532 1.00 27.43  ? 267 ILE B C   1 
ATOM   4290  O  O   . ILE B  1 246 ? 128.048 181.585 159.115 1.00 26.70  ? 267 ILE B O   1 
ATOM   4291  C  CB  . ILE B  1 246 ? 129.489 182.146 156.566 1.00 28.11  ? 267 ILE B CB  1 
ATOM   4292  C  CG1 . ILE B  1 246 ? 130.696 182.610 155.770 1.00 29.20  ? 267 ILE B CG1 1 
ATOM   4293  C  CG2 . ILE B  1 246 ? 128.278 181.981 155.675 1.00 28.47  ? 267 ILE B CG2 1 
ATOM   4294  C  CD1 . ILE B  1 246 ? 131.166 181.584 154.753 1.00 29.38  ? 267 ILE B CD1 1 
ATOM   4295  N  N   . SER B  1 247 ? 126.900 183.443 158.563 1.00 27.55  ? 268 SER B N   1 
ATOM   4296  C  CA  . SER B  1 247 ? 125.655 183.074 159.270 1.00 27.78  ? 268 SER B CA  1 
ATOM   4297  C  C   . SER B  1 247 ? 124.597 182.713 158.231 1.00 27.90  ? 268 SER B C   1 
ATOM   4298  O  O   . SER B  1 247 ? 124.140 183.628 157.520 1.00 29.31  ? 268 SER B O   1 
ATOM   4299  C  CB  . SER B  1 247 ? 125.149 184.152 160.159 1.00 27.98  ? 268 SER B CB  1 
ATOM   4300  O  OG  . SER B  1 247 ? 124.149 183.629 161.016 1.00 26.93  ? 268 SER B OG  1 
ATOM   4301  N  N   . ILE B  1 248 ? 124.162 181.454 158.212 1.00 27.05  ? 269 ILE B N   1 
ATOM   4302  C  CA  . ILE B  1 248 ? 123.077 181.004 157.285 1.00 26.34  ? 269 ILE B CA  1 
ATOM   4303  C  C   . ILE B  1 248 ? 121.827 180.623 158.099 1.00 25.21  ? 269 ILE B C   1 
ATOM   4304  O  O   . ILE B  1 248 ? 121.847 179.584 158.740 1.00 24.78  ? 269 ILE B O   1 
ATOM   4305  C  CB  . ILE B  1 248 ? 123.565 179.852 156.415 1.00 25.45  ? 269 ILE B CB  1 
ATOM   4306  C  CG1 . ILE B  1 248 ? 124.880 180.171 155.700 1.00 26.60  ? 269 ILE B CG1 1 
ATOM   4307  C  CG2 . ILE B  1 248 ? 122.474 179.414 155.483 1.00 25.70  ? 269 ILE B CG2 1 
ATOM   4308  C  CD1 . ILE B  1 248 ? 125.363 179.030 154.768 1.00 26.59  ? 269 ILE B CD1 1 
ATOM   4309  N  N   . ASP B  1 249 ? 120.838 181.506 158.112 1.00 24.72  ? 270 ASP B N   1 
ATOM   4310  C  CA  . ASP B  1 249 ? 119.425 181.184 158.336 1.00 24.60  ? 270 ASP B CA  1 
ATOM   4311  C  C   . ASP B  1 249 ? 118.944 180.414 157.111 1.00 24.94  ? 270 ASP B C   1 
ATOM   4312  O  O   . ASP B  1 249 ? 119.028 180.896 155.969 1.00 24.64  ? 270 ASP B O   1 
ATOM   4313  C  CB  . ASP B  1 249 ? 118.627 182.466 158.551 1.00 25.74  ? 270 ASP B CB  1 
ATOM   4314  C  CG  . ASP B  1 249 ? 117.219 182.323 159.102 1.00 25.73  ? 270 ASP B CG  1 
ATOM   4315  O  OD1 . ASP B  1 249 ? 116.563 181.286 158.795 1.00 25.04  ? 270 ASP B OD1 1 
ATOM   4316  O  OD2 . ASP B  1 249 ? 116.753 183.334 159.726 1.00 26.67  ? 270 ASP B OD2 1 
ATOM   4317  N  N   . VAL B  1 250 ? 118.504 179.195 157.332 1.00 24.94  ? 271 VAL B N   1 
ATOM   4318  C  CA  . VAL B  1 250 ? 117.909 178.326 156.280 1.00 25.93  ? 271 VAL B CA  1 
ATOM   4319  C  C   . VAL B  1 250 ? 116.756 179.054 155.526 1.00 26.71  ? 271 VAL B C   1 
ATOM   4320  O  O   . VAL B  1 250 ? 116.563 178.722 154.335 1.00 25.26  ? 271 VAL B O   1 
ATOM   4321  C  CB  . VAL B  1 250 ? 117.460 177.081 157.036 1.00 27.14  ? 271 VAL B CB  1 
ATOM   4322  C  CG1 . VAL B  1 250 ? 116.424 176.347 156.271 1.00 28.74  ? 271 VAL B CG1 1 
ATOM   4323  C  CG2 . VAL B  1 250 ? 118.666 176.229 157.352 1.00 27.25  ? 271 VAL B CG2 1 
ATOM   4324  N  N   . ASP B  1 251 ? 116.076 180.050 156.135 1.00 26.42  ? 272 ASP B N   1 
ATOM   4325  C  CA  . ASP B  1 251 ? 114.994 180.817 155.459 1.00 28.49  ? 272 ASP B CA  1 
ATOM   4326  C  C   . ASP B  1 251 ? 115.565 181.818 154.425 1.00 29.23  ? 272 ASP B C   1 
ATOM   4327  O  O   . ASP B  1 251 ? 114.774 182.443 153.719 1.00 27.84  ? 272 ASP B O   1 
ATOM   4328  C  CB  . ASP B  1 251 ? 114.039 181.525 156.437 1.00 29.46  ? 272 ASP B CB  1 
ATOM   4329  C  CG  . ASP B  1 251 ? 114.559 182.810 157.061 1.00 30.07  ? 272 ASP B CG  1 
ATOM   4330  O  OD1 . ASP B  1 251 ? 115.612 183.308 156.625 1.00 30.06  ? 272 ASP B OD1 1 
ATOM   4331  O  OD2 . ASP B  1 251 ? 113.935 183.268 158.030 1.00 31.11  ? 272 ASP B OD2 1 
ATOM   4332  N  N   . CYS B  1 252 ? 116.881 181.888 154.229 1.00 29.83  ? 273 CYS B N   1 
ATOM   4333  C  CA  . CYS B  1 252 ? 117.420 182.560 153.023 1.00 30.92  ? 273 CYS B CA  1 
ATOM   4334  C  C   . CYS B  1 252 ? 116.884 181.863 151.772 1.00 30.21  ? 273 CYS B C   1 
ATOM   4335  O  O   . CYS B  1 252 ? 116.618 182.573 150.726 1.00 31.67  ? 273 CYS B O   1 
ATOM   4336  C  CB  . CYS B  1 252 ? 118.937 182.659 153.018 1.00 31.79  ? 273 CYS B CB  1 
ATOM   4337  S  SG  . CYS B  1 252 ? 119.830 181.108 152.816 1.00 31.62  ? 273 CYS B SG  1 
ATOM   4338  N  N   . LEU B  1 253 ? 116.705 180.549 151.860 1.00 27.93  ? 274 LEU B N   1 
ATOM   4339  C  CA  . LEU B  1 253 ? 116.169 179.741 150.737 1.00 26.92  ? 274 LEU B CA  1 
ATOM   4340  C  C   . LEU B  1 253 ? 114.650 179.951 150.623 1.00 26.72  ? 274 LEU B C   1 
ATOM   4341  O  O   . LEU B  1 253 ? 113.976 180.058 151.644 1.00 26.49  ? 274 LEU B O   1 
ATOM   4342  C  CB  . LEU B  1 253 ? 116.488 178.277 150.983 1.00 25.64  ? 274 LEU B CB  1 
ATOM   4343  C  CG  . LEU B  1 253 ? 117.951 177.916 150.942 1.00 25.36  ? 274 LEU B CG  1 
ATOM   4344  C  CD1 . LEU B  1 253 ? 118.216 176.641 151.747 1.00 24.08  ? 274 LEU B CD1 1 
ATOM   4345  C  CD2 . LEU B  1 253 ? 118.404 177.749 149.498 1.00 25.89  ? 274 LEU B CD2 1 
ATOM   4346  N  N   . ASP B  1 254 ? 114.146 180.022 149.398 1.00 26.52  ? 275 ASP B N   1 
ATOM   4347  C  CA  . ASP B  1 254 ? 112.704 179.978 149.152 1.00 26.62  ? 275 ASP B CA  1 
ATOM   4348  C  C   . ASP B  1 254 ? 112.150 178.753 149.877 1.00 25.51  ? 275 ASP B C   1 
ATOM   4349  O  O   . ASP B  1 254 ? 112.757 177.687 149.962 1.00 24.09  ? 275 ASP B O   1 
ATOM   4350  C  CB  . ASP B  1 254 ? 112.423 179.956 147.666 1.00 27.69  ? 275 ASP B CB  1 
ATOM   4351  C  CG  . ASP B  1 254 ? 110.967 180.292 147.346 1.00 28.68  ? 275 ASP B CG  1 
ATOM   4352  O  OD1 . ASP B  1 254 ? 110.125 179.391 147.531 1.00 28.58  ? 275 ASP B OD1 1 
ATOM   4353  O  OD2 . ASP B  1 254 ? 110.674 181.479 146.997 1.00 30.09  ? 275 ASP B OD2 1 
ATOM   4354  N  N   . PRO B  1 255 ? 110.974 178.891 150.473 1.00 25.48  ? 276 PRO B N   1 
ATOM   4355  C  CA  . PRO B  1 255 ? 110.357 177.772 151.175 1.00 24.97  ? 276 PRO B CA  1 
ATOM   4356  C  C   . PRO B  1 255 ? 110.116 176.530 150.302 1.00 24.57  ? 276 PRO B C   1 
ATOM   4357  O  O   . PRO B  1 255 ? 109.957 175.484 150.835 1.00 24.55  ? 276 PRO B O   1 
ATOM   4358  C  CB  . PRO B  1 255 ? 109.023 178.316 151.669 1.00 25.54  ? 276 PRO B CB  1 
ATOM   4359  C  CG  . PRO B  1 255 ? 108.936 179.746 151.227 1.00 26.91  ? 276 PRO B CG  1 
ATOM   4360  C  CD  . PRO B  1 255 ? 110.265 180.154 150.632 1.00 26.54  ? 276 PRO B CD  1 
ATOM   4361  N  N   . ALA B  1 256 ? 110.063 176.689 148.993 1.00 24.91  ? 277 ALA B N   1 
ATOM   4362  C  CA  . ALA B  1 256 ? 109.994 175.574 148.053 1.00 25.10  ? 277 ALA B CA  1 
ATOM   4363  C  C   . ALA B  1 256 ? 111.204 174.651 148.336 1.00 24.86  ? 277 ALA B C   1 
ATOM   4364  O  O   . ALA B  1 256 ? 111.040 173.434 148.291 1.00 24.55  ? 277 ALA B O   1 
ATOM   4365  C  CB  . ALA B  1 256 ? 109.997 176.150 146.663 1.00 25.72  ? 277 ALA B CB  1 
ATOM   4366  N  N   . PHE B  1 257 ? 112.368 175.219 148.690 1.00 24.95  ? 278 PHE B N   1 
ATOM   4367  C  CA  . PHE B  1 257 ? 113.624 174.469 148.963 1.00 24.46  ? 278 PHE B CA  1 
ATOM   4368  C  C   . PHE B  1 257 ? 113.699 174.160 150.457 1.00 23.85  ? 278 PHE B C   1 
ATOM   4369  O  O   . PHE B  1 257 ? 114.193 173.077 150.781 1.00 23.44  ? 278 PHE B O   1 
ATOM   4370  C  CB  . PHE B  1 257 ? 114.881 175.204 148.445 1.00 24.86  ? 278 PHE B CB  1 
ATOM   4371  C  CG  . PHE B  1 257 ? 114.805 175.587 146.992 1.00 25.65  ? 278 PHE B CG  1 
ATOM   4372  C  CD1 . PHE B  1 257 ? 115.108 174.678 146.003 1.00 26.24  ? 278 PHE B CD1 1 
ATOM   4373  C  CD2 . PHE B  1 257 ? 114.378 176.838 146.613 1.00 26.86  ? 278 PHE B CD2 1 
ATOM   4374  C  CE1 . PHE B  1 257 ? 114.963 175.009 144.671 1.00 27.01  ? 278 PHE B CE1 1 
ATOM   4375  C  CE2 . PHE B  1 257 ? 114.217 177.176 145.274 1.00 27.51  ? 278 PHE B CE2 1 
ATOM   4376  C  CZ  . PHE B  1 257 ? 114.479 176.251 144.308 1.00 27.85  ? 278 PHE B CZ  1 
ATOM   4377  N  N   . ALA B  1 258 ? 113.235 175.062 151.325 1.00 23.97  ? 279 ALA B N   1 
ATOM   4378  C  CA  . ALA B  1 258 ? 113.430 174.952 152.781 1.00 23.95  ? 279 ALA B CA  1 
ATOM   4379  C  C   . ALA B  1 258 ? 112.112 175.251 153.501 1.00 24.62  ? 279 ALA B C   1 
ATOM   4380  O  O   . ALA B  1 258 ? 111.905 176.292 154.099 1.00 24.96  ? 279 ALA B O   1 
ATOM   4381  C  CB  . ALA B  1 258 ? 114.589 175.830 153.205 1.00 24.01  ? 279 ALA B CB  1 
ATOM   4382  N  N   . PRO B  1 259 ? 111.128 174.326 153.468 1.00 24.07  ? 280 PRO B N   1 
ATOM   4383  C  CA  . PRO B  1 259 ? 109.879 174.582 154.160 1.00 23.74  ? 280 PRO B CA  1 
ATOM   4384  C  C   . PRO B  1 259 ? 110.050 174.448 155.671 1.00 23.36  ? 280 PRO B C   1 
ATOM   4385  O  O   . PRO B  1 259 ? 109.196 174.915 156.378 1.00 23.66  ? 280 PRO B O   1 
ATOM   4386  C  CB  . PRO B  1 259 ? 108.932 173.529 153.591 1.00 23.96  ? 280 PRO B CB  1 
ATOM   4387  C  CG  . PRO B  1 259 ? 109.864 172.400 153.201 1.00 23.67  ? 280 PRO B CG  1 
ATOM   4388  C  CD  . PRO B  1 259 ? 111.107 173.106 152.656 1.00 23.37  ? 280 PRO B CD  1 
ATOM   4389  N  N   . GLY B  1 260 ? 111.064 173.752 156.120 1.00 23.47  ? 281 GLY B N   1 
ATOM   4390  C  CA  . GLY B  1 260 ? 111.239 173.491 157.561 1.00 24.53  ? 281 GLY B CA  1 
ATOM   4391  C  C   . GLY B  1 260 ? 111.858 174.677 158.290 1.00 24.98  ? 281 GLY B C   1 
ATOM   4392  O  O   . GLY B  1 260 ? 113.020 174.559 158.803 1.00 24.56  ? 281 GLY B O   1 
ATOM   4393  N  N   . VAL B  1 261 ? 111.080 175.745 158.384 1.00 25.39  ? 282 VAL B N   1 
ATOM   4394  C  CA  . VAL B  1 261 ? 111.435 177.036 159.028 1.00 26.20  ? 282 VAL B CA  1 
ATOM   4395  C  C   . VAL B  1 261 ? 110.212 177.561 159.771 1.00 26.19  ? 282 VAL B C   1 
ATOM   4396  O  O   . VAL B  1 261 ? 109.107 177.137 159.441 1.00 25.72  ? 282 VAL B O   1 
ATOM   4397  C  CB  . VAL B  1 261 ? 111.919 178.044 157.976 1.00 27.28  ? 282 VAL B CB  1 
ATOM   4398  C  CG1 . VAL B  1 261 ? 113.129 177.490 157.229 1.00 27.22  ? 282 VAL B CG1 1 
ATOM   4399  C  CG2 . VAL B  1 261 ? 110.825 178.414 157.001 1.00 27.73  ? 282 VAL B CG2 1 
ATOM   4400  N  N   . SER B  1 262 ? 110.442 178.403 160.772 1.00 26.06  ? 283 SER B N   1 
ATOM   4401  C  CA  . SER B  1 262 ? 109.396 179.115 161.532 1.00 27.95  ? 283 SER B CA  1 
ATOM   4402  C  C   . SER B  1 262 ? 108.761 180.259 160.704 1.00 28.62  ? 283 SER B C   1 
ATOM   4403  O  O   . SER B  1 262 ? 107.548 180.576 160.899 1.00 30.05  ? 283 SER B O   1 
ATOM   4404  C  CB  . SER B  1 262 ? 109.972 179.575 162.833 1.00 28.67  ? 283 SER B CB  1 
ATOM   4405  O  OG  . SER B  1 262 ? 110.477 178.476 163.606 1.00 27.81  ? 283 SER B OG  1 
ATOM   4406  N  N   . HIS B  1 263 ? 109.494 180.820 159.745 1.00 28.32  ? 284 HIS B N   1 
ATOM   4407  C  CA  . HIS B  1 263 ? 109.062 182.033 158.986 1.00 29.08  ? 284 HIS B CA  1 
ATOM   4408  C  C   . HIS B  1 263 ? 109.107 181.727 157.487 1.00 28.50  ? 284 HIS B C   1 
ATOM   4409  O  O   . HIS B  1 263 ? 110.160 181.878 156.885 1.00 27.20  ? 284 HIS B O   1 
ATOM   4410  C  CB  . HIS B  1 263 ? 109.909 183.293 159.332 1.00 29.29  ? 284 HIS B CB  1 
ATOM   4411  C  CG  . HIS B  1 263 ? 109.931 183.573 160.802 1.00 29.34  ? 284 HIS B CG  1 
ATOM   4412  N  ND1 . HIS B  1 263 ? 109.054 184.438 161.414 1.00 30.58  ? 284 HIS B ND1 1 
ATOM   4413  C  CD2 . HIS B  1 263 ? 110.639 182.980 161.794 1.00 28.64  ? 284 HIS B CD2 1 
ATOM   4414  C  CE1 . HIS B  1 263 ? 109.215 184.373 162.726 1.00 30.74  ? 284 HIS B CE1 1 
ATOM   4415  N  NE2 . HIS B  1 263 ? 110.205 183.486 162.980 1.00 29.48  ? 284 HIS B NE2 1 
ATOM   4416  N  N   . ILE B  1 264 ? 107.951 181.346 156.961 1.00 28.58  ? 285 ILE B N   1 
ATOM   4417  C  CA  . ILE B  1 264 ? 107.730 181.039 155.538 1.00 28.81  ? 285 ILE B CA  1 
ATOM   4418  C  C   . ILE B  1 264 ? 107.622 182.395 154.857 1.00 29.97  ? 285 ILE B C   1 
ATOM   4419  O  O   . ILE B  1 264 ? 106.822 183.223 155.298 1.00 31.07  ? 285 ILE B O   1 
ATOM   4420  C  CB  . ILE B  1 264 ? 106.475 180.179 155.350 1.00 29.13  ? 285 ILE B CB  1 
ATOM   4421  C  CG1 . ILE B  1 264 ? 106.591 178.838 156.063 1.00 28.64  ? 285 ILE B CG1 1 
ATOM   4422  C  CG2 . ILE B  1 264 ? 106.137 179.994 153.884 1.00 29.32  ? 285 ILE B CG2 1 
ATOM   4423  C  CD1 . ILE B  1 264 ? 107.631 177.961 155.488 1.00 28.53  ? 285 ILE B CD1 1 
ATOM   4424  N  N   . GLU B  1 265 ? 108.459 182.619 153.856 1.00 29.85  ? 286 GLU B N   1 
ATOM   4425  C  CA  . GLU B  1 265 ? 108.647 183.961 153.242 1.00 30.72  ? 286 GLU B CA  1 
ATOM   4426  C  C   . GLU B  1 265 ? 108.957 183.758 151.773 1.00 30.05  ? 286 GLU B C   1 
ATOM   4427  O  O   . GLU B  1 265 ? 110.093 183.539 151.397 1.00 29.50  ? 286 GLU B O   1 
ATOM   4428  C  CB  . GLU B  1 265 ? 109.750 184.717 153.956 1.00 31.11  ? 286 GLU B CB  1 
ATOM   4429  C  CG  . GLU B  1 265 ? 109.754 186.177 153.541 1.00 34.08  ? 286 GLU B CG  1 
ATOM   4430  C  CD  . GLU B  1 265 ? 108.496 186.995 153.807 1.00 35.20  ? 286 GLU B CD  1 
ATOM   4431  O  OE1 . GLU B  1 265 ? 107.916 186.879 154.930 1.00 35.24  ? 286 GLU B OE1 1 
ATOM   4432  O  OE2 . GLU B  1 265 ? 108.146 187.754 152.905 1.00 36.07  ? 286 GLU B OE2 1 
ATOM   4433  N  N   . PRO B  1 266 ? 107.923 183.636 150.939 1.00 30.18  ? 287 PRO B N   1 
ATOM   4434  C  CA  . PRO B  1 266 ? 108.119 183.328 149.536 1.00 30.68  ? 287 PRO B CA  1 
ATOM   4435  C  C   . PRO B  1 266 ? 109.020 184.324 148.796 1.00 31.51  ? 287 PRO B C   1 
ATOM   4436  O  O   . PRO B  1 266 ? 109.039 185.511 149.171 1.00 33.07  ? 287 PRO B O   1 
ATOM   4437  C  CB  . PRO B  1 266 ? 106.701 183.450 148.972 1.00 32.08  ? 287 PRO B CB  1 
ATOM   4438  C  CG  . PRO B  1 266 ? 105.803 183.144 150.130 1.00 31.77  ? 287 PRO B CG  1 
ATOM   4439  C  CD  . PRO B  1 266 ? 106.517 183.705 151.332 1.00 31.21  ? 287 PRO B CD  1 
ATOM   4440  N  N   . GLY B  1 267 ? 109.659 183.852 147.726 1.00 30.45  ? 288 GLY B N   1 
ATOM   4441  C  CA  . GLY B  1 267 ? 110.546 184.668 146.881 1.00 31.23  ? 288 GLY B CA  1 
ATOM   4442  C  C   . GLY B  1 267 ? 111.993 184.680 147.354 1.00 30.18  ? 288 GLY B C   1 
ATOM   4443  O  O   . GLY B  1 267 ? 112.602 185.743 147.248 1.00 30.79  ? 288 GLY B O   1 
ATOM   4444  N  N   . GLY B  1 268 ? 112.547 183.531 147.776 1.00 28.66  ? 289 GLY B N   1 
ATOM   4445  C  CA  . GLY B  1 268 ? 113.934 183.423 148.271 1.00 28.56  ? 289 GLY B CA  1 
ATOM   4446  C  C   . GLY B  1 268 ? 114.922 182.864 147.232 1.00 28.77  ? 289 GLY B C   1 
ATOM   4447  O  O   . GLY B  1 268 ? 114.562 182.696 146.046 1.00 29.65  ? 289 GLY B O   1 
ATOM   4448  N  N   . LEU B  1 269 ? 116.131 182.549 147.671 1.00 28.17  ? 290 LEU B N   1 
ATOM   4449  C  CA  . LEU B  1 269 ? 117.206 181.954 146.836 1.00 28.14  ? 290 LEU B CA  1 
ATOM   4450  C  C   . LEU B  1 269 ? 116.896 180.476 146.579 1.00 27.29  ? 290 LEU B C   1 
ATOM   4451  O  O   . LEU B  1 269 ? 116.274 179.879 147.437 1.00 26.80  ? 290 LEU B O   1 
ATOM   4452  C  CB  . LEU B  1 269 ? 118.513 182.089 147.621 1.00 27.92  ? 290 LEU B CB  1 
ATOM   4453  C  CG  . LEU B  1 269 ? 118.916 183.539 147.892 1.00 29.21  ? 290 LEU B CG  1 
ATOM   4454  C  CD1 . LEU B  1 269 ? 119.975 183.656 148.979 1.00 28.87  ? 290 LEU B CD1 1 
ATOM   4455  C  CD2 . LEU B  1 269 ? 119.388 184.170 146.599 1.00 30.74  ? 290 LEU B CD2 1 
ATOM   4456  N  N   . SER B  1 270 ? 117.380 179.900 145.482 1.00 27.30  ? 291 SER B N   1 
ATOM   4457  C  CA  . SER B  1 270 ? 117.460 178.434 145.299 1.00 27.20  ? 291 SER B CA  1 
ATOM   4458  C  C   . SER B  1 270 ? 118.666 177.875 146.074 1.00 27.10  ? 291 SER B C   1 
ATOM   4459  O  O   . SER B  1 270 ? 119.540 178.646 146.443 1.00 26.94  ? 291 SER B O   1 
ATOM   4460  C  CB  . SER B  1 270 ? 117.569 178.058 143.863 1.00 27.66  ? 291 SER B CB  1 
ATOM   4461  O  OG  . SER B  1 270 ? 118.885 178.349 143.410 1.00 28.73  ? 291 SER B OG  1 
ATOM   4462  N  N   . PHE B  1 271 ? 118.716 176.556 146.308 1.00 26.20  ? 292 PHE B N   1 
ATOM   4463  C  CA  . PHE B  1 271 ? 119.865 175.968 147.010 1.00 25.26  ? 292 PHE B CA  1 
ATOM   4464  C  C   . PHE B  1 271 ? 121.092 176.243 146.144 1.00 25.71  ? 292 PHE B C   1 
ATOM   4465  O  O   . PHE B  1 271 ? 122.147 176.591 146.663 1.00 25.56  ? 292 PHE B O   1 
ATOM   4466  C  CB  . PHE B  1 271 ? 119.630 174.494 147.293 1.00 24.97  ? 292 PHE B CB  1 
ATOM   4467  C  CG  . PHE B  1 271 ? 120.646 173.947 148.244 1.00 24.58  ? 292 PHE B CG  1 
ATOM   4468  C  CD1 . PHE B  1 271 ? 120.443 174.046 149.603 1.00 24.18  ? 292 PHE B CD1 1 
ATOM   4469  C  CD2 . PHE B  1 271 ? 121.829 173.399 147.784 1.00 25.59  ? 292 PHE B CD2 1 
ATOM   4470  C  CE1 . PHE B  1 271 ? 121.390 173.588 150.499 1.00 24.03  ? 292 PHE B CE1 1 
ATOM   4471  C  CE2 . PHE B  1 271 ? 122.759 172.911 148.683 1.00 25.29  ? 292 PHE B CE2 1 
ATOM   4472  C  CZ  . PHE B  1 271 ? 122.539 173.018 150.033 1.00 24.69  ? 292 PHE B CZ  1 
ATOM   4473  N  N   . ARG B  1 272 ? 120.955 176.102 144.823 1.00 26.30  ? 293 ARG B N   1 
ATOM   4474  C  CA  . ARG B  1 272 ? 122.093 176.314 143.883 1.00 27.47  ? 293 ARG B CA  1 
ATOM   4475  C  C   . ARG B  1 272 ? 122.598 177.761 143.996 1.00 28.29  ? 293 ARG B C   1 
ATOM   4476  O  O   . ARG B  1 272 ? 123.816 177.957 143.992 1.00 28.71  ? 293 ARG B O   1 
ATOM   4477  C  CB  . ARG B  1 272 ? 121.678 175.957 142.453 1.00 28.06  ? 293 ARG B CB  1 
ATOM   4478  C  CG  . ARG B  1 272 ? 122.806 176.024 141.435 1.00 29.57  ? 293 ARG B CG  1 
ATOM   4479  C  CD  . ARG B  1 272 ? 124.088 175.345 141.872 1.00 29.94  ? 293 ARG B CD  1 
ATOM   4480  N  NE  . ARG B  1 272 ? 123.888 173.981 142.333 1.00 29.64  ? 293 ARG B NE  1 
ATOM   4481  C  CZ  . ARG B  1 272 ? 124.800 173.251 142.954 1.00 29.73  ? 293 ARG B CZ  1 
ATOM   4482  N  NH1 . ARG B  1 272 ? 125.998 173.747 143.194 1.00 29.72  ? 293 ARG B NH1 1 
ATOM   4483  N  NH2 . ARG B  1 272 ? 124.511 172.023 143.329 1.00 30.31  ? 293 ARG B NH2 1 
ATOM   4484  N  N   . ASP B  1 273 ? 121.677 178.718 144.107 1.00 28.46  ? 294 ASP B N   1 
ATOM   4485  C  CA  . ASP B  1 273 ? 121.987 180.152 144.315 1.00 29.81  ? 294 ASP B CA  1 
ATOM   4486  C  C   . ASP B  1 273 ? 122.898 180.281 145.553 1.00 29.03  ? 294 ASP B C   1 
ATOM   4487  O  O   . ASP B  1 273 ? 123.960 180.927 145.460 1.00 28.71  ? 294 ASP B O   1 
ATOM   4488  C  CB  . ASP B  1 273 ? 120.728 181.021 144.463 1.00 31.23  ? 294 ASP B CB  1 
ATOM   4489  C  CG  . ASP B  1 273 ? 119.826 181.201 143.242 1.00 33.11  ? 294 ASP B CG  1 
ATOM   4490  O  OD1 . ASP B  1 273 ? 120.266 180.866 142.097 1.00 35.69  ? 294 ASP B OD1 1 
ATOM   4491  O  OD2 . ASP B  1 273 ? 118.642 181.654 143.433 1.00 33.96  ? 294 ASP B OD2 1 
ATOM   4492  N  N   . VAL B  1 274 ? 122.597 179.579 146.648 1.00 28.28  ? 295 VAL B N   1 
ATOM   4493  C  CA  . VAL B  1 274 ? 123.434 179.711 147.878 1.00 28.22  ? 295 VAL B CA  1 
ATOM   4494  C  C   . VAL B  1 274 ? 124.806 179.078 147.677 1.00 28.45  ? 295 VAL B C   1 
ATOM   4495  O  O   . VAL B  1 274 ? 125.783 179.719 148.063 1.00 28.88  ? 295 VAL B O   1 
ATOM   4496  C  CB  . VAL B  1 274 ? 122.713 179.188 149.123 1.00 27.65  ? 295 VAL B CB  1 
ATOM   4497  C  CG1 . VAL B  1 274 ? 123.642 179.156 150.344 1.00 27.34  ? 295 VAL B CG1 1 
ATOM   4498  C  CG2 . VAL B  1 274 ? 121.469 180.044 149.399 1.00 27.90  ? 295 VAL B CG2 1 
ATOM   4499  N  N   . LEU B  1 275 ? 124.925 177.923 147.025 1.00 28.52  ? 296 LEU B N   1 
ATOM   4500  C  CA  . LEU B  1 275 ? 126.266 177.318 146.788 1.00 28.66  ? 296 LEU B CA  1 
ATOM   4501  C  C   . LEU B  1 275 ? 127.052 178.171 145.800 1.00 30.43  ? 296 LEU B C   1 
ATOM   4502  O  O   . LEU B  1 275 ? 128.289 178.216 145.952 1.00 30.61  ? 296 LEU B O   1 
ATOM   4503  C  CB  . LEU B  1 275 ? 126.136 175.874 146.299 1.00 28.58  ? 296 LEU B CB  1 
ATOM   4504  C  CG  . LEU B  1 275 ? 125.555 174.922 147.349 1.00 27.39  ? 296 LEU B CG  1 
ATOM   4505  C  CD1 . LEU B  1 275 ? 125.694 173.481 146.908 1.00 28.35  ? 296 LEU B CD1 1 
ATOM   4506  C  CD2 . LEU B  1 275 ? 126.183 175.127 148.713 1.00 26.58  ? 296 LEU B CD2 1 
ATOM   4507  N  N   . ASN B  1 276 ? 126.398 178.816 144.827 1.00 30.65  ? 297 ASN B N   1 
ATOM   4508  C  CA  . ASN B  1 276 ? 127.181 179.701 143.931 1.00 32.27  ? 297 ASN B CA  1 
ATOM   4509  C  C   . ASN B  1 276 ? 127.829 180.781 144.808 1.00 32.20  ? 297 ASN B C   1 
ATOM   4510  O  O   . ASN B  1 276 ? 129.006 181.122 144.606 1.00 33.07  ? 297 ASN B O   1 
ATOM   4511  C  CB  . ASN B  1 276 ? 126.345 180.325 142.814 1.00 33.37  ? 297 ASN B CB  1 
ATOM   4512  C  CG  . ASN B  1 276 ? 125.879 179.348 141.751 1.00 33.65  ? 297 ASN B CG  1 
ATOM   4513  O  OD1 . ASN B  1 276 ? 126.341 178.202 141.685 1.00 33.19  ? 297 ASN B OD1 1 
ATOM   4514  N  ND2 . ASN B  1 276 ? 124.991 179.827 140.888 1.00 33.98  ? 297 ASN B ND2 1 
ATOM   4515  N  N   . ILE B  1 277 ? 127.088 181.340 145.750 1.00 31.08  ? 298 ILE B N   1 
ATOM   4516  C  CA  . ILE B  1 277 ? 127.628 182.456 146.564 1.00 31.19  ? 298 ILE B CA  1 
ATOM   4517  C  C   . ILE B  1 277 ? 128.752 181.889 147.419 1.00 30.98  ? 298 ILE B C   1 
ATOM   4518  O  O   . ILE B  1 277 ? 129.788 182.487 147.475 1.00 32.12  ? 298 ILE B O   1 
ATOM   4519  C  CB  . ILE B  1 277 ? 126.511 183.096 147.394 1.00 30.19  ? 298 ILE B CB  1 
ATOM   4520  C  CG1 . ILE B  1 277 ? 125.561 183.890 146.501 1.00 31.22  ? 298 ILE B CG1 1 
ATOM   4521  C  CG2 . ILE B  1 277 ? 127.068 183.922 148.529 1.00 30.07  ? 298 ILE B CG2 1 
ATOM   4522  C  CD1 . ILE B  1 277 ? 124.208 184.141 147.179 1.00 30.61  ? 298 ILE B CD1 1 
ATOM   4523  N  N   . LEU B  1 278 ? 128.483 180.817 148.161 1.00 30.80  ? 299 LEU B N   1 
ATOM   4524  C  CA  . LEU B  1 278 ? 129.434 180.194 149.108 1.00 30.63  ? 299 LEU B CA  1 
ATOM   4525  C  C   . LEU B  1 278 ? 130.680 179.723 148.342 1.00 31.04  ? 299 LEU B C   1 
ATOM   4526  O  O   . LEU B  1 278 ? 131.762 179.973 148.820 1.00 30.53  ? 299 LEU B O   1 
ATOM   4527  C  CB  . LEU B  1 278 ? 128.762 179.008 149.805 1.00 30.49  ? 299 LEU B CB  1 
ATOM   4528  C  CG  . LEU B  1 278 ? 127.735 179.379 150.865 1.00 31.82  ? 299 LEU B CG  1 
ATOM   4529  C  CD1 . LEU B  1 278 ? 127.248 178.155 151.641 1.00 31.65  ? 299 LEU B CD1 1 
ATOM   4530  C  CD2 . LEU B  1 278 ? 128.312 180.399 151.840 1.00 33.30  ? 299 LEU B CD2 1 
ATOM   4531  N  N   . HIS B  1 279 ? 130.527 178.994 147.232 1.00 31.14  ? 300 HIS B N   1 
ATOM   4532  C  CA  . HIS B  1 279 ? 131.682 178.383 146.508 1.00 32.00  ? 300 HIS B CA  1 
ATOM   4533  C  C   . HIS B  1 279 ? 132.617 179.490 146.057 1.00 32.95  ? 300 HIS B C   1 
ATOM   4534  O  O   . HIS B  1 279 ? 133.839 179.267 146.087 1.00 33.69  ? 300 HIS B O   1 
ATOM   4535  C  CB  . HIS B  1 279 ? 131.245 177.477 145.340 1.00 32.02  ? 300 HIS B CB  1 
ATOM   4536  C  CG  . HIS B  1 279 ? 130.722 176.146 145.796 1.00 31.29  ? 300 HIS B CG  1 
ATOM   4537  N  ND1 . HIS B  1 279 ? 129.995 175.281 144.937 1.00 31.23  ? 300 HIS B ND1 1 
ATOM   4538  C  CD2 . HIS B  1 279 ? 130.822 175.520 146.998 1.00 30.07  ? 300 HIS B CD2 1 
ATOM   4539  C  CE1 . HIS B  1 279 ? 129.681 174.193 145.613 1.00 30.28  ? 300 HIS B CE1 1 
ATOM   4540  N  NE2 . HIS B  1 279 ? 130.153 174.327 146.887 1.00 29.81  ? 300 HIS B NE2 1 
ATOM   4541  N  N   . ASN B  1 280 ? 132.069 180.633 145.635 1.00 33.89  ? 301 ASN B N   1 
ATOM   4542  C  CA  . ASN B  1 280 ? 132.872 181.676 144.917 1.00 35.66  ? 301 ASN B CA  1 
ATOM   4543  C  C   . ASN B  1 280 ? 133.334 182.744 145.907 1.00 35.35  ? 301 ASN B C   1 
ATOM   4544  O  O   . ASN B  1 280 ? 134.190 183.478 145.582 1.00 35.49  ? 301 ASN B O   1 
ATOM   4545  C  CB  . ASN B  1 280 ? 132.089 182.263 143.764 1.00 37.37  ? 301 ASN B CB  1 
ATOM   4546  C  CG  . ASN B  1 280 ? 131.898 181.255 142.660 1.00 38.87  ? 301 ASN B CG  1 
ATOM   4547  O  OD1 . ASN B  1 280 ? 132.826 181.031 141.898 1.00 42.90  ? 301 ASN B OD1 1 
ATOM   4548  N  ND2 . ASN B  1 280 ? 130.715 180.683 142.528 1.00 38.92  ? 301 ASN B ND2 1 
ATOM   4549  N  N   . LEU B  1 281 ? 132.775 182.788 147.120 1.00 34.76  ? 302 LEU B N   1 
ATOM   4550  C  CA  . LEU B  1 281 ? 133.215 183.760 148.150 1.00 35.21  ? 302 LEU B CA  1 
ATOM   4551  C  C   . LEU B  1 281 ? 134.724 183.612 148.360 1.00 36.28  ? 302 LEU B C   1 
ATOM   4552  O  O   . LEU B  1 281 ? 135.177 182.512 148.629 1.00 35.92  ? 302 LEU B O   1 
ATOM   4553  C  CB  . LEU B  1 281 ? 132.455 183.461 149.447 1.00 33.95  ? 302 LEU B CB  1 
ATOM   4554  C  CG  . LEU B  1 281 ? 132.933 184.239 150.674 1.00 33.69  ? 302 LEU B CG  1 
ATOM   4555  C  CD1 . LEU B  1 281 ? 132.785 185.741 150.439 1.00 34.91  ? 302 LEU B CD1 1 
ATOM   4556  C  CD2 . LEU B  1 281 ? 132.199 183.837 151.936 1.00 32.66  ? 302 LEU B CD2 1 
ATOM   4557  N  N   . GLN B  1 282 ? 135.505 184.667 148.269 1.00 38.90  ? 303 GLN B N   1 
ATOM   4558  C  CA  . GLN B  1 282 ? 136.927 184.589 148.700 1.00 41.12  ? 303 GLN B CA  1 
ATOM   4559  C  C   . GLN B  1 282 ? 137.012 185.097 150.140 1.00 39.96  ? 303 GLN B C   1 
ATOM   4560  O  O   . GLN B  1 282 ? 136.571 186.229 150.392 1.00 39.61  ? 303 GLN B O   1 
ATOM   4561  C  CB  . GLN B  1 282 ? 137.846 185.404 147.810 1.00 44.73  ? 303 GLN B CB  1 
ATOM   4562  C  CG  . GLN B  1 282 ? 138.020 184.819 146.412 1.00 47.93  ? 303 GLN B CG  1 
ATOM   4563  C  CD  . GLN B  1 282 ? 138.831 185.778 145.561 1.00 52.48  ? 303 GLN B CD  1 
ATOM   4564  O  OE1 . GLN B  1 282 ? 139.917 186.257 145.947 1.00 54.69  ? 303 GLN B OE1 1 
ATOM   4565  N  NE2 . GLN B  1 282 ? 138.253 186.148 144.427 1.00 54.86  ? 303 GLN B NE2 1 
ATOM   4566  N  N   . ALA B  1 283 ? 137.556 184.295 151.053 1.00 38.66  ? 304 ALA B N   1 
ATOM   4567  C  CA  . ALA B  1 283 ? 137.438 184.564 152.509 1.00 37.70  ? 304 ALA B CA  1 
ATOM   4568  C  C   . ALA B  1 283 ? 138.261 183.543 153.286 1.00 36.52  ? 304 ALA B C   1 
ATOM   4569  O  O   . ALA B  1 283 ? 138.246 182.396 152.933 1.00 36.94  ? 304 ALA B O   1 
ATOM   4570  C  CB  . ALA B  1 283 ? 135.980 184.523 152.969 1.00 35.67  ? 304 ALA B CB  1 
ATOM   4571  N  N   . ASP B  1 284 ? 138.939 183.999 154.318 1.00 36.33  ? 305 ASP B N   1 
ATOM   4572  C  CA  . ASP B  1 284 ? 139.503 183.150 155.383 1.00 35.74  ? 305 ASP B CA  1 
ATOM   4573  C  C   . ASP B  1 284 ? 138.360 182.957 156.406 1.00 34.09  ? 305 ASP B C   1 
ATOM   4574  O  O   . ASP B  1 284 ? 138.116 183.871 157.244 1.00 34.47  ? 305 ASP B O   1 
ATOM   4575  C  CB  . ASP B  1 284 ? 140.801 183.801 155.849 1.00 37.19  ? 305 ASP B CB  1 
ATOM   4576  C  CG  . ASP B  1 284 ? 141.346 183.180 157.103 1.00 38.00  ? 305 ASP B CG  1 
ATOM   4577  O  OD1 . ASP B  1 284 ? 140.873 182.059 157.424 1.00 37.50  ? 305 ASP B OD1 1 
ATOM   4578  O  OD2 . ASP B  1 284 ? 142.225 183.824 157.764 1.00 39.53  ? 305 ASP B OD2 1 
ATOM   4579  N  N   . VAL B  1 285 ? 137.600 181.866 156.312 1.00 31.69  ? 306 VAL B N   1 
ATOM   4580  C  CA  . VAL B  1 285 ? 136.391 181.741 157.157 1.00 30.16  ? 306 VAL B CA  1 
ATOM   4581  C  C   . VAL B  1 285 ? 136.848 181.219 158.516 1.00 29.75  ? 306 VAL B C   1 
ATOM   4582  O  O   . VAL B  1 285 ? 137.525 180.185 158.548 1.00 29.14  ? 306 VAL B O   1 
ATOM   4583  C  CB  . VAL B  1 285 ? 135.353 180.810 156.528 1.00 29.16  ? 306 VAL B CB  1 
ATOM   4584  C  CG1 . VAL B  1 285 ? 134.087 180.776 157.348 1.00 28.21  ? 306 VAL B CG1 1 
ATOM   4585  C  CG2 . VAL B  1 285 ? 135.069 181.216 155.099 1.00 29.88  ? 306 VAL B CG2 1 
ATOM   4586  N  N   . VAL B  1 286 ? 136.551 181.969 159.575 1.00 29.78  ? 307 VAL B N   1 
ATOM   4587  C  CA  . VAL B  1 286 ? 137.008 181.660 160.946 1.00 30.48  ? 307 VAL B CA  1 
ATOM   4588  C  C   . VAL B  1 286 ? 135.877 181.008 161.728 1.00 29.66  ? 307 VAL B C   1 
ATOM   4589  O  O   . VAL B  1 286 ? 136.180 180.439 162.752 1.00 30.55  ? 307 VAL B O   1 
ATOM   4590  C  CB  . VAL B  1 286 ? 137.531 182.900 161.674 1.00 31.48  ? 307 VAL B CB  1 
ATOM   4591  C  CG1 . VAL B  1 286 ? 138.818 183.366 161.016 1.00 33.03  ? 307 VAL B CG1 1 
ATOM   4592  C  CG2 . VAL B  1 286 ? 136.493 183.997 161.765 1.00 30.92  ? 307 VAL B CG2 1 
ATOM   4593  N  N   . GLY B  1 287 ? 134.653 181.018 161.219 1.00 28.79  ? 308 GLY B N   1 
ATOM   4594  C  CA  . GLY B  1 287 ? 133.510 180.459 161.956 1.00 27.81  ? 308 GLY B CA  1 
ATOM   4595  C  C   . GLY B  1 287 ? 132.272 180.518 161.091 1.00 27.59  ? 308 GLY B C   1 
ATOM   4596  O  O   . GLY B  1 287 ? 132.248 181.318 160.101 1.00 28.40  ? 308 GLY B O   1 
ATOM   4597  N  N   . ALA B  1 288 ? 131.284 179.698 161.403 1.00 26.58  ? 309 ALA B N   1 
ATOM   4598  C  CA  . ALA B  1 288 ? 130.004 179.753 160.688 1.00 26.97  ? 309 ALA B CA  1 
ATOM   4599  C  C   . ALA B  1 288 ? 128.888 179.210 161.572 1.00 26.71  ? 309 ALA B C   1 
ATOM   4600  O  O   . ALA B  1 288 ? 129.161 178.551 162.619 1.00 26.49  ? 309 ALA B O   1 
ATOM   4601  C  CB  . ALA B  1 288 ? 130.113 179.073 159.340 1.00 26.83  ? 309 ALA B CB  1 
ATOM   4602  N  N   . ASP B  1 289 ? 127.657 179.545 161.201 1.00 27.02  ? 310 ASP B N   1 
ATOM   4603  C  CA  . ASP B  1 289 ? 126.496 178.882 161.807 1.00 26.48  ? 310 ASP B CA  1 
ATOM   4604  C  C   . ASP B  1 289 ? 125.503 178.545 160.701 1.00 26.14  ? 310 ASP B C   1 
ATOM   4605  O  O   . ASP B  1 289 ? 125.397 179.289 159.652 1.00 26.95  ? 310 ASP B O   1 
ATOM   4606  C  CB  . ASP B  1 289 ? 125.966 179.683 163.001 1.00 27.60  ? 310 ASP B CB  1 
ATOM   4607  C  CG  . ASP B  1 289 ? 125.420 181.076 162.701 1.00 28.68  ? 310 ASP B CG  1 
ATOM   4608  O  OD1 . ASP B  1 289 ? 124.598 181.183 161.783 1.00 30.12  ? 310 ASP B OD1 1 
ATOM   4609  O  OD2 . ASP B  1 289 ? 125.762 182.048 163.447 1.00 29.62  ? 310 ASP B OD2 1 
ATOM   4610  N  N   . VAL B  1 290 ? 124.765 177.468 160.961 1.00 25.44  ? 311 VAL B N   1 
ATOM   4611  C  CA  . VAL B  1 290 ? 123.505 177.120 160.261 1.00 24.24  ? 311 VAL B CA  1 
ATOM   4612  C  C   . VAL B  1 290 ? 122.365 177.126 161.273 1.00 23.87  ? 311 VAL B C   1 
ATOM   4613  O  O   . VAL B  1 290 ? 122.307 176.230 162.114 1.00 23.99  ? 311 VAL B O   1 
ATOM   4614  C  CB  . VAL B  1 290 ? 123.643 175.808 159.494 1.00 23.50  ? 311 VAL B CB  1 
ATOM   4615  C  CG1 . VAL B  1 290 ? 122.383 175.444 158.763 1.00 22.96  ? 311 VAL B CG1 1 
ATOM   4616  C  CG2 . VAL B  1 290 ? 124.785 175.928 158.476 1.00 24.68  ? 311 VAL B CG2 1 
ATOM   4617  N  N   . VAL B  1 291 ? 121.442 178.080 161.122 1.00 23.27  ? 312 VAL B N   1 
ATOM   4618  C  CA  . VAL B  1 291 ? 120.381 178.307 162.126 1.00 23.14  ? 312 VAL B CA  1 
ATOM   4619  C  C   . VAL B  1 291 ? 118.990 178.245 161.486 1.00 23.34  ? 312 VAL B C   1 
ATOM   4620  O  O   . VAL B  1 291 ? 118.874 178.279 160.266 1.00 21.95  ? 312 VAL B O   1 
ATOM   4621  C  CB  . VAL B  1 291 ? 120.621 179.624 162.859 1.00 23.86  ? 312 VAL B CB  1 
ATOM   4622  C  CG1 . VAL B  1 291 ? 121.960 179.623 163.542 1.00 23.84  ? 312 VAL B CG1 1 
ATOM   4623  C  CG2 . VAL B  1 291 ? 120.510 180.824 161.925 1.00 24.65  ? 312 VAL B CG2 1 
ATOM   4624  N  N   . GLU B  1 292 ? 117.986 178.083 162.351 1.00 23.87  ? 313 GLU B N   1 
ATOM   4625  C  CA  . GLU B  1 292 ? 116.539 178.327 162.089 1.00 24.63  ? 313 GLU B CA  1 
ATOM   4626  C  C   . GLU B  1 292 ? 115.993 177.174 161.250 1.00 23.59  ? 313 GLU B C   1 
ATOM   4627  O  O   . GLU B  1 292 ? 114.891 177.296 160.701 1.00 24.01  ? 313 GLU B O   1 
ATOM   4628  C  CB  . GLU B  1 292 ? 116.314 179.729 161.496 1.00 24.60  ? 313 GLU B CB  1 
ATOM   4629  C  CG  . GLU B  1 292 ? 116.594 180.832 162.505 1.00 25.70  ? 313 GLU B CG  1 
ATOM   4630  C  CD  . GLU B  1 292 ? 115.551 181.071 163.577 1.00 27.28  ? 313 GLU B CD  1 
ATOM   4631  O  OE1 . GLU B  1 292 ? 114.443 180.430 163.478 1.00 27.12  ? 313 GLU B OE1 1 
ATOM   4632  O  OE2 . GLU B  1 292 ? 115.821 181.906 164.518 1.00 28.98  ? 313 GLU B OE2 1 
ATOM   4633  N  N   . PHE B  1 293 ? 116.709 176.064 161.168 1.00 22.87  ? 314 PHE B N   1 
ATOM   4634  C  CA  . PHE B  1 293 ? 116.062 174.813 160.704 1.00 21.86  ? 314 PHE B CA  1 
ATOM   4635  C  C   . PHE B  1 293 ? 115.096 174.390 161.808 1.00 23.06  ? 314 PHE B C   1 
ATOM   4636  O  O   . PHE B  1 293 ? 115.540 174.207 162.953 1.00 22.64  ? 314 PHE B O   1 
ATOM   4637  C  CB  . PHE B  1 293 ? 117.088 173.740 160.374 1.00 21.83  ? 314 PHE B CB  1 
ATOM   4638  C  CG  . PHE B  1 293 ? 116.576 172.330 160.234 1.00 21.94  ? 314 PHE B CG  1 
ATOM   4639  C  CD1 . PHE B  1 293 ? 115.373 172.056 159.586 1.00 22.42  ? 314 PHE B CD1 1 
ATOM   4640  C  CD2 . PHE B  1 293 ? 117.298 171.269 160.752 1.00 21.90  ? 314 PHE B CD2 1 
ATOM   4641  C  CE1 . PHE B  1 293 ? 114.907 170.750 159.484 1.00 22.47  ? 314 PHE B CE1 1 
ATOM   4642  C  CE2 . PHE B  1 293 ? 116.823 169.965 160.666 1.00 21.67  ? 314 PHE B CE2 1 
ATOM   4643  C  CZ  . PHE B  1 293 ? 115.623 169.711 160.048 1.00 22.16  ? 314 PHE B CZ  1 
ATOM   4644  N  N   . ASN B  1 294 ? 113.811 174.275 161.455 1.00 22.72  ? 315 ASN B N   1 
ATOM   4645  C  CA  . ASN B  1 294 ? 112.711 173.886 162.342 1.00 22.24  ? 315 ASN B CA  1 
ATOM   4646  C  C   . ASN B  1 294 ? 112.186 172.508 161.917 1.00 22.53  ? 315 ASN B C   1 
ATOM   4647  O  O   . ASN B  1 294 ? 111.230 172.404 161.125 1.00 21.49  ? 315 ASN B O   1 
ATOM   4648  C  CB  . ASN B  1 294 ? 111.600 174.947 162.313 1.00 22.60  ? 315 ASN B CB  1 
ATOM   4649  C  CG  . ASN B  1 294 ? 110.615 174.667 163.433 1.00 23.11  ? 315 ASN B CG  1 
ATOM   4650  O  OD1 . ASN B  1 294 ? 110.443 173.494 163.823 1.00 22.15  ? 315 ASN B OD1 1 
ATOM   4651  N  ND2 . ASN B  1 294 ? 109.939 175.700 163.912 1.00 23.31  ? 315 ASN B ND2 1 
ATOM   4652  N  N   . PRO B  1 295 ? 112.709 171.414 162.532 1.00 22.49  ? 316 PRO B N   1 
ATOM   4653  C  CA  . PRO B  1 295 ? 112.285 170.068 162.173 1.00 22.54  ? 316 PRO B CA  1 
ATOM   4654  C  C   . PRO B  1 295 ? 110.764 169.881 162.296 1.00 22.86  ? 316 PRO B C   1 
ATOM   4655  O  O   . PRO B  1 295 ? 110.220 169.114 161.570 1.00 22.40  ? 316 PRO B O   1 
ATOM   4656  C  CB  . PRO B  1 295 ? 113.017 169.148 163.160 1.00 22.79  ? 316 PRO B CB  1 
ATOM   4657  C  CG  . PRO B  1 295 ? 114.155 169.995 163.720 1.00 22.78  ? 316 PRO B CG  1 
ATOM   4658  C  CD  . PRO B  1 295 ? 113.733 171.432 163.586 1.00 22.55  ? 316 PRO B CD  1 
ATOM   4659  N  N   . GLN B  1 296 ? 110.110 170.585 163.208 1.00 23.65  ? 317 GLN B N   1 
ATOM   4660  C  CA  . GLN B  1 296 ? 108.664 170.423 163.415 1.00 25.06  ? 317 GLN B CA  1 
ATOM   4661  C  C   . GLN B  1 296 ? 107.944 170.921 162.163 1.00 25.42  ? 317 GLN B C   1 
ATOM   4662  O  O   . GLN B  1 296 ? 106.784 170.566 162.030 1.00 26.50  ? 317 GLN B O   1 
ATOM   4663  C  CB  . GLN B  1 296 ? 108.213 171.112 164.713 1.00 27.63  ? 317 GLN B CB  1 
ATOM   4664  C  CG  . GLN B  1 296 ? 108.815 170.404 165.928 1.00 30.82  ? 317 GLN B CG  1 
ATOM   4665  C  CD  . GLN B  1 296 ? 108.483 170.875 167.340 1.00 33.77  ? 317 GLN B CD  1 
ATOM   4666  O  OE1 . GLN B  1 296 ? 108.792 172.030 167.719 1.00 32.99  ? 317 GLN B OE1 1 
ATOM   4667  N  NE2 . GLN B  1 296 ? 107.946 169.929 168.143 1.00 32.99  ? 317 GLN B NE2 1 
ATOM   4668  N  N   . ARG B  1 297 ? 108.569 171.756 161.319 1.00 24.31  ? 318 ARG B N   1 
ATOM   4669  C  CA  . ARG B  1 297 ? 107.882 172.360 160.164 1.00 25.90  ? 318 ARG B CA  1 
ATOM   4670  C  C   . ARG B  1 297 ? 108.373 171.657 158.894 1.00 24.30  ? 318 ARG B C   1 
ATOM   4671  O  O   . ARG B  1 297 ? 107.953 172.075 157.808 1.00 23.14  ? 318 ARG B O   1 
ATOM   4672  C  CB  . ARG B  1 297 ? 108.153 173.876 160.122 1.00 28.06  ? 318 ARG B CB  1 
ATOM   4673  C  CG  . ARG B  1 297 ? 107.423 174.678 161.188 1.00 30.54  ? 318 ARG B CG  1 
ATOM   4674  C  CD  . ARG B  1 297 ? 105.951 174.609 160.836 1.00 34.09  ? 318 ARG B CD  1 
ATOM   4675  N  NE  . ARG B  1 297 ? 105.090 175.783 160.989 1.00 37.32  ? 318 ARG B NE  1 
ATOM   4676  C  CZ  . ARG B  1 297 ? 105.181 176.908 160.279 1.00 40.25  ? 318 ARG B CZ  1 
ATOM   4677  N  NH1 . ARG B  1 297 ? 106.172 177.124 159.399 1.00 42.06  ? 318 ARG B NH1 1 
ATOM   4678  N  NH2 . ARG B  1 297 ? 104.283 177.842 160.492 1.00 40.14  ? 318 ARG B NH2 1 
ATOM   4679  N  N   . ASP B  1 298 ? 109.225 170.641 159.032 1.00 22.59  ? 319 ASP B N   1 
ATOM   4680  C  CA  . ASP B  1 298 ? 109.894 170.005 157.878 1.00 22.39  ? 319 ASP B CA  1 
ATOM   4681  C  C   . ASP B  1 298 ? 108.915 169.035 157.223 1.00 22.36  ? 319 ASP B C   1 
ATOM   4682  O  O   . ASP B  1 298 ? 107.917 168.707 157.813 1.00 20.56  ? 319 ASP B O   1 
ATOM   4683  C  CB  . ASP B  1 298 ? 111.142 169.228 158.278 1.00 22.67  ? 319 ASP B CB  1 
ATOM   4684  C  CG  . ASP B  1 298 ? 112.188 169.088 157.179 1.00 22.79  ? 319 ASP B CG  1 
ATOM   4685  O  OD1 . ASP B  1 298 ? 111.907 169.499 156.021 1.00 23.16  ? 319 ASP B OD1 1 
ATOM   4686  O  OD2 . ASP B  1 298 ? 113.254 168.526 157.470 1.00 22.12  ? 319 ASP B OD2 1 
ATOM   4687  N  N   . THR B  1 299 ? 109.219 168.597 156.002 1.00 22.70  ? 320 THR B N   1 
ATOM   4688  C  CA  . THR B  1 299 ? 108.468 167.498 155.351 1.00 23.25  ? 320 THR B CA  1 
ATOM   4689  C  C   . THR B  1 299 ? 108.615 166.226 156.205 1.00 24.02  ? 320 THR B C   1 
ATOM   4690  O  O   . THR B  1 299 ? 109.576 166.120 156.995 1.00 22.65  ? 320 THR B O   1 
ATOM   4691  C  CB  . THR B  1 299 ? 108.961 167.277 153.917 1.00 23.60  ? 320 THR B CB  1 
ATOM   4692  O  OG1 . THR B  1 299 ? 110.223 166.590 153.891 1.00 23.32  ? 320 THR B OG1 1 
ATOM   4693  C  CG2 . THR B  1 299 ? 109.006 168.559 153.113 1.00 23.52  ? 320 THR B CG2 1 
ATOM   4694  N  N   . VAL B  1 300 ? 107.750 165.236 155.999 1.00 25.26  ? 321 VAL B N   1 
ATOM   4695  C  CA  . VAL B  1 300 ? 107.818 163.953 156.765 1.00 26.98  ? 321 VAL B CA  1 
ATOM   4696  C  C   . VAL B  1 300 ? 109.101 163.185 156.436 1.00 26.79  ? 321 VAL B C   1 
ATOM   4697  O  O   . VAL B  1 300 ? 109.506 162.419 157.230 1.00 28.26  ? 321 VAL B O   1 
ATOM   4698  C  CB  . VAL B  1 300 ? 106.582 163.073 156.502 1.00 28.61  ? 321 VAL B CB  1 
ATOM   4699  C  CG1 . VAL B  1 300 ? 105.288 163.837 156.730 1.00 28.11  ? 321 VAL B CG1 1 
ATOM   4700  C  CG2 . VAL B  1 300 ? 106.642 162.523 155.085 1.00 29.55  ? 321 VAL B CG2 1 
ATOM   4701  N  N   . ASP B  1 301 ? 109.743 163.405 155.307 1.00 27.44  ? 322 ASP B N   1 
ATOM   4702  C  CA  . ASP B  1 301 ? 111.010 162.723 154.952 1.00 27.71  ? 322 ASP B CA  1 
ATOM   4703  C  C   . ASP B  1 301 ? 112.209 163.586 155.333 1.00 26.47  ? 322 ASP B C   1 
ATOM   4704  O  O   . ASP B  1 301 ? 113.274 163.213 155.074 1.00 26.56  ? 322 ASP B O   1 
ATOM   4705  C  CB  . ASP B  1 301 ? 110.988 162.338 153.469 1.00 29.21  ? 322 ASP B CB  1 
ATOM   4706  C  CG  . ASP B  1 301 ? 109.859 161.352 153.142 1.00 31.58  ? 322 ASP B CG  1 
ATOM   4707  O  OD1 . ASP B  1 301 ? 109.675 160.410 153.932 1.00 33.78  ? 322 ASP B OD1 1 
ATOM   4708  O  OD2 . ASP B  1 301 ? 109.119 161.565 152.110 1.00 32.62  ? 322 ASP B OD2 1 
ATOM   4709  N  N   . GLY B  1 302 ? 112.040 164.761 155.904 1.00 27.25  ? 323 GLY B N   1 
ATOM   4710  C  CA  . GLY B  1 302 ? 113.183 165.557 156.406 1.00 25.84  ? 323 GLY B CA  1 
ATOM   4711  C  C   . GLY B  1 302 ? 113.935 166.229 155.276 1.00 25.66  ? 323 GLY B C   1 
ATOM   4712  O  O   . GLY B  1 302 ? 115.178 166.242 155.356 1.00 25.46  ? 323 GLY B O   1 
ATOM   4713  N  N   . MET B  1 303 ? 113.243 166.829 154.294 1.00 24.16  ? 324 MET B N   1 
ATOM   4714  C  CA  . MET B  1 303 ? 113.955 167.476 153.156 1.00 23.96  ? 324 MET B CA  1 
ATOM   4715  C  C   . MET B  1 303 ? 114.840 168.637 153.659 1.00 22.59  ? 324 MET B C   1 
ATOM   4716  O  O   . MET B  1 303 ? 115.955 168.837 153.157 1.00 21.59  ? 324 MET B O   1 
ATOM   4717  C  CB  . MET B  1 303 ? 112.954 167.987 152.107 1.00 23.89  ? 324 MET B CB  1 
ATOM   4718  C  CG  . MET B  1 303 ? 113.612 168.663 150.907 1.00 23.92  ? 324 MET B CG  1 
ATOM   4719  S  SD  . MET B  1 303 ? 112.447 168.941 149.532 1.00 24.63  ? 324 MET B SD  1 
ATOM   4720  C  CE  . MET B  1 303 ? 111.619 170.394 150.192 1.00 25.15  ? 324 MET B CE  1 
ATOM   4721  N  N   . THR B  1 304 ? 114.325 169.408 154.600 1.00 22.11  ? 325 THR B N   1 
ATOM   4722  C  CA  . THR B  1 304 ? 115.035 170.583 155.137 1.00 21.76  ? 325 THR B CA  1 
ATOM   4723  C  C   . THR B  1 304 ? 116.208 170.095 155.972 1.00 21.51  ? 325 THR B C   1 
ATOM   4724  O  O   . THR B  1 304 ? 117.238 170.817 155.961 1.00 20.41  ? 325 THR B O   1 
ATOM   4725  C  CB  . THR B  1 304 ? 114.104 171.565 155.852 1.00 22.40  ? 325 THR B CB  1 
ATOM   4726  O  OG1 . THR B  1 304 ? 112.897 171.808 155.100 1.00 23.63  ? 325 THR B OG1 1 
ATOM   4727  C  CG2 . THR B  1 304 ? 114.792 172.897 156.083 1.00 22.53  ? 325 THR B CG2 1 
ATOM   4728  N  N   . ALA B  1 305 ? 116.087 168.935 156.645 1.00 21.13  ? 326 ALA B N   1 
ATOM   4729  C  CA  . ALA B  1 305 ? 117.248 168.399 157.374 1.00 21.67  ? 326 ALA B CA  1 
ATOM   4730  C  C   . ALA B  1 305 ? 118.372 168.196 156.348 1.00 22.62  ? 326 ALA B C   1 
ATOM   4731  O  O   . ALA B  1 305 ? 119.534 168.379 156.737 1.00 22.48  ? 326 ALA B O   1 
ATOM   4732  C  CB  . ALA B  1 305 ? 116.916 167.119 158.143 1.00 21.77  ? 326 ALA B CB  1 
ATOM   4733  N  N   . MET B  1 306 ? 118.060 167.757 155.109 1.00 23.64  ? 327 MET B N   1 
ATOM   4734  C  CA  . MET B  1 306 ? 119.097 167.396 154.104 1.00 24.62  ? 327 MET B CA  1 
ATOM   4735  C  C   . MET B  1 306 ? 119.690 168.701 153.598 1.00 23.81  ? 327 MET B C   1 
ATOM   4736  O  O   . MET B  1 306 ? 120.888 168.763 153.338 1.00 24.20  ? 327 MET B O   1 
ATOM   4737  C  CB  . MET B  1 306 ? 118.552 166.570 152.935 1.00 26.68  ? 327 MET B CB  1 
ATOM   4738  C  CG  . MET B  1 306 ? 118.036 165.206 153.366 1.00 30.40  ? 327 MET B CG  1 
ATOM   4739  S  SD  . MET B  1 306 ? 119.305 163.984 153.993 1.00 35.89  ? 327 MET B SD  1 
ATOM   4740  C  CE  . MET B  1 306 ? 120.584 164.148 152.760 1.00 36.36  ? 327 MET B CE  1 
ATOM   4741  N  N   . VAL B  1 307 ? 118.859 169.718 153.484 1.00 23.61  ? 328 VAL B N   1 
ATOM   4742  C  CA  . VAL B  1 307 ? 119.279 171.088 153.090 1.00 23.45  ? 328 VAL B CA  1 
ATOM   4743  C  C   . VAL B  1 307 ? 120.283 171.653 154.109 1.00 23.63  ? 328 VAL B C   1 
ATOM   4744  O  O   . VAL B  1 307 ? 121.408 172.054 153.709 1.00 23.69  ? 328 VAL B O   1 
ATOM   4745  C  CB  . VAL B  1 307 ? 118.043 171.971 152.898 1.00 23.40  ? 328 VAL B CB  1 
ATOM   4746  C  CG1 . VAL B  1 307 ? 118.370 173.459 152.996 1.00 23.67  ? 328 VAL B CG1 1 
ATOM   4747  C  CG2 . VAL B  1 307 ? 117.388 171.632 151.569 1.00 23.69  ? 328 VAL B CG2 1 
ATOM   4748  N  N   . ALA B  1 308 ? 119.913 171.640 155.390 1.00 23.52  ? 329 ALA B N   1 
ATOM   4749  C  CA  . ALA B  1 308 ? 120.745 172.146 156.487 1.00 23.58  ? 329 ALA B CA  1 
ATOM   4750  C  C   . ALA B  1 308 ? 122.016 171.301 156.504 1.00 23.69  ? 329 ALA B C   1 
ATOM   4751  O  O   . ALA B  1 308 ? 123.106 171.869 156.654 1.00 23.49  ? 329 ALA B O   1 
ATOM   4752  C  CB  . ALA B  1 308 ? 119.979 172.092 157.800 1.00 24.30  ? 329 ALA B CB  1 
ATOM   4753  N  N   . ALA B  1 309 ? 121.904 169.990 156.287 1.00 23.50  ? 330 ALA B N   1 
ATOM   4754  C  CA  . ALA B  1 309 ? 123.096 169.112 156.328 1.00 24.23  ? 330 ALA B CA  1 
ATOM   4755  C  C   . ALA B  1 309 ? 124.037 169.466 155.173 1.00 24.88  ? 330 ALA B C   1 
ATOM   4756  O  O   . ALA B  1 309 ? 125.267 169.473 155.388 1.00 25.48  ? 330 ALA B O   1 
ATOM   4757  C  CB  . ALA B  1 309 ? 122.735 167.646 156.303 1.00 24.54  ? 330 ALA B CB  1 
ATOM   4758  N  N   . LYS B  1 310 ? 123.506 169.708 153.982 1.00 24.37  ? 331 LYS B N   1 
ATOM   4759  C  CA  . LYS B  1 310 ? 124.395 169.977 152.830 1.00 24.60  ? 331 LYS B CA  1 
ATOM   4760  C  C   . LYS B  1 310 ? 125.030 171.377 153.001 1.00 24.31  ? 331 LYS B C   1 
ATOM   4761  O  O   . LYS B  1 310 ? 126.197 171.528 152.709 1.00 23.69  ? 331 LYS B O   1 
ATOM   4762  C  CB  . LYS B  1 310 ? 123.623 169.821 151.529 1.00 24.93  ? 331 LYS B CB  1 
ATOM   4763  C  CG  . LYS B  1 310 ? 124.523 170.011 150.324 1.00 26.30  ? 331 LYS B CG  1 
ATOM   4764  C  CD  . LYS B  1 310 ? 124.104 169.289 149.137 1.00 26.80  ? 331 LYS B CD  1 
ATOM   4765  C  CE  . LYS B  1 310 ? 125.135 169.441 148.048 1.00 28.07  ? 331 LYS B CE  1 
ATOM   4766  N  NZ  . LYS B  1 310 ? 124.638 168.939 146.751 1.00 28.72  ? 331 LYS B NZ  1 
ATOM   4767  N  N   . LEU B  1 311 ? 124.312 172.350 153.574 1.00 23.93  ? 332 LEU B N   1 
ATOM   4768  C  CA  . LEU B  1 311 ? 124.915 173.669 153.877 1.00 24.08  ? 332 LEU B CA  1 
ATOM   4769  C  C   . LEU B  1 311 ? 126.103 173.480 154.832 1.00 23.99  ? 332 LEU B C   1 
ATOM   4770  O  O   . LEU B  1 311 ? 127.176 174.064 154.557 1.00 24.65  ? 332 LEU B O   1 
ATOM   4771  C  CB  . LEU B  1 311 ? 123.872 174.623 154.455 1.00 24.48  ? 332 LEU B CB  1 
ATOM   4772  C  CG  . LEU B  1 311 ? 122.774 175.036 153.473 1.00 25.40  ? 332 LEU B CG  1 
ATOM   4773  C  CD1 . LEU B  1 311 ? 121.682 175.721 154.223 1.00 25.56  ? 332 LEU B CD1 1 
ATOM   4774  C  CD2 . LEU B  1 311 ? 123.281 175.946 152.371 1.00 26.29  ? 332 LEU B CD2 1 
ATOM   4775  N  N   . VAL B  1 312 ? 125.953 172.648 155.858 1.00 23.60  ? 333 VAL B N   1 
ATOM   4776  C  CA  . VAL B  1 312 ? 127.016 172.320 156.855 1.00 23.56  ? 333 VAL B CA  1 
ATOM   4777  C  C   . VAL B  1 312 ? 128.195 171.656 156.168 1.00 24.33  ? 333 VAL B C   1 
ATOM   4778  O  O   . VAL B  1 312 ? 129.322 172.003 156.528 1.00 24.25  ? 333 VAL B O   1 
ATOM   4779  C  CB  . VAL B  1 312 ? 126.490 171.469 158.027 1.00 23.20  ? 333 VAL B CB  1 
ATOM   4780  C  CG1 . VAL B  1 312 ? 127.606 170.959 158.927 1.00 23.78  ? 333 VAL B CG1 1 
ATOM   4781  C  CG2 . VAL B  1 312 ? 125.504 172.247 158.883 1.00 22.93  ? 333 VAL B CG2 1 
ATOM   4782  N  N   . ARG B  1 313 ? 127.940 170.731 155.235 1.00 24.99  ? 334 ARG B N   1 
ATOM   4783  C  CA  . ARG B  1 313 ? 128.987 169.948 154.521 1.00 25.94  ? 334 ARG B CA  1 
ATOM   4784  C  C   . ARG B  1 313 ? 129.765 170.925 153.643 1.00 26.70  ? 334 ARG B C   1 
ATOM   4785  O  O   . ARG B  1 313 ? 131.006 170.861 153.651 1.00 27.40  ? 334 ARG B O   1 
ATOM   4786  C  CB  . ARG B  1 313 ? 128.416 168.792 153.685 1.00 26.64  ? 334 ARG B CB  1 
ATOM   4787  C  CG  . ARG B  1 313 ? 127.730 167.683 154.488 1.00 26.39  ? 334 ARG B CG  1 
ATOM   4788  C  CD  . ARG B  1 313 ? 126.747 166.775 153.736 1.00 26.37  ? 334 ARG B CD  1 
ATOM   4789  N  NE  . ARG B  1 313 ? 127.386 166.301 152.528 1.00 27.63  ? 334 ARG B NE  1 
ATOM   4790  C  CZ  . ARG B  1 313 ? 127.619 165.050 152.164 1.00 29.30  ? 334 ARG B CZ  1 
ATOM   4791  N  NH1 . ARG B  1 313 ? 128.302 164.803 151.044 1.00 30.38  ? 334 ARG B NH1 1 
ATOM   4792  N  NH2 . ARG B  1 313 ? 127.146 164.047 152.882 1.00 30.63  ? 334 ARG B NH2 1 
ATOM   4793  N  N   . GLU B  1 314 ? 129.103 171.858 152.965 1.00 27.14  ? 335 GLU B N   1 
ATOM   4794  C  CA  . GLU B  1 314 ? 129.826 172.798 152.034 1.00 27.68  ? 335 GLU B CA  1 
ATOM   4795  C  C   . GLU B  1 314 ? 130.554 173.885 152.832 1.00 27.20  ? 335 GLU B C   1 
ATOM   4796  O  O   . GLU B  1 314 ? 131.708 174.240 152.511 1.00 27.96  ? 335 GLU B O   1 
ATOM   4797  C  CB  . GLU B  1 314 ? 128.862 173.343 151.011 1.00 27.88  ? 335 GLU B CB  1 
ATOM   4798  C  CG  . GLU B  1 314 ? 128.274 172.224 150.176 1.00 28.79  ? 335 GLU B CG  1 
ATOM   4799  C  CD  . GLU B  1 314 ? 129.317 171.486 149.351 1.00 30.66  ? 335 GLU B CD  1 
ATOM   4800  O  OE1 . GLU B  1 314 ? 130.293 172.186 148.877 1.00 32.06  ? 335 GLU B OE1 1 
ATOM   4801  O  OE2 . GLU B  1 314 ? 129.177 170.237 149.200 1.00 30.04  ? 335 GLU B OE2 1 
ATOM   4802  N  N   . LEU B  1 315 ? 129.997 174.303 153.945 1.00 26.22  ? 336 LEU B N   1 
ATOM   4803  C  CA  . LEU B  1 315 ? 130.753 175.221 154.844 1.00 26.31  ? 336 LEU B CA  1 
ATOM   4804  C  C   . LEU B  1 315 ? 132.013 174.539 155.397 1.00 26.17  ? 336 LEU B C   1 
ATOM   4805  O  O   . LEU B  1 315 ? 133.021 175.187 155.477 1.00 25.71  ? 336 LEU B O   1 
ATOM   4806  C  CB  . LEU B  1 315 ? 129.826 175.682 155.958 1.00 26.01  ? 336 LEU B CB  1 
ATOM   4807  C  CG  . LEU B  1 315 ? 128.822 176.765 155.561 1.00 26.13  ? 336 LEU B CG  1 
ATOM   4808  C  CD1 . LEU B  1 315 ? 127.861 177.054 156.677 1.00 25.44  ? 336 LEU B CD1 1 
ATOM   4809  C  CD2 . LEU B  1 315 ? 129.552 178.047 155.227 1.00 28.14  ? 336 LEU B CD2 1 
ATOM   4810  N  N   . ALA B  1 316 ? 131.934 173.267 155.793 1.00 26.16  ? 337 ALA B N   1 
ATOM   4811  C  CA  . ALA B  1 316 ? 133.080 172.506 156.328 1.00 27.28  ? 337 ALA B CA  1 
ATOM   4812  C  C   . ALA B  1 316 ? 134.207 172.437 155.275 1.00 28.55  ? 337 ALA B C   1 
ATOM   4813  O  O   . ALA B  1 316 ? 135.407 172.517 155.644 1.00 28.77  ? 337 ALA B O   1 
ATOM   4814  C  CB  . ALA B  1 316 ? 132.662 171.105 156.747 1.00 27.08  ? 337 ALA B CB  1 
ATOM   4815  N  N   . ALA B  1 317 ? 133.870 172.193 154.015 1.00 28.84  ? 338 ALA B N   1 
ATOM   4816  C  CA  . ALA B  1 317 ? 134.890 172.068 152.946 1.00 30.46  ? 338 ALA B CA  1 
ATOM   4817  C  C   . ALA B  1 317 ? 135.587 173.439 152.831 1.00 31.95  ? 338 ALA B C   1 
ATOM   4818  O  O   . ALA B  1 317 ? 136.805 173.523 152.620 1.00 33.06  ? 338 ALA B O   1 
ATOM   4819  C  CB  . ALA B  1 317 ? 134.217 171.644 151.667 1.00 30.41  ? 338 ALA B CB  1 
ATOM   4820  N  N   . LYS B  1 318 ? 134.804 174.498 153.007 1.00 31.37  ? 339 LYS B N   1 
ATOM   4821  C  CA  . LYS B  1 318 ? 135.287 175.884 152.869 1.00 32.34  ? 339 LYS B CA  1 
ATOM   4822  C  C   . LYS B  1 318 ? 136.155 176.241 154.093 1.00 31.94  ? 339 LYS B C   1 
ATOM   4823  O  O   . LYS B  1 318 ? 137.164 176.863 153.941 1.00 33.35  ? 339 LYS B O   1 
ATOM   4824  C  CB  . LYS B  1 318 ? 134.063 176.785 152.688 1.00 31.77  ? 339 LYS B CB  1 
ATOM   4825  C  CG  . LYS B  1 318 ? 134.404 178.203 152.277 1.00 33.07  ? 339 LYS B CG  1 
ATOM   4826  C  CD  . LYS B  1 318 ? 133.213 179.002 151.777 1.00 32.58  ? 339 LYS B CD  1 
ATOM   4827  C  CE  . LYS B  1 318 ? 133.669 180.194 150.953 1.00 34.25  ? 339 LYS B CE  1 
ATOM   4828  N  NZ  . LYS B  1 318 ? 134.410 179.800 149.709 1.00 35.79  ? 339 LYS B NZ  1 
ATOM   4829  N  N   . ILE B  1 319 ? 135.752 175.887 155.289 1.00 30.58  ? 340 ILE B N   1 
ATOM   4830  C  CA  . ILE B  1 319 ? 136.464 176.319 156.517 1.00 30.59  ? 340 ILE B CA  1 
ATOM   4831  C  C   . ILE B  1 319 ? 137.692 175.434 156.655 1.00 31.81  ? 340 ILE B C   1 
ATOM   4832  O  O   . ILE B  1 319 ? 138.766 175.965 157.012 1.00 32.87  ? 340 ILE B O   1 
ATOM   4833  C  CB  . ILE B  1 319 ? 135.519 176.211 157.730 1.00 29.30  ? 340 ILE B CB  1 
ATOM   4834  C  CG1 . ILE B  1 319 ? 134.402 177.241 157.620 1.00 28.50  ? 340 ILE B CG1 1 
ATOM   4835  C  CG2 . ILE B  1 319 ? 136.297 176.317 159.030 1.00 29.69  ? 340 ILE B CG2 1 
ATOM   4836  C  CD1 . ILE B  1 319 ? 133.306 177.073 158.644 1.00 28.04  ? 340 ILE B CD1 1 
ATOM   4837  N  N   . SER B  1 320 ? 137.560 174.134 156.391 1.00 31.82  ? 341 SER B N   1 
ATOM   4838  C  CA  . SER B  1 320 ? 138.684 173.180 156.527 1.00 33.84  ? 341 SER B CA  1 
ATOM   4839  C  C   . SER B  1 320 ? 139.720 173.451 155.424 1.00 35.91  ? 341 SER B C   1 
ATOM   4840  O  O   . SER B  1 320 ? 139.322 173.732 154.285 1.00 35.91  ? 341 SER B O   1 
ATOM   4841  C  CB  . SER B  1 320 ? 138.205 171.762 156.543 1.00 33.28  ? 341 SER B CB  1 
ATOM   4842  O  OG  . SER B  1 320 ? 137.326 171.577 157.634 1.00 32.20  ? 341 SER B OG  1 
ATOM   4843  N  N   . LYS B  1 321 ? 140.999 173.427 155.767 1.00 38.08  ? 342 LYS B N   1 
ATOM   4844  C  CA  . LYS B  1 321 ? 142.089 173.610 154.772 1.00 41.90  ? 342 LYS B CA  1 
ATOM   4845  C  C   . LYS B  1 321 ? 143.434 173.164 155.360 1.00 43.48  ? 342 LYS B C   1 
ATOM   4846  O  O   . LYS B  1 321 ? 143.574 172.656 156.500 1.00 43.76  ? 342 LYS B O   1 
ATOM   4847  C  CB  . LYS B  1 321 ? 142.162 175.074 154.310 1.00 43.28  ? 342 LYS B CB  1 
ATOM   4848  C  CG  . LYS B  1 321 ? 142.760 176.059 155.307 1.00 44.49  ? 342 LYS B CG  1 
ATOM   4849  C  CD  . LYS B  1 321 ? 142.173 177.471 155.187 1.00 45.08  ? 342 LYS B CD  1 
ATOM   4850  C  CE  . LYS B  1 321 ? 142.736 178.475 156.190 1.00 45.42  ? 342 LYS B CE  1 
ATOM   4851  N  NZ  . LYS B  1 321 ? 141.981 179.744 156.141 1.00 45.47  ? 342 LYS B NZ  1 
ATOM   4852  O  OXT . LYS B  1 321 ? 144.420 173.337 154.651 1.00 45.56  ? 342 LYS B OXT 1 
ATOM   4853  N  N   . SER C  1 6   ? 56.066  180.747 143.703 1.00 128.38 ? 27  SER C N   1 
ATOM   4854  C  CA  . SER C  1 6   ? 57.158  181.704 143.399 1.00 124.43 ? 27  SER C CA  1 
ATOM   4855  C  C   . SER C  1 6   ? 57.517  182.510 144.653 1.00 122.08 ? 27  SER C C   1 
ATOM   4856  O  O   . SER C  1 6   ? 58.478  183.295 144.579 1.00 120.44 ? 27  SER C O   1 
ATOM   4857  C  CB  . SER C  1 6   ? 56.803  182.609 142.236 1.00 127.50 ? 27  SER C CB  1 
ATOM   4858  O  OG  . SER C  1 6   ? 57.866  182.662 141.286 1.00 125.80 ? 27  SER C OG  1 
ATOM   4859  N  N   . SER C  1 7   ? 56.817  182.272 145.767 1.00 122.99 ? 28  SER C N   1 
ATOM   4860  C  CA  . SER C  1 7   ? 57.078  182.839 147.121 1.00 120.89 ? 28  SER C CA  1 
ATOM   4861  C  C   . SER C  1 7   ? 58.572  182.741 147.464 1.00 114.63 ? 28  SER C C   1 
ATOM   4862  O  O   . SER C  1 7   ? 59.103  183.598 148.225 1.00 111.08 ? 28  SER C O   1 
ATOM   4863  C  CB  . SER C  1 7   ? 56.214  182.132 148.145 1.00 123.33 ? 28  SER C CB  1 
ATOM   4864  O  OG  . SER C  1 7   ? 56.938  181.924 149.344 1.00 120.88 ? 28  SER C OG  1 
ATOM   4865  N  N   . ILE C  1 8   ? 59.224  181.721 146.912 1.00 112.77 ? 29  ILE C N   1 
ATOM   4866  C  CA  . ILE C  1 8   ? 60.681  181.453 147.081 1.00 108.68 ? 29  ILE C CA  1 
ATOM   4867  C  C   . ILE C  1 8   ? 61.480  182.284 146.068 1.00 106.77 ? 29  ILE C C   1 
ATOM   4868  O  O   . ILE C  1 8   ? 62.597  182.707 146.439 1.00 102.66 ? 29  ILE C O   1 
ATOM   4869  C  CB  . ILE C  1 8   ? 60.979  179.945 146.944 1.00 107.90 ? 29  ILE C CB  1 
ATOM   4870  C  CG1 . ILE C  1 8   ? 60.233  179.144 148.017 1.00 109.74 ? 29  ILE C CG1 1 
ATOM   4871  C  CG2 . ILE C  1 8   ? 62.494  179.695 146.958 1.00 104.02 ? 29  ILE C CG2 1 
ATOM   4872  C  CD1 . ILE C  1 8   ? 59.561  177.882 147.515 1.00 112.46 ? 29  ILE C CD1 1 
ATOM   4873  N  N   . GLU C  1 9   ? 60.940  182.469 144.851 1.00 108.90 ? 30  GLU C N   1 
ATOM   4874  C  CA  . GLU C  1 9   ? 61.597  183.212 143.739 1.00 107.35 ? 30  GLU C CA  1 
ATOM   4875  C  C   . GLU C  1 9   ? 61.730  184.694 144.129 1.00 105.78 ? 30  GLU C C   1 
ATOM   4876  O  O   . GLU C  1 9   ? 62.841  185.256 143.930 1.00 103.37 ? 30  GLU C O   1 
ATOM   4877  C  CB  . GLU C  1 9   ? 60.862  183.002 142.411 1.00 111.53 ? 30  GLU C CB  1 
ATOM   4878  C  CG  . GLU C  1 9   ? 61.625  182.103 141.438 1.00 110.61 ? 30  GLU C CG  1 
ATOM   4879  C  CD  . GLU C  1 9   ? 62.669  182.756 140.528 1.00 109.36 ? 30  GLU C CD  1 
ATOM   4880  O  OE1 . GLU C  1 9   ? 62.518  183.942 140.180 1.00 111.23 ? 30  GLU C OE1 1 
ATOM   4881  O  OE2 . GLU C  1 9   ? 63.625  182.064 140.127 1.00 106.98 ? 30  GLU C OE2 1 
ATOM   4882  N  N   . LYS C  1 10  ? 60.675  185.302 144.679 1.00 106.42 ? 31  LYS C N   1 
ATOM   4883  C  CA  . LYS C  1 10  ? 60.778  186.652 145.293 1.00 104.86 ? 31  LYS C CA  1 
ATOM   4884  C  C   . LYS C  1 10  ? 61.672  186.586 146.542 1.00 100.00 ? 31  LYS C C   1 
ATOM   4885  O  O   . LYS C  1 10  ? 62.396  187.567 146.753 1.00 98.22  ? 31  LYS C O   1 
ATOM   4886  C  CB  . LYS C  1 10  ? 59.397  187.255 145.576 1.00 109.06 ? 31  LYS C CB  1 
ATOM   4887  C  CG  . LYS C  1 10  ? 58.449  186.439 146.452 1.00 110.57 ? 31  LYS C CG  1 
ATOM   4888  C  CD  . LYS C  1 10  ? 57.114  186.122 145.787 1.00 115.15 ? 31  LYS C CD  1 
ATOM   4889  C  CE  . LYS C  1 10  ? 56.488  187.252 144.982 1.00 118.49 ? 31  LYS C CE  1 
ATOM   4890  N  NZ  . LYS C  1 10  ? 55.850  188.287 145.834 1.00 120.38 ? 31  LYS C NZ  1 
ATOM   4891  N  N   . GLY C  1 11  ? 61.650  185.481 147.308 1.00 97.77  ? 32  GLY C N   1 
ATOM   4892  C  CA  . GLY C  1 11  ? 62.445  185.285 148.547 1.00 93.84  ? 32  GLY C CA  1 
ATOM   4893  C  C   . GLY C  1 11  ? 63.957  185.222 148.295 1.00 88.95  ? 32  GLY C C   1 
ATOM   4894  O  O   . GLY C  1 11  ? 64.764  185.846 149.069 1.00 86.19  ? 32  GLY C O   1 
ATOM   4895  N  N   . GLN C  1 12  ? 64.356  184.510 147.237 1.00 87.29  ? 33  GLN C N   1 
ATOM   4896  C  CA  . GLN C  1 12  ? 65.709  184.609 146.613 1.00 83.48  ? 33  GLN C CA  1 
ATOM   4897  C  C   . GLN C  1 12  ? 66.144  186.080 146.549 1.00 83.02  ? 33  GLN C C   1 
ATOM   4898  O  O   . GLN C  1 12  ? 67.235  186.363 146.939 1.00 80.99  ? 33  GLN C O   1 
ATOM   4899  C  CB  . GLN C  1 12  ? 65.713  183.937 145.241 1.00 83.56  ? 33  GLN C CB  1 
ATOM   4900  C  CG  . GLN C  1 12  ? 65.405  182.449 145.324 1.00 83.86  ? 33  GLN C CG  1 
ATOM   4901  C  CD  . GLN C  1 12  ? 65.397  181.740 143.991 1.00 85.06  ? 33  GLN C CD  1 
ATOM   4902  O  OE1 . GLN C  1 12  ? 65.016  182.300 142.963 1.00 87.70  ? 33  GLN C OE1 1 
ATOM   4903  N  NE2 . GLN C  1 12  ? 65.799  180.479 143.999 1.00 83.79  ? 33  GLN C NE2 1 
ATOM   4904  N  N   . ASN C  1 13  ? 65.289  187.010 146.143 1.00 86.41  ? 34  ASN C N   1 
ATOM   4905  C  CA  . ASN C  1 13  ? 65.651  188.448 145.986 1.00 86.63  ? 34  ASN C CA  1 
ATOM   4906  C  C   . ASN C  1 13  ? 65.916  189.091 147.358 1.00 85.23  ? 34  ASN C C   1 
ATOM   4907  O  O   . ASN C  1 13  ? 66.794  189.945 147.470 1.00 83.33  ? 34  ASN C O   1 
ATOM   4908  C  CB  . ASN C  1 13  ? 64.610  189.166 145.109 1.00 90.50  ? 34  ASN C CB  1 
ATOM   4909  C  CG  . ASN C  1 13  ? 64.609  188.608 143.697 1.00 91.12  ? 34  ASN C CG  1 
ATOM   4910  O  OD1 . ASN C  1 13  ? 65.658  188.366 143.103 1.00 88.62  ? 34  ASN C OD1 1 
ATOM   4911  N  ND2 . ASN C  1 13  ? 63.434  188.372 143.154 1.00 95.26  ? 34  ASN C ND2 1 
ATOM   4912  N  N   . ARG C  1 14  ? 65.216  188.667 148.395 1.00 86.85  ? 35  ARG C N   1 
ATOM   4913  C  CA  . ARG C  1 14  ? 65.407  189.226 149.753 1.00 86.14  ? 35  ARG C CA  1 
ATOM   4914  C  C   . ARG C  1 14  ? 66.745  188.698 150.277 1.00 81.23  ? 35  ARG C C   1 
ATOM   4915  O  O   . ARG C  1 14  ? 67.474  189.474 150.952 1.00 80.28  ? 35  ARG C O   1 
ATOM   4916  C  CB  . ARG C  1 14  ? 64.180  188.892 150.597 1.00 89.86  ? 35  ARG C CB  1 
ATOM   4917  C  CG  . ARG C  1 14  ? 62.866  189.269 149.928 1.00 94.33  ? 35  ARG C CG  1 
ATOM   4918  C  CD  . ARG C  1 14  ? 61.748  188.452 150.542 1.00 98.31  ? 35  ARG C CD  1 
ATOM   4919  N  NE  . ARG C  1 14  ? 61.543  188.618 151.995 1.00 99.30  ? 35  ARG C NE  1 
ATOM   4920  C  CZ  . ARG C  1 14  ? 60.795  189.569 152.567 1.00 102.56 ? 35  ARG C CZ  1 
ATOM   4921  N  NH1 . ARG C  1 14  ? 60.161  190.473 151.825 1.00 105.10 ? 35  ARG C NH1 1 
ATOM   4922  N  NH2 . ARG C  1 14  ? 60.677  189.597 153.886 1.00 102.90 ? 35  ARG C NH2 1 
ATOM   4923  N  N   . VAL C  1 15  ? 67.135  187.486 149.887 1.00 78.44  ? 36  VAL C N   1 
ATOM   4924  C  CA  . VAL C  1 15  ? 68.484  186.945 150.275 1.00 74.96  ? 36  VAL C CA  1 
ATOM   4925  C  C   . VAL C  1 15  ? 69.589  187.757 149.560 1.00 72.98  ? 36  VAL C C   1 
ATOM   4926  O  O   . VAL C  1 15  ? 70.518  188.257 150.229 1.00 70.66  ? 36  VAL C O   1 
ATOM   4927  C  CB  . VAL C  1 15  ? 68.586  185.420 150.025 1.00 73.67  ? 36  VAL C CB  1 
ATOM   4928  C  CG1 . VAL C  1 15  ? 70.008  184.887 150.168 1.00 70.05  ? 36  VAL C CG1 1 
ATOM   4929  C  CG2 . VAL C  1 15  ? 67.634  184.638 150.930 1.00 75.06  ? 36  VAL C CG2 1 
ATOM   4930  N  N   . ILE C  1 16  ? 69.449  187.951 148.248 1.00 74.32  ? 37  ILE C N   1 
ATOM   4931  C  CA  . ILE C  1 16  ? 70.366  188.754 147.380 1.00 73.58  ? 37  ILE C CA  1 
ATOM   4932  C  C   . ILE C  1 16  ? 70.443  190.210 147.872 1.00 73.98  ? 37  ILE C C   1 
ATOM   4933  O  O   . ILE C  1 16  ? 71.561  190.750 148.011 1.00 71.39  ? 37  ILE C O   1 
ATOM   4934  C  CB  . ILE C  1 16  ? 69.907  188.638 145.907 1.00 75.87  ? 37  ILE C CB  1 
ATOM   4935  C  CG1 . ILE C  1 16  ? 70.174  187.214 145.392 1.00 75.19  ? 37  ILE C CG1 1 
ATOM   4936  C  CG2 . ILE C  1 16  ? 70.551  189.715 145.035 1.00 75.38  ? 37  ILE C CG2 1 
ATOM   4937  C  CD1 . ILE C  1 16  ? 69.685  186.934 143.987 1.00 77.52  ? 37  ILE C CD1 1 
ATOM   4938  N  N   . ASP C  1 17  ? 69.300  190.846 148.108 1.00 76.81  ? 38  ASP C N   1 
ATOM   4939  C  CA  . ASP C  1 17  ? 69.267  192.271 148.528 1.00 78.31  ? 38  ASP C CA  1 
ATOM   4940  C  C   . ASP C  1 17  ? 70.127  192.436 149.784 1.00 76.55  ? 38  ASP C C   1 
ATOM   4941  O  O   . ASP C  1 17  ? 71.067  193.265 149.731 1.00 75.29  ? 38  ASP C O   1 
ATOM   4942  C  CB  . ASP C  1 17  ? 67.825  192.777 148.644 1.00 82.09  ? 38  ASP C CB  1 
ATOM   4943  C  CG  . ASP C  1 17  ? 67.279  193.200 147.289 1.00 84.73  ? 38  ASP C CG  1 
ATOM   4944  O  OD1 . ASP C  1 17  ? 68.097  193.274 146.316 1.00 83.31  ? 38  ASP C OD1 1 
ATOM   4945  O  OD2 . ASP C  1 17  ? 66.045  193.449 147.200 1.00 88.91  ? 38  ASP C OD2 1 
ATOM   4946  N  N   . ALA C  1 18  ? 69.832  191.645 150.836 1.00 76.67  ? 39  ALA C N   1 
ATOM   4947  C  CA  . ALA C  1 18  ? 70.541  191.599 152.136 1.00 74.83  ? 39  ALA C CA  1 
ATOM   4948  C  C   . ALA C  1 18  ? 72.008  191.213 151.919 1.00 71.42  ? 39  ALA C C   1 
ATOM   4949  O  O   . ALA C  1 18  ? 72.923  191.875 152.552 1.00 70.81  ? 39  ALA C O   1 
ATOM   4950  C  CB  . ALA C  1 18  ? 69.853  190.623 153.048 1.00 75.66  ? 39  ALA C CB  1 
ATOM   4951  N  N   . SER C  1 19  ? 72.269  190.244 151.029 1.00 69.36  ? 40  SER C N   1 
ATOM   4952  C  CA  . SER C  1 19  ? 73.674  189.875 150.684 1.00 66.39  ? 40  SER C CA  1 
ATOM   4953  C  C   . SER C  1 19  ? 74.409  191.140 150.211 1.00 66.27  ? 40  SER C C   1 
ATOM   4954  O  O   . SER C  1 19  ? 75.427  191.474 150.833 1.00 63.83  ? 40  SER C O   1 
ATOM   4955  C  CB  . SER C  1 19  ? 73.784  188.721 149.682 1.00 65.26  ? 40  SER C CB  1 
ATOM   4956  O  OG  . SER C  1 19  ? 73.179  187.508 150.149 1.00 64.79  ? 40  SER C OG  1 
ATOM   4957  N  N   . LEU C  1 20  ? 73.865  191.837 149.208 1.00 68.95  ? 41  LEU C N   1 
ATOM   4958  C  CA  . LEU C  1 20  ? 74.498  193.063 148.649 1.00 69.62  ? 41  LEU C CA  1 
ATOM   4959  C  C   . LEU C  1 20  ? 74.485  194.199 149.681 1.00 70.69  ? 41  LEU C C   1 
ATOM   4960  O  O   . LEU C  1 20  ? 75.487  194.925 149.754 1.00 69.75  ? 41  LEU C O   1 
ATOM   4961  C  CB  . LEU C  1 20  ? 73.769  193.445 147.358 1.00 71.99  ? 41  LEU C CB  1 
ATOM   4962  C  CG  . LEU C  1 20  ? 73.825  192.394 146.251 1.00 71.42  ? 41  LEU C CG  1 
ATOM   4963  C  CD1 . LEU C  1 20  ? 72.657  192.536 145.293 1.00 73.78  ? 41  LEU C CD1 1 
ATOM   4964  C  CD2 . LEU C  1 20  ? 75.144  192.455 145.499 1.00 69.71  ? 41  LEU C CD2 1 
ATOM   4965  N  N   . THR C  1 21  ? 73.403  194.320 150.457 1.00 72.74  ? 42  THR C N   1 
ATOM   4966  C  CA  . THR C  1 21  ? 73.253  195.359 151.503 1.00 74.31  ? 42  THR C CA  1 
ATOM   4967  C  C   . THR C  1 21  ? 74.491  195.286 152.385 1.00 72.02  ? 42  THR C C   1 
ATOM   4968  O  O   . THR C  1 21  ? 75.173  196.313 152.560 1.00 71.52  ? 42  THR C O   1 
ATOM   4969  C  CB  . THR C  1 21  ? 71.925  195.186 152.236 1.00 77.29  ? 42  THR C CB  1 
ATOM   4970  O  OG1 . THR C  1 21  ? 70.931  195.077 151.212 1.00 80.29  ? 42  THR C OG1 1 
ATOM   4971  C  CG2 . THR C  1 21  ? 71.605  196.351 153.149 1.00 79.89  ? 42  THR C CG2 1 
ATOM   4972  N  N   . LEU C  1 22  ? 74.802  194.067 152.846 1.00 70.69  ? 43  LEU C N   1 
ATOM   4973  C  CA  . LEU C  1 22  ? 75.929  193.794 153.761 1.00 68.62  ? 43  LEU C CA  1 
ATOM   4974  C  C   . LEU C  1 22  ? 77.274  194.194 153.125 1.00 67.44  ? 43  LEU C C   1 
ATOM   4975  O  O   . LEU C  1 22  ? 78.090  194.862 153.830 1.00 67.25  ? 43  LEU C O   1 
ATOM   4976  C  CB  . LEU C  1 22  ? 75.862  192.303 154.090 1.00 67.55  ? 43  LEU C CB  1 
ATOM   4977  C  CG  . LEU C  1 22  ? 76.866  191.804 155.115 1.00 64.92  ? 43  LEU C CG  1 
ATOM   4978  C  CD1 . LEU C  1 22  ? 76.836  192.654 156.369 1.00 66.06  ? 43  LEU C CD1 1 
ATOM   4979  C  CD2 . LEU C  1 22  ? 76.594  190.348 155.424 1.00 64.39  ? 43  LEU C CD2 1 
ATOM   4980  N  N   . ILE C  1 23  ? 77.456  193.876 151.843 1.00 66.91  ? 44  ILE C N   1 
ATOM   4981  C  CA  . ILE C  1 23  ? 78.694  194.283 151.117 1.00 66.96  ? 44  ILE C CA  1 
ATOM   4982  C  C   . ILE C  1 23  ? 78.778  195.815 151.102 1.00 68.25  ? 44  ILE C C   1 
ATOM   4983  O  O   . ILE C  1 23  ? 79.876  196.333 151.346 1.00 67.47  ? 44  ILE C O   1 
ATOM   4984  C  CB  . ILE C  1 23  ? 78.705  193.725 149.681 1.00 67.50  ? 44  ILE C CB  1 
ATOM   4985  C  CG1 . ILE C  1 23  ? 78.398  192.227 149.627 1.00 65.84  ? 44  ILE C CG1 1 
ATOM   4986  C  CG2 . ILE C  1 23  ? 80.015  194.059 148.991 1.00 66.17  ? 44  ILE C CG2 1 
ATOM   4987  C  CD1 . ILE C  1 23  ? 79.588  191.348 149.900 1.00 65.31  ? 44  ILE C CD1 1 
ATOM   4988  N  N   . ARG C  1 24  ? 77.648  196.503 150.876 1.00 69.92  ? 45  ARG C N   1 
ATOM   4989  C  CA  . ARG C  1 24  ? 77.627  197.993 150.757 1.00 71.95  ? 45  ARG C CA  1 
ATOM   4990  C  C   . ARG C  1 24  ? 77.855  198.642 152.116 1.00 72.30  ? 45  ARG C C   1 
ATOM   4991  O  O   . ARG C  1 24  ? 78.616  199.641 152.180 1.00 72.48  ? 45  ARG C O   1 
ATOM   4992  C  CB  . ARG C  1 24  ? 76.322  198.587 150.232 1.00 74.81  ? 45  ARG C CB  1 
ATOM   4993  C  CG  . ARG C  1 24  ? 76.419  200.083 149.932 1.00 76.42  ? 45  ARG C CG  1 
ATOM   4994  C  CD  . ARG C  1 24  ? 75.056  200.701 149.722 1.00 79.23  ? 45  ARG C CD  1 
ATOM   4995  N  NE  . ARG C  1 24  ? 74.274  199.807 148.889 1.00 79.15  ? 45  ARG C NE  1 
ATOM   4996  C  CZ  . ARG C  1 24  ? 73.289  199.027 149.312 1.00 79.97  ? 45  ARG C CZ  1 
ATOM   4997  N  NH1 . ARG C  1 24  ? 72.906  199.031 150.583 1.00 80.23  ? 45  ARG C NH1 1 
ATOM   4998  N  NH2 . ARG C  1 24  ? 72.672  198.250 148.438 1.00 80.48  ? 45  ARG C NH2 1 
ATOM   4999  N  N   . GLU C  1 25  ? 77.219  198.096 153.153 1.00 73.24  ? 46  GLU C N   1 
ATOM   5000  C  CA  . GLU C  1 25  ? 77.334  198.689 154.499 1.00 74.68  ? 46  GLU C CA  1 
ATOM   5001  C  C   . GLU C  1 25  ? 78.790  198.604 154.942 1.00 72.96  ? 46  GLU C C   1 
ATOM   5002  O  O   . GLU C  1 25  ? 79.287  199.625 155.463 1.00 74.03  ? 46  GLU C O   1 
ATOM   5003  C  CB  . GLU C  1 25  ? 76.309  198.104 155.464 1.00 76.51  ? 46  GLU C CB  1 
ATOM   5004  C  CG  . GLU C  1 25  ? 75.228  199.133 155.752 1.00 81.16  ? 46  GLU C CG  1 
ATOM   5005  C  CD  . GLU C  1 25  ? 75.801  200.535 155.982 1.00 82.95  ? 46  GLU C CD  1 
ATOM   5006  O  OE1 . GLU C  1 25  ? 76.941  200.634 156.561 1.00 83.01  ? 46  GLU C OE1 1 
ATOM   5007  O  OE2 . GLU C  1 25  ? 75.162  201.512 155.549 1.00 84.33  ? 46  GLU C OE2 1 
ATOM   5008  N  N   . ARG C  1 26  ? 79.438  197.456 154.689 1.00 70.83  ? 47  ARG C N   1 
ATOM   5009  C  CA  . ARG C  1 26  ? 80.885  197.223 154.948 1.00 69.31  ? 47  ARG C CA  1 
ATOM   5010  C  C   . ARG C  1 26  ? 81.696  198.165 154.038 1.00 68.60  ? 47  ARG C C   1 
ATOM   5011  O  O   . ARG C  1 26  ? 82.582  198.895 154.549 1.00 68.24  ? 47  ARG C O   1 
ATOM   5012  C  CB  . ARG C  1 26  ? 81.185  195.728 154.780 1.00 67.39  ? 47  ARG C CB  1 
ATOM   5013  C  CG  . ARG C  1 26  ? 80.965  194.907 156.056 1.00 68.80  ? 47  ARG C CG  1 
ATOM   5014  C  CD  . ARG C  1 26  ? 80.609  193.418 155.952 1.00 67.11  ? 47  ARG C CD  1 
ATOM   5015  N  NE  . ARG C  1 26  ? 81.278  192.567 154.942 1.00 64.82  ? 47  ARG C NE  1 
ATOM   5016  C  CZ  . ARG C  1 26  ? 80.912  191.299 154.672 1.00 64.29  ? 47  ARG C CZ  1 
ATOM   5017  N  NH1 . ARG C  1 26  ? 79.933  190.709 155.351 1.00 65.35  ? 47  ARG C NH1 1 
ATOM   5018  N  NH2 . ARG C  1 26  ? 81.536  190.594 153.753 1.00 63.06  ? 47  ARG C NH2 1 
ATOM   5019  N  N   . ALA C  1 27  ? 81.310  198.250 152.765 1.00 67.89  ? 48  ALA C N   1 
ATOM   5020  C  CA  . ALA C  1 27  ? 82.067  199.068 151.792 1.00 69.46  ? 48  ALA C CA  1 
ATOM   5021  C  C   . ALA C  1 27  ? 82.128  200.529 152.246 1.00 70.99  ? 48  ALA C C   1 
ATOM   5022  O  O   . ALA C  1 27  ? 83.208  201.121 152.136 1.00 70.25  ? 48  ALA C O   1 
ATOM   5023  C  CB  . ALA C  1 27  ? 81.428  198.942 150.435 1.00 70.59  ? 48  ALA C CB  1 
ATOM   5024  N  N   . LYS C  1 28  ? 81.029  201.051 152.797 1.00 72.40  ? 49  LYS C N   1 
ATOM   5025  C  CA  . LYS C  1 28  ? 80.923  202.471 153.232 1.00 75.37  ? 49  LYS C CA  1 
ATOM   5026  C  C   . LYS C  1 28  ? 81.871  202.769 154.407 1.00 73.88  ? 49  LYS C C   1 
ATOM   5027  O  O   . LYS C  1 28  ? 82.545  203.814 154.374 1.00 73.84  ? 49  LYS C O   1 
ATOM   5028  C  CB  . LYS C  1 28  ? 79.485  202.857 153.600 1.00 79.58  ? 49  LYS C CB  1 
ATOM   5029  C  CG  . LYS C  1 28  ? 79.368  204.182 154.361 1.00 83.53  ? 49  LYS C CG  1 
ATOM   5030  C  CD  . LYS C  1 28  ? 77.971  204.795 154.449 1.00 87.41  ? 49  LYS C CD  1 
ATOM   5031  C  CE  . LYS C  1 28  ? 77.768  205.625 155.705 1.00 90.86  ? 49  LYS C CE  1 
ATOM   5032  N  NZ  . LYS C  1 28  ? 77.894  204.777 156.921 1.00 92.45  ? 49  LYS C NZ  1 
ATOM   5033  N  N   . LEU C  1 29  ? 81.922  201.894 155.418 1.00 72.98  ? 50  LEU C N   1 
ATOM   5034  C  CA  . LEU C  1 29  ? 82.773  202.057 156.635 1.00 72.90  ? 50  LEU C CA  1 
ATOM   5035  C  C   . LEU C  1 29  ? 84.272  202.175 156.251 1.00 71.23  ? 50  LEU C C   1 
ATOM   5036  O  O   . LEU C  1 29  ? 85.074  202.910 156.993 1.00 72.63  ? 50  LEU C O   1 
ATOM   5037  C  CB  . LEU C  1 29  ? 82.588  200.836 157.539 1.00 72.37  ? 50  LEU C CB  1 
ATOM   5038  C  CG  . LEU C  1 29  ? 81.170  200.567 158.019 1.00 73.61  ? 50  LEU C CG  1 
ATOM   5039  C  CD1 . LEU C  1 29  ? 81.179  199.607 159.195 1.00 73.12  ? 50  LEU C CD1 1 
ATOM   5040  C  CD2 . LEU C  1 29  ? 80.479  201.864 158.405 1.00 77.29  ? 50  LEU C CD2 1 
ATOM   5041  N  N   . LYS C  1 30  ? 84.652  201.234 155.330 1.00 68.38  ? 51  LYS C N   1 
ATOM   5042  C  CA  . LYS C  1 30  ? 86.022  201.189 154.736 1.00 68.00  ? 51  LYS C CA  1 
ATOM   5043  C  C   . LYS C  1 30  ? 86.256  202.466 153.906 1.00 69.78  ? 51  LYS C C   1 
ATOM   5044  O  O   . LYS C  1 30  ? 87.253  203.212 154.200 1.00 70.43  ? 51  LYS C O   1 
ATOM   5045  C  CB  . LYS C  1 30  ? 86.209  199.877 153.962 1.00 65.59  ? 51  LYS C CB  1 
ATOM   5046  C  CG  . LYS C  1 30  ? 86.402  198.619 154.827 1.00 64.32  ? 51  LYS C CG  1 
ATOM   5047  C  CD  . LYS C  1 30  ? 87.017  198.843 156.233 1.00 65.16  ? 51  LYS C CD  1 
ATOM   5048  C  CE  . LYS C  1 30  ? 86.852  197.639 157.139 1.00 64.70  ? 51  LYS C CE  1 
ATOM   5049  N  NZ  . LYS C  1 30  ? 87.536  197.812 158.445 1.00 65.76  ? 51  LYS C NZ  1 
ATOM   5050  N  N   . GLY C  1 31  ? 85.327  202.772 152.989 1.00 70.11  ? 52  GLY C N   1 
ATOM   5051  C  CA  . GLY C  1 31  ? 85.301  204.060 152.281 1.00 72.92  ? 52  GLY C CA  1 
ATOM   5052  C  C   . GLY C  1 31  ? 85.624  205.204 153.232 1.00 75.37  ? 52  GLY C C   1 
ATOM   5053  O  O   . GLY C  1 31  ? 86.571  206.006 152.912 1.00 75.83  ? 52  GLY C O   1 
ATOM   5054  N  N   . GLU C  1 32  ? 84.917  205.248 154.381 1.00 76.49  ? 53  GLU C N   1 
ATOM   5055  C  CA  . GLU C  1 32  ? 84.910  206.410 155.310 1.00 79.12  ? 53  GLU C CA  1 
ATOM   5056  C  C   . GLU C  1 32  ? 86.285  206.542 155.991 1.00 77.62  ? 53  GLU C C   1 
ATOM   5057  O  O   . GLU C  1 32  ? 86.842  207.670 156.062 1.00 77.95  ? 53  GLU C O   1 
ATOM   5058  C  CB  . GLU C  1 32  ? 83.690  206.281 156.234 1.00 81.39  ? 53  GLU C CB  1 
ATOM   5059  C  CG  . GLU C  1 32  ? 82.375  206.571 155.488 1.00 83.42  ? 53  GLU C CG  1 
ATOM   5060  C  CD  . GLU C  1 32  ? 81.342  207.490 156.134 1.00 87.04  ? 53  GLU C CD  1 
ATOM   5061  O  OE1 . GLU C  1 32  ? 80.662  208.269 155.364 1.00 90.83  ? 53  GLU C OE1 1 
ATOM   5062  O  OE2 . GLU C  1 32  ? 81.200  207.452 157.386 1.00 87.43  ? 53  GLU C OE2 1 
ATOM   5063  N  N   . LEU C  1 33  ? 86.853  205.412 156.413 1.00 75.66  ? 54  LEU C N   1 
ATOM   5064  C  CA  . LEU C  1 33  ? 88.138  205.353 157.161 1.00 75.05  ? 54  LEU C CA  1 
ATOM   5065  C  C   . LEU C  1 33  ? 89.283  205.833 156.259 1.00 74.44  ? 54  LEU C C   1 
ATOM   5066  O  O   . LEU C  1 33  ? 90.155  206.671 156.753 1.00 75.88  ? 54  LEU C O   1 
ATOM   5067  C  CB  . LEU C  1 33  ? 88.384  203.921 157.643 1.00 72.35  ? 54  LEU C CB  1 
ATOM   5068  C  CG  . LEU C  1 33  ? 89.585  203.757 158.579 1.00 72.25  ? 54  LEU C CG  1 
ATOM   5069  C  CD1 . LEU C  1 33  ? 89.560  204.735 159.752 1.00 74.93  ? 54  LEU C CD1 1 
ATOM   5070  C  CD2 . LEU C  1 33  ? 89.678  202.325 159.079 1.00 70.16  ? 54  LEU C CD2 1 
ATOM   5071  N  N   . VAL C  1 34  ? 89.283  205.344 155.008 1.00 72.96  ? 55  VAL C N   1 
ATOM   5072  C  CA  . VAL C  1 34  ? 90.240  205.793 153.945 1.00 74.29  ? 55  VAL C CA  1 
ATOM   5073  C  C   . VAL C  1 34  ? 90.054  207.317 153.700 1.00 77.74  ? 55  VAL C C   1 
ATOM   5074  O  O   . VAL C  1 34  ? 91.076  208.024 153.771 1.00 79.85  ? 55  VAL C O   1 
ATOM   5075  C  CB  . VAL C  1 34  ? 90.129  204.959 152.640 1.00 72.26  ? 55  VAL C CB  1 
ATOM   5076  C  CG1 . VAL C  1 34  ? 90.962  205.538 151.498 1.00 72.87  ? 55  VAL C CG1 1 
ATOM   5077  C  CG2 . VAL C  1 34  ? 90.493  203.492 152.821 1.00 68.89  ? 55  VAL C CG2 1 
ATOM   5078  N  N   . ARG C  1 35  ? 88.834  207.838 153.459 1.00 79.35  ? 56  ARG C N   1 
ATOM   5079  C  CA  . ARG C  1 35  ? 88.606  209.305 153.215 1.00 82.62  ? 56  ARG C CA  1 
ATOM   5080  C  C   . ARG C  1 35  ? 88.990  210.085 154.481 1.00 83.93  ? 56  ARG C C   1 
ATOM   5081  O  O   . ARG C  1 35  ? 89.584  211.126 154.335 1.00 84.91  ? 56  ARG C O   1 
ATOM   5082  C  CB  . ARG C  1 35  ? 87.171  209.653 152.788 1.00 84.34  ? 56  ARG C CB  1 
ATOM   5083  C  CG  . ARG C  1 35  ? 86.750  209.042 151.457 1.00 83.92  ? 56  ARG C CG  1 
ATOM   5084  C  CD  . ARG C  1 35  ? 85.305  209.363 151.069 1.00 86.52  ? 56  ARG C CD  1 
ATOM   5085  N  NE  . ARG C  1 35  ? 84.244  208.537 151.679 1.00 86.27  ? 56  ARG C NE  1 
ATOM   5086  C  CZ  . ARG C  1 35  ? 83.814  207.347 151.217 1.00 85.52  ? 56  ARG C CZ  1 
ATOM   5087  N  NH1 . ARG C  1 35  ? 84.380  206.789 150.153 1.00 84.62  ? 56  ARG C NH1 1 
ATOM   5088  N  NH2 . ARG C  1 35  ? 82.853  206.684 151.849 1.00 85.45  ? 56  ARG C NH2 1 
ATOM   5089  N  N   . LEU C  1 36  ? 88.748  209.562 155.689 1.00 83.40  ? 57  LEU C N   1 
ATOM   5090  C  CA  . LEU C  1 36  ? 89.187  210.272 156.919 1.00 85.65  ? 57  LEU C CA  1 
ATOM   5091  C  C   . LEU C  1 36  ? 90.697  210.515 156.864 1.00 85.17  ? 57  LEU C C   1 
ATOM   5092  O  O   . LEU C  1 36  ? 91.115  211.573 157.335 1.00 86.97  ? 57  LEU C O   1 
ATOM   5093  C  CB  . LEU C  1 36  ? 88.820  209.498 158.190 1.00 85.70  ? 57  LEU C CB  1 
ATOM   5094  C  CG  . LEU C  1 36  ? 89.211  210.196 159.506 1.00 88.75  ? 57  LEU C CG  1 
ATOM   5095  C  CD1 . LEU C  1 36  ? 88.410  211.481 159.704 1.00 92.52  ? 57  LEU C CD1 1 
ATOM   5096  C  CD2 . LEU C  1 36  ? 89.035  209.275 160.710 1.00 88.51  ? 57  LEU C CD2 1 
ATOM   5097  N  N   . LEU C  1 37  ? 91.471  209.555 156.344 1.00 82.78  ? 58  LEU C N   1 
ATOM   5098  C  CA  . LEU C  1 37  ? 92.956  209.534 156.436 1.00 82.80  ? 58  LEU C CA  1 
ATOM   5099  C  C   . LEU C  1 37  ? 93.558  210.512 155.425 1.00 84.53  ? 58  LEU C C   1 
ATOM   5100  O  O   . LEU C  1 37  ? 94.504  211.236 155.815 1.00 86.41  ? 58  LEU C O   1 
ATOM   5101  C  CB  . LEU C  1 37  ? 93.463  208.109 156.194 1.00 79.97  ? 58  LEU C CB  1 
ATOM   5102  C  CG  . LEU C  1 37  ? 93.070  207.036 157.215 1.00 78.56  ? 58  LEU C CG  1 
ATOM   5103  C  CD1 . LEU C  1 37  ? 94.253  206.135 157.512 1.00 77.32  ? 58  LEU C CD1 1 
ATOM   5104  C  CD2 . LEU C  1 37  ? 92.541  207.606 158.521 1.00 81.05  ? 58  LEU C CD2 1 
ATOM   5105  N  N   . GLY C  1 38  ? 93.041  210.497 154.182 1.00 84.26  ? 59  GLY C N   1 
ATOM   5106  C  CA  . GLY C  1 38  ? 93.340  211.444 153.083 1.00 85.37  ? 59  GLY C CA  1 
ATOM   5107  C  C   . GLY C  1 38  ? 94.426  210.928 152.151 1.00 83.56  ? 59  GLY C C   1 
ATOM   5108  O  O   . GLY C  1 38  ? 95.048  209.944 152.506 1.00 80.04  ? 59  GLY C O   1 
ATOM   5109  N  N   . GLY C  1 39  ? 94.637  211.599 151.000 1.00 85.06  ? 60  GLY C N   1 
ATOM   5110  C  CA  . GLY C  1 39  ? 95.825  211.451 150.120 1.00 84.67  ? 60  GLY C CA  1 
ATOM   5111  C  C   . GLY C  1 39  ? 95.777  210.221 149.211 1.00 81.16  ? 60  GLY C C   1 
ATOM   5112  O  O   . GLY C  1 39  ? 96.591  210.114 148.268 1.00 80.75  ? 60  GLY C O   1 
ATOM   5113  N  N   . ALA C  1 40  ? 94.852  209.299 149.442 1.00 78.72  ? 61  ALA C N   1 
ATOM   5114  C  CA  . ALA C  1 40  ? 94.760  208.081 148.606 1.00 75.69  ? 61  ALA C CA  1 
ATOM   5115  C  C   . ALA C  1 40  ? 94.081  208.426 147.271 1.00 75.55  ? 61  ALA C C   1 
ATOM   5116  O  O   . ALA C  1 40  ? 92.880  208.749 147.288 1.00 75.25  ? 61  ALA C O   1 
ATOM   5117  C  CB  . ALA C  1 40  ? 94.018  206.998 149.343 1.00 73.47  ? 61  ALA C CB  1 
ATOM   5118  N  N   . LYS C  1 41  ? 94.808  208.277 146.166 1.00 74.60  ? 62  LYS C N   1 
ATOM   5119  C  CA  . LYS C  1 41  ? 94.228  208.152 144.804 1.00 75.26  ? 62  LYS C CA  1 
ATOM   5120  C  C   . LYS C  1 41  ? 93.469  206.812 144.641 1.00 71.99  ? 62  LYS C C   1 
ATOM   5121  O  O   . LYS C  1 41  ? 92.327  206.773 144.112 1.00 71.16  ? 62  LYS C O   1 
ATOM   5122  C  CB  . LYS C  1 41  ? 95.378  208.309 143.805 1.00 76.95  ? 62  LYS C CB  1 
ATOM   5123  C  CG  . LYS C  1 41  ? 96.074  209.667 143.869 1.00 81.02  ? 62  LYS C CG  1 
ATOM   5124  C  CD  . LYS C  1 41  ? 96.485  210.276 142.506 1.00 84.08  ? 62  LYS C CD  1 
ATOM   5125  C  CE  . LYS C  1 41  ? 97.682  209.611 141.847 1.00 83.73  ? 62  LYS C CE  1 
ATOM   5126  N  NZ  . LYS C  1 41  ? 98.963  210.005 142.484 1.00 85.03  ? 62  LYS C NZ  1 
ATOM   5127  N  N   . ALA C  1 42  ? 94.086  205.713 145.074 1.00 69.95  ? 63  ALA C N   1 
ATOM   5128  C  CA  . ALA C  1 42  ? 93.529  204.344 144.995 1.00 66.95  ? 63  ALA C CA  1 
ATOM   5129  C  C   . ALA C  1 42  ? 93.887  203.609 146.305 1.00 65.09  ? 63  ALA C C   1 
ATOM   5130  O  O   . ALA C  1 42  ? 94.931  203.935 146.947 1.00 64.96  ? 63  ALA C O   1 
ATOM   5131  C  CB  . ALA C  1 42  ? 94.018  203.664 143.717 1.00 65.44  ? 63  ALA C CB  1 
ATOM   5132  N  N   . SER C  1 43  ? 92.993  202.715 146.745 1.00 63.50  ? 64  SER C N   1 
ATOM   5133  C  CA  . SER C  1 43  ? 93.102  201.940 148.009 1.00 61.64  ? 64  SER C CA  1 
ATOM   5134  C  C   . SER C  1 43  ? 92.567  200.533 147.743 1.00 59.39  ? 64  SER C C   1 
ATOM   5135  O  O   . SER C  1 43  ? 91.340  200.336 147.466 1.00 59.76  ? 64  SER C O   1 
ATOM   5136  C  CB  . SER C  1 43  ? 92.403  202.605 149.142 1.00 63.04  ? 64  SER C CB  1 
ATOM   5137  O  OG  . SER C  1 43  ? 92.950  203.894 149.398 1.00 65.84  ? 64  SER C OG  1 
ATOM   5138  N  N   . THR C  1 44  ? 93.490  199.588 147.708 1.00 57.27  ? 65  THR C N   1 
ATOM   5139  C  CA  . THR C  1 44  ? 93.146  198.166 147.569 1.00 54.76  ? 65  THR C CA  1 
ATOM   5140  C  C   . THR C  1 44  ? 92.177  197.829 148.731 1.00 54.41  ? 65  THR C C   1 
ATOM   5141  O  O   . THR C  1 44  ? 92.465  198.080 149.968 1.00 55.13  ? 65  THR C O   1 
ATOM   5142  C  CB  . THR C  1 44  ? 94.393  197.286 147.566 1.00 52.74  ? 65  THR C CB  1 
ATOM   5143  O  OG1 . THR C  1 44  ? 95.063  197.574 146.342 1.00 52.79  ? 65  THR C OG1 1 
ATOM   5144  C  CG2 . THR C  1 44  ? 94.064  195.815 147.634 1.00 50.84  ? 65  THR C CG2 1 
ATOM   5145  N  N   . SER C  1 45  ? 91.055  197.208 148.311 1.00 53.58  ? 66  SER C N   1 
ATOM   5146  C  CA  . SER C  1 45  ? 90.036  196.649 149.225 1.00 53.27  ? 66  SER C CA  1 
ATOM   5147  C  C   . SER C  1 45  ? 89.804  195.227 148.775 1.00 51.52  ? 66  SER C C   1 
ATOM   5148  O  O   . SER C  1 45  ? 89.362  195.035 147.631 1.00 51.87  ? 66  SER C O   1 
ATOM   5149  C  CB  . SER C  1 45  ? 88.741  197.451 149.217 1.00 55.25  ? 66  SER C CB  1 
ATOM   5150  O  OG  . SER C  1 45  ? 88.017  197.360 150.466 1.00 55.42  ? 66  SER C OG  1 
ATOM   5151  N  N   . LEU C  1 46  ? 90.104  194.291 149.658 1.00 50.52  ? 67  LEU C N   1 
ATOM   5152  C  CA  . LEU C  1 46  ? 89.830  192.870 149.422 1.00 49.19  ? 67  LEU C CA  1 
ATOM   5153  C  C   . LEU C  1 46  ? 88.313  192.665 149.368 1.00 49.52  ? 67  LEU C C   1 
ATOM   5154  O  O   . LEU C  1 46  ? 87.557  193.237 150.250 1.00 51.01  ? 67  LEU C O   1 
ATOM   5155  C  CB  . LEU C  1 46  ? 90.442  192.038 150.546 1.00 48.10  ? 67  LEU C CB  1 
ATOM   5156  C  CG  . LEU C  1 46  ? 91.947  192.152 150.663 1.00 48.25  ? 67  LEU C CG  1 
ATOM   5157  C  CD1 . LEU C  1 46  ? 92.492  191.070 151.574 1.00 47.38  ? 67  LEU C CD1 1 
ATOM   5158  C  CD2 . LEU C  1 46  ? 92.581  192.075 149.282 1.00 48.16  ? 67  LEU C CD2 1 
ATOM   5159  N  N   . LEU C  1 47  ? 87.914  191.754 148.479 1.00 49.02  ? 68  LEU C N   1 
ATOM   5160  C  CA  . LEU C  1 47  ? 86.527  191.256 148.309 1.00 50.53  ? 68  LEU C CA  1 
ATOM   5161  C  C   . LEU C  1 47  ? 86.644  189.765 147.983 1.00 49.67  ? 68  LEU C C   1 
ATOM   5162  O  O   . LEU C  1 47  ? 87.150  189.438 146.902 1.00 49.32  ? 68  LEU C O   1 
ATOM   5163  C  CB  . LEU C  1 47  ? 85.799  192.008 147.192 1.00 52.11  ? 68  LEU C CB  1 
ATOM   5164  C  CG  . LEU C  1 47  ? 84.468  191.385 146.778 1.00 52.94  ? 68  LEU C CG  1 
ATOM   5165  C  CD1 . LEU C  1 47  ? 83.410  191.616 147.843 1.00 53.98  ? 68  LEU C CD1 1 
ATOM   5166  C  CD2 . LEU C  1 47  ? 83.999  191.920 145.435 1.00 54.77  ? 68  LEU C CD2 1 
ATOM   5167  N  N   . GLY C  1 48  ? 86.195  188.905 148.895 1.00 48.82  ? 69  GLY C N   1 
ATOM   5168  C  CA  . GLY C  1 48  ? 86.327  187.455 148.718 1.00 49.06  ? 69  GLY C CA  1 
ATOM   5169  C  C   . GLY C  1 48  ? 85.172  186.895 147.921 1.00 50.50  ? 69  GLY C C   1 
ATOM   5170  O  O   . GLY C  1 48  ? 84.048  187.394 148.082 1.00 53.05  ? 69  GLY C O   1 
ATOM   5171  N  N   . VAL C  1 49  ? 85.426  185.873 147.107 1.00 49.83  ? 70  VAL C N   1 
ATOM   5172  C  CA  . VAL C  1 49  ? 84.351  185.184 146.340 1.00 50.10  ? 70  VAL C CA  1 
ATOM   5173  C  C   . VAL C  1 49  ? 84.489  183.663 146.500 1.00 48.77  ? 70  VAL C C   1 
ATOM   5174  O  O   . VAL C  1 49  ? 84.997  182.954 145.624 1.00 47.48  ? 70  VAL C O   1 
ATOM   5175  C  CB  . VAL C  1 49  ? 84.318  185.690 144.889 1.00 50.36  ? 70  VAL C CB  1 
ATOM   5176  C  CG1 . VAL C  1 49  ? 83.267  184.958 144.072 1.00 51.58  ? 70  VAL C CG1 1 
ATOM   5177  C  CG2 . VAL C  1 49  ? 84.073  187.190 144.868 1.00 51.19  ? 70  VAL C CG2 1 
ATOM   5178  N  N   . PRO C  1 50  ? 84.008  183.132 147.646 1.00 47.91  ? 71  PRO C N   1 
ATOM   5179  C  CA  . PRO C  1 50  ? 84.181  181.722 147.983 1.00 47.32  ? 71  PRO C CA  1 
ATOM   5180  C  C   . PRO C  1 50  ? 83.354  180.812 147.062 1.00 48.70  ? 71  PRO C C   1 
ATOM   5181  O  O   . PRO C  1 50  ? 82.422  180.145 147.491 1.00 50.40  ? 71  PRO C O   1 
ATOM   5182  C  CB  . PRO C  1 50  ? 83.766  181.667 149.461 1.00 47.40  ? 71  PRO C CB  1 
ATOM   5183  C  CG  . PRO C  1 50  ? 82.799  182.833 149.608 1.00 49.30  ? 71  PRO C CG  1 
ATOM   5184  C  CD  . PRO C  1 50  ? 83.372  183.908 148.715 1.00 48.98  ? 71  PRO C CD  1 
ATOM   5185  N  N   . LEU C  1 51  ? 83.725  180.793 145.786 1.00 49.07  ? 72  LEU C N   1 
ATOM   5186  C  CA  . LEU C  1 51  ? 83.009  180.036 144.731 1.00 50.36  ? 72  LEU C CA  1 
ATOM   5187  C  C   . LEU C  1 51  ? 83.983  179.007 144.156 1.00 48.90  ? 72  LEU C C   1 
ATOM   5188  O  O   . LEU C  1 51  ? 85.071  179.404 143.743 1.00 48.99  ? 72  LEU C O   1 
ATOM   5189  C  CB  . LEU C  1 51  ? 82.527  181.032 143.680 1.00 51.92  ? 72  LEU C CB  1 
ATOM   5190  C  CG  . LEU C  1 51  ? 81.571  180.485 142.620 1.00 54.32  ? 72  LEU C CG  1 
ATOM   5191  C  CD1 . LEU C  1 51  ? 80.793  181.619 142.024 1.00 56.29  ? 72  LEU C CD1 1 
ATOM   5192  C  CD2 . LEU C  1 51  ? 82.289  179.732 141.504 1.00 54.41  ? 72  LEU C CD2 1 
ATOM   5193  N  N   . GLY C  1 52  ? 83.633  177.726 144.166 1.00 48.37  ? 73  GLY C N   1 
ATOM   5194  C  CA  . GLY C  1 52  ? 84.484  176.698 143.552 1.00 47.33  ? 73  GLY C CA  1 
ATOM   5195  C  C   . GLY C  1 52  ? 83.724  175.716 142.682 1.00 48.23  ? 73  GLY C C   1 
ATOM   5196  O  O   . GLY C  1 52  ? 84.357  174.745 142.225 1.00 48.13  ? 73  GLY C O   1 
ATOM   5197  N  N   . HIS C  1 53  ? 82.439  175.942 142.417 1.00 49.96  ? 74  HIS C N   1 
ATOM   5198  C  CA  . HIS C  1 53  ? 81.551  174.901 141.821 1.00 51.59  ? 74  HIS C CA  1 
ATOM   5199  C  C   . HIS C  1 53  ? 81.601  174.993 140.295 1.00 51.76  ? 74  HIS C C   1 
ATOM   5200  O  O   . HIS C  1 53  ? 80.972  174.184 139.644 1.00 52.75  ? 74  HIS C O   1 
ATOM   5201  C  CB  . HIS C  1 53  ? 80.133  175.017 142.397 1.00 53.66  ? 74  HIS C CB  1 
ATOM   5202  C  CG  . HIS C  1 53  ? 79.431  176.263 141.969 1.00 55.39  ? 74  HIS C CG  1 
ATOM   5203  N  ND1 . HIS C  1 53  ? 79.722  177.500 142.533 1.00 54.30  ? 74  HIS C ND1 1 
ATOM   5204  C  CD2 . HIS C  1 53  ? 78.488  176.467 141.015 1.00 57.55  ? 74  HIS C CD2 1 
ATOM   5205  C  CE1 . HIS C  1 53  ? 78.944  178.408 141.972 1.00 56.70  ? 74  HIS C CE1 1 
ATOM   5206  N  NE2 . HIS C  1 53  ? 78.187  177.803 141.025 1.00 58.44  ? 74  HIS C NE2 1 
ATOM   5207  N  N   . ASN C  1 54  ? 82.359  175.939 139.764 1.00 51.23  ? 75  ASN C N   1 
ATOM   5208  C  CA  . ASN C  1 54  ? 82.639  176.034 138.310 1.00 53.24  ? 75  ASN C CA  1 
ATOM   5209  C  C   . ASN C  1 54  ? 83.953  175.324 137.948 1.00 51.42  ? 75  ASN C C   1 
ATOM   5210  O  O   . ASN C  1 54  ? 84.353  175.357 136.771 1.00 52.24  ? 75  ASN C O   1 
ATOM   5211  C  CB  . ASN C  1 54  ? 82.651  177.502 137.889 1.00 54.26  ? 75  ASN C CB  1 
ATOM   5212  C  CG  . ASN C  1 54  ? 81.265  178.128 137.945 1.00 56.48  ? 75  ASN C CG  1 
ATOM   5213  O  OD1 . ASN C  1 54  ? 80.266  177.482 137.624 1.00 59.07  ? 75  ASN C OD1 1 
ATOM   5214  N  ND2 . ASN C  1 54  ? 81.202  179.399 138.318 1.00 56.68  ? 75  ASN C ND2 1 
ATOM   5215  N  N   . SER C  1 55  ? 84.599  174.686 138.918 1.00 49.84  ? 76  SER C N   1 
ATOM   5216  C  CA  . SER C  1 55  ? 85.917  174.012 138.750 1.00 47.90  ? 76  SER C CA  1 
ATOM   5217  C  C   . SER C  1 55  ? 85.715  172.707 137.972 1.00 48.68  ? 76  SER C C   1 
ATOM   5218  O  O   . SER C  1 55  ? 84.629  172.136 138.036 1.00 51.93  ? 76  SER C O   1 
ATOM   5219  C  CB  . SER C  1 55  ? 86.533  173.793 140.123 1.00 46.39  ? 76  SER C CB  1 
ATOM   5220  O  OG  . SER C  1 55  ? 86.841  175.047 140.744 1.00 45.72  ? 76  SER C OG  1 
ATOM   5221  N  N   . SER C  1 56  ? 86.701  172.207 137.258 1.00 48.00  ? 77  SER C N   1 
ATOM   5222  C  CA  . SER C  1 56  ? 86.557  170.980 136.439 1.00 49.55  ? 77  SER C CA  1 
ATOM   5223  C  C   . SER C  1 56  ? 87.024  169.748 137.223 1.00 48.51  ? 77  SER C C   1 
ATOM   5224  O  O   . SER C  1 56  ? 86.585  168.660 136.853 1.00 50.09  ? 77  SER C O   1 
ATOM   5225  C  CB  . SER C  1 56  ? 87.322  171.099 135.148 1.00 50.74  ? 77  SER C CB  1 
ATOM   5226  O  OG  . SER C  1 56  ? 88.700  171.345 135.423 1.00 49.22  ? 77  SER C OG  1 
ATOM   5227  N  N   . PHE C  1 57  ? 87.837  169.897 138.283 1.00 46.56  ? 78  PHE C N   1 
ATOM   5228  C  CA  . PHE C  1 57  ? 88.514  168.770 138.985 1.00 45.16  ? 78  PHE C CA  1 
ATOM   5229  C  C   . PHE C  1 57  ? 88.235  168.774 140.492 1.00 44.20  ? 78  PHE C C   1 
ATOM   5230  O  O   . PHE C  1 57  ? 87.901  167.684 140.995 1.00 45.95  ? 78  PHE C O   1 
ATOM   5231  C  CB  . PHE C  1 57  ? 90.013  168.828 138.700 1.00 44.14  ? 78  PHE C CB  1 
ATOM   5232  C  CG  . PHE C  1 57  ? 90.767  167.603 139.141 1.00 43.62  ? 78  PHE C CG  1 
ATOM   5233  C  CD1 . PHE C  1 57  ? 90.421  166.343 138.658 1.00 45.16  ? 78  PHE C CD1 1 
ATOM   5234  C  CD2 . PHE C  1 57  ? 91.787  167.714 140.072 1.00 41.53  ? 78  PHE C CD2 1 
ATOM   5235  C  CE1 . PHE C  1 57  ? 91.098  165.212 139.096 1.00 44.94  ? 78  PHE C CE1 1 
ATOM   5236  C  CE2 . PHE C  1 57  ? 92.491  166.593 140.474 1.00 41.44  ? 78  PHE C CE2 1 
ATOM   5237  C  CZ  . PHE C  1 57  ? 92.154  165.347 139.980 1.00 42.99  ? 78  PHE C CZ  1 
ATOM   5238  N  N   . LEU C  1 58  ? 88.439  169.905 141.188 1.00 42.15  ? 79  LEU C N   1 
ATOM   5239  C  CA  . LEU C  1 58  ? 88.265  170.068 142.659 1.00 41.09  ? 79  LEU C CA  1 
ATOM   5240  C  C   . LEU C  1 58  ? 87.699  171.460 142.948 1.00 40.34  ? 79  LEU C C   1 
ATOM   5241  O  O   . LEU C  1 58  ? 88.109  172.404 142.318 1.00 40.15  ? 79  LEU C O   1 
ATOM   5242  C  CB  . LEU C  1 58  ? 89.617  169.914 143.388 1.00 40.00  ? 79  LEU C CB  1 
ATOM   5243  C  CG  . LEU C  1 58  ? 90.338  168.575 143.243 1.00 39.72  ? 79  LEU C CG  1 
ATOM   5244  C  CD1 . LEU C  1 58  ? 91.791  168.676 143.646 1.00 38.11  ? 79  LEU C CD1 1 
ATOM   5245  C  CD2 . LEU C  1 58  ? 89.640  167.503 144.053 1.00 40.59  ? 79  LEU C CD2 1 
ATOM   5246  N  N   . GLN C  1 59  ? 86.813  171.544 143.931 1.00 40.23  ? 80  GLN C N   1 
ATOM   5247  C  CA  . GLN C  1 59  ? 86.098  172.789 144.301 1.00 40.40  ? 80  GLN C CA  1 
ATOM   5248  C  C   . GLN C  1 59  ? 86.735  173.489 145.491 1.00 38.63  ? 80  GLN C C   1 
ATOM   5249  O  O   . GLN C  1 59  ? 86.249  174.553 145.857 1.00 38.81  ? 80  GLN C O   1 
ATOM   5250  C  CB  . GLN C  1 59  ? 84.676  172.432 144.684 1.00 41.82  ? 80  GLN C CB  1 
ATOM   5251  C  CG  . GLN C  1 59  ? 83.753  172.288 143.497 1.00 43.61  ? 80  GLN C CG  1 
ATOM   5252  C  CD  . GLN C  1 59  ? 82.332  172.447 143.952 1.00 44.91  ? 80  GLN C CD  1 
ATOM   5253  O  OE1 . GLN C  1 59  ? 81.958  173.432 144.579 1.00 44.81  ? 80  GLN C OE1 1 
ATOM   5254  N  NE2 . GLN C  1 59  ? 81.548  171.442 143.661 1.00 45.71  ? 80  GLN C NE2 1 
ATOM   5255  N  N   . GLY C  1 60  ? 87.917  173.032 145.887 1.00 43.26  ? 81  GLY C N   1 
ATOM   5256  C  CA  . GLY C  1 60  ? 88.641  173.512 147.071 1.00 41.05  ? 81  GLY C CA  1 
ATOM   5257  C  C   . GLY C  1 60  ? 88.826  175.010 147.127 1.00 39.56  ? 81  GLY C C   1 
ATOM   5258  O  O   . GLY C  1 60  ? 88.771  175.509 148.227 1.00 39.29  ? 81  GLY C O   1 
ATOM   5259  N  N   . PRO C  1 61  ? 89.026  175.773 146.031 1.00 38.85  ? 82  PRO C N   1 
ATOM   5260  C  CA  . PRO C  1 61  ? 89.140  177.225 146.138 1.00 38.29  ? 82  PRO C CA  1 
ATOM   5261  C  C   . PRO C  1 61  ? 87.953  177.913 146.828 1.00 39.67  ? 82  PRO C C   1 
ATOM   5262  O  O   . PRO C  1 61  ? 88.138  178.982 147.290 1.00 39.33  ? 82  PRO C O   1 
ATOM   5263  C  CB  . PRO C  1 61  ? 89.301  177.672 144.687 1.00 38.36  ? 82  PRO C CB  1 
ATOM   5264  C  CG  . PRO C  1 61  ? 90.051  176.553 144.080 1.00 37.77  ? 82  PRO C CG  1 
ATOM   5265  C  CD  . PRO C  1 61  ? 89.436  175.328 144.704 1.00 38.65  ? 82  PRO C CD  1 
ATOM   5266  N  N   . ALA C  1 62  ? 86.762  177.312 146.829 1.00 41.54  ? 83  ALA C N   1 
ATOM   5267  C  CA  . ALA C  1 62  ? 85.649  177.911 147.587 1.00 43.53  ? 83  ALA C CA  1 
ATOM   5268  C  C   . ALA C  1 62  ? 86.080  178.261 149.027 1.00 43.36  ? 83  ALA C C   1 
ATOM   5269  O  O   . ALA C  1 62  ? 85.449  179.176 149.614 1.00 44.74  ? 83  ALA C O   1 
ATOM   5270  C  CB  . ALA C  1 62  ? 84.495  176.953 147.586 1.00 45.64  ? 83  ALA C CB  1 
ATOM   5271  N  N   . PHE C  1 63  ? 87.059  177.546 149.619 1.00 42.22  ? 84  PHE C N   1 
ATOM   5272  C  CA  . PHE C  1 63  ? 87.460  177.734 151.044 1.00 41.86  ? 84  PHE C CA  1 
ATOM   5273  C  C   . PHE C  1 63  ? 88.620  178.732 151.200 1.00 40.08  ? 84  PHE C C   1 
ATOM   5274  O  O   . PHE C  1 63  ? 89.029  178.953 152.314 1.00 39.69  ? 84  PHE C O   1 
ATOM   5275  C  CB  . PHE C  1 63  ? 87.840  176.392 151.672 1.00 41.93  ? 84  PHE C CB  1 
ATOM   5276  C  CG  . PHE C  1 63  ? 86.767  175.340 151.602 1.00 43.88  ? 84  PHE C CG  1 
ATOM   5277  C  CD1 . PHE C  1 63  ? 85.554  175.537 152.227 1.00 46.02  ? 84  PHE C CD1 1 
ATOM   5278  C  CD2 . PHE C  1 63  ? 86.984  174.135 150.955 1.00 44.36  ? 84  PHE C CD2 1 
ATOM   5279  C  CE1 . PHE C  1 63  ? 84.559  174.572 152.172 1.00 48.29  ? 84  PHE C CE1 1 
ATOM   5280  C  CE2 . PHE C  1 63  ? 86.003  173.158 150.904 1.00 46.44  ? 84  PHE C CE2 1 
ATOM   5281  C  CZ  . PHE C  1 63  ? 84.780  173.387 151.494 1.00 48.69  ? 84  PHE C CZ  1 
ATOM   5282  N  N   . ALA C  1 64  ? 89.124  179.366 150.143 1.00 39.15  ? 85  ALA C N   1 
ATOM   5283  C  CA  . ALA C  1 64  ? 90.446  180.043 150.174 1.00 37.82  ? 85  ALA C CA  1 
ATOM   5284  C  C   . ALA C  1 64  ? 90.449  181.418 150.853 1.00 37.95  ? 85  ALA C C   1 
ATOM   5285  O  O   . ALA C  1 64  ? 91.428  181.832 151.467 1.00 37.09  ? 85  ALA C O   1 
ATOM   5286  C  CB  . ALA C  1 64  ? 91.029  180.109 148.763 1.00 37.55  ? 85  ALA C CB  1 
ATOM   5287  N  N   . PRO C  1 65  ? 89.480  182.314 150.603 1.00 39.26  ? 86  PRO C N   1 
ATOM   5288  C  CA  . PRO C  1 65  ? 89.647  183.682 151.068 1.00 39.26  ? 86  PRO C CA  1 
ATOM   5289  C  C   . PRO C  1 65  ? 89.929  183.821 152.553 1.00 38.61  ? 86  PRO C C   1 
ATOM   5290  O  O   . PRO C  1 65  ? 90.746  184.644 152.921 1.00 38.00  ? 86  PRO C O   1 
ATOM   5291  C  CB  . PRO C  1 65  ? 88.310  184.309 150.713 1.00 40.91  ? 86  PRO C CB  1 
ATOM   5292  C  CG  . PRO C  1 65  ? 87.937  183.561 149.481 1.00 41.36  ? 86  PRO C CG  1 
ATOM   5293  C  CD  . PRO C  1 65  ? 88.299  182.129 149.756 1.00 40.33  ? 86  PRO C CD  1 
ATOM   5294  N  N   . PRO C  1 66  ? 89.200  183.149 153.453 1.00 39.23  ? 87  PRO C N   1 
ATOM   5295  C  CA  . PRO C  1 66  ? 89.517  183.248 154.881 1.00 39.54  ? 87  PRO C CA  1 
ATOM   5296  C  C   . PRO C  1 66  ? 90.953  182.782 155.230 1.00 38.64  ? 87  PRO C C   1 
ATOM   5297  O  O   . PRO C  1 66  ? 91.527  183.374 156.083 1.00 38.36  ? 87  PRO C O   1 
ATOM   5298  C  CB  . PRO C  1 66  ? 88.479  182.347 155.556 1.00 40.38  ? 87  PRO C CB  1 
ATOM   5299  C  CG  . PRO C  1 66  ? 87.376  182.226 154.527 1.00 41.58  ? 87  PRO C CG  1 
ATOM   5300  C  CD  . PRO C  1 66  ? 88.064  182.259 153.183 1.00 40.36  ? 87  PRO C CD  1 
ATOM   5301  N  N   . ARG C  1 67  ? 91.503  181.786 154.532 1.00 38.81  ? 88  ARG C N   1 
ATOM   5302  C  CA  . ARG C  1 67  ? 92.876  181.278 154.726 1.00 39.08  ? 88  ARG C CA  1 
ATOM   5303  C  C   . ARG C  1 67  ? 93.872  182.323 154.257 1.00 38.19  ? 88  ARG C C   1 
ATOM   5304  O  O   . ARG C  1 67  ? 94.912  182.500 154.916 1.00 37.23  ? 88  ARG C O   1 
ATOM   5305  C  CB  . ARG C  1 67  ? 93.106  179.982 153.948 1.00 41.01  ? 88  ARG C CB  1 
ATOM   5306  C  CG  . ARG C  1 67  ? 92.211  178.831 154.374 1.00 44.65  ? 88  ARG C CG  1 
ATOM   5307  C  CD  . ARG C  1 67  ? 92.353  178.531 155.855 1.00 48.46  ? 88  ARG C CD  1 
ATOM   5308  N  NE  . ARG C  1 67  ? 91.558  177.386 156.311 1.00 52.44  ? 88  ARG C NE  1 
ATOM   5309  C  CZ  . ARG C  1 67  ? 91.991  176.135 156.367 1.00 54.46  ? 88  ARG C CZ  1 
ATOM   5310  N  NH1 . ARG C  1 67  ? 93.219  175.852 155.950 1.00 55.38  ? 88  ARG C NH1 1 
ATOM   5311  N  NH2 . ARG C  1 67  ? 91.187  175.169 156.803 1.00 56.31  ? 88  ARG C NH2 1 
ATOM   5312  N  N   . ILE C  1 68  ? 93.574  182.993 153.135 1.00 38.16  ? 89  ILE C N   1 
ATOM   5313  C  CA  . ILE C  1 68  ? 94.476  184.039 152.611 1.00 37.63  ? 89  ILE C CA  1 
ATOM   5314  C  C   . ILE C  1 68  ? 94.570  185.139 153.657 1.00 37.92  ? 89  ILE C C   1 
ATOM   5315  O  O   . ILE C  1 68  ? 95.665  185.497 154.002 1.00 37.32  ? 89  ILE C O   1 
ATOM   5316  C  CB  . ILE C  1 68  ? 94.008  184.527 151.240 1.00 38.21  ? 89  ILE C CB  1 
ATOM   5317  C  CG1 . ILE C  1 68  ? 94.063  183.360 150.264 1.00 38.05  ? 89  ILE C CG1 1 
ATOM   5318  C  CG2 . ILE C  1 68  ? 94.859  185.705 150.804 1.00 38.47  ? 89  ILE C CG2 1 
ATOM   5319  C  CD1 . ILE C  1 68  ? 93.692  183.699 148.853 1.00 39.35  ? 89  ILE C CD1 1 
ATOM   5320  N  N   . ARG C  1 69  ? 93.445  185.566 154.204 1.00 39.56  ? 90  ARG C N   1 
ATOM   5321  C  CA  . ARG C  1 69  ? 93.344  186.668 155.204 1.00 41.01  ? 90  ARG C CA  1 
ATOM   5322  C  C   . ARG C  1 69  ? 94.166  186.306 156.445 1.00 39.85  ? 90  ARG C C   1 
ATOM   5323  O  O   . ARG C  1 69  ? 94.977  187.100 156.882 1.00 39.55  ? 90  ARG C O   1 
ATOM   5324  C  CB  . ARG C  1 69  ? 91.884  186.878 155.594 1.00 43.44  ? 90  ARG C CB  1 
ATOM   5325  C  CG  . ARG C  1 69  ? 91.119  187.777 154.638 1.00 46.18  ? 90  ARG C CG  1 
ATOM   5326  C  CD  . ARG C  1 69  ? 89.721  188.055 155.182 1.00 48.38  ? 90  ARG C CD  1 
ATOM   5327  N  NE  . ARG C  1 69  ? 88.984  188.635 154.078 1.00 50.82  ? 90  ARG C NE  1 
ATOM   5328  C  CZ  . ARG C  1 69  ? 88.190  187.988 153.220 1.00 52.26  ? 90  ARG C CZ  1 
ATOM   5329  N  NH1 . ARG C  1 69  ? 87.906  186.699 153.372 1.00 51.89  ? 90  ARG C NH1 1 
ATOM   5330  N  NH2 . ARG C  1 69  ? 87.624  188.677 152.238 1.00 53.86  ? 90  ARG C NH2 1 
ATOM   5331  N  N   . GLU C  1 70  ? 93.985  185.102 156.964 1.00 38.93  ? 91  GLU C N   1 
ATOM   5332  C  CA  . GLU C  1 70  ? 94.820  184.606 158.079 1.00 38.44  ? 91  GLU C CA  1 
ATOM   5333  C  C   . GLU C  1 70  ? 96.321  184.711 157.722 1.00 36.47  ? 91  GLU C C   1 
ATOM   5334  O  O   . GLU C  1 70  ? 97.051  185.247 158.555 1.00 36.06  ? 91  GLU C O   1 
ATOM   5335  C  CB  . GLU C  1 70  ? 94.381  183.203 158.457 1.00 39.68  ? 91  GLU C CB  1 
ATOM   5336  C  CG  . GLU C  1 70  ? 95.494  182.499 159.199 1.00 41.30  ? 91  GLU C CG  1 
ATOM   5337  C  CD  . GLU C  1 70  ? 95.199  181.150 159.809 1.00 42.89  ? 91  GLU C CD  1 
ATOM   5338  O  OE1 . GLU C  1 70  ? 95.333  181.092 161.002 1.00 47.09  ? 91  GLU C OE1 1 
ATOM   5339  O  OE2 . GLU C  1 70  ? 94.863  180.166 159.093 1.00 44.85  ? 91  GLU C OE2 1 
ATOM   5340  N  N   . ALA C  1 71  ? 96.768  184.260 156.541 1.00 34.68  ? 92  ALA C N   1 
ATOM   5341  C  CA  . ALA C  1 71  ? 98.193  184.307 156.150 1.00 34.05  ? 92  ALA C CA  1 
ATOM   5342  C  C   . ALA C  1 71  ? 98.743  185.744 156.024 1.00 34.84  ? 92  ALA C C   1 
ATOM   5343  O  O   . ALA C  1 71  ? 99.956  185.959 156.335 1.00 34.78  ? 92  ALA C O   1 
ATOM   5344  C  CB  . ALA C  1 71  ? 98.422  183.527 154.893 1.00 33.60  ? 92  ALA C CB  1 
ATOM   5345  N  N   . ILE C  1 72  ? 97.925  186.713 155.636 1.00 35.30  ? 93  ILE C N   1 
ATOM   5346  C  CA  . ILE C  1 72  ? 98.384  188.127 155.455 1.00 36.86  ? 93  ILE C CA  1 
ATOM   5347  C  C   . ILE C  1 72  ? 98.884  188.626 156.812 1.00 37.12  ? 93  ILE C C   1 
ATOM   5348  O  O   . ILE C  1 72  ? 99.854  189.399 156.834 1.00 37.77  ? 93  ILE C O   1 
ATOM   5349  C  CB  . ILE C  1 72  ? 97.267  189.045 154.853 1.00 37.72  ? 93  ILE C CB  1 
ATOM   5350  C  CG1 . ILE C  1 72  ? 96.912  188.635 153.422 1.00 37.69  ? 93  ILE C CG1 1 
ATOM   5351  C  CG2 . ILE C  1 72  ? 97.639  190.507 154.970 1.00 38.99  ? 93  ILE C CG2 1 
ATOM   5352  C  CD1 . ILE C  1 72  ? 95.647  189.276 152.861 1.00 39.03  ? 93  ILE C CD1 1 
ATOM   5353  N  N   . TRP C  1 73  ? 98.134  188.327 157.859 1.00 37.37  ? 94  TRP C N   1 
ATOM   5354  C  CA  . TRP C  1 73  ? 98.353  188.860 159.235 1.00 38.54  ? 94  TRP C CA  1 
ATOM   5355  C  C   . TRP C  1 73  ? 99.044  187.855 160.150 1.00 37.88  ? 94  TRP C C   1 
ATOM   5356  O  O   . TRP C  1 73  ? 99.046  188.076 161.346 1.00 38.43  ? 94  TRP C O   1 
ATOM   5357  C  CB  . TRP C  1 73  ? 97.040  189.289 159.860 1.00 39.23  ? 94  TRP C CB  1 
ATOM   5358  C  CG  . TRP C  1 73  ? 96.368  190.281 158.985 1.00 40.50  ? 94  TRP C CG  1 
ATOM   5359  C  CD1 . TRP C  1 73  ? 95.224  190.055 158.296 1.00 41.01  ? 94  TRP C CD1 1 
ATOM   5360  C  CD2 . TRP C  1 73  ? 96.794  191.612 158.654 1.00 41.81  ? 94  TRP C CD2 1 
ATOM   5361  N  NE1 . TRP C  1 73  ? 94.881  191.160 157.581 1.00 42.49  ? 94  TRP C NE1 1 
ATOM   5362  C  CE2 . TRP C  1 73  ? 95.835  192.130 157.750 1.00 42.97  ? 94  TRP C CE2 1 
ATOM   5363  C  CE3 . TRP C  1 73  ? 97.862  192.435 159.027 1.00 42.62  ? 94  TRP C CE3 1 
ATOM   5364  C  CZ2 . TRP C  1 73  ? 95.877  193.441 157.259 1.00 44.07  ? 94  TRP C CZ2 1 
ATOM   5365  C  CZ3 . TRP C  1 73  ? 97.915  193.724 158.534 1.00 44.04  ? 94  TRP C CZ3 1 
ATOM   5366  C  CH2 . TRP C  1 73  ? 96.939  194.214 157.662 1.00 44.75  ? 94  TRP C CH2 1 
ATOM   5367  N  N   . CYS C  1 74  ? 99.612  186.809 159.604 1.00 37.07  ? 95  CYS C N   1 
ATOM   5368  C  CA  . CYS C  1 74  ? 100.225 185.754 160.427 1.00 37.36  ? 95  CYS C CA  1 
ATOM   5369  C  C   . CYS C  1 74  ? 101.298 186.415 161.310 1.00 37.95  ? 95  CYS C C   1 
ATOM   5370  O  O   . CYS C  1 74  ? 102.087 187.207 160.783 1.00 38.02  ? 95  CYS C O   1 
ATOM   5371  C  CB  . CYS C  1 74  ? 100.801 184.675 159.521 1.00 36.92  ? 95  CYS C CB  1 
ATOM   5372  S  SG  . CYS C  1 74  ? 101.789 183.473 160.422 1.00 37.89  ? 95  CYS C SG  1 
ATOM   5373  N  N   . GLY C  1 75  ? 101.324 186.087 162.605 1.00 38.21  ? 96  GLY C N   1 
ATOM   5374  C  CA  . GLY C  1 75  ? 102.367 186.518 163.541 1.00 38.62  ? 96  GLY C CA  1 
ATOM   5375  C  C   . GLY C  1 75  ? 103.767 186.235 163.015 1.00 38.86  ? 96  GLY C C   1 
ATOM   5376  O  O   . GLY C  1 75  ? 104.659 186.913 163.453 1.00 40.24  ? 96  GLY C O   1 
ATOM   5377  N  N   . SER C  1 76  ? 104.005 185.279 162.116 1.00 37.76  ? 97  SER C N   1 
ATOM   5378  C  CA  . SER C  1 76  ? 105.381 184.992 161.622 1.00 38.00  ? 97  SER C CA  1 
ATOM   5379  C  C   . SER C  1 76  ? 105.934 186.109 160.693 1.00 39.09  ? 97  SER C C   1 
ATOM   5380  O  O   . SER C  1 76  ? 107.183 186.216 160.561 1.00 39.67  ? 97  SER C O   1 
ATOM   5381  C  CB  . SER C  1 76  ? 105.429 183.664 160.941 1.00 36.99  ? 97  SER C CB  1 
ATOM   5382  O  OG  . SER C  1 76  ? 104.795 183.747 159.693 1.00 35.96  ? 97  SER C OG  1 
ATOM   5383  N  N   . THR C  1 77  ? 105.068 186.944 160.102 1.00 39.29  ? 98  THR C N   1 
ATOM   5384  C  CA  . THR C  1 77  ? 105.401 187.977 159.100 1.00 40.81  ? 98  THR C CA  1 
ATOM   5385  C  C   . THR C  1 77  ? 105.373 189.366 159.720 1.00 42.36  ? 98  THR C C   1 
ATOM   5386  O  O   . THR C  1 77  ? 104.720 189.530 160.734 1.00 42.78  ? 98  THR C O   1 
ATOM   5387  C  CB  . THR C  1 77  ? 104.350 187.940 157.991 1.00 40.64  ? 98  THR C CB  1 
ATOM   5388  O  OG1 . THR C  1 77  ? 103.099 188.286 158.598 1.00 40.63  ? 98  THR C OG1 1 
ATOM   5389  C  CG2 . THR C  1 77  ? 104.296 186.577 157.335 1.00 39.48  ? 98  THR C CG2 1 
ATOM   5390  N  N   . ASN C  1 78  ? 105.935 190.368 159.064 1.00 44.20  ? 99  ASN C N   1 
ATOM   5391  C  CA  . ASN C  1 78  ? 105.629 191.782 159.445 1.00 46.05  ? 99  ASN C CA  1 
ATOM   5392  C  C   . ASN C  1 78  ? 104.648 192.344 158.419 1.00 45.42  ? 99  ASN C C   1 
ATOM   5393  O  O   . ASN C  1 78  ? 104.332 191.657 157.405 1.00 43.53  ? 99  ASN C O   1 
ATOM   5394  C  CB  . ASN C  1 78  ? 106.883 192.647 159.604 1.00 48.90  ? 99  ASN C CB  1 
ATOM   5395  C  CG  . ASN C  1 78  ? 107.678 192.699 158.325 1.00 51.06  ? 99  ASN C CG  1 
ATOM   5396  O  OD1 . ASN C  1 78  ? 107.094 192.756 157.244 1.00 52.43  ? 99  ASN C OD1 1 
ATOM   5397  N  ND2 . ASN C  1 78  ? 109.000 192.658 158.428 1.00 53.61  ? 99  ASN C ND2 1 
ATOM   5398  N  N   . SER C  1 79  ? 104.228 193.578 158.664 1.00 46.64  ? 100 SER C N   1 
ATOM   5399  C  CA  . SER C  1 79  ? 103.139 194.260 157.937 1.00 46.88  ? 100 SER C CA  1 
ATOM   5400  C  C   . SER C  1 79  ? 103.733 195.174 156.850 1.00 48.09  ? 100 SER C C   1 
ATOM   5401  O  O   . SER C  1 79  ? 102.958 195.911 156.201 1.00 48.99  ? 100 SER C O   1 
ATOM   5402  C  CB  . SER C  1 79  ? 102.271 195.010 158.923 1.00 47.71  ? 100 SER C CB  1 
ATOM   5403  O  OG  . SER C  1 79  ? 103.004 196.083 159.504 1.00 50.10  ? 100 SER C OG  1 
ATOM   5404  N  N   . ALA C  1 80  ? 105.041 195.117 156.631 1.00 48.36  ? 101 ALA C N   1 
ATOM   5405  C  CA  . ALA C  1 80  ? 105.701 195.863 155.533 1.00 49.99  ? 101 ALA C CA  1 
ATOM   5406  C  C   . ALA C  1 80  ? 105.664 195.026 154.264 1.00 48.65  ? 101 ALA C C   1 
ATOM   5407  O  O   . ALA C  1 80  ? 105.998 193.896 154.359 1.00 47.34  ? 101 ALA C O   1 
ATOM   5408  C  CB  . ALA C  1 80  ? 107.112 196.241 155.907 1.00 51.53  ? 101 ALA C CB  1 
ATOM   5409  N  N   . THR C  1 81  ? 105.349 195.639 153.123 1.00 49.82  ? 102 THR C N   1 
ATOM   5410  C  CA  . THR C  1 81  ? 105.521 194.960 151.813 1.00 49.14  ? 102 THR C CA  1 
ATOM   5411  C  C   . THR C  1 81  ? 107.007 195.065 151.416 1.00 50.63  ? 102 THR C C   1 
ATOM   5412  O  O   . THR C  1 81  ? 107.766 195.751 152.117 1.00 52.45  ? 102 THR C O   1 
ATOM   5413  C  CB  . THR C  1 81  ? 104.530 195.442 150.745 1.00 50.18  ? 102 THR C CB  1 
ATOM   5414  O  OG1 . THR C  1 81  ? 104.867 196.753 150.295 1.00 52.60  ? 102 THR C OG1 1 
ATOM   5415  C  CG2 . THR C  1 81  ? 103.090 195.392 151.201 1.00 48.94  ? 102 THR C CG2 1 
ATOM   5416  N  N   . GLU C  1 82  ? 107.430 194.335 150.385 1.00 50.07  ? 103 GLU C N   1 
ATOM   5417  C  CA  . GLU C  1 82  ? 108.838 194.353 149.919 1.00 52.04  ? 103 GLU C CA  1 
ATOM   5418  C  C   . GLU C  1 82  ? 109.315 195.779 149.650 1.00 56.21  ? 103 GLU C C   1 
ATOM   5419  O  O   . GLU C  1 82  ? 110.471 196.051 150.034 1.00 57.48  ? 103 GLU C O   1 
ATOM   5420  C  CB  . GLU C  1 82  ? 109.036 193.463 148.695 1.00 50.91  ? 103 GLU C CB  1 
ATOM   5421  C  CG  . GLU C  1 82  ? 109.164 192.001 149.105 1.00 47.94  ? 103 GLU C CG  1 
ATOM   5422  C  CD  . GLU C  1 82  ? 109.763 191.073 148.076 1.00 47.22  ? 103 GLU C CD  1 
ATOM   5423  O  OE1 . GLU C  1 82  ? 110.297 191.569 147.075 1.00 48.29  ? 103 GLU C OE1 1 
ATOM   5424  O  OE2 . GLU C  1 82  ? 109.681 189.825 148.316 1.00 44.80  ? 103 GLU C OE2 1 
ATOM   5425  N  N   . GLU C  1 83  ? 108.473 196.599 149.012 1.00 58.84  ? 104 GLU C N   1 
ATOM   5426  C  CA  . GLU C  1 83  ? 108.768 198.019 148.672 1.00 63.89  ? 104 GLU C CA  1 
ATOM   5427  C  C   . GLU C  1 83  ? 108.770 198.919 149.918 1.00 64.44  ? 104 GLU C C   1 
ATOM   5428  O  O   . GLU C  1 83  ? 109.328 200.013 149.830 1.00 67.82  ? 104 GLU C O   1 
ATOM   5429  C  CB  . GLU C  1 83  ? 107.883 198.501 147.522 1.00 66.82  ? 104 GLU C CB  1 
ATOM   5430  C  CG  . GLU C  1 83  ? 108.398 198.060 146.165 1.00 67.50  ? 104 GLU C CG  1 
ATOM   5431  C  CD  . GLU C  1 83  ? 107.354 197.928 145.072 1.00 67.87  ? 104 GLU C CD  1 
ATOM   5432  O  OE1 . GLU C  1 83  ? 106.214 197.529 145.384 1.00 66.13  ? 104 GLU C OE1 1 
ATOM   5433  O  OE2 . GLU C  1 83  ? 107.685 198.220 143.911 1.00 69.49  ? 104 GLU C OE2 1 
ATOM   5434  N  N   . GLY C  1 84  ? 108.109 198.514 151.006 1.00 62.03  ? 105 GLY C N   1 
ATOM   5435  C  CA  . GLY C  1 84  ? 108.092 199.323 152.254 1.00 63.03  ? 105 GLY C CA  1 
ATOM   5436  C  C   . GLY C  1 84  ? 106.726 199.939 152.633 1.00 62.53  ? 105 GLY C C   1 
ATOM   5437  O  O   . GLY C  1 84  ? 106.685 200.742 153.575 1.00 63.48  ? 105 GLY C O   1 
ATOM   5438  N  N   . LYS C  1 85  ? 105.665 199.517 151.914 1.00 61.13  ? 106 LYS C N   1 
ATOM   5439  C  CA  . LYS C  1 85  ? 104.265 199.970 152.120 1.00 61.31  ? 106 LYS C CA  1 
ATOM   5440  C  C   . LYS C  1 85  ? 103.709 199.255 153.354 1.00 59.44  ? 106 LYS C C   1 
ATOM   5441  O  O   . LYS C  1 85  ? 103.976 198.015 153.555 1.00 57.23  ? 106 LYS C O   1 
ATOM   5442  C  CB  . LYS C  1 85  ? 103.412 199.781 150.859 1.00 60.97  ? 106 LYS C CB  1 
ATOM   5443  C  CG  . LYS C  1 85  ? 103.642 200.854 149.790 1.00 64.46  ? 106 LYS C CG  1 
ATOM   5444  C  CD  . LYS C  1 85  ? 102.601 200.860 148.690 1.00 64.60  ? 106 LYS C CD  1 
ATOM   5445  C  CE  . LYS C  1 85  ? 102.762 201.958 147.677 1.00 68.09  ? 106 LYS C CE  1 
ATOM   5446  N  NZ  . LYS C  1 85  ? 101.468 202.226 147.012 1.00 68.78  ? 106 LYS C NZ  1 
ATOM   5447  N  N   . GLU C  1 86  ? 102.973 200.009 154.167 1.00 60.57  ? 107 GLU C N   1 
ATOM   5448  C  CA  . GLU C  1 86  ? 102.516 199.567 155.503 1.00 59.63  ? 107 GLU C CA  1 
ATOM   5449  C  C   . GLU C  1 86  ? 101.065 199.071 155.373 1.00 58.41  ? 107 GLU C C   1 
ATOM   5450  O  O   . GLU C  1 86  ? 100.163 199.904 155.160 1.00 59.13  ? 107 GLU C O   1 
ATOM   5451  C  CB  . GLU C  1 86  ? 102.748 200.691 156.512 1.00 62.14  ? 107 GLU C CB  1 
ATOM   5452  C  CG  . GLU C  1 86  ? 102.077 200.442 157.838 1.00 61.54  ? 107 GLU C CG  1 
ATOM   5453  C  CD  . GLU C  1 86  ? 102.442 199.097 158.441 1.00 60.15  ? 107 GLU C CD  1 
ATOM   5454  O  OE1 . GLU C  1 86  ? 103.642 198.957 158.831 1.00 61.93  ? 107 GLU C OE1 1 
ATOM   5455  O  OE2 . GLU C  1 86  ? 101.545 198.174 158.472 1.00 58.07  ? 107 GLU C OE2 1 
ATOM   5456  N  N   . LEU C  1 87  ? 100.870 197.750 155.512 1.00 56.19  ? 108 LEU C N   1 
ATOM   5457  C  CA  . LEU C  1 87  ? 99.595  197.042 155.244 1.00 55.15  ? 108 LEU C CA  1 
ATOM   5458  C  C   . LEU C  1 87  ? 98.529  197.420 156.304 1.00 55.96  ? 108 LEU C C   1 
ATOM   5459  O  O   . LEU C  1 87  ? 97.281  197.358 155.989 1.00 57.26  ? 108 LEU C O   1 
ATOM   5460  C  CB  . LEU C  1 87  ? 99.843  195.526 155.203 1.00 52.61  ? 108 LEU C CB  1 
ATOM   5461  C  CG  . LEU C  1 87  ? 100.610 195.014 153.984 1.00 52.09  ? 108 LEU C CG  1 
ATOM   5462  C  CD1 . LEU C  1 87  ? 100.992 193.555 154.147 1.00 50.51  ? 108 LEU C CD1 1 
ATOM   5463  C  CD2 . LEU C  1 87  ? 99.801  195.179 152.708 1.00 52.77  ? 108 LEU C CD2 1 
ATOM   5464  N  N   . LYS C  1 88  ? 98.979  197.932 157.473 1.00 56.59  ? 109 LYS C N   1 
ATOM   5465  C  CA  . LYS C  1 88  ? 98.063  198.320 158.597 1.00 57.99  ? 109 LYS C CA  1 
ATOM   5466  C  C   . LYS C  1 88  ? 97.327  199.635 158.302 1.00 59.18  ? 109 LYS C C   1 
ATOM   5467  O  O   . LYS C  1 88  ? 96.345  199.923 159.006 1.00 59.23  ? 109 LYS C O   1 
ATOM   5468  C  CB  . LYS C  1 88  ? 98.827  198.431 159.924 1.00 59.95  ? 109 LYS C CB  1 
ATOM   5469  C  CG  . LYS C  1 88  ? 99.101  197.090 160.594 1.00 59.62  ? 109 LYS C CG  1 
ATOM   5470  C  CD  . LYS C  1 88  ? 99.892  197.161 161.882 1.00 61.68  ? 109 LYS C CD  1 
ATOM   5471  C  CE  . LYS C  1 88  ? 99.526  196.023 162.820 1.00 62.47  ? 109 LYS C CE  1 
ATOM   5472  N  NZ  . LYS C  1 88  ? 100.717 195.405 163.456 1.00 63.31  ? 109 LYS C NZ  1 
ATOM   5473  N  N   . ASP C  1 89  ? 97.863  200.445 157.383 1.00 60.51  ? 110 ASP C N   1 
ATOM   5474  C  CA  . ASP C  1 89  ? 97.289  201.719 156.875 1.00 62.27  ? 110 ASP C CA  1 
ATOM   5475  C  C   . ASP C  1 89  ? 96.189  201.359 155.879 1.00 61.61  ? 110 ASP C C   1 
ATOM   5476  O  O   . ASP C  1 89  ? 96.458  200.572 154.880 1.00 60.12  ? 110 ASP C O   1 
ATOM   5477  C  CB  . ASP C  1 89  ? 98.343  202.544 156.159 1.00 64.91  ? 110 ASP C CB  1 
ATOM   5478  C  CG  . ASP C  1 89  ? 97.901  203.976 155.862 1.00 68.55  ? 110 ASP C CG  1 
ATOM   5479  O  OD1 . ASP C  1 89  ? 96.737  204.186 155.382 1.00 68.98  ? 110 ASP C OD1 1 
ATOM   5480  O  OD2 . ASP C  1 89  ? 98.706  204.875 156.178 1.00 70.56  ? 110 ASP C OD2 1 
ATOM   5481  N  N   . PRO C  1 90  ? 94.935  201.791 156.137 1.00 62.15  ? 111 PRO C N   1 
ATOM   5482  C  CA  . PRO C  1 90  ? 93.780  201.471 155.287 1.00 62.10  ? 111 PRO C CA  1 
ATOM   5483  C  C   . PRO C  1 90  ? 93.932  202.007 153.859 1.00 63.34  ? 111 PRO C C   1 
ATOM   5484  O  O   . PRO C  1 90  ? 93.365  201.431 152.953 1.00 63.09  ? 111 PRO C O   1 
ATOM   5485  C  CB  . PRO C  1 90  ? 92.592  202.108 156.019 1.00 63.91  ? 111 PRO C CB  1 
ATOM   5486  C  CG  . PRO C  1 90  ? 93.066  202.209 157.444 1.00 63.28  ? 111 PRO C CG  1 
ATOM   5487  C  CD  . PRO C  1 90  ? 94.536  202.547 157.319 1.00 63.39  ? 111 PRO C CD  1 
ATOM   5488  N  N   . ARG C  1 91  ? 94.627  203.134 153.718 1.00 65.61  ? 112 ARG C N   1 
ATOM   5489  C  CA  . ARG C  1 91  ? 94.886  203.736 152.370 1.00 67.60  ? 112 ARG C CA  1 
ATOM   5490  C  C   . ARG C  1 91  ? 95.537  202.657 151.481 1.00 65.51  ? 112 ARG C C   1 
ATOM   5491  O  O   . ARG C  1 91  ? 95.292  202.639 150.240 1.00 65.94  ? 112 ARG C O   1 
ATOM   5492  C  CB  . ARG C  1 91  ? 95.768  204.973 152.529 1.00 70.27  ? 112 ARG C CB  1 
ATOM   5493  C  CG  . ARG C  1 91  ? 95.117  206.062 153.370 1.00 72.77  ? 112 ARG C CG  1 
ATOM   5494  C  CD  . ARG C  1 91  ? 95.993  207.257 153.665 1.00 75.53  ? 112 ARG C CD  1 
ATOM   5495  N  NE  . ARG C  1 91  ? 96.962  206.985 154.720 1.00 73.77  ? 112 ARG C NE  1 
ATOM   5496  C  CZ  . ARG C  1 91  ? 97.559  207.937 155.422 1.00 75.99  ? 112 ARG C CZ  1 
ATOM   5497  N  NH1 . ARG C  1 91  ? 97.298  209.206 155.162 1.00 80.10  ? 112 ARG C NH1 1 
ATOM   5498  N  NH2 . ARG C  1 91  ? 98.424  207.650 156.370 1.00 74.39  ? 112 ARG C NH2 1 
ATOM   5499  N  N   . VAL C  1 92  ? 96.257  201.729 152.122 1.00 62.80  ? 113 VAL C N   1 
ATOM   5500  C  CA  . VAL C  1 92  ? 97.056  200.661 151.463 1.00 60.62  ? 113 VAL C CA  1 
ATOM   5501  C  C   . VAL C  1 92  ? 96.200  199.408 151.274 1.00 58.27  ? 113 VAL C C   1 
ATOM   5502  O  O   . VAL C  1 92  ? 96.312  198.724 150.202 1.00 57.23  ? 113 VAL C O   1 
ATOM   5503  C  CB  . VAL C  1 92  ? 98.301  200.352 152.295 1.00 59.15  ? 113 VAL C CB  1 
ATOM   5504  C  CG1 . VAL C  1 92  ? 99.074  199.229 151.653 1.00 57.21  ? 113 VAL C CG1 1 
ATOM   5505  C  CG2 . VAL C  1 92  ? 99.177  201.582 152.480 1.00 61.85  ? 113 VAL C CG2 1 
ATOM   5506  N  N   . LEU C  1 93  ? 95.428  199.076 152.311 1.00 51.18  ? 114 LEU C N   1 
ATOM   5507  C  CA  . LEU C  1 93  ? 94.642  197.824 152.367 1.00 49.85  ? 114 LEU C CA  1 
ATOM   5508  C  C   . LEU C  1 93  ? 93.484  197.976 153.382 1.00 50.03  ? 114 LEU C C   1 
ATOM   5509  O  O   . LEU C  1 93  ? 93.703  198.284 154.599 1.00 49.84  ? 114 LEU C O   1 
ATOM   5510  C  CB  . LEU C  1 93  ? 95.574  196.644 152.693 1.00 48.23  ? 114 LEU C CB  1 
ATOM   5511  C  CG  . LEU C  1 93  ? 94.860  195.291 152.793 1.00 47.58  ? 114 LEU C CG  1 
ATOM   5512  C  CD1 . LEU C  1 93  ? 94.214  194.902 151.472 1.00 48.19  ? 114 LEU C CD1 1 
ATOM   5513  C  CD2 . LEU C  1 93  ? 95.779  194.164 153.254 1.00 46.15  ? 114 LEU C CD2 1 
ATOM   5514  N  N   . THR C  1 94  ? 92.294  197.695 152.877 1.00 50.24  ? 115 THR C N   1 
ATOM   5515  C  CA  . THR C  1 94  ? 91.077  197.401 153.656 1.00 50.84  ? 115 THR C CA  1 
ATOM   5516  C  C   . THR C  1 94  ? 90.466  196.116 153.094 1.00 50.44  ? 115 THR C C   1 
ATOM   5517  O  O   . THR C  1 94  ? 90.921  195.631 152.014 1.00 50.97  ? 115 THR C O   1 
ATOM   5518  C  CB  . THR C  1 94  ? 90.073  198.569 153.593 1.00 52.53  ? 115 THR C CB  1 
ATOM   5519  O  OG1 . THR C  1 94  ? 89.610  198.782 152.241 1.00 53.04  ? 115 THR C OG1 1 
ATOM   5520  C  CG2 . THR C  1 94  ? 90.674  199.821 154.190 1.00 53.41  ? 115 THR C CG2 1 
ATOM   5521  N  N   . ASP C  1 95  ? 89.415  195.649 153.760 1.00 50.87  ? 116 ASP C N   1 
ATOM   5522  C  CA  . ASP C  1 95  ? 88.784  194.346 153.481 1.00 50.93  ? 116 ASP C CA  1 
ATOM   5523  C  C   . ASP C  1 95  ? 87.293  194.564 153.689 1.00 51.92  ? 116 ASP C C   1 
ATOM   5524  O  O   . ASP C  1 95  ? 86.930  194.983 154.767 1.00 52.52  ? 116 ASP C O   1 
ATOM   5525  C  CB  . ASP C  1 95  ? 89.395  193.284 154.412 1.00 49.69  ? 116 ASP C CB  1 
ATOM   5526  C  CG  . ASP C  1 95  ? 88.983  191.853 154.144 1.00 49.67  ? 116 ASP C CG  1 
ATOM   5527  O  OD1 . ASP C  1 95  ? 88.054  191.606 153.320 1.00 50.19  ? 116 ASP C OD1 1 
ATOM   5528  O  OD2 . ASP C  1 95  ? 89.596  190.976 154.800 1.00 50.99  ? 116 ASP C OD2 1 
ATOM   5529  N  N   . VAL C  1 96  ? 86.487  194.280 152.678 1.00 52.43  ? 117 VAL C N   1 
ATOM   5530  C  CA  . VAL C  1 96  ? 85.008  194.387 152.771 1.00 53.85  ? 117 VAL C CA  1 
ATOM   5531  C  C   . VAL C  1 96  ? 84.451  192.982 152.964 1.00 52.70  ? 117 VAL C C   1 
ATOM   5532  O  O   . VAL C  1 96  ? 83.279  192.809 152.736 1.00 54.25  ? 117 VAL C O   1 
ATOM   5533  C  CB  . VAL C  1 96  ? 84.404  195.098 151.520 1.00 55.65  ? 117 VAL C CB  1 
ATOM   5534  C  CG1 . VAL C  1 96  ? 84.955  196.501 151.344 1.00 56.52  ? 117 VAL C CG1 1 
ATOM   5535  C  CG2 . VAL C  1 96  ? 84.578  194.320 150.221 1.00 54.93  ? 117 VAL C CG2 1 
ATOM   5536  N  N   . GLY C  1 97  ? 85.289  191.998 153.277 1.00 51.29  ? 118 GLY C N   1 
ATOM   5537  C  CA  . GLY C  1 97  ? 84.845  190.627 153.534 1.00 50.19  ? 118 GLY C CA  1 
ATOM   5538  C  C   . GLY C  1 97  ? 84.398  189.926 152.264 1.00 50.48  ? 118 GLY C C   1 
ATOM   5539  O  O   . GLY C  1 97  ? 84.798  190.366 151.157 1.00 51.34  ? 118 GLY C O   1 
ATOM   5540  N  N   . ASP C  1 98  ? 83.595  188.868 152.444 1.00 50.58  ? 119 ASP C N   1 
ATOM   5541  C  CA  . ASP C  1 98  ? 83.243  187.832 151.444 1.00 50.40  ? 119 ASP C CA  1 
ATOM   5542  C  C   . ASP C  1 98  ? 81.802  188.013 150.969 1.00 52.10  ? 119 ASP C C   1 
ATOM   5543  O  O   . ASP C  1 98  ? 80.915  188.429 151.753 1.00 52.76  ? 119 ASP C O   1 
ATOM   5544  C  CB  . ASP C  1 98  ? 83.389  186.434 152.034 1.00 49.98  ? 119 ASP C CB  1 
ATOM   5545  C  CG  . ASP C  1 98  ? 84.842  186.007 152.187 1.00 49.11  ? 119 ASP C CG  1 
ATOM   5546  O  OD1 . ASP C  1 98  ? 85.714  186.774 151.671 1.00 48.14  ? 119 ASP C OD1 1 
ATOM   5547  O  OD2 . ASP C  1 98  ? 85.085  184.907 152.792 1.00 48.31  ? 119 ASP C OD2 1 
ATOM   5548  N  N   . VAL C  1 99  ? 81.557  187.600 149.729 1.00 51.96  ? 120 VAL C N   1 
ATOM   5549  C  CA  . VAL C  1 99  ? 80.182  187.579 149.164 1.00 53.68  ? 120 VAL C CA  1 
ATOM   5550  C  C   . VAL C  1 99  ? 79.592  186.241 149.622 1.00 53.50  ? 120 VAL C C   1 
ATOM   5551  O  O   . VAL C  1 99  ? 80.258  185.221 149.411 1.00 51.52  ? 120 VAL C O   1 
ATOM   5552  C  CB  . VAL C  1 99  ? 80.230  187.675 147.627 1.00 53.72  ? 120 VAL C CB  1 
ATOM   5553  C  CG1 . VAL C  1 99  ? 78.877  187.415 146.993 1.00 55.53  ? 120 VAL C CG1 1 
ATOM   5554  C  CG2 . VAL C  1 99  ? 80.810  188.997 147.154 1.00 53.64  ? 120 VAL C CG2 1 
ATOM   5555  N  N   . PRO C  1 100 ? 78.362  186.158 150.171 1.00 55.09  ? 121 PRO C N   1 
ATOM   5556  C  CA  . PRO C  1 100 ? 77.835  184.873 150.635 1.00 56.17  ? 121 PRO C CA  1 
ATOM   5557  C  C   . PRO C  1 100 ? 77.286  183.994 149.503 1.00 57.13  ? 121 PRO C C   1 
ATOM   5558  O  O   . PRO C  1 100 ? 76.104  183.754 149.450 1.00 59.84  ? 121 PRO C O   1 
ATOM   5559  C  CB  . PRO C  1 100 ? 76.710  185.291 151.585 1.00 57.61  ? 121 PRO C CB  1 
ATOM   5560  C  CG  . PRO C  1 100 ? 76.255  186.624 151.057 1.00 58.81  ? 121 PRO C CG  1 
ATOM   5561  C  CD  . PRO C  1 100 ? 77.487  187.280 150.475 1.00 56.91  ? 121 PRO C CD  1 
ATOM   5562  N  N   . VAL C  1 101 ? 78.212  183.470 148.702 1.00 54.85  ? 122 VAL C N   1 
ATOM   5563  C  CA  . VAL C  1 101 ? 77.967  182.625 147.503 1.00 55.64  ? 122 VAL C CA  1 
ATOM   5564  C  C   . VAL C  1 101 ? 77.280  181.323 147.908 1.00 57.25  ? 122 VAL C C   1 
ATOM   5565  O  O   . VAL C  1 101 ? 76.355  180.903 147.195 1.00 59.71  ? 122 VAL C O   1 
ATOM   5566  C  CB  . VAL C  1 101 ? 79.311  182.306 146.822 1.00 53.31  ? 122 VAL C CB  1 
ATOM   5567  C  CG1 . VAL C  1 101 ? 79.171  181.244 145.747 1.00 53.88  ? 122 VAL C CG1 1 
ATOM   5568  C  CG2 . VAL C  1 101 ? 80.001  183.545 146.288 1.00 52.04  ? 122 VAL C CG2 1 
ATOM   5569  N  N   . GLN C  1 102 ? 77.697  180.724 149.023 1.00 56.70  ? 123 GLN C N   1 
ATOM   5570  C  CA  . GLN C  1 102 ? 77.143  179.384 149.348 1.00 58.25  ? 123 GLN C CA  1 
ATOM   5571  C  C   . GLN C  1 102 ? 75.674  179.535 149.790 1.00 60.76  ? 123 GLN C C   1 
ATOM   5572  O  O   . GLN C  1 102 ? 74.895  178.571 149.582 1.00 60.75  ? 123 GLN C O   1 
ATOM   5573  C  CB  . GLN C  1 102 ? 77.986  178.683 150.410 1.00 57.25  ? 123 GLN C CB  1 
ATOM   5574  C  CG  . GLN C  1 102 ? 79.431  178.564 149.994 1.00 56.19  ? 123 GLN C CG  1 
ATOM   5575  C  CD  . GLN C  1 102 ? 79.547  178.016 148.587 1.00 57.07  ? 123 GLN C CD  1 
ATOM   5576  O  OE1 . GLN C  1 102 ? 78.780  177.129 148.205 1.00 58.92  ? 123 GLN C OE1 1 
ATOM   5577  N  NE2 . GLN C  1 102 ? 80.522  178.517 147.828 1.00 55.10  ? 123 GLN C NE2 1 
ATOM   5578  N  N   . GLU C  1 103 ? 75.375  180.616 150.510 1.00 61.88  ? 124 GLU C N   1 
ATOM   5579  C  CA  . GLU C  1 103 ? 73.997  180.888 150.980 1.00 65.40  ? 124 GLU C CA  1 
ATOM   5580  C  C   . GLU C  1 103 ? 73.117  181.136 149.754 1.00 66.73  ? 124 GLU C C   1 
ATOM   5581  O  O   . GLU C  1 103 ? 72.095  180.443 149.617 1.00 68.30  ? 124 GLU C O   1 
ATOM   5582  C  CB  . GLU C  1 103 ? 74.027  182.103 151.905 1.00 66.54  ? 124 GLU C CB  1 
ATOM   5583  C  CG  . GLU C  1 103 ? 74.578  181.797 153.287 1.00 65.94  ? 124 GLU C CG  1 
ATOM   5584  C  CD  . GLU C  1 103 ? 76.056  181.454 153.397 1.00 63.85  ? 124 GLU C CD  1 
ATOM   5585  O  OE1 . GLU C  1 103 ? 76.870  182.163 152.775 1.00 64.53  ? 124 GLU C OE1 1 
ATOM   5586  O  OE2 . GLU C  1 103 ? 76.386  180.491 154.114 1.00 61.20  ? 124 GLU C OE2 1 
ATOM   5587  N  N   . ILE C  1 104 ? 73.585  182.002 148.848 1.00 65.15  ? 125 ILE C N   1 
ATOM   5588  C  CA  . ILE C  1 104 ? 72.882  182.272 147.565 1.00 66.13  ? 125 ILE C CA  1 
ATOM   5589  C  C   . ILE C  1 104 ? 72.672  180.968 146.777 1.00 66.21  ? 125 ILE C C   1 
ATOM   5590  O  O   . ILE C  1 104 ? 71.516  180.678 146.389 1.00 68.20  ? 125 ILE C O   1 
ATOM   5591  C  CB  . ILE C  1 104 ? 73.615  183.347 146.765 1.00 64.52  ? 125 ILE C CB  1 
ATOM   5592  C  CG1 . ILE C  1 104 ? 73.752  184.656 147.557 1.00 64.07  ? 125 ILE C CG1 1 
ATOM   5593  C  CG2 . ILE C  1 104 ? 72.852  183.542 145.475 1.00 66.90  ? 125 ILE C CG2 1 
ATOM   5594  C  CD1 . ILE C  1 104 ? 74.494  185.781 146.856 1.00 62.86  ? 125 ILE C CD1 1 
ATOM   5595  N  N   . ARG C  1 105 ? 73.717  180.186 146.542 1.00 64.26  ? 126 ARG C N   1 
ATOM   5596  C  CA  . ARG C  1 105 ? 73.561  178.878 145.845 1.00 64.93  ? 126 ARG C CA  1 
ATOM   5597  C  C   . ARG C  1 105 ? 72.468  178.045 146.520 1.00 67.55  ? 126 ARG C C   1 
ATOM   5598  O  O   . ARG C  1 105 ? 71.686  177.352 145.812 1.00 69.29  ? 126 ARG C O   1 
ATOM   5599  C  CB  . ARG C  1 105 ? 74.866  178.087 145.850 1.00 61.88  ? 126 ARG C CB  1 
ATOM   5600  C  CG  . ARG C  1 105 ? 75.917  178.651 144.911 1.00 59.90  ? 126 ARG C CG  1 
ATOM   5601  C  CD  . ARG C  1 105 ? 77.147  177.758 144.987 1.00 57.56  ? 126 ARG C CD  1 
ATOM   5602  N  NE  . ARG C  1 105 ? 76.922  176.477 144.330 1.00 57.80  ? 126 ARG C NE  1 
ATOM   5603  C  CZ  . ARG C  1 105 ? 77.486  175.325 144.664 1.00 56.74  ? 126 ARG C CZ  1 
ATOM   5604  N  NH1 . ARG C  1 105 ? 78.330  175.241 145.690 1.00 54.94  ? 126 ARG C NH1 1 
ATOM   5605  N  NH2 . ARG C  1 105 ? 77.181  174.245 143.968 1.00 57.38  ? 126 ARG C NH2 1 
ATOM   5606  N  N   . ASP C  1 106 ? 72.423  178.101 147.848 1.00 67.81  ? 127 ASP C N   1 
ATOM   5607  C  CA  . ASP C  1 106 ? 71.616  177.155 148.640 1.00 70.22  ? 127 ASP C CA  1 
ATOM   5608  C  C   . ASP C  1 106 ? 70.130  177.526 148.530 1.00 73.82  ? 127 ASP C C   1 
ATOM   5609  O  O   . ASP C  1 106 ? 69.302  176.599 148.623 1.00 75.58  ? 127 ASP C O   1 
ATOM   5610  C  CB  . ASP C  1 106 ? 72.150  177.053 150.067 1.00 69.28  ? 127 ASP C CB  1 
ATOM   5611  C  CG  . ASP C  1 106 ? 71.055  176.625 150.981 1.00 72.24  ? 127 ASP C CG  1 
ATOM   5612  O  OD1 . ASP C  1 106 ? 70.188  177.506 151.253 1.00 74.11  ? 127 ASP C OD1 1 
ATOM   5613  O  OD2 . ASP C  1 106 ? 71.046  175.407 151.377 1.00 74.19  ? 127 ASP C OD2 1 
ATOM   5614  N  N   . CYS C  1 107 ? 69.792  178.804 148.350 1.00 74.63  ? 128 CYS C N   1 
ATOM   5615  C  CA  . CYS C  1 107 ? 68.384  179.250 148.279 1.00 79.26  ? 128 CYS C CA  1 
ATOM   5616  C  C   . CYS C  1 107 ? 67.859  179.060 146.835 1.00 80.93  ? 128 CYS C C   1 
ATOM   5617  O  O   . CYS C  1 107 ? 66.806  179.667 146.493 1.00 82.73  ? 128 CYS C O   1 
ATOM   5618  C  CB  . CYS C  1 107 ? 68.244  180.656 148.862 1.00 80.35  ? 128 CYS C CB  1 
ATOM   5619  S  SG  . CYS C  1 107 ? 68.724  182.013 147.761 1.00 80.76  ? 128 CYS C SG  1 
ATOM   5620  N  N   . GLY C  1 108 ? 68.572  178.249 146.024 1.00 79.57  ? 129 GLY C N   1 
ATOM   5621  C  CA  . GLY C  1 108 ? 68.163  177.772 144.681 1.00 80.64  ? 129 GLY C CA  1 
ATOM   5622  C  C   . GLY C  1 108 ? 68.455  178.727 143.518 1.00 79.86  ? 129 GLY C C   1 
ATOM   5623  O  O   . GLY C  1 108 ? 68.058  178.364 142.387 1.00 81.48  ? 129 GLY C O   1 
ATOM   5624  N  N   . VAL C  1 109 ? 69.057  179.905 143.741 1.00 78.19  ? 130 VAL C N   1 
ATOM   5625  C  CA  . VAL C  1 109 ? 69.415  180.890 142.662 1.00 78.24  ? 130 VAL C CA  1 
ATOM   5626  C  C   . VAL C  1 109 ? 70.319  180.194 141.622 1.00 77.05  ? 130 VAL C C   1 
ATOM   5627  O  O   . VAL C  1 109 ? 71.267  179.519 142.084 1.00 75.68  ? 130 VAL C O   1 
ATOM   5628  C  CB  . VAL C  1 109 ? 70.140  182.119 143.254 1.00 76.35  ? 130 VAL C CB  1 
ATOM   5629  C  CG1 . VAL C  1 109 ? 70.900  182.911 142.206 1.00 75.13  ? 130 VAL C CG1 1 
ATOM   5630  C  CG2 . VAL C  1 109 ? 69.209  183.024 144.028 1.00 78.19  ? 130 VAL C CG2 1 
ATOM   5631  N  N   . ASP C  1 110 ? 70.060  180.362 140.312 1.00 77.54  ? 131 ASP C N   1 
ATOM   5632  C  CA  . ASP C  1 110 ? 70.882  179.850 139.167 1.00 76.37  ? 131 ASP C CA  1 
ATOM   5633  C  C   . ASP C  1 110 ? 72.167  180.684 138.929 1.00 73.15  ? 131 ASP C C   1 
ATOM   5634  O  O   . ASP C  1 110 ? 72.267  181.820 139.484 1.00 72.74  ? 131 ASP C O   1 
ATOM   5635  C  CB  . ASP C  1 110 ? 70.069  179.842 137.860 1.00 78.76  ? 131 ASP C CB  1 
ATOM   5636  C  CG  . ASP C  1 110 ? 69.811  181.199 137.208 1.00 80.03  ? 131 ASP C CG  1 
ATOM   5637  O  OD1 . ASP C  1 110 ? 70.752  181.993 137.072 1.00 78.49  ? 131 ASP C OD1 1 
ATOM   5638  O  OD2 . ASP C  1 110 ? 68.663  181.440 136.787 1.00 83.76  ? 131 ASP C OD2 1 
ATOM   5639  N  N   . ASP C  1 111 ? 73.078  180.215 138.055 1.00 70.70  ? 132 ASP C N   1 
ATOM   5640  C  CA  . ASP C  1 111 ? 74.461  180.782 137.979 1.00 68.32  ? 132 ASP C CA  1 
ATOM   5641  C  C   . ASP C  1 111 ? 74.421  182.198 137.397 1.00 67.99  ? 132 ASP C C   1 
ATOM   5642  O  O   . ASP C  1 111 ? 75.168  183.066 137.901 1.00 65.46  ? 132 ASP C O   1 
ATOM   5643  C  CB  . ASP C  1 111 ? 75.482  179.869 137.284 1.00 66.86  ? 132 ASP C CB  1 
ATOM   5644  C  CG  . ASP C  1 111 ? 76.351  179.134 138.299 1.00 65.52  ? 132 ASP C CG  1 
ATOM   5645  O  OD1 . ASP C  1 111 ? 75.791  178.261 138.990 1.00 65.83  ? 132 ASP C OD1 1 
ATOM   5646  O  OD2 . ASP C  1 111 ? 77.613  179.467 138.426 1.00 64.23  ? 132 ASP C OD2 1 
ATOM   5647  N  N   . ASP C  1 112 ? 73.562  182.423 136.398 1.00 70.10  ? 133 ASP C N   1 
ATOM   5648  C  CA  . ASP C  1 112 ? 73.316  183.757 135.798 1.00 71.00  ? 133 ASP C CA  1 
ATOM   5649  C  C   . ASP C  1 112 ? 73.192  184.810 136.907 1.00 71.28  ? 133 ASP C C   1 
ATOM   5650  O  O   . ASP C  1 112 ? 74.017  185.734 136.965 1.00 69.72  ? 133 ASP C O   1 
ATOM   5651  C  CB  . ASP C  1 112 ? 72.068  183.740 134.905 1.00 73.78  ? 133 ASP C CB  1 
ATOM   5652  C  CG  . ASP C  1 112 ? 72.325  183.287 133.483 1.00 73.27  ? 133 ASP C CG  1 
ATOM   5653  O  OD1 . ASP C  1 112 ? 73.531  183.157 133.112 1.00 70.21  ? 133 ASP C OD1 1 
ATOM   5654  O  OD2 . ASP C  1 112 ? 71.301  183.054 132.772 1.00 75.73  ? 133 ASP C OD2 1 
ATOM   5655  N  N   . ARG C  1 113 ? 72.185  184.673 137.761 1.00 73.99  ? 134 ARG C N   1 
ATOM   5656  C  CA  . ARG C  1 113 ? 71.922  185.632 138.863 1.00 75.46  ? 134 ARG C CA  1 
ATOM   5657  C  C   . ARG C  1 113 ? 73.095  185.636 139.850 1.00 72.26  ? 134 ARG C C   1 
ATOM   5658  O  O   . ARG C  1 113 ? 73.475  186.739 140.251 1.00 72.66  ? 134 ARG C O   1 
ATOM   5659  C  CB  . ARG C  1 113 ? 70.593  185.282 139.527 1.00 79.14  ? 134 ARG C CB  1 
ATOM   5660  C  CG  . ARG C  1 113 ? 69.495  185.008 138.513 1.00 82.73  ? 134 ARG C CG  1 
ATOM   5661  C  CD  . ARG C  1 113 ? 68.246  185.727 138.920 1.00 86.74  ? 134 ARG C CD  1 
ATOM   5662  N  NE  . ARG C  1 113 ? 67.550  185.018 139.977 1.00 88.81  ? 134 ARG C NE  1 
ATOM   5663  C  CZ  . ARG C  1 113 ? 66.988  185.592 141.044 1.00 90.99  ? 134 ARG C CZ  1 
ATOM   5664  N  NH1 . ARG C  1 113 ? 66.320  184.841 141.905 1.00 92.69  ? 134 ARG C NH1 1 
ATOM   5665  N  NH2 . ARG C  1 113 ? 67.091  186.899 141.260 1.00 91.44  ? 134 ARG C NH2 1 
ATOM   5666  N  N   . LEU C  1 114 ? 73.693  184.490 140.184 1.00 69.78  ? 135 LEU C N   1 
ATOM   5667  C  CA  . LEU C  1 114 ? 74.889  184.451 141.102 1.00 67.69  ? 135 LEU C CA  1 
ATOM   5668  C  C   . LEU C  1 114 ? 76.015  185.352 140.570 1.00 66.14  ? 135 LEU C C   1 
ATOM   5669  O  O   . LEU C  1 114 ? 76.491  186.273 141.303 1.00 64.65  ? 135 LEU C O   1 
ATOM   5670  C  CB  . LEU C  1 114 ? 75.438  183.026 141.279 1.00 65.95  ? 135 LEU C CB  1 
ATOM   5671  C  CG  . LEU C  1 114 ? 76.652  182.922 142.210 1.00 64.07  ? 135 LEU C CG  1 
ATOM   5672  C  CD1 . LEU C  1 114 ? 76.468  183.723 143.499 1.00 63.85  ? 135 LEU C CD1 1 
ATOM   5673  C  CD2 . LEU C  1 114 ? 76.976  181.469 142.536 1.00 63.05  ? 135 LEU C CD2 1 
ATOM   5674  N  N   . MET C  1 115 ? 76.390  185.132 139.306 1.00 66.39  ? 136 MET C N   1 
ATOM   5675  C  CA  A MET C  1 115 ? 77.561  185.821 138.715 0.50 65.04  ? 136 MET C CA  1 
ATOM   5676  C  CA  B MET C  1 115 ? 77.544  185.825 138.674 0.50 64.95  ? 136 MET C CA  1 
ATOM   5677  C  C   . MET C  1 115 ? 77.227  187.316 138.626 1.00 66.23  ? 136 MET C C   1 
ATOM   5678  O  O   . MET C  1 115 ? 78.113  188.120 138.864 1.00 64.57  ? 136 MET C O   1 
ATOM   5679  C  CB  A MET C  1 115 ? 77.934  185.205 137.362 0.50 64.87  ? 136 MET C CB  1 
ATOM   5680  C  CB  B MET C  1 115 ? 77.823  185.291 137.267 0.50 64.79  ? 136 MET C CB  1 
ATOM   5681  C  CG  A MET C  1 115 ? 78.120  183.649 137.389 0.50 64.02  ? 136 MET C CG  1 
ATOM   5682  C  CG  B MET C  1 115 ? 78.288  183.826 137.242 0.50 63.48  ? 136 MET C CG  1 
ATOM   5683  S  SD  A MET C  1 115 ? 79.111  182.869 138.749 0.50 61.43  ? 136 MET C SD  1 
ATOM   5684  S  SD  B MET C  1 115 ? 79.642  183.413 138.398 0.50 60.39  ? 136 MET C SD  1 
ATOM   5685  C  CE  A MET C  1 115 ? 80.616  183.826 138.590 0.50 59.74  ? 136 MET C CE  1 
ATOM   5686  C  CE  B MET C  1 115 ? 80.763  182.517 137.324 0.50 58.88  ? 136 MET C CE  1 
ATOM   5687  N  N   . ASN C  1 116 ? 75.942  187.637 138.432 1.00 70.10  ? 137 ASN C N   1 
ATOM   5688  C  CA  . ASN C  1 116 ? 75.461  189.046 138.408 1.00 73.03  ? 137 ASN C CA  1 
ATOM   5689  C  C   . ASN C  1 116 ? 75.574  189.644 139.817 1.00 71.74  ? 137 ASN C C   1 
ATOM   5690  O  O   . ASN C  1 116 ? 76.083  190.767 139.937 1.00 71.22  ? 137 ASN C O   1 
ATOM   5691  C  CB  . ASN C  1 116 ? 74.060  189.143 137.802 1.00 77.52  ? 137 ASN C CB  1 
ATOM   5692  C  CG  . ASN C  1 116 ? 74.086  189.009 136.296 1.00 80.04  ? 137 ASN C CG  1 
ATOM   5693  O  OD1 . ASN C  1 116 ? 74.259  189.995 135.586 1.00 82.93  ? 137 ASN C OD1 1 
ATOM   5694  N  ND2 . ASN C  1 116 ? 73.939  187.791 135.804 1.00 80.27  ? 137 ASN C ND2 1 
ATOM   5695  N  N   . VAL C  1 117 ? 75.138  188.894 140.838 1.00 70.85  ? 138 VAL C N   1 
ATOM   5696  C  CA  . VAL C  1 117 ? 75.315  189.318 142.259 1.00 70.13  ? 138 VAL C CA  1 
ATOM   5697  C  C   . VAL C  1 117 ? 76.810  189.566 142.485 1.00 66.93  ? 138 VAL C C   1 
ATOM   5698  O  O   . VAL C  1 117 ? 77.154  190.601 143.081 1.00 68.26  ? 138 VAL C O   1 
ATOM   5699  C  CB  . VAL C  1 117 ? 74.797  188.255 143.244 1.00 70.45  ? 138 VAL C CB  1 
ATOM   5700  C  CG1 . VAL C  1 117 ? 75.228  188.574 144.666 1.00 69.01  ? 138 VAL C CG1 1 
ATOM   5701  C  CG2 . VAL C  1 117 ? 73.288  188.089 143.166 1.00 73.73  ? 138 VAL C CG2 1 
ATOM   5702  N  N   . ILE C  1 118 ? 77.659  188.675 141.969 1.00 63.61  ? 139 ILE C N   1 
ATOM   5703  C  CA  . ILE C  1 118 ? 79.130  188.867 142.130 1.00 62.22  ? 139 ILE C CA  1 
ATOM   5704  C  C   . ILE C  1 118 ? 79.548  190.159 141.420 1.00 62.16  ? 139 ILE C C   1 
ATOM   5705  O  O   . ILE C  1 118 ? 80.288  190.942 142.037 1.00 60.97  ? 139 ILE C O   1 
ATOM   5706  C  CB  . ILE C  1 118 ? 79.918  187.651 141.610 1.00 60.93  ? 139 ILE C CB  1 
ATOM   5707  C  CG1 . ILE C  1 118 ? 79.619  186.391 142.422 1.00 60.30  ? 139 ILE C CG1 1 
ATOM   5708  C  CG2 . ILE C  1 118 ? 81.402  187.957 141.589 1.00 59.91  ? 139 ILE C CG2 1 
ATOM   5709  C  CD1 . ILE C  1 118 ? 80.338  185.166 141.926 1.00 59.75  ? 139 ILE C CD1 1 
ATOM   5710  N  N   . SER C  1 119 ? 79.035  190.399 140.206 1.00 62.87  ? 140 SER C N   1 
ATOM   5711  C  CA  . SER C  1 119 ? 79.389  191.631 139.449 1.00 63.90  ? 140 SER C CA  1 
ATOM   5712  C  C   . SER C  1 119 ? 78.924  192.860 140.235 1.00 65.65  ? 140 SER C C   1 
ATOM   5713  O  O   . SER C  1 119 ? 79.718  193.803 140.379 1.00 65.63  ? 140 SER C O   1 
ATOM   5714  C  CB  . SER C  1 119 ? 78.760  191.630 138.078 1.00 65.20  ? 140 SER C CB  1 
ATOM   5715  O  OG  . SER C  1 119 ? 79.286  190.606 137.256 1.00 63.29  ? 140 SER C OG  1 
ATOM   5716  N  N   . GLU C  1 120 ? 77.702  192.802 140.776 1.00 67.05  ? 141 GLU C N   1 
ATOM   5717  C  CA  . GLU C  1 120 ? 77.121  193.927 141.550 1.00 69.67  ? 141 GLU C CA  1 
ATOM   5718  C  C   . GLU C  1 120 ? 77.976  194.185 142.795 1.00 67.26  ? 141 GLU C C   1 
ATOM   5719  O  O   . GLU C  1 120 ? 78.223  195.362 143.099 1.00 67.02  ? 141 GLU C O   1 
ATOM   5720  C  CB  . GLU C  1 120 ? 75.682  193.600 141.953 1.00 73.79  ? 141 GLU C CB  1 
ATOM   5721  C  CG  . GLU C  1 120 ? 74.724  193.470 140.785 1.00 77.31  ? 141 GLU C CG  1 
ATOM   5722  C  CD  . GLU C  1 120 ? 74.671  194.668 139.853 1.00 80.63  ? 141 GLU C CD  1 
ATOM   5723  O  OE1 . GLU C  1 120 ? 74.856  195.799 140.335 1.00 83.16  ? 141 GLU C OE1 1 
ATOM   5724  O  OE2 . GLU C  1 120 ? 74.455  194.460 138.650 1.00 82.54  ? 141 GLU C OE2 1 
ATOM   5725  N  N   . SER C  1 121 ? 78.434  193.115 143.455 1.00 64.81  ? 142 SER C N   1 
ATOM   5726  C  CA  . SER C  1 121 ? 79.258  193.241 144.686 1.00 63.90  ? 142 SER C CA  1 
ATOM   5727  C  C   . SER C  1 121 ? 80.555  193.984 144.354 1.00 63.05  ? 142 SER C C   1 
ATOM   5728  O  O   . SER C  1 121 ? 80.943  194.862 145.136 1.00 64.53  ? 142 SER C O   1 
ATOM   5729  C  CB  . SER C  1 121 ? 79.554  191.887 145.266 1.00 62.23  ? 142 SER C CB  1 
ATOM   5730  O  OG  . SER C  1 121 ? 78.411  191.051 145.239 1.00 63.49  ? 142 SER C OG  1 
ATOM   5731  N  N   . VAL C  1 122 ? 81.168  193.655 143.214 1.00 60.80  ? 143 VAL C N   1 
ATOM   5732  C  CA  . VAL C  1 122 ? 82.418  194.336 142.763 1.00 61.23  ? 143 VAL C CA  1 
ATOM   5733  C  C   . VAL C  1 122 ? 82.105  195.820 142.532 1.00 63.62  ? 143 VAL C C   1 
ATOM   5734  O  O   . VAL C  1 122 ? 82.898  196.668 142.980 1.00 63.45  ? 143 VAL C O   1 
ATOM   5735  C  CB  . VAL C  1 122 ? 82.951  193.690 141.471 1.00 60.51  ? 143 VAL C CB  1 
ATOM   5736  C  CG1 . VAL C  1 122 ? 84.095  194.490 140.875 1.00 60.72  ? 143 VAL C CG1 1 
ATOM   5737  C  CG2 . VAL C  1 122 ? 83.351  192.241 141.680 1.00 58.95  ? 143 VAL C CG2 1 
ATOM   5738  N  N   . LYS C  1 123 ? 80.953  196.109 141.919 1.00 65.03  ? 144 LYS C N   1 
ATOM   5739  C  CA  . LYS C  1 123 ? 80.528  197.505 141.626 1.00 69.39  ? 144 LYS C CA  1 
ATOM   5740  C  C   . LYS C  1 123 ? 80.355  198.283 142.938 1.00 70.52  ? 144 LYS C C   1 
ATOM   5741  O  O   . LYS C  1 123 ? 80.806  199.440 142.994 1.00 72.25  ? 144 LYS C O   1 
ATOM   5742  C  CB  . LYS C  1 123 ? 79.276  197.506 140.743 1.00 72.26  ? 144 LYS C CB  1 
ATOM   5743  C  CG  . LYS C  1 123 ? 79.464  196.853 139.380 1.00 72.47  ? 144 LYS C CG  1 
ATOM   5744  C  CD  . LYS C  1 123 ? 78.361  197.134 138.385 1.00 75.34  ? 144 LYS C CD  1 
ATOM   5745  C  CE  . LYS C  1 123 ? 78.595  196.459 137.051 1.00 75.07  ? 144 LYS C CE  1 
ATOM   5746  N  NZ  . LYS C  1 123 ? 77.465  196.667 136.119 1.00 79.21  ? 144 LYS C NZ  1 
ATOM   5747  N  N   . LEU C  1 124 ? 79.828  197.631 143.980 1.00 69.59  ? 145 LEU C N   1 
ATOM   5748  C  CA  . LEU C  1 124 ? 79.601  198.279 145.303 1.00 70.01  ? 145 LEU C CA  1 
ATOM   5749  C  C   . LEU C  1 124 ? 80.925  198.795 145.880 1.00 68.04  ? 145 LEU C C   1 
ATOM   5750  O  O   . LEU C  1 124 ? 80.907  199.863 146.503 1.00 69.00  ? 145 LEU C O   1 
ATOM   5751  C  CB  . LEU C  1 124 ? 78.968  197.254 146.248 1.00 69.90  ? 145 LEU C CB  1 
ATOM   5752  C  CG  . LEU C  1 124 ? 77.460  197.373 146.461 1.00 72.59  ? 145 LEU C CG  1 
ATOM   5753  C  CD1 . LEU C  1 124 ? 76.780  198.037 145.277 1.00 74.84  ? 145 LEU C CD1 1 
ATOM   5754  C  CD2 . LEU C  1 124 ? 76.841  196.013 146.739 1.00 72.22  ? 145 LEU C CD2 1 
ATOM   5755  N  N   . VAL C  1 125 ? 82.019  198.049 145.706 1.00 66.09  ? 146 VAL C N   1 
ATOM   5756  C  CA  . VAL C  1 125 ? 83.356  198.472 146.218 1.00 64.02  ? 146 VAL C CA  1 
ATOM   5757  C  C   . VAL C  1 125 ? 83.853  199.678 145.414 1.00 65.11  ? 146 VAL C C   1 
ATOM   5758  O  O   . VAL C  1 125 ? 84.328  200.640 146.040 1.00 66.46  ? 146 VAL C O   1 
ATOM   5759  C  CB  . VAL C  1 125 ? 84.369  197.314 146.156 1.00 61.70  ? 146 VAL C CB  1 
ATOM   5760  C  CG1 . VAL C  1 125 ? 85.677  197.697 146.827 1.00 60.78  ? 146 VAL C CG1 1 
ATOM   5761  C  CG2 . VAL C  1 125 ? 83.806  196.043 146.764 1.00 60.70  ? 146 VAL C CG2 1 
ATOM   5762  N  N   . MET C  1 126 ? 83.760  199.611 144.082 1.00 64.33  ? 147 MET C N   1 
ATOM   5763  C  CA  A MET C  1 126 ? 84.246  200.599 143.074 0.55 65.51  ? 147 MET C CA  1 
ATOM   5764  C  CA  B MET C  1 126 ? 84.281  200.616 143.113 0.45 65.35  ? 147 MET C CA  1 
ATOM   5765  C  C   . MET C  1 126 ? 83.533  201.947 143.325 1.00 68.38  ? 147 MET C C   1 
ATOM   5766  O  O   . MET C  1 126 ? 84.197  203.009 143.195 1.00 69.22  ? 147 MET C O   1 
ATOM   5767  C  CB  A MET C  1 126 ? 83.988  200.130 141.624 0.55 65.03  ? 147 MET C CB  1 
ATOM   5768  C  CB  B MET C  1 126 ? 84.133  200.161 141.651 0.45 64.66  ? 147 MET C CB  1 
ATOM   5769  C  CG  A MET C  1 126 ? 84.824  198.919 141.133 0.55 62.19  ? 147 MET C CG  1 
ATOM   5770  C  CG  B MET C  1 126 ? 85.439  199.764 140.950 0.45 62.40  ? 147 MET C CG  1 
ATOM   5771  S  SD  A MET C  1 126 ? 84.464  198.280 139.438 0.55 61.69  ? 147 MET C SD  1 
ATOM   5772  S  SD  B MET C  1 126 ? 86.798  200.920 141.228 0.45 61.83  ? 147 MET C SD  1 
ATOM   5773  C  CE  A MET C  1 126 ? 85.352  199.487 138.458 0.55 62.86  ? 147 MET C CE  1 
ATOM   5774  C  CE  B MET C  1 126 ? 88.031  200.328 140.062 0.45 60.47  ? 147 MET C CE  1 
ATOM   5775  N  N   . GLU C  1 127 ? 82.238  201.894 143.702 1.00 70.50  ? 148 GLU C N   1 
ATOM   5776  C  CA  . GLU C  1 127 ? 81.347  203.089 143.935 1.00 74.37  ? 148 GLU C CA  1 
ATOM   5777  C  C   . GLU C  1 127 ? 81.766  203.832 145.212 1.00 74.73  ? 148 GLU C C   1 
ATOM   5778  O  O   . GLU C  1 127 ? 81.266  204.897 145.454 1.00 75.76  ? 148 GLU C O   1 
ATOM   5779  C  CB  . GLU C  1 127 ? 79.871  202.709 144.120 1.00 76.04  ? 148 GLU C CB  1 
ATOM   5780  C  CG  . GLU C  1 127 ? 78.899  203.455 143.248 1.00 79.93  ? 148 GLU C CG  1 
ATOM   5781  C  CD  . GLU C  1 127 ? 78.530  202.731 141.959 1.00 80.79  ? 148 GLU C CD  1 
ATOM   5782  O  OE1 . GLU C  1 127 ? 77.492  203.053 141.377 1.00 83.84  ? 148 GLU C OE1 1 
ATOM   5783  O  OE2 . GLU C  1 127 ? 79.277  201.823 141.549 1.00 80.90  ? 148 GLU C OE2 1 
ATOM   5784  N  N   . GLU C  1 128 ? 82.574  203.170 146.038 1.00 73.91  ? 149 GLU C N   1 
ATOM   5785  C  CA  . GLU C  1 128 ? 83.101  203.814 147.263 1.00 75.22  ? 149 GLU C CA  1 
ATOM   5786  C  C   . GLU C  1 128 ? 84.503  204.274 146.890 1.00 74.25  ? 149 GLU C C   1 
ATOM   5787  O  O   . GLU C  1 128 ? 85.385  203.412 146.741 1.00 73.59  ? 149 GLU C O   1 
ATOM   5788  C  CB  . GLU C  1 128 ? 83.156  202.820 148.421 1.00 74.06  ? 149 GLU C CB  1 
ATOM   5789  C  CG  . GLU C  1 128 ? 81.851  202.089 148.647 1.00 76.04  ? 149 GLU C CG  1 
ATOM   5790  C  CD  . GLU C  1 128 ? 80.745  202.941 149.238 1.00 80.33  ? 149 GLU C CD  1 
ATOM   5791  O  OE1 . GLU C  1 128 ? 81.047  204.030 149.756 1.00 82.99  ? 149 GLU C OE1 1 
ATOM   5792  O  OE2 . GLU C  1 128 ? 79.586  202.503 149.186 1.00 84.46  ? 149 GLU C OE2 1 
ATOM   5793  N  N   . GLU C  1 129 ? 84.681  205.581 146.732 1.00 75.80  ? 150 GLU C N   1 
ATOM   5794  C  CA  . GLU C  1 129 ? 85.996  206.111 146.311 1.00 75.12  ? 150 GLU C CA  1 
ATOM   5795  C  C   . GLU C  1 129 ? 86.846  206.220 147.573 1.00 72.95  ? 150 GLU C C   1 
ATOM   5796  O  O   . GLU C  1 129 ? 86.321  206.454 148.677 1.00 72.65  ? 150 GLU C O   1 
ATOM   5797  C  CB  . GLU C  1 129 ? 85.891  207.438 145.561 1.00 77.78  ? 150 GLU C CB  1 
ATOM   5798  C  CG  . GLU C  1 129 ? 84.642  207.540 144.720 1.00 80.09  ? 150 GLU C CG  1 
ATOM   5799  C  CD  . GLU C  1 129 ? 84.798  207.566 143.214 1.00 80.48  ? 150 GLU C CD  1 
ATOM   5800  O  OE1 . GLU C  1 129 ? 85.706  206.893 142.685 1.00 78.90  ? 150 GLU C OE1 1 
ATOM   5801  O  OE2 . GLU C  1 129 ? 83.987  208.256 142.589 1.00 82.48  ? 150 GLU C OE2 1 
ATOM   5802  N  N   . PRO C  1 130 ? 88.167  205.989 147.421 1.00 70.71  ? 151 PRO C N   1 
ATOM   5803  C  CA  . PRO C  1 130 ? 88.753  205.565 146.140 1.00 69.27  ? 151 PRO C CA  1 
ATOM   5804  C  C   . PRO C  1 130 ? 89.179  204.088 146.118 1.00 66.43  ? 151 PRO C C   1 
ATOM   5805  O  O   . PRO C  1 130 ? 90.253  203.778 145.673 1.00 63.86  ? 151 PRO C O   1 
ATOM   5806  C  CB  . PRO C  1 130 ? 90.016  206.425 146.150 1.00 70.27  ? 151 PRO C CB  1 
ATOM   5807  C  CG  . PRO C  1 130 ? 90.468  206.381 147.590 1.00 69.50  ? 151 PRO C CG  1 
ATOM   5808  C  CD  . PRO C  1 130 ? 89.203  206.240 148.412 1.00 70.02  ? 151 PRO C CD  1 
ATOM   5809  N  N   . LEU C  1 131 ? 88.314  203.208 146.603 1.00 65.05  ? 152 LEU C N   1 
ATOM   5810  C  CA  . LEU C  1 131 ? 88.669  201.786 146.736 1.00 62.39  ? 152 LEU C CA  1 
ATOM   5811  C  C   . LEU C  1 131 ? 88.718  201.215 145.309 1.00 61.12  ? 152 LEU C C   1 
ATOM   5812  O  O   . LEU C  1 131 ? 87.911  201.663 144.442 1.00 62.40  ? 152 LEU C O   1 
ATOM   5813  C  CB  . LEU C  1 131 ? 87.707  201.011 147.665 1.00 61.96  ? 152 LEU C CB  1 
ATOM   5814  C  CG  . LEU C  1 131 ? 87.333  201.660 149.005 1.00 62.91  ? 152 LEU C CG  1 
ATOM   5815  C  CD1 . LEU C  1 131 ? 86.332  200.780 149.733 1.00 62.42  ? 152 LEU C CD1 1 
ATOM   5816  C  CD2 . LEU C  1 131 ? 88.535  201.972 149.889 1.00 61.58  ? 152 LEU C CD2 1 
ATOM   5817  N  N   . ARG C  1 132 ? 89.647  200.272 145.122 1.00 58.43  ? 153 ARG C N   1 
ATOM   5818  C  CA  . ARG C  1 132 ? 89.845  199.458 143.899 1.00 57.06  ? 153 ARG C CA  1 
ATOM   5819  C  C   . ARG C  1 132 ? 89.790  198.001 144.368 1.00 54.77  ? 153 ARG C C   1 
ATOM   5820  O  O   . ARG C  1 132 ? 90.459  197.666 145.349 1.00 53.45  ? 153 ARG C O   1 
ATOM   5821  C  CB  . ARG C  1 132 ? 91.148  199.818 143.181 1.00 56.94  ? 153 ARG C CB  1 
ATOM   5822  C  CG  . ARG C  1 132 ? 91.146  201.207 142.562 1.00 59.43  ? 153 ARG C CG  1 
ATOM   5823  C  CD  . ARG C  1 132 ? 92.007  201.324 141.323 1.00 59.42  ? 153 ARG C CD  1 
ATOM   5824  N  NE  . ARG C  1 132 ? 92.067  202.708 140.888 1.00 61.69  ? 153 ARG C NE  1 
ATOM   5825  C  CZ  . ARG C  1 132 ? 92.616  203.131 139.758 1.00 62.73  ? 153 ARG C CZ  1 
ATOM   5826  N  NH1 . ARG C  1 132 ? 93.164  202.274 138.915 1.00 61.26  ? 153 ARG C NH1 1 
ATOM   5827  N  NH2 . ARG C  1 132 ? 92.605  204.419 139.474 1.00 64.87  ? 153 ARG C NH2 1 
ATOM   5828  N  N   . PRO C  1 133 ? 89.033  197.124 143.691 1.00 54.68  ? 154 PRO C N   1 
ATOM   5829  C  CA  . PRO C  1 133 ? 88.842  195.757 144.151 1.00 53.52  ? 154 PRO C CA  1 
ATOM   5830  C  C   . PRO C  1 133 ? 89.990  194.777 143.827 1.00 52.15  ? 154 PRO C C   1 
ATOM   5831  O  O   . PRO C  1 133 ? 90.417  194.652 142.663 1.00 51.55  ? 154 PRO C O   1 
ATOM   5832  C  CB  . PRO C  1 133 ? 87.544  195.364 143.455 1.00 54.52  ? 154 PRO C CB  1 
ATOM   5833  C  CG  . PRO C  1 133 ? 87.634  196.124 142.132 1.00 56.29  ? 154 PRO C CG  1 
ATOM   5834  C  CD  . PRO C  1 133 ? 88.304  197.444 142.460 1.00 56.71  ? 154 PRO C CD  1 
ATOM   5835  N  N   . LEU C  1 134 ? 90.472  194.102 144.892 1.00 50.95  ? 155 LEU C N   1 
ATOM   5836  C  CA  . LEU C  1 134 ? 91.322  192.899 144.802 1.00 48.83  ? 155 LEU C CA  1 
ATOM   5837  C  C   . LEU C  1 134 ? 90.446  191.739 145.246 1.00 48.42  ? 155 LEU C C   1 
ATOM   5838  O  O   . LEU C  1 134 ? 90.117  191.649 146.444 1.00 49.01  ? 155 LEU C O   1 
ATOM   5839  C  CB  . LEU C  1 134 ? 92.553  193.098 145.668 1.00 48.55  ? 155 LEU C CB  1 
ATOM   5840  C  CG  . LEU C  1 134 ? 93.738  192.208 145.288 1.00 48.02  ? 155 LEU C CG  1 
ATOM   5841  C  CD1 . LEU C  1 134 ? 95.007  192.633 146.028 1.00 47.55  ? 155 LEU C CD1 1 
ATOM   5842  C  CD2 . LEU C  1 134 ? 93.404  190.743 145.576 1.00 46.70  ? 155 LEU C CD2 1 
ATOM   5843  N  N   . VAL C  1 135 ? 89.995  190.938 144.297 1.00 47.80  ? 156 VAL C N   1 
ATOM   5844  C  CA  . VAL C  1 135 ? 89.104  189.792 144.584 1.00 47.14  ? 156 VAL C CA  1 
ATOM   5845  C  C   . VAL C  1 135 ? 89.964  188.596 144.979 1.00 45.55  ? 156 VAL C C   1 
ATOM   5846  O  O   . VAL C  1 135 ? 90.881  188.222 144.211 1.00 44.09  ? 156 VAL C O   1 
ATOM   5847  C  CB  . VAL C  1 135 ? 88.222  189.471 143.376 1.00 48.45  ? 156 VAL C CB  1 
ATOM   5848  C  CG1 . VAL C  1 135 ? 87.576  188.086 143.471 1.00 48.06  ? 156 VAL C CG1 1 
ATOM   5849  C  CG2 . VAL C  1 135 ? 87.171  190.559 143.185 1.00 50.44  ? 156 VAL C CG2 1 
ATOM   5850  N  N   . LEU C  1 136 ? 89.651  187.999 146.130 1.00 45.19  ? 157 LEU C N   1 
ATOM   5851  C  CA  . LEU C  1 136 ? 90.216  186.710 146.559 1.00 43.90  ? 157 LEU C CA  1 
ATOM   5852  C  C   . LEU C  1 136 ? 89.295  185.627 146.021 1.00 44.41  ? 157 LEU C C   1 
ATOM   5853  O  O   . LEU C  1 136 ? 88.132  185.547 146.492 1.00 46.06  ? 157 LEU C O   1 
ATOM   5854  C  CB  . LEU C  1 136 ? 90.297  186.686 148.086 1.00 43.80  ? 157 LEU C CB  1 
ATOM   5855  C  CG  . LEU C  1 136 ? 91.026  187.872 148.721 1.00 43.94  ? 157 LEU C CG  1 
ATOM   5856  C  CD1 . LEU C  1 136 ? 91.106  187.709 150.215 1.00 43.19  ? 157 LEU C CD1 1 
ATOM   5857  C  CD2 . LEU C  1 136 ? 92.417  188.026 148.150 1.00 43.86  ? 157 LEU C CD2 1 
ATOM   5858  N  N   . GLY C  1 137 ? 89.765  184.835 145.064 1.00 43.65  ? 158 GLY C N   1 
ATOM   5859  C  CA  . GLY C  1 137 ? 89.027  183.646 144.616 1.00 43.95  ? 158 GLY C CA  1 
ATOM   5860  C  C   . GLY C  1 137 ? 89.127  182.569 145.690 1.00 43.44  ? 158 GLY C C   1 
ATOM   5861  O  O   . GLY C  1 137 ? 89.902  182.718 146.635 1.00 42.75  ? 158 GLY C O   1 
ATOM   5862  N  N   . GLY C  1 138 ? 88.382  181.467 145.525 1.00 43.83  ? 159 GLY C N   1 
ATOM   5863  C  CA  . GLY C  1 138 ? 87.521  181.267 144.371 1.00 45.20  ? 159 GLY C CA  1 
ATOM   5864  C  C   . GLY C  1 138 ? 88.277  180.718 143.167 1.00 44.82  ? 159 GLY C C   1 
ATOM   5865  O  O   . GLY C  1 138 ? 89.494  181.015 143.023 1.00 43.87  ? 159 GLY C O   1 
ATOM   5866  N  N   . ASP C  1 139 ? 87.545  179.959 142.334 1.00 45.74  ? 160 ASP C N   1 
ATOM   5867  C  CA  . ASP C  1 139 ? 88.018  179.311 141.085 1.00 45.46  ? 160 ASP C CA  1 
ATOM   5868  C  C   . ASP C  1 139 ? 87.970  180.404 140.009 1.00 45.68  ? 160 ASP C C   1 
ATOM   5869  O  O   . ASP C  1 139 ? 87.419  181.467 140.320 1.00 45.29  ? 160 ASP C O   1 
ATOM   5870  C  CB  . ASP C  1 139 ? 87.229  178.029 140.818 1.00 46.44  ? 160 ASP C CB  1 
ATOM   5871  C  CG  . ASP C  1 139 ? 85.843  178.267 140.229 1.00 48.51  ? 160 ASP C CG  1 
ATOM   5872  O  OD1 . ASP C  1 139 ? 85.675  179.328 139.534 1.00 49.07  ? 160 ASP C OD1 1 
ATOM   5873  O  OD2 . ASP C  1 139 ? 84.977  177.352 140.377 1.00 48.60  ? 160 ASP C OD2 1 
ATOM   5874  N  N   . HIS C  1 140 ? 88.650  180.143 138.898 1.00 45.73  ? 161 HIS C N   1 
ATOM   5875  C  CA  . HIS C  1 140 ? 88.896  181.089 137.783 1.00 46.36  ? 161 HIS C CA  1 
ATOM   5876  C  C   . HIS C  1 140 ? 87.599  181.701 137.245 1.00 47.93  ? 161 HIS C C   1 
ATOM   5877  O  O   . HIS C  1 140 ? 87.622  182.858 136.892 1.00 48.00  ? 161 HIS C O   1 
ATOM   5878  C  CB  . HIS C  1 140 ? 89.845  180.464 136.764 1.00 45.89  ? 161 HIS C CB  1 
ATOM   5879  C  CG  . HIS C  1 140 ? 90.949  181.411 136.509 1.00 45.32  ? 161 HIS C CG  1 
ATOM   5880  N  ND1 . HIS C  1 140 ? 92.242  181.076 136.286 1.00 44.05  ? 161 HIS C ND1 1 
ATOM   5881  C  CD2 . HIS C  1 140 ? 90.936  182.735 136.536 1.00 45.32  ? 161 HIS C CD2 1 
ATOM   5882  C  CE1 . HIS C  1 140 ? 92.930  182.174 136.153 1.00 44.09  ? 161 HIS C CE1 1 
ATOM   5883  N  NE2 . HIS C  1 140 ? 92.171  183.180 136.306 1.00 44.87  ? 161 HIS C NE2 1 
ATOM   5884  N  N   . SER C  1 141 ? 86.533  180.914 137.237 1.00 49.47  ? 162 SER C N   1 
ATOM   5885  C  CA  . SER C  1 141 ? 85.156  181.323 136.824 1.00 51.52  ? 162 SER C CA  1 
ATOM   5886  C  C   . SER C  1 141 ? 84.829  182.749 137.269 1.00 51.54  ? 162 SER C C   1 
ATOM   5887  O  O   . SER C  1 141 ? 84.169  183.411 136.469 1.00 52.54  ? 162 SER C O   1 
ATOM   5888  C  CB  . SER C  1 141 ? 84.061  180.341 137.240 1.00 52.88  ? 162 SER C CB  1 
ATOM   5889  O  OG  . SER C  1 141 ? 83.538  180.546 138.554 1.00 53.10  ? 162 SER C OG  1 
ATOM   5890  N  N   . ILE C  1 142 ? 85.324  183.225 138.414 1.00 50.23  ? 163 ILE C N   1 
ATOM   5891  C  CA  . ILE C  1 142 ? 84.904  184.555 138.953 1.00 51.10  ? 163 ILE C CA  1 
ATOM   5892  C  C   . ILE C  1 142 ? 85.467  185.709 138.141 1.00 50.76  ? 163 ILE C C   1 
ATOM   5893  O  O   . ILE C  1 142 ? 84.909  186.780 138.213 1.00 52.69  ? 163 ILE C O   1 
ATOM   5894  C  CB  . ILE C  1 142 ? 85.290  184.779 140.421 1.00 50.28  ? 163 ILE C CB  1 
ATOM   5895  C  CG1 . ILE C  1 142 ? 86.781  185.063 140.570 1.00 48.99  ? 163 ILE C CG1 1 
ATOM   5896  C  CG2 . ILE C  1 142 ? 84.769  183.642 141.296 1.00 50.32  ? 163 ILE C CG2 1 
ATOM   5897  C  CD1 . ILE C  1 142 ? 87.278  184.920 141.972 1.00 48.23  ? 163 ILE C CD1 1 
ATOM   5898  N  N   . SER C  1 143 ? 86.578  185.546 137.472 1.00 50.10  ? 164 SER C N   1 
ATOM   5899  C  CA  . SER C  1 143 ? 87.246  186.651 136.743 1.00 50.36  ? 164 SER C CA  1 
ATOM   5900  C  C   . SER C  1 143 ? 86.270  187.307 135.750 1.00 52.04  ? 164 SER C C   1 
ATOM   5901  O  O   . SER C  1 143 ? 86.303  188.575 135.600 1.00 51.93  ? 164 SER C O   1 
ATOM   5902  C  CB  . SER C  1 143 ? 88.457  186.118 136.077 1.00 49.60  ? 164 SER C CB  1 
ATOM   5903  O  OG  . SER C  1 143 ? 89.171  185.297 136.999 1.00 48.79  ? 164 SER C OG  1 
ATOM   5904  N  N   . TYR C  1 144 ? 85.407  186.496 135.115 1.00 53.20  ? 165 TYR C N   1 
ATOM   5905  C  CA  . TYR C  1 144 ? 84.492  186.962 134.030 1.00 55.29  ? 165 TYR C CA  1 
ATOM   5906  C  C   . TYR C  1 144 ? 83.537  187.990 134.605 1.00 56.48  ? 165 TYR C C   1 
ATOM   5907  O  O   . TYR C  1 144 ? 83.452  189.055 134.048 1.00 57.46  ? 165 TYR C O   1 
ATOM   5908  C  CB  . TYR C  1 144 ? 83.713  185.846 133.315 1.00 56.40  ? 165 TYR C CB  1 
ATOM   5909  C  CG  . TYR C  1 144 ? 82.550  186.334 132.461 1.00 58.51  ? 165 TYR C CG  1 
ATOM   5910  C  CD1 . TYR C  1 144 ? 82.686  187.377 131.551 1.00 59.52  ? 165 TYR C CD1 1 
ATOM   5911  C  CD2 . TYR C  1 144 ? 81.295  185.747 132.564 1.00 59.89  ? 165 TYR C CD2 1 
ATOM   5912  C  CE1 . TYR C  1 144 ? 81.604  187.834 130.795 1.00 61.97  ? 165 TYR C CE1 1 
ATOM   5913  C  CE2 . TYR C  1 144 ? 80.205  186.191 131.816 1.00 62.41  ? 165 TYR C CE2 1 
ATOM   5914  C  CZ  . TYR C  1 144 ? 80.346  187.242 130.916 1.00 63.30  ? 165 TYR C CZ  1 
ATOM   5915  O  OH  . TYR C  1 144 ? 79.253  187.654 130.169 1.00 65.48  ? 165 TYR C OH  1 
ATOM   5916  N  N   . PRO C  1 145 ? 82.781  187.683 135.692 1.00 57.46  ? 166 PRO C N   1 
ATOM   5917  C  CA  . PRO C  1 145 ? 81.917  188.670 136.342 1.00 58.98  ? 166 PRO C CA  1 
ATOM   5918  C  C   . PRO C  1 145 ? 82.654  189.836 137.017 1.00 58.46  ? 166 PRO C C   1 
ATOM   5919  O  O   . PRO C  1 145 ? 82.110  190.934 137.056 1.00 60.11  ? 166 PRO C O   1 
ATOM   5920  C  CB  . PRO C  1 145 ? 81.092  187.859 137.369 1.00 59.00  ? 166 PRO C CB  1 
ATOM   5921  C  CG  . PRO C  1 145 ? 81.920  186.620 137.599 1.00 57.40  ? 166 PRO C CG  1 
ATOM   5922  C  CD  . PRO C  1 145 ? 82.607  186.339 136.275 1.00 56.52  ? 166 PRO C CD  1 
ATOM   5923  N  N   . VAL C  1 146 ? 83.858  189.617 137.518 1.00 56.86  ? 167 VAL C N   1 
ATOM   5924  C  CA  . VAL C  1 146 ? 84.617  190.749 138.118 1.00 57.08  ? 167 VAL C CA  1 
ATOM   5925  C  C   . VAL C  1 146 ? 84.984  191.686 136.983 1.00 58.78  ? 167 VAL C C   1 
ATOM   5926  O  O   . VAL C  1 146 ? 84.734  192.892 137.157 1.00 60.65  ? 167 VAL C O   1 
ATOM   5927  C  CB  . VAL C  1 146 ? 85.878  190.324 138.884 1.00 55.33  ? 167 VAL C CB  1 
ATOM   5928  C  CG1 . VAL C  1 146 ? 86.606  191.557 139.405 1.00 55.36  ? 167 VAL C CG1 1 
ATOM   5929  C  CG2 . VAL C  1 146 ? 85.543  189.361 140.017 1.00 54.14  ? 167 VAL C CG2 1 
ATOM   5930  N  N   . VAL C  1 147 ? 85.517  191.138 135.879 1.00 58.30  ? 168 VAL C N   1 
ATOM   5931  C  CA  . VAL C  1 147 ? 86.094  191.955 134.767 1.00 59.46  ? 168 VAL C CA  1 
ATOM   5932  C  C   . VAL C  1 147 ? 84.935  192.757 134.126 1.00 61.64  ? 168 VAL C C   1 
ATOM   5933  O  O   . VAL C  1 147 ? 85.034  194.022 134.085 1.00 61.78  ? 168 VAL C O   1 
ATOM   5934  C  CB  . VAL C  1 147 ? 86.933  191.110 133.767 1.00 58.35  ? 168 VAL C CB  1 
ATOM   5935  C  CG1 . VAL C  1 147 ? 87.181  191.846 132.451 1.00 60.18  ? 168 VAL C CG1 1 
ATOM   5936  C  CG2 . VAL C  1 147 ? 88.282  190.701 134.342 1.00 55.97  ? 168 VAL C CG2 1 
ATOM   5937  N  N   . ARG C  1 148 ? 83.847  192.061 133.749 1.00 62.67  ? 169 ARG C N   1 
ATOM   5938  C  CA  . ARG C  1 148 ? 82.571  192.637 133.223 1.00 65.08  ? 169 ARG C CA  1 
ATOM   5939  C  C   . ARG C  1 148 ? 82.138  193.807 134.103 1.00 65.58  ? 169 ARG C C   1 
ATOM   5940  O  O   . ARG C  1 148 ? 81.784  194.832 133.579 1.00 67.08  ? 169 ARG C O   1 
ATOM   5941  C  CB  . ARG C  1 148 ? 81.469  191.569 133.177 1.00 66.39  ? 169 ARG C CB  1 
ATOM   5942  C  CG  . ARG C  1 148 ? 80.103  192.062 132.710 1.00 69.43  ? 169 ARG C CG  1 
ATOM   5943  C  CD  . ARG C  1 148 ? 79.068  190.954 132.656 1.00 70.47  ? 169 ARG C CD  1 
ATOM   5944  N  NE  . ARG C  1 148 ? 78.561  190.565 133.969 1.00 70.21  ? 169 ARG C NE  1 
ATOM   5945  C  CZ  . ARG C  1 148 ? 77.894  189.422 134.214 1.00 70.98  ? 169 ARG C CZ  1 
ATOM   5946  N  NH1 . ARG C  1 148 ? 77.643  188.568 133.233 1.00 71.37  ? 169 ARG C NH1 1 
ATOM   5947  N  NH2 . ARG C  1 148 ? 77.483  189.124 135.440 1.00 70.61  ? 169 ARG C NH2 1 
ATOM   5948  N  N   . ALA C  1 149 ? 82.162  193.636 135.415 1.00 65.29  ? 170 ALA C N   1 
ATOM   5949  C  CA  . ALA C  1 149 ? 81.740  194.669 136.389 1.00 66.38  ? 170 ALA C CA  1 
ATOM   5950  C  C   . ALA C  1 149 ? 82.757  195.816 136.346 1.00 65.76  ? 170 ALA C C   1 
ATOM   5951  O  O   . ALA C  1 149 ? 82.350  196.964 136.389 1.00 67.55  ? 170 ALA C O   1 
ATOM   5952  C  CB  . ALA C  1 149 ? 81.603  194.051 137.773 1.00 65.34  ? 170 ALA C CB  1 
ATOM   5953  N  N   . VAL C  1 150 ? 84.044  195.501 136.244 1.00 63.77  ? 171 VAL C N   1 
ATOM   5954  C  CA  . VAL C  1 150 ? 85.111  196.531 136.177 1.00 63.84  ? 171 VAL C CA  1 
ATOM   5955  C  C   . VAL C  1 150 ? 84.915  197.267 134.846 1.00 65.72  ? 171 VAL C C   1 
ATOM   5956  O  O   . VAL C  1 150 ? 84.920  198.498 134.873 1.00 66.98  ? 171 VAL C O   1 
ATOM   5957  C  CB  . VAL C  1 150 ? 86.521  195.930 136.351 1.00 61.91  ? 171 VAL C CB  1 
ATOM   5958  C  CG1 . VAL C  1 150 ? 87.593  197.000 136.170 1.00 62.24  ? 171 VAL C CG1 1 
ATOM   5959  C  CG2 . VAL C  1 150 ? 86.684  195.222 137.716 1.00 59.86  ? 171 VAL C CG2 1 
ATOM   5960  N  N   . SER C  1 151 ? 84.649  196.544 133.753 1.00 65.99  ? 172 SER C N   1 
ATOM   5961  C  CA  . SER C  1 151 ? 84.632  197.075 132.350 1.00 67.98  ? 172 SER C CA  1 
ATOM   5962  C  C   . SER C  1 151 ? 83.412  197.984 132.143 1.00 70.93  ? 172 SER C C   1 
ATOM   5963  O  O   . SER C  1 151 ? 83.567  199.098 131.547 1.00 72.11  ? 172 SER C O   1 
ATOM   5964  C  CB  . SER C  1 151 ? 84.666  195.949 131.333 1.00 67.02  ? 172 SER C CB  1 
ATOM   5965  O  OG  . SER C  1 151 ? 84.564  196.448 130.006 1.00 68.19  ? 172 SER C OG  1 
ATOM   5966  N  N   . GLU C  1 152 ? 82.254  197.520 132.645 1.00 72.26  ? 173 GLU C N   1 
ATOM   5967  C  CA  . GLU C  1 152 ? 80.968  198.271 132.732 1.00 74.74  ? 173 GLU C CA  1 
ATOM   5968  C  C   . GLU C  1 152 ? 81.170  199.541 133.577 1.00 75.43  ? 173 GLU C C   1 
ATOM   5969  O  O   . GLU C  1 152 ? 80.987  200.609 133.038 1.00 79.47  ? 173 GLU C O   1 
ATOM   5970  C  CB  . GLU C  1 152 ? 79.838  197.363 133.234 1.00 75.42  ? 173 GLU C CB  1 
ATOM   5971  C  CG  . GLU C  1 152 ? 79.273  196.424 132.158 1.00 76.66  ? 173 GLU C CG  1 
ATOM   5972  C  CD  . GLU C  1 152 ? 78.397  195.234 132.672 1.00 77.66  ? 173 GLU C CD  1 
ATOM   5973  O  OE1 . GLU C  1 152 ? 78.149  195.170 133.894 1.00 78.15  ? 173 GLU C OE1 1 
ATOM   5974  O  OE2 . GLU C  1 152 ? 77.972  194.355 131.862 1.00 79.07  ? 173 GLU C OE2 1 
ATOM   5975  N  N   . LYS C  1 153 ? 81.563  199.452 134.840 1.00 73.94  ? 174 LYS C N   1 
ATOM   5976  C  CA  . LYS C  1 153 ? 81.778  200.637 135.718 1.00 74.37  ? 174 LYS C CA  1 
ATOM   5977  C  C   . LYS C  1 153 ? 82.701  201.662 135.058 1.00 72.80  ? 174 LYS C C   1 
ATOM   5978  O  O   . LYS C  1 153 ? 82.415  202.853 135.202 1.00 73.99  ? 174 LYS C O   1 
ATOM   5979  C  CB  . LYS C  1 153 ? 82.400  200.240 137.068 1.00 74.08  ? 174 LYS C CB  1 
ATOM   5980  C  CG  . LYS C  1 153 ? 81.536  200.553 138.276 1.00 76.94  ? 174 LYS C CG  1 
ATOM   5981  C  CD  . LYS C  1 153 ? 81.225  202.042 138.417 1.00 80.93  ? 174 LYS C CD  1 
ATOM   5982  C  CE  . LYS C  1 153 ? 82.367  202.794 139.077 1.00 81.31  ? 174 LYS C CE  1 
ATOM   5983  N  NZ  . LYS C  1 153 ? 81.829  203.962 139.822 1.00 83.84  ? 174 LYS C NZ  1 
ATOM   5984  N  N   . LEU C  1 154 ? 83.781  201.217 134.418 1.00 69.70  ? 175 LEU C N   1 
ATOM   5985  C  CA  . LEU C  1 154 ? 84.836  202.134 133.929 1.00 70.20  ? 175 LEU C CA  1 
ATOM   5986  C  C   . LEU C  1 154 ? 84.439  202.762 132.581 1.00 72.17  ? 175 LEU C C   1 
ATOM   5987  O  O   . LEU C  1 154 ? 84.884  203.906 132.306 1.00 73.01  ? 175 LEU C O   1 
ATOM   5988  C  CB  . LEU C  1 154 ? 86.155  201.380 133.852 1.00 67.85  ? 175 LEU C CB  1 
ATOM   5989  C  CG  . LEU C  1 154 ? 86.674  200.888 135.211 1.00 66.32  ? 175 LEU C CG  1 
ATOM   5990  C  CD1 . LEU C  1 154 ? 88.077  200.357 135.050 1.00 64.26  ? 175 LEU C CD1 1 
ATOM   5991  C  CD2 . LEU C  1 154 ? 86.611  201.993 136.268 1.00 67.56  ? 175 LEU C CD2 1 
ATOM   5992  N  N   . GLY C  1 155 ? 83.621  202.042 131.802 1.00 72.19  ? 176 GLY C N   1 
ATOM   5993  C  CA  . GLY C  1 155 ? 82.928  202.536 130.595 1.00 74.49  ? 176 GLY C CA  1 
ATOM   5994  C  C   . GLY C  1 155 ? 83.566  202.002 129.330 1.00 73.61  ? 176 GLY C C   1 
ATOM   5995  O  O   . GLY C  1 155 ? 83.530  202.685 128.342 1.00 74.96  ? 176 GLY C O   1 
ATOM   5996  N  N   . GLY C  1 156 ? 84.196  200.833 129.369 1.00 71.65  ? 177 GLY C N   1 
ATOM   5997  C  CA  . GLY C  1 156 ? 84.927  200.365 128.187 1.00 71.33  ? 177 GLY C CA  1 
ATOM   5998  C  C   . GLY C  1 156 ? 85.908  199.265 128.515 1.00 69.34  ? 177 GLY C C   1 
ATOM   5999  O  O   . GLY C  1 156 ? 86.047  198.840 129.672 1.00 68.22  ? 177 GLY C O   1 
ATOM   6000  N  N   . PRO C  1 157 ? 86.622  198.757 127.490 1.00 68.98  ? 178 PRO C N   1 
ATOM   6001  C  CA  . PRO C  1 157 ? 87.386  197.529 127.679 1.00 66.76  ? 178 PRO C CA  1 
ATOM   6002  C  C   . PRO C  1 157 ? 88.621  197.799 128.567 1.00 66.25  ? 178 PRO C C   1 
ATOM   6003  O  O   . PRO C  1 157 ? 89.032  198.982 128.648 1.00 67.45  ? 178 PRO C O   1 
ATOM   6004  C  CB  . PRO C  1 157 ? 87.718  197.106 126.244 1.00 66.95  ? 178 PRO C CB  1 
ATOM   6005  C  CG  . PRO C  1 157 ? 87.698  198.408 125.431 1.00 69.26  ? 178 PRO C CG  1 
ATOM   6006  C  CD  . PRO C  1 157 ? 86.704  199.309 126.132 1.00 70.50  ? 178 PRO C CD  1 
ATOM   6007  N  N   . VAL C  1 158 ? 89.176  196.757 129.209 1.00 63.24  ? 179 VAL C N   1 
ATOM   6008  C  CA  . VAL C  1 158 ? 90.530  196.851 129.830 1.00 62.97  ? 179 VAL C CA  1 
ATOM   6009  C  C   . VAL C  1 158 ? 91.502  195.820 129.120 1.00 62.60  ? 179 VAL C C   1 
ATOM   6010  O  O   . VAL C  1 158 ? 91.023  194.826 128.664 1.00 63.23  ? 179 VAL C O   1 
ATOM   6011  C  CB  . VAL C  1 158 ? 90.497  196.585 131.356 1.00 61.72  ? 179 VAL C CB  1 
ATOM   6012  C  CG1 . VAL C  1 158 ? 89.554  197.538 132.069 1.00 63.19  ? 179 VAL C CG1 1 
ATOM   6013  C  CG2 . VAL C  1 158 ? 90.149  195.142 131.671 1.00 59.58  ? 179 VAL C CG2 1 
ATOM   6014  N  N   . ASP C  1 159 ? 92.819  196.063 129.340 1.00 61.34  ? 180 ASP C N   1 
ATOM   6015  C  CA  . ASP C  1 159 ? 93.883  195.039 129.074 1.00 59.37  ? 180 ASP C CA  1 
ATOM   6016  C  C   . ASP C  1 159 ? 94.133  194.213 130.348 1.00 57.86  ? 180 ASP C C   1 
ATOM   6017  O  O   . ASP C  1 159 ? 94.007  194.714 131.504 1.00 57.61  ? 180 ASP C O   1 
ATOM   6018  C  CB  . ASP C  1 159 ? 95.228  195.589 128.601 1.00 59.29  ? 180 ASP C CB  1 
ATOM   6019  C  CG  . ASP C  1 159 ? 95.224  196.332 127.280 1.00 60.41  ? 180 ASP C CG  1 
ATOM   6020  O  OD1 . ASP C  1 159 ? 94.165  196.344 126.564 1.00 61.19  ? 180 ASP C OD1 1 
ATOM   6021  O  OD2 . ASP C  1 159 ? 96.277  196.905 127.014 1.00 60.45  ? 180 ASP C OD2 1 
ATOM   6022  N  N   . ILE C  1 160 ? 94.522  192.970 130.134 1.00 56.32  ? 181 ILE C N   1 
ATOM   6023  C  CA  . ILE C  1 160 ? 94.613  192.003 131.237 1.00 55.38  ? 181 ILE C CA  1 
ATOM   6024  C  C   . ILE C  1 160 ? 96.003  191.404 131.154 1.00 54.12  ? 181 ILE C C   1 
ATOM   6025  O  O   . ILE C  1 160 ? 96.432  191.085 130.016 1.00 54.26  ? 181 ILE C O   1 
ATOM   6026  C  CB  . ILE C  1 160 ? 93.461  190.992 131.108 1.00 55.69  ? 181 ILE C CB  1 
ATOM   6027  C  CG1 . ILE C  1 160 ? 92.107  191.720 131.119 1.00 57.42  ? 181 ILE C CG1 1 
ATOM   6028  C  CG2 . ILE C  1 160 ? 93.569  189.907 132.160 1.00 54.55  ? 181 ILE C CG2 1 
ATOM   6029  C  CD1 . ILE C  1 160 ? 90.917  190.800 131.161 1.00 57.74  ? 181 ILE C CD1 1 
ATOM   6030  N  N   . LEU C  1 161 ? 96.695  191.439 132.293 1.00 52.95  ? 182 LEU C N   1 
ATOM   6031  C  CA  . LEU C  1 161 ? 97.790  190.498 132.655 1.00 51.69  ? 182 LEU C CA  1 
ATOM   6032  C  C   . LEU C  1 161 ? 97.189  189.299 133.399 1.00 49.66  ? 182 LEU C C   1 
ATOM   6033  O  O   . LEU C  1 161 ? 96.721  189.450 134.487 1.00 48.56  ? 182 LEU C O   1 
ATOM   6034  C  CB  . LEU C  1 161 ? 98.844  191.180 133.524 1.00 51.91  ? 182 LEU C CB  1 
ATOM   6035  C  CG  . LEU C  1 161 ? 100.022 190.265 133.877 1.00 51.75  ? 182 LEU C CG  1 
ATOM   6036  C  CD1 . LEU C  1 161 ? 100.573 189.582 132.628 1.00 52.03  ? 182 LEU C CD1 1 
ATOM   6037  C  CD2 . LEU C  1 161 ? 101.145 191.016 134.579 1.00 52.10  ? 182 LEU C CD2 1 
ATOM   6038  N  N   . HIS C  1 162 ? 97.241  188.147 132.760 1.00 49.11  ? 183 HIS C N   1 
ATOM   6039  C  CA  . HIS C  1 162 ? 96.669  186.860 133.184 1.00 48.14  ? 183 HIS C CA  1 
ATOM   6040  C  C   . HIS C  1 162 ? 97.844  185.891 133.349 1.00 47.63  ? 183 HIS C C   1 
ATOM   6041  O  O   . HIS C  1 162 ? 98.407  185.457 132.321 1.00 47.61  ? 183 HIS C O   1 
ATOM   6042  C  CB  . HIS C  1 162 ? 95.647  186.418 132.153 1.00 48.79  ? 183 HIS C CB  1 
ATOM   6043  C  CG  . HIS C  1 162 ? 95.080  185.075 132.417 1.00 48.43  ? 183 HIS C CG  1 
ATOM   6044  N  ND1 . HIS C  1 162 ? 94.633  184.256 131.383 1.00 48.85  ? 183 HIS C ND1 1 
ATOM   6045  C  CD2 . HIS C  1 162 ? 94.904  184.405 133.582 1.00 47.30  ? 183 HIS C CD2 1 
ATOM   6046  C  CE1 . HIS C  1 162 ? 94.174  183.146 131.906 1.00 48.80  ? 183 HIS C CE1 1 
ATOM   6047  N  NE2 . HIS C  1 162 ? 94.349  183.199 133.269 1.00 47.16  ? 183 HIS C NE2 1 
ATOM   6048  N  N   . LEU C  1 163 ? 98.253  185.680 134.603 1.00 46.35  ? 184 LEU C N   1 
ATOM   6049  C  CA  . LEU C  1 163 ? 99.363  184.786 135.008 1.00 44.98  ? 184 LEU C CA  1 
ATOM   6050  C  C   . LEU C  1 163 ? 98.753  183.434 135.347 1.00 43.29  ? 184 LEU C C   1 
ATOM   6051  O  O   . LEU C  1 163 ? 98.063  183.372 136.355 1.00 43.09  ? 184 LEU C O   1 
ATOM   6052  C  CB  . LEU C  1 163 ? 100.016 185.410 136.234 1.00 45.11  ? 184 LEU C CB  1 
ATOM   6053  C  CG  . LEU C  1 163 ? 100.906 186.598 135.935 1.00 46.09  ? 184 LEU C CG  1 
ATOM   6054  C  CD1 . LEU C  1 163 ? 101.216 187.367 137.188 1.00 46.06  ? 184 LEU C CD1 1 
ATOM   6055  C  CD2 . LEU C  1 163 ? 102.180 186.142 135.271 1.00 47.12  ? 184 LEU C CD2 1 
ATOM   6056  N  N   . ASP C  1 164 ? 98.971  182.413 134.505 1.00 52.49  ? 185 ASP C N   1 
ATOM   6057  C  CA  . ASP C  1 164 ? 98.344  181.078 134.704 1.00 51.60  ? 185 ASP C CA  1 
ATOM   6058  C  C   . ASP C  1 164 ? 99.008  180.018 133.814 1.00 51.96  ? 185 ASP C C   1 
ATOM   6059  O  O   . ASP C  1 164 ? 99.549  180.382 132.770 1.00 52.34  ? 185 ASP C O   1 
ATOM   6060  C  CB  . ASP C  1 164 ? 96.852  181.170 134.373 1.00 51.50  ? 185 ASP C CB  1 
ATOM   6061  C  CG  . ASP C  1 164 ? 96.001  179.943 134.627 1.00 51.18  ? 185 ASP C CG  1 
ATOM   6062  O  OD1 . ASP C  1 164 ? 96.507  178.832 134.589 1.00 51.53  ? 185 ASP C OD1 1 
ATOM   6063  O  OD2 . ASP C  1 164 ? 94.813  180.101 134.653 1.00 51.06  ? 185 ASP C OD2 1 
ATOM   6064  N  N   . ALA C  1 165 ? 99.039  178.767 134.279 1.00 51.43  ? 186 ALA C N   1 
ATOM   6065  C  CA  . ALA C  1 165 ? 99.564  177.611 133.516 1.00 52.49  ? 186 ALA C CA  1 
ATOM   6066  C  C   . ALA C  1 165 ? 98.675  177.330 132.298 1.00 52.97  ? 186 ALA C C   1 
ATOM   6067  O  O   . ALA C  1 165 ? 99.189  176.835 131.288 1.00 53.86  ? 186 ALA C O   1 
ATOM   6068  C  CB  . ALA C  1 165 ? 99.659  176.399 134.408 1.00 52.41  ? 186 ALA C CB  1 
ATOM   6069  N  N   . HIS C  1 166 ? 97.364  177.501 132.470 1.00 52.37  ? 187 HIS C N   1 
ATOM   6070  C  CA  . HIS C  1 166 ? 96.348  177.264 131.409 1.00 53.21  ? 187 HIS C CA  1 
ATOM   6071  C  C   . HIS C  1 166 ? 95.858  178.619 130.898 1.00 53.64  ? 187 HIS C C   1 
ATOM   6072  O  O   . HIS C  1 166 ? 96.152  179.622 131.498 1.00 52.51  ? 187 HIS C O   1 
ATOM   6073  C  CB  . HIS C  1 166 ? 95.185  176.461 132.001 1.00 52.59  ? 187 HIS C CB  1 
ATOM   6074  C  CG  . HIS C  1 166 ? 95.629  175.414 132.963 1.00 52.31  ? 187 HIS C CG  1 
ATOM   6075  N  ND1 . HIS C  1 166 ? 96.039  175.715 134.243 1.00 50.85  ? 187 HIS C ND1 1 
ATOM   6076  C  CD2 . HIS C  1 166 ? 95.738  174.078 132.833 1.00 53.33  ? 187 HIS C CD2 1 
ATOM   6077  C  CE1 . HIS C  1 166 ? 96.389  174.606 134.849 1.00 51.28  ? 187 HIS C CE1 1 
ATOM   6078  N  NE2 . HIS C  1 166 ? 96.205  173.593 134.015 1.00 52.71  ? 187 HIS C NE2 1 
ATOM   6079  N  N   . PRO C  1 167 ? 95.197  178.683 129.723 1.00 55.62  ? 188 PRO C N   1 
ATOM   6080  C  CA  . PRO C  1 167 ? 94.678  179.925 129.137 1.00 56.59  ? 188 PRO C CA  1 
ATOM   6081  C  C   . PRO C  1 167 ? 93.182  180.232 129.325 1.00 56.89  ? 188 PRO C C   1 
ATOM   6082  O  O   . PRO C  1 167 ? 92.792  181.344 129.169 1.00 56.83  ? 188 PRO C O   1 
ATOM   6083  C  CB  . PRO C  1 167 ? 94.816  179.694 127.629 1.00 58.14  ? 188 PRO C CB  1 
ATOM   6084  C  CG  . PRO C  1 167 ? 94.974  178.203 127.445 1.00 58.94  ? 188 PRO C CG  1 
ATOM   6085  C  CD  . PRO C  1 167 ? 95.006  177.572 128.819 1.00 57.49  ? 188 PRO C CD  1 
ATOM   6086  N  N   . ASP C  1 168 ? 92.404  179.207 129.639 1.00 57.56  ? 189 ASP C N   1 
ATOM   6087  C  CA  . ASP C  1 168 ? 90.990  179.282 130.079 1.00 57.66  ? 189 ASP C CA  1 
ATOM   6088  C  C   . ASP C  1 168 ? 90.075  180.017 129.107 1.00 58.52  ? 189 ASP C C   1 
ATOM   6089  O  O   . ASP C  1 168 ? 89.235  180.780 129.600 1.00 57.79  ? 189 ASP C O   1 
ATOM   6090  C  CB  . ASP C  1 168 ? 90.886  179.957 131.442 1.00 56.21  ? 189 ASP C CB  1 
ATOM   6091  C  CG  . ASP C  1 168 ? 91.655  179.208 132.484 1.00 55.58  ? 189 ASP C CG  1 
ATOM   6092  O  OD1 . ASP C  1 168 ? 91.836  177.965 132.336 1.00 56.11  ? 189 ASP C OD1 1 
ATOM   6093  O  OD2 . ASP C  1 168 ? 92.071  179.881 133.410 1.00 55.29  ? 189 ASP C OD2 1 
ATOM   6094  N  N   . ILE C  1 169 ? 90.255  179.792 127.801 1.00 60.22  ? 190 ILE C N   1 
ATOM   6095  C  CA  . ILE C  1 169 ? 89.446  180.398 126.707 1.00 61.24  ? 190 ILE C CA  1 
ATOM   6096  C  C   . ILE C  1 169 ? 88.687  179.274 125.977 1.00 63.03  ? 190 ILE C C   1 
ATOM   6097  O  O   . ILE C  1 169 ? 88.225  179.534 124.800 1.00 64.21  ? 190 ILE C O   1 
ATOM   6098  C  CB  . ILE C  1 169 ? 90.284  181.236 125.696 1.00 62.26  ? 190 ILE C CB  1 
ATOM   6099  C  CG1 . ILE C  1 169 ? 91.752  180.829 125.664 1.00 61.81  ? 190 ILE C CG1 1 
ATOM   6100  C  CG2 . ILE C  1 169 ? 90.127  182.758 125.833 1.00 61.94  ? 190 ILE C CG2 1 
ATOM   6101  C  CD1 . ILE C  1 169 ? 91.957  179.543 124.933 1.00 63.20  ? 190 ILE C CD1 1 
ATOM   6102  N  N   . TYR C  1 170 ? 88.493  178.091 126.584 1.00 62.89  ? 191 TYR C N   1 
ATOM   6103  C  CA  . TYR C  1 170 ? 87.595  177.075 125.968 1.00 65.15  ? 191 TYR C CA  1 
ATOM   6104  C  C   . TYR C  1 170 ? 86.209  177.719 125.698 1.00 66.13  ? 191 TYR C C   1 
ATOM   6105  O  O   . TYR C  1 170 ? 85.734  178.594 126.457 1.00 64.00  ? 191 TYR C O   1 
ATOM   6106  C  CB  . TYR C  1 170 ? 87.436  175.821 126.814 1.00 65.24  ? 191 TYR C CB  1 
ATOM   6107  C  CG  . TYR C  1 170 ? 88.582  174.838 126.869 1.00 65.39  ? 191 TYR C CG  1 
ATOM   6108  C  CD1 . TYR C  1 170 ? 89.485  174.836 127.936 1.00 63.36  ? 191 TYR C CD1 1 
ATOM   6109  C  CD2 . TYR C  1 170 ? 88.635  173.779 125.975 1.00 67.42  ? 191 TYR C CD2 1 
ATOM   6110  C  CE1 . TYR C  1 170 ? 90.486  173.879 128.037 1.00 63.65  ? 191 TYR C CE1 1 
ATOM   6111  C  CE2 . TYR C  1 170 ? 89.608  172.797 126.082 1.00 68.03  ? 191 TYR C CE2 1 
ATOM   6112  C  CZ  . TYR C  1 170 ? 90.542  172.851 127.109 1.00 66.12  ? 191 TYR C CZ  1 
ATOM   6113  O  OH  . TYR C  1 170 ? 91.511  171.895 127.166 1.00 66.57  ? 191 TYR C OH  1 
ATOM   6114  N  N   . ASP C  1 171 ? 85.590  177.373 124.566 1.00 69.33  ? 192 ASP C N   1 
ATOM   6115  C  CA  . ASP C  1 171 ? 84.291  177.967 124.149 1.00 71.09  ? 192 ASP C CA  1 
ATOM   6116  C  C   . ASP C  1 171 ? 83.250  177.671 125.239 1.00 72.20  ? 192 ASP C C   1 
ATOM   6117  O  O   . ASP C  1 171 ? 82.719  178.621 125.903 1.00 70.57  ? 192 ASP C O   1 
ATOM   6118  C  CB  . ASP C  1 171 ? 83.850  177.408 122.799 1.00 73.67  ? 192 ASP C CB  1 
ATOM   6119  C  CG  . ASP C  1 171 ? 82.544  178.067 122.317 1.00 74.56  ? 192 ASP C CG  1 
ATOM   6120  O  OD1 . ASP C  1 171 ? 82.500  179.320 122.116 1.00 73.19  ? 192 ASP C OD1 1 
ATOM   6121  O  OD2 . ASP C  1 171 ? 81.577  177.318 122.092 1.00 76.92  ? 192 ASP C OD2 1 
ATOM   6122  N  N   . CYS C  1 172 ? 83.057  176.372 125.470 1.00 75.35  ? 193 CYS C N   1 
ATOM   6123  C  CA  . CYS C  1 172 ? 82.130  175.819 126.476 1.00 77.37  ? 193 CYS C CA  1 
ATOM   6124  C  C   . CYS C  1 172 ? 82.771  174.545 127.016 1.00 77.03  ? 193 CYS C C   1 
ATOM   6125  O  O   . CYS C  1 172 ? 82.870  173.571 126.248 1.00 79.71  ? 193 CYS C O   1 
ATOM   6126  C  CB  . CYS C  1 172 ? 80.781  175.568 125.805 1.00 81.37  ? 193 CYS C CB  1 
ATOM   6127  S  SG  . CYS C  1 172 ? 79.400  175.421 126.970 1.00 84.47  ? 193 CYS C SG  1 
ATOM   6128  N  N   . PHE C  1 173 ? 83.287  174.564 128.238 1.00 74.93  ? 194 PHE C N   1 
ATOM   6129  C  CA  . PHE C  1 173 ? 84.010  173.386 128.790 1.00 74.39  ? 194 PHE C CA  1 
ATOM   6130  C  C   . PHE C  1 173 ? 83.163  172.494 129.695 1.00 75.30  ? 194 PHE C C   1 
ATOM   6131  O  O   . PHE C  1 173 ? 82.543  172.998 130.642 1.00 74.27  ? 194 PHE C O   1 
ATOM   6132  C  CB  . PHE C  1 173 ? 85.255  173.778 129.586 1.00 71.88  ? 194 PHE C CB  1 
ATOM   6133  C  CG  . PHE C  1 173 ? 86.095  172.598 130.027 1.00 72.61  ? 194 PHE C CG  1 
ATOM   6134  C  CD1 . PHE C  1 173 ? 85.808  171.907 131.211 1.00 72.89  ? 194 PHE C CD1 1 
ATOM   6135  C  CD2 . PHE C  1 173 ? 87.171  172.155 129.266 1.00 72.84  ? 194 PHE C CD2 1 
ATOM   6136  C  CE1 . PHE C  1 173 ? 86.584  170.827 131.628 1.00 73.22  ? 194 PHE C CE1 1 
ATOM   6137  C  CE2 . PHE C  1 173 ? 87.939  171.068 129.681 1.00 73.77  ? 194 PHE C CE2 1 
ATOM   6138  C  CZ  . PHE C  1 173 ? 87.654  170.409 130.866 1.00 73.63  ? 194 PHE C CZ  1 
ATOM   6139  N  N   . GLU C  1 174 ? 83.098  171.219 129.302 1.00 77.43  ? 195 GLU C N   1 
ATOM   6140  C  CA  . GLU C  1 174 ? 82.173  170.116 129.696 1.00 80.07  ? 195 GLU C CA  1 
ATOM   6141  C  C   . GLU C  1 174 ? 80.715  170.607 129.733 1.00 80.11  ? 195 GLU C C   1 
ATOM   6142  O  O   . GLU C  1 174 ? 79.960  170.139 130.587 1.00 81.59  ? 195 GLU C O   1 
ATOM   6143  C  CB  . GLU C  1 174 ? 82.583  169.567 131.060 1.00 79.80  ? 195 GLU C CB  1 
ATOM   6144  C  CG  . GLU C  1 174 ? 83.571  168.426 130.962 1.00 81.65  ? 195 GLU C CG  1 
ATOM   6145  C  CD  . GLU C  1 174 ? 84.504  168.308 132.157 1.00 80.59  ? 195 GLU C CD  1 
ATOM   6146  O  OE1 . GLU C  1 174 ? 85.614  167.745 131.974 1.00 80.83  ? 195 GLU C OE1 1 
ATOM   6147  O  OE2 . GLU C  1 174 ? 84.128  168.798 133.271 1.00 80.29  ? 195 GLU C OE2 1 
ATOM   6148  N  N   . GLY C  1 175 ? 80.309  171.474 128.820 1.00 78.76  ? 196 GLY C N   1 
ATOM   6149  C  CA  . GLY C  1 175 ? 78.899  171.880 128.677 1.00 79.66  ? 196 GLY C CA  1 
ATOM   6150  C  C   . GLY C  1 175 ? 78.512  172.933 129.696 1.00 76.68  ? 196 GLY C C   1 
ATOM   6151  O  O   . GLY C  1 175 ? 77.306  173.212 129.804 1.00 77.55  ? 196 GLY C O   1 
ATOM   6152  N  N   . ASN C  1 176 ? 79.489  173.507 130.403 1.00 73.30  ? 197 ASN C N   1 
ATOM   6153  C  CA  . ASN C  1 176 ? 79.258  174.609 131.375 1.00 71.04  ? 197 ASN C CA  1 
ATOM   6154  C  C   . ASN C  1 176 ? 79.884  175.884 130.813 1.00 68.86  ? 197 ASN C C   1 
ATOM   6155  O  O   . ASN C  1 176 ? 81.109  175.936 130.699 1.00 67.17  ? 197 ASN C O   1 
ATOM   6156  C  CB  . ASN C  1 176 ? 79.801  174.268 132.771 1.00 69.24  ? 197 ASN C CB  1 
ATOM   6157  C  CG  . ASN C  1 176 ? 79.686  175.388 133.790 1.00 66.92  ? 197 ASN C CG  1 
ATOM   6158  O  OD1 . ASN C  1 176 ? 78.974  176.370 133.569 1.00 66.02  ? 197 ASN C OD1 1 
ATOM   6159  N  ND2 . ASN C  1 176 ? 80.393  175.236 134.919 1.00 65.59  ? 197 ASN C ND2 1 
ATOM   6160  N  N   . LYS C  1 177 ? 79.060  176.885 130.534 1.00 69.50  ? 198 LYS C N   1 
ATOM   6161  C  CA  . LYS C  1 177 ? 79.523  178.190 129.989 1.00 68.49  ? 198 LYS C CA  1 
ATOM   6162  C  C   . LYS C  1 177 ? 80.188  178.985 131.109 1.00 65.09  ? 198 LYS C C   1 
ATOM   6163  O  O   . LYS C  1 177 ? 80.761  180.016 130.818 1.00 63.47  ? 198 LYS C O   1 
ATOM   6164  C  CB  . LYS C  1 177 ? 78.384  178.963 129.301 1.00 70.84  ? 198 LYS C CB  1 
ATOM   6165  C  CG  . LYS C  1 177 ? 77.375  179.682 130.198 1.00 72.06  ? 198 LYS C CG  1 
ATOM   6166  C  CD  . LYS C  1 177 ? 76.658  180.806 129.447 1.00 73.74  ? 198 LYS C CD  1 
ATOM   6167  C  CE  . LYS C  1 177 ? 75.769  181.675 130.318 1.00 74.79  ? 198 LYS C CE  1 
ATOM   6168  N  NZ  . LYS C  1 177 ? 74.418  181.087 130.526 1.00 77.54  ? 198 LYS C NZ  1 
ATOM   6169  N  N   . TYR C  1 178 ? 80.088  178.536 132.353 1.00 64.26  ? 199 TYR C N   1 
ATOM   6170  C  CA  . TYR C  1 178 ? 80.668  179.278 133.493 1.00 61.91  ? 199 TYR C CA  1 
ATOM   6171  C  C   . TYR C  1 178 ? 81.934  178.554 133.970 1.00 60.55  ? 199 TYR C C   1 
ATOM   6172  O  O   . TYR C  1 178 ? 82.562  179.040 134.953 1.00 58.79  ? 199 TYR C O   1 
ATOM   6173  C  CB  . TYR C  1 178 ? 79.596  179.533 134.556 1.00 62.71  ? 199 TYR C CB  1 
ATOM   6174  C  CG  . TYR C  1 178 ? 78.732  180.737 134.271 1.00 63.46  ? 199 TYR C CG  1 
ATOM   6175  C  CD1 . TYR C  1 178 ? 79.280  182.011 134.130 1.00 62.25  ? 199 TYR C CD1 1 
ATOM   6176  C  CD2 . TYR C  1 178 ? 77.357  180.609 134.129 1.00 65.67  ? 199 TYR C CD2 1 
ATOM   6177  C  CE1 . TYR C  1 178 ? 78.489  183.120 133.844 1.00 63.01  ? 199 TYR C CE1 1 
ATOM   6178  C  CE2 . TYR C  1 178 ? 76.550  181.709 133.835 1.00 66.52  ? 199 TYR C CE2 1 
ATOM   6179  C  CZ  . TYR C  1 178 ? 77.113  182.972 133.700 1.00 65.10  ? 199 TYR C CZ  1 
ATOM   6180  O  OH  . TYR C  1 178 ? 76.302  184.034 133.394 1.00 66.20  ? 199 TYR C OH  1 
ATOM   6181  N  N   . SER C  1 179 ? 82.339  177.478 133.268 1.00 60.67  ? 200 SER C N   1 
ATOM   6182  C  CA  . SER C  1 179 ? 83.558  176.654 133.542 1.00 59.43  ? 200 SER C CA  1 
ATOM   6183  C  C   . SER C  1 179 ? 84.777  177.541 133.798 1.00 56.72  ? 200 SER C C   1 
ATOM   6184  O  O   . SER C  1 179 ? 84.985  178.454 133.031 1.00 55.65  ? 200 SER C O   1 
ATOM   6185  C  CB  . SER C  1 179 ? 83.869  175.710 132.401 1.00 60.81  ? 200 SER C CB  1 
ATOM   6186  O  OG  . SER C  1 179 ? 85.140  175.088 132.598 1.00 59.93  ? 200 SER C OG  1 
ATOM   6187  N  N   . HIS C  1 180 ? 85.593  177.212 134.806 1.00 55.59  ? 201 HIS C N   1 
ATOM   6188  C  CA  . HIS C  1 180 ? 86.817  178.004 135.135 1.00 53.80  ? 201 HIS C CA  1 
ATOM   6189  C  C   . HIS C  1 180 ? 87.777  178.023 133.939 1.00 54.34  ? 201 HIS C C   1 
ATOM   6190  O  O   . HIS C  1 180 ? 88.568  178.982 133.867 1.00 53.28  ? 201 HIS C O   1 
ATOM   6191  C  CB  . HIS C  1 180 ? 87.472  177.567 136.439 1.00 52.26  ? 201 HIS C CB  1 
ATOM   6192  C  CG  . HIS C  1 180 ? 88.071  176.208 136.453 1.00 52.31  ? 201 HIS C CG  1 
ATOM   6193  N  ND1 . HIS C  1 180 ? 89.051  175.862 137.385 1.00 51.02  ? 201 HIS C ND1 1 
ATOM   6194  C  CD2 . HIS C  1 180 ? 87.793  175.092 135.742 1.00 53.44  ? 201 HIS C CD2 1 
ATOM   6195  C  CE1 . HIS C  1 180 ? 89.369  174.606 137.207 1.00 51.91  ? 201 HIS C CE1 1 
ATOM   6196  N  NE2 . HIS C  1 180 ? 88.614  174.103 136.209 1.00 53.37  ? 201 HIS C NE2 1 
ATOM   6197  N  N   . ALA C  1 181 ? 87.575  177.080 132.998 1.00 56.57  ? 202 ALA C N   1 
ATOM   6198  C  CA  . ALA C  1 181 ? 88.353  176.801 131.760 1.00 57.60  ? 202 ALA C CA  1 
ATOM   6199  C  C   . ALA C  1 181 ? 87.808  177.564 130.550 1.00 58.57  ? 202 ALA C C   1 
ATOM   6200  O  O   . ALA C  1 181 ? 88.378  177.392 129.453 1.00 59.38  ? 202 ALA C O   1 
ATOM   6201  C  CB  . ALA C  1 181 ? 88.317  175.308 131.481 1.00 59.41  ? 202 ALA C CB  1 
ATOM   6202  N  N   . SER C  1 182 ? 86.746  178.352 130.731 1.00 59.02  ? 203 SER C N   1 
ATOM   6203  C  CA  . SER C  1 182 ? 86.014  179.079 129.652 1.00 59.92  ? 203 SER C CA  1 
ATOM   6204  C  C   . SER C  1 182 ? 85.887  180.564 129.997 1.00 59.05  ? 203 SER C C   1 
ATOM   6205  O  O   . SER C  1 182 ? 85.363  181.283 129.178 1.00 60.08  ? 203 SER C O   1 
ATOM   6206  C  CB  . SER C  1 182 ? 84.652  178.465 129.372 1.00 61.65  ? 203 SER C CB  1 
ATOM   6207  O  OG  . SER C  1 182 ? 84.755  177.214 128.689 1.00 63.36  ? 203 SER C OG  1 
ATOM   6208  N  N   . SER C  1 183 ? 86.505  181.014 131.082 1.00 58.50  ? 204 SER C N   1 
ATOM   6209  C  CA  . SER C  1 183 ? 86.303  182.341 131.710 1.00 58.45  ? 204 SER C CA  1 
ATOM   6210  C  C   . SER C  1 183 ? 86.770  183.460 130.790 1.00 57.88  ? 204 SER C C   1 
ATOM   6211  O  O   . SER C  1 183 ? 86.061  184.443 130.702 1.00 58.92  ? 204 SER C O   1 
ATOM   6212  C  CB  . SER C  1 183 ? 87.016  182.412 133.038 1.00 58.77  ? 204 SER C CB  1 
ATOM   6213  O  OG  . SER C  1 183 ? 87.212  183.778 133.397 1.00 60.20  ? 204 SER C OG  1 
ATOM   6214  N  N   . PHE C  1 184 ? 87.916  183.318 130.124 1.00 57.44  ? 205 PHE C N   1 
ATOM   6215  C  CA  . PHE C  1 184 ? 88.536  184.385 129.273 1.00 57.04  ? 205 PHE C CA  1 
ATOM   6216  C  C   . PHE C  1 184 ? 87.887  184.386 127.896 1.00 57.99  ? 205 PHE C C   1 
ATOM   6217  O  O   . PHE C  1 184 ? 87.928  185.434 127.288 1.00 58.21  ? 205 PHE C O   1 
ATOM   6218  C  CB  . PHE C  1 184 ? 90.071  184.274 129.285 1.00 56.20  ? 205 PHE C CB  1 
ATOM   6219  C  CG  . PHE C  1 184 ? 90.647  184.794 130.572 1.00 54.76  ? 205 PHE C CG  1 
ATOM   6220  C  CD1 . PHE C  1 184 ? 90.676  183.991 131.703 1.00 54.12  ? 205 PHE C CD1 1 
ATOM   6221  C  CD2 . PHE C  1 184 ? 91.097  186.095 130.679 1.00 54.56  ? 205 PHE C CD2 1 
ATOM   6222  C  CE1 . PHE C  1 184 ? 91.166  184.479 132.912 1.00 53.33  ? 205 PHE C CE1 1 
ATOM   6223  C  CE2 . PHE C  1 184 ? 91.605  186.574 131.879 1.00 54.05  ? 205 PHE C CE2 1 
ATOM   6224  C  CZ  . PHE C  1 184 ? 91.620  185.778 132.999 1.00 53.29  ? 205 PHE C CZ  1 
ATOM   6225  N  N   . ALA C  1 185 ? 87.262  183.275 127.474 1.00 58.96  ? 206 ALA C N   1 
ATOM   6226  C  CA  . ALA C  1 185 ? 86.375  183.193 126.273 1.00 60.63  ? 206 ALA C CA  1 
ATOM   6227  C  C   . ALA C  1 185 ? 85.117  184.072 126.439 1.00 60.71  ? 206 ALA C C   1 
ATOM   6228  O  O   . ALA C  1 185 ? 84.753  184.770 125.454 1.00 62.11  ? 206 ALA C O   1 
ATOM   6229  C  CB  . ALA C  1 185 ? 85.989  181.751 125.960 1.00 61.79  ? 206 ALA C CB  1 
ATOM   6230  N  N   . ARG C  1 186 ? 84.479  184.021 127.615 1.00 59.99  ? 207 ARG C N   1 
ATOM   6231  C  CA  . ARG C  1 186 ? 83.348  184.887 128.045 1.00 60.14  ? 207 ARG C CA  1 
ATOM   6232  C  C   . ARG C  1 186 ? 83.787  186.363 128.013 1.00 59.72  ? 207 ARG C C   1 
ATOM   6233  O  O   . ARG C  1 186 ? 82.988  187.202 127.430 1.00 60.60  ? 207 ARG C O   1 
ATOM   6234  C  CB  . ARG C  1 186 ? 82.865  184.467 129.440 1.00 59.49  ? 207 ARG C CB  1 
ATOM   6235  C  CG  . ARG C  1 186 ? 82.332  183.044 129.503 1.00 60.31  ? 207 ARG C CG  1 
ATOM   6236  C  CD  . ARG C  1 186 ? 81.117  182.829 128.594 1.00 62.23  ? 207 ARG C CD  1 
ATOM   6237  N  NE  . ARG C  1 186 ? 81.499  182.435 127.244 1.00 63.21  ? 207 ARG C NE  1 
ATOM   6238  C  CZ  . ARG C  1 186 ? 81.798  181.195 126.853 1.00 64.14  ? 207 ARG C CZ  1 
ATOM   6239  N  NH1 . ARG C  1 186 ? 81.757  180.174 127.692 1.00 64.08  ? 207 ARG C NH1 1 
ATOM   6240  N  NH2 . ARG C  1 186 ? 82.160  180.980 125.603 1.00 65.15  ? 207 ARG C NH2 1 
ATOM   6241  N  N   . ILE C  1 187 ? 84.985  186.663 128.543 1.00 58.26  ? 208 ILE C N   1 
ATOM   6242  C  CA  . ILE C  1 187 ? 85.492  188.052 128.691 1.00 58.58  ? 208 ILE C CA  1 
ATOM   6243  C  C   . ILE C  1 187 ? 85.776  188.619 127.296 1.00 60.47  ? 208 ILE C C   1 
ATOM   6244  O  O   . ILE C  1 187 ? 85.367  189.764 127.002 1.00 61.83  ? 208 ILE C O   1 
ATOM   6245  C  CB  . ILE C  1 187 ? 86.755  188.112 129.568 1.00 57.65  ? 208 ILE C CB  1 
ATOM   6246  C  CG1 . ILE C  1 187 ? 86.483  187.689 131.027 1.00 56.66  ? 208 ILE C CG1 1 
ATOM   6247  C  CG2 . ILE C  1 187 ? 87.359  189.511 129.456 1.00 57.83  ? 208 ILE C CG2 1 
ATOM   6248  C  CD1 . ILE C  1 187 ? 87.630  187.031 131.726 1.00 55.81  ? 208 ILE C CD1 1 
ATOM   6249  N  N   . MET C  1 188 ? 86.454  187.836 126.463 1.00 61.15  ? 209 MET C N   1 
ATOM   6250  C  CA  . MET C  1 188 ? 86.830  188.278 125.098 1.00 63.35  ? 209 MET C CA  1 
ATOM   6251  C  C   . MET C  1 188 ? 85.560  188.452 124.257 1.00 65.73  ? 209 MET C C   1 
ATOM   6252  O  O   . MET C  1 188 ? 85.358  189.524 123.737 1.00 66.67  ? 209 MET C O   1 
ATOM   6253  C  CB  . MET C  1 188 ? 87.824  187.315 124.444 1.00 63.16  ? 209 MET C CB  1 
ATOM   6254  C  CG  . MET C  1 188 ? 89.198  187.305 125.099 1.00 61.71  ? 209 MET C CG  1 
ATOM   6255  S  SD  . MET C  1 188 ? 89.839  188.891 125.653 1.00 60.98  ? 209 MET C SD  1 
ATOM   6256  C  CE  . MET C  1 188 ? 89.935  189.768 124.099 1.00 62.88  ? 209 MET C CE  1 
ATOM   6257  N  N   . GLU C  1 189 ? 84.624  187.527 124.415 1.00 67.55  ? 210 GLU C N   1 
ATOM   6258  C  CA  . GLU C  1 189 ? 83.328  187.491 123.711 1.00 69.08  ? 210 GLU C CA  1 
ATOM   6259  C  C   . GLU C  1 189 ? 82.559  188.789 123.956 1.00 69.60  ? 210 GLU C C   1 
ATOM   6260  O  O   . GLU C  1 189 ? 81.971  189.280 123.000 1.00 71.52  ? 210 GLU C O   1 
ATOM   6261  C  CB  . GLU C  1 189 ? 82.508  186.352 124.308 1.00 69.23  ? 210 GLU C CB  1 
ATOM   6262  C  CG  . GLU C  1 189 ? 82.846  185.024 123.700 1.00 71.39  ? 210 GLU C CG  1 
ATOM   6263  C  CD  . GLU C  1 189 ? 81.950  183.879 124.107 1.00 73.31  ? 210 GLU C CD  1 
ATOM   6264  O  OE1 . GLU C  1 189 ? 80.993  184.125 124.851 1.00 73.86  ? 210 GLU C OE1 1 
ATOM   6265  O  OE2 . GLU C  1 189 ? 82.223  182.751 123.667 1.00 74.98  ? 210 GLU C OE2 1 
ATOM   6266  N  N   . GLY C  1 190 ? 82.589  189.320 125.171 1.00 68.63  ? 211 GLY C N   1 
ATOM   6267  C  CA  . GLY C  1 190 ? 81.875  190.553 125.536 1.00 69.69  ? 211 GLY C CA  1 
ATOM   6268  C  C   . GLY C  1 190 ? 82.690  191.816 125.326 1.00 70.35  ? 211 GLY C C   1 
ATOM   6269  O  O   . GLY C  1 190 ? 82.198  192.861 125.685 1.00 72.79  ? 211 GLY C O   1 
ATOM   6270  N  N   . GLY C  1 191 ? 83.908  191.730 124.812 1.00 69.31  ? 212 GLY C N   1 
ATOM   6271  C  CA  . GLY C  1 191 ? 84.721  192.939 124.586 1.00 69.98  ? 212 GLY C CA  1 
ATOM   6272  C  C   . GLY C  1 191 ? 84.941  193.736 125.863 1.00 69.41  ? 212 GLY C C   1 
ATOM   6273  O  O   . GLY C  1 191 ? 84.950  194.973 125.797 1.00 69.12  ? 212 GLY C O   1 
ATOM   6274  N  N   . TYR C  1 192 ? 85.088  193.057 127.002 1.00 69.31  ? 213 TYR C N   1 
ATOM   6275  C  CA  . TYR C  1 192 ? 85.449  193.686 128.312 1.00 69.56  ? 213 TYR C CA  1 
ATOM   6276  C  C   . TYR C  1 192 ? 86.975  193.907 128.379 1.00 69.56  ? 213 TYR C C   1 
ATOM   6277  O  O   . TYR C  1 192 ? 87.457  194.829 129.164 1.00 70.75  ? 213 TYR C O   1 
ATOM   6278  C  CB  . TYR C  1 192 ? 84.896  192.884 129.497 1.00 68.51  ? 213 TYR C CB  1 
ATOM   6279  C  CG  . TYR C  1 192 ? 83.402  192.638 129.393 1.00 69.46  ? 213 TYR C CG  1 
ATOM   6280  C  CD1 . TYR C  1 192 ? 82.454  193.649 129.632 1.00 70.87  ? 213 TYR C CD1 1 
ATOM   6281  C  CD2 . TYR C  1 192 ? 82.914  191.400 128.980 1.00 69.57  ? 213 TYR C CD2 1 
ATOM   6282  C  CE1 . TYR C  1 192 ? 81.074  193.420 129.497 1.00 71.14  ? 213 TYR C CE1 1 
ATOM   6283  C  CE2 . TYR C  1 192 ? 81.537  191.161 128.826 1.00 70.07  ? 213 TYR C CE2 1 
ATOM   6284  C  CZ  . TYR C  1 192 ? 80.621  192.169 129.080 1.00 70.69  ? 213 TYR C CZ  1 
ATOM   6285  O  OH  . TYR C  1 192 ? 79.295  191.900 128.859 1.00 71.58  ? 213 TYR C OH  1 
ATOM   6286  N  N   . ALA C  1 193 ? 87.713  193.134 127.558 1.00 68.96  ? 214 ALA C N   1 
ATOM   6287  C  CA  . ALA C  1 193 ? 89.179  193.264 127.369 1.00 69.11  ? 214 ALA C CA  1 
ATOM   6288  C  C   . ALA C  1 193 ? 89.517  193.635 125.916 1.00 69.80  ? 214 ALA C C   1 
ATOM   6289  O  O   . ALA C  1 193 ? 88.741  193.217 125.017 1.00 69.88  ? 214 ALA C O   1 
ATOM   6290  C  CB  . ALA C  1 193 ? 89.887  191.988 127.769 1.00 67.81  ? 214 ALA C CB  1 
ATOM   6291  N  N   . ARG C  1 194 ? 90.635  194.367 125.740 1.00 69.89  ? 215 ARG C N   1 
ATOM   6292  C  CA  . ARG C  1 194 ? 91.364  194.587 124.459 1.00 70.75  ? 215 ARG C CA  1 
ATOM   6293  C  C   . ARG C  1 194 ? 92.589  193.648 124.417 1.00 70.17  ? 215 ARG C C   1 
ATOM   6294  O  O   . ARG C  1 194 ? 92.426  192.558 123.866 1.00 69.94  ? 215 ARG C O   1 
ATOM   6295  C  CB  . ARG C  1 194 ? 91.722  196.065 124.329 1.00 72.34  ? 215 ARG C CB  1 
ATOM   6296  C  CG  . ARG C  1 194 ? 92.646  196.383 123.161 1.00 74.01  ? 215 ARG C CG  1 
ATOM   6297  C  CD  . ARG C  1 194 ? 93.270  197.782 123.188 1.00 75.80  ? 215 ARG C CD  1 
ATOM   6298  N  NE  . ARG C  1 194 ? 94.137  198.159 124.334 1.00 75.19  ? 215 ARG C NE  1 
ATOM   6299  C  CZ  . ARG C  1 194 ? 94.878  199.274 124.351 1.00 76.75  ? 215 ARG C CZ  1 
ATOM   6300  N  NH1 . ARG C  1 194 ? 95.607  199.619 125.395 1.00 76.50  ? 215 ARG C NH1 1 
ATOM   6301  N  NH2 . ARG C  1 194 ? 94.860  200.072 123.301 1.00 78.87  ? 215 ARG C NH2 1 
ATOM   6302  N  N   . ARG C  1 195 ? 93.757  194.026 124.976 1.00 70.07  ? 216 ARG C N   1 
ATOM   6303  C  CA  . ARG C  1 195 ? 94.949  193.122 125.103 1.00 69.35  ? 216 ARG C CA  1 
ATOM   6304  C  C   . ARG C  1 195 ? 94.845  192.184 126.335 1.00 67.16  ? 216 ARG C C   1 
ATOM   6305  O  O   . ARG C  1 195 ? 94.981  192.649 127.500 1.00 67.53  ? 216 ARG C O   1 
ATOM   6306  C  CB  . ARG C  1 195 ? 96.267  193.889 125.222 1.00 70.68  ? 216 ARG C CB  1 
ATOM   6307  C  CG  . ARG C  1 195 ? 96.503  194.892 124.108 1.00 73.32  ? 216 ARG C CG  1 
ATOM   6308  C  CD  . ARG C  1 195 ? 97.788  195.674 124.339 1.00 75.03  ? 216 ARG C CD  1 
ATOM   6309  N  NE  . ARG C  1 195 ? 98.950  194.790 124.344 1.00 75.02  ? 216 ARG C NE  1 
ATOM   6310  C  CZ  . ARG C  1 195 ? 100.172 195.142 124.704 1.00 75.45  ? 216 ARG C CZ  1 
ATOM   6311  N  NH1 . ARG C  1 195 ? 101.135 194.240 124.636 1.00 75.23  ? 216 ARG C NH1 1 
ATOM   6312  N  NH2 . ARG C  1 195 ? 100.420 196.362 125.152 1.00 76.61  ? 216 ARG C NH2 1 
ATOM   6313  N  N   . LEU C  1 196 ? 94.737  190.881 126.068 1.00 65.10  ? 217 LEU C N   1 
ATOM   6314  C  CA  . LEU C  1 196 ? 95.008  189.760 127.006 1.00 63.02  ? 217 LEU C CA  1 
ATOM   6315  C  C   . LEU C  1 196 ? 96.417  189.150 126.780 1.00 62.94  ? 217 LEU C C   1 
ATOM   6316  O  O   . LEU C  1 196 ? 96.598  188.278 125.808 1.00 63.31  ? 217 LEU C O   1 
ATOM   6317  C  CB  . LEU C  1 196 ? 93.917  188.720 126.752 1.00 62.24  ? 217 LEU C CB  1 
ATOM   6318  C  CG  . LEU C  1 196 ? 93.892  187.546 127.716 1.00 60.76  ? 217 LEU C CG  1 
ATOM   6319  C  CD1 . LEU C  1 196 ? 93.669  188.058 129.125 1.00 60.05  ? 217 LEU C CD1 1 
ATOM   6320  C  CD2 . LEU C  1 196 ? 92.812  186.539 127.306 1.00 60.61  ? 217 LEU C CD2 1 
ATOM   6321  N  N   . LEU C  1 197 ? 97.366  189.565 127.654 1.00 62.56  ? 218 LEU C N   1 
ATOM   6322  C  CA  . LEU C  1 197 ? 98.680  188.914 127.903 1.00 62.21  ? 218 LEU C CA  1 
ATOM   6323  C  C   . LEU C  1 197 ? 98.538  187.742 128.903 1.00 60.10  ? 218 LEU C C   1 
ATOM   6324  O  O   . LEU C  1 197 ? 98.372  187.991 130.129 1.00 58.85  ? 218 LEU C O   1 
ATOM   6325  C  CB  . LEU C  1 197 ? 99.629  189.968 128.474 1.00 63.47  ? 218 LEU C CB  1 
ATOM   6326  C  CG  . LEU C  1 197 ? 100.397 190.773 127.439 1.00 66.04  ? 218 LEU C CG  1 
ATOM   6327  C  CD1 . LEU C  1 197 ? 99.441  191.626 126.626 1.00 66.58  ? 218 LEU C CD1 1 
ATOM   6328  C  CD2 . LEU C  1 197 ? 101.496 191.609 128.094 1.00 67.35  ? 218 LEU C CD2 1 
ATOM   6329  N  N   . GLN C  1 198 ? 98.698  186.519 128.401 1.00 59.04  ? 219 GLN C N   1 
ATOM   6330  C  CA  . GLN C  1 198 ? 98.700  185.257 129.174 1.00 57.36  ? 219 GLN C CA  1 
ATOM   6331  C  C   . GLN C  1 198 ? 100.157 184.812 129.383 1.00 57.44  ? 219 GLN C C   1 
ATOM   6332  O  O   . GLN C  1 198 ? 100.867 184.646 128.392 1.00 58.81  ? 219 GLN C O   1 
ATOM   6333  C  CB  . GLN C  1 198 ? 97.795  184.270 128.439 1.00 57.33  ? 219 GLN C CB  1 
ATOM   6334  C  CG  . GLN C  1 198 ? 96.373  184.806 128.284 1.00 57.07  ? 219 GLN C CG  1 
ATOM   6335  C  CD  . GLN C  1 198 ? 95.390  183.740 127.830 1.00 57.47  ? 219 GLN C CD  1 
ATOM   6336  O  OE1 . GLN C  1 198 ? 95.649  183.001 126.864 1.00 58.55  ? 219 GLN C OE1 1 
ATOM   6337  N  NE2 . GLN C  1 198 ? 94.265  183.624 128.542 1.00 56.54  ? 219 GLN C NE2 1 
ATOM   6338  N  N   . VAL C  1 199 ? 100.599 184.672 130.638 1.00 56.00  ? 220 VAL C N   1 
ATOM   6339  C  CA  . VAL C  1 199 ? 102.028 184.474 131.017 1.00 56.13  ? 220 VAL C CA  1 
ATOM   6340  C  C   . VAL C  1 199 ? 102.141 183.273 131.964 1.00 54.90  ? 220 VAL C C   1 
ATOM   6341  O  O   . VAL C  1 199 ? 101.358 183.210 132.916 1.00 54.22  ? 220 VAL C O   1 
ATOM   6342  C  CB  . VAL C  1 199 ? 102.556 185.749 131.688 1.00 56.50  ? 220 VAL C CB  1 
ATOM   6343  C  CG1 . VAL C  1 199 ? 103.966 185.568 132.215 1.00 57.28  ? 220 VAL C CG1 1 
ATOM   6344  C  CG2 . VAL C  1 199 ? 102.443 186.949 130.768 1.00 57.76  ? 220 VAL C CG2 1 
ATOM   6345  N  N   . GLY C  1 200 ? 103.127 182.401 131.790 1.00 54.99  ? 221 GLY C N   1 
ATOM   6346  C  CA  . GLY C  1 200 ? 103.277 181.174 132.594 1.00 54.00  ? 221 GLY C CA  1 
ATOM   6347  C  C   . GLY C  1 200 ? 102.562 179.993 131.963 1.00 53.70  ? 221 GLY C C   1 
ATOM   6348  O  O   . GLY C  1 200 ? 102.524 178.932 132.618 1.00 52.80  ? 221 GLY C O   1 
ATOM   6349  N  N   . ILE C  1 201 ? 102.046 180.165 130.724 1.00 54.21  ? 222 ILE C N   1 
ATOM   6350  C  CA  . ILE C  1 201 ? 101.267 179.123 129.995 1.00 54.58  ? 222 ILE C CA  1 
ATOM   6351  C  C   . ILE C  1 201 ? 102.154 177.907 129.697 1.00 55.89  ? 222 ILE C C   1 
ATOM   6352  O  O   . ILE C  1 201 ? 103.288 178.134 129.131 1.00 57.80  ? 222 ILE C O   1 
ATOM   6353  C  CB  . ILE C  1 201 ? 100.673 179.677 128.705 1.00 55.32  ? 222 ILE C CB  1 
ATOM   6354  C  CG1 . ILE C  1 201 ? 99.672  180.799 128.977 1.00 54.30  ? 222 ILE C CG1 1 
ATOM   6355  C  CG2 . ILE C  1 201 ? 100.065 178.544 127.902 1.00 56.24  ? 222 ILE C CG2 1 
ATOM   6356  C  CD1 . ILE C  1 201 ? 98.349  180.321 129.535 1.00 53.22  ? 222 ILE C CD1 1 
ATOM   6357  N  N   . ARG C  1 202 ? 101.681 176.702 130.056 1.00 55.69  ? 223 ARG C N   1 
ATOM   6358  C  CA  . ARG C  1 202 ? 102.370 175.411 129.771 1.00 57.20  ? 223 ARG C CA  1 
ATOM   6359  C  C   . ARG C  1 202 ? 101.361 174.261 129.604 1.00 58.07  ? 223 ARG C C   1 
ATOM   6360  O  O   . ARG C  1 202 ? 101.801 173.115 129.429 1.00 59.60  ? 223 ARG C O   1 
ATOM   6361  C  CB  . ARG C  1 202 ? 103.393 175.105 130.866 1.00 56.70  ? 223 ARG C CB  1 
ATOM   6362  C  CG  . ARG C  1 202 ? 102.851 175.280 132.274 1.00 54.73  ? 223 ARG C CG  1 
ATOM   6363  C  CD  . ARG C  1 202 ? 103.971 175.536 133.251 1.00 54.13  ? 223 ARG C CD  1 
ATOM   6364  N  NE  . ARG C  1 202 ? 103.516 175.318 134.606 1.00 52.71  ? 223 ARG C NE  1 
ATOM   6365  C  CZ  . ARG C  1 202 ? 103.097 176.268 135.421 1.00 51.23  ? 223 ARG C CZ  1 
ATOM   6366  N  NH1 . ARG C  1 202 ? 103.065 177.522 135.016 1.00 50.90  ? 223 ARG C NH1 1 
ATOM   6367  N  NH2 . ARG C  1 202 ? 102.710 175.960 136.642 1.00 50.41  ? 223 ARG C NH2 1 
ATOM   6368  N  N   . SER C  1 203 ? 100.062 174.566 129.636 1.00 57.51  ? 224 SER C N   1 
ATOM   6369  C  CA  . SER C  1 203 ? 98.935  173.598 129.497 1.00 58.70  ? 224 SER C CA  1 
ATOM   6370  C  C   . SER C  1 203 ? 97.956  174.272 128.556 1.00 59.72  ? 224 SER C C   1 
ATOM   6371  O  O   . SER C  1 203 ? 97.196  175.142 129.025 1.00 58.40  ? 224 SER C O   1 
ATOM   6372  C  CB  . SER C  1 203 ? 98.319  173.210 130.844 1.00 57.37  ? 224 SER C CB  1 
ATOM   6373  O  OG  . SER C  1 203 ? 97.548  172.003 130.723 1.00 58.51  ? 224 SER C OG  1 
ATOM   6374  N  N   . ILE C  1 204 ? 98.126  174.011 127.257 1.00 62.85  ? 225 ILE C N   1 
ATOM   6375  C  CA  . ILE C  1 204 ? 97.330  174.619 126.152 1.00 64.17  ? 225 ILE C CA  1 
ATOM   6376  C  C   . ILE C  1 204 ? 97.086  173.571 125.071 1.00 67.52  ? 225 ILE C C   1 
ATOM   6377  O  O   . ILE C  1 204 ? 98.004  172.797 124.781 1.00 68.48  ? 225 ILE C O   1 
ATOM   6378  C  CB  . ILE C  1 204 ? 97.998  175.872 125.571 1.00 64.32  ? 225 ILE C CB  1 
ATOM   6379  C  CG1 . ILE C  1 204 ? 97.097  176.468 124.502 1.00 65.32  ? 225 ILE C CG1 1 
ATOM   6380  C  CG2 . ILE C  1 204 ? 99.375  175.597 124.999 1.00 65.95  ? 225 ILE C CG2 1 
ATOM   6381  C  CD1 . ILE C  1 204 ? 97.331  177.931 124.240 1.00 64.99  ? 225 ILE C CD1 1 
ATOM   6382  N  N   . ASN C  1 205 ? 95.889  173.572 124.475 1.00 69.90  ? 226 ASN C N   1 
ATOM   6383  C  CA  . ASN C  1 205 ? 95.534  172.607 123.404 1.00 74.33  ? 226 ASN C CA  1 
ATOM   6384  C  C   . ASN C  1 205 ? 95.182  173.389 122.139 1.00 76.50  ? 226 ASN C C   1 
ATOM   6385  O  O   . ASN C  1 205 ? 95.228  174.654 122.146 1.00 74.61  ? 226 ASN C O   1 
ATOM   6386  C  CB  . ASN C  1 205 ? 94.443  171.636 123.867 1.00 75.65  ? 226 ASN C CB  1 
ATOM   6387  C  CG  . ASN C  1 205 ? 93.046  172.326 124.111 1.00 75.12  ? 226 ASN C CG  1 
ATOM   6388  O  OD1 . ASN C  1 205 ? 92.931  173.556 124.172 1.00 74.37  ? 226 ASN C OD1 1 
ATOM   6389  N  ND2 . ASN C  1 205 ? 92.023  171.515 124.393 1.00 76.61  ? 226 ASN C ND2 1 
ATOM   6390  N  N   . GLN C  1 206 ? 94.839  172.679 121.067 1.00 74.19  ? 227 GLN C N   1 
ATOM   6391  C  CA  . GLN C  1 206 ? 94.707  173.346 119.758 1.00 77.86  ? 227 GLN C CA  1 
ATOM   6392  C  C   . GLN C  1 206 ? 93.502  174.300 119.833 1.00 78.00  ? 227 GLN C C   1 
ATOM   6393  O  O   . GLN C  1 206 ? 93.512  175.332 119.108 1.00 80.11  ? 227 GLN C O   1 
ATOM   6394  C  CB  . GLN C  1 206 ? 94.741  172.322 118.615 1.00 82.78  ? 227 GLN C CB  1 
ATOM   6395  C  CG  . GLN C  1 206 ? 93.385  171.830 118.114 1.00 86.29  ? 227 GLN C CG  1 
ATOM   6396  C  CD  . GLN C  1 206 ? 93.288  171.901 116.610 1.00 90.79  ? 227 GLN C CD  1 
ATOM   6397  O  OE1 . GLN C  1 206 ? 93.302  172.979 116.018 1.00 94.21  ? 227 GLN C OE1 1 
ATOM   6398  N  NE2 . GLN C  1 206 ? 93.168  170.748 115.968 1.00 93.86  ? 227 GLN C NE2 1 
ATOM   6399  N  N   . GLU C  1 207 ? 92.513  174.012 120.684 1.00 75.81  ? 228 GLU C N   1 
ATOM   6400  C  CA  . GLU C  1 207 ? 91.406  174.964 120.947 1.00 75.56  ? 228 GLU C CA  1 
ATOM   6401  C  C   . GLU C  1 207 ? 91.942  176.186 121.698 1.00 73.27  ? 228 GLU C C   1 
ATOM   6402  O  O   . GLU C  1 207 ? 91.413  177.278 121.501 1.00 73.49  ? 228 GLU C O   1 
ATOM   6403  C  CB  . GLU C  1 207 ? 90.278  174.354 121.777 1.00 75.32  ? 228 GLU C CB  1 
ATOM   6404  C  CG  . GLU C  1 207 ? 89.054  175.275 121.801 1.00 76.48  ? 228 GLU C CG  1 
ATOM   6405  C  CD  . GLU C  1 207 ? 87.797  174.737 122.567 1.00 76.16  ? 228 GLU C CD  1 
ATOM   6406  O  OE1 . GLU C  1 207 ? 87.898  173.571 122.999 1.00 75.56  ? 228 GLU C OE1 1 
ATOM   6407  O  OE2 . GLU C  1 207 ? 86.791  175.480 122.913 1.00 76.46  ? 228 GLU C OE2 1 
ATOM   6408  N  N   . GLY C  1 208 ? 92.923  175.990 122.577 1.00 70.89  ? 229 GLY C N   1 
ATOM   6409  C  CA  . GLY C  1 208 ? 93.496  177.108 123.350 1.00 69.23  ? 229 GLY C CA  1 
ATOM   6410  C  C   . GLY C  1 208 ? 94.176  178.122 122.454 1.00 70.87  ? 229 GLY C C   1 
ATOM   6411  O  O   . GLY C  1 208 ? 94.083  179.312 122.732 1.00 71.76  ? 229 GLY C O   1 
ATOM   6412  N  N   . ARG C  1 209 ? 94.857  177.633 121.421 1.00 72.37  ? 230 ARG C N   1 
ATOM   6413  C  CA  . ARG C  1 209 ? 95.620  178.456 120.432 1.00 74.50  ? 230 ARG C CA  1 
ATOM   6414  C  C   . ARG C  1 209 ? 94.662  179.159 119.451 1.00 77.02  ? 230 ARG C C   1 
ATOM   6415  O  O   . ARG C  1 209 ? 94.855  180.384 119.193 1.00 77.96  ? 230 ARG C O   1 
ATOM   6416  C  CB  . ARG C  1 209 ? 96.628  177.595 119.653 1.00 75.11  ? 230 ARG C CB  1 
ATOM   6417  C  CG  . ARG C  1 209 ? 97.615  176.843 120.533 1.00 72.69  ? 230 ARG C CG  1 
ATOM   6418  C  CD  . ARG C  1 209 ? 98.690  176.112 119.763 1.00 73.49  ? 230 ARG C CD  1 
ATOM   6419  N  NE  . ARG C  1 209 ? 99.508  175.299 120.665 1.00 72.22  ? 230 ARG C NE  1 
ATOM   6420  C  CZ  . ARG C  1 209 ? 100.439 175.759 121.503 1.00 69.84  ? 230 ARG C CZ  1 
ATOM   6421  N  NH1 . ARG C  1 209 ? 101.147 174.916 122.239 1.00 67.82  ? 230 ARG C NH1 1 
ATOM   6422  N  NH2 . ARG C  1 209 ? 100.663 177.059 121.585 1.00 70.13  ? 230 ARG C NH2 1 
ATOM   6423  N  N   . GLU C  1 210 ? 93.711  178.409 118.878 1.00 78.32  ? 231 GLU C N   1 
ATOM   6424  C  CA  . GLU C  1 210 ? 92.719  178.937 117.893 1.00 81.11  ? 231 GLU C CA  1 
ATOM   6425  C  C   . GLU C  1 210 ? 91.922  180.072 118.546 1.00 79.89  ? 231 GLU C C   1 
ATOM   6426  O  O   . GLU C  1 210 ? 91.774  181.112 117.919 1.00 80.56  ? 231 GLU C O   1 
ATOM   6427  C  CB  . GLU C  1 210 ? 91.789  177.828 117.384 1.00 83.28  ? 231 GLU C CB  1 
ATOM   6428  C  CG  . GLU C  1 210 ? 92.445  176.941 116.331 1.00 85.76  ? 231 GLU C CG  1 
ATOM   6429  C  CD  . GLU C  1 210 ? 91.516  176.074 115.489 1.00 88.85  ? 231 GLU C CD  1 
ATOM   6430  O  OE1 . GLU C  1 210 ? 90.937  176.587 114.480 1.00 92.51  ? 231 GLU C OE1 1 
ATOM   6431  O  OE2 . GLU C  1 210 ? 91.377  174.880 115.829 1.00 89.11  ? 231 GLU C OE2 1 
ATOM   6432  N  N   . GLN C  1 211 ? 91.431  179.854 119.768 1.00 77.65  ? 232 GLN C N   1 
ATOM   6433  C  CA  . GLN C  1 211 ? 90.665  180.897 120.500 1.00 76.87  ? 232 GLN C CA  1 
ATOM   6434  C  C   . GLN C  1 211 ? 91.581  182.094 120.784 1.00 76.41  ? 232 GLN C C   1 
ATOM   6435  O  O   . GLN C  1 211 ? 91.108  183.228 120.671 1.00 77.37  ? 232 GLN C O   1 
ATOM   6436  C  CB  . GLN C  1 211 ? 90.029  180.304 121.759 1.00 74.56  ? 232 GLN C CB  1 
ATOM   6437  C  CG  . GLN C  1 211 ? 88.987  179.231 121.471 1.00 75.41  ? 232 GLN C CG  1 
ATOM   6438  C  CD  . GLN C  1 211 ? 87.606  179.785 121.210 1.00 76.99  ? 232 GLN C CD  1 
ATOM   6439  O  OE1 . GLN C  1 211 ? 87.091  179.729 120.098 1.00 79.27  ? 232 GLN C OE1 1 
ATOM   6440  N  NE2 . GLN C  1 211 ? 86.989  180.328 122.243 1.00 75.28  ? 232 GLN C NE2 1 
ATOM   6441  N  N   . GLY C  1 212 ? 92.844  181.845 121.136 1.00 74.54  ? 233 GLY C N   1 
ATOM   6442  C  CA  . GLY C  1 212 ? 93.806  182.924 121.426 1.00 74.88  ? 233 GLY C CA  1 
ATOM   6443  C  C   . GLY C  1 212 ? 94.048  183.793 120.197 1.00 79.09  ? 233 GLY C C   1 
ATOM   6444  O  O   . GLY C  1 212 ? 94.162  185.039 120.335 1.00 80.18  ? 233 GLY C O   1 
ATOM   6445  N  N   . LYS C  1 213 ? 94.225  183.161 119.034 1.00 81.18  ? 234 LYS C N   1 
ATOM   6446  C  CA  . LYS C  1 213 ? 94.432  183.925 117.774 1.00 85.26  ? 234 LYS C CA  1 
ATOM   6447  C  C   . LYS C  1 213 ? 93.145  184.682 117.414 1.00 86.75  ? 234 LYS C C   1 
ATOM   6448  O  O   . LYS C  1 213 ? 93.217  185.894 117.184 1.00 89.34  ? 234 LYS C O   1 
ATOM   6449  C  CB  . LYS C  1 213 ? 94.846  182.964 116.655 1.00 87.55  ? 234 LYS C CB  1 
ATOM   6450  C  CG  . LYS C  1 213 ? 95.552  183.602 115.467 1.00 91.34  ? 234 LYS C CG  1 
ATOM   6451  C  CD  . LYS C  1 213 ? 95.627  182.694 114.258 1.00 94.17  ? 234 LYS C CD  1 
ATOM   6452  C  CE  . LYS C  1 213 ? 96.953  181.981 114.111 1.00 94.68  ? 234 LYS C CE  1 
ATOM   6453  N  NZ  . LYS C  1 213 ? 97.944  182.801 113.374 1.00 98.03  ? 234 LYS C NZ  1 
ATOM   6454  N  N   . ARG C  1 214 ? 92.005  183.994 117.501 1.00 86.12  ? 235 ARG C N   1 
ATOM   6455  C  CA  . ARG C  1 214 ? 90.661  184.516 117.149 1.00 86.64  ? 235 ARG C CA  1 
ATOM   6456  C  C   . ARG C  1 214 ? 90.382  185.760 117.992 1.00 85.23  ? 235 ARG C C   1 
ATOM   6457  O  O   . ARG C  1 214 ? 89.818  186.717 117.452 1.00 86.89  ? 235 ARG C O   1 
ATOM   6458  C  CB  . ARG C  1 214 ? 89.611  183.434 117.411 1.00 86.18  ? 235 ARG C CB  1 
ATOM   6459  C  CG  . ARG C  1 214 ? 88.225  183.978 117.722 1.00 87.47  ? 235 ARG C CG  1 
ATOM   6460  C  CD  . ARG C  1 214 ? 87.154  182.905 117.764 1.00 88.19  ? 235 ARG C CD  1 
ATOM   6461  N  NE  . ARG C  1 214 ? 85.911  183.401 118.338 1.00 89.08  ? 235 ARG C NE  1 
ATOM   6462  C  CZ  . ARG C  1 214 ? 84.863  182.644 118.634 1.00 89.71  ? 235 ARG C CZ  1 
ATOM   6463  N  NH1 . ARG C  1 214 ? 84.901  181.344 118.409 1.00 88.62  ? 235 ARG C NH1 1 
ATOM   6464  N  NH2 . ARG C  1 214 ? 83.780  183.188 119.158 1.00 91.40  ? 235 ARG C NH2 1 
ATOM   6465  N  N   . PHE C  1 215 ? 90.785  185.746 119.262 1.00 81.72  ? 236 PHE C N   1 
ATOM   6466  C  CA  . PHE C  1 215 ? 90.566  186.920 120.144 1.00 80.99  ? 236 PHE C CA  1 
ATOM   6467  C  C   . PHE C  1 215 ? 91.813  187.810 120.130 1.00 80.48  ? 236 PHE C C   1 
ATOM   6468  O  O   . PHE C  1 215 ? 91.798  188.849 120.796 1.00 80.97  ? 236 PHE C O   1 
ATOM   6469  C  CB  . PHE C  1 215 ? 90.112  186.473 121.537 1.00 79.09  ? 236 PHE C CB  1 
ATOM   6470  C  CG  . PHE C  1 215 ? 88.816  185.699 121.552 1.00 80.21  ? 236 PHE C CG  1 
ATOM   6471  C  CD1 . PHE C  1 215 ? 87.606  186.335 121.327 1.00 82.73  ? 236 PHE C CD1 1 
ATOM   6472  C  CD2 . PHE C  1 215 ? 88.804  184.332 121.781 1.00 79.46  ? 236 PHE C CD2 1 
ATOM   6473  C  CE1 . PHE C  1 215 ? 86.418  185.622 121.331 1.00 83.45  ? 236 PHE C CE1 1 
ATOM   6474  C  CE2 . PHE C  1 215 ? 87.615  183.621 121.792 1.00 80.47  ? 236 PHE C CE2 1 
ATOM   6475  C  CZ  . PHE C  1 215 ? 86.423  184.267 121.564 1.00 82.54  ? 236 PHE C CZ  1 
ATOM   6476  N  N   . GLY C  1 216 ? 92.812  187.459 119.315 1.00 81.75  ? 237 GLY C N   1 
ATOM   6477  C  CA  . GLY C  1 216 ? 94.077  188.220 119.276 1.00 81.85  ? 237 GLY C CA  1 
ATOM   6478  C  C   . GLY C  1 216 ? 94.762  188.256 120.634 1.00 79.03  ? 237 GLY C C   1 
ATOM   6479  O  O   . GLY C  1 216 ? 95.076  189.357 121.116 1.00 79.22  ? 237 GLY C O   1 
ATOM   6480  N  N   . VAL C  1 217 ? 94.937  187.081 121.247 1.00 76.79  ? 238 VAL C N   1 
ATOM   6481  C  CA  . VAL C  1 217 ? 95.556  186.946 122.600 1.00 74.28  ? 238 VAL C CA  1 
ATOM   6482  C  C   . VAL C  1 217 ? 97.080  186.778 122.510 1.00 73.81  ? 238 VAL C C   1 
ATOM   6483  O  O   . VAL C  1 217 ? 97.524  185.926 121.731 1.00 75.01  ? 238 VAL C O   1 
ATOM   6484  C  CB  . VAL C  1 217 ? 94.948  185.733 123.331 1.00 73.04  ? 238 VAL C CB  1 
ATOM   6485  C  CG1 . VAL C  1 217 ? 95.404  185.653 124.779 1.00 69.96  ? 238 VAL C CG1 1 
ATOM   6486  C  CG2 . VAL C  1 217 ? 93.433  185.706 123.233 1.00 74.15  ? 238 VAL C CG2 1 
ATOM   6487  N  N   . GLU C  1 218 ? 97.817  187.523 123.341 1.00 72.25  ? 239 GLU C N   1 
ATOM   6488  C  CA  . GLU C  1 218 ? 99.297  187.413 123.440 1.00 72.24  ? 239 GLU C CA  1 
ATOM   6489  C  C   . GLU C  1 218 ? 99.629  186.345 124.494 1.00 68.98  ? 239 GLU C C   1 
ATOM   6490  O  O   . GLU C  1 218 ? 99.906  186.718 125.642 1.00 66.76  ? 239 GLU C O   1 
ATOM   6491  C  CB  . GLU C  1 218 ? 99.885  188.750 123.885 1.00 73.66  ? 239 GLU C CB  1 
ATOM   6492  C  CG  . GLU C  1 218 ? 99.464  189.920 123.023 1.00 78.51  ? 239 GLU C CG  1 
ATOM   6493  C  CD  . GLU C  1 218 ? 100.039 191.246 123.480 1.00 80.47  ? 239 GLU C CD  1 
ATOM   6494  O  OE1 . GLU C  1 218 ? 101.209 191.265 123.883 1.00 81.38  ? 239 GLU C OE1 1 
ATOM   6495  O  OE2 . GLU C  1 218 ? 99.310  192.249 123.448 1.00 83.72  ? 239 GLU C OE2 1 
ATOM   6496  N  N   . GLN C  1 219 ? 99.666  185.077 124.081 1.00 68.05  ? 240 GLN C N   1 
ATOM   6497  C  CA  . GLN C  1 219 ? 99.930  183.909 124.957 1.00 65.14  ? 240 GLN C CA  1 
ATOM   6498  C  C   . GLN C  1 219 ? 101.447 183.701 124.970 1.00 64.22  ? 240 GLN C C   1 
ATOM   6499  O  O   . GLN C  1 219 ? 101.986 183.363 123.911 1.00 65.02  ? 240 GLN C O   1 
ATOM   6500  C  CB  . GLN C  1 219 ? 99.213  182.654 124.448 1.00 65.60  ? 240 GLN C CB  1 
ATOM   6501  C  CG  . GLN C  1 219 ? 97.713  182.825 124.229 1.00 67.14  ? 240 GLN C CG  1 
ATOM   6502  C  CD  . GLN C  1 219 ? 97.087  181.579 123.640 1.00 68.22  ? 240 GLN C CD  1 
ATOM   6503  O  OE1 . GLN C  1 219 ? 97.500  181.111 122.566 1.00 70.37  ? 240 GLN C OE1 1 
ATOM   6504  N  NE2 . GLN C  1 219 ? 96.056  181.041 124.322 1.00 67.02  ? 240 GLN C NE2 1 
ATOM   6505  N  N   . TYR C  1 220 ? 102.094 183.943 126.114 1.00 62.02  ? 241 TYR C N   1 
ATOM   6506  C  CA  . TYR C  1 220 ? 103.515 183.599 126.405 1.00 61.25  ? 241 TYR C CA  1 
ATOM   6507  C  C   . TYR C  1 220 ? 103.610 182.232 127.106 1.00 58.69  ? 241 TYR C C   1 
ATOM   6508  O  O   . TYR C  1 220 ? 103.152 182.141 128.288 1.00 57.02  ? 241 TYR C O   1 
ATOM   6509  C  CB  . TYR C  1 220 ? 104.166 184.676 127.275 1.00 60.91  ? 241 TYR C CB  1 
ATOM   6510  C  CG  . TYR C  1 220 ? 104.323 186.004 126.584 1.00 62.88  ? 241 TYR C CG  1 
ATOM   6511  C  CD1 . TYR C  1 220 ? 105.430 186.253 125.802 1.00 64.89  ? 241 TYR C CD1 1 
ATOM   6512  C  CD2 . TYR C  1 220 ? 103.354 186.990 126.683 1.00 63.86  ? 241 TYR C CD2 1 
ATOM   6513  C  CE1 . TYR C  1 220 ? 105.571 187.443 125.092 1.00 67.46  ? 241 TYR C CE1 1 
ATOM   6514  C  CE2 . TYR C  1 220 ? 103.486 188.200 126.017 1.00 66.56  ? 241 TYR C CE2 1 
ATOM   6515  C  CZ  . TYR C  1 220 ? 104.610 188.427 125.236 1.00 68.05  ? 241 TYR C CZ  1 
ATOM   6516  O  OH  . TYR C  1 220 ? 104.775 189.605 124.604 1.00 71.18  ? 241 TYR C OH  1 
ATOM   6517  N  N   . GLU C  1 221 ? 104.128 181.219 126.381 1.00 58.72  ? 242 GLU C N   1 
ATOM   6518  C  CA  . GLU C  1 221 ? 104.346 179.807 126.813 1.00 57.00  ? 242 GLU C CA  1 
ATOM   6519  C  C   . GLU C  1 221 ? 105.700 179.717 127.516 1.00 55.55  ? 242 GLU C C   1 
ATOM   6520  O  O   . GLU C  1 221 ? 106.653 180.527 127.197 1.00 55.36  ? 242 GLU C O   1 
ATOM   6521  C  CB  . GLU C  1 221 ? 104.257 178.794 125.662 1.00 58.65  ? 242 GLU C CB  1 
ATOM   6522  C  CG  . GLU C  1 221 ? 102.891 178.783 124.981 1.00 60.53  ? 242 GLU C CG  1 
ATOM   6523  C  CD  . GLU C  1 221 ? 102.728 177.993 123.693 1.00 62.73  ? 242 GLU C CD  1 
ATOM   6524  O  OE1 . GLU C  1 221 ? 102.741 176.749 123.703 1.00 61.86  ? 242 GLU C OE1 1 
ATOM   6525  O  OE2 . GLU C  1 221 ? 102.561 178.646 122.657 1.00 67.62  ? 242 GLU C OE2 1 
ATOM   6526  N  N   . MET C  1 222 ? 105.784 178.849 128.525 1.00 54.05  ? 243 MET C N   1 
ATOM   6527  C  CA  . MET C  1 222 ? 107.006 178.735 129.366 1.00 53.58  ? 243 MET C CA  1 
ATOM   6528  C  C   . MET C  1 222 ? 108.158 178.240 128.502 1.00 55.02  ? 243 MET C C   1 
ATOM   6529  O  O   . MET C  1 222 ? 109.303 178.361 128.910 1.00 56.22  ? 243 MET C O   1 
ATOM   6530  C  CB  . MET C  1 222 ? 106.790 177.800 130.557 1.00 51.51  ? 243 MET C CB  1 
ATOM   6531  C  CG  . MET C  1 222 ? 106.012 178.451 131.661 1.00 50.61  ? 243 MET C CG  1 
ATOM   6532  S  SD  . MET C  1 222 ? 106.774 179.956 132.254 1.00 51.77  ? 243 MET C SD  1 
ATOM   6533  C  CE  . MET C  1 222 ? 108.317 179.333 132.906 1.00 49.98  ? 243 MET C CE  1 
ATOM   6534  N  N   . ARG C  1 223 ? 107.792 177.647 127.379 1.00 56.77  ? 244 ARG C N   1 
ATOM   6535  C  CA  . ARG C  1 223 ? 108.702 177.082 126.359 1.00 59.02  ? 244 ARG C CA  1 
ATOM   6536  C  C   . ARG C  1 223 ? 109.666 178.190 125.916 1.00 60.44  ? 244 ARG C C   1 
ATOM   6537  O  O   . ARG C  1 223 ? 110.839 177.883 125.699 1.00 61.30  ? 244 ARG C O   1 
ATOM   6538  C  CB  . ARG C  1 223 ? 107.817 176.735 125.162 1.00 62.31  ? 244 ARG C CB  1 
ATOM   6539  C  CG  . ARG C  1 223 ? 107.892 175.294 124.688 1.00 64.26  ? 244 ARG C CG  1 
ATOM   6540  C  CD  . ARG C  1 223 ? 106.657 174.969 123.873 1.00 66.72  ? 244 ARG C CD  1 
ATOM   6541  N  NE  . ARG C  1 223 ? 105.975 176.150 123.366 1.00 68.32  ? 244 ARG C NE  1 
ATOM   6542  C  CZ  . ARG C  1 223 ? 105.814 176.445 122.082 1.00 72.71  ? 244 ARG C CZ  1 
ATOM   6543  N  NH1 . ARG C  1 223 ? 105.177 177.549 121.731 1.00 74.37  ? 244 ARG C NH1 1 
ATOM   6544  N  NH2 . ARG C  1 223 ? 106.284 175.638 121.150 1.00 73.89  ? 244 ARG C NH2 1 
ATOM   6545  N  N   . THR C  1 224 ? 109.159 179.415 125.789 1.00 60.31  ? 245 THR C N   1 
ATOM   6546  C  CA  . THR C  1 224 ? 109.945 180.573 125.296 1.00 61.66  ? 245 THR C CA  1 
ATOM   6547  C  C   . THR C  1 224 ? 110.272 181.540 126.436 1.00 60.38  ? 245 THR C C   1 
ATOM   6548  O  O   . THR C  1 224 ? 110.702 182.662 126.137 1.00 61.34  ? 245 THR C O   1 
ATOM   6549  C  CB  . THR C  1 224 ? 109.181 181.257 124.158 1.00 63.97  ? 245 THR C CB  1 
ATOM   6550  O  OG1 . THR C  1 224 ? 107.997 181.836 124.699 1.00 64.03  ? 245 THR C OG1 1 
ATOM   6551  C  CG2 . THR C  1 224 ? 108.779 180.289 123.070 1.00 65.32  ? 245 THR C CG2 1 
ATOM   6552  N  N   . PHE C  1 225 ? 110.122 181.104 127.688 1.00 58.76  ? 246 PHE C N   1 
ATOM   6553  C  CA  . PHE C  1 225 ? 110.356 182.010 128.843 1.00 58.56  ? 246 PHE C CA  1 
ATOM   6554  C  C   . PHE C  1 225 ? 111.798 182.532 128.893 1.00 60.55  ? 246 PHE C C   1 
ATOM   6555  O  O   . PHE C  1 225 ? 111.982 183.671 129.334 1.00 62.87  ? 246 PHE C O   1 
ATOM   6556  C  CB  . PHE C  1 225 ? 109.901 181.401 130.172 1.00 56.00  ? 246 PHE C CB  1 
ATOM   6557  C  CG  . PHE C  1 225 ? 109.991 182.363 131.328 1.00 55.51  ? 246 PHE C CG  1 
ATOM   6558  C  CD1 . PHE C  1 225 ? 109.155 183.462 131.400 1.00 56.22  ? 246 PHE C CD1 1 
ATOM   6559  C  CD2 . PHE C  1 225 ? 110.926 182.184 132.332 1.00 54.81  ? 246 PHE C CD2 1 
ATOM   6560  C  CE1 . PHE C  1 225 ? 109.246 184.356 132.452 1.00 56.14  ? 246 PHE C CE1 1 
ATOM   6561  C  CE2 . PHE C  1 225 ? 111.012 183.075 133.389 1.00 54.24  ? 246 PHE C CE2 1 
ATOM   6562  C  CZ  . PHE C  1 225 ? 110.173 184.160 133.445 1.00 55.27  ? 246 PHE C CZ  1 
ATOM   6563  N  N   . SER C  1 226 ? 112.774 181.718 128.485 1.00 61.33  ? 247 SER C N   1 
ATOM   6564  C  CA  . SER C  1 226 ? 114.194 182.157 128.488 1.00 62.68  ? 247 SER C CA  1 
ATOM   6565  C  C   . SER C  1 226 ? 114.318 183.447 127.672 1.00 64.74  ? 247 SER C C   1 
ATOM   6566  O  O   . SER C  1 226 ? 114.867 184.428 128.196 1.00 65.99  ? 247 SER C O   1 
ATOM   6567  C  CB  . SER C  1 226 ? 115.089 181.092 127.927 1.00 63.19  ? 247 SER C CB  1 
ATOM   6568  O  OG  . SER C  1 226 ? 114.895 179.865 128.599 1.00 61.16  ? 247 SER C OG  1 
ATOM   6569  N  N   . LYS C  1 227 ? 113.876 183.397 126.413 1.00 65.93  ? 248 LYS C N   1 
ATOM   6570  C  CA  . LYS C  1 227 ? 113.882 184.566 125.498 1.00 68.18  ? 248 LYS C CA  1 
ATOM   6571  C  C   . LYS C  1 227 ? 112.907 185.644 125.989 1.00 67.31  ? 248 LYS C C   1 
ATOM   6572  O  O   . LYS C  1 227 ? 113.292 186.820 126.003 1.00 68.45  ? 248 LYS C O   1 
ATOM   6573  C  CB  . LYS C  1 227 ? 113.456 184.108 124.100 1.00 71.22  ? 248 LYS C CB  1 
ATOM   6574  C  CG  . LYS C  1 227 ? 113.341 185.214 123.059 1.00 75.62  ? 248 LYS C CG  1 
ATOM   6575  C  CD  . LYS C  1 227 ? 113.039 184.728 121.656 1.00 78.94  ? 248 LYS C CD  1 
ATOM   6576  C  CE  . LYS C  1 227 ? 111.561 184.559 121.375 1.00 79.76  ? 248 LYS C CE  1 
ATOM   6577  N  NZ  . LYS C  1 227 ? 111.143 183.138 121.378 1.00 76.28  ? 248 LYS C NZ  1 
ATOM   6578  N  N   . ASP C  1 228 ? 111.709 185.230 126.412 1.00 64.51  ? 249 ASP C N   1 
ATOM   6579  C  CA  . ASP C  1 228 ? 110.608 186.139 126.839 1.00 65.04  ? 249 ASP C CA  1 
ATOM   6580  C  C   . ASP C  1 228 ? 110.893 186.944 128.110 1.00 64.49  ? 249 ASP C C   1 
ATOM   6581  O  O   . ASP C  1 228 ? 110.311 188.028 128.207 1.00 67.30  ? 249 ASP C O   1 
ATOM   6582  C  CB  . ASP C  1 228 ? 109.253 185.439 126.873 1.00 63.47  ? 249 ASP C CB  1 
ATOM   6583  C  CG  . ASP C  1 228 ? 108.723 185.112 125.493 1.00 65.35  ? 249 ASP C CG  1 
ATOM   6584  O  OD1 . ASP C  1 228 ? 109.209 185.713 124.519 1.00 67.32  ? 249 ASP C OD1 1 
ATOM   6585  O  OD2 . ASP C  1 228 ? 107.839 184.255 125.409 1.00 64.39  ? 249 ASP C OD2 1 
ATOM   6586  N  N   . ARG C  1 229 ? 111.619 186.372 129.079 1.00 63.69  ? 250 ARG C N   1 
ATOM   6587  C  CA  . ARG C  1 229 ? 111.916 187.011 130.397 1.00 62.35  ? 250 ARG C CA  1 
ATOM   6588  C  C   . ARG C  1 229 ? 112.147 188.522 130.282 1.00 64.94  ? 250 ARG C C   1 
ATOM   6589  O  O   . ARG C  1 229 ? 111.376 189.260 130.898 1.00 64.96  ? 250 ARG C O   1 
ATOM   6590  C  CB  . ARG C  1 229 ? 113.077 186.329 131.127 1.00 60.40  ? 250 ARG C CB  1 
ATOM   6591  C  CG  . ARG C  1 229 ? 113.404 186.982 132.462 1.00 59.20  ? 250 ARG C CG  1 
ATOM   6592  C  CD  . ARG C  1 229 ? 114.566 186.386 133.232 1.00 58.03  ? 250 ARG C CD  1 
ATOM   6593  N  NE  . ARG C  1 229 ? 114.302 185.048 133.737 1.00 55.95  ? 250 ARG C NE  1 
ATOM   6594  C  CZ  . ARG C  1 229 ? 113.804 184.781 134.939 1.00 54.04  ? 250 ARG C CZ  1 
ATOM   6595  N  NH1 . ARG C  1 229 ? 113.512 185.764 135.771 1.00 53.85  ? 250 ARG C NH1 1 
ATOM   6596  N  NH2 . ARG C  1 229 ? 113.604 183.530 135.309 1.00 51.91  ? 250 ARG C NH2 1 
ATOM   6597  N  N   . PRO C  1 230 ? 113.148 189.016 129.521 1.00 68.18  ? 251 PRO C N   1 
ATOM   6598  C  CA  . PRO C  1 230 ? 113.382 190.462 129.391 1.00 71.91  ? 251 PRO C CA  1 
ATOM   6599  C  C   . PRO C  1 230 ? 112.116 191.260 129.029 1.00 74.44  ? 251 PRO C C   1 
ATOM   6600  O  O   . PRO C  1 230 ? 111.891 192.280 129.633 1.00 77.29  ? 251 PRO C O   1 
ATOM   6601  C  CB  . PRO C  1 230 ? 114.429 190.544 128.274 1.00 73.96  ? 251 PRO C CB  1 
ATOM   6602  C  CG  . PRO C  1 230 ? 115.177 189.240 128.388 1.00 72.44  ? 251 PRO C CG  1 
ATOM   6603  C  CD  . PRO C  1 230 ? 114.123 188.225 128.775 1.00 69.05  ? 251 PRO C CD  1 
ATOM   6604  N  N   . MET C  1 231 ? 111.369 190.808 128.018 1.00 76.20  ? 252 MET C N   1 
ATOM   6605  C  CA  . MET C  1 231 ? 110.099 191.467 127.611 1.00 78.41  ? 252 MET C CA  1 
ATOM   6606  C  C   . MET C  1 231 ? 109.073 191.330 128.741 1.00 74.03  ? 252 MET C C   1 
ATOM   6607  O  O   . MET C  1 231 ? 108.437 192.330 129.085 1.00 73.80  ? 252 MET C O   1 
ATOM   6608  C  CB  . MET C  1 231 ? 109.518 190.776 126.374 1.00 82.75  ? 252 MET C CB  1 
ATOM   6609  C  CG  . MET C  1 231 ? 108.551 191.626 125.571 1.00 91.38  ? 252 MET C CG  1 
ATOM   6610  S  SD  . MET C  1 231 ? 107.878 193.053 126.455 1.00 99.07  ? 252 MET C SD  1 
ATOM   6611  C  CE  . MET C  1 231 ? 106.699 193.658 125.250 1.00 101.61 ? 252 MET C CE  1 
ATOM   6612  N  N   . LEU C  1 232 ? 108.969 190.129 129.320 1.00 69.32  ? 253 LEU C N   1 
ATOM   6613  C  CA  . LEU C  1 232 ? 107.991 189.824 130.404 1.00 65.42  ? 253 LEU C CA  1 
ATOM   6614  C  C   . LEU C  1 232 ? 108.314 190.604 131.680 1.00 63.75  ? 253 LEU C C   1 
ATOM   6615  O  O   . LEU C  1 232 ? 107.382 190.921 132.424 1.00 63.80  ? 253 LEU C O   1 
ATOM   6616  C  CB  . LEU C  1 232 ? 107.898 188.314 130.626 1.00 63.35  ? 253 LEU C CB  1 
ATOM   6617  C  CG  . LEU C  1 232 ? 107.220 187.562 129.484 1.00 64.25  ? 253 LEU C CG  1 
ATOM   6618  C  CD1 . LEU C  1 232 ? 107.121 186.078 129.775 1.00 62.01  ? 253 LEU C CD1 1 
ATOM   6619  C  CD2 . LEU C  1 232 ? 105.847 188.144 129.199 1.00 65.04  ? 253 LEU C CD2 1 
ATOM   6620  N  N   . GLU C  1 233 ? 109.595 190.891 131.912 1.00 63.63  ? 254 GLU C N   1 
ATOM   6621  C  CA  . GLU C  1 233 ? 110.062 191.636 133.111 1.00 64.13  ? 254 GLU C CA  1 
ATOM   6622  C  C   . GLU C  1 233 ? 110.152 193.132 132.807 1.00 67.53  ? 254 GLU C C   1 
ATOM   6623  O  O   . GLU C  1 233 ? 110.778 193.842 133.595 1.00 68.49  ? 254 GLU C O   1 
ATOM   6624  C  CB  . GLU C  1 233 ? 111.413 191.105 133.579 1.00 63.82  ? 254 GLU C CB  1 
ATOM   6625  C  CG  . GLU C  1 233 ? 111.330 189.684 134.088 1.00 61.59  ? 254 GLU C CG  1 
ATOM   6626  C  CD  . GLU C  1 233 ? 112.466 189.299 135.008 1.00 61.01  ? 254 GLU C CD  1 
ATOM   6627  O  OE1 . GLU C  1 233 ? 113.253 190.184 135.371 1.00 62.41  ? 254 GLU C OE1 1 
ATOM   6628  O  OE2 . GLU C  1 233 ? 112.563 188.115 135.352 1.00 59.21  ? 254 GLU C OE2 1 
ATOM   6629  N  N   . ASN C  1 234 ? 109.638 193.552 131.651 1.00 69.40  ? 255 ASN C N   1 
ATOM   6630  C  CA  . ASN C  1 234 ? 109.591 194.979 131.247 1.00 73.18  ? 255 ASN C CA  1 
ATOM   6631  C  C   . ASN C  1 234 ? 108.253 195.190 130.543 1.00 73.53  ? 255 ASN C C   1 
ATOM   6632  O  O   . ASN C  1 234 ? 108.256 195.696 129.405 1.00 74.84  ? 255 ASN C O   1 
ATOM   6633  C  CB  . ASN C  1 234 ? 110.764 195.354 130.341 1.00 76.15  ? 255 ASN C CB  1 
ATOM   6634  C  CG  . ASN C  1 234 ? 112.088 195.350 131.073 1.00 77.05  ? 255 ASN C CG  1 
ATOM   6635  O  OD1 . ASN C  1 234 ? 112.419 196.309 131.761 1.00 79.22  ? 255 ASN C OD1 1 
ATOM   6636  N  ND2 . ASN C  1 234 ? 112.845 194.273 130.936 1.00 77.35  ? 255 ASN C ND2 1 
ATOM   6637  N  N   . LEU C  1 235 ? 107.153 194.825 131.207 1.00 70.48  ? 256 LEU C N   1 
ATOM   6638  C  CA  . LEU C  1 235 ? 105.833 194.959 130.535 1.00 71.54  ? 256 LEU C CA  1 
ATOM   6639  C  C   . LEU C  1 235 ? 105.209 196.334 130.800 1.00 73.42  ? 256 LEU C C   1 
ATOM   6640  O  O   . LEU C  1 235 ? 105.486 196.924 131.852 1.00 73.41  ? 256 LEU C O   1 
ATOM   6641  C  CB  . LEU C  1 235 ? 104.892 193.841 130.987 1.00 68.69  ? 256 LEU C CB  1 
ATOM   6642  C  CG  . LEU C  1 235 ? 105.031 192.510 130.254 1.00 67.56  ? 256 LEU C CG  1 
ATOM   6643  C  CD1 . LEU C  1 235 ? 104.105 191.471 130.863 1.00 65.28  ? 256 LEU C CD1 1 
ATOM   6644  C  CD2 . LEU C  1 235 ? 104.737 192.669 128.772 1.00 69.65  ? 256 LEU C CD2 1 
ATOM   6645  N  N   . LYS C  1 236 ? 104.487 196.848 129.805 1.00 75.93  ? 257 LYS C N   1 
ATOM   6646  C  CA  . LYS C  1 236 ? 103.709 198.110 129.910 1.00 77.54  ? 257 LYS C CA  1 
ATOM   6647  C  C   . LYS C  1 236 ? 102.321 197.813 129.340 1.00 76.47  ? 257 LYS C C   1 
ATOM   6648  O  O   . LYS C  1 236 ? 102.252 197.294 128.218 1.00 78.36  ? 257 LYS C O   1 
ATOM   6649  C  CB  . LYS C  1 236 ? 104.425 199.272 129.218 1.00 81.54  ? 257 LYS C CB  1 
ATOM   6650  C  CG  . LYS C  1 236 ? 105.635 199.800 129.975 1.00 82.59  ? 257 LYS C CG  1 
ATOM   6651  C  CD  . LYS C  1 236 ? 105.612 201.298 130.177 1.00 86.59  ? 257 LYS C CD  1 
ATOM   6652  C  CE  . LYS C  1 236 ? 106.411 201.741 131.382 1.00 86.82  ? 257 LYS C CE  1 
ATOM   6653  N  NZ  . LYS C  1 236 ? 106.015 203.096 131.834 1.00 87.59  ? 257 LYS C NZ  1 
ATOM   6654  N  N   . LEU C  1 237 ? 101.246 198.166 130.046 1.00 73.79  ? 258 LEU C N   1 
ATOM   6655  C  CA  . LEU C  1 237 ? 99.899  197.834 129.511 1.00 72.74  ? 258 LEU C CA  1 
ATOM   6656  C  C   . LEU C  1 237 ? 98.889  198.946 129.807 1.00 73.31  ? 258 LEU C C   1 
ATOM   6657  O  O   . LEU C  1 237 ? 99.215  199.870 130.578 1.00 74.58  ? 258 LEU C O   1 
ATOM   6658  C  CB  . LEU C  1 237 ? 99.421  196.517 130.130 1.00 69.86  ? 258 LEU C CB  1 
ATOM   6659  C  CG  . LEU C  1 237 ? 100.075 195.238 129.613 1.00 68.59  ? 258 LEU C CG  1 
ATOM   6660  C  CD1 . LEU C  1 237 ? 99.801  194.084 130.563 1.00 65.89  ? 258 LEU C CD1 1 
ATOM   6661  C  CD2 . LEU C  1 237 ? 99.576  194.892 128.222 1.00 70.07  ? 258 LEU C CD2 1 
ATOM   6662  N  N   . GLY C  1 238 ? 97.734  198.868 129.144 1.00 72.92  ? 259 GLY C N   1 
ATOM   6663  C  CA  . GLY C  1 238 ? 96.599  199.775 129.391 1.00 73.65  ? 259 GLY C CA  1 
ATOM   6664  C  C   . GLY C  1 238 ? 96.614  201.095 128.641 1.00 76.27  ? 259 GLY C C   1 
ATOM   6665  O  O   . GLY C  1 238 ? 95.697  201.885 128.889 1.00 77.24  ? 259 GLY C O   1 
ATOM   6666  N  N   . GLU C  1 239 ? 97.584  201.342 127.757 1.00 77.28  ? 260 GLU C N   1 
ATOM   6667  C  CA  . GLU C  1 239 ? 97.559  202.646 127.042 1.00 80.57  ? 260 GLU C CA  1 
ATOM   6668  C  C   . GLU C  1 239 ? 96.410  202.615 126.029 1.00 82.11  ? 260 GLU C C   1 
ATOM   6669  O  O   . GLU C  1 239 ? 96.408  201.729 125.172 1.00 83.04  ? 260 GLU C O   1 
ATOM   6670  C  CB  . GLU C  1 239 ? 98.913  202.944 126.398 1.00 82.05  ? 260 GLU C CB  1 
ATOM   6671  C  CG  . GLU C  1 239 ? 100.004 203.259 127.405 1.00 81.02  ? 260 GLU C CG  1 
ATOM   6672  C  CD  . GLU C  1 239 ? 99.553  204.077 128.601 1.00 80.58  ? 260 GLU C CD  1 
ATOM   6673  O  OE1 . GLU C  1 239 ? 99.169  205.238 128.408 1.00 82.97  ? 260 GLU C OE1 1 
ATOM   6674  O  OE2 . GLU C  1 239 ? 99.571  203.541 129.721 1.00 77.43  ? 260 GLU C OE2 1 
ATOM   6675  N  N   . GLY C  1 240 ? 95.511  203.598 126.099 1.00 83.16  ? 261 GLY C N   1 
ATOM   6676  C  CA  . GLY C  1 240 ? 94.342  203.645 125.202 1.00 85.24  ? 261 GLY C CA  1 
ATOM   6677  C  C   . GLY C  1 240 ? 93.144  202.881 125.743 1.00 83.68  ? 261 GLY C C   1 
ATOM   6678  O  O   . GLY C  1 240 ? 92.165  202.725 124.988 1.00 84.48  ? 261 GLY C O   1 
ATOM   6679  N  N   . VAL C  1 241 ? 93.206  202.422 126.999 1.00 81.55  ? 262 VAL C N   1 
ATOM   6680  C  CA  . VAL C  1 241 ? 92.066  201.663 127.604 1.00 80.84  ? 262 VAL C CA  1 
ATOM   6681  C  C   . VAL C  1 241 ? 91.734  202.184 129.007 1.00 80.28  ? 262 VAL C C   1 
ATOM   6682  O  O   . VAL C  1 241 ? 92.478  203.037 129.520 1.00 81.20  ? 262 VAL C O   1 
ATOM   6683  C  CB  . VAL C  1 241 ? 92.218  200.133 127.540 1.00 78.99  ? 262 VAL C CB  1 
ATOM   6684  C  CG1 . VAL C  1 241 ? 91.619  199.573 126.260 1.00 80.55  ? 262 VAL C CG1 1 
ATOM   6685  C  CG2 . VAL C  1 241 ? 93.657  199.688 127.706 1.00 76.53  ? 262 VAL C CG2 1 
ATOM   6686  N  N   . LYS C  1 242 ? 90.622  201.692 129.562 1.00 79.07  ? 263 LYS C N   1 
ATOM   6687  C  CA  . LYS C  1 242 ? 90.044  202.140 130.833 1.00 78.20  ? 263 LYS C CA  1 
ATOM   6688  C  C   . LYS C  1 242 ? 91.033  201.732 131.923 1.00 75.99  ? 263 LYS C C   1 
ATOM   6689  O  O   . LYS C  1 242 ? 91.162  202.497 132.948 1.00 76.21  ? 263 LYS C O   1 
ATOM   6690  C  CB  . LYS C  1 242 ? 88.614  201.590 130.921 1.00 77.55  ? 263 LYS C CB  1 
ATOM   6691  C  CG  . LYS C  1 242 ? 87.644  202.282 129.973 1.00 79.99  ? 263 LYS C CG  1 
ATOM   6692  C  CD  . LYS C  1 242 ? 87.558  203.742 130.294 1.00 81.92  ? 263 LYS C CD  1 
ATOM   6693  C  CE  . LYS C  1 242 ? 86.439  204.462 129.579 1.00 84.69  ? 263 LYS C CE  1 
ATOM   6694  N  NZ  . LYS C  1 242 ? 86.687  205.920 129.531 1.00 86.97  ? 263 LYS C NZ  1 
ATOM   6695  N  N   . GLY C  1 243 ? 91.716  200.606 131.713 1.00 74.20  ? 264 GLY C N   1 
ATOM   6696  C  CA  . GLY C  1 243 ? 92.694  200.135 132.705 1.00 71.53  ? 264 GLY C CA  1 
ATOM   6697  C  C   . GLY C  1 243 ? 93.275  198.776 132.375 1.00 69.58  ? 264 GLY C C   1 
ATOM   6698  O  O   . GLY C  1 243 ? 93.053  198.266 131.264 1.00 70.29  ? 264 GLY C O   1 
ATOM   6699  N  N   . VAL C  1 244 ? 94.019  198.255 133.348 1.00 68.08  ? 265 VAL C N   1 
ATOM   6700  C  CA  . VAL C  1 244 ? 94.713  196.933 133.381 1.00 65.59  ? 265 VAL C CA  1 
ATOM   6701  C  C   . VAL C  1 244 ? 94.239  196.136 134.607 1.00 63.60  ? 265 VAL C C   1 
ATOM   6702  O  O   . VAL C  1 244 ? 94.409  196.587 135.799 1.00 62.71  ? 265 VAL C O   1 
ATOM   6703  C  CB  . VAL C  1 244 ? 96.233  197.084 133.386 1.00 65.49  ? 265 VAL C CB  1 
ATOM   6704  C  CG1 . VAL C  1 244 ? 96.884  195.727 133.412 1.00 64.01  ? 265 VAL C CG1 1 
ATOM   6705  C  CG2 . VAL C  1 244 ? 96.728  197.896 132.201 1.00 68.19  ? 265 VAL C CG2 1 
ATOM   6706  N  N   . TYR C  1 245 ? 93.688  194.965 134.286 1.00 62.49  ? 266 TYR C N   1 
ATOM   6707  C  CA  . TYR C  1 245 ? 93.239  193.906 135.203 1.00 60.76  ? 266 TYR C CA  1 
ATOM   6708  C  C   . TYR C  1 245 ? 94.356  192.847 135.222 1.00 58.84  ? 266 TYR C C   1 
ATOM   6709  O  O   . TYR C  1 245 ? 94.848  192.482 134.115 1.00 58.95  ? 266 TYR C O   1 
ATOM   6710  C  CB  . TYR C  1 245 ? 91.860  193.394 134.760 1.00 61.37  ? 266 TYR C CB  1 
ATOM   6711  C  CG  . TYR C  1 245 ? 91.190  192.535 135.798 1.00 59.93  ? 266 TYR C CG  1 
ATOM   6712  C  CD1 . TYR C  1 245 ? 91.609  191.226 136.012 1.00 58.26  ? 266 TYR C CD1 1 
ATOM   6713  C  CD2 . TYR C  1 245 ? 90.199  193.041 136.624 1.00 60.33  ? 266 TYR C CD2 1 
ATOM   6714  C  CE1 . TYR C  1 245 ? 91.036  190.437 136.997 1.00 57.18  ? 266 TYR C CE1 1 
ATOM   6715  C  CE2 . TYR C  1 245 ? 89.631  192.262 137.626 1.00 59.63  ? 266 TYR C CE2 1 
ATOM   6716  C  CZ  . TYR C  1 245 ? 90.038  190.950 137.810 1.00 57.99  ? 266 TYR C CZ  1 
ATOM   6717  O  OH  . TYR C  1 245 ? 89.476  190.176 138.791 1.00 57.64  ? 266 TYR C OH  1 
ATOM   6718  N  N   . ILE C  1 246 ? 94.752  192.447 136.438 1.00 56.81  ? 267 ILE C N   1 
ATOM   6719  C  CA  . ILE C  1 246 ? 95.716  191.349 136.756 1.00 54.64  ? 267 ILE C CA  1 
ATOM   6720  C  C   . ILE C  1 246 ? 94.946  190.170 137.352 1.00 52.71  ? 267 ILE C C   1 
ATOM   6721  O  O   . ILE C  1 246 ? 94.447  190.313 138.494 1.00 52.71  ? 267 ILE C O   1 
ATOM   6722  C  CB  . ILE C  1 246 ? 96.793  191.847 137.726 1.00 54.15  ? 267 ILE C CB  1 
ATOM   6723  C  CG1 . ILE C  1 246 ? 97.433  193.140 137.206 1.00 56.13  ? 267 ILE C CG1 1 
ATOM   6724  C  CG2 . ILE C  1 246 ? 97.837  190.754 137.930 1.00 52.82  ? 267 ILE C CG2 1 
ATOM   6725  C  CD1 . ILE C  1 246 ? 98.491  193.749 138.106 1.00 55.98  ? 267 ILE C CD1 1 
ATOM   6726  N  N   . SER C  1 247 ? 94.916  189.091 136.600 1.00 51.93  ? 268 SER C N   1 
ATOM   6727  C  CA  . SER C  1 247 ? 94.290  187.856 137.083 1.00 51.00  ? 268 SER C CA  1 
ATOM   6728  C  C   . SER C  1 247 ? 95.384  186.834 137.387 1.00 49.39  ? 268 SER C C   1 
ATOM   6729  O  O   . SER C  1 247 ? 95.945  186.291 136.444 1.00 49.90  ? 268 SER C O   1 
ATOM   6730  C  CB  . SER C  1 247 ? 93.267  187.332 136.141 1.00 51.84  ? 268 SER C CB  1 
ATOM   6731  O  OG  . SER C  1 247 ? 92.669  186.169 136.651 1.00 50.93  ? 268 SER C OG  1 
ATOM   6732  N  N   . ILE C  1 248 ? 95.689  186.627 138.668 1.00 47.91  ? 269 ILE C N   1 
ATOM   6733  C  CA  . ILE C  1 248 ? 96.773  185.670 139.021 1.00 46.62  ? 269 ILE C CA  1 
ATOM   6734  C  C   . ILE C  1 248 ? 96.199  184.338 139.476 1.00 46.05  ? 269 ILE C C   1 
ATOM   6735  O  O   . ILE C  1 248 ? 95.690  184.269 140.573 1.00 45.72  ? 269 ILE C O   1 
ATOM   6736  C  CB  . ILE C  1 248 ? 97.695  186.242 140.103 1.00 45.53  ? 269 ILE C CB  1 
ATOM   6737  C  CG1 . ILE C  1 248 ? 98.058  187.694 139.823 1.00 46.69  ? 269 ILE C CG1 1 
ATOM   6738  C  CG2 . ILE C  1 248 ? 98.922  185.376 140.256 1.00 44.27  ? 269 ILE C CG2 1 
ATOM   6739  C  CD1 . ILE C  1 248 ? 99.276  188.145 140.530 1.00 46.21  ? 269 ILE C CD1 1 
ATOM   6740  N  N   . ASP C  1 249 ? 96.253  183.352 138.587 1.00 46.45  ? 270 ASP C N   1 
ATOM   6741  C  CA  . ASP C  1 249 ? 95.931  181.972 139.000 1.00 45.99  ? 270 ASP C CA  1 
ATOM   6742  C  C   . ASP C  1 249 ? 97.204  181.536 139.717 1.00 44.83  ? 270 ASP C C   1 
ATOM   6743  O  O   . ASP C  1 249 ? 98.292  181.733 139.154 1.00 45.75  ? 270 ASP C O   1 
ATOM   6744  C  CB  . ASP C  1 249 ? 95.658  181.056 137.815 1.00 46.77  ? 270 ASP C CB  1 
ATOM   6745  C  CG  . ASP C  1 249 ? 95.372  179.635 138.241 1.00 45.75  ? 270 ASP C CG  1 
ATOM   6746  O  OD1 . ASP C  1 249 ? 95.732  179.293 139.377 1.00 45.33  ? 270 ASP C OD1 1 
ATOM   6747  O  OD2 . ASP C  1 249 ? 94.851  178.869 137.422 1.00 45.20  ? 270 ASP C OD2 1 
ATOM   6748  N  N   . VAL C  1 250 ? 97.062  180.922 140.888 1.00 44.25  ? 271 VAL C N   1 
ATOM   6749  C  CA  . VAL C  1 250 ? 98.189  180.516 141.775 1.00 43.29  ? 271 VAL C CA  1 
ATOM   6750  C  C   . VAL C  1 250 ? 99.097  179.484 141.106 1.00 43.24  ? 271 VAL C C   1 
ATOM   6751  O  O   . VAL C  1 250 ? 100.277 179.580 141.314 1.00 43.96  ? 271 VAL C O   1 
ATOM   6752  C  CB  . VAL C  1 250 ? 97.672  180.106 143.164 1.00 42.69  ? 271 VAL C CB  1 
ATOM   6753  C  CG1 . VAL C  1 250 ? 98.607  179.144 143.860 1.00 42.14  ? 271 VAL C CG1 1 
ATOM   6754  C  CG2 . VAL C  1 250 ? 97.445  181.334 144.015 1.00 42.85  ? 271 VAL C CG2 1 
ATOM   6755  N  N   . ASP C  1 251 ? 98.567  178.664 140.189 1.00 44.10  ? 272 ASP C N   1 
ATOM   6756  C  CA  . ASP C  1 251 ? 99.333  177.639 139.428 1.00 43.83  ? 272 ASP C CA  1 
ATOM   6757  C  C   . ASP C  1 251 ? 100.254 178.240 138.340 1.00 44.42  ? 272 ASP C C   1 
ATOM   6758  O  O   . ASP C  1 251 ? 100.865 177.444 137.628 1.00 44.06  ? 272 ASP C O   1 
ATOM   6759  C  CB  . ASP C  1 251 ? 98.411  176.531 138.923 1.00 45.54  ? 272 ASP C CB  1 
ATOM   6760  C  CG  . ASP C  1 251 ? 97.517  176.974 137.787 1.00 47.50  ? 272 ASP C CG  1 
ATOM   6761  O  OD1 . ASP C  1 251 ? 97.866  177.958 137.139 1.00 46.98  ? 272 ASP C OD1 1 
ATOM   6762  O  OD2 . ASP C  1 251 ? 96.495  176.321 137.562 1.00 51.07  ? 272 ASP C OD2 1 
ATOM   6763  N  N   . CYS C  1 252 ? 100.274 179.561 138.130 1.00 44.30  ? 273 CYS C N   1 
ATOM   6764  C  CA  . CYS C  1 252 ? 101.275 180.168 137.235 1.00 44.51  ? 273 CYS C CA  1 
ATOM   6765  C  C   . CYS C  1 252 ? 102.643 179.760 137.807 1.00 42.11  ? 273 CYS C C   1 
ATOM   6766  O  O   . CYS C  1 252 ? 103.522 179.471 137.025 1.00 41.91  ? 273 CYS C O   1 
ATOM   6767  C  CB  . CYS C  1 252 ? 101.087 181.678 137.134 1.00 45.42  ? 273 CYS C CB  1 
ATOM   6768  S  SG  . CYS C  1 252 ? 101.572 182.645 138.577 1.00 44.87  ? 273 CYS C SG  1 
ATOM   6769  N  N   . LEU C  1 253 ? 102.744 179.675 139.138 1.00 40.26  ? 274 LEU C N   1 
ATOM   6770  C  CA  . LEU C  1 253 ? 103.938 179.227 139.883 1.00 38.60  ? 274 LEU C CA  1 
ATOM   6771  C  C   . LEU C  1 253 ? 104.118 177.733 139.681 1.00 37.35  ? 274 LEU C C   1 
ATOM   6772  O  O   . LEU C  1 253 ? 103.146 176.996 139.741 1.00 36.97  ? 274 LEU C O   1 
ATOM   6773  C  CB  . LEU C  1 253 ? 103.720 179.539 141.358 1.00 37.64  ? 274 LEU C CB  1 
ATOM   6774  C  CG  . LEU C  1 253 ? 103.688 181.027 141.681 1.00 38.23  ? 274 LEU C CG  1 
ATOM   6775  C  CD1 . LEU C  1 253 ? 103.153 181.246 143.083 1.00 37.51  ? 274 LEU C CD1 1 
ATOM   6776  C  CD2 . LEU C  1 253 ? 105.071 181.633 141.545 1.00 38.36  ? 274 LEU C CD2 1 
ATOM   6777  N  N   . ASP C  1 254 ? 105.351 177.308 139.491 1.00 37.17  ? 275 ASP C N   1 
ATOM   6778  C  CA  . ASP C  1 254 ? 105.698 175.865 139.588 1.00 36.44  ? 275 ASP C CA  1 
ATOM   6779  C  C   . ASP C  1 254 ? 105.036 175.310 140.842 1.00 35.17  ? 275 ASP C C   1 
ATOM   6780  O  O   . ASP C  1 254 ? 104.937 175.940 141.891 1.00 34.74  ? 275 ASP C O   1 
ATOM   6781  C  CB  . ASP C  1 254 ? 107.210 175.653 139.514 1.00 35.97  ? 275 ASP C CB  1 
ATOM   6782  C  CG  . ASP C  1 254 ? 107.557 174.220 139.201 1.00 35.80  ? 275 ASP C CG  1 
ATOM   6783  O  OD1 . ASP C  1 254 ? 107.467 173.358 140.126 1.00 34.85  ? 275 ASP C OD1 1 
ATOM   6784  O  OD2 . ASP C  1 254 ? 107.843 173.976 138.020 1.00 36.49  ? 275 ASP C OD2 1 
ATOM   6785  N  N   . PRO C  1 255 ? 104.467 174.107 140.780 1.00 35.35  ? 276 PRO C N   1 
ATOM   6786  C  CA  . PRO C  1 255 ? 103.967 173.475 142.001 1.00 34.33  ? 276 PRO C CA  1 
ATOM   6787  C  C   . PRO C  1 255 ? 104.990 173.377 143.146 1.00 33.06  ? 276 PRO C C   1 
ATOM   6788  O  O   . PRO C  1 255 ? 104.556 173.299 144.260 1.00 32.64  ? 276 PRO C O   1 
ATOM   6789  C  CB  . PRO C  1 255 ? 103.538 172.086 141.528 1.00 34.89  ? 276 PRO C CB  1 
ATOM   6790  C  CG  . PRO C  1 255 ? 104.085 171.941 140.129 1.00 35.74  ? 276 PRO C CG  1 
ATOM   6791  C  CD  . PRO C  1 255 ? 104.171 173.348 139.555 1.00 36.27  ? 276 PRO C CD  1 
ATOM   6792  N  N   . ALA C  1 256 ? 106.297 173.419 142.877 1.00 32.64  ? 277 ALA C N   1 
ATOM   6793  C  CA  . ALA C  1 256 ? 107.338 173.425 143.932 1.00 31.55  ? 277 ALA C CA  1 
ATOM   6794  C  C   . ALA C  1 256 ? 107.079 174.575 144.905 1.00 31.42  ? 277 ALA C C   1 
ATOM   6795  O  O   . ALA C  1 256 ? 107.294 174.369 146.090 1.00 30.57  ? 277 ALA C O   1 
ATOM   6796  C  CB  . ALA C  1 256 ? 108.697 173.558 143.314 1.00 31.46  ? 277 ALA C CB  1 
ATOM   6797  N  N   . PHE C  1 257 ? 106.655 175.752 144.390 1.00 32.04  ? 278 PHE C N   1 
ATOM   6798  C  CA  . PHE C  1 257 ? 106.374 176.987 145.186 1.00 32.02  ? 278 PHE C CA  1 
ATOM   6799  C  C   . PHE C  1 257 ? 104.933 177.030 145.652 1.00 32.67  ? 278 PHE C C   1 
ATOM   6800  O  O   . PHE C  1 257 ? 104.676 177.517 146.732 1.00 33.06  ? 278 PHE C O   1 
ATOM   6801  C  CB  . PHE C  1 257 ? 106.629 178.244 144.355 1.00 32.63  ? 278 PHE C CB  1 
ATOM   6802  C  CG  . PHE C  1 257 ? 108.022 178.285 143.803 1.00 31.99  ? 278 PHE C CG  1 
ATOM   6803  C  CD1 . PHE C  1 257 ? 109.075 178.656 144.613 1.00 31.40  ? 278 PHE C CD1 1 
ATOM   6804  C  CD2 . PHE C  1 257 ? 108.277 177.825 142.533 1.00 32.31  ? 278 PHE C CD2 1 
ATOM   6805  C  CE1 . PHE C  1 257 ? 110.368 178.593 144.156 1.00 31.39  ? 278 PHE C CE1 1 
ATOM   6806  C  CE2 . PHE C  1 257 ? 109.582 177.796 142.056 1.00 32.38  ? 278 PHE C CE2 1 
ATOM   6807  C  CZ  . PHE C  1 257 ? 110.612 178.182 142.874 1.00 31.99  ? 278 PHE C CZ  1 
ATOM   6808  N  N   . ALA C  1 258 ? 104.015 176.504 144.859 1.00 33.81  ? 279 ALA C N   1 
ATOM   6809  C  CA  . ALA C  1 258 ? 102.552 176.590 145.082 1.00 34.74  ? 279 ALA C CA  1 
ATOM   6810  C  C   . ALA C  1 258 ? 101.900 175.213 144.892 1.00 35.35  ? 279 ALA C C   1 
ATOM   6811  O  O   . ALA C  1 258 ? 101.201 174.988 143.865 1.00 36.42  ? 279 ALA C O   1 
ATOM   6812  C  CB  . ALA C  1 258 ? 101.995 177.618 144.106 1.00 35.85  ? 279 ALA C CB  1 
ATOM   6813  N  N   . PRO C  1 259 ? 102.079 174.235 145.841 1.00 35.73  ? 280 PRO C N   1 
ATOM   6814  C  CA  . PRO C  1 259 ? 101.476 172.917 145.655 1.00 36.33  ? 280 PRO C CA  1 
ATOM   6815  C  C   . PRO C  1 259 ? 99.894  172.966 145.692 1.00 39.19  ? 280 PRO C C   1 
ATOM   6816  O  O   . PRO C  1 259 ? 99.230  172.029 145.229 1.00 42.99  ? 280 PRO C O   1 
ATOM   6817  C  CB  . PRO C  1 259 ? 102.094 172.005 146.747 1.00 35.47  ? 280 PRO C CB  1 
ATOM   6818  C  CG  . PRO C  1 259 ? 102.706 172.981 147.737 1.00 34.81  ? 280 PRO C CG  1 
ATOM   6819  C  CD  . PRO C  1 259 ? 103.048 174.246 146.955 1.00 34.73  ? 280 PRO C CD  1 
ATOM   6820  N  N   . GLY C  1 260 ? 99.428  173.924 146.483 1.00 40.06  ? 281 GLY C N   1 
ATOM   6821  C  CA  . GLY C  1 260 ? 98.022  174.058 146.887 1.00 40.41  ? 281 GLY C CA  1 
ATOM   6822  C  C   . GLY C  1 260 ? 97.163  174.659 145.811 1.00 41.79  ? 281 GLY C C   1 
ATOM   6823  O  O   . GLY C  1 260 ? 96.636  175.713 145.986 1.00 44.01  ? 281 GLY C O   1 
ATOM   6824  N  N   . VAL C  1 261 ? 97.000  173.875 144.771 1.00 41.32  ? 282 VAL C N   1 
ATOM   6825  C  CA  . VAL C  1 261 ? 96.170  174.161 143.555 1.00 41.46  ? 282 VAL C CA  1 
ATOM   6826  C  C   . VAL C  1 261 ? 95.516  172.868 143.088 1.00 42.12  ? 282 VAL C C   1 
ATOM   6827  O  O   . VAL C  1 261 ? 95.931  171.761 143.575 1.00 41.68  ? 282 VAL C O   1 
ATOM   6828  C  CB  . VAL C  1 261 ? 97.100  174.756 142.481 1.00 41.63  ? 282 VAL C CB  1 
ATOM   6829  C  CG1 . VAL C  1 261 ? 97.676  176.099 142.953 1.00 41.05  ? 282 VAL C CG1 1 
ATOM   6830  C  CG2 . VAL C  1 261 ? 98.208  173.755 142.131 1.00 40.95  ? 282 VAL C CG2 1 
ATOM   6831  N  N   . SER C  1 262 ? 94.466  172.980 142.259 1.00 43.27  ? 283 SER C N   1 
ATOM   6832  C  CA  . SER C  1 262 ? 93.718  171.805 141.762 1.00 44.52  ? 283 SER C CA  1 
ATOM   6833  C  C   . SER C  1 262 ? 94.444  171.206 140.551 1.00 45.02  ? 283 SER C C   1 
ATOM   6834  O  O   . SER C  1 262 ? 94.288  170.013 140.308 1.00 46.54  ? 283 SER C O   1 
ATOM   6835  C  CB  . SER C  1 262 ? 92.308  172.152 141.475 1.00 45.88  ? 283 SER C CB  1 
ATOM   6836  O  OG  . SER C  1 262 ? 91.665  172.824 142.567 1.00 45.69  ? 283 SER C OG  1 
ATOM   6837  N  N   . HIS C  1 263 ? 95.235  172.011 139.862 1.00 45.36  ? 284 HIS C N   1 
ATOM   6838  C  CA  . HIS C  1 263 ? 95.956  171.513 138.666 1.00 46.64  ? 284 HIS C CA  1 
ATOM   6839  C  C   . HIS C  1 263 ? 97.468  171.662 138.847 1.00 44.62  ? 284 HIS C C   1 
ATOM   6840  O  O   . HIS C  1 263 ? 97.974  172.766 138.679 1.00 44.30  ? 284 HIS C O   1 
ATOM   6841  C  CB  . HIS C  1 263 ? 95.416  172.205 137.405 1.00 48.18  ? 284 HIS C CB  1 
ATOM   6842  C  CG  . HIS C  1 263 ? 93.934  172.141 137.296 1.00 50.91  ? 284 HIS C CG  1 
ATOM   6843  N  ND1 . HIS C  1 263 ? 93.295  171.101 136.690 1.00 53.16  ? 284 HIS C ND1 1 
ATOM   6844  C  CD2 . HIS C  1 263 ? 92.973  172.967 137.740 1.00 52.09  ? 284 HIS C CD2 1 
ATOM   6845  C  CE1 . HIS C  1 263 ? 92.009  171.300 136.750 1.00 54.73  ? 284 HIS C CE1 1 
ATOM   6846  N  NE2 . HIS C  1 263 ? 91.792  172.423 137.381 1.00 53.87  ? 284 HIS C NE2 1 
ATOM   6847  N  N   . ILE C  1 264 ? 98.123  170.557 139.189 1.00 44.04  ? 285 ILE C N   1 
ATOM   6848  C  CA  . ILE C  1 264 ? 99.603  170.473 139.326 1.00 43.12  ? 285 ILE C CA  1 
ATOM   6849  C  C   . ILE C  1 264 ? 100.136 170.430 137.898 1.00 44.08  ? 285 ILE C C   1 
ATOM   6850  O  O   . ILE C  1 264 ? 99.780  169.460 137.185 1.00 45.15  ? 285 ILE C O   1 
ATOM   6851  C  CB  . ILE C  1 264 ? 100.039 169.268 140.164 1.00 42.26  ? 285 ILE C CB  1 
ATOM   6852  C  CG1 . ILE C  1 264 ? 99.427  169.339 141.565 1.00 42.76  ? 285 ILE C CG1 1 
ATOM   6853  C  CG2 . ILE C  1 264 ? 101.552 169.141 140.233 1.00 41.09  ? 285 ILE C CG2 1 
ATOM   6854  C  CD1 . ILE C  1 264 ? 99.685  170.661 142.277 1.00 42.59  ? 285 ILE C CD1 1 
ATOM   6855  N  N   . GLU C  1 265 ? 100.848 171.486 137.496 1.00 43.56  ? 286 GLU C N   1 
ATOM   6856  C  CA  . GLU C  1 265 ? 101.454 171.591 136.131 1.00 44.43  ? 286 GLU C CA  1 
ATOM   6857  C  C   . GLU C  1 265 ? 102.942 171.980 136.267 1.00 42.60  ? 286 GLU C C   1 
ATOM   6858  O  O   . GLU C  1 265 ? 103.329 173.153 136.389 1.00 43.06  ? 286 GLU C O   1 
ATOM   6859  C  CB  . GLU C  1 265 ? 100.605 172.509 135.262 1.00 45.72  ? 286 GLU C CB  1 
ATOM   6860  C  CG  . GLU C  1 265 ? 100.963 172.381 133.805 1.00 47.89  ? 286 GLU C CG  1 
ATOM   6861  C  CD  . GLU C  1 265 ? 100.602 171.080 133.104 1.00 49.60  ? 286 GLU C CD  1 
ATOM   6862  O  OE1 . GLU C  1 265 ? 99.499  170.504 133.427 1.00 50.37  ? 286 GLU C OE1 1 
ATOM   6863  O  OE2 . GLU C  1 265 ? 101.433 170.654 132.208 1.00 50.14  ? 286 GLU C OE2 1 
ATOM   6864  N  N   . PRO C  1 266 ? 103.841 170.974 136.275 1.00 41.23  ? 287 PRO C N   1 
ATOM   6865  C  CA  . PRO C  1 266 ? 105.291 171.220 136.370 1.00 40.25  ? 287 PRO C CA  1 
ATOM   6866  C  C   . PRO C  1 266 ? 105.878 172.157 135.305 1.00 41.31  ? 287 PRO C C   1 
ATOM   6867  O  O   . PRO C  1 266 ? 105.322 172.277 134.214 1.00 42.36  ? 287 PRO C O   1 
ATOM   6868  C  CB  . PRO C  1 266 ? 105.893 169.820 136.200 1.00 40.18  ? 287 PRO C CB  1 
ATOM   6869  C  CG  . PRO C  1 266 ? 104.808 168.875 136.674 1.00 40.18  ? 287 PRO C CG  1 
ATOM   6870  C  CD  . PRO C  1 266 ? 103.513 169.537 136.234 1.00 41.08  ? 287 PRO C CD  1 
ATOM   6871  N  N   . GLY C  1 267 ? 106.979 172.826 135.647 1.00 40.65  ? 288 GLY C N   1 
ATOM   6872  C  CA  . GLY C  1 267 ? 107.656 173.762 134.728 1.00 41.66  ? 288 GLY C CA  1 
ATOM   6873  C  C   . GLY C  1 267 ? 107.067 175.163 134.761 1.00 42.34  ? 288 GLY C C   1 
ATOM   6874  O  O   . GLY C  1 267 ? 106.979 175.858 133.702 1.00 44.05  ? 288 GLY C O   1 
ATOM   6875  N  N   . GLY C  1 268 ? 106.820 175.639 135.965 1.00 41.65  ? 289 GLY C N   1 
ATOM   6876  C  CA  . GLY C  1 268 ? 106.190 176.945 136.234 1.00 42.52  ? 289 GLY C CA  1 
ATOM   6877  C  C   . GLY C  1 268 ? 107.221 178.085 136.489 1.00 43.14  ? 289 GLY C C   1 
ATOM   6878  O  O   . GLY C  1 268 ? 108.451 177.880 136.288 1.00 43.50  ? 289 GLY C O   1 
ATOM   6879  N  N   . LEU C  1 269 ? 106.654 179.240 136.889 1.00 43.13  ? 290 LEU C N   1 
ATOM   6880  C  CA  . LEU C  1 269 ? 107.455 180.412 137.367 1.00 42.95  ? 290 LEU C CA  1 
ATOM   6881  C  C   . LEU C  1 269 ? 107.882 180.160 138.803 1.00 40.55  ? 290 LEU C C   1 
ATOM   6882  O  O   . LEU C  1 269 ? 107.138 179.451 139.544 1.00 39.03  ? 290 LEU C O   1 
ATOM   6883  C  CB  . LEU C  1 269 ? 106.595 181.674 137.260 1.00 44.27  ? 290 LEU C CB  1 
ATOM   6884  C  CG  . LEU C  1 269 ? 106.120 182.017 135.841 1.00 46.01  ? 290 LEU C CG  1 
ATOM   6885  C  CD1 . LEU C  1 269 ? 104.976 183.011 135.887 1.00 46.73  ? 290 LEU C CD1 1 
ATOM   6886  C  CD2 . LEU C  1 269 ? 107.252 182.560 135.001 1.00 47.34  ? 290 LEU C CD2 1 
ATOM   6887  N  N   . SER C  1 270 ? 108.989 180.779 139.212 1.00 40.03  ? 291 SER C N   1 
ATOM   6888  C  CA  . SER C  1 270 ? 109.326 180.922 140.656 1.00 38.91  ? 291 SER C CA  1 
ATOM   6889  C  C   . SER C  1 270 ? 108.535 182.091 141.259 1.00 39.50  ? 291 SER C C   1 
ATOM   6890  O  O   . SER C  1 270 ? 107.957 182.916 140.504 1.00 40.91  ? 291 SER C O   1 
ATOM   6891  C  CB  . SER C  1 270 ? 110.779 181.118 140.854 1.00 38.78  ? 291 SER C CB  1 
ATOM   6892  O  OG  . SER C  1 270 ? 111.164 182.401 140.374 1.00 40.33  ? 291 SER C OG  1 
ATOM   6893  N  N   . PHE C  1 271 ? 108.439 182.173 142.581 1.00 39.01  ? 292 PHE C N   1 
ATOM   6894  C  CA  . PHE C  1 271 ? 107.707 183.306 143.207 1.00 39.17  ? 292 PHE C CA  1 
ATOM   6895  C  C   . PHE C  1 271 ? 108.477 184.592 142.876 1.00 40.50  ? 292 PHE C C   1 
ATOM   6896  O  O   . PHE C  1 271 ? 107.884 185.627 142.662 1.00 41.06  ? 292 PHE C O   1 
ATOM   6897  C  CB  . PHE C  1 271 ? 107.588 183.147 144.714 1.00 38.23  ? 292 PHE C CB  1 
ATOM   6898  C  CG  . PHE C  1 271 ? 106.594 184.091 145.344 1.00 38.94  ? 292 PHE C CG  1 
ATOM   6899  C  CD1 . PHE C  1 271 ? 106.989 185.332 145.813 1.00 39.64  ? 292 PHE C CD1 1 
ATOM   6900  C  CD2 . PHE C  1 271 ? 105.268 183.721 145.491 1.00 38.65  ? 292 PHE C CD2 1 
ATOM   6901  C  CE1 . PHE C  1 271 ? 106.091 186.198 146.398 1.00 40.07  ? 292 PHE C CE1 1 
ATOM   6902  C  CE2 . PHE C  1 271 ? 104.370 184.589 146.084 1.00 39.29  ? 292 PHE C CE2 1 
ATOM   6903  C  CZ  . PHE C  1 271 ? 104.783 185.829 146.523 1.00 40.03  ? 292 PHE C CZ  1 
ATOM   6904  N  N   . ARG C  1 272 ? 109.799 184.520 142.834 1.00 40.55  ? 293 ARG C N   1 
ATOM   6905  C  CA  . ARG C  1 272 ? 110.618 185.727 142.578 1.00 42.34  ? 293 ARG C CA  1 
ATOM   6906  C  C   . ARG C  1 272 ? 110.386 186.147 141.120 1.00 44.55  ? 293 ARG C C   1 
ATOM   6907  O  O   . ARG C  1 272 ? 110.362 187.328 140.846 1.00 46.19  ? 293 ARG C O   1 
ATOM   6908  C  CB  . ARG C  1 272 ? 112.091 185.496 142.927 1.00 41.63  ? 293 ARG C CB  1 
ATOM   6909  C  CG  . ARG C  1 272 ? 112.996 186.710 142.717 1.00 43.11  ? 293 ARG C CG  1 
ATOM   6910  C  CD  . ARG C  1 272 ? 112.540 187.955 143.470 1.00 43.74  ? 293 ARG C CD  1 
ATOM   6911  N  NE  . ARG C  1 272 ? 112.205 187.724 144.874 1.00 42.33  ? 293 ARG C NE  1 
ATOM   6912  C  CZ  . ARG C  1 272 ? 111.572 188.566 145.699 1.00 42.67  ? 293 ARG C CZ  1 
ATOM   6913  N  NH1 . ARG C  1 272 ? 111.139 189.755 145.287 1.00 43.98  ? 293 ARG C NH1 1 
ATOM   6914  N  NH2 . ARG C  1 272 ? 111.376 188.188 146.956 1.00 41.40  ? 293 ARG C NH2 1 
ATOM   6915  N  N   . ASP C  1 273 ? 110.229 185.208 140.199 1.00 45.20  ? 294 ASP C N   1 
ATOM   6916  C  CA  . ASP C  1 273 ? 109.956 185.556 138.784 1.00 47.11  ? 294 ASP C CA  1 
ATOM   6917  C  C   . ASP C  1 273 ? 108.647 186.382 138.764 1.00 48.01  ? 294 ASP C C   1 
ATOM   6918  O  O   . ASP C  1 273 ? 108.541 187.372 138.002 1.00 49.65  ? 294 ASP C O   1 
ATOM   6919  C  CB  . ASP C  1 273 ? 109.778 184.304 137.919 1.00 47.18  ? 294 ASP C CB  1 
ATOM   6920  C  CG  . ASP C  1 273 ? 111.000 183.454 137.615 1.00 47.12  ? 294 ASP C CG  1 
ATOM   6921  O  OD1 . ASP C  1 273 ? 112.128 184.022 137.574 1.00 48.38  ? 294 ASP C OD1 1 
ATOM   6922  O  OD2 . ASP C  1 273 ? 110.790 182.230 137.350 1.00 46.88  ? 294 ASP C OD2 1 
ATOM   6923  N  N   . VAL C  1 274 ? 107.670 185.991 139.577 1.00 46.41  ? 295 VAL C N   1 
ATOM   6924  C  CA  . VAL C  1 274 ? 106.334 186.632 139.546 1.00 46.65  ? 295 VAL C CA  1 
ATOM   6925  C  C   . VAL C  1 274 ? 106.499 188.028 140.130 1.00 47.01  ? 295 VAL C C   1 
ATOM   6926  O  O   . VAL C  1 274 ? 106.067 188.961 139.470 1.00 48.94  ? 295 VAL C O   1 
ATOM   6927  C  CB  . VAL C  1 274 ? 105.260 185.771 140.215 1.00 45.66  ? 295 VAL C CB  1 
ATOM   6928  C  CG1 . VAL C  1 274 ? 103.984 186.551 140.514 1.00 46.84  ? 295 VAL C CG1 1 
ATOM   6929  C  CG2 . VAL C  1 274 ? 104.951 184.596 139.315 1.00 45.33  ? 295 VAL C CG2 1 
ATOM   6930  N  N   . LEU C  1 275 ? 107.249 188.186 141.204 1.00 45.58  ? 296 LEU C N   1 
ATOM   6931  C  CA  . LEU C  1 275 ? 107.484 189.528 141.771 1.00 46.44  ? 296 LEU C CA  1 
ATOM   6932  C  C   . LEU C  1 275 ? 108.279 190.386 140.763 1.00 48.57  ? 296 LEU C C   1 
ATOM   6933  O  O   . LEU C  1 275 ? 107.989 191.564 140.685 1.00 50.80  ? 296 LEU C O   1 
ATOM   6934  C  CB  . LEU C  1 275 ? 108.142 189.402 143.146 1.00 45.02  ? 296 LEU C CB  1 
ATOM   6935  C  CG  . LEU C  1 275 ? 107.236 188.872 144.288 1.00 43.61  ? 296 LEU C CG  1 
ATOM   6936  C  CD1 . LEU C  1 275 ? 107.820 189.221 145.628 1.00 43.31  ? 296 LEU C CD1 1 
ATOM   6937  C  CD2 . LEU C  1 275 ? 105.819 189.415 144.232 1.00 44.14  ? 296 LEU C CD2 1 
ATOM   6938  N  N   . ASN C  1 276 ? 109.226 189.840 139.991 1.00 48.61  ? 297 ASN C N   1 
ATOM   6939  C  CA  . ASN C  1 276 ? 110.013 190.633 139.010 1.00 50.84  ? 297 ASN C CA  1 
ATOM   6940  C  C   . ASN C  1 276 ? 109.030 191.250 138.009 1.00 52.26  ? 297 ASN C C   1 
ATOM   6941  O  O   . ASN C  1 276 ? 109.137 192.427 137.764 1.00 54.42  ? 297 ASN C O   1 
ATOM   6942  C  CB  . ASN C  1 276 ? 111.109 189.813 138.322 1.00 50.76  ? 297 ASN C CB  1 
ATOM   6943  C  CG  . ASN C  1 276 ? 112.270 189.484 139.253 1.00 49.65  ? 297 ASN C CG  1 
ATOM   6944  O  OD1 . ASN C  1 276 ? 112.269 189.903 140.397 1.00 49.27  ? 297 ASN C OD1 1 
ATOM   6945  N  ND2 . ASN C  1 276 ? 113.269 188.752 138.778 1.00 49.35  ? 297 ASN C ND2 1 
ATOM   6946  N  N   . ILE C  1 277 ? 108.064 190.468 137.548 1.00 51.52  ? 298 ILE C N   1 
ATOM   6947  C  CA  . ILE C  1 277 ? 107.065 190.868 136.537 1.00 53.29  ? 298 ILE C CA  1 
ATOM   6948  C  C   . ILE C  1 277 ? 106.141 191.921 137.146 1.00 53.93  ? 298 ILE C C   1 
ATOM   6949  O  O   . ILE C  1 277 ? 105.971 192.978 136.480 1.00 55.91  ? 298 ILE C O   1 
ATOM   6950  C  CB  . ILE C  1 277 ? 106.277 189.645 136.043 1.00 52.77  ? 298 ILE C CB  1 
ATOM   6951  C  CG1 . ILE C  1 277 ? 107.169 188.615 135.339 1.00 52.79  ? 298 ILE C CG1 1 
ATOM   6952  C  CG2 . ILE C  1 277 ? 105.117 190.102 135.153 1.00 53.94  ? 298 ILE C CG2 1 
ATOM   6953  C  CD1 . ILE C  1 277 ? 106.440 187.328 135.028 1.00 51.79  ? 298 ILE C CD1 1 
ATOM   6954  N  N   . LEU C  1 278 ? 105.548 191.638 138.323 1.00 52.28  ? 299 LEU C N   1 
ATOM   6955  C  CA  . LEU C  1 278 ? 104.592 192.543 139.025 1.00 52.95  ? 299 LEU C CA  1 
ATOM   6956  C  C   . LEU C  1 278 ? 105.291 193.842 139.390 1.00 54.47  ? 299 LEU C C   1 
ATOM   6957  O  O   . LEU C  1 278 ? 104.699 194.863 139.078 1.00 56.18  ? 299 LEU C O   1 
ATOM   6958  C  CB  . LEU C  1 278 ? 104.020 191.949 140.315 1.00 51.30  ? 299 LEU C CB  1 
ATOM   6959  C  CG  . LEU C  1 278 ? 103.045 190.798 140.124 1.00 50.50  ? 299 LEU C CG  1 
ATOM   6960  C  CD1 . LEU C  1 278 ? 102.462 190.352 141.465 1.00 49.60  ? 299 LEU C CD1 1 
ATOM   6961  C  CD2 . LEU C  1 278 ? 101.956 191.167 139.142 1.00 51.94  ? 299 LEU C CD2 1 
ATOM   6962  N  N   . HIS C  1 279 ? 106.457 193.795 140.041 1.00 53.99  ? 300 HIS C N   1 
ATOM   6963  C  CA  . HIS C  1 279 ? 107.187 195.019 140.460 1.00 56.17  ? 300 HIS C CA  1 
ATOM   6964  C  C   . HIS C  1 279 ? 107.493 195.900 139.224 1.00 59.53  ? 300 HIS C C   1 
ATOM   6965  O  O   . HIS C  1 279 ? 107.497 197.134 139.392 1.00 61.17  ? 300 HIS C O   1 
ATOM   6966  C  CB  . HIS C  1 279 ? 108.461 194.686 141.242 1.00 55.06  ? 300 HIS C CB  1 
ATOM   6967  C  CG  . HIS C  1 279 ? 108.244 194.229 142.648 1.00 53.59  ? 300 HIS C CG  1 
ATOM   6968  N  ND1 . HIS C  1 279 ? 109.259 193.656 143.402 1.00 52.38  ? 300 HIS C ND1 1 
ATOM   6969  C  CD2 . HIS C  1 279 ? 107.144 194.216 143.440 1.00 52.65  ? 300 HIS C CD2 1 
ATOM   6970  C  CE1 . HIS C  1 279 ? 108.818 193.384 144.611 1.00 51.03  ? 300 HIS C CE1 1 
ATOM   6971  N  NE2 . HIS C  1 279 ? 107.510 193.681 144.652 1.00 51.26  ? 300 HIS C NE2 1 
ATOM   6972  N  N   . ASN C  1 280 ? 107.726 195.315 138.036 1.00 60.54  ? 301 ASN C N   1 
ATOM   6973  C  CA  . ASN C  1 280 ? 108.282 196.074 136.873 1.00 65.01  ? 301 ASN C CA  1 
ATOM   6974  C  C   . ASN C  1 280 ? 107.166 196.587 135.962 1.00 66.56  ? 301 ASN C C   1 
ATOM   6975  O  O   . ASN C  1 280 ? 107.408 197.571 135.312 1.00 69.55  ? 301 ASN C O   1 
ATOM   6976  C  CB  . ASN C  1 280 ? 109.291 195.276 136.033 1.00 65.24  ? 301 ASN C CB  1 
ATOM   6977  C  CG  . ASN C  1 280 ? 110.626 195.104 136.731 1.00 65.59  ? 301 ASN C CG  1 
ATOM   6978  O  OD1 . ASN C  1 280 ? 110.807 195.558 137.862 1.00 66.46  ? 301 ASN C OD1 1 
ATOM   6979  N  ND2 . ASN C  1 280 ? 111.555 194.417 136.083 1.00 66.29  ? 301 ASN C ND2 1 
ATOM   6980  N  N   . LEU C  1 281 ? 106.028 195.896 135.913 1.00 60.55  ? 302 LEU C N   1 
ATOM   6981  C  CA  . LEU C  1 281 ? 104.862 196.170 135.032 1.00 61.27  ? 302 LEU C CA  1 
ATOM   6982  C  C   . LEU C  1 281 ? 104.395 197.588 135.263 1.00 62.54  ? 302 LEU C C   1 
ATOM   6983  O  O   . LEU C  1 281 ? 103.971 197.890 136.404 1.00 60.94  ? 302 LEU C O   1 
ATOM   6984  C  CB  . LEU C  1 281 ? 103.720 195.211 135.399 1.00 59.55  ? 302 LEU C CB  1 
ATOM   6985  C  CG  . LEU C  1 281 ? 102.331 195.541 134.836 1.00 60.33  ? 302 LEU C CG  1 
ATOM   6986  C  CD1 . LEU C  1 281 ? 102.317 195.595 133.302 1.00 62.40  ? 302 LEU C CD1 1 
ATOM   6987  C  CD2 . LEU C  1 281 ? 101.332 194.511 135.328 1.00 58.25  ? 302 LEU C CD2 1 
ATOM   6988  N  N   . GLN C  1 282 ? 104.385 198.400 134.219 1.00 65.93  ? 303 GLN C N   1 
ATOM   6989  C  CA  . GLN C  1 282 ? 103.716 199.716 134.333 1.00 68.39  ? 303 GLN C CA  1 
ATOM   6990  C  C   . GLN C  1 282 ? 102.312 199.604 133.733 1.00 68.37  ? 303 GLN C C   1 
ATOM   6991  O  O   . GLN C  1 282 ? 102.151 199.180 132.562 1.00 70.10  ? 303 GLN C O   1 
ATOM   6992  C  CB  . GLN C  1 282 ? 104.642 200.835 133.871 1.00 72.03  ? 303 GLN C CB  1 
ATOM   6993  C  CG  . GLN C  1 282 ? 105.227 201.576 135.084 1.00 72.62  ? 303 GLN C CG  1 
ATOM   6994  C  CD  . GLN C  1 282 ? 104.167 202.285 135.913 1.00 71.69  ? 303 GLN C CD  1 
ATOM   6995  O  OE1 . GLN C  1 282 ? 103.352 201.666 136.627 1.00 65.86  ? 303 GLN C OE1 1 
ATOM   6996  N  NE2 . GLN C  1 282 ? 104.148 203.618 135.750 1.00 74.09  ? 303 GLN C NE2 1 
ATOM   6997  N  N   . ALA C  1 283 ? 101.349 199.920 134.595 1.00 67.53  ? 304 ALA C N   1 
ATOM   6998  C  CA  . ALA C  1 283 ? 99.887  199.795 134.409 1.00 67.30  ? 304 ALA C CA  1 
ATOM   6999  C  C   . ALA C  1 283 ? 99.209  200.786 135.350 1.00 67.60  ? 304 ALA C C   1 
ATOM   7000  O  O   . ALA C  1 283 ? 99.778  201.106 136.423 1.00 67.71  ? 304 ALA C O   1 
ATOM   7001  C  CB  . ALA C  1 283 ? 99.435  198.388 134.715 1.00 65.29  ? 304 ALA C CB  1 
ATOM   7002  N  N   . ASP C  1 284 ? 98.078  201.312 134.906 1.00 68.68  ? 305 ASP C N   1 
ATOM   7003  C  CA  . ASP C  1 284 ? 96.999  201.815 135.782 1.00 68.06  ? 305 ASP C CA  1 
ATOM   7004  C  C   . ASP C  1 284 ? 96.207  200.574 136.195 1.00 64.99  ? 305 ASP C C   1 
ATOM   7005  O  O   . ASP C  1 284 ? 95.329  200.234 135.415 1.00 65.18  ? 305 ASP C O   1 
ATOM   7006  C  CB  . ASP C  1 284 ? 96.174  202.863 135.021 1.00 70.39  ? 305 ASP C CB  1 
ATOM   7007  C  CG  . ASP C  1 284 ? 95.053  203.459 135.853 1.00 71.21  ? 305 ASP C CG  1 
ATOM   7008  O  OD1 . ASP C  1 284 ? 95.018  203.082 137.090 1.00 70.50  ? 305 ASP C OD1 1 
ATOM   7009  O  OD2 . ASP C  1 284 ? 94.199  204.237 135.274 1.00 72.91  ? 305 ASP C OD2 1 
ATOM   7010  N  N   . VAL C  1 285 ? 96.566  199.916 137.305 1.00 63.05  ? 306 VAL C N   1 
ATOM   7011  C  CA  . VAL C  1 285 ? 95.819  198.692 137.714 1.00 60.49  ? 306 VAL C CA  1 
ATOM   7012  C  C   . VAL C  1 285 ? 94.540  199.160 138.386 1.00 62.15  ? 306 VAL C C   1 
ATOM   7013  O  O   . VAL C  1 285 ? 94.584  199.913 139.357 1.00 63.85  ? 306 VAL C O   1 
ATOM   7014  C  CB  . VAL C  1 285 ? 96.617  197.731 138.616 1.00 58.96  ? 306 VAL C CB  1 
ATOM   7015  C  CG1 . VAL C  1 285 ? 95.853  196.440 138.870 1.00 57.06  ? 306 VAL C CG1 1 
ATOM   7016  C  CG2 . VAL C  1 285 ? 97.990  197.430 138.058 1.00 58.15  ? 306 VAL C CG2 1 
ATOM   7017  N  N   . VAL C  1 286 ? 93.450  198.710 137.802 1.00 63.33  ? 307 VAL C N   1 
ATOM   7018  C  CA  . VAL C  1 286 ? 92.037  199.018 138.196 1.00 64.97  ? 307 VAL C CA  1 
ATOM   7019  C  C   . VAL C  1 286 ? 91.433  197.806 138.944 1.00 63.39  ? 307 VAL C C   1 
ATOM   7020  O  O   . VAL C  1 286 ? 90.415  198.015 139.631 1.00 65.67  ? 307 VAL C O   1 
ATOM   7021  C  CB  . VAL C  1 286 ? 91.152  199.450 137.001 1.00 67.45  ? 307 VAL C CB  1 
ATOM   7022  C  CG1 . VAL C  1 286 ? 91.678  200.711 136.318 1.00 69.64  ? 307 VAL C CG1 1 
ATOM   7023  C  CG2 . VAL C  1 286 ? 90.958  198.345 135.963 1.00 66.89  ? 307 VAL C CG2 1 
ATOM   7024  N  N   . GLY C  1 287 ? 91.981  196.589 138.822 1.00 60.59  ? 308 GLY C N   1 
ATOM   7025  C  CA  . GLY C  1 287 ? 91.365  195.406 139.465 1.00 59.37  ? 308 GLY C CA  1 
ATOM   7026  C  C   . GLY C  1 287 ? 92.208  194.170 139.311 1.00 57.05  ? 308 GLY C C   1 
ATOM   7027  O  O   . GLY C  1 287 ? 92.884  194.051 138.294 1.00 58.07  ? 308 GLY C O   1 
ATOM   7028  N  N   . ALA C  1 288 ? 92.187  193.300 140.309 1.00 55.68  ? 309 ALA C N   1 
ATOM   7029  C  CA  . ALA C  1 288 ? 93.116  192.159 140.434 1.00 53.35  ? 309 ALA C CA  1 
ATOM   7030  C  C   . ALA C  1 288 ? 92.400  191.064 141.201 1.00 53.29  ? 309 ALA C C   1 
ATOM   7031  O  O   . ALA C  1 288 ? 91.641  191.391 142.138 1.00 58.24  ? 309 ALA C O   1 
ATOM   7032  C  CB  . ALA C  1 288 ? 94.428  192.544 141.084 1.00 50.90  ? 309 ALA C CB  1 
ATOM   7033  N  N   . ASP C  1 289 ? 92.628  189.822 140.783 1.00 50.46  ? 310 ASP C N   1 
ATOM   7034  C  CA  . ASP C  1 289 ? 92.153  188.615 141.466 1.00 47.19  ? 310 ASP C CA  1 
ATOM   7035  C  C   . ASP C  1 289 ? 93.384  187.768 141.735 1.00 44.57  ? 310 ASP C C   1 
ATOM   7036  O  O   . ASP C  1 289 ? 94.406  187.968 141.049 1.00 44.04  ? 310 ASP C O   1 
ATOM   7037  C  CB  . ASP C  1 289 ? 90.975  187.979 140.706 1.00 49.06  ? 310 ASP C CB  1 
ATOM   7038  C  CG  . ASP C  1 289 ? 91.186  187.497 139.264 1.00 49.78  ? 310 ASP C CG  1 
ATOM   7039  O  OD1 . ASP C  1 289 ? 92.144  186.687 139.082 1.00 49.88  ? 310 ASP C OD1 1 
ATOM   7040  O  OD2 . ASP C  1 289 ? 90.341  187.835 138.349 1.00 48.71  ? 310 ASP C OD2 1 
ATOM   7041  N  N   . VAL C  1 290 ? 93.310  186.980 142.816 1.00 42.73  ? 311 VAL C N   1 
ATOM   7042  C  CA  . VAL C  1 290 ? 94.241  185.880 143.171 1.00 40.14  ? 311 VAL C CA  1 
ATOM   7043  C  C   . VAL C  1 290 ? 93.321  184.682 143.349 1.00 39.37  ? 311 VAL C C   1 
ATOM   7044  O  O   . VAL C  1 290 ? 92.450  184.732 144.229 1.00 39.27  ? 311 VAL C O   1 
ATOM   7045  C  CB  . VAL C  1 290 ? 95.073  186.185 144.429 1.00 39.25  ? 311 VAL C CB  1 
ATOM   7046  C  CG1 . VAL C  1 290 ? 96.034  185.068 144.747 1.00 37.40  ? 311 VAL C CG1 1 
ATOM   7047  C  CG2 . VAL C  1 290 ? 95.868  187.468 144.316 1.00 40.14  ? 311 VAL C CG2 1 
ATOM   7048  N  N   . VAL C  1 291 ? 93.412  183.747 142.419 1.00 38.83  ? 312 VAL C N   1 
ATOM   7049  C  CA  . VAL C  1 291 ? 92.438  182.635 142.357 1.00 38.88  ? 312 VAL C CA  1 
ATOM   7050  C  C   . VAL C  1 291 ? 93.128  181.280 142.326 1.00 36.82  ? 312 VAL C C   1 
ATOM   7051  O  O   . VAL C  1 291 ? 94.323  181.224 142.230 1.00 35.92  ? 312 VAL C O   1 
ATOM   7052  C  CB  . VAL C  1 291 ? 91.554  182.798 141.099 1.00 41.06  ? 312 VAL C CB  1 
ATOM   7053  C  CG1 . VAL C  1 291 ? 90.889  184.157 141.033 1.00 42.81  ? 312 VAL C CG1 1 
ATOM   7054  C  CG2 . VAL C  1 291 ? 92.314  182.539 139.810 1.00 41.51  ? 312 VAL C CG2 1 
ATOM   7055  N  N   . GLU C  1 292 ? 92.320  180.237 142.457 1.00 37.10  ? 313 GLU C N   1 
ATOM   7056  C  CA  . GLU C  1 292 ? 92.703  178.819 142.259 1.00 37.09  ? 313 GLU C CA  1 
ATOM   7057  C  C   . GLU C  1 292 ? 93.557  178.278 143.411 1.00 35.68  ? 313 GLU C C   1 
ATOM   7058  O  O   . GLU C  1 292 ? 93.939  177.110 143.326 1.00 34.64  ? 313 GLU C O   1 
ATOM   7059  C  CB  . GLU C  1 292 ? 93.160  178.590 140.821 1.00 37.76  ? 313 GLU C CB  1 
ATOM   7060  C  CG  . GLU C  1 292 ? 92.009  178.669 139.838 1.00 39.72  ? 313 GLU C CG  1 
ATOM   7061  C  CD  . GLU C  1 292 ? 91.046  177.495 139.848 1.00 40.58  ? 313 GLU C CD  1 
ATOM   7062  O  OE1 . GLU C  1 292 ? 91.342  176.503 140.507 1.00 39.48  ? 313 GLU C OE1 1 
ATOM   7063  O  OE2 . GLU C  1 292 ? 90.014  177.571 139.174 1.00 43.03  ? 313 GLU C OE2 1 
ATOM   7064  N  N   . PHE C  1 293 ? 93.847  179.117 144.408 1.00 35.34  ? 314 PHE C N   1 
ATOM   7065  C  CA  . PHE C  1 293 ? 94.451  178.664 145.698 1.00 34.34  ? 314 PHE C CA  1 
ATOM   7066  C  C   . PHE C  1 293 ? 93.466  177.669 146.313 1.00 34.31  ? 314 PHE C C   1 
ATOM   7067  O  O   . PHE C  1 293 ? 92.343  178.082 146.599 1.00 34.23  ? 314 PHE C O   1 
ATOM   7068  C  CB  . PHE C  1 293 ? 94.719  179.787 146.712 1.00 34.39  ? 314 PHE C CB  1 
ATOM   7069  C  CG  . PHE C  1 293 ? 95.072  179.322 148.119 1.00 33.37  ? 314 PHE C CG  1 
ATOM   7070  C  CD1 . PHE C  1 293 ? 95.797  178.167 148.338 1.00 32.45  ? 314 PHE C CD1 1 
ATOM   7071  C  CD2 . PHE C  1 293 ? 94.638  180.021 149.230 1.00 34.60  ? 314 PHE C CD2 1 
ATOM   7072  C  CE1 . PHE C  1 293 ? 96.107  177.721 149.606 1.00 32.06  ? 314 PHE C CE1 1 
ATOM   7073  C  CE2 . PHE C  1 293 ? 94.910  179.577 150.518 1.00 33.72  ? 314 PHE C CE2 1 
ATOM   7074  C  CZ  . PHE C  1 293 ? 95.660  178.427 150.700 1.00 33.27  ? 314 PHE C CZ  1 
ATOM   7075  N  N   . ASN C  1 294 ? 93.889  176.410 146.449 1.00 33.70  ? 315 ASN C N   1 
ATOM   7076  C  CA  . ASN C  1 294 ? 93.082  175.282 146.987 1.00 34.21  ? 315 ASN C CA  1 
ATOM   7077  C  C   . ASN C  1 294 ? 93.709  174.845 148.323 1.00 33.06  ? 315 ASN C C   1 
ATOM   7078  O  O   . ASN C  1 294 ? 94.672  174.072 148.340 1.00 31.53  ? 315 ASN C O   1 
ATOM   7079  C  CB  . ASN C  1 294 ? 93.041  174.172 145.926 1.00 34.87  ? 315 ASN C CB  1 
ATOM   7080  C  CG  . ASN C  1 294 ? 92.133  173.016 146.270 1.00 36.19  ? 315 ASN C CG  1 
ATOM   7081  O  OD1 . ASN C  1 294 ? 91.835  172.790 147.451 1.00 36.70  ? 315 ASN C OD1 1 
ATOM   7082  N  ND2 . ASN C  1 294 ? 91.697  172.275 145.256 1.00 36.62  ? 315 ASN C ND2 1 
ATOM   7083  N  N   . PRO C  1 295 ? 93.175  175.296 149.488 1.00 33.40  ? 316 PRO C N   1 
ATOM   7084  C  CA  . PRO C  1 295 ? 93.720  174.940 150.791 1.00 32.49  ? 316 PRO C CA  1 
ATOM   7085  C  C   . PRO C  1 295 ? 93.720  173.427 150.999 1.00 32.71  ? 316 PRO C C   1 
ATOM   7086  O  O   . PRO C  1 295 ? 94.596  172.918 151.647 1.00 31.38  ? 316 PRO C O   1 
ATOM   7087  C  CB  . PRO C  1 295 ? 92.769  175.574 151.796 1.00 33.20  ? 316 PRO C CB  1 
ATOM   7088  C  CG  . PRO C  1 295 ? 92.038  176.633 151.044 1.00 34.44  ? 316 PRO C CG  1 
ATOM   7089  C  CD  . PRO C  1 295 ? 92.016  176.176 149.612 1.00 34.65  ? 316 PRO C CD  1 
ATOM   7090  N  N   . GLN C  1 296 ? 92.729  172.740 150.445 1.00 34.73  ? 317 GLN C N   1 
ATOM   7091  C  CA  . GLN C  1 296 ? 92.646  171.268 150.607 1.00 36.28  ? 317 GLN C CA  1 
ATOM   7092  C  C   . GLN C  1 296 ? 93.840  170.593 149.909 1.00 34.86  ? 317 GLN C C   1 
ATOM   7093  O  O   . GLN C  1 296 ? 93.979  169.404 150.106 1.00 34.02  ? 317 GLN C O   1 
ATOM   7094  C  CB  . GLN C  1 296 ? 91.305  170.706 150.105 1.00 39.19  ? 317 GLN C CB  1 
ATOM   7095  C  CG  . GLN C  1 296 ? 90.148  171.320 150.855 1.00 41.94  ? 317 GLN C CG  1 
ATOM   7096  C  CD  . GLN C  1 296 ? 88.761  170.874 150.465 1.00 44.91  ? 317 GLN C CD  1 
ATOM   7097  O  OE1 . GLN C  1 296 ? 88.277  171.299 149.415 1.00 46.31  ? 317 GLN C OE1 1 
ATOM   7098  N  NE2 . GLN C  1 296 ? 88.105  170.104 151.350 1.00 45.08  ? 317 GLN C NE2 1 
ATOM   7099  N  N   . ARG C  1 297 ? 94.600  171.285 149.059 1.00 33.79  ? 318 ARG C N   1 
ATOM   7100  C  CA  . ARG C  1 297 ? 95.800  170.688 148.417 1.00 34.15  ? 318 ARG C CA  1 
ATOM   7101  C  C   . ARG C  1 297 ? 97.083  171.284 149.006 1.00 30.96  ? 318 ARG C C   1 
ATOM   7102  O  O   . ARG C  1 297 ? 98.192  170.978 148.503 1.00 30.21  ? 318 ARG C O   1 
ATOM   7103  C  CB  . ARG C  1 297 ? 95.721  170.887 146.902 1.00 37.41  ? 318 ARG C CB  1 
ATOM   7104  C  CG  . ARG C  1 297 ? 94.722  169.932 146.245 1.00 42.12  ? 318 ARG C CG  1 
ATOM   7105  C  CD  . ARG C  1 297 ? 95.007  168.468 146.579 1.00 46.73  ? 318 ARG C CD  1 
ATOM   7106  N  NE  . ARG C  1 297 ? 94.703  167.474 145.553 1.00 52.05  ? 318 ARG C NE  1 
ATOM   7107  C  CZ  . ARG C  1 297 ? 95.218  167.449 144.306 1.00 57.81  ? 318 ARG C CZ  1 
ATOM   7108  N  NH1 . ARG C  1 297 ? 96.038  168.399 143.846 1.00 59.90  ? 318 ARG C NH1 1 
ATOM   7109  N  NH2 . ARG C  1 297 ? 94.857  166.474 143.483 1.00 60.99  ? 318 ARG C NH2 1 
ATOM   7110  N  N   . ASP C  1 298 ? 96.954  172.113 150.027 1.00 28.77  ? 319 ASP C N   1 
ATOM   7111  C  CA  . ASP C  1 298 ? 98.129  172.822 150.545 1.00 27.79  ? 319 ASP C CA  1 
ATOM   7112  C  C   . ASP C  1 298 ? 98.949  171.908 151.453 1.00 26.63  ? 319 ASP C C   1 
ATOM   7113  O  O   . ASP C  1 298 ? 98.445  170.814 151.867 1.00 26.00  ? 319 ASP C O   1 
ATOM   7114  C  CB  . ASP C  1 298 ? 97.703  174.088 151.254 1.00 28.00  ? 319 ASP C CB  1 
ATOM   7115  C  CG  . ASP C  1 298 ? 98.802  175.129 151.282 1.00 27.72  ? 319 ASP C CG  1 
ATOM   7116  O  OD1 . ASP C  1 298 ? 99.903  174.869 150.731 1.00 27.77  ? 319 ASP C OD1 1 
ATOM   7117  O  OD2 . ASP C  1 298 ? 98.539  176.185 151.859 1.00 28.44  ? 319 ASP C OD2 1 
ATOM   7118  N  N   . THR C  1 299 ? 100.161 172.357 151.787 1.00 25.68  ? 320 THR C N   1 
ATOM   7119  C  CA  . THR C  1 299 ? 101.014 171.667 152.794 1.00 25.90  ? 320 THR C CA  1 
ATOM   7120  C  C   . THR C  1 299 ? 100.307 171.812 154.138 1.00 26.47  ? 320 THR C C   1 
ATOM   7121  O  O   . THR C  1 299 ? 99.384  172.657 154.254 1.00 26.62  ? 320 THR C O   1 
ATOM   7122  C  CB  . THR C  1 299 ? 102.445 172.212 152.808 1.00 25.47  ? 320 THR C CB  1 
ATOM   7123  O  OG1 . THR C  1 299 ? 102.401 173.492 153.441 1.00 25.05  ? 320 THR C OG1 1 
ATOM   7124  C  CG2 . THR C  1 299 ? 103.009 172.328 151.412 1.00 25.72  ? 320 THR C CG2 1 
ATOM   7125  N  N   . VAL C  1 300 ? 100.686 170.988 155.106 1.00 27.53  ? 321 VAL C N   1 
ATOM   7126  C  CA  . VAL C  1 300 ? 100.053 170.954 156.456 1.00 28.64  ? 321 VAL C CA  1 
ATOM   7127  C  C   . VAL C  1 300 ? 100.328 172.262 157.192 1.00 28.98  ? 321 VAL C C   1 
ATOM   7128  O  O   . VAL C  1 300 ? 99.594  172.556 158.077 1.00 29.79  ? 321 VAL C O   1 
ATOM   7129  C  CB  . VAL C  1 300 ? 100.486 169.718 157.273 1.00 28.69  ? 321 VAL C CB  1 
ATOM   7130  C  CG1 . VAL C  1 300 ? 100.053 168.417 156.637 1.00 29.14  ? 321 VAL C CG1 1 
ATOM   7131  C  CG2 . VAL C  1 300 ? 101.970 169.691 157.562 1.00 28.75  ? 321 VAL C CG2 1 
ATOM   7132  N  N   . ASP C  1 301 ? 101.313 173.033 156.743 1.00 29.11  ? 322 ASP C N   1 
ATOM   7133  C  CA  . ASP C  1 301 ? 101.744 174.292 157.406 1.00 29.86  ? 322 ASP C CA  1 
ATOM   7134  C  C   . ASP C  1 301 ? 101.235 175.507 156.635 1.00 28.81  ? 322 ASP C C   1 
ATOM   7135  O  O   . ASP C  1 301 ? 101.456 176.563 157.094 1.00 28.48  ? 322 ASP C O   1 
ATOM   7136  C  CB  . ASP C  1 301 ? 103.271 174.333 157.575 1.00 30.60  ? 322 ASP C CB  1 
ATOM   7137  C  CG  . ASP C  1 301 ? 103.740 173.194 158.495 1.00 31.47  ? 322 ASP C CG  1 
ATOM   7138  O  OD1 . ASP C  1 301 ? 103.027 172.941 159.480 1.00 32.89  ? 322 ASP C OD1 1 
ATOM   7139  O  OD2 . ASP C  1 301 ? 104.782 172.531 158.201 1.00 31.28  ? 322 ASP C OD2 1 
ATOM   7140  N  N   . GLY C  1 302 ? 100.579 175.318 155.506 1.00 28.06  ? 323 GLY C N   1 
ATOM   7141  C  CA  . GLY C  1 302 ? 99.900  176.391 154.763 1.00 28.30  ? 323 GLY C CA  1 
ATOM   7142  C  C   . GLY C  1 302 ? 100.841 177.175 153.865 1.00 27.56  ? 323 GLY C C   1 
ATOM   7143  O  O   . GLY C  1 302 ? 100.649 178.386 153.768 1.00 29.43  ? 323 GLY C O   1 
ATOM   7144  N  N   . MET C  1 303 ? 101.819 176.542 153.240 1.00 26.80  ? 324 MET C N   1 
ATOM   7145  C  CA  . MET C  1 303 ? 102.852 177.260 152.460 1.00 27.19  ? 324 MET C CA  1 
ATOM   7146  C  C   . MET C  1 303 ? 102.173 178.074 151.333 1.00 27.54  ? 324 MET C C   1 
ATOM   7147  O  O   . MET C  1 303 ? 102.579 179.220 151.098 1.00 27.73  ? 324 MET C O   1 
ATOM   7148  C  CB  . MET C  1 303 ? 103.883 176.294 151.888 1.00 27.47  ? 324 MET C CB  1 
ATOM   7149  C  CG  . MET C  1 303 ? 104.931 177.019 151.090 1.00 28.86  ? 324 MET C CG  1 
ATOM   7150  S  SD  . MET C  1 303 ? 106.346 176.021 150.688 1.00 30.76  ? 324 MET C SD  1 
ATOM   7151  C  CE  . MET C  1 303 ? 105.588 175.017 149.411 1.00 30.89  ? 324 MET C CE  1 
ATOM   7152  N  N   . THR C  1 304 ? 101.159 177.514 150.670 1.00 27.49  ? 325 THR C N   1 
ATOM   7153  C  CA  . THR C  1 304 ? 100.530 178.124 149.494 1.00 28.12  ? 325 THR C CA  1 
ATOM   7154  C  C   . THR C  1 304 ? 99.662  179.262 150.003 1.00 29.84  ? 325 THR C C   1 
ATOM   7155  O  O   . THR C  1 304 ? 99.470  180.239 149.243 1.00 29.61  ? 325 THR C O   1 
ATOM   7156  C  CB  . THR C  1 304 ? 99.832  177.105 148.595 1.00 28.08  ? 325 THR C CB  1 
ATOM   7157  O  OG1 . THR C  1 304 ? 100.688 176.023 148.201 1.00 27.59  ? 325 THR C OG1 1 
ATOM   7158  C  CG2 . THR C  1 304 ? 99.359  177.743 147.308 1.00 29.08  ? 325 THR C CG2 1 
ATOM   7159  N  N   . ALA C  1 305 ? 99.133  179.141 151.235 1.00 30.81  ? 326 ALA C N   1 
ATOM   7160  C  CA  . ALA C  1 305 ? 98.347  180.238 151.843 1.00 31.34  ? 326 ALA C CA  1 
ATOM   7161  C  C   . ALA C  1 305 ? 99.295  181.444 151.959 1.00 31.74  ? 326 ALA C C   1 
ATOM   7162  O  O   . ALA C  1 305 ? 98.821  182.561 151.753 1.00 32.17  ? 326 ALA C O   1 
ATOM   7163  C  CB  . ALA C  1 305 ? 97.735  179.857 153.168 1.00 30.93  ? 326 ALA C CB  1 
ATOM   7164  N  N   . MET C  1 306 ? 100.578 181.228 152.260 1.00 31.33  ? 327 MET C N   1 
ATOM   7165  C  CA  . MET C  1 306 ? 101.532 182.337 152.503 1.00 32.51  ? 327 MET C CA  1 
ATOM   7166  C  C   . MET C  1 306 ? 101.913 182.912 151.130 1.00 32.36  ? 327 MET C C   1 
ATOM   7167  O  O   . MET C  1 306 ? 102.178 184.109 151.077 1.00 33.57  ? 327 MET C O   1 
ATOM   7168  C  CB  . MET C  1 306 ? 102.798 181.910 153.249 1.00 33.83  ? 327 MET C CB  1 
ATOM   7169  C  CG  . MET C  1 306 ? 102.557 181.306 154.682 1.00 36.09  ? 327 MET C CG  1 
ATOM   7170  S  SD  . MET C  1 306 ? 102.064 182.581 155.936 1.00 40.04  ? 327 MET C SD  1 
ATOM   7171  C  CE  . MET C  1 306 ? 102.861 184.039 155.258 1.00 40.94  ? 327 MET C CE  1 
ATOM   7172  N  N   . VAL C  1 307 ? 101.996 182.054 150.115 1.00 30.42  ? 328 VAL C N   1 
ATOM   7173  C  CA  . VAL C  1 307 ? 102.191 182.427 148.704 1.00 31.32  ? 328 VAL C CA  1 
ATOM   7174  C  C   . VAL C  1 307 ? 101.040 183.330 148.243 1.00 32.22  ? 328 VAL C C   1 
ATOM   7175  O  O   . VAL C  1 307 ? 101.334 184.419 147.720 1.00 33.58  ? 328 VAL C O   1 
ATOM   7176  C  CB  . VAL C  1 307 ? 102.300 181.200 147.798 1.00 31.05  ? 328 VAL C CB  1 
ATOM   7177  C  CG1 . VAL C  1 307 ? 102.228 181.588 146.313 1.00 31.89  ? 328 VAL C CG1 1 
ATOM   7178  C  CG2 . VAL C  1 307 ? 103.578 180.460 148.064 1.00 31.28  ? 328 VAL C CG2 1 
ATOM   7179  N  N   . ALA C  1 308 ? 99.793  182.868 148.356 1.00 31.63  ? 329 ALA C N   1 
ATOM   7180  C  CA  . ALA C  1 308 ? 98.608  183.670 148.013 1.00 32.37  ? 329 ALA C CA  1 
ATOM   7181  C  C   . ALA C  1 308 ? 98.674  184.953 148.820 1.00 33.50  ? 329 ALA C C   1 
ATOM   7182  O  O   . ALA C  1 308 ? 98.503  186.034 148.218 1.00 35.38  ? 329 ALA C O   1 
ATOM   7183  C  CB  . ALA C  1 308 ? 97.328  182.921 148.195 1.00 31.86  ? 329 ALA C CB  1 
ATOM   7184  N  N   . ALA C  1 309 ? 99.000  184.884 150.102 1.00 33.58  ? 330 ALA C N   1 
ATOM   7185  C  CA  . ALA C  1 309 ? 98.899  186.077 150.970 1.00 34.76  ? 330 ALA C CA  1 
ATOM   7186  C  C   . ALA C  1 309 ? 99.888  187.087 150.426 1.00 35.58  ? 330 ALA C C   1 
ATOM   7187  O  O   . ALA C  1 309 ? 99.519  188.220 150.280 1.00 36.39  ? 330 ALA C O   1 
ATOM   7188  C  CB  . ALA C  1 309 ? 99.187  185.782 152.410 1.00 34.82  ? 330 ALA C CB  1 
ATOM   7189  N  N   . LYS C  1 310 ? 101.089 186.650 150.103 1.00 35.29  ? 331 LYS C N   1 
ATOM   7190  C  CA  . LYS C  1 310 ? 102.148 187.617 149.748 1.00 37.05  ? 331 LYS C CA  1 
ATOM   7191  C  C   . LYS C  1 310 ? 101.867 188.205 148.355 1.00 38.35  ? 331 LYS C C   1 
ATOM   7192  O  O   . LYS C  1 310 ? 102.314 189.323 148.136 1.00 41.14  ? 331 LYS C O   1 
ATOM   7193  C  CB  . LYS C  1 310 ? 103.532 186.994 149.840 1.00 36.37  ? 331 LYS C CB  1 
ATOM   7194  C  CG  . LYS C  1 310 ? 104.651 187.919 149.418 1.00 37.72  ? 331 LYS C CG  1 
ATOM   7195  C  CD  . LYS C  1 310 ? 106.001 187.616 150.022 1.00 37.90  ? 331 LYS C CD  1 
ATOM   7196  C  CE  . LYS C  1 310 ? 107.005 188.710 149.688 1.00 40.11  ? 331 LYS C CE  1 
ATOM   7197  N  NZ  . LYS C  1 310 ? 108.352 188.392 150.216 1.00 40.97  ? 331 LYS C NZ  1 
ATOM   7198  N  N   . LEU C  1 311 ? 101.180 187.487 147.457 1.00 37.71  ? 332 LEU C N   1 
ATOM   7199  C  CA  . LEU C  1 311 ? 100.812 188.006 146.112 1.00 38.15  ? 332 LEU C CA  1 
ATOM   7200  C  C   . LEU C  1 311 ? 99.717  189.043 146.294 1.00 39.94  ? 332 LEU C C   1 
ATOM   7201  O  O   . LEU C  1 311 ? 99.765  190.100 145.540 1.00 42.20  ? 332 LEU C O   1 
ATOM   7202  C  CB  . LEU C  1 311 ? 100.269 186.921 145.197 1.00 37.21  ? 332 LEU C CB  1 
ATOM   7203  C  CG  . LEU C  1 311 ? 101.314 185.898 144.780 1.00 36.99  ? 332 LEU C CG  1 
ATOM   7204  C  CD1 . LEU C  1 311 ? 100.653 184.641 144.238 1.00 37.24  ? 332 LEU C CD1 1 
ATOM   7205  C  CD2 . LEU C  1 311 ? 102.278 186.452 143.783 1.00 37.62  ? 332 LEU C CD2 1 
ATOM   7206  N  N   . VAL C  1 312 ? 98.760  188.755 147.189 1.00 38.09  ? 333 VAL C N   1 
ATOM   7207  C  CA  . VAL C  1 312 ? 97.756  189.769 147.585 1.00 38.83  ? 333 VAL C CA  1 
ATOM   7208  C  C   . VAL C  1 312 ? 98.495  191.008 148.084 1.00 39.24  ? 333 VAL C C   1 
ATOM   7209  O  O   . VAL C  1 312 ? 98.123  192.090 147.631 1.00 39.52  ? 333 VAL C O   1 
ATOM   7210  C  CB  . VAL C  1 312 ? 96.730  189.278 148.617 1.00 38.54  ? 333 VAL C CB  1 
ATOM   7211  C  CG1 . VAL C  1 312 ? 95.894  190.407 149.172 1.00 40.27  ? 333 VAL C CG1 1 
ATOM   7212  C  CG2 . VAL C  1 312 ? 95.798  188.279 147.994 1.00 38.63  ? 333 VAL C CG2 1 
ATOM   7213  N  N   . ARG C  1 313 ? 99.445  190.850 149.009 1.00 38.34  ? 334 ARG C N   1 
ATOM   7214  C  CA  . ARG C  1 313 ? 100.144 191.992 149.653 1.00 39.37  ? 334 ARG C CA  1 
ATOM   7215  C  C   . ARG C  1 313 ? 100.852 192.811 148.565 1.00 40.74  ? 334 ARG C C   1 
ATOM   7216  O  O   . ARG C  1 313 ? 100.725 194.035 148.561 1.00 42.61  ? 334 ARG C O   1 
ATOM   7217  C  CB  . ARG C  1 313 ? 101.151 191.532 150.708 1.00 38.43  ? 334 ARG C CB  1 
ATOM   7218  C  CG  . ARG C  1 313 ? 100.509 190.928 151.951 1.00 37.78  ? 334 ARG C CG  1 
ATOM   7219  C  CD  . ARG C  1 313 ? 101.423 190.048 152.777 1.00 36.40  ? 334 ARG C CD  1 
ATOM   7220  N  NE  . ARG C  1 313 ? 102.626 190.729 153.233 1.00 37.44  ? 334 ARG C NE  1 
ATOM   7221  C  CZ  . ARG C  1 313 ? 103.015 190.936 154.482 1.00 38.31  ? 334 ARG C CZ  1 
ATOM   7222  N  NH1 . ARG C  1 313 ? 104.146 191.573 154.734 1.00 39.74  ? 334 ARG C NH1 1 
ATOM   7223  N  NH2 . ARG C  1 313 ? 102.301 190.504 155.500 1.00 38.81  ? 334 ARG C NH2 1 
ATOM   7224  N  N   . GLU C  1 314 ? 101.542 192.157 147.641 1.00 39.96  ? 335 GLU C N   1 
ATOM   7225  C  CA  . GLU C  1 314 ? 102.361 192.890 146.655 1.00 41.48  ? 335 GLU C CA  1 
ATOM   7226  C  C   . GLU C  1 314 ? 101.392 193.510 145.648 1.00 42.79  ? 335 GLU C C   1 
ATOM   7227  O  O   . GLU C  1 314 ? 101.584 194.696 145.328 1.00 44.84  ? 335 GLU C O   1 
ATOM   7228  C  CB  . GLU C  1 314 ? 103.453 191.968 146.112 1.00 40.68  ? 335 GLU C CB  1 
ATOM   7229  C  CG  . GLU C  1 314 ? 104.456 191.566 147.197 1.00 39.78  ? 335 GLU C CG  1 
ATOM   7230  C  CD  . GLU C  1 314 ? 105.295 192.723 147.692 1.00 41.21  ? 335 GLU C CD  1 
ATOM   7231  O  OE1 . GLU C  1 314 ? 105.680 193.535 146.823 1.00 42.23  ? 335 GLU C OE1 1 
ATOM   7232  O  OE2 . GLU C  1 314 ? 105.636 192.770 148.926 1.00 41.00  ? 335 GLU C OE2 1 
ATOM   7233  N  N   . LEU C  1 315 ? 100.342 192.777 145.255 1.00 41.72  ? 336 LEU C N   1 
ATOM   7234  C  CA  . LEU C  1 315 ? 99.292  193.302 144.365 1.00 42.97  ? 336 LEU C CA  1 
ATOM   7235  C  C   . LEU C  1 315 ? 98.678  194.544 144.992 1.00 44.78  ? 336 LEU C C   1 
ATOM   7236  O  O   . LEU C  1 315 ? 98.328  195.492 144.208 1.00 46.84  ? 336 LEU C O   1 
ATOM   7237  C  CB  . LEU C  1 315 ? 98.207  192.268 144.089 1.00 41.95  ? 336 LEU C CB  1 
ATOM   7238  C  CG  . LEU C  1 315 ? 98.442  191.349 142.895 1.00 41.63  ? 336 LEU C CG  1 
ATOM   7239  C  CD1 . LEU C  1 315 ? 97.269  190.365 142.777 1.00 41.14  ? 336 LEU C CD1 1 
ATOM   7240  C  CD2 . LEU C  1 315 ? 98.648  192.133 141.604 1.00 43.41  ? 336 LEU C CD2 1 
ATOM   7241  N  N   . ALA C  1 316 ? 98.544  194.578 146.316 1.00 44.30  ? 337 ALA C N   1 
ATOM   7242  C  CA  . ALA C  1 316 ? 97.917  195.722 147.021 1.00 46.10  ? 337 ALA C CA  1 
ATOM   7243  C  C   . ALA C  1 316 ? 98.886  196.897 147.053 1.00 48.16  ? 337 ALA C C   1 
ATOM   7244  O  O   . ALA C  1 316 ? 98.393  198.038 147.011 1.00 49.96  ? 337 ALA C O   1 
ATOM   7245  C  CB  . ALA C  1 316 ? 97.464  195.391 148.406 1.00 45.71  ? 337 ALA C CB  1 
ATOM   7246  N  N   . ALA C  1 317 ? 100.185 196.646 147.158 1.00 48.05  ? 338 ALA C N   1 
ATOM   7247  C  CA  . ALA C  1 317 ? 101.212 197.719 147.132 1.00 50.44  ? 338 ALA C CA  1 
ATOM   7248  C  C   . ALA C  1 317 ? 101.259 198.382 145.737 1.00 52.73  ? 338 ALA C C   1 
ATOM   7249  O  O   . ALA C  1 317 ? 101.515 199.605 145.657 1.00 54.64  ? 338 ALA C O   1 
ATOM   7250  C  CB  . ALA C  1 317 ? 102.556 197.173 147.532 1.00 49.36  ? 338 ALA C CB  1 
ATOM   7251  N  N   . LYS C  1 318 ? 100.950 197.633 144.679 1.00 52.79  ? 339 LYS C N   1 
ATOM   7252  C  CA  . LYS C  1 318 ? 100.857 198.165 143.288 1.00 55.44  ? 339 LYS C CA  1 
ATOM   7253  C  C   . LYS C  1 318 ? 99.534  198.908 143.001 1.00 57.37  ? 339 LYS C C   1 
ATOM   7254  O  O   . LYS C  1 318 ? 99.540  199.818 142.158 1.00 58.45  ? 339 LYS C O   1 
ATOM   7255  C  CB  . LYS C  1 318 ? 100.936 197.007 142.298 1.00 54.67  ? 339 LYS C CB  1 
ATOM   7256  C  CG  . LYS C  1 318 ? 101.138 197.429 140.860 1.00 57.20  ? 339 LYS C CG  1 
ATOM   7257  C  CD  . LYS C  1 318 ? 101.696 196.329 139.984 1.00 57.01  ? 339 LYS C CD  1 
ATOM   7258  C  CE  . LYS C  1 318 ? 102.407 196.896 138.767 1.00 59.01  ? 339 LYS C CE  1 
ATOM   7259  N  NZ  . LYS C  1 318 ? 103.644 197.617 139.151 1.00 60.46  ? 339 LYS C NZ  1 
ATOM   7260  N  N   . ILE C  1 319 ? 98.402  198.456 143.564 1.00 57.28  ? 340 ILE C N   1 
ATOM   7261  C  CA  . ILE C  1 319 ? 97.046  198.970 143.194 1.00 58.52  ? 340 ILE C CA  1 
ATOM   7262  C  C   . ILE C  1 319 ? 96.835  200.263 143.973 1.00 59.80  ? 340 ILE C C   1 
ATOM   7263  O  O   . ILE C  1 319 ? 96.516  201.343 143.325 1.00 62.51  ? 340 ILE C O   1 
ATOM   7264  C  CB  . ILE C  1 319 ? 95.929  197.937 143.478 1.00 58.33  ? 340 ILE C CB  1 
ATOM   7265  C  CG1 . ILE C  1 319 ? 96.037  196.705 142.569 1.00 57.41  ? 340 ILE C CG1 1 
ATOM   7266  C  CG2 . ILE C  1 319 ? 94.562  198.604 143.361 1.00 60.58  ? 340 ILE C CG2 1 
ATOM   7267  C  CD1 . ILE C  1 319 ? 95.063  195.562 142.859 1.00 56.35  ? 340 ILE C CD1 1 
ATOM   7268  N  N   . SER C  1 320 ? 97.079  200.180 145.279 1.00 57.22  ? 341 SER C N   1 
ATOM   7269  C  CA  . SER C  1 320 ? 97.044  201.341 146.191 1.00 59.54  ? 341 SER C CA  1 
ATOM   7270  C  C   . SER C  1 320 ? 98.010  202.394 145.647 1.00 60.78  ? 341 SER C C   1 
ATOM   7271  O  O   . SER C  1 320 ? 99.057  202.035 145.152 1.00 60.84  ? 341 SER C O   1 
ATOM   7272  C  CB  . SER C  1 320 ? 97.339  200.935 147.636 1.00 58.24  ? 341 SER C CB  1 
ATOM   7273  O  OG  . SER C  1 320 ? 96.539  199.796 148.018 1.00 56.20  ? 341 SER C OG  1 
ATOM   7274  N  N   . LYS C  1 321 ? 97.584  203.656 145.627 1.00 63.65  ? 342 LYS C N   1 
ATOM   7275  C  CA  . LYS C  1 321 ? 98.437  204.822 145.241 1.00 66.76  ? 342 LYS C CA  1 
ATOM   7276  C  C   . LYS C  1 321 ? 97.848  206.119 145.796 1.00 70.34  ? 342 LYS C C   1 
ATOM   7277  O  O   . LYS C  1 321 ? 96.677  206.161 146.125 1.00 71.86  ? 342 LYS C O   1 
ATOM   7278  C  CB  . LYS C  1 321 ? 98.794  204.917 143.754 1.00 66.62  ? 342 LYS C CB  1 
ATOM   7279  C  CG  . LYS C  1 321 ? 97.663  205.228 142.792 1.00 67.85  ? 342 LYS C CG  1 
ATOM   7280  C  CD  . LYS C  1 321 ? 98.025  204.972 141.349 1.00 67.68  ? 342 LYS C CD  1 
ATOM   7281  C  CE  . LYS C  1 321 ? 96.831  204.792 140.434 1.00 68.55  ? 342 LYS C CE  1 
ATOM   7282  N  NZ  . LYS C  1 321 ? 97.239  204.347 139.084 1.00 67.71  ? 342 LYS C NZ  1 
ATOM   7283  O  OXT . LYS C  1 321 ? 98.620  207.070 145.909 1.00 73.25  ? 342 LYS C OXT 1 
ATOM   7284  N  N   . SER D  1 6   ? 88.867  143.390 113.894 1.00 95.80  ? 27  SER D N   1 
ATOM   7285  C  CA  . SER D  1 6   ? 88.450  142.022 114.329 1.00 94.95  ? 27  SER D CA  1 
ATOM   7286  C  C   . SER D  1 6   ? 89.628  141.293 114.962 1.00 92.56  ? 27  SER D C   1 
ATOM   7287  O  O   . SER D  1 6   ? 89.408  140.619 115.978 1.00 92.78  ? 27  SER D O   1 
ATOM   7288  C  CB  . SER D  1 6   ? 87.950  141.190 113.201 1.00 99.90  ? 27  SER D CB  1 
ATOM   7289  O  OG  . SER D  1 6   ? 88.384  139.854 113.405 1.00 100.33 ? 27  SER D OG  1 
ATOM   7290  N  N   . SER D  1 7   ? 90.809  141.401 114.337 1.00 90.94  ? 28  SER D N   1 
ATOM   7291  C  CA  . SER D  1 7   ? 92.128  140.946 114.866 1.00 87.94  ? 28  SER D CA  1 
ATOM   7292  C  C   . SER D  1 7   ? 92.444  141.616 116.219 1.00 82.59  ? 28  SER D C   1 
ATOM   7293  O  O   . SER D  1 7   ? 93.472  141.291 116.817 1.00 79.79  ? 28  SER D O   1 
ATOM   7294  C  CB  . SER D  1 7   ? 93.232  141.237 113.886 1.00 90.30  ? 28  SER D CB  1 
ATOM   7295  O  OG  . SER D  1 7   ? 93.934  142.413 114.273 1.00 88.46  ? 28  SER D OG  1 
ATOM   7296  N  N   . ILE D  1 8   ? 91.646  142.601 116.627 1.00 80.21  ? 29  ILE D N   1 
ATOM   7297  C  CA  . ILE D  1 8   ? 91.627  143.147 118.010 1.00 76.85  ? 29  ILE D CA  1 
ATOM   7298  C  C   . ILE D  1 8   ? 91.095  142.061 118.949 1.00 74.84  ? 29  ILE D C   1 
ATOM   7299  O  O   . ILE D  1 8   ? 91.762  141.793 119.977 1.00 71.51  ? 29  ILE D O   1 
ATOM   7300  C  CB  . ILE D  1 8   ? 90.782  144.432 118.066 1.00 76.38  ? 29  ILE D CB  1 
ATOM   7301  C  CG1 . ILE D  1 8   ? 91.542  145.588 117.400 1.00 77.58  ? 29  ILE D CG1 1 
ATOM   7302  C  CG2 . ILE D  1 8   ? 90.362  144.721 119.503 1.00 73.64  ? 29  ILE D CG2 1 
ATOM   7303  C  CD1 . ILE D  1 8   ? 90.843  146.936 117.413 1.00 77.38  ? 29  ILE D CD1 1 
ATOM   7304  N  N   . GLU D  1 9   ? 89.947  141.470 118.593 1.00 76.74  ? 30  GLU D N   1 
ATOM   7305  C  CA  . GLU D  1 9   ? 89.285  140.365 119.347 1.00 75.78  ? 30  GLU D CA  1 
ATOM   7306  C  C   . GLU D  1 9   ? 90.250  139.188 119.472 1.00 73.15  ? 30  GLU D C   1 
ATOM   7307  O  O   . GLU D  1 9   ? 90.332  138.630 120.600 1.00 69.11  ? 30  GLU D O   1 
ATOM   7308  C  CB  . GLU D  1 9   ? 87.969  139.898 118.705 1.00 80.78  ? 30  GLU D CB  1 
ATOM   7309  C  CG  . GLU D  1 9   ? 86.737  140.202 119.573 1.00 81.78  ? 30  GLU D CG  1 
ATOM   7310  C  CD  . GLU D  1 9   ? 86.253  139.128 120.552 1.00 82.06  ? 30  GLU D CD  1 
ATOM   7311  O  OE1 . GLU D  1 9   ? 85.277  138.409 120.206 1.00 83.01  ? 30  GLU D OE1 1 
ATOM   7312  O  OE2 . GLU D  1 9   ? 86.830  139.027 121.685 1.00 83.33  ? 30  GLU D OE2 1 
ATOM   7313  N  N   . LYS D  1 10  ? 90.892  138.809 118.363 1.00 73.09  ? 31  LYS D N   1 
ATOM   7314  C  CA  . LYS D  1 10  ? 91.960  137.774 118.321 1.00 72.88  ? 31  LYS D CA  1 
ATOM   7315  C  C   . LYS D  1 10  ? 93.071  138.171 119.291 1.00 69.31  ? 31  LYS D C   1 
ATOM   7316  O  O   . LYS D  1 10  ? 93.486  137.344 120.140 1.00 68.32  ? 31  LYS D O   1 
ATOM   7317  C  CB  . LYS D  1 10  ? 92.579  137.667 116.927 1.00 76.50  ? 31  LYS D CB  1 
ATOM   7318  C  CG  . LYS D  1 10  ? 91.659  137.179 115.822 1.00 79.51  ? 31  LYS D CG  1 
ATOM   7319  C  CD  . LYS D  1 10  ? 91.599  135.657 115.750 1.00 80.63  ? 31  LYS D CD  1 
ATOM   7320  C  CE  . LYS D  1 10  ? 91.289  135.138 114.365 1.00 83.18  ? 31  LYS D CE  1 
ATOM   7321  N  NZ  . LYS D  1 10  ? 90.004  135.682 113.881 1.00 84.00  ? 31  LYS D NZ  1 
ATOM   7322  N  N   . GLY D  1 11  ? 93.529  139.413 119.199 1.00 67.74  ? 32  GLY D N   1 
ATOM   7323  C  CA  . GLY D  1 11  ? 94.558  139.932 120.121 1.00 65.15  ? 32  GLY D CA  1 
ATOM   7324  C  C   . GLY D  1 11  ? 94.147  139.801 121.570 1.00 61.33  ? 32  GLY D C   1 
ATOM   7325  O  O   . GLY D  1 11  ? 94.956  139.349 122.397 1.00 60.06  ? 32  GLY D O   1 
ATOM   7326  N  N   . GLN D  1 12  ? 92.922  140.183 121.898 1.00 59.94  ? 33  GLN D N   1 
ATOM   7327  C  CA  . GLN D  1 12  ? 92.441  140.145 123.303 1.00 56.65  ? 33  GLN D CA  1 
ATOM   7328  C  C   . GLN D  1 12  ? 92.551  138.714 123.873 1.00 55.60  ? 33  GLN D C   1 
ATOM   7329  O  O   . GLN D  1 12  ? 92.937  138.591 125.077 1.00 52.02  ? 33  GLN D O   1 
ATOM   7330  C  CB  . GLN D  1 12  ? 91.017  140.697 123.363 1.00 56.99  ? 33  GLN D CB  1 
ATOM   7331  C  CG  . GLN D  1 12  ? 90.931  142.211 123.189 1.00 57.60  ? 33  GLN D CG  1 
ATOM   7332  C  CD  . GLN D  1 12  ? 89.513  142.696 122.799 1.00 59.51  ? 33  GLN D CD  1 
ATOM   7333  O  OE1 . GLN D  1 12  ? 88.701  141.909 122.357 1.00 60.94  ? 33  GLN D OE1 1 
ATOM   7334  N  NE2 . GLN D  1 12  ? 89.228  143.967 123.169 1.00 59.03  ? 33  GLN D NE2 1 
ATOM   7335  N  N   . ASN D  1 13  ? 92.215  137.677 123.079 1.00 57.32  ? 34  ASN D N   1 
ATOM   7336  C  CA  . ASN D  1 13  ? 92.174  136.266 123.549 1.00 57.54  ? 34  ASN D CA  1 
ATOM   7337  C  C   . ASN D  1 13  ? 93.606  135.789 123.817 1.00 57.29  ? 34  ASN D C   1 
ATOM   7338  O  O   . ASN D  1 13  ? 93.793  134.983 124.783 1.00 55.23  ? 34  ASN D O   1 
ATOM   7339  C  CB  . ASN D  1 13  ? 91.457  135.281 122.607 1.00 60.55  ? 34  ASN D CB  1 
ATOM   7340  C  CG  . ASN D  1 13  ? 90.047  135.680 122.206 1.00 61.72  ? 34  ASN D CG  1 
ATOM   7341  O  OD1 . ASN D  1 13  ? 89.380  136.441 122.896 1.00 61.40  ? 34  ASN D OD1 1 
ATOM   7342  N  ND2 . ASN D  1 13  ? 89.588  135.184 121.074 1.00 64.68  ? 34  ASN D ND2 1 
ATOM   7343  N  N   . ARG D  1 14  ? 94.577  136.256 123.023 1.00 59.10  ? 35  ARG D N   1 
ATOM   7344  C  CA  . ARG D  1 14  ? 96.010  135.863 123.151 1.00 59.72  ? 35  ARG D CA  1 
ATOM   7345  C  C   . ARG D  1 14  ? 96.546  136.501 124.432 1.00 56.06  ? 35  ARG D C   1 
ATOM   7346  O  O   . ARG D  1 14  ? 97.258  135.816 125.203 1.00 55.04  ? 35  ARG D O   1 
ATOM   7347  C  CB  . ARG D  1 14  ? 96.786  136.187 121.863 1.00 63.88  ? 35  ARG D CB  1 
ATOM   7348  C  CG  . ARG D  1 14  ? 96.607  135.138 120.768 1.00 68.02  ? 35  ARG D CG  1 
ATOM   7349  C  CD  . ARG D  1 14  ? 97.552  135.194 119.583 1.00 72.26  ? 35  ARG D CD  1 
ATOM   7350  N  NE  . ARG D  1 14  ? 97.148  136.248 118.634 1.00 75.21  ? 35  ARG D NE  1 
ATOM   7351  C  CZ  . ARG D  1 14  ? 96.403  136.103 117.529 1.00 78.40  ? 35  ARG D CZ  1 
ATOM   7352  N  NH1 . ARG D  1 14  ? 96.130  137.186 116.813 1.00 80.00  ? 35  ARG D NH1 1 
ATOM   7353  N  NH2 . ARG D  1 14  ? 95.957  134.911 117.123 1.00 80.03  ? 35  ARG D NH2 1 
ATOM   7354  N  N   . VAL D  1 15  ? 96.107  137.720 124.737 1.00 54.01  ? 36  VAL D N   1 
ATOM   7355  C  CA  . VAL D  1 15  ? 96.482  138.433 125.998 1.00 50.86  ? 36  VAL D CA  1 
ATOM   7356  C  C   . VAL D  1 15  ? 95.812  137.759 127.210 1.00 49.08  ? 36  VAL D C   1 
ATOM   7357  O  O   . VAL D  1 15  ? 96.519  137.532 128.209 1.00 46.39  ? 36  VAL D O   1 
ATOM   7358  C  CB  . VAL D  1 15  ? 96.147  139.934 125.936 1.00 50.01  ? 36  VAL D CB  1 
ATOM   7359  C  CG1 . VAL D  1 15  ? 96.295  140.616 127.286 1.00 47.48  ? 36  VAL D CG1 1 
ATOM   7360  C  CG2 . VAL D  1 15  ? 96.992  140.639 124.897 1.00 52.17  ? 36  VAL D CG2 1 
ATOM   7361  N  N   . ILE D  1 16  ? 94.503  137.492 127.155 1.00 49.45  ? 37  ILE D N   1 
ATOM   7362  C  CA  . ILE D  1 16  ? 93.805  136.779 128.257 1.00 48.65  ? 37  ILE D CA  1 
ATOM   7363  C  C   . ILE D  1 16  ? 94.524  135.431 128.465 1.00 50.28  ? 37  ILE D C   1 
ATOM   7364  O  O   . ILE D  1 16  ? 94.941  135.159 129.584 1.00 48.83  ? 37  ILE D O   1 
ATOM   7365  C  CB  . ILE D  1 16  ? 92.304  136.649 127.956 1.00 48.93  ? 37  ILE D CB  1 
ATOM   7366  C  CG1 . ILE D  1 16  ? 91.602  137.992 128.099 1.00 47.83  ? 37  ILE D CG1 1 
ATOM   7367  C  CG2 . ILE D  1 16  ? 91.635  135.615 128.843 1.00 48.05  ? 37  ILE D CG2 1 
ATOM   7368  C  CD1 . ILE D  1 16  ? 90.278  138.022 127.405 1.00 49.34  ? 37  ILE D CD1 1 
ATOM   7369  N  N   . ASP D  1 17  ? 94.777  134.670 127.408 1.00 54.04  ? 38  ASP D N   1 
ATOM   7370  C  CA  . ASP D  1 17  ? 95.449  133.350 127.479 1.00 55.95  ? 38  ASP D CA  1 
ATOM   7371  C  C   . ASP D  1 17  ? 96.799  133.428 128.163 1.00 55.59  ? 38  ASP D C   1 
ATOM   7372  O  O   . ASP D  1 17  ? 97.053  132.527 129.010 1.00 55.36  ? 38  ASP D O   1 
ATOM   7373  C  CB  . ASP D  1 17  ? 95.653  132.731 126.100 1.00 60.41  ? 38  ASP D CB  1 
ATOM   7374  C  CG  . ASP D  1 17  ? 94.564  131.732 125.850 1.00 62.54  ? 38  ASP D CG  1 
ATOM   7375  O  OD1 . ASP D  1 17  ? 93.488  131.913 126.498 1.00 63.11  ? 38  ASP D OD1 1 
ATOM   7376  O  OD2 . ASP D  1 17  ? 94.821  130.753 125.108 1.00 66.38  ? 38  ASP D OD2 1 
ATOM   7377  N  N   . ALA D  1 18  ? 97.656  134.388 127.781 1.00 56.27  ? 39  ALA D N   1 
ATOM   7378  C  CA  . ALA D  1 18  ? 99.001  134.579 128.400 1.00 54.95  ? 39  ALA D CA  1 
ATOM   7379  C  C   . ALA D  1 18  ? 98.852  135.015 129.846 1.00 50.81  ? 39  ALA D C   1 
ATOM   7380  O  O   . ALA D  1 18  ? 99.670  134.628 130.702 1.00 49.00  ? 39  ALA D O   1 
ATOM   7381  C  CB  . ALA D  1 18  ? 99.833  135.587 127.650 1.00 57.62  ? 39  ALA D CB  1 
ATOM   7382  N  N   . SER D  1 19  ? 97.825  135.807 130.109 1.00 49.00  ? 40  SER D N   1 
ATOM   7383  C  CA  . SER D  1 19  ? 97.468  136.255 131.475 1.00 45.22  ? 40  SER D CA  1 
ATOM   7384  C  C   . SER D  1 19  ? 97.113  135.039 132.329 1.00 45.00  ? 40  SER D C   1 
ATOM   7385  O  O   . SER D  1 19  ? 97.638  134.940 133.468 1.00 43.38  ? 40  SER D O   1 
ATOM   7386  C  CB  . SER D  1 19  ? 96.387  137.303 131.423 1.00 44.25  ? 40  SER D CB  1 
ATOM   7387  O  OG  . SER D  1 19  ? 96.853  138.486 130.740 1.00 44.54  ? 40  SER D OG  1 
ATOM   7388  N  N   . LEU D  1 20  ? 96.277  134.116 131.823 1.00 47.31  ? 41  LEU D N   1 
ATOM   7389  C  CA  . LEU D  1 20  ? 95.887  132.882 132.579 1.00 47.36  ? 41  LEU D CA  1 
ATOM   7390  C  C   . LEU D  1 20  ? 97.075  131.926 132.630 1.00 49.04  ? 41  LEU D C   1 
ATOM   7391  O  O   . LEU D  1 20  ? 97.350  131.368 133.733 1.00 46.40  ? 41  LEU D O   1 
ATOM   7392  C  CB  . LEU D  1 20  ? 94.645  132.230 131.974 1.00 48.17  ? 41  LEU D CB  1 
ATOM   7393  C  CG  . LEU D  1 20  ? 93.364  133.006 132.253 1.00 47.21  ? 41  LEU D CG  1 
ATOM   7394  C  CD1 . LEU D  1 20  ? 92.232  132.542 131.329 1.00 49.00  ? 41  LEU D CD1 1 
ATOM   7395  C  CD2 . LEU D  1 20  ? 92.996  132.906 133.739 1.00 44.81  ? 41  LEU D CD2 1 
ATOM   7396  N  N   . THR D  1 21  ? 97.813  131.841 131.515 1.00 52.36  ? 42  THR D N   1 
ATOM   7397  C  CA  . THR D  1 21  ? 98.990  130.958 131.405 1.00 54.97  ? 42  THR D CA  1 
ATOM   7398  C  C   . THR D  1 21  ? 100.011 131.322 132.468 1.00 55.23  ? 42  THR D C   1 
ATOM   7399  O  O   . THR D  1 21  ? 100.632 130.413 132.977 1.00 58.81  ? 42  THR D O   1 
ATOM   7400  C  CB  . THR D  1 21  ? 99.569  130.950 129.996 1.00 57.78  ? 42  THR D CB  1 
ATOM   7401  O  OG1 . THR D  1 21  ? 98.582  130.239 129.257 1.00 57.80  ? 42  THR D OG1 1 
ATOM   7402  C  CG2 . THR D  1 21  ? 100.919 130.272 129.926 1.00 59.18  ? 42  THR D CG2 1 
ATOM   7403  N  N   . LEU D  1 22  ? 100.097 132.585 132.860 1.00 55.02  ? 43  LEU D N   1 
ATOM   7404  C  CA  . LEU D  1 22  ? 101.097 133.063 133.836 1.00 53.12  ? 43  LEU D CA  1 
ATOM   7405  C  C   . LEU D  1 22  ? 100.655 132.657 135.259 1.00 52.46  ? 43  LEU D C   1 
ATOM   7406  O  O   . LEU D  1 22  ? 101.526 132.295 136.108 1.00 53.57  ? 43  LEU D O   1 
ATOM   7407  C  CB  . LEU D  1 22  ? 101.158 134.583 133.642 1.00 52.70  ? 43  LEU D CB  1 
ATOM   7408  C  CG  . LEU D  1 22  ? 102.408 135.301 134.138 1.00 51.22  ? 43  LEU D CG  1 
ATOM   7409  C  CD1 . LEU D  1 22  ? 103.662 134.655 133.600 1.00 52.87  ? 43  LEU D CD1 1 
ATOM   7410  C  CD2 . LEU D  1 22  ? 102.355 136.759 133.740 1.00 50.44  ? 43  LEU D CD2 1 
ATOM   7411  N  N   . ILE D  1 23  ? 99.353  132.758 135.566 1.00 49.56  ? 44  ILE D N   1 
ATOM   7412  C  CA  . ILE D  1 23  ? 98.811  132.326 136.880 1.00 44.96  ? 44  ILE D CA  1 
ATOM   7413  C  C   . ILE D  1 23  ? 98.924  130.792 136.939 1.00 44.72  ? 44  ILE D C   1 
ATOM   7414  O  O   . ILE D  1 23  ? 99.394  130.284 137.943 1.00 43.14  ? 44  ILE D O   1 
ATOM   7415  C  CB  . ILE D  1 23  ? 97.378  132.852 137.097 1.00 44.04  ? 44  ILE D CB  1 
ATOM   7416  C  CG1 . ILE D  1 23  ? 97.280  134.366 136.964 1.00 43.71  ? 44  ILE D CG1 1 
ATOM   7417  C  CG2 . ILE D  1 23  ? 96.842  132.428 138.448 1.00 42.05  ? 44  ILE D CG2 1 
ATOM   7418  C  CD1 . ILE D  1 23  ? 98.050  135.099 138.040 1.00 42.69  ? 44  ILE D CD1 1 
ATOM   7419  N  N   . ARG D  1 24  ? 98.564  130.068 135.883 1.00 45.81  ? 45  ARG D N   1 
ATOM   7420  C  CA  . ARG D  1 24  ? 98.638  128.584 135.887 1.00 46.96  ? 45  ARG D CA  1 
ATOM   7421  C  C   . ARG D  1 24  ? 100.060 128.146 136.281 1.00 45.83  ? 45  ARG D C   1 
ATOM   7422  O  O   . ARG D  1 24  ? 100.203 127.266 137.151 1.00 44.63  ? 45  ARG D O   1 
ATOM   7423  C  CB  . ARG D  1 24  ? 98.228  127.988 134.533 1.00 50.18  ? 45  ARG D CB  1 
ATOM   7424  C  CG  . ARG D  1 24  ? 98.302  126.468 134.445 1.00 52.86  ? 45  ARG D CG  1 
ATOM   7425  C  CD  . ARG D  1 24  ? 97.669  125.891 133.183 1.00 56.43  ? 45  ARG D CD  1 
ATOM   7426  N  NE  . ARG D  1 24  ? 96.379  126.526 132.867 1.00 58.53  ? 45  ARG D NE  1 
ATOM   7427  C  CZ  . ARG D  1 24  ? 96.176  127.569 132.010 1.00 60.66  ? 45  ARG D CZ  1 
ATOM   7428  N  NH1 . ARG D  1 24  ? 97.203  128.096 131.347 1.00 61.83  ? 45  ARG D NH1 1 
ATOM   7429  N  NH2 . ARG D  1 24  ? 94.948  128.072 131.809 1.00 59.53  ? 45  ARG D NH2 1 
ATOM   7430  N  N   . GLU D  1 25  ? 101.075 128.704 135.645 1.00 45.48  ? 46  GLU D N   1 
ATOM   7431  C  CA  . GLU D  1 25  ? 102.441 128.144 135.737 1.00 46.67  ? 46  GLU D CA  1 
ATOM   7432  C  C   . GLU D  1 25  ? 102.953 128.449 137.146 1.00 45.45  ? 46  GLU D C   1 
ATOM   7433  O  O   . GLU D  1 25  ? 103.609 127.584 137.741 1.00 46.07  ? 46  GLU D O   1 
ATOM   7434  C  CB  . GLU D  1 25  ? 103.318 128.663 134.592 1.00 47.74  ? 46  GLU D CB  1 
ATOM   7435  C  CG  . GLU D  1 25  ? 102.845 128.273 133.196 1.00 49.58  ? 46  GLU D CG  1 
ATOM   7436  C  CD  . GLU D  1 25  ? 102.979 126.799 132.799 1.00 51.35  ? 46  GLU D CD  1 
ATOM   7437  O  OE1 . GLU D  1 25  ? 103.603 126.056 133.550 1.00 50.91  ? 46  GLU D OE1 1 
ATOM   7438  O  OE2 . GLU D  1 25  ? 102.442 126.400 131.736 1.00 52.72  ? 46  GLU D OE2 1 
ATOM   7439  N  N   . ARG D  1 26  ? 102.650 129.643 137.664 1.00 45.05  ? 47  ARG D N   1 
ATOM   7440  C  CA  . ARG D  1 26  ? 103.077 130.047 139.033 1.00 44.49  ? 47  ARG D CA  1 
ATOM   7441  C  C   . ARG D  1 26  ? 102.390 129.171 140.087 1.00 42.24  ? 47  ARG D C   1 
ATOM   7442  O  O   . ARG D  1 26  ? 103.092 128.678 140.970 1.00 40.76  ? 47  ARG D O   1 
ATOM   7443  C  CB  . ARG D  1 26  ? 102.866 131.552 139.220 1.00 46.79  ? 47  ARG D CB  1 
ATOM   7444  C  CG  . ARG D  1 26  ? 103.943 132.393 138.548 1.00 51.24  ? 47  ARG D CG  1 
ATOM   7445  C  CD  . ARG D  1 26  ? 103.519 133.693 137.896 1.00 50.80  ? 47  ARG D CD  1 
ATOM   7446  N  NE  . ARG D  1 26  ? 102.673 134.484 138.767 1.00 50.94  ? 47  ARG D NE  1 
ATOM   7447  C  CZ  . ARG D  1 26  ? 102.141 135.643 138.434 1.00 51.42  ? 47  ARG D CZ  1 
ATOM   7448  N  NH1 . ARG D  1 26  ? 102.371 136.160 137.244 1.00 54.44  ? 47  ARG D NH1 1 
ATOM   7449  N  NH2 . ARG D  1 26  ? 101.373 136.281 139.288 1.00 51.21  ? 47  ARG D NH2 1 
ATOM   7450  N  N   . ALA D  1 27  ? 101.084 128.937 139.937 1.00 40.21  ? 48  ALA D N   1 
ATOM   7451  C  CA  . ALA D  1 27  ? 100.296 128.070 140.839 1.00 38.81  ? 48  ALA D CA  1 
ATOM   7452  C  C   . ALA D  1 27  ? 100.842 126.637 140.788 1.00 39.33  ? 48  ALA D C   1 
ATOM   7453  O  O   . ALA D  1 27  ? 100.856 125.953 141.834 1.00 38.28  ? 48  ALA D O   1 
ATOM   7454  C  CB  . ALA D  1 27  ? 98.843  128.139 140.464 1.00 39.11  ? 48  ALA D CB  1 
ATOM   7455  N  N   . LYS D  1 28  ? 101.372 126.226 139.646 1.00 40.51  ? 49  LYS D N   1 
ATOM   7456  C  CA  . LYS D  1 28  ? 101.938 124.870 139.510 1.00 42.34  ? 49  LYS D CA  1 
ATOM   7457  C  C   . LYS D  1 28  ? 103.178 124.775 140.394 1.00 41.57  ? 49  LYS D C   1 
ATOM   7458  O  O   . LYS D  1 28  ? 103.338 123.761 141.113 1.00 41.53  ? 49  LYS D O   1 
ATOM   7459  C  CB  . LYS D  1 28  ? 102.248 124.584 138.050 1.00 44.52  ? 49  LYS D CB  1 
ATOM   7460  C  CG  . LYS D  1 28  ? 102.681 123.166 137.743 1.00 47.03  ? 49  LYS D CG  1 
ATOM   7461  C  CD  . LYS D  1 28  ? 102.502 122.864 136.276 1.00 49.33  ? 49  LYS D CD  1 
ATOM   7462  C  CE  . LYS D  1 28  ? 103.199 121.609 135.814 1.00 51.98  ? 49  LYS D CE  1 
ATOM   7463  N  NZ  . LYS D  1 28  ? 104.614 121.605 136.243 1.00 52.46  ? 49  LYS D NZ  1 
ATOM   7464  N  N   . LEU D  1 29  ? 104.029 125.794 140.348 1.00 40.74  ? 50  LEU D N   1 
ATOM   7465  C  CA  . LEU D  1 29  ? 105.264 125.792 141.154 1.00 40.54  ? 50  LEU D CA  1 
ATOM   7466  C  C   . LEU D  1 29  ? 104.899 125.802 142.637 1.00 38.94  ? 50  LEU D C   1 
ATOM   7467  O  O   . LEU D  1 29  ? 105.610 125.149 143.396 1.00 39.21  ? 50  LEU D O   1 
ATOM   7468  C  CB  . LEU D  1 29  ? 106.117 126.998 140.779 1.00 40.58  ? 50  LEU D CB  1 
ATOM   7469  C  CG  . LEU D  1 29  ? 106.670 126.990 139.364 1.00 42.83  ? 50  LEU D CG  1 
ATOM   7470  C  CD1 . LEU D  1 29  ? 107.702 128.096 139.189 1.00 42.71  ? 50  LEU D CD1 1 
ATOM   7471  C  CD2 . LEU D  1 29  ? 107.280 125.625 139.004 1.00 45.09  ? 50  LEU D CD2 1 
ATOM   7472  N  N   . LYS D  1 30  ? 103.836 126.491 143.042 1.00 37.78  ? 51  LYS D N   1 
ATOM   7473  C  CA  . LYS D  1 30  ? 103.496 126.609 144.483 1.00 37.32  ? 51  LYS D CA  1 
ATOM   7474  C  C   . LYS D  1 30  ? 102.861 125.289 144.961 1.00 38.02  ? 51  LYS D C   1 
ATOM   7475  O  O   . LYS D  1 30  ? 103.193 124.808 146.059 1.00 36.81  ? 51  LYS D O   1 
ATOM   7476  C  CB  . LYS D  1 30  ? 102.602 127.826 144.751 1.00 36.25  ? 51  LYS D CB  1 
ATOM   7477  C  CG  . LYS D  1 30  ? 103.164 129.183 144.334 1.00 35.88  ? 51  LYS D CG  1 
ATOM   7478  C  CD  . LYS D  1 30  ? 104.596 129.428 144.722 1.00 36.59  ? 51  LYS D CD  1 
ATOM   7479  C  CE  . LYS D  1 30  ? 105.115 130.752 144.174 1.00 36.90  ? 51  LYS D CE  1 
ATOM   7480  N  NZ  . LYS D  1 30  ? 106.406 131.144 144.780 1.00 36.84  ? 51  LYS D NZ  1 
ATOM   7481  N  N   . GLY D  1 31  ? 101.996 124.700 144.160 1.00 38.97  ? 52  GLY D N   1 
ATOM   7482  C  CA  . GLY D  1 31  ? 101.397 123.420 144.538 1.00 40.46  ? 52  GLY D CA  1 
ATOM   7483  C  C   . GLY D  1 31  ? 102.453 122.360 144.687 1.00 42.64  ? 52  GLY D C   1 
ATOM   7484  O  O   . GLY D  1 31  ? 102.371 121.567 145.621 1.00 43.19  ? 52  GLY D O   1 
ATOM   7485  N  N   . GLU D  1 32  ? 103.398 122.312 143.756 1.00 45.21  ? 53  GLU D N   1 
ATOM   7486  C  CA  . GLU D  1 32  ? 104.477 121.292 143.737 1.00 46.96  ? 53  GLU D CA  1 
ATOM   7487  C  C   . GLU D  1 32  ? 105.315 121.438 145.006 1.00 45.17  ? 53  GLU D C   1 
ATOM   7488  O  O   . GLU D  1 32  ? 105.618 120.435 145.636 1.00 45.39  ? 53  GLU D O   1 
ATOM   7489  C  CB  . GLU D  1 32  ? 105.266 121.440 142.439 1.00 49.57  ? 53  GLU D CB  1 
ATOM   7490  C  CG  . GLU D  1 32  ? 104.447 120.878 141.287 1.00 52.58  ? 53  GLU D CG  1 
ATOM   7491  C  CD  . GLU D  1 32  ? 105.087 120.777 139.919 1.00 55.54  ? 53  GLU D CD  1 
ATOM   7492  O  OE1 . GLU D  1 32  ? 104.493 120.086 139.078 1.00 59.07  ? 53  GLU D OE1 1 
ATOM   7493  O  OE2 . GLU D  1 32  ? 106.149 121.406 139.686 1.00 57.65  ? 53  GLU D OE2 1 
ATOM   7494  N  N   . LEU D  1 33  ? 105.600 122.674 145.399 1.00 43.39  ? 54  LEU D N   1 
ATOM   7495  C  CA  . LEU D  1 33  ? 106.375 122.988 146.629 1.00 42.11  ? 54  LEU D CA  1 
ATOM   7496  C  C   . LEU D  1 33  ? 105.613 122.514 147.876 1.00 40.70  ? 54  LEU D C   1 
ATOM   7497  O  O   . LEU D  1 33  ? 106.191 121.829 148.719 1.00 40.51  ? 54  LEU D O   1 
ATOM   7498  C  CB  . LEU D  1 33  ? 106.608 124.495 146.668 1.00 40.94  ? 54  LEU D CB  1 
ATOM   7499  C  CG  . LEU D  1 33  ? 107.251 125.009 147.945 1.00 40.73  ? 54  LEU D CG  1 
ATOM   7500  C  CD1 . LEU D  1 33  ? 108.512 124.216 148.266 1.00 42.33  ? 54  LEU D CD1 1 
ATOM   7501  C  CD2 . LEU D  1 33  ? 107.579 126.488 147.800 1.00 39.80  ? 54  LEU D CD2 1 
ATOM   7502  N  N   . VAL D  1 34  ? 104.340 122.885 147.989 1.00 39.41  ? 55  VAL D N   1 
ATOM   7503  C  CA  . VAL D  1 34  ? 103.471 122.496 149.128 1.00 38.86  ? 55  VAL D CA  1 
ATOM   7504  C  C   . VAL D  1 34  ? 103.409 120.967 149.205 1.00 40.88  ? 55  VAL D C   1 
ATOM   7505  O  O   . VAL D  1 34  ? 103.598 120.409 150.310 1.00 41.19  ? 55  VAL D O   1 
ATOM   7506  C  CB  . VAL D  1 34  ? 102.078 123.135 149.010 1.00 37.38  ? 55  VAL D CB  1 
ATOM   7507  C  CG1 . VAL D  1 34  ? 101.112 122.556 150.025 1.00 37.58  ? 55  VAL D CG1 1 
ATOM   7508  C  CG2 . VAL D  1 34  ? 102.166 124.627 149.169 1.00 35.64  ? 55  VAL D CG2 1 
ATOM   7509  N  N   . ARG D  1 35  ? 103.218 120.304 148.073 1.00 42.53  ? 56  ARG D N   1 
ATOM   7510  C  CA  . ARG D  1 35  ? 102.994 118.837 148.041 1.00 44.84  ? 56  ARG D CA  1 
ATOM   7511  C  C   . ARG D  1 35  ? 104.287 118.130 148.441 1.00 46.68  ? 56  ARG D C   1 
ATOM   7512  O  O   . ARG D  1 35  ? 104.208 117.110 149.150 1.00 47.37  ? 56  ARG D O   1 
ATOM   7513  C  CB  . ARG D  1 35  ? 102.467 118.434 146.665 1.00 46.06  ? 56  ARG D CB  1 
ATOM   7514  C  CG  . ARG D  1 35  ? 101.038 118.894 146.410 1.00 45.22  ? 56  ARG D CG  1 
ATOM   7515  C  CD  . ARG D  1 35  ? 100.428 118.148 145.228 1.00 47.47  ? 56  ARG D CD  1 
ATOM   7516  N  NE  . ARG D  1 35  ? 101.011 118.598 143.963 1.00 47.89  ? 56  ARG D NE  1 
ATOM   7517  C  CZ  . ARG D  1 35  ? 100.617 119.665 143.271 1.00 47.11  ? 56  ARG D CZ  1 
ATOM   7518  N  NH1 . ARG D  1 35  ? 99.611  120.428 143.689 1.00 45.86  ? 56  ARG D NH1 1 
ATOM   7519  N  NH2 . ARG D  1 35  ? 101.240 119.971 142.148 1.00 47.94  ? 56  ARG D NH2 1 
ATOM   7520  N  N   . LEU D  1 36  ? 105.429 118.682 148.044 1.00 47.95  ? 57  LEU D N   1 
ATOM   7521  C  CA  . LEU D  1 36  ? 106.754 118.085 148.314 1.00 50.46  ? 57  LEU D CA  1 
ATOM   7522  C  C   . LEU D  1 36  ? 107.117 118.224 149.798 1.00 49.93  ? 57  LEU D C   1 
ATOM   7523  O  O   . LEU D  1 36  ? 107.788 117.329 150.326 1.00 51.68  ? 57  LEU D O   1 
ATOM   7524  C  CB  . LEU D  1 36  ? 107.765 118.766 147.398 1.00 52.42  ? 57  LEU D CB  1 
ATOM   7525  C  CG  . LEU D  1 36  ? 109.186 118.191 147.401 1.00 55.45  ? 57  LEU D CG  1 
ATOM   7526  C  CD1 . LEU D  1 36  ? 109.760 118.199 145.984 1.00 56.92  ? 57  LEU D CD1 1 
ATOM   7527  C  CD2 . LEU D  1 36  ? 110.097 118.999 148.336 1.00 54.92  ? 57  LEU D CD2 1 
ATOM   7528  N  N   . LEU D  1 37  ? 106.695 119.280 150.485 1.00 48.15  ? 58  LEU D N   1 
ATOM   7529  C  CA  . LEU D  1 37  ? 106.928 119.372 151.948 1.00 47.62  ? 58  LEU D CA  1 
ATOM   7530  C  C   . LEU D  1 37  ? 105.999 118.403 152.698 1.00 48.61  ? 58  LEU D C   1 
ATOM   7531  O  O   . LEU D  1 37  ? 106.418 117.921 153.739 1.00 49.68  ? 58  LEU D O   1 
ATOM   7532  C  CB  . LEU D  1 37  ? 106.724 120.812 152.388 1.00 46.32  ? 58  LEU D CB  1 
ATOM   7533  C  CG  . LEU D  1 37  ? 107.691 121.799 151.751 1.00 45.70  ? 58  LEU D CG  1 
ATOM   7534  C  CD1 . LEU D  1 37  ? 107.195 123.212 151.944 1.00 43.95  ? 58  LEU D CD1 1 
ATOM   7535  C  CD2 . LEU D  1 37  ? 109.079 121.625 152.336 1.00 46.15  ? 58  LEU D CD2 1 
ATOM   7536  N  N   . GLY D  1 38  ? 104.818 118.063 152.163 1.00 49.61  ? 59  GLY D N   1 
ATOM   7537  C  CA  . GLY D  1 38  ? 103.934 117.001 152.707 1.00 49.65  ? 59  GLY D CA  1 
ATOM   7538  C  C   . GLY D  1 38  ? 103.125 117.499 153.911 1.00 48.14  ? 59  GLY D C   1 
ATOM   7539  O  O   . GLY D  1 38  ? 103.539 118.485 154.543 1.00 44.74  ? 59  GLY D O   1 
ATOM   7540  N  N   . GLY D  1 39  ? 101.971 116.875 154.185 1.00 48.50  ? 60  GLY D N   1 
ATOM   7541  C  CA  . GLY D  1 39  ? 101.220 117.024 155.449 1.00 47.92  ? 60  GLY D CA  1 
ATOM   7542  C  C   . GLY D  1 39  ? 100.062 118.017 155.410 1.00 46.81  ? 60  GLY D C   1 
ATOM   7543  O  O   . GLY D  1 39  ? 99.131  117.839 156.255 1.00 48.05  ? 60  GLY D O   1 
ATOM   7544  N  N   . ALA D  1 40  ? 100.094 119.041 154.541 1.00 43.97  ? 61  ALA D N   1 
ATOM   7545  C  CA  . ALA D  1 40  ? 99.028  120.069 154.465 1.00 42.19  ? 61  ALA D CA  1 
ATOM   7546  C  C   . ALA D  1 40  ? 97.709  119.456 153.982 1.00 42.03  ? 61  ALA D C   1 
ATOM   7547  O  O   . ALA D  1 40  ? 97.744  118.775 152.978 1.00 42.93  ? 61  ALA D O   1 
ATOM   7548  C  CB  . ALA D  1 40  ? 99.430  121.199 153.545 1.00 41.17  ? 61  ALA D CB  1 
ATOM   7549  N  N   . LYS D  1 41  ? 96.604  119.793 154.641 1.00 41.15  ? 62  LYS D N   1 
ATOM   7550  C  CA  . LYS D  1 41  ? 95.211  119.609 154.177 1.00 42.72  ? 62  LYS D CA  1 
ATOM   7551  C  C   . LYS D  1 41  ? 94.743  120.824 153.383 1.00 39.53  ? 62  LYS D C   1 
ATOM   7552  O  O   . LYS D  1 41  ? 93.969  120.694 152.491 1.00 39.66  ? 62  LYS D O   1 
ATOM   7553  C  CB  . LYS D  1 41  ? 94.341  119.398 155.410 1.00 45.83  ? 62  LYS D CB  1 
ATOM   7554  C  CG  . LYS D  1 41  ? 94.803  118.188 156.206 1.00 52.10  ? 62  LYS D CG  1 
ATOM   7555  C  CD  . LYS D  1 41  ? 93.816  117.638 157.221 1.00 57.11  ? 62  LYS D CD  1 
ATOM   7556  C  CE  . LYS D  1 41  ? 94.362  116.416 157.925 1.00 61.42  ? 62  LYS D CE  1 
ATOM   7557  N  NZ  . LYS D  1 41  ? 93.426  115.968 158.988 1.00 67.02  ? 62  LYS D NZ  1 
ATOM   7558  N  N   . ALA D  1 42  ? 95.223  121.995 153.744 1.00 37.72  ? 63  ALA D N   1 
ATOM   7559  C  CA  . ALA D  1 42  ? 94.892  123.276 153.102 1.00 35.81  ? 63  ALA D CA  1 
ATOM   7560  C  C   . ALA D  1 42  ? 96.073  124.227 153.295 1.00 34.34  ? 63  ALA D C   1 
ATOM   7561  O  O   . ALA D  1 42  ? 96.739  124.180 154.336 1.00 33.81  ? 63  ALA D O   1 
ATOM   7562  C  CB  . ALA D  1 42  ? 93.597  123.814 153.653 1.00 34.87  ? 63  ALA D CB  1 
ATOM   7563  N  N   . SER D  1 43  ? 96.323  125.033 152.270 1.00 33.99  ? 64  SER D N   1 
ATOM   7564  C  CA  . SER D  1 43  ? 97.475  125.945 152.140 1.00 33.86  ? 64  SER D CA  1 
ATOM   7565  C  C   . SER D  1 43  ? 96.987  127.201 151.429 1.00 32.93  ? 64  SER D C   1 
ATOM   7566  O  O   . SER D  1 43  ? 96.674  127.124 150.211 1.00 34.01  ? 64  SER D O   1 
ATOM   7567  C  CB  . SER D  1 43  ? 98.594  125.298 151.367 1.00 34.56  ? 64  SER D CB  1 
ATOM   7568  O  OG  . SER D  1 43  ? 99.047  124.210 152.104 1.00 35.41  ? 64  SER D OG  1 
ATOM   7569  N  N   . THR D  1 44  ? 96.918  128.271 152.182 1.00 30.78  ? 65  THR D N   1 
ATOM   7570  C  CA  . THR D  1 44  ? 96.546  129.609 151.699 1.00 30.06  ? 65  THR D CA  1 
ATOM   7571  C  C   . THR D  1 44  ? 97.504  130.047 150.577 1.00 30.11  ? 65  THR D C   1 
ATOM   7572  O  O   . THR D  1 44  ? 98.745  129.963 150.741 1.00 30.02  ? 65  THR D O   1 
ATOM   7573  C  CB  . THR D  1 44  ? 96.583  130.645 152.828 1.00 28.66  ? 65  THR D CB  1 
ATOM   7574  O  OG1 . THR D  1 44  ? 95.748  130.228 153.915 1.00 27.88  ? 65  THR D OG1 1 
ATOM   7575  C  CG2 . THR D  1 44  ? 96.165  132.010 152.310 1.00 28.84  ? 65  THR D CG2 1 
ATOM   7576  N  N   . SER D  1 45  ? 96.942  130.467 149.448 1.00 29.89  ? 66  SER D N   1 
ATOM   7577  C  CA  . SER D  1 45  ? 97.726  131.031 148.331 1.00 29.80  ? 66  SER D CA  1 
ATOM   7578  C  C   . SER D  1 45  ? 97.132  132.379 147.947 1.00 28.13  ? 66  SER D C   1 
ATOM   7579  O  O   . SER D  1 45  ? 95.977  132.413 147.639 1.00 27.36  ? 66  SER D O   1 
ATOM   7580  C  CB  . SER D  1 45  ? 97.825  130.071 147.195 1.00 31.69  ? 66  SER D CB  1 
ATOM   7581  O  OG  . SER D  1 45  ? 98.984  130.381 146.429 1.00 32.86  ? 66  SER D OG  1 
ATOM   7582  N  N   . LEU D  1 46  ? 97.926  133.441 148.065 1.00 27.54  ? 67  LEU D N   1 
ATOM   7583  C  CA  . LEU D  1 46  ? 97.526  134.818 147.697 1.00 27.15  ? 67  LEU D CA  1 
ATOM   7584  C  C   . LEU D  1 46  ? 97.335  134.892 146.184 1.00 28.38  ? 67  LEU D C   1 
ATOM   7585  O  O   . LEU D  1 46  ? 98.213  134.458 145.485 1.00 30.09  ? 67  LEU D O   1 
ATOM   7586  C  CB  . LEU D  1 46  ? 98.612  135.806 148.126 1.00 26.52  ? 67  LEU D CB  1 
ATOM   7587  C  CG  . LEU D  1 46  ? 98.958  135.800 149.607 1.00 26.19  ? 67  LEU D CG  1 
ATOM   7588  C  CD1 . LEU D  1 46  ? 99.817  136.977 149.957 1.00 26.74  ? 67  LEU D CD1 1 
ATOM   7589  C  CD2 . LEU D  1 46  ? 97.721  135.807 150.498 1.00 25.71  ? 67  LEU D CD2 1 
ATOM   7590  N  N   . LEU D  1 47  ? 96.228  135.467 145.730 1.00 28.60  ? 68  LEU D N   1 
ATOM   7591  C  CA  . LEU D  1 47  ? 95.995  135.902 144.336 1.00 29.60  ? 68  LEU D CA  1 
ATOM   7592  C  C   . LEU D  1 47  ? 95.628  137.374 144.380 1.00 28.86  ? 68  LEU D C   1 
ATOM   7593  O  O   . LEU D  1 47  ? 94.677  137.718 145.059 1.00 29.70  ? 68  LEU D O   1 
ATOM   7594  C  CB  . LEU D  1 47  ? 94.889  135.049 143.696 1.00 30.36  ? 68  LEU D CB  1 
ATOM   7595  C  CG  . LEU D  1 47  ? 94.459  135.507 142.303 1.00 31.27  ? 68  LEU D CG  1 
ATOM   7596  C  CD1 . LEU D  1 47  ? 95.595  135.320 141.312 1.00 32.16  ? 68  LEU D CD1 1 
ATOM   7597  C  CD2 . LEU D  1 47  ? 93.228  134.741 141.862 1.00 32.09  ? 68  LEU D CD2 1 
ATOM   7598  N  N   . GLY D  1 48  ? 96.406  138.224 143.734 1.00 29.68  ? 69  GLY D N   1 
ATOM   7599  C  CA  . GLY D  1 48  ? 96.143  139.672 143.675 1.00 29.21  ? 69  GLY D CA  1 
ATOM   7600  C  C   . GLY D  1 48  ? 95.206  139.968 142.538 1.00 29.46  ? 69  GLY D C   1 
ATOM   7601  O  O   . GLY D  1 48  ? 95.466  139.430 141.462 1.00 32.51  ? 69  GLY D O   1 
ATOM   7602  N  N   . VAL D  1 49  ? 94.214  140.828 142.760 1.00 29.02  ? 70  VAL D N   1 
ATOM   7603  C  CA  . VAL D  1 49  ? 93.323  141.433 141.725 1.00 29.97  ? 70  VAL D CA  1 
ATOM   7604  C  C   . VAL D  1 49  ? 93.347  142.966 141.803 1.00 29.33  ? 70  VAL D C   1 
ATOM   7605  O  O   . VAL D  1 49  ? 92.530  143.596 142.481 1.00 29.25  ? 70  VAL D O   1 
ATOM   7606  C  CB  . VAL D  1 49  ? 91.894  140.882 141.818 1.00 30.49  ? 70  VAL D CB  1 
ATOM   7607  C  CG1 . VAL D  1 49  ? 91.088  141.345 140.599 1.00 31.41  ? 70  VAL D CG1 1 
ATOM   7608  C  CG2 . VAL D  1 49  ? 91.893  139.351 141.909 1.00 30.65  ? 70  VAL D CG2 1 
ATOM   7609  N  N   . PRO D  1 50  ? 94.334  143.608 141.147 1.00 28.68  ? 71  PRO D N   1 
ATOM   7610  C  CA  . PRO D  1 50  ? 94.489  145.060 141.189 1.00 28.45  ? 71  PRO D CA  1 
ATOM   7611  C  C   . PRO D  1 50  ? 93.476  145.791 140.289 1.00 29.30  ? 71  PRO D C   1 
ATOM   7612  O  O   . PRO D  1 50  ? 93.795  146.181 139.222 1.00 28.81  ? 71  PRO D O   1 
ATOM   7613  C  CB  . PRO D  1 50  ? 95.923  145.297 140.706 1.00 28.80  ? 71  PRO D CB  1 
ATOM   7614  C  CG  . PRO D  1 50  ? 96.270  144.081 139.894 1.00 29.88  ? 71  PRO D CG  1 
ATOM   7615  C  CD  . PRO D  1 50  ? 95.444  142.943 140.452 1.00 29.36  ? 71  PRO D CD  1 
ATOM   7616  N  N   . LEU D  1 51  ? 92.247  145.890 140.776 1.00 29.42  ? 72  LEU D N   1 
ATOM   7617  C  CA  . LEU D  1 51  ? 91.114  146.469 140.032 1.00 30.44  ? 72  LEU D CA  1 
ATOM   7618  C  C   . LEU D  1 51  ? 90.465  147.548 140.899 1.00 29.19  ? 72  LEU D C   1 
ATOM   7619  O  O   . LEU D  1 51  ? 90.132  147.214 142.058 1.00 28.17  ? 72  LEU D O   1 
ATOM   7620  C  CB  . LEU D  1 51  ? 90.180  145.291 139.741 1.00 31.83  ? 72  LEU D CB  1 
ATOM   7621  C  CG  . LEU D  1 51  ? 89.013  145.582 138.806 1.00 33.76  ? 72  LEU D CG  1 
ATOM   7622  C  CD1 . LEU D  1 51  ? 88.496  144.306 138.153 1.00 35.15  ? 72  LEU D CD1 1 
ATOM   7623  C  CD2 . LEU D  1 51  ? 87.921  146.251 139.611 1.00 33.74  ? 72  LEU D CD2 1 
ATOM   7624  N  N   . GLY D  1 52  ? 90.306  148.772 140.372 1.00 28.75  ? 73  GLY D N   1 
ATOM   7625  C  CA  . GLY D  1 52  ? 89.671  149.893 141.091 1.00 27.96  ? 73  GLY D CA  1 
ATOM   7626  C  C   . GLY D  1 52  ? 88.563  150.589 140.306 1.00 28.84  ? 73  GLY D C   1 
ATOM   7627  O  O   . GLY D  1 52  ? 87.921  151.532 140.850 1.00 28.00  ? 73  GLY D O   1 
ATOM   7628  N  N   . HIS D  1 53  ? 88.302  150.201 139.068 1.00 29.96  ? 74  HIS D N   1 
ATOM   7629  C  CA  . HIS D  1 53  ? 87.486  151.086 138.182 1.00 31.50  ? 74  HIS D CA  1 
ATOM   7630  C  C   . HIS D  1 53  ? 85.985  150.870 138.460 1.00 31.58  ? 74  HIS D C   1 
ATOM   7631  O  O   . HIS D  1 53  ? 85.156  151.556 137.885 1.00 32.10  ? 74  HIS D O   1 
ATOM   7632  C  CB  . HIS D  1 53  ? 87.874  150.879 136.725 1.00 33.01  ? 74  HIS D CB  1 
ATOM   7633  C  CG  . HIS D  1 53  ? 87.555  149.517 136.210 1.00 33.45  ? 74  HIS D CG  1 
ATOM   7634  N  ND1 . HIS D  1 53  ? 88.368  148.438 136.436 1.00 32.99  ? 74  HIS D ND1 1 
ATOM   7635  C  CD2 . HIS D  1 53  ? 86.552  149.074 135.434 1.00 34.86  ? 74  HIS D CD2 1 
ATOM   7636  C  CE1 . HIS D  1 53  ? 87.875  147.393 135.820 1.00 34.00  ? 74  HIS D CE1 1 
ATOM   7637  N  NE2 . HIS D  1 53  ? 86.782  147.763 135.181 1.00 35.11  ? 74  HIS D NE2 1 
ATOM   7638  N  N   . ASN D  1 54  ? 85.648  149.968 139.380 1.00 31.03  ? 75  ASN D N   1 
ATOM   7639  C  CA  . ASN D  1 54  ? 84.235  149.704 139.774 1.00 30.83  ? 75  ASN D CA  1 
ATOM   7640  C  C   . ASN D  1 54  ? 83.948  150.492 141.042 1.00 30.67  ? 75  ASN D C   1 
ATOM   7641  O  O   . ASN D  1 54  ? 82.813  150.415 141.506 1.00 32.52  ? 75  ASN D O   1 
ATOM   7642  C  CB  . ASN D  1 54  ? 83.948  148.210 139.879 1.00 29.99  ? 75  ASN D CB  1 
ATOM   7643  C  CG  . ASN D  1 54  ? 83.829  147.575 138.506 1.00 30.68  ? 75  ASN D CG  1 
ATOM   7644  O  OD1 . ASN D  1 54  ? 83.244  148.159 137.595 1.00 31.03  ? 75  ASN D OD1 1 
ATOM   7645  N  ND2 . ASN D  1 54  ? 84.372  146.376 138.380 1.00 30.02  ? 75  ASN D ND2 1 
ATOM   7646  N  N   . SER D  1 55  ? 84.929  151.246 141.538 1.00 30.00  ? 76  SER D N   1 
ATOM   7647  C  CA  . SER D  1 55  ? 84.781  152.153 142.701 1.00 30.05  ? 76  SER D CA  1 
ATOM   7648  C  C   . SER D  1 55  ? 83.833  153.300 142.343 1.00 31.36  ? 76  SER D C   1 
ATOM   7649  O  O   . SER D  1 55  ? 83.839  153.758 141.196 1.00 31.93  ? 76  SER D O   1 
ATOM   7650  C  CB  . SER D  1 55  ? 86.132  152.672 143.202 1.00 29.56  ? 76  SER D CB  1 
ATOM   7651  O  OG  . SER D  1 55  ? 86.949  151.598 143.714 1.00 28.11  ? 76  SER D OG  1 
ATOM   7652  N  N   . SER D  1 56  ? 83.040  153.745 143.319 1.00 31.44  ? 77  SER D N   1 
ATOM   7653  C  CA  . SER D  1 56  ? 82.138  154.913 143.186 1.00 32.12  ? 77  SER D CA  1 
ATOM   7654  C  C   . SER D  1 56  ? 82.886  156.213 143.456 1.00 31.83  ? 77  SER D C   1 
ATOM   7655  O  O   . SER D  1 56  ? 82.339  157.244 143.160 1.00 32.08  ? 77  SER D O   1 
ATOM   7656  C  CB  . SER D  1 56  ? 80.932  154.772 144.096 1.00 32.20  ? 77  SER D CB  1 
ATOM   7657  O  OG  . SER D  1 56  ? 81.290  154.572 145.450 1.00 31.93  ? 77  SER D OG  1 
ATOM   7658  N  N   . PHE D  1 57  ? 84.021  156.202 144.148 1.00 30.99  ? 78  PHE D N   1 
ATOM   7659  C  CA  . PHE D  1 57  ? 84.564  157.477 144.680 1.00 30.54  ? 78  PHE D CA  1 
ATOM   7660  C  C   . PHE D  1 57  ? 86.049  157.645 144.333 1.00 29.70  ? 78  PHE D C   1 
ATOM   7661  O  O   . PHE D  1 57  ? 86.401  158.655 143.769 1.00 30.28  ? 78  PHE D O   1 
ATOM   7662  C  CB  . PHE D  1 57  ? 84.240  157.585 146.176 1.00 29.65  ? 78  PHE D CB  1 
ATOM   7663  C  CG  . PHE D  1 57  ? 84.606  158.932 146.754 1.00 29.51  ? 78  PHE D CG  1 
ATOM   7664  C  CD1 . PHE D  1 57  ? 83.913  160.074 146.362 1.00 29.98  ? 78  PHE D CD1 1 
ATOM   7665  C  CD2 . PHE D  1 57  ? 85.646  159.061 147.681 1.00 28.38  ? 78  PHE D CD2 1 
ATOM   7666  C  CE1 . PHE D  1 57  ? 84.247  161.311 146.896 1.00 30.22  ? 78  PHE D CE1 1 
ATOM   7667  C  CE2 . PHE D  1 57  ? 85.959  160.297 148.231 1.00 28.50  ? 78  PHE D CE2 1 
ATOM   7668  C  CZ  . PHE D  1 57  ? 85.259  161.417 147.825 1.00 29.54  ? 78  PHE D CZ  1 
ATOM   7669  N  N   . LEU D  1 58  ? 86.884  156.670 144.643 1.00 28.83  ? 79  LEU D N   1 
ATOM   7670  C  CA  . LEU D  1 58  ? 88.327  156.702 144.299 1.00 29.04  ? 79  LEU D CA  1 
ATOM   7671  C  C   . LEU D  1 58  ? 88.744  155.305 143.845 1.00 28.91  ? 79  LEU D C   1 
ATOM   7672  O  O   . LEU D  1 58  ? 88.303  154.312 144.476 1.00 28.12  ? 79  LEU D O   1 
ATOM   7673  C  CB  . LEU D  1 58  ? 89.117  157.140 145.540 1.00 28.22  ? 79  LEU D CB  1 
ATOM   7674  C  CG  . LEU D  1 58  ? 88.843  158.563 146.039 1.00 28.76  ? 79  LEU D CG  1 
ATOM   7675  C  CD1 . LEU D  1 58  ? 89.328  158.711 147.458 1.00 28.19  ? 79  LEU D CD1 1 
ATOM   7676  C  CD2 . LEU D  1 58  ? 89.470  159.639 145.146 1.00 29.38  ? 79  LEU D CD2 1 
ATOM   7677  N  N   . GLN D  1 59  ? 89.652  155.224 142.872 1.00 29.49  ? 80  GLN D N   1 
ATOM   7678  C  CA  . GLN D  1 59  ? 90.131  153.939 142.303 1.00 28.80  ? 80  GLN D CA  1 
ATOM   7679  C  C   . GLN D  1 59  ? 91.435  153.463 142.969 1.00 27.73  ? 80  GLN D C   1 
ATOM   7680  O  O   . GLN D  1 59  ? 91.969  152.422 142.536 1.00 27.01  ? 80  GLN D O   1 
ATOM   7681  C  CB  . GLN D  1 59  ? 90.234  154.134 140.805 1.00 30.23  ? 80  GLN D CB  1 
ATOM   7682  C  CG  . GLN D  1 59  ? 88.891  154.508 140.202 1.00 31.71  ? 80  GLN D CG  1 
ATOM   7683  C  CD  . GLN D  1 59  ? 88.966  154.438 138.698 1.00 33.77  ? 80  GLN D CD  1 
ATOM   7684  O  OE1 . GLN D  1 59  ? 89.590  153.538 138.136 1.00 35.23  ? 80  GLN D OE1 1 
ATOM   7685  N  NE2 . GLN D  1 59  ? 88.477  155.478 138.050 1.00 35.33  ? 80  GLN D NE2 1 
ATOM   7686  N  N   . GLY D  1 60  ? 91.898  154.125 144.036 1.00 27.00  ? 81  GLY D N   1 
ATOM   7687  C  CA  . GLY D  1 60  ? 93.099  153.735 144.804 1.00 26.20  ? 81  GLY D CA  1 
ATOM   7688  C  C   . GLY D  1 60  ? 93.297  152.238 145.068 1.00 25.47  ? 81  GLY D C   1 
ATOM   7689  O  O   . GLY D  1 60  ? 94.417  151.745 144.979 1.00 26.50  ? 81  GLY D O   1 
ATOM   7690  N  N   . PRO D  1 61  ? 92.294  151.440 145.461 1.00 25.12  ? 82  PRO D N   1 
ATOM   7691  C  CA  . PRO D  1 61  ? 92.513  150.013 145.734 1.00 24.96  ? 82  PRO D CA  1 
ATOM   7692  C  C   . PRO D  1 61  ? 93.143  149.211 144.574 1.00 25.85  ? 82  PRO D C   1 
ATOM   7693  O  O   . PRO D  1 61  ? 93.704  148.102 144.835 1.00 23.67  ? 82  PRO D O   1 
ATOM   7694  C  CB  . PRO D  1 61  ? 91.101  149.503 146.028 1.00 24.78  ? 82  PRO D CB  1 
ATOM   7695  C  CG  . PRO D  1 61  ? 90.401  150.722 146.596 1.00 24.49  ? 82  PRO D CG  1 
ATOM   7696  C  CD  . PRO D  1 61  ? 90.924  151.868 145.767 1.00 25.44  ? 82  PRO D CD  1 
ATOM   7697  N  N   . ALA D  1 62  ? 93.103  149.797 143.358 1.00 26.74  ? 83  ALA D N   1 
ATOM   7698  C  CA  . ALA D  1 62  ? 93.811  149.247 142.193 1.00 28.78  ? 83  ALA D CA  1 
ATOM   7699  C  C   . ALA D  1 62  ? 95.268  148.998 142.589 1.00 29.04  ? 83  ALA D C   1 
ATOM   7700  O  O   . ALA D  1 62  ? 95.880  148.031 142.048 1.00 29.91  ? 83  ALA D O   1 
ATOM   7701  C  CB  . ALA D  1 62  ? 93.730  150.169 140.980 1.00 30.22  ? 83  ALA D CB  1 
ATOM   7702  N  N   . PHE D  1 63  ? 95.848  149.859 143.421 1.00 28.78  ? 84  PHE D N   1 
ATOM   7703  C  CA  . PHE D  1 63  ? 97.307  149.808 143.696 1.00 29.48  ? 84  PHE D CA  1 
ATOM   7704  C  C   . PHE D  1 63  ? 97.608  148.963 144.939 1.00 27.68  ? 84  PHE D C   1 
ATOM   7705  O  O   . PHE D  1 63  ? 98.743  148.915 145.351 1.00 27.28  ? 84  PHE D O   1 
ATOM   7706  C  CB  . PHE D  1 63  ? 97.850  151.227 143.839 1.00 31.03  ? 84  PHE D CB  1 
ATOM   7707  C  CG  . PHE D  1 63  ? 97.611  152.110 142.634 1.00 33.85  ? 84  PHE D CG  1 
ATOM   7708  C  CD1 . PHE D  1 63  ? 98.260  151.872 141.446 1.00 36.43  ? 84  PHE D CD1 1 
ATOM   7709  C  CD2 . PHE D  1 63  ? 96.729  153.168 142.682 1.00 34.96  ? 84  PHE D CD2 1 
ATOM   7710  C  CE1 . PHE D  1 63  ? 98.039  152.674 140.340 1.00 38.67  ? 84  PHE D CE1 1 
ATOM   7711  C  CE2 . PHE D  1 63  ? 96.532  153.997 141.592 1.00 37.65  ? 84  PHE D CE2 1 
ATOM   7712  C  CZ  . PHE D  1 63  ? 97.175  153.734 140.410 1.00 38.88  ? 84  PHE D CZ  1 
ATOM   7713  N  N   . ALA D  1 64  ? 96.613  148.339 145.555 1.00 26.81  ? 85  ALA D N   1 
ATOM   7714  C  CA  . ALA D  1 64  ? 96.761  147.762 146.919 1.00 25.96  ? 85  ALA D CA  1 
ATOM   7715  C  C   . ALA D  1 64  ? 97.645  146.509 146.980 1.00 25.92  ? 85  ALA D C   1 
ATOM   7716  O  O   . ALA D  1 64  ? 98.486  146.397 147.875 1.00 24.86  ? 85  ALA D O   1 
ATOM   7717  C  CB  . ALA D  1 64  ? 95.411  147.510 147.520 1.00 25.04  ? 85  ALA D CB  1 
ATOM   7718  N  N   . PRO D  1 65  ? 97.467  145.489 146.110 1.00 25.71  ? 86  PRO D N   1 
ATOM   7719  C  CA  . PRO D  1 65  ? 98.093  144.204 146.371 1.00 25.21  ? 86  PRO D CA  1 
ATOM   7720  C  C   . PRO D  1 65  ? 99.593  144.221 146.507 1.00 25.47  ? 86  PRO D C   1 
ATOM   7721  O  O   . PRO D  1 65  ? 100.099 143.515 147.363 1.00 26.07  ? 86  PRO D O   1 
ATOM   7722  C  CB  . PRO D  1 65  ? 97.654  143.334 145.205 1.00 26.74  ? 86  PRO D CB  1 
ATOM   7723  C  CG  . PRO D  1 65  ? 96.338  143.988 144.768 1.00 27.06  ? 86  PRO D CG  1 
ATOM   7724  C  CD  . PRO D  1 65  ? 96.602  145.477 144.929 1.00 26.63  ? 86  PRO D CD  1 
ATOM   7725  N  N   . PRO D  1 66  ? 100.379 144.977 145.713 1.00 26.58  ? 87  PRO D N   1 
ATOM   7726  C  CA  . PRO D  1 66  ? 101.812 145.036 145.954 1.00 27.06  ? 87  PRO D CA  1 
ATOM   7727  C  C   . PRO D  1 66  ? 102.180 145.643 147.318 1.00 27.38  ? 87  PRO D C   1 
ATOM   7728  O  O   . PRO D  1 66  ? 103.228 145.317 147.842 1.00 26.96  ? 87  PRO D O   1 
ATOM   7729  C  CB  . PRO D  1 66  ? 102.322 145.932 144.813 1.00 28.19  ? 87  PRO D CB  1 
ATOM   7730  C  CG  . PRO D  1 66  ? 101.267 145.849 143.745 1.00 28.45  ? 87  PRO D CG  1 
ATOM   7731  C  CD  . PRO D  1 66  ? 99.975  145.715 144.491 1.00 27.32  ? 87  PRO D CD  1 
ATOM   7732  N  N   . ARG D  1 67  ? 101.385 146.586 147.813 1.00 28.21  ? 88  ARG D N   1 
ATOM   7733  C  CA  . ARG D  1 67  ? 101.687 147.296 149.077 1.00 29.13  ? 88  ARG D CA  1 
ATOM   7734  C  C   . ARG D  1 67  ? 101.362 146.364 150.221 1.00 27.54  ? 88  ARG D C   1 
ATOM   7735  O  O   . ARG D  1 67  ? 102.030 146.449 151.250 1.00 27.64  ? 88  ARG D O   1 
ATOM   7736  C  CB  . ARG D  1 67  ? 100.844 148.550 149.283 1.00 31.41  ? 88  ARG D CB  1 
ATOM   7737  C  CG  . ARG D  1 67  ? 101.001 149.564 148.182 1.00 36.99  ? 88  ARG D CG  1 
ATOM   7738  C  CD  . ARG D  1 67  ? 102.459 149.936 147.908 1.00 43.64  ? 88  ARG D CD  1 
ATOM   7739  N  NE  . ARG D  1 67  ? 102.557 151.050 146.955 1.00 48.68  ? 88  ARG D NE  1 
ATOM   7740  C  CZ  . ARG D  1 67  ? 102.654 152.346 147.293 1.00 55.45  ? 88  ARG D CZ  1 
ATOM   7741  N  NH1 . ARG D  1 67  ? 102.700 152.707 148.572 1.00 54.87  ? 88  ARG D NH1 1 
ATOM   7742  N  NH2 . ARG D  1 67  ? 102.733 153.271 146.335 1.00 60.04  ? 88  ARG D NH2 1 
ATOM   7743  N  N   . ILE D  1 68  ? 100.317 145.547 150.076 1.00 26.45  ? 89  ILE D N   1 
ATOM   7744  C  CA  . ILE D  1 68  ? 100.010 144.503 151.104 1.00 25.29  ? 89  ILE D CA  1 
ATOM   7745  C  C   . ILE D  1 68  ? 101.206 143.540 151.207 1.00 25.39  ? 89  ILE D C   1 
ATOM   7746  O  O   . ILE D  1 68  ? 101.649 143.260 152.333 1.00 25.27  ? 89  ILE D O   1 
ATOM   7747  C  CB  . ILE D  1 68  ? 98.662  143.818 150.834 1.00 23.99  ? 89  ILE D CB  1 
ATOM   7748  C  CG1 . ILE D  1 68  ? 97.511  144.814 151.010 1.00 23.97  ? 89  ILE D CG1 1 
ATOM   7749  C  CG2 . ILE D  1 68  ? 98.492  142.649 151.778 1.00 24.17  ? 89  ILE D CG2 1 
ATOM   7750  C  CD1 . ILE D  1 68  ? 96.177  144.360 150.476 1.00 23.68  ? 89  ILE D CD1 1 
ATOM   7751  N  N   . ARG D  1 69  ? 101.730 143.059 150.087 1.00 26.65  ? 90  ARG D N   1 
ATOM   7752  C  CA  . ARG D  1 69  ? 102.810 142.025 150.107 1.00 28.62  ? 90  ARG D CA  1 
ATOM   7753  C  C   . ARG D  1 69  ? 104.009 142.601 150.822 1.00 27.98  ? 90  ARG D C   1 
ATOM   7754  O  O   . ARG D  1 69  ? 104.542 141.938 151.669 1.00 29.28  ? 90  ARG D O   1 
ATOM   7755  C  CB  . ARG D  1 69  ? 103.294 141.603 148.726 1.00 30.69  ? 90  ARG D CB  1 
ATOM   7756  C  CG  . ARG D  1 69  ? 102.258 140.827 147.925 1.00 32.06  ? 90  ARG D CG  1 
ATOM   7757  C  CD  . ARG D  1 69  ? 102.714 140.534 146.488 1.00 33.99  ? 90  ARG D CD  1 
ATOM   7758  N  NE  . ARG D  1 69  ? 101.718 139.587 145.961 1.00 35.46  ? 90  ARG D NE  1 
ATOM   7759  C  CZ  . ARG D  1 69  ? 100.655 139.924 145.249 1.00 36.01  ? 90  ARG D CZ  1 
ATOM   7760  N  NH1 . ARG D  1 69  ? 100.481 141.181 144.872 1.00 37.57  ? 90  ARG D NH1 1 
ATOM   7761  N  NH2 . ARG D  1 69  ? 99.812  138.996 144.873 1.00 35.51  ? 90  ARG D NH2 1 
ATOM   7762  N  N   . GLU D  1 70  ? 104.343 143.830 150.531 1.00 27.58  ? 91  GLU D N   1 
ATOM   7763  C  CA  . GLU D  1 70  ? 105.479 144.522 151.155 1.00 28.66  ? 91  GLU D CA  1 
ATOM   7764  C  C   . GLU D  1 70  ? 105.281 144.510 152.678 1.00 27.29  ? 91  GLU D C   1 
ATOM   7765  O  O   . GLU D  1 70  ? 106.287 144.226 153.395 1.00 27.62  ? 91  GLU D O   1 
ATOM   7766  C  CB  . GLU D  1 70  ? 105.597 145.915 150.546 1.00 30.27  ? 91  GLU D CB  1 
ATOM   7767  C  CG  . GLU D  1 70  ? 106.716 146.722 151.166 1.00 33.33  ? 91  GLU D CG  1 
ATOM   7768  C  CD  . GLU D  1 70  ? 106.786 148.196 150.785 1.00 35.91  ? 91  GLU D CD  1 
ATOM   7769  O  OE1 . GLU D  1 70  ? 107.826 148.766 151.033 1.00 38.66  ? 91  GLU D OE1 1 
ATOM   7770  O  OE2 . GLU D  1 70  ? 105.781 148.783 150.284 1.00 39.41  ? 91  GLU D OE2 1 
ATOM   7771  N  N   . ALA D  1 71  ? 104.069 144.834 153.144 1.00 24.71  ? 92  ALA D N   1 
ATOM   7772  C  CA  . ALA D  1 71  ? 103.725 144.962 154.578 1.00 24.45  ? 92  ALA D CA  1 
ATOM   7773  C  C   . ALA D  1 71  ? 103.820 143.590 155.281 1.00 23.80  ? 92  ALA D C   1 
ATOM   7774  O  O   . ALA D  1 71  ? 104.343 143.538 156.396 1.00 23.87  ? 92  ALA D O   1 
ATOM   7775  C  CB  . ALA D  1 71  ? 102.333 145.555 154.744 1.00 23.89  ? 92  ALA D CB  1 
ATOM   7776  N  N   . ILE D  1 72  ? 103.392 142.525 154.627 1.00 22.96  ? 93  ILE D N   1 
ATOM   7777  C  CA  . ILE D  1 72  ? 103.442 141.156 155.173 1.00 23.85  ? 93  ILE D CA  1 
ATOM   7778  C  C   . ILE D  1 72  ? 104.884 140.830 155.521 1.00 25.23  ? 93  ILE D C   1 
ATOM   7779  O  O   . ILE D  1 72  ? 105.099 140.218 156.612 1.00 24.97  ? 93  ILE D O   1 
ATOM   7780  C  CB  . ILE D  1 72  ? 102.878 140.130 154.188 1.00 24.17  ? 93  ILE D CB  1 
ATOM   7781  C  CG1 . ILE D  1 72  ? 101.385 140.319 153.957 1.00 24.10  ? 93  ILE D CG1 1 
ATOM   7782  C  CG2 . ILE D  1 72  ? 103.192 138.735 154.630 1.00 24.63  ? 93  ILE D CG2 1 
ATOM   7783  C  CD1 . ILE D  1 72  ? 100.819 139.486 152.818 1.00 24.74  ? 93  ILE D CD1 1 
ATOM   7784  N  N   . TRP D  1 73  ? 105.835 141.233 154.672 1.00 25.98  ? 94  TRP D N   1 
ATOM   7785  C  CA  . TRP D  1 73  ? 107.264 140.827 154.796 1.00 27.47  ? 94  TRP D CA  1 
ATOM   7786  C  C   . TRP D  1 73  ? 108.100 141.949 155.378 1.00 26.93  ? 94  TRP D C   1 
ATOM   7787  O  O   . TRP D  1 73  ? 109.262 141.845 155.394 1.00 28.20  ? 94  TRP D O   1 
ATOM   7788  C  CB  . TRP D  1 73  ? 107.800 140.328 153.448 1.00 29.10  ? 94  TRP D CB  1 
ATOM   7789  C  CG  . TRP D  1 73  ? 106.997 139.176 152.948 1.00 30.26  ? 94  TRP D CG  1 
ATOM   7790  C  CD1 . TRP D  1 73  ? 106.193 139.160 151.847 1.00 31.06  ? 94  TRP D CD1 1 
ATOM   7791  C  CD2 . TRP D  1 73  ? 106.856 137.879 153.560 1.00 31.28  ? 94  TRP D CD2 1 
ATOM   7792  N  NE1 . TRP D  1 73  ? 105.615 137.930 151.696 1.00 31.07  ? 94  TRP D NE1 1 
ATOM   7793  C  CE2 . TRP D  1 73  ? 105.960 137.139 152.754 1.00 31.68  ? 94  TRP D CE2 1 
ATOM   7794  C  CE3 . TRP D  1 73  ? 107.405 137.268 154.689 1.00 31.72  ? 94  TRP D CE3 1 
ATOM   7795  C  CZ2 . TRP D  1 73  ? 105.599 135.822 153.042 1.00 32.18  ? 94  TRP D CZ2 1 
ATOM   7796  C  CZ3 . TRP D  1 73  ? 107.022 135.985 154.994 1.00 32.03  ? 94  TRP D CZ3 1 
ATOM   7797  C  CH2 . TRP D  1 73  ? 106.157 135.266 154.177 1.00 32.23  ? 94  TRP D CH2 1 
ATOM   7798  N  N   . CYS D  1 74  ? 107.509 143.015 155.873 1.00 26.29  ? 95  CYS D N   1 
ATOM   7799  C  CA  . CYS D  1 74  ? 108.294 144.140 156.438 1.00 26.00  ? 95  CYS D CA  1 
ATOM   7800  C  C   . CYS D  1 74  ? 109.268 143.640 157.516 1.00 26.44  ? 95  CYS D C   1 
ATOM   7801  O  O   . CYS D  1 74  ? 108.888 142.777 158.314 1.00 25.07  ? 95  CYS D O   1 
ATOM   7802  C  CB  . CYS D  1 74  ? 107.321 145.144 156.999 1.00 25.21  ? 95  CYS D CB  1 
ATOM   7803  S  SG  . CYS D  1 74  ? 108.123 146.547 157.762 1.00 26.34  ? 95  CYS D SG  1 
ATOM   7804  N  N   . GLY D  1 75  ? 110.491 144.188 157.514 1.00 27.53  ? 96  GLY D N   1 
ATOM   7805  C  CA  . GLY D  1 75  ? 111.591 143.823 158.429 1.00 28.68  ? 96  GLY D CA  1 
ATOM   7806  C  C   . GLY D  1 75  ? 111.266 144.214 159.875 1.00 29.05  ? 96  GLY D C   1 
ATOM   7807  O  O   . GLY D  1 75  ? 111.879 143.644 160.787 1.00 29.85  ? 96  GLY D O   1 
ATOM   7808  N  N   . SER D  1 76  ? 110.259 145.082 160.079 1.00 27.70  ? 97  SER D N   1 
ATOM   7809  C  CA  . SER D  1 76  ? 109.788 145.553 161.410 1.00 27.19  ? 97  SER D CA  1 
ATOM   7810  C  C   . SER D  1 76  ? 108.952 144.449 162.080 1.00 26.51  ? 97  SER D C   1 
ATOM   7811  O  O   . SER D  1 76  ? 108.735 144.555 163.283 1.00 26.33  ? 97  SER D O   1 
ATOM   7812  C  CB  . SER D  1 76  ? 109.003 146.842 161.282 1.00 25.91  ? 97  SER D CB  1 
ATOM   7813  O  OG  . SER D  1 76  ? 107.669 146.582 160.877 1.00 24.09  ? 97  SER D OG  1 
ATOM   7814  N  N   . THR D  1 77  ? 108.485 143.460 161.329 1.00 26.33  ? 98  THR D N   1 
ATOM   7815  C  CA  . THR D  1 77  ? 107.553 142.402 161.798 1.00 27.17  ? 98  THR D CA  1 
ATOM   7816  C  C   . THR D  1 77  ? 108.289 141.081 162.007 1.00 28.83  ? 98  THR D C   1 
ATOM   7817  O  O   . THR D  1 77  ? 109.413 140.956 161.530 1.00 29.73  ? 98  THR D O   1 
ATOM   7818  C  CB  . THR D  1 77  ? 106.445 142.115 160.774 1.00 27.52  ? 98  THR D CB  1 
ATOM   7819  O  OG1 . THR D  1 77  ? 107.007 141.559 159.562 1.00 27.59  ? 98  THR D OG1 1 
ATOM   7820  C  CG2 . THR D  1 77  ? 105.636 143.358 160.486 1.00 27.63  ? 98  THR D CG2 1 
ATOM   7821  N  N   . ASN D  1 78  ? 107.668 140.101 162.676 1.00 30.84  ? 99  ASN D N   1 
ATOM   7822  C  CA  . ASN D  1 78  ? 108.170 138.704 162.586 1.00 32.52  ? 99  ASN D CA  1 
ATOM   7823  C  C   . ASN D  1 78  ? 107.213 137.864 161.759 1.00 29.90  ? 99  ASN D C   1 
ATOM   7824  O  O   . ASN D  1 78  ? 106.125 138.346 161.439 1.00 30.39  ? 99  ASN D O   1 
ATOM   7825  C  CB  . ASN D  1 78  ? 108.610 138.092 163.914 1.00 36.17  ? 99  ASN D CB  1 
ATOM   7826  C  CG  . ASN D  1 78  ? 107.494 137.754 164.858 1.00 39.08  ? 99  ASN D CG  1 
ATOM   7827  O  OD1 . ASN D  1 78  ? 106.869 136.718 164.702 1.00 44.21  ? 99  ASN D OD1 1 
ATOM   7828  N  ND2 . ASN D  1 78  ? 107.432 138.471 165.965 1.00 42.50  ? 99  ASN D ND2 1 
ATOM   7829  N  N   . SER D  1 79  ? 107.655 136.669 161.397 1.00 28.25  ? 100 SER D N   1 
ATOM   7830  C  CA  . SER D  1 79  ? 106.962 135.824 160.433 1.00 27.84  ? 100 SER D CA  1 
ATOM   7831  C  C   . SER D  1 79  ? 105.987 134.868 161.138 1.00 26.89  ? 100 SER D C   1 
ATOM   7832  O  O   . SER D  1 79  ? 105.395 134.049 160.425 1.00 26.10  ? 100 SER D O   1 
ATOM   7833  C  CB  . SER D  1 79  ? 107.963 135.130 159.570 1.00 29.01  ? 100 SER D CB  1 
ATOM   7834  O  OG  . SER D  1 79  ? 108.828 134.350 160.370 1.00 30.38  ? 100 SER D OG  1 
ATOM   7835  N  N   . ALA D  1 80  ? 105.777 134.988 162.449 1.00 25.79  ? 101 ALA D N   1 
ATOM   7836  C  CA  . ALA D  1 80  ? 104.742 134.192 163.140 1.00 25.87  ? 101 ALA D CA  1 
ATOM   7837  C  C   . ALA D  1 80  ? 103.412 134.942 163.150 1.00 24.51  ? 101 ALA D C   1 
ATOM   7838  O  O   . ALA D  1 80  ? 103.394 136.137 163.441 1.00 23.36  ? 101 ALA D O   1 
ATOM   7839  C  CB  . ALA D  1 80  ? 105.151 133.830 164.552 1.00 27.25  ? 101 ALA D CB  1 
ATOM   7840  N  N   . THR D  1 81  ? 102.307 134.224 162.981 1.00 24.06  ? 102 THR D N   1 
ATOM   7841  C  CA  . THR D  1 81  ? 100.972 134.822 163.231 1.00 23.94  ? 102 THR D CA  1 
ATOM   7842  C  C   . THR D  1 81  ? 100.705 134.837 164.738 1.00 24.59  ? 102 THR D C   1 
ATOM   7843  O  O   . THR D  1 81  ? 101.514 134.266 165.485 1.00 24.77  ? 102 THR D O   1 
ATOM   7844  C  CB  . THR D  1 81  ? 99.893  134.066 162.478 1.00 23.86  ? 102 THR D CB  1 
ATOM   7845  O  OG1 . THR D  1 81  ? 99.734  132.778 163.086 1.00 24.28  ? 102 THR D OG1 1 
ATOM   7846  C  CG2 . THR D  1 81  ? 100.245 134.005 161.008 1.00 23.97  ? 102 THR D CG2 1 
ATOM   7847  N  N   . GLU D  1 82  ? 99.608  135.464 165.160 1.00 24.66  ? 103 GLU D N   1 
ATOM   7848  C  CA  . GLU D  1 82  ? 99.278  135.614 166.608 1.00 25.51  ? 103 GLU D CA  1 
ATOM   7849  C  C   . GLU D  1 82  ? 99.189  134.239 167.307 1.00 26.77  ? 103 GLU D C   1 
ATOM   7850  O  O   . GLU D  1 82  ? 99.657  134.174 168.443 1.00 26.83  ? 103 GLU D O   1 
ATOM   7851  C  CB  . GLU D  1 82  ? 98.000  136.423 166.805 1.00 24.72  ? 103 GLU D CB  1 
ATOM   7852  C  CG  . GLU D  1 82  ? 98.215  137.886 166.563 1.00 24.54  ? 103 GLU D CG  1 
ATOM   7853  C  CD  . GLU D  1 82  ? 97.211  138.758 167.292 1.00 24.96  ? 103 GLU D CD  1 
ATOM   7854  O  OE1 . GLU D  1 82  ? 96.370  138.180 168.049 1.00 24.51  ? 103 GLU D OE1 1 
ATOM   7855  O  OE2 . GLU D  1 82  ? 97.310  140.027 167.130 1.00 25.25  ? 103 GLU D OE2 1 
ATOM   7856  N  N   . GLU D  1 83  ? 98.648  133.213 166.652 1.00 27.73  ? 104 GLU D N   1 
ATOM   7857  C  CA  . GLU D  1 83  ? 98.475  131.862 167.242 1.00 31.23  ? 104 GLU D CA  1 
ATOM   7858  C  C   . GLU D  1 83  ? 99.659  130.952 166.871 1.00 31.09  ? 104 GLU D C   1 
ATOM   7859  O  O   . GLU D  1 83  ? 99.584  129.781 167.158 1.00 31.92  ? 104 GLU D O   1 
ATOM   7860  C  CB  . GLU D  1 83  ? 97.100  131.291 166.846 1.00 33.66  ? 104 GLU D CB  1 
ATOM   7861  C  CG  . GLU D  1 83  ? 95.920  132.179 167.310 1.00 35.43  ? 104 GLU D CG  1 
ATOM   7862  C  CD  . GLU D  1 83  ? 94.503  131.633 167.162 1.00 38.47  ? 104 GLU D CD  1 
ATOM   7863  O  OE1 . GLU D  1 83  ? 94.118  131.307 166.010 1.00 40.41  ? 104 GLU D OE1 1 
ATOM   7864  O  OE2 . GLU D  1 83  ? 93.751  131.588 168.177 1.00 41.01  ? 104 GLU D OE2 1 
ATOM   7865  N  N   . GLY D  1 84  ? 100.727 131.457 166.263 1.00 30.37  ? 105 GLY D N   1 
ATOM   7866  C  CA  . GLY D  1 84  ? 102.021 130.738 166.190 1.00 31.59  ? 105 GLY D CA  1 
ATOM   7867  C  C   . GLY D  1 84  ? 102.319 130.056 164.848 1.00 31.68  ? 105 GLY D C   1 
ATOM   7868  O  O   . GLY D  1 84  ? 103.327 129.362 164.780 1.00 31.87  ? 105 GLY D O   1 
ATOM   7869  N  N   . LYS D  1 85  ? 101.562 130.314 163.776 1.00 31.34  ? 106 LYS D N   1 
ATOM   7870  C  CA  . LYS D  1 85  ? 101.896 129.694 162.477 1.00 32.09  ? 106 LYS D CA  1 
ATOM   7871  C  C   . LYS D  1 85  ? 103.049 130.443 161.826 1.00 31.68  ? 106 LYS D C   1 
ATOM   7872  O  O   . LYS D  1 85  ? 103.114 131.645 161.928 1.00 30.99  ? 106 LYS D O   1 
ATOM   7873  C  CB  . LYS D  1 85  ? 100.665 129.653 161.588 1.00 32.20  ? 106 LYS D CB  1 
ATOM   7874  C  CG  . LYS D  1 85  ? 99.624  128.744 162.185 1.00 33.81  ? 106 LYS D CG  1 
ATOM   7875  C  CD  . LYS D  1 85  ? 98.898  127.997 161.160 1.00 35.05  ? 106 LYS D CD  1 
ATOM   7876  C  CE  . LYS D  1 85  ? 97.956  126.975 161.750 1.00 35.60  ? 106 LYS D CE  1 
ATOM   7877  N  NZ  . LYS D  1 85  ? 97.077  126.542 160.647 1.00 36.36  ? 106 LYS D NZ  1 
ATOM   7878  N  N   . GLU D  1 86  ? 103.861 129.738 161.081 1.00 32.35  ? 107 GLU D N   1 
ATOM   7879  C  CA  . GLU D  1 86  ? 105.095 130.296 160.476 1.00 32.95  ? 107 GLU D CA  1 
ATOM   7880  C  C   . GLU D  1 86  ? 104.846 130.633 159.003 1.00 30.87  ? 107 GLU D C   1 
ATOM   7881  O  O   . GLU D  1 86  ? 104.709 129.729 158.187 1.00 29.99  ? 107 GLU D O   1 
ATOM   7882  C  CB  . GLU D  1 86  ? 106.182 129.254 160.720 1.00 35.66  ? 107 GLU D CB  1 
ATOM   7883  C  CG  . GLU D  1 86  ? 107.510 129.623 160.135 1.00 38.57  ? 107 GLU D CG  1 
ATOM   7884  C  CD  . GLU D  1 86  ? 108.012 131.008 160.479 1.00 39.17  ? 107 GLU D CD  1 
ATOM   7885  O  OE1 . GLU D  1 86  ? 108.323 131.214 161.689 1.00 44.37  ? 107 GLU D OE1 1 
ATOM   7886  O  OE2 . GLU D  1 86  ? 108.039 131.876 159.546 1.00 36.08  ? 107 GLU D OE2 1 
ATOM   7887  N  N   . LEU D  1 87  ? 104.774 131.915 158.662 1.00 29.87  ? 108 LEU D N   1 
ATOM   7888  C  CA  . LEU D  1 87  ? 104.395 132.385 157.299 1.00 29.14  ? 108 LEU D CA  1 
ATOM   7889  C  C   . LEU D  1 87  ? 105.437 132.009 156.237 1.00 29.14  ? 108 LEU D C   1 
ATOM   7890  O  O   . LEU D  1 87  ? 105.077 132.038 155.071 1.00 28.35  ? 108 LEU D O   1 
ATOM   7891  C  CB  . LEU D  1 87  ? 104.200 133.903 157.319 1.00 29.15  ? 108 LEU D CB  1 
ATOM   7892  C  CG  . LEU D  1 87  ? 103.004 134.349 158.134 1.00 29.20  ? 108 LEU D CG  1 
ATOM   7893  C  CD1 . LEU D  1 87  ? 103.098 135.816 158.438 1.00 29.52  ? 108 LEU D CD1 1 
ATOM   7894  C  CD2 . LEU D  1 87  ? 101.710 134.000 157.422 1.00 29.20  ? 108 LEU D CD2 1 
ATOM   7895  N  N   . LYS D  1 88  ? 106.668 131.726 156.607 1.00 30.26  ? 109 LYS D N   1 
ATOM   7896  C  CA  . LYS D  1 88  ? 107.735 131.313 155.661 1.00 32.54  ? 109 LYS D CA  1 
ATOM   7897  C  C   . LYS D  1 88  ? 107.521 129.874 155.229 1.00 32.95  ? 109 LYS D C   1 
ATOM   7898  O  O   . LYS D  1 88  ? 108.143 129.491 154.230 1.00 34.56  ? 109 LYS D O   1 
ATOM   7899  C  CB  . LYS D  1 88  ? 109.127 131.421 156.294 1.00 35.32  ? 109 LYS D CB  1 
ATOM   7900  C  CG  . LYS D  1 88  ? 109.597 132.863 156.343 1.00 37.73  ? 109 LYS D CG  1 
ATOM   7901  C  CD  . LYS D  1 88  ? 110.737 133.145 157.309 1.00 41.94  ? 109 LYS D CD  1 
ATOM   7902  C  CE  . LYS D  1 88  ? 111.129 134.619 157.308 1.00 43.48  ? 109 LYS D CE  1 
ATOM   7903  N  NZ  . LYS D  1 88  ? 112.054 134.919 158.424 1.00 46.15  ? 109 LYS D NZ  1 
ATOM   7904  N  N   . ASP D  1 89  ? 106.703 129.096 155.952 1.00 31.40  ? 110 ASP D N   1 
ATOM   7905  C  CA  . ASP D  1 89  ? 106.377 127.708 155.551 1.00 31.65  ? 110 ASP D CA  1 
ATOM   7906  C  C   . ASP D  1 89  ? 105.392 127.780 154.378 1.00 30.67  ? 110 ASP D C   1 
ATOM   7907  O  O   . ASP D  1 89  ? 104.277 128.211 154.579 1.00 29.27  ? 110 ASP D O   1 
ATOM   7908  C  CB  . ASP D  1 89  ? 105.836 126.933 156.756 1.00 31.86  ? 110 ASP D CB  1 
ATOM   7909  C  CG  . ASP D  1 89  ? 105.463 125.492 156.465 1.00 33.35  ? 110 ASP D CG  1 
ATOM   7910  O  OD1 . ASP D  1 89  ? 105.417 125.085 155.216 1.00 33.29  ? 110 ASP D OD1 1 
ATOM   7911  O  OD2 . ASP D  1 89  ? 105.219 124.767 157.485 1.00 33.36  ? 110 ASP D OD2 1 
ATOM   7912  N  N   . PRO D  1 90  ? 105.724 127.327 153.144 1.00 31.34  ? 111 PRO D N   1 
ATOM   7913  C  CA  . PRO D  1 90  ? 104.779 127.410 152.022 1.00 31.20  ? 111 PRO D CA  1 
ATOM   7914  C  C   . PRO D  1 90  ? 103.420 126.738 152.294 1.00 31.70  ? 111 PRO D C   1 
ATOM   7915  O  O   . PRO D  1 90  ? 102.409 127.122 151.702 1.00 31.65  ? 111 PRO D O   1 
ATOM   7916  C  CB  . PRO D  1 90  ? 105.534 126.712 150.876 1.00 32.63  ? 111 PRO D CB  1 
ATOM   7917  C  CG  . PRO D  1 90  ? 107.015 126.802 151.243 1.00 33.38  ? 111 PRO D CG  1 
ATOM   7918  C  CD  . PRO D  1 90  ? 107.026 126.746 152.757 1.00 32.68  ? 111 PRO D CD  1 
ATOM   7919  N  N   . ARG D  1 91  ? 103.388 125.713 153.149 1.00 32.47  ? 112 ARG D N   1 
ATOM   7920  C  CA  . ARG D  1 91  ? 102.118 125.027 153.533 1.00 32.79  ? 112 ARG D CA  1 
ATOM   7921  C  C   . ARG D  1 91  ? 101.198 125.986 154.309 1.00 31.31  ? 112 ARG D C   1 
ATOM   7922  O  O   . ARG D  1 91  ? 100.009 125.682 154.433 1.00 30.88  ? 112 ARG D O   1 
ATOM   7923  C  CB  . ARG D  1 91  ? 102.406 123.786 154.382 1.00 34.13  ? 112 ARG D CB  1 
ATOM   7924  C  CG  . ARG D  1 91  ? 103.087 122.671 153.604 1.00 35.92  ? 112 ARG D CG  1 
ATOM   7925  C  CD  . ARG D  1 91  ? 103.674 121.623 154.476 1.00 37.05  ? 112 ARG D CD  1 
ATOM   7926  N  NE  . ARG D  1 91  ? 104.676 122.190 155.337 1.00 37.17  ? 112 ARG D NE  1 
ATOM   7927  C  CZ  . ARG D  1 91  ? 105.323 121.491 156.239 1.00 38.36  ? 112 ARG D CZ  1 
ATOM   7928  N  NH1 . ARG D  1 91  ? 105.069 120.205 156.372 1.00 40.13  ? 112 ARG D NH1 1 
ATOM   7929  N  NH2 . ARG D  1 91  ? 106.218 122.060 157.008 1.00 38.14  ? 112 ARG D NH2 1 
ATOM   7930  N  N   . VAL D  1 92  ? 101.745 127.074 154.864 1.00 30.46  ? 113 VAL D N   1 
ATOM   7931  C  CA  . VAL D  1 92  ? 100.967 128.117 155.582 1.00 29.07  ? 113 VAL D CA  1 
ATOM   7932  C  C   . VAL D  1 92  ? 100.601 129.231 154.603 1.00 28.36  ? 113 VAL D C   1 
ATOM   7933  O  O   . VAL D  1 92  ? 99.460  129.700 154.654 1.00 27.86  ? 113 VAL D O   1 
ATOM   7934  C  CB  . VAL D  1 92  ? 101.779 128.693 156.749 1.00 28.77  ? 113 VAL D CB  1 
ATOM   7935  C  CG1 . VAL D  1 92  ? 101.022 129.842 157.384 1.00 27.21  ? 113 VAL D CG1 1 
ATOM   7936  C  CG2 . VAL D  1 92  ? 102.141 127.616 157.772 1.00 30.08  ? 113 VAL D CG2 1 
ATOM   7937  N  N   . LEU D  1 93  ? 101.538 129.611 153.738 1.00 28.46  ? 114 LEU D N   1 
ATOM   7938  C  CA  . LEU D  1 93  ? 101.352 130.742 152.809 1.00 28.50  ? 114 LEU D CA  1 
ATOM   7939  C  C   . LEU D  1 93  ? 102.236 130.569 151.583 1.00 29.59  ? 114 LEU D C   1 
ATOM   7940  O  O   . LEU D  1 93  ? 103.472 130.359 151.759 1.00 30.87  ? 114 LEU D O   1 
ATOM   7941  C  CB  . LEU D  1 93  ? 101.678 132.058 153.521 1.00 27.67  ? 114 LEU D CB  1 
ATOM   7942  C  CG  . LEU D  1 93  ? 101.335 133.335 152.739 1.00 26.76  ? 114 LEU D CG  1 
ATOM   7943  C  CD1 . LEU D  1 93  ? 99.867  133.428 152.522 1.00 26.09  ? 114 LEU D CD1 1 
ATOM   7944  C  CD2 . LEU D  1 93  ? 101.806 134.566 153.477 1.00 26.47  ? 114 LEU D CD2 1 
ATOM   7945  N  N   . THR D  1 94  ? 101.602 130.621 150.417 1.00 29.55  ? 115 THR D N   1 
ATOM   7946  C  CA  . THR D  1 94  ? 102.269 130.928 149.126 1.00 30.80  ? 115 THR D CA  1 
ATOM   7947  C  C   . THR D  1 94  ? 101.547 132.060 148.405 1.00 30.64  ? 115 THR D C   1 
ATOM   7948  O  O   . THR D  1 94  ? 100.535 132.572 148.909 1.00 29.41  ? 115 THR D O   1 
ATOM   7949  C  CB  . THR D  1 94  ? 102.333 129.715 148.197 1.00 31.55  ? 115 THR D CB  1 
ATOM   7950  O  OG1 . THR D  1 94  ? 100.985 129.276 148.000 1.00 30.60  ? 115 THR D OG1 1 
ATOM   7951  C  CG2 . THR D  1 94  ? 103.275 128.673 148.766 1.00 31.76  ? 115 THR D CG2 1 
ATOM   7952  N  N   . ASP D  1 95  ? 102.128 132.489 147.295 1.00 32.12  ? 116 ASP D N   1 
ATOM   7953  C  CA  . ASP D  1 95  ? 101.657 133.680 146.545 1.00 31.46  ? 116 ASP D CA  1 
ATOM   7954  C  C   . ASP D  1 95  ? 101.772 133.406 145.059 1.00 31.69  ? 116 ASP D C   1 
ATOM   7955  O  O   . ASP D  1 95  ? 102.872 133.052 144.656 1.00 31.87  ? 116 ASP D O   1 
ATOM   7956  C  CB  . ASP D  1 95  ? 102.513 134.875 146.927 1.00 32.01  ? 116 ASP D CB  1 
ATOM   7957  C  CG  . ASP D  1 95  ? 102.028 136.188 146.350 1.00 32.53  ? 116 ASP D CG  1 
ATOM   7958  O  OD1 . ASP D  1 95  ? 101.090 136.218 145.459 1.00 32.07  ? 116 ASP D OD1 1 
ATOM   7959  O  OD2 . ASP D  1 95  ? 102.606 137.168 146.791 1.00 34.52  ? 116 ASP D OD2 1 
ATOM   7960  N  N   . VAL D  1 96  ? 100.670 133.493 144.308 1.00 31.76  ? 117 VAL D N   1 
ATOM   7961  C  CA  . VAL D  1 96  ? 100.709 133.246 142.838 1.00 33.53  ? 117 VAL D CA  1 
ATOM   7962  C  C   . VAL D  1 96  ? 100.647 134.587 142.104 1.00 33.14  ? 117 VAL D C   1 
ATOM   7963  O  O   . VAL D  1 96  ? 100.548 134.562 140.884 1.00 33.23  ? 117 VAL D O   1 
ATOM   7964  C  CB  . VAL D  1 96  ? 99.595  132.289 142.364 1.00 35.00  ? 117 VAL D CB  1 
ATOM   7965  C  CG1 . VAL D  1 96  ? 99.645  130.954 143.086 1.00 35.52  ? 117 VAL D CG1 1 
ATOM   7966  C  CG2 . VAL D  1 96  ? 98.215  132.912 142.530 1.00 34.74  ? 117 VAL D CG2 1 
ATOM   7967  N  N   . GLY D  1 97  ? 100.744 135.705 142.829 1.00 32.16  ? 118 GLY D N   1 
ATOM   7968  C  CA  . GLY D  1 97  ? 100.937 137.052 142.258 1.00 32.15  ? 118 GLY D CA  1 
ATOM   7969  C  C   . GLY D  1 97  ? 99.631  137.635 141.748 1.00 31.88  ? 118 GLY D C   1 
ATOM   7970  O  O   . GLY D  1 97  ? 98.575  137.272 142.299 1.00 31.08  ? 118 GLY D O   1 
ATOM   7971  N  N   . ASP D  1 98  ? 99.704  138.542 140.774 1.00 32.61  ? 119 ASP D N   1 
ATOM   7972  C  CA  . ASP D  1 98  ? 98.598  139.464 140.400 1.00 32.39  ? 119 ASP D CA  1 
ATOM   7973  C  C   . ASP D  1 98  ? 97.997  139.086 139.033 1.00 33.73  ? 119 ASP D C   1 
ATOM   7974  O  O   . ASP D  1 98  ? 98.701  138.735 138.105 1.00 32.85  ? 119 ASP D O   1 
ATOM   7975  C  CB  . ASP D  1 98  ? 99.104  140.903 140.495 1.00 32.64  ? 119 ASP D CB  1 
ATOM   7976  C  CG  . ASP D  1 98  ? 99.184  141.456 141.932 1.00 31.33  ? 119 ASP D CG  1 
ATOM   7977  O  OD1 . ASP D  1 98  ? 98.678  140.805 142.841 1.00 30.83  ? 119 ASP D OD1 1 
ATOM   7978  O  OD2 . ASP D  1 98  ? 99.749  142.528 142.138 1.00 31.93  ? 119 ASP D OD2 1 
ATOM   7979  N  N   . VAL D  1 99  ? 96.676  139.045 138.979 1.00 34.65  ? 120 VAL D N   1 
ATOM   7980  C  CA  . VAL D  1 99  ? 95.946  138.974 137.699 1.00 35.61  ? 120 VAL D CA  1 
ATOM   7981  C  C   . VAL D  1 99  ? 96.326  140.260 136.987 1.00 36.24  ? 120 VAL D C   1 
ATOM   7982  O  O   . VAL D  1 99  ? 96.227  141.311 137.590 1.00 34.49  ? 120 VAL D O   1 
ATOM   7983  C  CB  . VAL D  1 99  ? 94.434  138.857 137.902 1.00 35.97  ? 120 VAL D CB  1 
ATOM   7984  C  CG1 . VAL D  1 99  ? 93.690  138.981 136.564 1.00 37.72  ? 120 VAL D CG1 1 
ATOM   7985  C  CG2 . VAL D  1 99  ? 94.080  137.565 138.616 1.00 35.71  ? 120 VAL D CG2 1 
ATOM   7986  N  N   . PRO D  1 100 ? 96.862  140.217 135.748 1.00 37.65  ? 121 PRO D N   1 
ATOM   7987  C  CA  . PRO D  1 100 ? 97.199  141.440 135.021 1.00 38.97  ? 121 PRO D CA  1 
ATOM   7988  C  C   . PRO D  1 100 ? 95.921  142.170 134.587 1.00 39.42  ? 121 PRO D C   1 
ATOM   7989  O  O   . PRO D  1 100 ? 95.560  142.068 133.452 1.00 41.40  ? 121 PRO D O   1 
ATOM   7990  C  CB  . PRO D  1 100 ? 97.978  140.984 133.793 1.00 41.06  ? 121 PRO D CB  1 
ATOM   7991  C  CG  . PRO D  1 100 ? 98.249  139.503 134.026 1.00 41.21  ? 121 PRO D CG  1 
ATOM   7992  C  CD  . PRO D  1 100 ? 97.222  139.003 135.024 1.00 38.95  ? 121 PRO D CD  1 
ATOM   7993  N  N   . VAL D  1 101 ? 95.264  142.862 135.504 1.00 38.14  ? 122 VAL D N   1 
ATOM   7994  C  CA  . VAL D  1 101 ? 93.945  143.514 135.268 1.00 38.77  ? 122 VAL D CA  1 
ATOM   7995  C  C   . VAL D  1 101 ? 94.120  144.691 134.296 1.00 40.37  ? 122 VAL D C   1 
ATOM   7996  O  O   . VAL D  1 101 ? 93.357  144.768 133.322 1.00 40.92  ? 122 VAL D O   1 
ATOM   7997  C  CB  . VAL D  1 101 ? 93.308  143.950 136.604 1.00 37.37  ? 122 VAL D CB  1 
ATOM   7998  C  CG1 . VAL D  1 101 ? 92.034  144.756 136.431 1.00 38.28  ? 122 VAL D CG1 1 
ATOM   7999  C  CG2 . VAL D  1 101 ? 93.035  142.782 137.503 1.00 35.78  ? 122 VAL D CG2 1 
ATOM   8000  N  N   . GLN D  1 102 ? 95.090  145.566 134.526 1.00 41.14  ? 123 GLN D N   1 
ATOM   8001  C  CA  . GLN D  1 102 ? 95.211  146.805 133.729 1.00 44.13  ? 123 GLN D CA  1 
ATOM   8002  C  C   . GLN D  1 102 ? 95.606  146.457 132.294 1.00 47.05  ? 123 GLN D C   1 
ATOM   8003  O  O   . GLN D  1 102 ? 95.239  147.222 131.401 1.00 49.97  ? 123 GLN D O   1 
ATOM   8004  C  CB  . GLN D  1 102 ? 96.150  147.799 134.402 1.00 44.24  ? 123 GLN D CB  1 
ATOM   8005  C  CG  . GLN D  1 102 ? 95.749  148.099 135.846 1.00 43.32  ? 123 GLN D CG  1 
ATOM   8006  C  CD  . GLN D  1 102 ? 94.301  148.532 135.989 1.00 43.06  ? 123 GLN D CD  1 
ATOM   8007  O  OE1 . GLN D  1 102 ? 93.752  149.225 135.115 1.00 44.25  ? 123 GLN D OE1 1 
ATOM   8008  N  NE2 . GLN D  1 102 ? 93.653  148.092 137.062 1.00 39.72  ? 123 GLN D NE2 1 
ATOM   8009  N  N   . GLU D  1 103 ? 96.292  145.337 132.050 1.00 47.98  ? 124 GLU D N   1 
ATOM   8010  C  CA  . GLU D  1 103 ? 96.716  144.962 130.667 1.00 49.93  ? 124 GLU D CA  1 
ATOM   8011  C  C   . GLU D  1 103 ? 95.463  144.478 129.933 1.00 49.78  ? 124 GLU D C   1 
ATOM   8012  O  O   . GLU D  1 103 ? 95.229  144.825 128.758 1.00 53.57  ? 124 GLU D O   1 
ATOM   8013  C  CB  . GLU D  1 103 ? 97.840  143.927 130.714 1.00 50.39  ? 124 GLU D CB  1 
ATOM   8014  C  CG  . GLU D  1 103 ? 99.156  144.497 131.229 1.00 50.71  ? 124 GLU D CG  1 
ATOM   8015  C  CD  . GLU D  1 103 ? 99.402  144.612 132.739 1.00 49.50  ? 124 GLU D CD  1 
ATOM   8016  O  OE1 . GLU D  1 103 ? 98.486  144.355 133.529 1.00 45.88  ? 124 GLU D OE1 1 
ATOM   8017  O  OE2 . GLU D  1 103 ? 100.557 144.988 133.101 1.00 51.47  ? 124 GLU D OE2 1 
ATOM   8018  N  N   . ILE D  1 104 ? 94.612  143.775 130.642 1.00 47.03  ? 125 ILE D N   1 
ATOM   8019  C  CA  . ILE D  1 104 ? 93.388  143.222 130.018 1.00 47.78  ? 125 ILE D CA  1 
ATOM   8020  C  C   . ILE D  1 104 ? 92.426  144.363 129.668 1.00 48.19  ? 125 ILE D C   1 
ATOM   8021  O  O   . ILE D  1 104 ? 91.969  144.400 128.504 1.00 50.07  ? 125 ILE D O   1 
ATOM   8022  C  CB  . ILE D  1 104 ? 92.819  142.133 130.926 1.00 45.35  ? 125 ILE D CB  1 
ATOM   8023  C  CG1 . ILE D  1 104 ? 93.800  140.959 130.990 1.00 45.26  ? 125 ILE D CG1 1 
ATOM   8024  C  CG2 . ILE D  1 104 ? 91.439  141.716 130.452 1.00 46.04  ? 125 ILE D CG2 1 
ATOM   8025  C  CD1 . ILE D  1 104 ? 93.461  139.954 132.071 1.00 44.28  ? 125 ILE D CD1 1 
ATOM   8026  N  N   . ARG D  1 105 ? 92.209  145.299 130.594 1.00 47.00  ? 126 ARG D N   1 
ATOM   8027  C  CA  . ARG D  1 105 ? 91.370  146.500 130.357 1.00 47.83  ? 126 ARG D CA  1 
ATOM   8028  C  C   . ARG D  1 105 ? 91.916  147.246 129.159 1.00 50.96  ? 126 ARG D C   1 
ATOM   8029  O  O   . ARG D  1 105 ? 91.108  147.615 128.301 1.00 52.61  ? 126 ARG D O   1 
ATOM   8030  C  CB  . ARG D  1 105 ? 91.378  147.495 131.512 1.00 45.92  ? 126 ARG D CB  1 
ATOM   8031  C  CG  . ARG D  1 105 ? 90.776  146.952 132.794 1.00 43.69  ? 126 ARG D CG  1 
ATOM   8032  C  CD  . ARG D  1 105 ? 90.673  148.043 133.838 1.00 42.14  ? 126 ARG D CD  1 
ATOM   8033  N  NE  . ARG D  1 105 ? 89.835  149.187 133.444 1.00 42.62  ? 126 ARG D NE  1 
ATOM   8034  C  CZ  . ARG D  1 105 ? 90.015  150.435 133.879 1.00 42.30  ? 126 ARG D CZ  1 
ATOM   8035  N  NH1 . ARG D  1 105 ? 90.999  150.738 134.719 1.00 41.43  ? 126 ARG D NH1 1 
ATOM   8036  N  NH2 . ARG D  1 105 ? 89.195  151.383 133.493 1.00 43.19  ? 126 ARG D NH2 1 
ATOM   8037  N  N   . ASP D  1 106 ? 93.225  147.485 129.143 1.00 52.87  ? 127 ASP D N   1 
ATOM   8038  C  CA  . ASP D  1 106 ? 93.854  148.390 128.160 1.00 56.37  ? 127 ASP D CA  1 
ATOM   8039  C  C   . ASP D  1 106 ? 93.623  147.873 126.742 1.00 58.81  ? 127 ASP D C   1 
ATOM   8040  O  O   . ASP D  1 106 ? 93.532  148.698 125.843 1.00 61.13  ? 127 ASP D O   1 
ATOM   8041  C  CB  . ASP D  1 106 ? 95.351  148.563 128.375 1.00 58.80  ? 127 ASP D CB  1 
ATOM   8042  C  CG  . ASP D  1 106 ? 95.932  149.376 127.226 1.00 63.77  ? 127 ASP D CG  1 
ATOM   8043  O  OD1 . ASP D  1 106 ? 96.123  148.800 126.075 1.00 65.67  ? 127 ASP D OD1 1 
ATOM   8044  O  OD2 . ASP D  1 106 ? 96.115  150.596 127.438 1.00 67.87  ? 127 ASP D OD2 1 
ATOM   8045  N  N   . CYS D  1 107 ? 93.565  146.566 126.521 1.00 58.91  ? 128 CYS D N   1 
ATOM   8046  C  CA  . CYS D  1 107 ? 93.395  146.012 125.158 1.00 61.41  ? 128 CYS D CA  1 
ATOM   8047  C  C   . CYS D  1 107 ? 91.894  145.976 124.784 1.00 62.03  ? 128 CYS D C   1 
ATOM   8048  O  O   . CYS D  1 107 ? 91.560  145.472 123.675 1.00 64.02  ? 128 CYS D O   1 
ATOM   8049  C  CB  . CYS D  1 107 ? 94.100  144.668 125.067 1.00 62.20  ? 128 CYS D CB  1 
ATOM   8050  S  SG  . CYS D  1 107 ? 93.186  143.333 125.881 1.00 63.43  ? 128 CYS D SG  1 
ATOM   8051  N  N   . GLY D  1 108 ? 91.013  146.491 125.661 1.00 60.01  ? 129 GLY D N   1 
ATOM   8052  C  CA  . GLY D  1 108 ? 89.627  146.898 125.339 1.00 60.22  ? 129 GLY D CA  1 
ATOM   8053  C  C   . GLY D  1 108 ? 88.596  145.864 125.756 1.00 58.77  ? 129 GLY D C   1 
ATOM   8054  O  O   . GLY D  1 108 ? 87.466  145.965 125.325 1.00 60.15  ? 129 GLY D O   1 
ATOM   8055  N  N   . VAL D  1 109 ? 88.962  144.913 126.607 1.00 56.55  ? 130 VAL D N   1 
ATOM   8056  C  CA  . VAL D  1 109 ? 88.083  143.791 127.044 1.00 54.74  ? 130 VAL D CA  1 
ATOM   8057  C  C   . VAL D  1 109 ? 86.982  144.362 127.927 1.00 53.08  ? 130 VAL D C   1 
ATOM   8058  O  O   . VAL D  1 109 ? 87.316  145.216 128.768 1.00 50.87  ? 130 VAL D O   1 
ATOM   8059  C  CB  . VAL D  1 109 ? 88.908  142.786 127.849 1.00 53.39  ? 130 VAL D CB  1 
ATOM   8060  C  CG1 . VAL D  1 109 ? 88.040  141.802 128.602 1.00 52.54  ? 130 VAL D CG1 1 
ATOM   8061  C  CG2 . VAL D  1 109 ? 89.931  142.087 126.986 1.00 55.66  ? 130 VAL D CG2 1 
ATOM   8062  N  N   . ASP D  1 110 ? 85.759  143.840 127.803 1.00 53.01  ? 131 ASP D N   1 
ATOM   8063  C  CA  . ASP D  1 110 ? 84.589  144.330 128.560 1.00 52.00  ? 131 ASP D CA  1 
ATOM   8064  C  C   . ASP D  1 110 ? 84.629  143.729 129.979 1.00 49.08  ? 131 ASP D C   1 
ATOM   8065  O  O   . ASP D  1 110 ? 85.445  142.812 130.265 1.00 46.04  ? 131 ASP D O   1 
ATOM   8066  C  CB  . ASP D  1 110 ? 83.323  144.138 127.726 1.00 55.34  ? 131 ASP D CB  1 
ATOM   8067  C  CG  . ASP D  1 110 ? 82.795  142.720 127.547 1.00 57.08  ? 131 ASP D CG  1 
ATOM   8068  O  OD1 . ASP D  1 110 ? 83.128  141.831 128.359 1.00 56.10  ? 131 ASP D OD1 1 
ATOM   8069  O  OD2 . ASP D  1 110 ? 81.975  142.535 126.617 1.00 61.73  ? 131 ASP D OD2 1 
ATOM   8070  N  N   . ASP D  1 111 ? 83.826  144.286 130.878 1.00 47.84  ? 132 ASP D N   1 
ATOM   8071  C  CA  . ASP D  1 111 ? 83.891  143.917 132.308 1.00 46.12  ? 132 ASP D CA  1 
ATOM   8072  C  C   . ASP D  1 111 ? 83.404  142.479 132.495 1.00 44.90  ? 132 ASP D C   1 
ATOM   8073  O  O   . ASP D  1 111 ? 83.966  141.795 133.363 1.00 41.69  ? 132 ASP D O   1 
ATOM   8074  C  CB  . ASP D  1 111 ? 83.110  144.913 133.167 1.00 47.30  ? 132 ASP D CB  1 
ATOM   8075  C  CG  . ASP D  1 111 ? 83.911  146.195 133.472 1.00 48.52  ? 132 ASP D CG  1 
ATOM   8076  O  OD1 . ASP D  1 111 ? 85.167  146.073 133.625 1.00 46.90  ? 132 ASP D OD1 1 
ATOM   8077  O  OD2 . ASP D  1 111 ? 83.263  147.280 133.501 1.00 51.00  ? 132 ASP D OD2 1 
ATOM   8078  N  N   . ASP D  1 112 ? 82.397  142.064 131.711 1.00 46.03  ? 133 ASP D N   1 
ATOM   8079  C  CA  . ASP D  1 112 ? 81.882  140.673 131.682 1.00 46.13  ? 133 ASP D CA  1 
ATOM   8080  C  C   . ASP D  1 112 ? 83.076  139.744 131.527 1.00 45.26  ? 133 ASP D C   1 
ATOM   8081  O  O   . ASP D  1 112 ? 83.256  138.911 132.395 1.00 43.54  ? 133 ASP D O   1 
ATOM   8082  C  CB  . ASP D  1 112 ? 80.834  140.432 130.578 1.00 48.70  ? 133 ASP D CB  1 
ATOM   8083  C  CG  . ASP D  1 112 ? 79.438  140.940 130.918 1.00 48.65  ? 133 ASP D CG  1 
ATOM   8084  O  OD1 . ASP D  1 112 ? 79.136  141.029 132.114 1.00 45.83  ? 133 ASP D OD1 1 
ATOM   8085  O  OD2 . ASP D  1 112 ? 78.674  141.272 129.972 1.00 51.99  ? 133 ASP D OD2 1 
ATOM   8086  N  N   . ARG D  1 113 ? 83.896  139.922 130.502 1.00 46.50  ? 134 ARG D N   1 
ATOM   8087  C  CA  . ARG D  1 113 ? 85.029  138.988 130.261 1.00 47.77  ? 134 ARG D CA  1 
ATOM   8088  C  C   . ARG D  1 113 ? 86.162  139.152 131.297 1.00 45.09  ? 134 ARG D C   1 
ATOM   8089  O  O   . ARG D  1 113 ? 86.787  138.151 131.672 1.00 43.55  ? 134 ARG D O   1 
ATOM   8090  C  CB  . ARG D  1 113 ? 85.573  139.194 128.852 1.00 52.37  ? 134 ARG D CB  1 
ATOM   8091  C  CG  . ARG D  1 113 ? 86.199  137.925 128.293 1.00 55.41  ? 134 ARG D CG  1 
ATOM   8092  C  CD  . ARG D  1 113 ? 85.639  137.688 126.935 1.00 59.44  ? 134 ARG D CD  1 
ATOM   8093  N  NE  . ARG D  1 113 ? 86.010  138.821 126.091 1.00 63.18  ? 134 ARG D NE  1 
ATOM   8094  C  CZ  . ARG D  1 113 ? 87.009  138.835 125.200 1.00 64.85  ? 134 ARG D CZ  1 
ATOM   8095  N  NH1 . ARG D  1 113 ? 87.781  137.767 125.010 1.00 64.04  ? 134 ARG D NH1 1 
ATOM   8096  N  NH2 . ARG D  1 113 ? 87.204  139.943 124.498 1.00 67.35  ? 134 ARG D NH2 1 
ATOM   8097  N  N   . LEU D  1 114 ? 86.450  140.368 131.747 1.00 43.31  ? 135 LEU D N   1 
ATOM   8098  C  CA  . LEU D  1 114 ? 87.507  140.602 132.761 1.00 41.41  ? 135 LEU D CA  1 
ATOM   8099  C  C   . LEU D  1 114 ? 87.123  139.869 134.058 1.00 38.34  ? 135 LEU D C   1 
ATOM   8100  O  O   . LEU D  1 114 ? 87.954  139.174 134.620 1.00 36.79  ? 135 LEU D O   1 
ATOM   8101  C  CB  . LEU D  1 114 ? 87.649  142.110 132.958 1.00 41.65  ? 135 LEU D CB  1 
ATOM   8102  C  CG  . LEU D  1 114 ? 88.417  142.545 134.200 1.00 40.82  ? 135 LEU D CG  1 
ATOM   8103  C  CD1 . LEU D  1 114 ? 89.778  141.852 134.255 1.00 41.30  ? 135 LEU D CD1 1 
ATOM   8104  C  CD2 . LEU D  1 114 ? 88.597  144.062 134.188 1.00 41.72  ? 135 LEU D CD2 1 
ATOM   8105  N  N   . MET D  1 115 ? 85.880  140.003 134.485 1.00 37.51  ? 136 MET D N   1 
ATOM   8106  C  CA  . MET D  1 115 ? 85.358  139.305 135.668 1.00 36.68  ? 136 MET D CA  1 
ATOM   8107  C  C   . MET D  1 115 ? 85.473  137.788 135.461 1.00 36.99  ? 136 MET D C   1 
ATOM   8108  O  O   . MET D  1 115 ? 85.910  137.125 136.406 1.00 36.06  ? 136 MET D O   1 
ATOM   8109  C  CB  . MET D  1 115 ? 83.921  139.746 135.959 1.00 37.16  ? 136 MET D CB  1 
ATOM   8110  C  CG  . MET D  1 115 ? 83.779  141.198 136.401 1.00 37.42  ? 136 MET D CG  1 
ATOM   8111  S  SD  . MET D  1 115 ? 85.089  141.813 137.514 1.00 37.27  ? 136 MET D SD  1 
ATOM   8112  C  CE  . MET D  1 115 ? 84.128  142.485 138.865 1.00 36.48  ? 136 MET D CE  1 
ATOM   8113  N  N   . ASN D  1 116 ? 85.177  137.259 134.267 1.00 38.73  ? 137 ASN D N   1 
ATOM   8114  C  CA  . ASN D  1 116 ? 85.315  135.806 133.996 1.00 39.93  ? 137 ASN D CA  1 
ATOM   8115  C  C   . ASN D  1 116 ? 86.786  135.412 134.148 1.00 38.75  ? 137 ASN D C   1 
ATOM   8116  O  O   . ASN D  1 116 ? 87.057  134.310 134.642 1.00 37.83  ? 137 ASN D O   1 
ATOM   8117  C  CB  . ASN D  1 116 ? 84.764  135.361 132.634 1.00 43.05  ? 137 ASN D CB  1 
ATOM   8118  C  CG  . ASN D  1 116 ? 83.266  135.585 132.528 1.00 45.49  ? 137 ASN D CG  1 
ATOM   8119  O  OD1 . ASN D  1 116 ? 82.564  135.763 133.538 1.00 45.63  ? 137 ASN D OD1 1 
ATOM   8120  N  ND2 . ASN D  1 116 ? 82.768  135.600 131.306 1.00 48.63  ? 137 ASN D ND2 1 
ATOM   8121  N  N   . VAL D  1 117 ? 87.705  136.251 133.713 1.00 38.67  ? 138 VAL D N   1 
ATOM   8122  C  CA  . VAL D  1 117 ? 89.159  135.955 133.852 1.00 39.20  ? 138 VAL D CA  1 
ATOM   8123  C  C   . VAL D  1 117 ? 89.517  135.817 135.345 1.00 37.07  ? 138 VAL D C   1 
ATOM   8124  O  O   . VAL D  1 117 ? 90.390  134.961 135.696 1.00 37.38  ? 138 VAL D O   1 
ATOM   8125  C  CB  . VAL D  1 117 ? 90.012  137.047 133.168 1.00 40.17  ? 138 VAL D CB  1 
ATOM   8126  C  CG1 . VAL D  1 117 ? 91.493  136.806 133.363 1.00 39.93  ? 138 VAL D CG1 1 
ATOM   8127  C  CG2 . VAL D  1 117 ? 89.709  137.147 131.699 1.00 42.33  ? 138 VAL D CG2 1 
ATOM   8128  N  N   . ILE D  1 118 ? 88.911  136.650 136.188 1.00 35.19  ? 139 ILE D N   1 
ATOM   8129  C  CA  . ILE D  1 118 ? 89.210  136.659 137.639 1.00 33.45  ? 139 ILE D CA  1 
ATOM   8130  C  C   . ILE D  1 118 ? 88.675  135.340 138.181 1.00 33.54  ? 139 ILE D C   1 
ATOM   8131  O  O   . ILE D  1 118 ? 89.444  134.605 138.864 1.00 33.09  ? 139 ILE D O   1 
ATOM   8132  C  CB  . ILE D  1 118 ? 88.609  137.915 138.304 1.00 32.22  ? 139 ILE D CB  1 
ATOM   8133  C  CG1 . ILE D  1 118 ? 89.406  139.160 137.924 1.00 32.33  ? 139 ILE D CG1 1 
ATOM   8134  C  CG2 . ILE D  1 118 ? 88.548  137.763 139.809 1.00 30.99  ? 139 ILE D CG2 1 
ATOM   8135  C  CD1 . ILE D  1 118 ? 88.675  140.455 138.197 1.00 31.97  ? 139 ILE D CD1 1 
ATOM   8136  N  N   . SER D  1 119 ? 87.437  134.992 137.825 1.00 34.08  ? 140 SER D N   1 
ATOM   8137  C  CA  . SER D  1 119 ? 86.857  133.674 138.209 1.00 34.49  ? 140 SER D CA  1 
ATOM   8138  C  C   . SER D  1 119 ? 87.815  132.539 137.822 1.00 35.99  ? 140 SER D C   1 
ATOM   8139  O  O   . SER D  1 119 ? 88.127  131.676 138.672 1.00 35.68  ? 140 SER D O   1 
ATOM   8140  C  CB  . SER D  1 119 ? 85.491  133.491 137.618 1.00 34.80  ? 140 SER D CB  1 
ATOM   8141  O  OG  . SER D  1 119 ? 84.580  134.350 138.288 1.00 33.70  ? 140 SER D OG  1 
ATOM   8142  N  N   . GLU D  1 120 ? 88.296  132.545 136.582 1.00 38.61  ? 141 GLU D N   1 
ATOM   8143  C  CA  . GLU D  1 120 ? 89.194  131.473 136.082 1.00 41.65  ? 141 GLU D CA  1 
ATOM   8144  C  C   . GLU D  1 120 ? 90.509  131.437 136.866 1.00 38.48  ? 141 GLU D C   1 
ATOM   8145  O  O   . GLU D  1 120 ? 91.072  130.357 136.999 1.00 37.97  ? 141 GLU D O   1 
ATOM   8146  C  CB  . GLU D  1 120 ? 89.453  131.616 134.581 1.00 46.59  ? 141 GLU D CB  1 
ATOM   8147  C  CG  . GLU D  1 120 ? 88.227  131.374 133.728 1.00 52.67  ? 141 GLU D CG  1 
ATOM   8148  C  CD  . GLU D  1 120 ? 87.648  129.980 133.860 1.00 58.34  ? 141 GLU D CD  1 
ATOM   8149  O  OE1 . GLU D  1 120 ? 88.414  129.019 133.734 1.00 61.15  ? 141 GLU D OE1 1 
ATOM   8150  O  OE2 . GLU D  1 120 ? 86.440  129.865 134.116 1.00 65.62  ? 141 GLU D OE2 1 
ATOM   8151  N  N   . SER D  1 121 ? 91.002  132.600 137.285 1.00 35.86  ? 142 SER D N   1 
ATOM   8152  C  CA  . SER D  1 121 ? 92.321  132.722 137.962 1.00 34.60  ? 142 SER D CA  1 
ATOM   8153  C  C   . SER D  1 121 ? 92.201  132.068 139.337 1.00 33.30  ? 142 SER D C   1 
ATOM   8154  O  O   . SER D  1 121 ? 93.112  131.325 139.743 1.00 32.63  ? 142 SER D O   1 
ATOM   8155  C  CB  . SER D  1 121 ? 92.787  134.168 138.016 1.00 33.52  ? 142 SER D CB  1 
ATOM   8156  O  OG  . SER D  1 121 ? 92.994  134.664 136.685 1.00 35.10  ? 142 SER D OG  1 
ATOM   8157  N  N   . VAL D  1 122 ? 91.063  132.285 139.987 1.00 32.28  ? 143 VAL D N   1 
ATOM   8158  C  CA  . VAL D  1 122 ? 90.737  131.642 141.289 1.00 31.79  ? 143 VAL D CA  1 
ATOM   8159  C  C   . VAL D  1 122 ? 90.724  130.115 141.094 1.00 33.45  ? 143 VAL D C   1 
ATOM   8160  O  O   . VAL D  1 122 ? 91.300  129.381 141.952 1.00 32.89  ? 143 VAL D O   1 
ATOM   8161  C  CB  . VAL D  1 122 ? 89.408  132.201 141.836 1.00 30.92  ? 143 VAL D CB  1 
ATOM   8162  C  CG1 . VAL D  1 122 ? 88.917  131.444 143.054 1.00 30.49  ? 143 VAL D CG1 1 
ATOM   8163  C  CG2 . VAL D  1 122 ? 89.540  133.691 142.136 1.00 29.92  ? 143 VAL D CG2 1 
ATOM   8164  N  N   . LYS D  1 123 ? 90.095  129.627 140.034 1.00 34.49  ? 144 LYS D N   1 
ATOM   8165  C  CA  . LYS D  1 123 ? 89.918  128.168 139.891 1.00 36.38  ? 144 LYS D CA  1 
ATOM   8166  C  C   . LYS D  1 123 ? 91.281  127.508 139.648 1.00 37.49  ? 144 LYS D C   1 
ATOM   8167  O  O   . LYS D  1 123 ? 91.505  126.332 140.075 1.00 37.73  ? 144 LYS D O   1 
ATOM   8168  C  CB  . LYS D  1 123 ? 88.939  127.897 138.752 1.00 38.31  ? 144 LYS D CB  1 
ATOM   8169  C  CG  . LYS D  1 123 ? 87.494  128.290 139.060 1.00 37.96  ? 144 LYS D CG  1 
ATOM   8170  C  CD  . LYS D  1 123 ? 86.547  127.744 138.006 1.00 39.65  ? 144 LYS D CD  1 
ATOM   8171  C  CE  . LYS D  1 123 ? 85.135  128.261 138.148 1.00 39.47  ? 144 LYS D CE  1 
ATOM   8172  N  NZ  . LYS D  1 123 ? 84.227  127.601 137.187 1.00 40.81  ? 144 LYS D NZ  1 
ATOM   8173  N  N   . LEU D  1 124 ? 92.181  128.242 139.005 1.00 37.45  ? 145 LEU D N   1 
ATOM   8174  C  CA  . LEU D  1 124 ? 93.572  127.794 138.741 1.00 38.68  ? 145 LEU D CA  1 
ATOM   8175  C  C   . LEU D  1 124 ? 94.282  127.546 140.072 1.00 37.48  ? 145 LEU D C   1 
ATOM   8176  O  O   . LEU D  1 124 ? 95.046  126.588 140.201 1.00 38.34  ? 145 LEU D O   1 
ATOM   8177  C  CB  . LEU D  1 124 ? 94.305  128.899 137.986 1.00 39.50  ? 145 LEU D CB  1 
ATOM   8178  C  CG  . LEU D  1 124 ? 94.481  128.734 136.478 1.00 41.53  ? 145 LEU D CG  1 
ATOM   8179  C  CD1 . LEU D  1 124 ? 93.389  127.955 135.829 1.00 42.38  ? 145 LEU D CD1 1 
ATOM   8180  C  CD2 . LEU D  1 124 ? 94.604  130.107 135.854 1.00 41.65  ? 145 LEU D CD2 1 
ATOM   8181  N  N   . VAL D  1 125 ? 94.081  128.427 141.022 1.00 35.55  ? 146 VAL D N   1 
ATOM   8182  C  CA  . VAL D  1 125 ? 94.617  128.188 142.374 1.00 35.14  ? 146 VAL D CA  1 
ATOM   8183  C  C   . VAL D  1 125 ? 93.944  126.940 142.941 1.00 35.00  ? 146 VAL D C   1 
ATOM   8184  O  O   . VAL D  1 125 ? 94.670  126.071 143.401 1.00 35.65  ? 146 VAL D O   1 
ATOM   8185  C  CB  . VAL D  1 125 ? 94.392  129.407 143.276 1.00 33.70  ? 146 VAL D CB  1 
ATOM   8186  C  CG1 . VAL D  1 125 ? 94.824  129.094 144.684 1.00 33.24  ? 146 VAL D CG1 1 
ATOM   8187  C  CG2 . VAL D  1 125 ? 95.094  130.632 142.711 1.00 33.57  ? 146 VAL D CG2 1 
ATOM   8188  N  N   . MET D  1 126 ? 92.620  126.887 142.916 1.00 34.51  ? 147 MET D N   1 
ATOM   8189  C  CA  . MET D  1 126 ? 91.827  125.794 143.540 1.00 35.50  ? 147 MET D CA  1 
ATOM   8190  C  C   . MET D  1 126 ? 92.201  124.441 142.909 1.00 36.91  ? 147 MET D C   1 
ATOM   8191  O  O   . MET D  1 126 ? 92.117  123.432 143.625 1.00 36.32  ? 147 MET D O   1 
ATOM   8192  C  CB  . MET D  1 126 ? 90.318  126.048 143.415 1.00 35.13  ? 147 MET D CB  1 
ATOM   8193  C  CG  . MET D  1 126 ? 89.880  127.294 144.149 1.00 33.99  ? 147 MET D CG  1 
ATOM   8194  S  SD  . MET D  1 126 ? 88.075  127.530 144.098 1.00 35.12  ? 147 MET D SD  1 
ATOM   8195  C  CE  . MET D  1 126 ? 87.579  126.294 145.299 1.00 35.99  ? 147 MET D CE  1 
ATOM   8196  N  N   . GLU D  1 127 ? 92.631  124.435 141.648 1.00 38.90  ? 148 GLU D N   1 
ATOM   8197  C  CA  . GLU D  1 127 ? 92.997  123.190 140.916 1.00 42.81  ? 148 GLU D CA  1 
ATOM   8198  C  C   . GLU D  1 127 ? 94.364  122.650 141.341 1.00 42.45  ? 148 GLU D C   1 
ATOM   8199  O  O   . GLU D  1 127 ? 94.711  121.567 140.872 1.00 44.31  ? 148 GLU D O   1 
ATOM   8200  C  CB  . GLU D  1 127 ? 92.989  123.405 139.404 1.00 45.69  ? 148 GLU D CB  1 
ATOM   8201  C  CG  . GLU D  1 127 ? 91.608  123.189 138.858 1.00 49.62  ? 148 GLU D CG  1 
ATOM   8202  C  CD  . GLU D  1 127 ? 91.215  123.929 137.596 1.00 53.82  ? 148 GLU D CD  1 
ATOM   8203  O  OE1 . GLU D  1 127 ? 92.113  124.214 136.708 1.00 56.74  ? 148 GLU D OE1 1 
ATOM   8204  O  OE2 . GLU D  1 127 ? 89.978  124.208 137.494 1.00 57.83  ? 148 GLU D OE2 1 
ATOM   8205  N  N   . GLU D  1 128 ? 95.133  123.393 142.123 1.00 40.45  ? 149 GLU D N   1 
ATOM   8206  C  CA  . GLU D  1 128 ? 96.442  122.933 142.632 1.00 41.53  ? 149 GLU D CA  1 
ATOM   8207  C  C   . GLU D  1 128 ? 96.209  122.511 144.083 1.00 40.78  ? 149 GLU D C   1 
ATOM   8208  O  O   . GLU D  1 128 ? 96.139  123.360 144.967 1.00 38.46  ? 149 GLU D O   1 
ATOM   8209  C  CB  . GLU D  1 128 ? 97.512  124.001 142.404 1.00 41.38  ? 149 GLU D CB  1 
ATOM   8210  C  CG  . GLU D  1 128 ? 97.987  124.118 140.957 1.00 43.39  ? 149 GLU D CG  1 
ATOM   8211  C  CD  . GLU D  1 128 ? 98.851  122.981 140.412 1.00 47.58  ? 149 GLU D CD  1 
ATOM   8212  O  OE1 . GLU D  1 128 ? 99.246  122.115 141.219 1.00 49.13  ? 149 GLU D OE1 1 
ATOM   8213  O  OE2 . GLU D  1 128 ? 99.147  122.937 139.153 1.00 49.88  ? 149 GLU D OE2 1 
ATOM   8214  N  N   . GLU D  1 129 ? 95.943  121.235 144.294 1.00 42.74  ? 150 GLU D N   1 
ATOM   8215  C  CA  . GLU D  1 129 ? 95.719  120.723 145.665 1.00 43.90  ? 150 GLU D CA  1 
ATOM   8216  C  C   . GLU D  1 129 ? 97.011  120.865 146.478 1.00 42.17  ? 150 GLU D C   1 
ATOM   8217  O  O   . GLU D  1 129 ? 98.096  120.632 145.954 1.00 43.48  ? 150 GLU D O   1 
ATOM   8218  C  CB  . GLU D  1 129 ? 95.140  119.313 145.567 1.00 48.28  ? 150 GLU D CB  1 
ATOM   8219  C  CG  . GLU D  1 129 ? 93.715  119.245 146.086 1.00 51.12  ? 150 GLU D CG  1 
ATOM   8220  C  CD  . GLU D  1 129 ? 92.724  118.558 145.162 1.00 56.22  ? 150 GLU D CD  1 
ATOM   8221  O  OE1 . GLU D  1 129 ? 92.849  117.314 144.988 1.00 60.14  ? 150 GLU D OE1 1 
ATOM   8222  O  OE2 . GLU D  1 129 ? 91.816  119.268 144.617 1.00 58.97  ? 150 GLU D OE2 1 
ATOM   8223  N  N   . PRO D  1 130 ? 96.958  121.333 147.743 1.00 39.02  ? 151 PRO D N   1 
ATOM   8224  C  CA  . PRO D  1 130 ? 95.735  121.740 148.416 1.00 37.01  ? 151 PRO D CA  1 
ATOM   8225  C  C   . PRO D  1 130 ? 95.601  123.254 148.648 1.00 34.29  ? 151 PRO D C   1 
ATOM   8226  O  O   . PRO D  1 130 ? 95.192  123.631 149.710 1.00 33.06  ? 151 PRO D O   1 
ATOM   8227  C  CB  . PRO D  1 130 ? 95.972  121.050 149.758 1.00 37.82  ? 151 PRO D CB  1 
ATOM   8228  C  CG  . PRO D  1 130 ? 97.434  121.285 150.023 1.00 38.47  ? 151 PRO D CG  1 
ATOM   8229  C  CD  . PRO D  1 130 ? 98.080  121.425 148.662 1.00 39.31  ? 151 PRO D CD  1 
ATOM   8230  N  N   . LEU D  1 131 ? 95.960  124.074 147.661 1.00 33.14  ? 152 LEU D N   1 
ATOM   8231  C  CA  . LEU D  1 131 ? 95.905  125.543 147.819 1.00 31.45  ? 152 LEU D CA  1 
ATOM   8232  C  C   . LEU D  1 131 ? 94.431  125.951 147.983 1.00 30.65  ? 152 LEU D C   1 
ATOM   8233  O  O   . LEU D  1 131 ? 93.494  125.338 147.375 1.00 30.59  ? 152 LEU D O   1 
ATOM   8234  C  CB  . LEU D  1 131 ? 96.566  126.266 146.645 1.00 31.79  ? 152 LEU D CB  1 
ATOM   8235  C  CG  . LEU D  1 131 ? 97.963  125.811 146.197 1.00 33.10  ? 152 LEU D CG  1 
ATOM   8236  C  CD1 . LEU D  1 131 ? 98.439  126.654 145.041 1.00 33.34  ? 152 LEU D CD1 1 
ATOM   8237  C  CD2 . LEU D  1 131 ? 98.995  125.860 147.290 1.00 32.44  ? 152 LEU D CD2 1 
ATOM   8238  N  N   . ARG D  1 132 ? 94.216  126.971 148.795 1.00 29.50  ? 153 ARG D N   1 
ATOM   8239  C  CA  . ARG D  1 132 ? 92.910  127.650 148.928 1.00 29.52  ? 153 ARG D CA  1 
ATOM   8240  C  C   . ARG D  1 132 ? 93.174  129.125 148.700 1.00 29.20  ? 153 ARG D C   1 
ATOM   8241  O  O   . ARG D  1 132 ? 94.195  129.654 149.157 1.00 29.15  ? 153 ARG D O   1 
ATOM   8242  C  CB  . ARG D  1 132 ? 92.335  127.407 150.322 1.00 29.73  ? 153 ARG D CB  1 
ATOM   8243  C  CG  . ARG D  1 132 ? 92.064  125.936 150.614 1.00 31.10  ? 153 ARG D CG  1 
ATOM   8244  C  CD  . ARG D  1 132 ? 90.965  125.731 151.619 1.00 30.85  ? 153 ARG D CD  1 
ATOM   8245  N  NE  . ARG D  1 132 ? 90.809  124.293 151.779 1.00 32.83  ? 153 ARG D NE  1 
ATOM   8246  C  CZ  . ARG D  1 132 ? 89.919  123.707 152.559 1.00 32.47  ? 153 ARG D CZ  1 
ATOM   8247  N  NH1 . ARG D  1 132 ? 89.058  124.437 153.244 1.00 31.56  ? 153 ARG D NH1 1 
ATOM   8248  N  NH2 . ARG D  1 132 ? 89.906  122.399 152.634 1.00 33.45  ? 153 ARG D NH2 1 
ATOM   8249  N  N   . PRO D  1 133 ? 92.300  129.823 147.961 1.00 30.14  ? 154 PRO D N   1 
ATOM   8250  C  CA  . PRO D  1 133 ? 92.590  131.202 147.575 1.00 30.03  ? 154 PRO D CA  1 
ATOM   8251  C  C   . PRO D  1 133 ? 92.268  132.241 148.653 1.00 28.78  ? 154 PRO D C   1 
ATOM   8252  O  O   . PRO D  1 133 ? 91.261  132.159 149.301 1.00 27.96  ? 154 PRO D O   1 
ATOM   8253  C  CB  . PRO D  1 133 ? 91.729  131.425 146.329 1.00 30.96  ? 154 PRO D CB  1 
ATOM   8254  C  CG  . PRO D  1 133 ? 90.563  130.431 146.501 1.00 31.91  ? 154 PRO D CG  1 
ATOM   8255  C  CD  . PRO D  1 133 ? 91.109  129.262 147.305 1.00 31.74  ? 154 PRO D CD  1 
ATOM   8256  N  N   . LEU D  1 134 ? 93.179  133.210 148.791 1.00 28.62  ? 155 LEU D N   1 
ATOM   8257  C  CA  . LEU D  1 134 ? 93.020  134.459 149.573 1.00 26.63  ? 155 LEU D CA  1 
ATOM   8258  C  C   . LEU D  1 134 ? 93.382  135.576 148.613 1.00 25.92  ? 155 LEU D C   1 
ATOM   8259  O  O   . LEU D  1 134 ? 94.534  135.667 148.211 1.00 24.72  ? 155 LEU D O   1 
ATOM   8260  C  CB  . LEU D  1 134 ? 93.942  134.459 150.801 1.00 26.86  ? 155 LEU D CB  1 
ATOM   8261  C  CG  . LEU D  1 134 ? 93.545  135.401 151.937 1.00 26.08  ? 155 LEU D CG  1 
ATOM   8262  C  CD1 . LEU D  1 134 ? 94.499  135.254 153.096 1.00 25.91  ? 155 LEU D CD1 1 
ATOM   8263  C  CD2 . LEU D  1 134 ? 93.511  136.839 151.471 1.00 26.34  ? 155 LEU D CD2 1 
ATOM   8264  N  N   . VAL D  1 135 ? 92.381  136.354 148.251 1.00 25.75  ? 156 VAL D N   1 
ATOM   8265  C  CA  . VAL D  1 135 ? 92.490  137.351 147.164 1.00 25.96  ? 156 VAL D CA  1 
ATOM   8266  C  C   . VAL D  1 135 ? 92.738  138.702 147.814 1.00 24.62  ? 156 VAL D C   1 
ATOM   8267  O  O   . VAL D  1 135 ? 92.015  139.052 148.805 1.00 25.11  ? 156 VAL D O   1 
ATOM   8268  C  CB  . VAL D  1 135 ? 91.208  137.348 146.335 1.00 27.20  ? 156 VAL D CB  1 
ATOM   8269  C  CG1 . VAL D  1 135 ? 91.112  138.571 145.452 1.00 28.97  ? 156 VAL D CG1 1 
ATOM   8270  C  CG2 . VAL D  1 135 ? 91.092  136.087 145.518 1.00 28.84  ? 156 VAL D CG2 1 
ATOM   8271  N  N   . LEU D  1 136 ? 93.702  139.423 147.278 1.00 24.08  ? 157 LEU D N   1 
ATOM   8272  C  CA  . LEU D  1 136 ? 94.013  140.809 147.657 1.00 23.57  ? 157 LEU D CA  1 
ATOM   8273  C  C   . LEU D  1 136 ? 93.357  141.736 146.662 1.00 23.74  ? 157 LEU D C   1 
ATOM   8274  O  O   . LEU D  1 136 ? 93.704  141.693 145.503 1.00 24.71  ? 157 LEU D O   1 
ATOM   8275  C  CB  . LEU D  1 136 ? 95.525  141.017 147.641 1.00 25.03  ? 157 LEU D CB  1 
ATOM   8276  C  CG  . LEU D  1 136 ? 96.355  139.966 148.354 1.00 25.53  ? 157 LEU D CG  1 
ATOM   8277  C  CD1 . LEU D  1 136 ? 97.811  140.356 148.301 1.00 26.92  ? 157 LEU D CD1 1 
ATOM   8278  C  CD2 . LEU D  1 136 ? 95.910  139.806 149.783 1.00 25.04  ? 157 LEU D CD2 1 
ATOM   8279  N  N   . GLY D  1 137 ? 92.347  142.472 147.091 1.00 23.64  ? 158 GLY D N   1 
ATOM   8280  C  CA  . GLY D  1 137 ? 91.788  143.572 146.278 1.00 23.30  ? 158 GLY D CA  1 
ATOM   8281  C  C   . GLY D  1 137 ? 92.701  144.785 146.301 1.00 23.07  ? 158 GLY D C   1 
ATOM   8282  O  O   . GLY D  1 137 ? 93.668  144.813 147.052 1.00 22.29  ? 158 GLY D O   1 
ATOM   8283  N  N   . GLY D  1 138 ? 92.397  145.782 145.463 1.00 24.00  ? 159 GLY D N   1 
ATOM   8284  C  CA  . GLY D  1 138 ? 91.257  145.746 144.577 1.00 24.43  ? 159 GLY D CA  1 
ATOM   8285  C  C   . GLY D  1 138 ? 89.990  146.195 145.253 1.00 23.98  ? 159 GLY D C   1 
ATOM   8286  O  O   . GLY D  1 138 ? 89.898  146.111 146.477 1.00 24.48  ? 159 GLY D O   1 
ATOM   8287  N  N   . ASP D  1 139 ? 89.001  146.649 144.487 1.00 24.60  ? 160 ASP D N   1 
ATOM   8288  C  CA  . ASP D  1 139 ? 87.778  147.185 145.092 1.00 24.12  ? 160 ASP D CA  1 
ATOM   8289  C  C   . ASP D  1 139 ? 86.820  146.018 145.303 1.00 24.38  ? 160 ASP D C   1 
ATOM   8290  O  O   . ASP D  1 139 ? 87.098  144.893 144.840 1.00 24.49  ? 160 ASP D O   1 
ATOM   8291  C  CB  . ASP D  1 139 ? 87.255  148.343 144.260 1.00 25.44  ? 160 ASP D CB  1 
ATOM   8292  C  CG  . ASP D  1 139 ? 86.611  147.930 142.943 1.00 26.40  ? 160 ASP D CG  1 
ATOM   8293  O  OD1 . ASP D  1 139 ? 85.915  146.867 142.939 1.00 25.23  ? 160 ASP D OD1 1 
ATOM   8294  O  OD2 . ASP D  1 139 ? 86.810  148.691 141.954 1.00 27.11  ? 160 ASP D OD2 1 
ATOM   8295  N  N   . HIS D  1 140 ? 85.697  146.268 145.969 1.00 24.28  ? 161 HIS D N   1 
ATOM   8296  C  CA  . HIS D  1 140 ? 84.826  145.176 146.442 1.00 24.05  ? 161 HIS D CA  1 
ATOM   8297  C  C   . HIS D  1 140 ? 84.168  144.499 145.242 1.00 25.10  ? 161 HIS D C   1 
ATOM   8298  O  O   . HIS D  1 140 ? 83.595  143.415 145.419 1.00 24.94  ? 161 HIS D O   1 
ATOM   8299  C  CB  . HIS D  1 140 ? 83.797  145.674 147.457 1.00 23.65  ? 161 HIS D CB  1 
ATOM   8300  C  CG  . HIS D  1 140 ? 83.708  144.756 148.624 1.00 22.37  ? 161 HIS D CG  1 
ATOM   8301  N  ND1 . HIS D  1 140 ? 83.483  145.227 149.913 1.00 21.24  ? 161 HIS D ND1 1 
ATOM   8302  C  CD2 . HIS D  1 140 ? 83.836  143.397 148.673 1.00 21.96  ? 161 HIS D CD2 1 
ATOM   8303  C  CE1 . HIS D  1 140 ? 83.517  144.164 150.740 1.00 22.08  ? 161 HIS D CE1 1 
ATOM   8304  N  NE2 . HIS D  1 140 ? 83.700  143.001 149.988 1.00 21.34  ? 161 HIS D NE2 1 
ATOM   8305  N  N   . SER D  1 141 ? 84.234  145.066 144.050 1.00 26.51  ? 162 SER D N   1 
ATOM   8306  C  CA  . SER D  1 141 ? 83.554  144.406 142.906 1.00 28.46  ? 162 SER D CA  1 
ATOM   8307  C  C   . SER D  1 141 ? 84.085  142.975 142.754 1.00 29.44  ? 162 SER D C   1 
ATOM   8308  O  O   . SER D  1 141 ? 83.351  142.120 142.275 1.00 31.21  ? 162 SER D O   1 
ATOM   8309  C  CB  . SER D  1 141 ? 83.703  145.171 141.649 1.00 29.81  ? 162 SER D CB  1 
ATOM   8310  O  OG  . SER D  1 141 ? 85.019  145.082 141.174 1.00 30.35  ? 162 SER D OG  1 
ATOM   8311  N  N   . ILE D  1 142 ? 85.314  142.691 143.184 1.00 29.72  ? 163 ILE D N   1 
ATOM   8312  C  CA  . ILE D  1 142 ? 86.014  141.422 142.838 1.00 29.55  ? 163 ILE D CA  1 
ATOM   8313  C  C   . ILE D  1 142 ? 85.420  140.265 143.644 1.00 28.42  ? 163 ILE D C   1 
ATOM   8314  O  O   . ILE D  1 142 ? 85.667  139.093 143.265 1.00 28.23  ? 163 ILE D O   1 
ATOM   8315  C  CB  . ILE D  1 142 ? 87.524  141.555 143.072 1.00 29.97  ? 163 ILE D CB  1 
ATOM   8316  C  CG1 . ILE D  1 142 ? 87.839  141.532 144.549 1.00 29.71  ? 163 ILE D CG1 1 
ATOM   8317  C  CG2 . ILE D  1 142 ? 88.084  142.794 142.397 1.00 31.32  ? 163 ILE D CG2 1 
ATOM   8318  C  CD1 . ILE D  1 142 ? 89.304  141.571 144.829 1.00 30.96  ? 163 ILE D CD1 1 
ATOM   8319  N  N   . SER D  1 143 ? 84.717  140.534 144.750 1.00 26.91  ? 164 SER D N   1 
ATOM   8320  C  CA  . SER D  1 143 ? 84.172  139.427 145.589 1.00 26.25  ? 164 SER D CA  1 
ATOM   8321  C  C   . SER D  1 143 ? 83.195  138.564 144.771 1.00 26.96  ? 164 SER D C   1 
ATOM   8322  O  O   . SER D  1 143 ? 83.150  137.318 144.972 1.00 26.67  ? 164 SER D O   1 
ATOM   8323  C  CB  . SER D  1 143 ? 83.596  139.963 146.856 1.00 25.12  ? 164 SER D CB  1 
ATOM   8324  O  OG  . SER D  1 143 ? 84.635  140.601 147.592 1.00 24.68  ? 164 SER D OG  1 
ATOM   8325  N  N   . TYR D  1 144 ? 82.500  139.169 143.821 1.00 27.29  ? 165 TYR D N   1 
ATOM   8326  C  CA  . TYR D  1 144 ? 81.478  138.435 143.051 1.00 29.67  ? 165 TYR D CA  1 
ATOM   8327  C  C   . TYR D  1 144 ? 82.169  137.357 142.209 1.00 30.45  ? 165 TYR D C   1 
ATOM   8328  O  O   . TYR D  1 144 ? 81.869  136.172 142.337 1.00 29.57  ? 165 TYR D O   1 
ATOM   8329  C  CB  . TYR D  1 144 ? 80.588  139.400 142.260 1.00 30.77  ? 165 TYR D CB  1 
ATOM   8330  C  CG  . TYR D  1 144 ? 79.783  138.732 141.184 1.00 32.53  ? 165 TYR D CG  1 
ATOM   8331  C  CD1 . TYR D  1 144 ? 79.070  137.561 141.415 1.00 33.54  ? 165 TYR D CD1 1 
ATOM   8332  C  CD2 . TYR D  1 144 ? 79.697  139.294 139.922 1.00 33.85  ? 165 TYR D CD2 1 
ATOM   8333  C  CE1 . TYR D  1 144 ? 78.283  136.970 140.413 1.00 35.00  ? 165 TYR D CE1 1 
ATOM   8334  C  CE2 . TYR D  1 144 ? 78.915  138.727 138.926 1.00 35.60  ? 165 TYR D CE2 1 
ATOM   8335  C  CZ  . TYR D  1 144 ? 78.236  137.540 139.151 1.00 35.98  ? 165 TYR D CZ  1 
ATOM   8336  O  OH  . TYR D  1 144 ? 77.521  137.010 138.108 1.00 38.49  ? 165 TYR D OH  1 
ATOM   8337  N  N   . PRO D  1 145 ? 83.117  137.694 141.304 1.00 31.13  ? 166 PRO D N   1 
ATOM   8338  C  CA  . PRO D  1 145 ? 83.737  136.649 140.491 1.00 32.41  ? 166 PRO D CA  1 
ATOM   8339  C  C   . PRO D  1 145 ? 84.546  135.660 141.346 1.00 31.08  ? 166 PRO D C   1 
ATOM   8340  O  O   . PRO D  1 145 ? 84.633  134.501 141.016 1.00 32.46  ? 166 PRO D O   1 
ATOM   8341  C  CB  . PRO D  1 145 ? 84.579  137.445 139.481 1.00 33.63  ? 166 PRO D CB  1 
ATOM   8342  C  CG  . PRO D  1 145 ? 84.814  138.771 140.170 1.00 32.24  ? 166 PRO D CG  1 
ATOM   8343  C  CD  . PRO D  1 145 ? 83.487  139.041 140.849 1.00 31.69  ? 166 PRO D CD  1 
ATOM   8344  N  N   . VAL D  1 146 ? 85.099  136.106 142.454 1.00 28.80  ? 167 VAL D N   1 
ATOM   8345  C  CA  . VAL D  1 146 ? 85.828  135.179 143.350 1.00 27.70  ? 167 VAL D CA  1 
ATOM   8346  C  C   . VAL D  1 146 ? 84.837  134.187 143.963 1.00 28.31  ? 167 VAL D C   1 
ATOM   8347  O  O   . VAL D  1 146 ? 85.038  133.019 143.823 1.00 29.12  ? 167 VAL D O   1 
ATOM   8348  C  CB  . VAL D  1 146 ? 86.619  135.940 144.416 1.00 26.09  ? 167 VAL D CB  1 
ATOM   8349  C  CG1 . VAL D  1 146 ? 87.288  134.939 145.329 1.00 25.82  ? 167 VAL D CG1 1 
ATOM   8350  C  CG2 . VAL D  1 146 ? 87.659  136.866 143.807 1.00 25.99  ? 167 VAL D CG2 1 
ATOM   8351  N  N   . VAL D  1 147 ? 83.788  134.633 144.656 1.00 29.18  ? 168 VAL D N   1 
ATOM   8352  C  CA  . VAL D  1 147 ? 82.785  133.699 145.273 1.00 29.26  ? 168 VAL D CA  1 
ATOM   8353  C  C   . VAL D  1 147 ? 82.149  132.862 144.192 1.00 30.75  ? 168 VAL D C   1 
ATOM   8354  O  O   . VAL D  1 147 ? 81.908  131.696 144.454 1.00 31.50  ? 168 VAL D O   1 
ATOM   8355  C  CB  . VAL D  1 147 ? 81.718  134.461 146.069 1.00 29.06  ? 168 VAL D CB  1 
ATOM   8356  C  CG1 . VAL D  1 147 ? 80.519  133.633 146.427 1.00 29.57  ? 168 VAL D CG1 1 
ATOM   8357  C  CG2 . VAL D  1 147 ? 82.361  135.078 147.293 1.00 28.06  ? 168 VAL D CG2 1 
ATOM   8358  N  N   . ARG D  1 148 ? 81.835  133.438 143.036 1.00 31.61  ? 169 ARG D N   1 
ATOM   8359  C  CA  . ARG D  1 148 ? 81.187  132.636 141.981 1.00 32.93  ? 169 ARG D CA  1 
ATOM   8360  C  C   . ARG D  1 148 ? 82.094  131.442 141.660 1.00 33.65  ? 169 ARG D C   1 
ATOM   8361  O  O   . ARG D  1 148 ? 81.580  130.331 141.617 1.00 34.88  ? 169 ARG D O   1 
ATOM   8362  C  CB  . ARG D  1 148 ? 80.944  133.459 140.724 1.00 34.66  ? 169 ARG D CB  1 
ATOM   8363  C  CG  . ARG D  1 148 ? 80.539  132.592 139.548 1.00 37.48  ? 169 ARG D CG  1 
ATOM   8364  C  CD  . ARG D  1 148 ? 80.229  133.395 138.314 1.00 39.70  ? 169 ARG D CD  1 
ATOM   8365  N  NE  . ARG D  1 148 ? 81.427  134.046 137.830 1.00 39.52  ? 169 ARG D NE  1 
ATOM   8366  C  CZ  . ARG D  1 148 ? 81.441  135.127 137.064 1.00 41.82  ? 169 ARG D CZ  1 
ATOM   8367  N  NH1 . ARG D  1 148 ? 80.304  135.694 136.703 1.00 42.87  ? 169 ARG D NH1 1 
ATOM   8368  N  NH2 . ARG D  1 148 ? 82.597  135.671 136.670 1.00 42.78  ? 169 ARG D NH2 1 
ATOM   8369  N  N   . ALA D  1 149 ? 83.396  131.661 141.432 1.00 32.40  ? 170 ALA D N   1 
ATOM   8370  C  CA  . ALA D  1 149 ? 84.389  130.598 141.169 1.00 32.46  ? 170 ALA D CA  1 
ATOM   8371  C  C   . ALA D  1 149 ? 84.483  129.592 142.321 1.00 31.62  ? 170 ALA D C   1 
ATOM   8372  O  O   . ALA D  1 149 ? 84.495  128.406 142.058 1.00 31.47  ? 170 ALA D O   1 
ATOM   8373  C  CB  . ALA D  1 149 ? 85.737  131.183 140.884 1.00 32.05  ? 170 ALA D CB  1 
ATOM   8374  N  N   . VAL D  1 150 ? 84.608  130.048 143.558 1.00 30.59  ? 171 VAL D N   1 
ATOM   8375  C  CA  . VAL D  1 150 ? 84.716  129.101 144.703 1.00 30.78  ? 171 VAL D CA  1 
ATOM   8376  C  C   . VAL D  1 150 ? 83.475  128.185 144.730 1.00 31.83  ? 171 VAL D C   1 
ATOM   8377  O  O   . VAL D  1 150 ? 83.651  126.920 144.781 1.00 33.39  ? 171 VAL D O   1 
ATOM   8378  C  CB  . VAL D  1 150 ? 84.937  129.877 146.018 1.00 29.48  ? 171 VAL D CB  1 
ATOM   8379  C  CG1 . VAL D  1 150 ? 84.693  129.005 147.226 1.00 29.56  ? 171 VAL D CG1 1 
ATOM   8380  C  CG2 . VAL D  1 150 ? 86.326  130.479 146.075 1.00 28.62  ? 171 VAL D CG2 1 
ATOM   8381  N  N   . SER D  1 151 ? 82.263  128.759 144.690 1.00 32.17  ? 172 SER D N   1 
ATOM   8382  C  CA  . SER D  1 151 ? 80.956  128.035 144.710 1.00 33.75  ? 172 SER D CA  1 
ATOM   8383  C  C   . SER D  1 151 ? 80.834  127.071 143.511 1.00 35.82  ? 172 SER D C   1 
ATOM   8384  O  O   . SER D  1 151 ? 80.499  125.915 143.724 1.00 37.04  ? 172 SER D O   1 
ATOM   8385  C  CB  . SER D  1 151 ? 79.802  129.029 144.782 1.00 33.93  ? 172 SER D CB  1 
ATOM   8386  O  OG  . SER D  1 151 ? 78.515  128.406 144.786 1.00 35.59  ? 172 SER D OG  1 
ATOM   8387  N  N   . GLU D  1 152 ? 81.146  127.511 142.291 1.00 36.58  ? 173 GLU D N   1 
ATOM   8388  C  CA  . GLU D  1 152 ? 81.132  126.664 141.072 1.00 38.52  ? 173 GLU D CA  1 
ATOM   8389  C  C   . GLU D  1 152 ? 82.127  125.533 141.271 1.00 39.43  ? 173 GLU D C   1 
ATOM   8390  O  O   . GLU D  1 152 ? 81.774  124.421 141.012 1.00 40.67  ? 173 GLU D O   1 
ATOM   8391  C  CB  . GLU D  1 152 ? 81.521  127.436 139.810 1.00 38.86  ? 173 GLU D CB  1 
ATOM   8392  C  CG  . GLU D  1 152 ? 80.412  128.337 139.330 1.00 39.33  ? 173 GLU D CG  1 
ATOM   8393  C  CD  . GLU D  1 152 ? 80.725  129.156 138.093 1.00 40.23  ? 173 GLU D CD  1 
ATOM   8394  O  OE1 . GLU D  1 152 ? 81.909  129.287 137.736 1.00 39.68  ? 173 GLU D OE1 1 
ATOM   8395  O  OE2 . GLU D  1 152 ? 79.769  129.675 137.508 1.00 42.10  ? 173 GLU D OE2 1 
ATOM   8396  N  N   . LYS D  1 153 ? 83.340  125.834 141.716 1.00 39.17  ? 174 LYS D N   1 
ATOM   8397  C  CA  . LYS D  1 153 ? 84.378  124.799 141.883 1.00 40.58  ? 174 LYS D CA  1 
ATOM   8398  C  C   . LYS D  1 153 ? 83.913  123.781 142.934 1.00 40.18  ? 174 LYS D C   1 
ATOM   8399  O  O   . LYS D  1 153 ? 84.028  122.585 142.691 1.00 42.07  ? 174 LYS D O   1 
ATOM   8400  C  CB  . LYS D  1 153 ? 85.722  125.434 142.258 1.00 41.12  ? 174 LYS D CB  1 
ATOM   8401  C  CG  . LYS D  1 153 ? 86.882  124.454 142.167 1.00 44.06  ? 174 LYS D CG  1 
ATOM   8402  C  CD  . LYS D  1 153 ? 86.973  123.773 140.808 1.00 47.50  ? 174 LYS D CD  1 
ATOM   8403  C  CE  . LYS D  1 153 ? 88.071  122.744 140.741 1.00 50.72  ? 174 LYS D CE  1 
ATOM   8404  N  NZ  . LYS D  1 153 ? 88.439  122.499 139.320 1.00 53.65  ? 174 LYS D NZ  1 
ATOM   8405  N  N   . LEU D  1 154 ? 83.374  124.209 144.066 1.00 38.15  ? 175 LEU D N   1 
ATOM   8406  C  CA  . LEU D  1 154 ? 83.040  123.227 145.137 1.00 38.64  ? 175 LEU D CA  1 
ATOM   8407  C  C   . LEU D  1 154 ? 81.685  122.568 144.882 1.00 39.59  ? 175 LEU D C   1 
ATOM   8408  O  O   . LEU D  1 154 ? 81.364  121.643 145.669 1.00 40.69  ? 175 LEU D O   1 
ATOM   8409  C  CB  . LEU D  1 154 ? 83.094  123.895 146.513 1.00 36.94  ? 175 LEU D CB  1 
ATOM   8410  C  CG  . LEU D  1 154 ? 84.476  124.425 146.888 1.00 35.68  ? 175 LEU D CG  1 
ATOM   8411  C  CD1 . LEU D  1 154 ? 84.422  125.275 148.139 1.00 34.81  ? 175 LEU D CD1 1 
ATOM   8412  C  CD2 . LEU D  1 154 ? 85.468  123.300 147.079 1.00 36.71  ? 175 LEU D CD2 1 
ATOM   8413  N  N   . GLY D  1 155 ? 80.949  122.999 143.848 1.00 39.18  ? 176 GLY D N   1 
ATOM   8414  C  CA  . GLY D  1 155 ? 79.670  122.380 143.435 1.00 40.57  ? 176 GLY D CA  1 
ATOM   8415  C  C   . GLY D  1 155 ? 78.508  122.665 144.388 1.00 39.88  ? 176 GLY D C   1 
ATOM   8416  O  O   . GLY D  1 155 ? 77.603  121.795 144.538 1.00 42.14  ? 176 GLY D O   1 
ATOM   8417  N  N   . GLY D  1 156 ? 78.471  123.842 144.997 1.00 38.23  ? 177 GLY D N   1 
ATOM   8418  C  CA  . GLY D  1 156 ? 77.425  124.163 145.983 1.00 37.96  ? 177 GLY D CA  1 
ATOM   8419  C  C   . GLY D  1 156 ? 77.607  125.510 146.657 1.00 35.51  ? 177 GLY D C   1 
ATOM   8420  O  O   . GLY D  1 156 ? 78.631  126.156 146.514 1.00 34.61  ? 177 GLY D O   1 
ATOM   8421  N  N   . PRO D  1 157 ? 76.623  125.967 147.450 1.00 35.33  ? 178 PRO D N   1 
ATOM   8422  C  CA  . PRO D  1 157 ? 76.743  127.255 148.122 1.00 33.91  ? 178 PRO D CA  1 
ATOM   8423  C  C   . PRO D  1 157 ? 77.663  127.221 149.359 1.00 32.93  ? 178 PRO D C   1 
ATOM   8424  O  O   . PRO D  1 157 ? 77.973  126.165 149.877 1.00 33.64  ? 178 PRO D O   1 
ATOM   8425  C  CB  . PRO D  1 157 ? 75.285  127.531 148.491 1.00 34.33  ? 178 PRO D CB  1 
ATOM   8426  C  CG  . PRO D  1 157 ? 74.752  126.171 148.803 1.00 35.96  ? 178 PRO D CG  1 
ATOM   8427  C  CD  . PRO D  1 157 ? 75.341  125.294 147.719 1.00 37.00  ? 178 PRO D CD  1 
ATOM   8428  N  N   . VAL D  1 158 ? 78.110  128.394 149.771 1.00 31.83  ? 179 VAL D N   1 
ATOM   8429  C  CA  . VAL D  1 158 ? 78.973  128.609 150.960 1.00 30.95  ? 179 VAL D CA  1 
ATOM   8430  C  C   . VAL D  1 158 ? 78.204  129.545 151.892 1.00 31.18  ? 179 VAL D C   1 
ATOM   8431  O  O   . VAL D  1 158 ? 77.259  130.218 151.417 1.00 32.48  ? 179 VAL D O   1 
ATOM   8432  C  CB  . VAL D  1 158 ? 80.333  129.211 150.571 1.00 30.21  ? 179 VAL D CB  1 
ATOM   8433  C  CG1 . VAL D  1 158 ? 81.173  128.282 149.729 1.00 30.95  ? 179 VAL D CG1 1 
ATOM   8434  C  CG2 . VAL D  1 158 ? 80.201  130.542 149.876 1.00 29.38  ? 179 VAL D CG2 1 
ATOM   8435  N  N   . ASP D  1 159 ? 78.521  129.533 153.187 1.00 30.58  ? 180 ASP D N   1 
ATOM   8436  C  CA  . ASP D  1 159 ? 78.108  130.628 154.095 1.00 29.49  ? 180 ASP D CA  1 
ATOM   8437  C  C   . ASP D  1 159 ? 79.163  131.728 153.945 1.00 27.92  ? 180 ASP D C   1 
ATOM   8438  O  O   . ASP D  1 159 ? 80.371  131.411 153.733 1.00 26.65  ? 180 ASP D O   1 
ATOM   8439  C  CB  . ASP D  1 159 ? 77.969  130.152 155.539 1.00 30.07  ? 180 ASP D CB  1 
ATOM   8440  C  CG  . ASP D  1 159 ? 76.717  129.365 155.809 1.00 32.64  ? 180 ASP D CG  1 
ATOM   8441  O  OD1 . ASP D  1 159 ? 75.752  129.508 154.996 1.00 33.57  ? 180 ASP D OD1 1 
ATOM   8442  O  OD2 . ASP D  1 159 ? 76.682  128.668 156.881 1.00 33.91  ? 180 ASP D OD2 1 
ATOM   8443  N  N   . ILE D  1 160 ? 78.748  132.974 154.071 1.00 27.16  ? 181 ILE D N   1 
ATOM   8444  C  CA  . ILE D  1 160 ? 79.697  134.104 153.955 1.00 26.71  ? 181 ILE D CA  1 
ATOM   8445  C  C   . ILE D  1 160 ? 79.625  134.984 155.202 1.00 25.40  ? 181 ILE D C   1 
ATOM   8446  O  O   . ILE D  1 160 ? 78.532  135.428 155.600 1.00 25.90  ? 181 ILE D O   1 
ATOM   8447  C  CB  . ILE D  1 160 ? 79.445  134.927 152.684 1.00 27.52  ? 181 ILE D CB  1 
ATOM   8448  C  CG1 . ILE D  1 160 ? 79.558  134.090 151.421 1.00 29.10  ? 181 ILE D CG1 1 
ATOM   8449  C  CG2 . ILE D  1 160 ? 80.407  136.106 152.636 1.00 26.68  ? 181 ILE D CG2 1 
ATOM   8450  C  CD1 . ILE D  1 160 ? 79.222  134.878 150.155 1.00 30.10  ? 181 ILE D CD1 1 
ATOM   8451  N  N   . LEU D  1 161 ? 80.795  135.304 155.690 1.00 24.07  ? 182 LEU D N   1 
ATOM   8452  C  CA  . LEU D  1 161 ? 81.025  136.391 156.646 1.00 24.18  ? 182 LEU D CA  1 
ATOM   8453  C  C   . LEU D  1 161 ? 81.617  137.579 155.895 1.00 22.97  ? 182 LEU D C   1 
ATOM   8454  O  O   . LEU D  1 161 ? 82.709  137.467 155.307 1.00 23.00  ? 182 LEU D O   1 
ATOM   8455  C  CB  . LEU D  1 161 ? 81.946  135.897 157.764 1.00 24.50  ? 182 LEU D CB  1 
ATOM   8456  C  CG  . LEU D  1 161 ? 82.420  136.969 158.730 1.00 23.88  ? 182 LEU D CG  1 
ATOM   8457  C  CD1 . LEU D  1 161 ? 81.273  137.564 159.499 1.00 24.27  ? 182 LEU D CD1 1 
ATOM   8458  C  CD2 . LEU D  1 161 ? 83.463  136.412 159.663 1.00 24.20  ? 182 LEU D CD2 1 
ATOM   8459  N  N   . HIS D  1 162 ? 80.856  138.673 155.878 1.00 23.44  ? 183 HIS D N   1 
ATOM   8460  C  CA  . HIS D  1 162 ? 81.131  139.906 155.103 1.00 23.26  ? 183 HIS D CA  1 
ATOM   8461  C  C   . HIS D  1 162 ? 81.346  141.017 156.130 1.00 23.14  ? 183 HIS D C   1 
ATOM   8462  O  O   . HIS D  1 162 ? 80.371  141.403 156.837 1.00 22.62  ? 183 HIS D O   1 
ATOM   8463  C  CB  . HIS D  1 162 ? 80.018  140.137 154.103 1.00 23.95  ? 183 HIS D CB  1 
ATOM   8464  C  CG  . HIS D  1 162 ? 80.087  141.425 153.364 1.00 23.94  ? 183 HIS D CG  1 
ATOM   8465  N  ND1 . HIS D  1 162 ? 78.949  142.064 152.920 1.00 24.55  ? 183 HIS D ND1 1 
ATOM   8466  C  CD2 . HIS D  1 162 ? 81.129  142.194 153.028 1.00 23.21  ? 183 HIS D CD2 1 
ATOM   8467  C  CE1 . HIS D  1 162 ? 79.306  143.190 152.358 1.00 24.68  ? 183 HIS D CE1 1 
ATOM   8468  N  NE2 . HIS D  1 162 ? 80.656  143.278 152.381 1.00 23.63  ? 183 HIS D NE2 1 
ATOM   8469  N  N   . LEU D  1 163 ? 82.605  141.416 156.281 1.00 22.08  ? 184 LEU D N   1 
ATOM   8470  C  CA  . LEU D  1 163 ? 83.004  142.479 157.238 1.00 22.50  ? 184 LEU D CA  1 
ATOM   8471  C  C   . LEU D  1 163 ? 83.131  143.768 156.431 1.00 21.73  ? 184 LEU D C   1 
ATOM   8472  O  O   . LEU D  1 163 ? 83.983  143.861 155.523 1.00 20.55  ? 184 LEU D O   1 
ATOM   8473  C  CB  . LEU D  1 163 ? 84.308  142.115 157.953 1.00 22.92  ? 184 LEU D CB  1 
ATOM   8474  C  CG  . LEU D  1 163 ? 84.168  141.053 159.040 1.00 24.93  ? 184 LEU D CG  1 
ATOM   8475  C  CD1 . LEU D  1 163 ? 85.470  140.290 159.238 1.00 26.33  ? 184 LEU D CD1 1 
ATOM   8476  C  CD2 . LEU D  1 163 ? 83.830  141.717 160.337 1.00 26.51  ? 184 LEU D CD2 1 
ATOM   8477  N  N   . ASP D  1 164 ? 82.287  144.729 156.773 1.00 22.28  ? 185 ASP D N   1 
ATOM   8478  C  CA  . ASP D  1 164 ? 82.141  145.948 155.970 1.00 22.00  ? 185 ASP D CA  1 
ATOM   8479  C  C   . ASP D  1 164 ? 81.338  146.998 156.724 1.00 21.20  ? 185 ASP D C   1 
ATOM   8480  O  O   . ASP D  1 164 ? 80.386  146.612 157.348 1.00 20.99  ? 185 ASP D O   1 
ATOM   8481  C  CB  . ASP D  1 164 ? 81.423  145.520 154.704 1.00 22.30  ? 185 ASP D CB  1 
ATOM   8482  C  CG  . ASP D  1 164 ? 81.795  146.366 153.510 1.00 23.40  ? 185 ASP D CG  1 
ATOM   8483  O  OD1 . ASP D  1 164 ? 81.864  147.575 153.674 1.00 23.69  ? 185 ASP D OD1 1 
ATOM   8484  O  OD2 . ASP D  1 164 ? 81.898  145.790 152.411 1.00 25.15  ? 185 ASP D OD2 1 
ATOM   8485  N  N   . ALA D  1 165 ? 81.651  148.276 156.496 1.00 21.04  ? 186 ALA D N   1 
ATOM   8486  C  CA  . ALA D  1 165 ? 80.808  149.440 156.863 1.00 21.34  ? 186 ALA D CA  1 
ATOM   8487  C  C   . ALA D  1 165 ? 79.554  149.500 155.964 1.00 21.96  ? 186 ALA D C   1 
ATOM   8488  O  O   . ALA D  1 165 ? 78.564  150.067 156.429 1.00 21.60  ? 186 ALA D O   1 
ATOM   8489  C  CB  . ALA D  1 165 ? 81.579  150.709 156.777 1.00 21.18  ? 186 ALA D CB  1 
ATOM   8490  N  N   . HIS D  1 166 ? 79.612  148.923 154.757 1.00 22.25  ? 187 HIS D N   1 
ATOM   8491  C  CA  . HIS D  1 166 ? 78.549  149.016 153.709 1.00 23.77  ? 187 HIS D CA  1 
ATOM   8492  C  C   . HIS D  1 166 ? 78.036  147.624 153.330 1.00 23.95  ? 187 HIS D C   1 
ATOM   8493  O  O   . HIS D  1 166 ? 78.783  146.646 153.303 1.00 22.83  ? 187 HIS D O   1 
ATOM   8494  C  CB  . HIS D  1 166 ? 79.113  149.700 152.465 1.00 23.88  ? 187 HIS D CB  1 
ATOM   8495  C  CG  . HIS D  1 166 ? 79.985  150.871 152.796 1.00 24.37  ? 187 HIS D CG  1 
ATOM   8496  N  ND1 . HIS D  1 166 ? 81.353  150.728 153.113 1.00 22.74  ? 187 HIS D ND1 1 
ATOM   8497  C  CD2 . HIS D  1 166 ? 79.673  152.189 152.913 1.00 24.53  ? 187 HIS D CD2 1 
ATOM   8498  C  CE1 . HIS D  1 166 ? 81.817  151.948 153.335 1.00 23.90  ? 187 HIS D CE1 1 
ATOM   8499  N  NE2 . HIS D  1 166 ? 80.812  152.858 153.239 1.00 23.82  ? 187 HIS D NE2 1 
ATOM   8500  N  N   . PRO D  1 167 ? 76.739  147.466 153.033 1.00 24.89  ? 188 PRO D N   1 
ATOM   8501  C  CA  . PRO D  1 167 ? 76.239  146.159 152.616 1.00 26.05  ? 188 PRO D CA  1 
ATOM   8502  C  C   . PRO D  1 167 ? 76.584  145.785 151.157 1.00 27.46  ? 188 PRO D C   1 
ATOM   8503  O  O   . PRO D  1 167 ? 76.602  144.580 150.828 1.00 27.11  ? 188 PRO D O   1 
ATOM   8504  C  CB  . PRO D  1 167 ? 74.731  146.284 152.851 1.00 26.73  ? 188 PRO D CB  1 
ATOM   8505  C  CG  . PRO D  1 167 ? 74.443  147.729 152.763 1.00 26.94  ? 188 PRO D CG  1 
ATOM   8506  C  CD  . PRO D  1 167 ? 75.679  148.439 153.282 1.00 25.99  ? 188 PRO D CD  1 
ATOM   8507  N  N   . ASP D  1 168 ? 76.905  146.780 150.324 1.00 28.66  ? 189 ASP D N   1 
ATOM   8508  C  CA  . ASP D  1 168 ? 77.265  146.507 148.919 1.00 29.74  ? 189 ASP D CA  1 
ATOM   8509  C  C   . ASP D  1 168 ? 76.201  145.614 148.297 1.00 30.45  ? 189 ASP D C   1 
ATOM   8510  O  O   . ASP D  1 168 ? 76.551  144.637 147.632 1.00 31.58  ? 189 ASP D O   1 
ATOM   8511  C  CB  . ASP D  1 168 ? 78.636  145.843 148.877 1.00 29.70  ? 189 ASP D CB  1 
ATOM   8512  C  CG  . ASP D  1 168 ? 79.711  146.820 149.286 1.00 29.63  ? 189 ASP D CG  1 
ATOM   8513  O  OD1 . ASP D  1 168 ? 79.424  148.048 149.283 1.00 30.85  ? 189 ASP D OD1 1 
ATOM   8514  O  OD2 . ASP D  1 168 ? 80.816  146.357 149.559 1.00 30.17  ? 189 ASP D OD2 1 
ATOM   8515  N  N   . ILE D  1 169 ? 74.943  145.970 148.448 1.00 31.80  ? 190 ILE D N   1 
ATOM   8516  C  CA  . ILE D  1 169 ? 73.833  145.101 147.966 1.00 33.80  ? 190 ILE D CA  1 
ATOM   8517  C  C   . ILE D  1 169 ? 72.835  145.886 147.097 1.00 34.43  ? 190 ILE D C   1 
ATOM   8518  O  O   . ILE D  1 169 ? 71.732  145.361 146.817 1.00 35.49  ? 190 ILE D O   1 
ATOM   8519  C  CB  . ILE D  1 169 ? 73.249  144.434 149.217 1.00 34.56  ? 190 ILE D CB  1 
ATOM   8520  C  CG1 . ILE D  1 169 ? 72.607  143.112 148.863 1.00 36.77  ? 190 ILE D CG1 1 
ATOM   8521  C  CG2 . ILE D  1 169 ? 72.324  145.353 149.988 1.00 34.37  ? 190 ILE D CG2 1 
ATOM   8522  C  CD1 . ILE D  1 169 ? 72.338  142.300 150.069 1.00 39.07  ? 190 ILE D CD1 1 
ATOM   8523  N  N   . TYR D  1 170 ? 73.249  147.067 146.619 1.00 34.62  ? 191 TYR D N   1 
ATOM   8524  C  CA  . TYR D  1 170 ? 72.517  147.904 145.638 1.00 36.67  ? 191 TYR D CA  1 
ATOM   8525  C  C   . TYR D  1 170 ? 72.291  147.052 144.396 1.00 36.42  ? 191 TYR D C   1 
ATOM   8526  O  O   . TYR D  1 170 ? 73.215  146.310 143.991 1.00 35.05  ? 191 TYR D O   1 
ATOM   8527  C  CB  . TYR D  1 170 ? 73.290  149.159 145.238 1.00 37.89  ? 191 TYR D CB  1 
ATOM   8528  C  CG  . TYR D  1 170 ? 73.366  150.294 146.234 1.00 39.53  ? 191 TYR D CG  1 
ATOM   8529  C  CD1 . TYR D  1 170 ? 72.416  151.308 146.249 1.00 42.18  ? 191 TYR D CD1 1 
ATOM   8530  C  CD2 . TYR D  1 170 ? 74.455  150.444 147.101 1.00 39.48  ? 191 TYR D CD2 1 
ATOM   8531  C  CE1 . TYR D  1 170 ? 72.507  152.397 147.121 1.00 42.10  ? 191 TYR D CE1 1 
ATOM   8532  C  CE2 . TYR D  1 170 ? 74.559  151.520 147.984 1.00 38.84  ? 191 TYR D CE2 1 
ATOM   8533  C  CZ  . TYR D  1 170 ? 73.592  152.519 147.981 1.00 40.46  ? 191 TYR D CZ  1 
ATOM   8534  O  OH  . TYR D  1 170 ? 73.673  153.595 148.824 1.00 39.27  ? 191 TYR D OH  1 
ATOM   8535  N  N   . ASP D  1 171 ? 71.092  147.117 143.849 1.00 37.53  ? 192 ASP D N   1 
ATOM   8536  C  CA  . ASP D  1 171 ? 70.762  146.406 142.586 1.00 40.64  ? 192 ASP D CA  1 
ATOM   8537  C  C   . ASP D  1 171 ? 71.761  146.792 141.481 1.00 41.92  ? 192 ASP D C   1 
ATOM   8538  O  O   . ASP D  1 171 ? 72.340  145.885 140.808 1.00 40.99  ? 192 ASP D O   1 
ATOM   8539  C  CB  . ASP D  1 171 ? 69.363  146.749 142.089 1.00 42.43  ? 192 ASP D CB  1 
ATOM   8540  C  CG  . ASP D  1 171 ? 69.020  146.017 140.816 1.00 43.73  ? 192 ASP D CG  1 
ATOM   8541  O  OD1 . ASP D  1 171 ? 69.339  144.810 140.752 1.00 42.76  ? 192 ASP D OD1 1 
ATOM   8542  O  OD2 . ASP D  1 171 ? 68.547  146.693 139.882 1.00 44.75  ? 192 ASP D OD2 1 
ATOM   8543  N  N   . CYS D  1 172 ? 71.968  148.094 141.309 1.00 43.30  ? 193 CYS D N   1 
ATOM   8544  C  CA  . CYS D  1 172 ? 72.718  148.614 140.155 1.00 45.79  ? 193 CYS D CA  1 
ATOM   8545  C  C   . CYS D  1 172 ? 73.234  150.003 140.481 1.00 45.29  ? 193 CYS D C   1 
ATOM   8546  O  O   . CYS D  1 172 ? 72.643  150.970 139.972 1.00 45.35  ? 193 CYS D O   1 
ATOM   8547  C  CB  . CYS D  1 172 ? 71.812  148.673 138.937 1.00 49.33  ? 193 CYS D CB  1 
ATOM   8548  S  SG  . CYS D  1 172 ? 72.780  148.839 137.427 1.00 52.90  ? 193 CYS D SG  1 
ATOM   8549  N  N   . PHE D  1 173 ? 74.262  150.094 141.322 1.00 42.26  ? 194 PHE D N   1 
ATOM   8550  C  CA  . PHE D  1 173 ? 74.683  151.415 141.829 1.00 44.46  ? 194 PHE D CA  1 
ATOM   8551  C  C   . PHE D  1 173 ? 75.214  152.236 140.648 1.00 45.58  ? 194 PHE D C   1 
ATOM   8552  O  O   . PHE D  1 173 ? 76.052  151.713 139.909 1.00 44.68  ? 194 PHE D O   1 
ATOM   8553  C  CB  . PHE D  1 173 ? 75.704  151.265 142.952 1.00 43.73  ? 194 PHE D CB  1 
ATOM   8554  C  CG  . PHE D  1 173 ? 76.038  152.559 143.626 1.00 44.80  ? 194 PHE D CG  1 
ATOM   8555  C  CD1 . PHE D  1 173 ? 75.193  153.075 144.596 1.00 45.78  ? 194 PHE D CD1 1 
ATOM   8556  C  CD2 . PHE D  1 173 ? 77.164  153.276 143.250 1.00 46.09  ? 194 PHE D CD2 1 
ATOM   8557  C  CE1 . PHE D  1 173 ? 75.493  154.277 145.213 1.00 47.63  ? 194 PHE D CE1 1 
ATOM   8558  C  CE2 . PHE D  1 173 ? 77.476  154.470 143.883 1.00 47.22  ? 194 PHE D CE2 1 
ATOM   8559  C  CZ  . PHE D  1 173 ? 76.643  154.960 144.867 1.00 48.79  ? 194 PHE D CZ  1 
ATOM   8560  N  N   . GLU D  1 174 ? 74.658  153.428 140.419 1.00 47.63  ? 195 GLU D N   1 
ATOM   8561  C  CA  . GLU D  1 174 ? 75.061  154.347 139.312 1.00 50.76  ? 195 GLU D CA  1 
ATOM   8562  C  C   . GLU D  1 174 ? 75.148  153.619 137.959 1.00 49.24  ? 195 GLU D C   1 
ATOM   8563  O  O   . GLU D  1 174 ? 76.048  153.952 137.168 1.00 53.67  ? 195 GLU D O   1 
ATOM   8564  C  CB  . GLU D  1 174 ? 76.386  155.036 139.671 1.00 52.48  ? 195 GLU D CB  1 
ATOM   8565  C  CG  . GLU D  1 174 ? 76.322  155.825 140.984 1.00 55.75  ? 195 GLU D CG  1 
ATOM   8566  C  CD  . GLU D  1 174 ? 77.527  156.683 141.420 1.00 59.16  ? 195 GLU D CD  1 
ATOM   8567  O  OE1 . GLU D  1 174 ? 77.442  157.350 142.512 1.00 60.75  ? 195 GLU D OE1 1 
ATOM   8568  O  OE2 . GLU D  1 174 ? 78.564  156.689 140.711 1.00 59.60  ? 195 GLU D OE2 1 
ATOM   8569  N  N   . GLY D  1 175 ? 74.251  152.694 137.647 1.00 46.24  ? 196 GLY D N   1 
ATOM   8570  C  CA  . GLY D  1 175 ? 74.174  152.101 136.300 1.00 45.89  ? 196 GLY D CA  1 
ATOM   8571  C  C   . GLY D  1 175 ? 75.110  150.920 136.083 1.00 42.89  ? 196 GLY D C   1 
ATOM   8572  O  O   . GLY D  1 175 ? 74.996  150.264 135.045 1.00 43.07  ? 196 GLY D O   1 
ATOM   8573  N  N   . ASN D  1 176 ? 75.999  150.623 137.022 1.00 39.74  ? 197 ASN D N   1 
ATOM   8574  C  CA  . ASN D  1 176 ? 77.081  149.619 136.838 1.00 38.24  ? 197 ASN D CA  1 
ATOM   8575  C  C   . ASN D  1 176 ? 76.735  148.351 137.629 1.00 36.63  ? 197 ASN D C   1 
ATOM   8576  O  O   . ASN D  1 176 ? 76.796  148.379 138.852 1.00 34.52  ? 197 ASN D O   1 
ATOM   8577  C  CB  . ASN D  1 176 ? 78.417  150.211 137.297 1.00 37.64  ? 197 ASN D CB  1 
ATOM   8578  C  CG  . ASN D  1 176 ? 79.598  149.268 137.179 1.00 36.65  ? 197 ASN D CG  1 
ATOM   8579  O  OD1 . ASN D  1 176 ? 79.495  148.207 136.553 1.00 36.41  ? 197 ASN D OD1 1 
ATOM   8580  N  ND2 . ASN D  1 176 ? 80.736  149.699 137.718 1.00 35.32  ? 197 ASN D ND2 1 
ATOM   8581  N  N   . LYS D  1 177 ? 76.406  147.250 136.981 1.00 37.27  ? 198 LYS D N   1 
ATOM   8582  C  CA  . LYS D  1 177 ? 76.082  146.013 137.732 1.00 37.14  ? 198 LYS D CA  1 
ATOM   8583  C  C   . LYS D  1 177 ? 77.333  145.405 138.403 1.00 34.46  ? 198 LYS D C   1 
ATOM   8584  O  O   . LYS D  1 177 ? 77.187  144.578 139.299 1.00 32.16  ? 198 LYS D O   1 
ATOM   8585  C  CB  . LYS D  1 177 ? 75.394  145.048 136.775 1.00 40.62  ? 198 LYS D CB  1 
ATOM   8586  C  CG  . LYS D  1 177 ? 76.308  144.291 135.828 1.00 43.27  ? 198 LYS D CG  1 
ATOM   8587  C  CD  . LYS D  1 177 ? 75.513  143.171 135.192 1.00 46.90  ? 198 LYS D CD  1 
ATOM   8588  C  CE  . LYS D  1 177 ? 76.335  142.235 134.345 1.00 48.85  ? 198 LYS D CE  1 
ATOM   8589  N  NZ  . LYS D  1 177 ? 76.868  142.977 133.187 1.00 51.73  ? 198 LYS D NZ  1 
ATOM   8590  N  N   . TYR D  1 178 ? 78.534  145.770 137.958 1.00 34.61  ? 199 TYR D N   1 
ATOM   8591  C  CA  . TYR D  1 178 ? 79.821  145.367 138.582 1.00 33.57  ? 199 TYR D CA  1 
ATOM   8592  C  C   . TYR D  1 178 ? 80.312  146.436 139.575 1.00 32.29  ? 199 TYR D C   1 
ATOM   8593  O  O   . TYR D  1 178 ? 81.489  146.400 139.945 1.00 31.01  ? 199 TYR D O   1 
ATOM   8594  C  CB  . TYR D  1 178 ? 80.860  145.058 137.502 1.00 34.74  ? 199 TYR D CB  1 
ATOM   8595  C  CG  . TYR D  1 178 ? 80.555  143.821 136.697 1.00 36.10  ? 199 TYR D CG  1 
ATOM   8596  C  CD1 . TYR D  1 178 ? 80.441  142.568 137.288 1.00 35.67  ? 199 TYR D CD1 1 
ATOM   8597  C  CD2 . TYR D  1 178 ? 80.353  143.902 135.337 1.00 38.50  ? 199 TYR D CD2 1 
ATOM   8598  C  CE1 . TYR D  1 178 ? 80.149  141.433 136.549 1.00 36.79  ? 199 TYR D CE1 1 
ATOM   8599  C  CE2 . TYR D  1 178 ? 80.037  142.781 134.580 1.00 40.32  ? 199 TYR D CE2 1 
ATOM   8600  C  CZ  . TYR D  1 178 ? 79.961  141.534 135.178 1.00 39.51  ? 199 TYR D CZ  1 
ATOM   8601  O  OH  . TYR D  1 178 ? 79.711  140.438 134.376 1.00 40.82  ? 199 TYR D OH  1 
ATOM   8602  N  N   . SER D  1 179 ? 79.454  147.359 140.001 1.00 31.96  ? 200 SER D N   1 
ATOM   8603  C  CA  . SER D  1 179 ? 79.798  148.356 141.049 1.00 32.04  ? 200 SER D CA  1 
ATOM   8604  C  C   . SER D  1 179 ? 80.315  147.621 142.285 1.00 31.09  ? 200 SER D C   1 
ATOM   8605  O  O   . SER D  1 179 ? 79.725  146.535 142.622 1.00 30.98  ? 200 SER D O   1 
ATOM   8606  C  CB  . SER D  1 179 ? 78.591  149.169 141.427 1.00 32.48  ? 200 SER D CB  1 
ATOM   8607  O  OG  . SER D  1 179 ? 78.881  150.074 142.457 1.00 32.41  ? 200 SER D OG  1 
ATOM   8608  N  N   . HIS D  1 180 ? 81.312  148.182 142.977 1.00 31.36  ? 201 HIS D N   1 
ATOM   8609  C  CA  . HIS D  1 180 ? 81.753  147.661 144.306 1.00 30.40  ? 201 HIS D CA  1 
ATOM   8610  C  C   . HIS D  1 180 ? 80.607  147.735 145.322 1.00 29.80  ? 201 HIS D C   1 
ATOM   8611  O  O   . HIS D  1 180 ? 80.648  146.943 146.310 1.00 31.94  ? 201 HIS D O   1 
ATOM   8612  C  CB  . HIS D  1 180 ? 83.041  148.349 144.785 1.00 31.22  ? 201 HIS D CB  1 
ATOM   8613  C  CG  . HIS D  1 180 ? 82.932  149.783 145.178 1.00 31.90  ? 201 HIS D CG  1 
ATOM   8614  N  ND1 . HIS D  1 180 ? 83.835  150.361 146.058 1.00 32.17  ? 201 HIS D ND1 1 
ATOM   8615  C  CD2 . HIS D  1 180 ? 82.042  150.741 144.844 1.00 32.48  ? 201 HIS D CD2 1 
ATOM   8616  C  CE1 . HIS D  1 180 ? 83.485  151.608 146.275 1.00 33.48  ? 201 HIS D CE1 1 
ATOM   8617  N  NE2 . HIS D  1 180 ? 82.375  151.868 145.558 1.00 33.65  ? 201 HIS D NE2 1 
ATOM   8618  N  N   . ALA D  1 181 ? 79.611  148.594 145.129 1.00 29.73  ? 202 ALA D N   1 
ATOM   8619  C  CA  . ALA D  1 181 ? 78.397  148.681 145.990 1.00 30.11  ? 202 ALA D CA  1 
ATOM   8620  C  C   . ALA D  1 181 ? 77.286  147.696 145.561 1.00 29.34  ? 202 ALA D C   1 
ATOM   8621  O  O   . ALA D  1 181 ? 76.182  147.758 146.195 1.00 29.14  ? 202 ALA D O   1 
ATOM   8622  C  CB  . ALA D  1 181 ? 77.871  150.102 146.046 1.00 31.65  ? 202 ALA D CB  1 
ATOM   8623  N  N   . SER D  1 182 ? 77.547  146.755 144.649 1.00 28.32  ? 203 SER D N   1 
ATOM   8624  C  CA  . SER D  1 182 ? 76.512  145.782 144.200 1.00 29.22  ? 203 SER D CA  1 
ATOM   8625  C  C   . SER D  1 182 ? 77.016  144.332 144.229 1.00 28.87  ? 203 SER D C   1 
ATOM   8626  O  O   . SER D  1 182 ? 76.298  143.410 143.764 1.00 28.45  ? 203 SER D O   1 
ATOM   8627  C  CB  . SER D  1 182 ? 75.982  146.143 142.786 1.00 29.91  ? 203 SER D CB  1 
ATOM   8628  O  OG  . SER D  1 182 ? 75.383  147.446 142.751 1.00 30.62  ? 203 SER D OG  1 
ATOM   8629  N  N   . SER D  1 183 ? 78.228  144.082 144.682 1.00 29.28  ? 204 SER D N   1 
ATOM   8630  C  CA  . SER D  1 183 ? 78.802  142.749 144.392 1.00 29.96  ? 204 SER D CA  1 
ATOM   8631  C  C   . SER D  1 183 ? 78.061  141.693 145.210 1.00 29.98  ? 204 SER D C   1 
ATOM   8632  O  O   . SER D  1 183 ? 77.990  140.564 144.753 1.00 32.17  ? 204 SER D O   1 
ATOM   8633  C  CB  . SER D  1 183 ? 80.300  142.707 144.582 1.00 30.39  ? 204 SER D CB  1 
ATOM   8634  O  OG  . SER D  1 183 ? 80.620  143.196 145.831 1.00 30.67  ? 204 SER D OG  1 
ATOM   8635  N  N   . PHE D  1 184 ? 77.475  142.046 146.339 1.00 29.45  ? 205 PHE D N   1 
ATOM   8636  C  CA  . PHE D  1 184 ? 76.706  141.082 147.171 1.00 29.41  ? 205 PHE D CA  1 
ATOM   8637  C  C   . PHE D  1 184 ? 75.284  140.925 146.615 1.00 29.22  ? 205 PHE D C   1 
ATOM   8638  O  O   . PHE D  1 184 ? 74.635  139.906 146.878 1.00 30.05  ? 205 PHE D O   1 
ATOM   8639  C  CB  . PHE D  1 184 ? 76.804  141.454 148.652 1.00 29.29  ? 205 PHE D CB  1 
ATOM   8640  C  CG  . PHE D  1 184 ? 78.182  141.131 149.157 1.00 29.59  ? 205 PHE D CG  1 
ATOM   8641  C  CD1 . PHE D  1 184 ? 78.518  139.845 149.530 1.00 30.60  ? 205 PHE D CD1 1 
ATOM   8642  C  CD2 . PHE D  1 184 ? 79.164  142.083 149.156 1.00 30.23  ? 205 PHE D CD2 1 
ATOM   8643  C  CE1 . PHE D  1 184 ? 79.810  139.536 149.951 1.00 31.74  ? 205 PHE D CE1 1 
ATOM   8644  C  CE2 . PHE D  1 184 ? 80.472  141.766 149.497 1.00 30.99  ? 205 PHE D CE2 1 
ATOM   8645  C  CZ  . PHE D  1 184 ? 80.790  140.500 149.934 1.00 31.42  ? 205 PHE D CZ  1 
ATOM   8646  N  N   . ALA D  1 185 ? 74.800  141.859 145.820 1.00 29.29  ? 206 ALA D N   1 
ATOM   8647  C  CA  . ALA D  1 185 ? 73.519  141.653 145.111 1.00 30.39  ? 206 ALA D CA  1 
ATOM   8648  C  C   . ALA D  1 185 ? 73.779  140.586 144.028 1.00 30.99  ? 206 ALA D C   1 
ATOM   8649  O  O   . ALA D  1 185 ? 73.028  139.575 143.942 1.00 31.25  ? 206 ALA D O   1 
ATOM   8650  C  CB  . ALA D  1 185 ? 73.030  142.964 144.569 1.00 31.76  ? 206 ALA D CB  1 
ATOM   8651  N  N   . ARG D  1 186 ? 74.892  140.730 143.306 1.00 29.97  ? 207 ARG D N   1 
ATOM   8652  C  CA  . ARG D  1 186 ? 75.304  139.736 142.289 1.00 30.51  ? 207 ARG D CA  1 
ATOM   8653  C  C   . ARG D  1 186 ? 75.502  138.385 142.969 1.00 30.13  ? 207 ARG D C   1 
ATOM   8654  O  O   . ARG D  1 186 ? 75.025  137.400 142.429 1.00 31.64  ? 207 ARG D O   1 
ATOM   8655  C  CB  . ARG D  1 186 ? 76.563  140.159 141.518 1.00 30.68  ? 207 ARG D CB  1 
ATOM   8656  C  CG  . ARG D  1 186 ? 76.483  141.531 140.842 1.00 30.86  ? 207 ARG D CG  1 
ATOM   8657  C  CD  . ARG D  1 186 ? 75.577  141.587 139.655 1.00 32.12  ? 207 ARG D CD  1 
ATOM   8658  N  NE  . ARG D  1 186 ? 74.192  141.808 140.036 1.00 32.70  ? 207 ARG D NE  1 
ATOM   8659  C  CZ  . ARG D  1 186 ? 73.645  142.994 140.232 1.00 32.89  ? 207 ARG D CZ  1 
ATOM   8660  N  NH1 . ARG D  1 186 ? 74.351  144.102 140.091 1.00 32.56  ? 207 ARG D NH1 1 
ATOM   8661  N  NH2 . ARG D  1 186 ? 72.363  143.073 140.523 1.00 33.94  ? 207 ARG D NH2 1 
ATOM   8662  N  N   . ILE D  1 187 ? 76.224  138.314 144.084 1.00 29.53  ? 208 ILE D N   1 
ATOM   8663  C  CA  . ILE D  1 187 ? 76.450  137.021 144.774 1.00 29.27  ? 208 ILE D CA  1 
ATOM   8664  C  C   . ILE D  1 187 ? 75.090  136.417 145.169 1.00 29.63  ? 208 ILE D C   1 
ATOM   8665  O  O   . ILE D  1 187 ? 74.867  135.240 144.906 1.00 29.98  ? 208 ILE D O   1 
ATOM   8666  C  CB  . ILE D  1 187 ? 77.423  137.169 145.954 1.00 29.05  ? 208 ILE D CB  1 
ATOM   8667  C  CG1 . ILE D  1 187 ? 78.855  137.438 145.471 1.00 29.11  ? 208 ILE D CG1 1 
ATOM   8668  C  CG2 . ILE D  1 187 ? 77.363  135.924 146.821 1.00 29.32  ? 208 ILE D CG2 1 
ATOM   8669  C  CD1 . ILE D  1 187 ? 79.806  137.787 146.547 1.00 28.85  ? 208 ILE D CD1 1 
ATOM   8670  N  N   . MET D  1 188 ? 74.181  137.181 145.770 1.00 30.16  ? 209 MET D N   1 
ATOM   8671  C  CA  . MET D  1 188 ? 72.964  136.557 146.337 1.00 30.50  ? 209 MET D CA  1 
ATOM   8672  C  C   . MET D  1 188 ? 72.052  136.157 145.181 1.00 31.75  ? 209 MET D C   1 
ATOM   8673  O  O   . MET D  1 188 ? 71.425  135.100 145.289 1.00 32.62  ? 209 MET D O   1 
ATOM   8674  C  CB  . MET D  1 188 ? 72.255  137.463 147.345 1.00 30.31  ? 209 MET D CB  1 
ATOM   8675  C  CG  . MET D  1 188 ? 73.091  137.724 148.584 1.00 29.67  ? 209 MET D CG  1 
ATOM   8676  S  SD  . MET D  1 188 ? 73.752  136.215 149.364 1.00 30.80  ? 209 MET D SD  1 
ATOM   8677  C  CE  . MET D  1 188 ? 72.294  135.718 150.273 1.00 32.13  ? 209 MET D CE  1 
ATOM   8678  N  N   . GLU D  1 189 ? 72.090  136.874 144.053 1.00 32.97  ? 210 GLU D N   1 
ATOM   8679  C  CA  . GLU D  1 189 ? 71.244  136.514 142.885 1.00 35.21  ? 210 GLU D CA  1 
ATOM   8680  C  C   . GLU D  1 189 ? 71.718  135.177 142.294 1.00 35.47  ? 210 GLU D C   1 
ATOM   8681  O  O   . GLU D  1 189 ? 70.956  134.546 141.605 1.00 36.85  ? 210 GLU D O   1 
ATOM   8682  C  CB  . GLU D  1 189 ? 71.323  137.573 141.792 1.00 36.50  ? 210 GLU D CB  1 
ATOM   8683  C  CG  . GLU D  1 189 ? 70.505  138.796 142.072 1.00 37.27  ? 210 GLU D CG  1 
ATOM   8684  C  CD  . GLU D  1 189 ? 70.918  140.006 141.229 1.00 38.45  ? 210 GLU D CD  1 
ATOM   8685  O  OE1 . GLU D  1 189 ? 71.754  139.806 140.272 1.00 39.55  ? 210 GLU D OE1 1 
ATOM   8686  O  OE2 . GLU D  1 189 ? 70.456  141.161 141.567 1.00 37.36  ? 210 GLU D OE2 1 
ATOM   8687  N  N   . GLY D  1 190 ? 72.983  134.810 142.431 1.00 35.32  ? 211 GLY D N   1 
ATOM   8688  C  CA  . GLY D  1 190 ? 73.481  133.607 141.734 1.00 36.80  ? 211 GLY D CA  1 
ATOM   8689  C  C   . GLY D  1 190 ? 73.270  132.356 142.555 1.00 37.02  ? 211 GLY D C   1 
ATOM   8690  O  O   . GLY D  1 190 ? 73.611  131.299 142.082 1.00 38.27  ? 211 GLY D O   1 
ATOM   8691  N  N   . GLY D  1 191 ? 72.731  132.470 143.765 1.00 36.67  ? 212 GLY D N   1 
ATOM   8692  C  CA  . GLY D  1 191 ? 72.584  131.298 144.651 1.00 37.69  ? 212 GLY D CA  1 
ATOM   8693  C  C   . GLY D  1 191 ? 73.937  130.778 145.159 1.00 37.57  ? 212 GLY D C   1 
ATOM   8694  O  O   . GLY D  1 191 ? 73.971  129.606 145.572 1.00 39.84  ? 212 GLY D O   1 
ATOM   8695  N  N   . TYR D  1 192 ? 75.017  131.578 145.137 1.00 35.47  ? 213 TYR D N   1 
ATOM   8696  C  CA  . TYR D  1 192 ? 76.394  131.121 145.488 1.00 34.96  ? 213 TYR D CA  1 
ATOM   8697  C  C   . TYR D  1 192 ? 76.520  130.979 147.008 1.00 34.85  ? 213 TYR D C   1 
ATOM   8698  O  O   . TYR D  1 192 ? 77.426  130.271 147.481 1.00 36.40  ? 213 TYR D O   1 
ATOM   8699  C  CB  . TYR D  1 192 ? 77.447  132.065 144.901 1.00 34.39  ? 213 TYR D CB  1 
ATOM   8700  C  CG  . TYR D  1 192 ? 77.386  132.160 143.396 1.00 34.92  ? 213 TYR D CG  1 
ATOM   8701  C  CD1 . TYR D  1 192 ? 77.492  131.025 142.613 1.00 36.49  ? 213 TYR D CD1 1 
ATOM   8702  C  CD2 . TYR D  1 192 ? 77.147  133.365 142.740 1.00 34.37  ? 213 TYR D CD2 1 
ATOM   8703  C  CE1 . TYR D  1 192 ? 77.391  131.080 141.230 1.00 37.29  ? 213 TYR D CE1 1 
ATOM   8704  C  CE2 . TYR D  1 192 ? 77.036  133.427 141.352 1.00 34.59  ? 213 TYR D CE2 1 
ATOM   8705  C  CZ  . TYR D  1 192 ? 77.151  132.284 140.591 1.00 36.38  ? 213 TYR D CZ  1 
ATOM   8706  O  OH  . TYR D  1 192 ? 77.073  132.301 139.214 1.00 38.06  ? 213 TYR D OH  1 
ATOM   8707  N  N   . ALA D  1 193 ? 75.606  131.600 147.765 1.00 34.67  ? 214 ALA D N   1 
ATOM   8708  C  CA  . ALA D  1 193 ? 75.652  131.696 149.229 1.00 33.83  ? 214 ALA D CA  1 
ATOM   8709  C  C   . ALA D  1 193 ? 74.348  131.227 149.845 1.00 34.24  ? 214 ALA D C   1 
ATOM   8710  O  O   . ALA D  1 193 ? 73.294  131.561 149.322 1.00 36.39  ? 214 ALA D O   1 
ATOM   8711  C  CB  . ALA D  1 193 ? 75.929  133.111 149.618 1.00 33.87  ? 214 ALA D CB  1 
ATOM   8712  N  N   . ARG D  1 194 ? 74.429  130.507 150.956 1.00 33.46  ? 215 ARG D N   1 
ATOM   8713  C  CA  . ARG D  1 194 ? 73.263  130.258 151.820 1.00 32.67  ? 215 ARG D CA  1 
ATOM   8714  C  C   . ARG D  1 194 ? 73.164  131.423 152.801 1.00 32.40  ? 215 ARG D C   1 
ATOM   8715  O  O   . ARG D  1 194 ? 72.331  132.280 152.585 1.00 34.01  ? 215 ARG D O   1 
ATOM   8716  C  CB  . ARG D  1 194 ? 73.371  128.921 152.546 1.00 33.08  ? 215 ARG D CB  1 
ATOM   8717  C  CG  . ARG D  1 194 ? 72.207  128.656 153.489 1.00 32.97  ? 215 ARG D CG  1 
ATOM   8718  C  CD  . ARG D  1 194 ? 72.376  127.391 154.323 1.00 33.60  ? 215 ARG D CD  1 
ATOM   8719  N  NE  . ARG D  1 194 ? 73.529  127.389 155.225 1.00 32.98  ? 215 ARG D NE  1 
ATOM   8720  C  CZ  . ARG D  1 194 ? 73.835  126.382 155.992 1.00 33.99  ? 215 ARG D CZ  1 
ATOM   8721  N  NH1 . ARG D  1 194 ? 73.113  125.289 155.936 1.00 35.27  ? 215 ARG D NH1 1 
ATOM   8722  N  NH2 . ARG D  1 194 ? 74.896  126.412 156.778 1.00 35.18  ? 215 ARG D NH2 1 
ATOM   8723  N  N   . ARG D  1 195 ? 73.978  131.485 153.846 1.00 32.28  ? 216 ARG D N   1 
ATOM   8724  C  CA  . ARG D  1 195 ? 73.941  132.654 154.765 1.00 31.41  ? 216 ARG D CA  1 
ATOM   8725  C  C   . ARG D  1 195 ? 74.949  133.702 154.290 1.00 30.42  ? 216 ARG D C   1 
ATOM   8726  O  O   . ARG D  1 195 ? 76.018  133.382 153.712 1.00 29.22  ? 216 ARG D O   1 
ATOM   8727  C  CB  . ARG D  1 195 ? 74.222  132.231 156.206 1.00 32.90  ? 216 ARG D CB  1 
ATOM   8728  C  CG  . ARG D  1 195 ? 73.181  131.265 156.733 1.00 34.02  ? 216 ARG D CG  1 
ATOM   8729  C  CD  . ARG D  1 195 ? 73.521  130.795 158.134 1.00 35.75  ? 216 ARG D CD  1 
ATOM   8730  N  NE  . ARG D  1 195 ? 73.485  131.844 159.152 1.00 36.00  ? 216 ARG D NE  1 
ATOM   8731  C  CZ  . ARG D  1 195 ? 73.858  131.665 160.413 1.00 37.16  ? 216 ARG D CZ  1 
ATOM   8732  N  NH1 . ARG D  1 195 ? 73.778  132.670 161.257 1.00 37.85  ? 216 ARG D NH1 1 
ATOM   8733  N  NH2 . ARG D  1 195 ? 74.301  130.489 160.831 1.00 37.83  ? 216 ARG D NH2 1 
ATOM   8734  N  N   . LEU D  1 196 ? 74.570  134.941 154.517 1.00 29.52  ? 217 LEU D N   1 
ATOM   8735  C  CA  . LEU D  1 196 ? 75.434  136.132 154.342 1.00 28.95  ? 217 LEU D CA  1 
ATOM   8736  C  C   . LEU D  1 196 ? 75.246  136.948 155.610 1.00 28.68  ? 217 LEU D C   1 
ATOM   8737  O  O   . LEU D  1 196 ? 74.101  137.381 155.879 1.00 27.84  ? 217 LEU D O   1 
ATOM   8738  C  CB  . LEU D  1 196 ? 75.054  136.903 153.080 1.00 28.39  ? 217 LEU D CB  1 
ATOM   8739  C  CG  . LEU D  1 196 ? 75.729  138.257 152.939 1.00 27.47  ? 217 LEU D CG  1 
ATOM   8740  C  CD1 . LEU D  1 196 ? 77.243  138.154 152.897 1.00 27.23  ? 217 LEU D CD1 1 
ATOM   8741  C  CD2 . LEU D  1 196 ? 75.217  138.952 151.700 1.00 28.48  ? 217 LEU D CD2 1 
ATOM   8742  N  N   . LEU D  1 197 ? 76.309  136.992 156.419 1.00 28.43  ? 218 LEU D N   1 
ATOM   8743  C  CA  . LEU D  1 197 ? 76.319  137.725 157.705 1.00 28.35  ? 218 LEU D CA  1 
ATOM   8744  C  C   . LEU D  1 197 ? 77.165  138.951 157.418 1.00 27.21  ? 218 LEU D C   1 
ATOM   8745  O  O   . LEU D  1 197 ? 78.296  138.759 157.087 1.00 27.86  ? 218 LEU D O   1 
ATOM   8746  C  CB  . LEU D  1 197 ? 76.967  136.921 158.837 1.00 29.10  ? 218 LEU D CB  1 
ATOM   8747  C  CG  . LEU D  1 197 ? 76.084  135.979 159.596 1.00 30.78  ? 218 LEU D CG  1 
ATOM   8748  C  CD1 . LEU D  1 197 ? 75.697  134.818 158.694 1.00 32.80  ? 218 LEU D CD1 1 
ATOM   8749  C  CD2 . LEU D  1 197 ? 76.781  135.456 160.836 1.00 31.37  ? 218 LEU D CD2 1 
ATOM   8750  N  N   . GLN D  1 198 ? 76.581  140.132 157.424 1.00 27.32  ? 219 GLN D N   1 
ATOM   8751  C  CA  . GLN D  1 198 ? 77.271  141.418 157.210 1.00 26.22  ? 219 GLN D CA  1 
ATOM   8752  C  C   . GLN D  1 198 ? 77.497  142.029 158.580 1.00 27.76  ? 219 GLN D C   1 
ATOM   8753  O  O   . GLN D  1 198 ? 76.543  142.103 159.435 1.00 30.29  ? 219 GLN D O   1 
ATOM   8754  C  CB  . GLN D  1 198 ? 76.455  142.287 156.297 1.00 25.91  ? 219 GLN D CB  1 
ATOM   8755  C  CG  . GLN D  1 198 ? 76.107  141.552 155.012 1.00 25.87  ? 219 GLN D CG  1 
ATOM   8756  C  CD  . GLN D  1 198 ? 75.594  142.541 154.000 1.00 25.40  ? 219 GLN D CD  1 
ATOM   8757  O  OE1 . GLN D  1 198 ? 74.610  143.224 154.300 1.00 25.50  ? 219 GLN D OE1 1 
ATOM   8758  N  NE2 . GLN D  1 198 ? 76.240  142.601 152.833 1.00 23.78  ? 219 GLN D NE2 1 
ATOM   8759  N  N   . VAL D  1 199 ? 78.768  142.253 158.880 1.00 27.72  ? 220 VAL D N   1 
ATOM   8760  C  CA  . VAL D  1 199 ? 79.172  142.655 160.239 1.00 27.29  ? 220 VAL D CA  1 
ATOM   8761  C  C   . VAL D  1 199 ? 79.934  143.977 160.130 1.00 25.84  ? 220 VAL D C   1 
ATOM   8762  O  O   . VAL D  1 199 ? 80.820  144.079 159.307 1.00 25.26  ? 220 VAL D O   1 
ATOM   8763  C  CB  . VAL D  1 199 ? 79.961  141.529 160.937 1.00 27.80  ? 220 VAL D CB  1 
ATOM   8764  C  CG1 . VAL D  1 199 ? 80.497  142.034 162.273 1.00 27.56  ? 220 VAL D CG1 1 
ATOM   8765  C  CG2 . VAL D  1 199 ? 79.110  140.288 161.107 1.00 27.91  ? 220 VAL D CG2 1 
ATOM   8766  N  N   . GLY D  1 200 ? 79.551  144.933 160.982 1.00 26.16  ? 221 GLY D N   1 
ATOM   8767  C  CA  . GLY D  1 200 ? 80.166  146.263 161.144 1.00 25.16  ? 221 GLY D CA  1 
ATOM   8768  C  C   . GLY D  1 200 ? 79.489  147.304 160.294 1.00 24.57  ? 221 GLY D C   1 
ATOM   8769  O  O   . GLY D  1 200 ? 80.067  148.362 160.092 1.00 24.06  ? 221 GLY D O   1 
ATOM   8770  N  N   . ILE D  1 201 ? 78.286  147.004 159.833 1.00 24.48  ? 222 ILE D N   1 
ATOM   8771  C  CA  . ILE D  1 201 ? 77.486  147.893 158.961 1.00 24.33  ? 222 ILE D CA  1 
ATOM   8772  C  C   . ILE D  1 201 ? 77.153  149.179 159.708 1.00 24.27  ? 222 ILE D C   1 
ATOM   8773  O  O   . ILE D  1 201 ? 76.589  149.101 160.752 1.00 24.34  ? 222 ILE D O   1 
ATOM   8774  C  CB  . ILE D  1 201 ? 76.190  147.183 158.516 1.00 25.09  ? 222 ILE D CB  1 
ATOM   8775  C  CG1 . ILE D  1 201 ? 76.465  145.933 157.679 1.00 24.63  ? 222 ILE D CG1 1 
ATOM   8776  C  CG2 . ILE D  1 201 ? 75.269  148.163 157.802 1.00 25.90  ? 222 ILE D CG2 1 
ATOM   8777  C  CD1 . ILE D  1 201 ? 77.086  146.198 156.319 1.00 24.96  ? 222 ILE D CD1 1 
ATOM   8778  N  N   . ARG D  1 202 ? 77.422  150.329 159.110 1.00 24.59  ? 223 ARG D N   1 
ATOM   8779  C  CA  . ARG D  1 202 ? 76.995  151.608 159.699 1.00 25.59  ? 223 ARG D CA  1 
ATOM   8780  C  C   . ARG D  1 202 ? 76.671  152.645 158.625 1.00 26.09  ? 223 ARG D C   1 
ATOM   8781  O  O   . ARG D  1 202 ? 76.378  153.756 159.015 1.00 27.90  ? 223 ARG D O   1 
ATOM   8782  C  CB  . ARG D  1 202 ? 78.081  152.080 160.674 1.00 25.19  ? 223 ARG D CB  1 
ATOM   8783  C  CG  . ARG D  1 202 ? 79.466  152.229 160.053 1.00 24.25  ? 223 ARG D CG  1 
ATOM   8784  C  CD  . ARG D  1 202 ? 80.562  152.205 161.072 1.00 23.37  ? 223 ARG D CD  1 
ATOM   8785  N  NE  . ARG D  1 202 ? 81.875  152.491 160.522 1.00 23.29  ? 223 ARG D NE  1 
ATOM   8786  C  CZ  . ARG D  1 202 ? 82.758  151.570 160.107 1.00 22.81  ? 223 ARG D CZ  1 
ATOM   8787  N  NH1 . ARG D  1 202 ? 82.453  150.276 160.102 1.00 22.21  ? 223 ARG D NH1 1 
ATOM   8788  N  NH2 . ARG D  1 202 ? 83.931  151.966 159.664 1.00 22.44  ? 223 ARG D NH2 1 
ATOM   8789  N  N   . SER D  1 203 ? 76.698  152.290 157.346 1.00 25.93  ? 224 SER D N   1 
ATOM   8790  C  CA  . SER D  1 203 ? 76.296  153.161 156.212 1.00 26.76  ? 224 SER D CA  1 
ATOM   8791  C  C   . SER D  1 203 ? 75.365  152.340 155.319 1.00 26.95  ? 224 SER D C   1 
ATOM   8792  O  O   . SER D  1 203 ? 75.825  151.428 154.612 1.00 25.77  ? 224 SER D O   1 
ATOM   8793  C  CB  . SER D  1 203 ? 77.490  153.696 155.443 1.00 27.01  ? 224 SER D CB  1 
ATOM   8794  O  OG  . SER D  1 203 ? 77.121  154.422 154.267 1.00 28.66  ? 224 SER D OG  1 
ATOM   8795  N  N   . ILE D  1 204 ? 74.076  152.597 155.435 1.00 28.32  ? 225 ILE D N   1 
ATOM   8796  C  CA  . ILE D  1 204 ? 73.009  151.758 154.820 1.00 29.26  ? 225 ILE D CA  1 
ATOM   8797  C  C   . ILE D  1 204 ? 71.779  152.635 154.662 1.00 30.67  ? 225 ILE D C   1 
ATOM   8798  O  O   . ILE D  1 204 ? 71.436  153.397 155.576 1.00 30.56  ? 225 ILE D O   1 
ATOM   8799  C  CB  . ILE D  1 204 ? 72.741  150.459 155.605 1.00 29.26  ? 225 ILE D CB  1 
ATOM   8800  C  CG1 . ILE D  1 204 ? 71.730  149.563 154.889 1.00 30.01  ? 225 ILE D CG1 1 
ATOM   8801  C  CG2 . ILE D  1 204 ? 72.296  150.775 157.021 1.00 30.25  ? 225 ILE D CG2 1 
ATOM   8802  C  CD1 . ILE D  1 204 ? 71.748  148.124 155.360 1.00 29.40  ? 225 ILE D CD1 1 
ATOM   8803  N  N   . ASN D  1 205 ? 71.177  152.554 153.490 1.00 32.03  ? 226 ASN D N   1 
ATOM   8804  C  CA  . ASN D  1 205 ? 69.923  153.286 153.249 1.00 34.48  ? 226 ASN D CA  1 
ATOM   8805  C  C   . ASN D  1 205 ? 68.798  152.271 153.050 1.00 35.35  ? 226 ASN D C   1 
ATOM   8806  O  O   . ASN D  1 205 ? 69.051  151.031 153.274 1.00 33.85  ? 226 ASN D O   1 
ATOM   8807  C  CB  . ASN D  1 205 ? 70.148  154.273 152.109 1.00 35.77  ? 226 ASN D CB  1 
ATOM   8808  C  CG  . ASN D  1 205 ? 70.339  153.592 150.772 1.00 35.41  ? 226 ASN D CG  1 
ATOM   8809  O  OD1 . ASN D  1 205 ? 70.375  152.355 150.690 1.00 34.18  ? 226 ASN D OD1 1 
ATOM   8810  N  ND2 . ASN D  1 205 ? 70.441  154.411 149.742 1.00 35.68  ? 226 ASN D ND2 1 
ATOM   8811  N  N   . GLN D  1 206 ? 67.619  152.795 152.711 1.00 37.97  ? 227 GLN D N   1 
ATOM   8812  C  CA  . GLN D  1 206 ? 66.360  152.036 152.489 1.00 39.65  ? 227 GLN D CA  1 
ATOM   8813  C  C   . GLN D  1 206 ? 66.629  150.906 151.496 1.00 37.73  ? 227 GLN D C   1 
ATOM   8814  O  O   . GLN D  1 206 ? 66.300  149.762 151.811 1.00 37.83  ? 227 GLN D O   1 
ATOM   8815  C  CB  . GLN D  1 206 ? 65.248  152.955 151.988 1.00 44.11  ? 227 GLN D CB  1 
ATOM   8816  C  CG  . GLN D  1 206 ? 63.957  152.226 151.662 1.00 47.97  ? 227 GLN D CG  1 
ATOM   8817  C  CD  . GLN D  1 206 ? 62.912  153.107 151.016 1.00 52.57  ? 227 GLN D CD  1 
ATOM   8818  O  OE1 . GLN D  1 206 ? 62.450  154.084 151.602 1.00 57.09  ? 227 GLN D OE1 1 
ATOM   8819  N  NE2 . GLN D  1 206 ? 62.467  152.729 149.825 1.00 54.90  ? 227 GLN D NE2 1 
ATOM   8820  N  N   . GLU D  1 207 ? 67.224  151.193 150.349 1.00 36.49  ? 228 GLU D N   1 
ATOM   8821  C  CA  . GLU D  1 207 ? 67.553  150.142 149.359 1.00 35.47  ? 228 GLU D CA  1 
ATOM   8822  C  C   . GLU D  1 207 ? 68.435  149.058 150.009 1.00 32.90  ? 228 GLU D C   1 
ATOM   8823  O  O   . GLU D  1 207 ? 68.264  147.853 149.722 1.00 31.72  ? 228 GLU D O   1 
ATOM   8824  C  CB  . GLU D  1 207 ? 68.212  150.737 148.113 1.00 36.05  ? 228 GLU D CB  1 
ATOM   8825  C  CG  . GLU D  1 207 ? 68.447  149.669 147.059 1.00 36.46  ? 228 GLU D CG  1 
ATOM   8826  C  CD  . GLU D  1 207 ? 68.900  150.111 145.669 1.00 38.21  ? 228 GLU D CD  1 
ATOM   8827  O  OE1 . GLU D  1 207 ? 69.095  151.367 145.449 1.00 39.29  ? 228 GLU D OE1 1 
ATOM   8828  O  OE2 . GLU D  1 207 ? 69.120  149.175 144.822 1.00 37.81  ? 228 GLU D OE2 1 
ATOM   8829  N  N   . GLY D  1 208 ? 69.442  149.437 150.782 1.00 31.28  ? 229 GLY D N   1 
ATOM   8830  C  CA  . GLY D  1 208 ? 70.306  148.406 151.357 1.00 29.88  ? 229 GLY D CA  1 
ATOM   8831  C  C   . GLY D  1 208 ? 69.496  147.499 152.255 1.00 29.59  ? 229 GLY D C   1 
ATOM   8832  O  O   . GLY D  1 208 ? 69.769  146.315 152.299 1.00 28.86  ? 229 GLY D O   1 
ATOM   8833  N  N   . ARG D  1 209 ? 68.616  148.083 153.065 1.00 31.09  ? 230 ARG D N   1 
ATOM   8834  C  CA  . ARG D  1 209 ? 67.760  147.300 153.994 1.00 32.45  ? 230 ARG D CA  1 
ATOM   8835  C  C   . ARG D  1 209 ? 66.767  146.424 153.223 1.00 33.24  ? 230 ARG D C   1 
ATOM   8836  O  O   . ARG D  1 209 ? 66.708  145.239 153.519 1.00 32.94  ? 230 ARG D O   1 
ATOM   8837  C  CB  . ARG D  1 209 ? 66.996  148.235 154.933 1.00 33.60  ? 230 ARG D CB  1 
ATOM   8838  C  CG  . ARG D  1 209 ? 67.877  149.051 155.860 1.00 33.59  ? 230 ARG D CG  1 
ATOM   8839  C  CD  . ARG D  1 209 ? 67.059  149.890 156.812 1.00 35.16  ? 230 ARG D CD  1 
ATOM   8840  N  NE  . ARG D  1 209 ? 67.900  150.793 157.573 1.00 34.80  ? 230 ARG D NE  1 
ATOM   8841  C  CZ  . ARG D  1 209 ? 68.655  150.423 158.588 1.00 33.75  ? 230 ARG D CZ  1 
ATOM   8842  N  NH1 . ARG D  1 209 ? 69.391  151.309 159.226 1.00 33.12  ? 230 ARG D NH1 1 
ATOM   8843  N  NH2 . ARG D  1 209 ? 68.669  149.163 158.964 1.00 34.12  ? 230 ARG D NH2 1 
ATOM   8844  N  N   . GLU D  1 210 ? 66.095  146.983 152.213 1.00 34.16  ? 231 GLU D N   1 
ATOM   8845  C  CA  . GLU D  1 210 ? 65.080  146.239 151.418 1.00 35.80  ? 231 GLU D CA  1 
ATOM   8846  C  C   . GLU D  1 210 ? 65.757  145.072 150.700 1.00 33.56  ? 231 GLU D C   1 
ATOM   8847  O  O   . GLU D  1 210 ? 65.259  143.955 150.803 1.00 32.50  ? 231 GLU D O   1 
ATOM   8848  C  CB  . GLU D  1 210 ? 64.476  147.152 150.351 1.00 38.52  ? 231 GLU D CB  1 
ATOM   8849  C  CG  . GLU D  1 210 ? 63.520  148.199 150.885 1.00 41.87  ? 231 GLU D CG  1 
ATOM   8850  C  CD  . GLU D  1 210 ? 63.030  149.183 149.834 1.00 46.19  ? 231 GLU D CD  1 
ATOM   8851  O  OE1 . GLU D  1 210 ? 63.736  149.373 148.824 1.00 45.87  ? 231 GLU D OE1 1 
ATOM   8852  O  OE2 . GLU D  1 210 ? 61.946  149.756 150.027 1.00 47.80  ? 231 GLU D OE2 1 
ATOM   8853  N  N   . GLN D  1 211 ? 66.892  145.333 150.062 1.00 31.45  ? 232 GLN D N   1 
ATOM   8854  C  CA  . GLN D  1 211 ? 67.666  144.272 149.402 1.00 30.75  ? 232 GLN D CA  1 
ATOM   8855  C  C   . GLN D  1 211 ? 68.182  143.239 150.416 1.00 30.17  ? 232 GLN D C   1 
ATOM   8856  O  O   . GLN D  1 211 ? 68.185  142.032 150.073 1.00 30.31  ? 232 GLN D O   1 
ATOM   8857  C  CB  . GLN D  1 211 ? 68.822  144.924 148.642 1.00 30.43  ? 232 GLN D CB  1 
ATOM   8858  C  CG  . GLN D  1 211 ? 68.353  145.695 147.395 1.00 31.08  ? 232 GLN D CG  1 
ATOM   8859  C  CD  . GLN D  1 211 ? 68.233  144.732 146.252 1.00 31.31  ? 232 GLN D CD  1 
ATOM   8860  O  OE1 . GLN D  1 211 ? 67.151  144.199 146.021 1.00 32.23  ? 232 GLN D OE1 1 
ATOM   8861  N  NE2 . GLN D  1 211 ? 69.358  144.448 145.606 1.00 30.43  ? 232 GLN D NE2 1 
ATOM   8862  N  N   . GLY D  1 212 ? 68.606  143.652 151.617 1.00 29.29  ? 233 GLY D N   1 
ATOM   8863  C  CA  . GLY D  1 212 ? 68.963  142.693 152.671 1.00 28.48  ? 233 GLY D CA  1 
ATOM   8864  C  C   . GLY D  1 212 ? 67.795  141.751 152.973 1.00 29.33  ? 233 GLY D C   1 
ATOM   8865  O  O   . GLY D  1 212 ? 67.992  140.518 153.002 1.00 28.39  ? 233 GLY D O   1 
ATOM   8866  N  N   . LYS D  1 213 ? 66.610  142.304 153.156 1.00 30.57  ? 234 LYS D N   1 
ATOM   8867  C  CA  . LYS D  1 213 ? 65.437  141.473 153.453 1.00 32.97  ? 234 LYS D CA  1 
ATOM   8868  C  C   . LYS D  1 213 ? 65.181  140.549 152.272 1.00 32.35  ? 234 LYS D C   1 
ATOM   8869  O  O   . LYS D  1 213 ? 64.867  139.392 152.535 1.00 32.21  ? 234 LYS D O   1 
ATOM   8870  C  CB  . LYS D  1 213 ? 64.242  142.340 153.837 1.00 36.61  ? 234 LYS D CB  1 
ATOM   8871  C  CG  . LYS D  1 213 ? 64.448  142.974 155.205 1.00 39.67  ? 234 LYS D CG  1 
ATOM   8872  C  CD  . LYS D  1 213 ? 63.327  143.917 155.639 1.00 44.95  ? 234 LYS D CD  1 
ATOM   8873  C  CE  . LYS D  1 213 ? 63.688  144.615 156.958 1.00 48.55  ? 234 LYS D CE  1 
ATOM   8874  N  NZ  . LYS D  1 213 ? 62.475  145.093 157.695 1.00 51.05  ? 234 LYS D NZ  1 
ATOM   8875  N  N   . ARG D  1 214 ? 65.270  141.059 151.039 1.00 31.84  ? 235 ARG D N   1 
ATOM   8876  C  CA  . ARG D  1 214 ? 64.945  140.296 149.805 1.00 32.25  ? 235 ARG D CA  1 
ATOM   8877  C  C   . ARG D  1 214 ? 65.794  139.012 149.759 1.00 30.82  ? 235 ARG D C   1 
ATOM   8878  O  O   . ARG D  1 214 ? 65.243  137.942 149.496 1.00 30.34  ? 235 ARG D O   1 
ATOM   8879  C  CB  . ARG D  1 214 ? 65.128  141.173 148.577 1.00 32.84  ? 235 ARG D CB  1 
ATOM   8880  C  CG  . ARG D  1 214 ? 65.236  140.388 147.284 1.00 33.89  ? 235 ARG D CG  1 
ATOM   8881  C  CD  . ARG D  1 214 ? 65.430  141.359 146.143 1.00 35.18  ? 235 ARG D CD  1 
ATOM   8882  N  NE  . ARG D  1 214 ? 65.491  140.658 144.878 1.00 36.32  ? 235 ARG D NE  1 
ATOM   8883  C  CZ  . ARG D  1 214 ? 66.190  141.048 143.830 1.00 37.23  ? 235 ARG D CZ  1 
ATOM   8884  N  NH1 . ARG D  1 214 ? 66.906  142.159 143.869 1.00 37.29  ? 235 ARG D NH1 1 
ATOM   8885  N  NH2 . ARG D  1 214 ? 66.179  140.313 142.735 1.00 38.06  ? 235 ARG D NH2 1 
ATOM   8886  N  N   . PHE D  1 215 ? 67.071  139.088 150.119 1.00 29.59  ? 236 PHE D N   1 
ATOM   8887  C  CA  . PHE D  1 215 ? 68.030  137.971 149.929 1.00 29.30  ? 236 PHE D CA  1 
ATOM   8888  C  C   . PHE D  1 215 ? 68.289  137.237 151.248 1.00 29.01  ? 236 PHE D C   1 
ATOM   8889  O  O   . PHE D  1 215 ? 69.250  136.453 151.288 1.00 28.77  ? 236 PHE D O   1 
ATOM   8890  C  CB  . PHE D  1 215 ? 69.343  138.455 149.330 1.00 28.68  ? 236 PHE D CB  1 
ATOM   8891  C  CG  . PHE D  1 215 ? 69.240  139.067 147.954 1.00 29.57  ? 236 PHE D CG  1 
ATOM   8892  C  CD1 . PHE D  1 215 ? 68.822  138.312 146.878 1.00 31.00  ? 236 PHE D CD1 1 
ATOM   8893  C  CD2 . PHE D  1 215 ? 69.673  140.358 147.727 1.00 29.67  ? 236 PHE D CD2 1 
ATOM   8894  C  CE1 . PHE D  1 215 ? 68.725  138.867 145.609 1.00 32.04  ? 236 PHE D CE1 1 
ATOM   8895  C  CE2 . PHE D  1 215 ? 69.589  140.921 146.466 1.00 30.86  ? 236 PHE D CE2 1 
ATOM   8896  C  CZ  . PHE D  1 215 ? 69.121  140.174 145.407 1.00 32.02  ? 236 PHE D CZ  1 
ATOM   8897  N  N   . GLY D  1 216 ? 67.523  137.527 152.293 1.00 29.62  ? 237 GLY D N   1 
ATOM   8898  C  CA  . GLY D  1 216 ? 67.688  136.915 153.631 1.00 30.02  ? 237 GLY D CA  1 
ATOM   8899  C  C   . GLY D  1 216 ? 69.046  137.200 154.264 1.00 28.79  ? 237 GLY D C   1 
ATOM   8900  O  O   . GLY D  1 216 ? 69.543  136.351 154.927 1.00 29.29  ? 237 GLY D O   1 
ATOM   8901  N  N   . VAL D  1 217 ? 69.600  138.383 154.135 1.00 28.49  ? 238 VAL D N   1 
ATOM   8902  C  CA  . VAL D  1 217 ? 70.929  138.748 154.714 1.00 27.95  ? 238 VAL D CA  1 
ATOM   8903  C  C   . VAL D  1 217 ? 70.767  139.064 156.195 1.00 28.82  ? 238 VAL D C   1 
ATOM   8904  O  O   . VAL D  1 217 ? 69.783  139.714 156.557 1.00 29.12  ? 238 VAL D O   1 
ATOM   8905  C  CB  . VAL D  1 217 ? 71.478  139.958 153.969 1.00 27.82  ? 238 VAL D CB  1 
ATOM   8906  C  CG1 . VAL D  1 217 ? 72.869  140.326 154.400 1.00 27.09  ? 238 VAL D CG1 1 
ATOM   8907  C  CG2 . VAL D  1 217 ? 71.446  139.712 152.474 1.00 28.04  ? 238 VAL D CG2 1 
ATOM   8908  N  N   . GLU D  1 218 ? 71.693  138.572 157.015 1.00 29.37  ? 239 GLU D N   1 
ATOM   8909  C  CA  . GLU D  1 218 ? 71.811  138.888 158.456 1.00 30.52  ? 239 GLU D CA  1 
ATOM   8910  C  C   . GLU D  1 218 ? 72.729  140.092 158.591 1.00 29.64  ? 239 GLU D C   1 
ATOM   8911  O  O   . GLU D  1 218 ? 73.947  139.959 158.346 1.00 29.33  ? 239 GLU D O   1 
ATOM   8912  C  CB  . GLU D  1 218 ? 72.340  137.682 159.204 1.00 31.94  ? 239 GLU D CB  1 
ATOM   8913  C  CG  . GLU D  1 218 ? 71.394  136.515 159.127 1.00 34.15  ? 239 GLU D CG  1 
ATOM   8914  C  CD  . GLU D  1 218 ? 72.069  135.253 159.608 1.00 36.81  ? 239 GLU D CD  1 
ATOM   8915  O  OE1 . GLU D  1 218 ? 72.428  135.186 160.839 1.00 40.05  ? 239 GLU D OE1 1 
ATOM   8916  O  OE2 . GLU D  1 218 ? 72.282  134.376 158.747 1.00 38.81  ? 239 GLU D OE2 1 
ATOM   8917  N  N   . GLN D  1 219 ? 72.120  141.240 158.829 1.00 29.49  ? 240 GLN D N   1 
ATOM   8918  C  CA  . GLN D  1 219 ? 72.787  142.556 158.803 1.00 28.90  ? 240 GLN D CA  1 
ATOM   8919  C  C   . GLN D  1 219 ? 72.969  142.976 160.261 1.00 28.80  ? 240 GLN D C   1 
ATOM   8920  O  O   . GLN D  1 219 ? 72.004  143.316 160.899 1.00 29.06  ? 240 GLN D O   1 
ATOM   8921  C  CB  . GLN D  1 219 ? 72.011  143.554 157.939 1.00 29.22  ? 240 GLN D CB  1 
ATOM   8922  C  CG  . GLN D  1 219 ? 72.218  143.324 156.450 1.00 29.42  ? 240 GLN D CG  1 
ATOM   8923  C  CD  . GLN D  1 219 ? 71.424  144.272 155.592 1.00 30.39  ? 240 GLN D CD  1 
ATOM   8924  O  OE1 . GLN D  1 219 ? 70.362  144.731 156.000 1.00 32.07  ? 240 GLN D OE1 1 
ATOM   8925  N  NE2 . GLN D  1 219 ? 71.926  144.576 154.403 1.00 29.74  ? 240 GLN D NE2 1 
ATOM   8926  N  N   . TYR D  1 220 ? 74.200  142.894 160.733 1.00 28.16  ? 241 TYR D N   1 
ATOM   8927  C  CA  . TYR D  1 220 ? 74.631  143.317 162.083 1.00 28.52  ? 241 TYR D CA  1 
ATOM   8928  C  C   . TYR D  1 220 ? 75.172  144.737 161.950 1.00 27.39  ? 241 TYR D C   1 
ATOM   8929  O  O   . TYR D  1 220 ? 76.260  144.900 161.390 1.00 27.19  ? 241 TYR D O   1 
ATOM   8930  C  CB  . TYR D  1 220 ? 75.644  142.317 162.649 1.00 28.95  ? 241 TYR D CB  1 
ATOM   8931  C  CG  . TYR D  1 220 ? 75.037  140.974 162.933 1.00 31.00  ? 241 TYR D CG  1 
ATOM   8932  C  CD1 . TYR D  1 220 ? 74.472  140.704 164.170 1.00 34.22  ? 241 TYR D CD1 1 
ATOM   8933  C  CD2 . TYR D  1 220 ? 75.034  139.963 161.983 1.00 31.46  ? 241 TYR D CD2 1 
ATOM   8934  C  CE1 . TYR D  1 220 ? 73.905  139.464 164.439 1.00 36.80  ? 241 TYR D CE1 1 
ATOM   8935  C  CE2 . TYR D  1 220 ? 74.444  138.739 162.217 1.00 33.41  ? 241 TYR D CE2 1 
ATOM   8936  C  CZ  . TYR D  1 220 ? 73.864  138.482 163.449 1.00 37.70  ? 241 TYR D CZ  1 
ATOM   8937  O  OH  . TYR D  1 220 ? 73.294  137.248 163.730 1.00 42.61  ? 241 TYR D OH  1 
ATOM   8938  N  N   . GLU D  1 221 ? 74.382  145.701 162.411 1.00 27.40  ? 242 GLU D N   1 
ATOM   8939  C  CA  . GLU D  1 221 ? 74.687  147.147 162.408 1.00 27.17  ? 242 GLU D CA  1 
ATOM   8940  C  C   . GLU D  1 221 ? 75.501  147.519 163.661 1.00 26.92  ? 242 GLU D C   1 
ATOM   8941  O  O   . GLU D  1 221 ? 75.277  146.952 164.755 1.00 26.72  ? 242 GLU D O   1 
ATOM   8942  C  CB  . GLU D  1 221 ? 73.391  147.938 162.301 1.00 28.14  ? 242 GLU D CB  1 
ATOM   8943  C  CG  . GLU D  1 221 ? 72.686  147.712 160.982 1.00 28.84  ? 242 GLU D CG  1 
ATOM   8944  C  CD  . GLU D  1 221 ? 71.361  148.444 160.840 1.00 30.81  ? 242 GLU D CD  1 
ATOM   8945  O  OE1 . GLU D  1 221 ? 71.371  149.677 160.880 1.00 30.82  ? 242 GLU D OE1 1 
ATOM   8946  O  OE2 . GLU D  1 221 ? 70.304  147.754 160.773 1.00 33.27  ? 242 GLU D OE2 1 
ATOM   8947  N  N   . MET D  1 222 ? 76.432  148.457 163.503 1.00 26.19  ? 243 MET D N   1 
ATOM   8948  C  CA  . MET D  1 222 ? 77.310  148.871 164.631 1.00 26.41  ? 243 MET D CA  1 
ATOM   8949  C  C   . MET D  1 222 ? 76.452  149.454 165.770 1.00 27.06  ? 243 MET D C   1 
ATOM   8950  O  O   . MET D  1 222 ? 76.849  149.333 166.932 1.00 26.28  ? 243 MET D O   1 
ATOM   8951  C  CB  . MET D  1 222 ? 78.396  149.840 164.148 1.00 26.08  ? 243 MET D CB  1 
ATOM   8952  C  CG  . MET D  1 222 ? 79.537  149.148 163.384 1.00 25.05  ? 243 MET D CG  1 
ATOM   8953  S  SD  . MET D  1 222 ? 80.303  147.830 164.367 1.00 25.28  ? 243 MET D SD  1 
ATOM   8954  C  CE  . MET D  1 222 ? 80.836  148.739 165.820 1.00 25.70  ? 243 MET D CE  1 
ATOM   8955  N  N   . ARG D  1 223 ? 75.265  149.955 165.469 1.00 27.97  ? 244 ARG D N   1 
ATOM   8956  C  CA  . ARG D  1 223 ? 74.380  150.551 166.508 1.00 30.11  ? 244 ARG D CA  1 
ATOM   8957  C  C   . ARG D  1 223 ? 73.802  149.490 167.457 1.00 29.73  ? 244 ARG D C   1 
ATOM   8958  O  O   . ARG D  1 223 ? 73.206  149.907 168.436 1.00 30.93  ? 244 ARG D O   1 
ATOM   8959  C  CB  . ARG D  1 223 ? 73.255  151.371 165.869 1.00 31.92  ? 244 ARG D CB  1 
ATOM   8960  C  CG  . ARG D  1 223 ? 72.331  150.583 164.967 1.00 33.36  ? 244 ARG D CG  1 
ATOM   8961  C  CD  . ARG D  1 223 ? 71.385  151.558 164.284 1.00 36.10  ? 244 ARG D CD  1 
ATOM   8962  N  NE  . ARG D  1 223 ? 70.551  150.810 163.385 1.00 37.94  ? 244 ARG D NE  1 
ATOM   8963  C  CZ  . ARG D  1 223 ? 69.405  150.272 163.708 1.00 42.06  ? 244 ARG D CZ  1 
ATOM   8964  N  NH1 . ARG D  1 223 ? 68.783  149.533 162.812 1.00 43.89  ? 244 ARG D NH1 1 
ATOM   8965  N  NH2 . ARG D  1 223 ? 68.904  150.422 164.925 1.00 44.93  ? 244 ARG D NH2 1 
ATOM   8966  N  N   . THR D  1 224 ? 73.951  148.198 167.173 1.00 28.29  ? 245 THR D N   1 
ATOM   8967  C  CA  . THR D  1 224 ? 73.575  147.105 168.108 1.00 28.61  ? 245 THR D CA  1 
ATOM   8968  C  C   . THR D  1 224 ? 74.781  146.232 168.457 1.00 28.22  ? 245 THR D C   1 
ATOM   8969  O  O   . THR D  1 224 ? 74.580  145.178 169.037 1.00 28.79  ? 245 THR D O   1 
ATOM   8970  C  CB  . THR D  1 224 ? 72.449  146.244 167.530 1.00 28.48  ? 245 THR D CB  1 
ATOM   8971  O  OG1 . THR D  1 224 ? 72.938  145.565 166.363 1.00 27.10  ? 245 THR D OG1 1 
ATOM   8972  C  CG2 . THR D  1 224 ? 71.208  147.063 167.269 1.00 28.79  ? 245 THR D CG2 1 
ATOM   8973  N  N   . PHE D  1 225 ? 75.988  146.686 168.189 1.00 27.96  ? 246 PHE D N   1 
ATOM   8974  C  CA  . PHE D  1 225 ? 77.225  145.919 168.445 1.00 28.70  ? 246 PHE D CA  1 
ATOM   8975  C  C   . PHE D  1 225 ? 77.368  145.608 169.941 1.00 30.66  ? 246 PHE D C   1 
ATOM   8976  O  O   . PHE D  1 225 ? 77.828  144.509 170.280 1.00 30.10  ? 246 PHE D O   1 
ATOM   8977  C  CB  . PHE D  1 225 ? 78.456  146.654 167.914 1.00 27.90  ? 246 PHE D CB  1 
ATOM   8978  C  CG  . PHE D  1 225 ? 79.687  145.798 167.956 1.00 28.06  ? 246 PHE D CG  1 
ATOM   8979  C  CD1 . PHE D  1 225 ? 79.747  144.625 167.214 1.00 28.46  ? 246 PHE D CD1 1 
ATOM   8980  C  CD2 . PHE D  1 225 ? 80.744  146.089 168.814 1.00 28.76  ? 246 PHE D CD2 1 
ATOM   8981  C  CE1 . PHE D  1 225 ? 80.867  143.792 167.258 1.00 28.93  ? 246 PHE D CE1 1 
ATOM   8982  C  CE2 . PHE D  1 225 ? 81.868  145.274 168.838 1.00 28.88  ? 246 PHE D CE2 1 
ATOM   8983  C  CZ  . PHE D  1 225 ? 81.929  144.118 168.076 1.00 28.86  ? 246 PHE D CZ  1 
ATOM   8984  N  N   . SER D  1 226 ? 77.017  146.514 170.836 1.00 33.09  ? 247 SER D N   1 
ATOM   8985  C  CA  . SER D  1 226 ? 77.109  146.191 172.278 1.00 38.01  ? 247 SER D CA  1 
ATOM   8986  C  C   . SER D  1 226 ? 76.389  144.867 172.570 1.00 37.97  ? 247 SER D C   1 
ATOM   8987  O  O   . SER D  1 226 ? 76.898  144.061 173.306 1.00 39.00  ? 247 SER D O   1 
ATOM   8988  C  CB  . SER D  1 226 ? 76.467  147.267 173.124 1.00 41.98  ? 247 SER D CB  1 
ATOM   8989  O  OG  . SER D  1 226 ? 77.350  148.350 173.255 1.00 45.69  ? 247 SER D OG  1 
ATOM   8990  N  N   . LYS D  1 227 ? 75.176  144.756 172.091 1.00 38.06  ? 248 LYS D N   1 
ATOM   8991  C  CA  . LYS D  1 227 ? 74.279  143.607 172.357 1.00 40.52  ? 248 LYS D CA  1 
ATOM   8992  C  C   . LYS D  1 227 ? 74.811  142.399 171.581 1.00 37.03  ? 248 LYS D C   1 
ATOM   8993  O  O   . LYS D  1 227 ? 74.748  141.289 172.075 1.00 37.37  ? 248 LYS D O   1 
ATOM   8994  C  CB  . LYS D  1 227 ? 72.848  144.025 171.990 1.00 44.56  ? 248 LYS D CB  1 
ATOM   8995  C  CG  . LYS D  1 227 ? 71.851  142.894 171.754 1.00 50.95  ? 248 LYS D CG  1 
ATOM   8996  C  CD  . LYS D  1 227 ? 71.230  142.319 173.038 1.00 59.07  ? 248 LYS D CD  1 
ATOM   8997  C  CE  . LYS D  1 227 ? 69.828  142.832 173.314 1.00 64.95  ? 248 LYS D CE  1 
ATOM   8998  N  NZ  . LYS D  1 227 ? 69.010  142.835 172.073 1.00 67.69  ? 248 LYS D NZ  1 
ATOM   8999  N  N   . ASP D  1 228 ? 75.297  142.629 170.380 1.00 33.91  ? 249 ASP D N   1 
ATOM   9000  C  CA  . ASP D  1 228 ? 75.599  141.571 169.397 1.00 32.99  ? 249 ASP D CA  1 
ATOM   9001  C  C   . ASP D  1 228 ? 76.980  140.966 169.633 1.00 32.43  ? 249 ASP D C   1 
ATOM   9002  O  O   . ASP D  1 228 ? 77.150  139.839 169.155 1.00 31.61  ? 249 ASP D O   1 
ATOM   9003  C  CB  . ASP D  1 228 ? 75.510  142.100 167.970 1.00 31.85  ? 249 ASP D CB  1 
ATOM   9004  C  CG  . ASP D  1 228 ? 74.086  142.403 167.547 1.00 32.56  ? 249 ASP D CG  1 
ATOM   9005  O  OD1 . ASP D  1 228 ? 73.139  141.952 168.236 1.00 34.24  ? 249 ASP D OD1 1 
ATOM   9006  O  OD2 . ASP D  1 228 ? 73.940  143.145 166.568 1.00 33.07  ? 249 ASP D OD2 1 
ATOM   9007  N  N   . ARG D  1 229 ? 77.901  141.677 170.293 1.00 31.93  ? 250 ARG D N   1 
ATOM   9008  C  CA  . ARG D  1 229 ? 79.341  141.295 170.346 1.00 32.33  ? 250 ARG D CA  1 
ATOM   9009  C  C   . ARG D  1 229 ? 79.496  139.850 170.828 1.00 33.24  ? 250 ARG D C   1 
ATOM   9010  O  O   . ARG D  1 229 ? 80.238  139.093 170.228 1.00 32.63  ? 250 ARG D O   1 
ATOM   9011  C  CB  . ARG D  1 229 ? 80.150  142.240 171.251 1.00 32.97  ? 250 ARG D CB  1 
ATOM   9012  C  CG  . ARG D  1 229 ? 81.554  141.756 171.585 1.00 34.01  ? 250 ARG D CG  1 
ATOM   9013  C  CD  . ARG D  1 229 ? 82.295  142.525 172.667 1.00 34.69  ? 250 ARG D CD  1 
ATOM   9014  N  NE  . ARG D  1 229 ? 82.721  143.891 172.341 1.00 34.69  ? 250 ARG D NE  1 
ATOM   9015  C  CZ  . ARG D  1 229 ? 83.816  144.247 171.627 1.00 34.53  ? 250 ARG D CZ  1 
ATOM   9016  N  NH1 . ARG D  1 229 ? 84.122  145.528 171.506 1.00 34.12  ? 250 ARG D NH1 1 
ATOM   9017  N  NH2 . ARG D  1 229 ? 84.605  143.356 171.024 1.00 34.23  ? 250 ARG D NH2 1 
ATOM   9018  N  N   . PRO D  1 230 ? 78.872  139.398 171.935 1.00 34.72  ? 251 PRO D N   1 
ATOM   9019  C  CA  . PRO D  1 230 ? 79.048  138.014 172.382 1.00 36.84  ? 251 PRO D CA  1 
ATOM   9020  C  C   . PRO D  1 230 ? 78.729  136.986 171.288 1.00 37.06  ? 251 PRO D C   1 
ATOM   9021  O  O   . PRO D  1 230 ? 79.401  135.995 171.182 1.00 37.70  ? 251 PRO D O   1 
ATOM   9022  C  CB  . PRO D  1 230 ? 78.093  137.842 173.571 1.00 37.97  ? 251 PRO D CB  1 
ATOM   9023  C  CG  . PRO D  1 230 ? 77.886  139.251 174.069 1.00 37.70  ? 251 PRO D CG  1 
ATOM   9024  C  CD  . PRO D  1 230 ? 78.005  140.153 172.843 1.00 35.63  ? 251 PRO D CD  1 
ATOM   9025  N  N   . MET D  1 231 ? 77.701  137.241 170.501 1.00 37.43  ? 252 MET D N   1 
ATOM   9026  C  CA  . MET D  1 231 ? 77.282  136.304 169.442 1.00 38.50  ? 252 MET D CA  1 
ATOM   9027  C  C   . MET D  1 231 ? 78.283  136.414 168.279 1.00 34.30  ? 252 MET D C   1 
ATOM   9028  O  O   . MET D  1 231 ? 78.720  135.403 167.753 1.00 33.23  ? 252 MET D O   1 
ATOM   9029  C  CB  . MET D  1 231 ? 75.847  136.650 169.043 1.00 43.48  ? 252 MET D CB  1 
ATOM   9030  C  CG  . MET D  1 231 ? 75.267  135.759 167.984 1.00 48.36  ? 252 MET D CG  1 
ATOM   9031  S  SD  . MET D  1 231 ? 75.564  136.453 166.359 1.00 57.46  ? 252 MET D SD  1 
ATOM   9032  C  CE  . MET D  1 231 ? 74.598  135.278 165.389 1.00 59.82  ? 252 MET D CE  1 
ATOM   9033  N  N   . LEU D  1 232 ? 78.758  137.597 167.928 1.00 31.17  ? 253 LEU D N   1 
ATOM   9034  C  CA  . LEU D  1 232 ? 79.740  137.706 166.833 1.00 29.49  ? 253 LEU D CA  1 
ATOM   9035  C  C   . LEU D  1 232 ? 81.146  137.164 167.203 1.00 29.50  ? 253 LEU D C   1 
ATOM   9036  O  O   . LEU D  1 232 ? 81.863  136.730 166.260 1.00 29.05  ? 253 LEU D O   1 
ATOM   9037  C  CB  . LEU D  1 232 ? 79.765  139.161 166.408 1.00 28.91  ? 253 LEU D CB  1 
ATOM   9038  C  CG  . LEU D  1 232 ? 78.431  139.720 165.916 1.00 28.62  ? 253 LEU D CG  1 
ATOM   9039  C  CD1 . LEU D  1 232 ? 78.591  141.218 165.763 1.00 28.17  ? 253 LEU D CD1 1 
ATOM   9040  C  CD2 . LEU D  1 232 ? 78.038  139.103 164.584 1.00 27.90  ? 253 LEU D CD2 1 
ATOM   9041  N  N   . GLU D  1 233 ? 81.512  137.056 168.487 1.00 29.53  ? 254 GLU D N   1 
ATOM   9042  C  CA  . GLU D  1 233 ? 82.805  136.464 168.918 1.00 30.40  ? 254 GLU D CA  1 
ATOM   9043  C  C   . GLU D  1 233 ? 82.676  134.962 169.172 1.00 32.37  ? 254 GLU D C   1 
ATOM   9044  O  O   . GLU D  1 233 ? 83.530  134.385 169.812 1.00 33.46  ? 254 GLU D O   1 
ATOM   9045  C  CB  . GLU D  1 233 ? 83.328  137.221 170.141 1.00 30.38  ? 254 GLU D CB  1 
ATOM   9046  C  CG  . GLU D  1 233 ? 83.631  138.685 169.828 1.00 28.61  ? 254 GLU D CG  1 
ATOM   9047  C  CD  . GLU D  1 233 ? 84.305  139.523 170.907 1.00 28.68  ? 254 GLU D CD  1 
ATOM   9048  O  OE1 . GLU D  1 233 ? 84.386  139.081 172.070 1.00 30.34  ? 254 GLU D OE1 1 
ATOM   9049  O  OE2 . GLU D  1 233 ? 84.769  140.604 170.567 1.00 27.26  ? 254 GLU D OE2 1 
ATOM   9050  N  N   . ASN D  1 234 ? 81.604  134.354 168.709 1.00 33.49  ? 255 ASN D N   1 
ATOM   9051  C  CA  . ASN D  1 234 ? 81.287  132.927 168.928 1.00 35.72  ? 255 ASN D CA  1 
ATOM   9052  C  C   . ASN D  1 234 ? 80.570  132.387 167.690 1.00 34.40  ? 255 ASN D C   1 
ATOM   9053  O  O   . ASN D  1 234 ? 79.606  131.701 167.869 1.00 35.46  ? 255 ASN D O   1 
ATOM   9054  C  CB  . ASN D  1 234 ? 80.466  132.819 170.212 1.00 38.82  ? 255 ASN D CB  1 
ATOM   9055  C  CG  . ASN D  1 234 ? 81.345  133.015 171.437 1.00 43.19  ? 255 ASN D CG  1 
ATOM   9056  O  OD1 . ASN D  1 234 ? 82.024  132.060 171.863 1.00 48.47  ? 255 ASN D OD1 1 
ATOM   9057  N  ND2 . ASN D  1 234 ? 81.377  134.226 172.019 1.00 43.04  ? 255 ASN D ND2 1 
ATOM   9058  N  N   . LEU D  1 235 ? 80.925  132.809 166.483 1.00 32.57  ? 256 LEU D N   1 
ATOM   9059  C  CA  . LEU D  1 235 ? 80.181  132.429 165.261 1.00 32.50  ? 256 LEU D CA  1 
ATOM   9060  C  C   . LEU D  1 235 ? 80.539  130.997 164.893 1.00 34.23  ? 256 LEU D C   1 
ATOM   9061  O  O   . LEU D  1 235 ? 81.674  130.599 165.132 1.00 34.96  ? 256 LEU D O   1 
ATOM   9062  C  CB  . LEU D  1 235 ? 80.527  133.366 164.107 1.00 30.47  ? 256 LEU D CB  1 
ATOM   9063  C  CG  . LEU D  1 235 ? 79.959  134.776 164.217 1.00 29.55  ? 256 LEU D CG  1 
ATOM   9064  C  CD1 . LEU D  1 235 ? 80.493  135.646 163.115 1.00 28.08  ? 256 LEU D CD1 1 
ATOM   9065  C  CD2 . LEU D  1 235 ? 78.424  134.791 164.217 1.00 29.98  ? 256 LEU D CD2 1 
ATOM   9066  N  N   . LYS D  1 236 ? 79.588  130.243 164.365 1.00 35.73  ? 257 LYS D N   1 
ATOM   9067  C  CA  . LYS D  1 236 ? 79.872  128.957 163.671 1.00 37.75  ? 257 LYS D CA  1 
ATOM   9068  C  C   . LYS D  1 236 ? 79.131  129.023 162.348 1.00 36.40  ? 257 LYS D C   1 
ATOM   9069  O  O   . LYS D  1 236 ? 77.954  129.364 162.336 1.00 37.81  ? 257 LYS D O   1 
ATOM   9070  C  CB  . LYS D  1 236 ? 79.548  127.698 164.493 1.00 40.86  ? 257 LYS D CB  1 
ATOM   9071  C  CG  . LYS D  1 236 ? 78.492  127.880 165.558 1.00 43.89  ? 257 LYS D CG  1 
ATOM   9072  C  CD  . LYS D  1 236 ? 78.807  127.170 166.899 1.00 47.54  ? 257 LYS D CD  1 
ATOM   9073  C  CE  . LYS D  1 236 ? 79.754  128.039 167.698 1.00 48.31  ? 257 LYS D CE  1 
ATOM   9074  N  NZ  . LYS D  1 236 ? 80.283  127.354 168.886 1.00 52.05  ? 257 LYS D NZ  1 
ATOM   9075  N  N   . LEU D  1 237 ? 79.843  128.770 161.272 1.00 35.22  ? 258 LEU D N   1 
ATOM   9076  C  CA  . LEU D  1 237 ? 79.259  128.827 159.932 1.00 34.13  ? 258 LEU D CA  1 
ATOM   9077  C  C   . LEU D  1 237 ? 79.670  127.582 159.164 1.00 34.12  ? 258 LEU D C   1 
ATOM   9078  O  O   . LEU D  1 237 ? 80.614  126.851 159.598 1.00 33.76  ? 258 LEU D O   1 
ATOM   9079  C  CB  . LEU D  1 237 ? 79.755  130.106 159.259 1.00 33.31  ? 258 LEU D CB  1 
ATOM   9080  C  CG  . LEU D  1 237 ? 79.230  131.422 159.834 1.00 32.84  ? 258 LEU D CG  1 
ATOM   9081  C  CD1 . LEU D  1 237 ? 79.852  132.578 159.085 1.00 32.02  ? 258 LEU D CD1 1 
ATOM   9082  C  CD2 . LEU D  1 237 ? 77.714  131.538 159.762 1.00 33.30  ? 258 LEU D CD2 1 
ATOM   9083  N  N   . GLY D  1 238 ? 78.896  127.349 158.101 1.00 34.00  ? 259 GLY D N   1 
ATOM   9084  C  CA  . GLY D  1 238 ? 79.185  126.420 156.995 1.00 34.44  ? 259 GLY D CA  1 
ATOM   9085  C  C   . GLY D  1 238 ? 78.619  125.039 157.226 1.00 36.18  ? 259 GLY D C   1 
ATOM   9086  O  O   . GLY D  1 238 ? 78.888  124.182 156.403 1.00 36.59  ? 259 GLY D O   1 
ATOM   9087  N  N   . GLU D  1 239 ? 77.968  124.780 158.349 1.00 37.87  ? 260 GLU D N   1 
ATOM   9088  C  CA  . GLU D  1 239 ? 77.517  123.406 158.671 1.00 41.12  ? 260 GLU D CA  1 
ATOM   9089  C  C   . GLU D  1 239 ? 76.458  122.963 157.654 1.00 39.49  ? 260 GLU D C   1 
ATOM   9090  O  O   . GLU D  1 239 ? 75.496  123.691 157.469 1.00 38.15  ? 260 GLU D O   1 
ATOM   9091  C  CB  . GLU D  1 239 ? 76.990  123.352 160.096 1.00 45.20  ? 260 GLU D CB  1 
ATOM   9092  C  CG  . GLU D  1 239 ? 76.760  121.934 160.572 1.00 51.37  ? 260 GLU D CG  1 
ATOM   9093  C  CD  . GLU D  1 239 ? 76.110  121.942 161.945 1.00 56.82  ? 260 GLU D CD  1 
ATOM   9094  O  OE1 . GLU D  1 239 ? 75.769  123.094 162.401 1.00 62.15  ? 260 GLU D OE1 1 
ATOM   9095  O  OE2 . GLU D  1 239 ? 75.985  120.845 162.572 1.00 60.78  ? 260 GLU D OE2 1 
ATOM   9096  N  N   . GLY D  1 240 ? 76.687  121.837 156.980 1.00 39.79  ? 261 GLY D N   1 
ATOM   9097  C  CA  . GLY D  1 240 ? 75.838  121.284 155.900 1.00 39.38  ? 261 GLY D CA  1 
ATOM   9098  C  C   . GLY D  1 240 ? 75.986  122.012 154.554 1.00 37.20  ? 261 GLY D C   1 
ATOM   9099  O  O   . GLY D  1 240 ? 75.259  121.664 153.639 1.00 37.55  ? 261 GLY D O   1 
ATOM   9100  N  N   . VAL D  1 241 ? 76.897  122.954 154.366 1.00 34.88  ? 262 VAL D N   1 
ATOM   9101  C  CA  . VAL D  1 241 ? 77.175  123.506 153.008 1.00 33.63  ? 262 VAL D CA  1 
ATOM   9102  C  C   . VAL D  1 241 ? 78.657  123.295 152.667 1.00 33.46  ? 262 VAL D C   1 
ATOM   9103  O  O   . VAL D  1 241 ? 79.286  122.496 153.330 1.00 34.48  ? 262 VAL D O   1 
ATOM   9104  C  CB  . VAL D  1 241 ? 76.725  124.972 152.916 1.00 32.31  ? 262 VAL D CB  1 
ATOM   9105  C  CG1 . VAL D  1 241 ? 75.226  125.087 152.928 1.00 32.69  ? 262 VAL D CG1 1 
ATOM   9106  C  CG2 . VAL D  1 241 ? 77.315  125.826 154.029 1.00 31.95  ? 262 VAL D CG2 1 
ATOM   9107  N  N   . LYS D  1 242 ? 79.187  123.891 151.604 1.00 32.79  ? 263 LYS D N   1 
ATOM   9108  C  CA  . LYS D  1 242 ? 80.503  123.489 151.032 1.00 33.80  ? 263 LYS D CA  1 
ATOM   9109  C  C   . LYS D  1 242 ? 81.664  124.133 151.802 1.00 33.44  ? 263 LYS D C   1 
ATOM   9110  O  O   . LYS D  1 242 ? 82.842  123.700 151.615 1.00 34.43  ? 263 LYS D O   1 
ATOM   9111  C  CB  . LYS D  1 242 ? 80.591  123.897 149.561 1.00 33.72  ? 263 LYS D CB  1 
ATOM   9112  C  CG  . LYS D  1 242 ? 79.621  123.153 148.642 1.00 34.77  ? 263 LYS D CG  1 
ATOM   9113  C  CD  . LYS D  1 242 ? 79.783  121.625 148.723 1.00 36.83  ? 263 LYS D CD  1 
ATOM   9114  C  CE  . LYS D  1 242 ? 78.918  120.919 147.693 1.00 37.41  ? 263 LYS D CE  1 
ATOM   9115  N  NZ  . LYS D  1 242 ? 78.635  119.556 148.134 1.00 39.20  ? 263 LYS D NZ  1 
ATOM   9116  N  N   . GLY D  1 243 ? 81.353  125.138 152.615 1.00 32.25  ? 264 GLY D N   1 
ATOM   9117  C  CA  . GLY D  1 243 ? 82.325  125.776 153.505 1.00 31.97  ? 264 GLY D CA  1 
ATOM   9118  C  C   . GLY D  1 243 ? 81.999  127.226 153.704 1.00 29.98  ? 264 GLY D C   1 
ATOM   9119  O  O   . GLY D  1 243 ? 80.849  127.617 153.494 1.00 29.49  ? 264 GLY D O   1 
ATOM   9120  N  N   . VAL D  1 244 ? 83.006  128.002 154.044 1.00 28.96  ? 265 VAL D N   1 
ATOM   9121  C  CA  . VAL D  1 244 ? 82.791  129.390 154.487 1.00 27.70  ? 265 VAL D CA  1 
ATOM   9122  C  C   . VAL D  1 244 ? 83.767  130.267 153.746 1.00 27.07  ? 265 VAL D C   1 
ATOM   9123  O  O   . VAL D  1 244 ? 84.920  129.871 153.569 1.00 27.52  ? 265 VAL D O   1 
ATOM   9124  C  CB  . VAL D  1 244 ? 82.962  129.531 156.005 1.00 28.08  ? 265 VAL D CB  1 
ATOM   9125  C  CG1 . VAL D  1 244 ? 82.800  130.987 156.386 1.00 26.66  ? 265 VAL D CG1 1 
ATOM   9126  C  CG2 . VAL D  1 244 ? 82.028  128.596 156.812 1.00 28.87  ? 265 VAL D CG2 1 
ATOM   9127  N  N   . TYR D  1 245 ? 83.274  131.411 153.300 1.00 26.30  ? 266 TYR D N   1 
ATOM   9128  C  CA  . TYR D  1 245 ? 84.062  132.403 152.552 1.00 25.87  ? 266 TYR D CA  1 
ATOM   9129  C  C   . TYR D  1 245 ? 84.003  133.677 153.380 1.00 25.02  ? 266 TYR D C   1 
ATOM   9130  O  O   . TYR D  1 245 ? 82.885  134.002 153.889 1.00 23.96  ? 266 TYR D O   1 
ATOM   9131  C  CB  . TYR D  1 245 ? 83.476  132.659 151.175 1.00 25.92  ? 266 TYR D CB  1 
ATOM   9132  C  CG  . TYR D  1 245 ? 84.322  133.608 150.385 1.00 26.13  ? 266 TYR D CG  1 
ATOM   9133  C  CD1 . TYR D  1 245 ? 84.121  134.967 150.479 1.00 26.08  ? 266 TYR D CD1 1 
ATOM   9134  C  CD2 . TYR D  1 245 ? 85.306  133.144 149.535 1.00 26.93  ? 266 TYR D CD2 1 
ATOM   9135  C  CE1 . TYR D  1 245 ? 84.884  135.856 149.736 1.00 26.25  ? 266 TYR D CE1 1 
ATOM   9136  C  CE2 . TYR D  1 245 ? 86.088  134.008 148.800 1.00 27.00  ? 266 TYR D CE2 1 
ATOM   9137  C  CZ  . TYR D  1 245 ? 85.876  135.365 148.915 1.00 26.48  ? 266 TYR D CZ  1 
ATOM   9138  O  OH  . TYR D  1 245 ? 86.587  136.238 148.183 1.00 26.76  ? 266 TYR D OH  1 
ATOM   9139  N  N   . ILE D  1 246 ? 85.151  134.312 153.599 1.00 24.91  ? 267 ILE D N   1 
ATOM   9140  C  CA  . ILE D  1 246 ? 85.208  135.513 154.489 1.00 24.38  ? 267 ILE D CA  1 
ATOM   9141  C  C   . ILE D  1 246 ? 85.670  136.641 153.604 1.00 24.21  ? 267 ILE D C   1 
ATOM   9142  O  O   . ILE D  1 246 ? 86.825  136.536 153.127 1.00 24.51  ? 267 ILE D O   1 
ATOM   9143  C  CB  . ILE D  1 246 ? 86.161  135.326 155.678 1.00 24.86  ? 267 ILE D CB  1 
ATOM   9144  C  CG1 . ILE D  1 246 ? 85.790  134.125 156.518 1.00 25.51  ? 267 ILE D CG1 1 
ATOM   9145  C  CG2 . ILE D  1 246 ? 86.210  136.586 156.503 1.00 24.56  ? 267 ILE D CG2 1 
ATOM   9146  C  CD1 . ILE D  1 246 ? 86.863  133.710 157.497 1.00 26.87  ? 267 ILE D CD1 1 
ATOM   9147  N  N   . SER D  1 247 ? 84.826  137.660 153.416 1.00 23.61  ? 268 SER D N   1 
ATOM   9148  C  CA  . SER D  1 247 ? 85.190  138.916 152.714 1.00 22.78  ? 268 SER D CA  1 
ATOM   9149  C  C   . SER D  1 247 ? 85.410  140.047 153.720 1.00 22.62  ? 268 SER D C   1 
ATOM   9150  O  O   . SER D  1 247 ? 84.444  140.432 154.414 1.00 21.90  ? 268 SER D O   1 
ATOM   9151  C  CB  . SER D  1 247 ? 84.140  139.331 151.752 1.00 22.80  ? 268 SER D CB  1 
ATOM   9152  O  OG  . SER D  1 247 ? 84.540  140.487 151.037 1.00 22.88  ? 268 SER D OG  1 
ATOM   9153  N  N   . ILE D  1 248 ? 86.611  140.625 153.712 1.00 22.51  ? 269 ILE D N   1 
ATOM   9154  C  CA  . ILE D  1 248 ? 86.944  141.751 154.607 1.00 22.44  ? 269 ILE D CA  1 
ATOM   9155  C  C   . ILE D  1 248 ? 87.242  143.016 153.799 1.00 22.21  ? 269 ILE D C   1 
ATOM   9156  O  O   . ILE D  1 248 ? 88.311  143.084 153.138 1.00 22.09  ? 269 ILE D O   1 
ATOM   9157  C  CB  . ILE D  1 248 ? 88.076  141.380 155.559 1.00 22.84  ? 269 ILE D CB  1 
ATOM   9158  C  CG1 . ILE D  1 248 ? 87.767  140.098 156.306 1.00 23.17  ? 269 ILE D CG1 1 
ATOM   9159  C  CG2 . ILE D  1 248 ? 88.296  142.556 156.485 1.00 22.79  ? 269 ILE D CG2 1 
ATOM   9160  C  CD1 . ILE D  1 248 ? 88.725  139.826 157.387 1.00 24.35  ? 269 ILE D CD1 1 
ATOM   9161  N  N   . ASP D  1 249 ? 86.298  143.964 153.861 1.00 21.77  ? 270 ASP D N   1 
ATOM   9162  C  CA  . ASP D  1 249 ? 86.490  145.371 153.451 1.00 22.19  ? 270 ASP D CA  1 
ATOM   9163  C  C   . ASP D  1 249 ? 87.199  145.992 154.661 1.00 23.08  ? 270 ASP D C   1 
ATOM   9164  O  O   . ASP D  1 249 ? 86.699  145.823 155.844 1.00 23.27  ? 270 ASP D O   1 
ATOM   9165  C  CB  . ASP D  1 249 ? 85.173  146.053 153.041 1.00 22.23  ? 270 ASP D CB  1 
ATOM   9166  C  CG  . ASP D  1 249 ? 85.236  147.527 152.615 1.00 22.52  ? 270 ASP D CG  1 
ATOM   9167  O  OD1 . ASP D  1 249 ? 86.268  148.168 152.899 1.00 22.19  ? 270 ASP D OD1 1 
ATOM   9168  O  OD2 . ASP D  1 249 ? 84.193  148.052 152.013 1.00 22.23  ? 270 ASP D OD2 1 
ATOM   9169  N  N   . VAL D  1 250 ? 88.352  146.590 154.396 1.00 23.47  ? 271 VAL D N   1 
ATOM   9170  C  CA  . VAL D  1 250 ? 89.194  147.223 155.436 1.00 24.94  ? 271 VAL D CA  1 
ATOM   9171  C  C   . VAL D  1 250 ? 88.392  148.311 156.167 1.00 24.27  ? 271 VAL D C   1 
ATOM   9172  O  O   . VAL D  1 250 ? 88.736  148.594 157.322 1.00 23.50  ? 271 VAL D O   1 
ATOM   9173  C  CB  . VAL D  1 250 ? 90.495  147.741 154.783 1.00 26.26  ? 271 VAL D CB  1 
ATOM   9174  C  CG1 . VAL D  1 250 ? 91.162  148.838 155.576 1.00 28.65  ? 271 VAL D CG1 1 
ATOM   9175  C  CG2 . VAL D  1 250 ? 91.445  146.603 154.615 1.00 26.58  ? 271 VAL D CG2 1 
ATOM   9176  N  N   . ASP D  1 251 ? 87.373  148.908 155.534 1.00 24.29  ? 272 ASP D N   1 
ATOM   9177  C  CA  . ASP D  1 251 ? 86.561  149.977 156.169 1.00 24.14  ? 272 ASP D CA  1 
ATOM   9178  C  C   . ASP D  1 251 ? 85.560  149.385 157.159 1.00 24.39  ? 272 ASP D C   1 
ATOM   9179  O  O   . ASP D  1 251 ? 84.810  150.186 157.807 1.00 25.33  ? 272 ASP D O   1 
ATOM   9180  C  CB  . ASP D  1 251 ? 85.922  150.869 155.131 1.00 25.01  ? 272 ASP D CB  1 
ATOM   9181  C  CG  . ASP D  1 251 ? 84.734  150.231 154.448 1.00 25.16  ? 272 ASP D CG  1 
ATOM   9182  O  OD1 . ASP D  1 251 ? 84.244  149.225 154.928 1.00 24.96  ? 272 ASP D OD1 1 
ATOM   9183  O  OD2 . ASP D  1 251 ? 84.366  150.719 153.406 1.00 27.88  ? 272 ASP D OD2 1 
ATOM   9184  N  N   . CYS D  1 252 ? 85.576  148.064 157.398 1.00 24.16  ? 273 CYS D N   1 
ATOM   9185  C  CA  . CYS D  1 252 ? 84.898  147.468 158.582 1.00 23.76  ? 273 CYS D CA  1 
ATOM   9186  C  C   . CYS D  1 252 ? 85.464  148.110 159.852 1.00 24.19  ? 273 CYS D C   1 
ATOM   9187  O  O   . CYS D  1 252 ? 84.690  148.310 160.836 1.00 24.20  ? 273 CYS D O   1 
ATOM   9188  C  CB  . CYS D  1 252 ? 84.955  145.939 158.607 1.00 23.66  ? 273 CYS D CB  1 
ATOM   9189  S  SG  . CYS D  1 252 ? 86.547  145.182 159.029 1.00 24.12  ? 273 CYS D SG  1 
ATOM   9190  N  N   . LEU D  1 253 ? 86.766  148.414 159.817 1.00 20.24  ? 274 LEU D N   1 
ATOM   9191  C  CA  . LEU D  1 253 ? 87.517  149.081 160.912 1.00 19.50  ? 274 LEU D CA  1 
ATOM   9192  C  C   . LEU D  1 253 ? 87.159  150.576 160.940 1.00 19.59  ? 274 LEU D C   1 
ATOM   9193  O  O   . LEU D  1 253 ? 86.995  151.218 159.880 1.00 18.97  ? 274 LEU D O   1 
ATOM   9194  C  CB  . LEU D  1 253 ? 89.001  148.898 160.675 1.00 19.31  ? 274 LEU D CB  1 
ATOM   9195  C  CG  . LEU D  1 253 ? 89.480  147.454 160.682 1.00 20.68  ? 274 LEU D CG  1 
ATOM   9196  C  CD1 . LEU D  1 253 ? 90.871  147.371 160.096 1.00 20.85  ? 274 LEU D CD1 1 
ATOM   9197  C  CD2 . LEU D  1 253 ? 89.533  146.899 162.097 1.00 21.45  ? 274 LEU D CD2 1 
ATOM   9198  N  N   . ASP D  1 254 ? 87.057  151.102 162.140 1.00 19.00  ? 275 ASP D N   1 
ATOM   9199  C  CA  . ASP D  1 254 ? 86.982  152.543 162.375 1.00 19.32  ? 275 ASP D CA  1 
ATOM   9200  C  C   . ASP D  1 254 ? 88.140  153.176 161.619 1.00 19.45  ? 275 ASP D C   1 
ATOM   9201  O  O   . ASP D  1 254 ? 89.249  152.659 161.565 1.00 17.40  ? 275 ASP D O   1 
ATOM   9202  C  CB  . ASP D  1 254 ? 87.040  152.874 163.860 1.00 19.28  ? 275 ASP D CB  1 
ATOM   9203  C  CG  . ASP D  1 254 ? 86.551  154.280 164.094 1.00 20.91  ? 275 ASP D CG  1 
ATOM   9204  O  OD1 . ASP D  1 254 ? 87.358  155.245 163.901 1.00 21.25  ? 275 ASP D OD1 1 
ATOM   9205  O  OD2 . ASP D  1 254 ? 85.315  154.415 164.338 1.00 22.96  ? 275 ASP D OD2 1 
ATOM   9206  N  N   . PRO D  1 255 ? 87.896  154.307 160.928 1.00 20.33  ? 276 PRO D N   1 
ATOM   9207  C  CA  . PRO D  1 255 ? 88.977  154.979 160.224 1.00 20.32  ? 276 PRO D CA  1 
ATOM   9208  C  C   . PRO D  1 255 ? 90.146  155.312 161.181 1.00 19.71  ? 276 PRO D C   1 
ATOM   9209  O  O   . PRO D  1 255 ? 91.192  155.535 160.685 1.00 18.88  ? 276 PRO D O   1 
ATOM   9210  C  CB  . PRO D  1 255 ? 88.298  156.204 159.594 1.00 21.13  ? 276 PRO D CB  1 
ATOM   9211  C  CG  . PRO D  1 255 ? 86.984  156.318 160.279 1.00 21.67  ? 276 PRO D CG  1 
ATOM   9212  C  CD  . PRO D  1 255 ? 86.595  154.922 160.697 1.00 21.01  ? 276 PRO D CD  1 
ATOM   9213  N  N   . ALA D  1 256 ? 89.963  155.319 162.514 1.00 19.11  ? 277 ALA D N   1 
ATOM   9214  C  CA  . ALA D  1 256 ? 91.101  155.550 163.434 1.00 18.91  ? 277 ALA D CA  1 
ATOM   9215  C  C   . ALA D  1 256 ? 92.159  154.477 163.168 1.00 18.30  ? 277 ALA D C   1 
ATOM   9216  O  O   . ALA D  1 256 ? 93.340  154.757 163.260 1.00 18.25  ? 277 ALA D O   1 
ATOM   9217  C  CB  . ALA D  1 256 ? 90.656  155.523 164.878 1.00 19.06  ? 277 ALA D CB  1 
ATOM   9218  N  N   . PHE D  1 257 ? 91.719  153.249 162.892 1.00 17.64  ? 278 PHE D N   1 
ATOM   9219  C  CA  . PHE D  1 257 ? 92.617  152.103 162.677 1.00 17.50  ? 278 PHE D CA  1 
ATOM   9220  C  C   . PHE D  1 257 ? 92.978  151.968 161.195 1.00 17.55  ? 278 PHE D C   1 
ATOM   9221  O  O   . PHE D  1 257 ? 94.076  151.519 160.901 1.00 17.47  ? 278 PHE D O   1 
ATOM   9222  C  CB  . PHE D  1 257 ? 91.999  150.814 163.209 1.00 17.22  ? 278 PHE D CB  1 
ATOM   9223  C  CG  . PHE D  1 257 ? 91.507  150.911 164.626 1.00 17.33  ? 278 PHE D CG  1 
ATOM   9224  C  CD1 . PHE D  1 257 ? 92.354  150.646 165.676 1.00 17.46  ? 278 PHE D CD1 1 
ATOM   9225  C  CD2 . PHE D  1 257 ? 90.192  151.209 164.907 1.00 17.51  ? 278 PHE D CD2 1 
ATOM   9226  C  CE1 . PHE D  1 257 ? 91.950  150.771 166.992 1.00 17.56  ? 278 PHE D CE1 1 
ATOM   9227  C  CE2 . PHE D  1 257 ? 89.774  151.263 166.234 1.00 18.38  ? 278 PHE D CE2 1 
ATOM   9228  C  CZ  . PHE D  1 257 ? 90.667  151.128 167.270 1.00 17.90  ? 278 PHE D CZ  1 
ATOM   9229  N  N   . ALA D  1 258 ? 92.092  152.349 160.303 1.00 17.93  ? 279 ALA D N   1 
ATOM   9230  C  CA  . ALA D  1 258 ? 92.217  152.084 158.858 1.00 19.07  ? 279 ALA D CA  1 
ATOM   9231  C  C   . ALA D  1 258 ? 91.822  153.342 158.091 1.00 19.79  ? 279 ALA D C   1 
ATOM   9232  O  O   . ALA D  1 258 ? 90.768  153.414 157.462 1.00 19.13  ? 279 ALA D O   1 
ATOM   9233  C  CB  . ALA D  1 258 ? 91.313  150.917 158.529 1.00 18.81  ? 279 ALA D CB  1 
ATOM   9234  N  N   . PRO D  1 259 ? 92.639  154.403 158.165 1.00 20.16  ? 280 PRO D N   1 
ATOM   9235  C  CA  . PRO D  1 259 ? 92.341  155.605 157.380 1.00 21.63  ? 280 PRO D CA  1 
ATOM   9236  C  C   . PRO D  1 259 ? 92.507  155.397 155.849 1.00 22.62  ? 280 PRO D C   1 
ATOM   9237  O  O   . PRO D  1 259 ? 91.945  156.158 155.138 1.00 24.95  ? 280 PRO D O   1 
ATOM   9238  C  CB  . PRO D  1 259 ? 93.365  156.624 157.924 1.00 21.42  ? 280 PRO D CB  1 
ATOM   9239  C  CG  . PRO D  1 259 ? 94.485  155.733 158.469 1.00 20.44  ? 280 PRO D CG  1 
ATOM   9240  C  CD  . PRO D  1 259 ? 93.835  154.505 158.997 1.00 19.20  ? 280 PRO D CD  1 
ATOM   9241  N  N   . GLY D  1 260 ? 93.257  154.389 155.391 1.00 22.65  ? 281 GLY D N   1 
ATOM   9242  C  CA  . GLY D  1 260 ? 93.562  154.130 153.963 1.00 22.93  ? 281 GLY D CA  1 
ATOM   9243  C  C   . GLY D  1 260 ? 92.432  153.410 153.255 1.00 23.05  ? 281 GLY D C   1 
ATOM   9244  O  O   . GLY D  1 260 ? 92.581  152.217 152.883 1.00 21.63  ? 281 GLY D O   1 
ATOM   9245  N  N   . VAL D  1 261 ? 91.323  154.136 153.088 1.00 23.11  ? 282 VAL D N   1 
ATOM   9246  C  CA  . VAL D  1 261 ? 90.061  153.641 152.475 1.00 22.91  ? 282 VAL D CA  1 
ATOM   9247  C  C   . VAL D  1 261 ? 89.435  154.791 151.700 1.00 23.16  ? 282 VAL D C   1 
ATOM   9248  O  O   . VAL D  1 261 ? 89.758  155.966 151.992 1.00 23.44  ? 282 VAL D O   1 
ATOM   9249  C  CB  . VAL D  1 261 ? 89.071  153.086 153.522 1.00 22.51  ? 282 VAL D CB  1 
ATOM   9250  C  CG1 . VAL D  1 261 ? 89.653  151.929 154.287 1.00 21.70  ? 282 VAL D CG1 1 
ATOM   9251  C  CG2 . VAL D  1 261 ? 88.625  154.172 154.487 1.00 22.87  ? 282 VAL D CG2 1 
ATOM   9252  N  N   . SER D  1 262 ? 88.637  154.435 150.701 1.00 23.28  ? 283 SER D N   1 
ATOM   9253  C  CA  . SER D  1 262 ? 87.961  155.405 149.821 1.00 24.44  ? 283 SER D CA  1 
ATOM   9254  C  C   . SER D  1 262 ? 86.755  155.971 150.567 1.00 24.92  ? 283 SER D C   1 
ATOM   9255  O  O   . SER D  1 262 ? 86.311  157.056 150.216 1.00 27.26  ? 283 SER D O   1 
ATOM   9256  C  CB  . SER D  1 262 ? 87.611  154.779 148.508 1.00 24.73  ? 283 SER D CB  1 
ATOM   9257  O  OG  . SER D  1 262 ? 88.785  154.328 147.831 1.00 24.27  ? 283 SER D OG  1 
ATOM   9258  N  N   . HIS D  1 263 ? 86.270  155.292 151.605 1.00 24.29  ? 284 HIS D N   1 
ATOM   9259  C  CA  . HIS D  1 263 ? 85.009  155.655 152.308 1.00 24.10  ? 284 HIS D CA  1 
ATOM   9260  C  C   . HIS D  1 263 ? 85.216  155.658 153.837 1.00 23.70  ? 284 HIS D C   1 
ATOM   9261  O  O   . HIS D  1 263 ? 85.033  154.606 154.472 1.00 24.16  ? 284 HIS D O   1 
ATOM   9262  C  CB  . HIS D  1 263 ? 83.914  154.681 151.877 1.00 24.08  ? 284 HIS D CB  1 
ATOM   9263  C  CG  . HIS D  1 263 ? 83.629  154.649 150.423 1.00 24.24  ? 284 HIS D CG  1 
ATOM   9264  N  ND1 . HIS D  1 263 ? 82.608  155.396 149.879 1.00 25.17  ? 284 HIS D ND1 1 
ATOM   9265  C  CD2 . HIS D  1 263 ? 84.227  153.963 149.423 1.00 24.29  ? 284 HIS D CD2 1 
ATOM   9266  C  CE1 . HIS D  1 263 ? 82.596  155.194 148.569 1.00 26.42  ? 284 HIS D CE1 1 
ATOM   9267  N  NE2 . HIS D  1 263 ? 83.599  154.299 148.256 1.00 25.97  ? 284 HIS D NE2 1 
ATOM   9268  N  N   . ILE D  1 264 ? 85.580  156.823 154.360 1.00 23.70  ? 285 ILE D N   1 
ATOM   9269  C  CA  . ILE D  1 264 ? 85.727  157.188 155.774 1.00 23.61  ? 285 ILE D CA  1 
ATOM   9270  C  C   . ILE D  1 264 ? 84.324  157.139 156.402 1.00 23.36  ? 285 ILE D C   1 
ATOM   9271  O  O   . ILE D  1 264 ? 83.447  157.910 156.055 1.00 23.80  ? 285 ILE D O   1 
ATOM   9272  C  CB  . ILE D  1 264 ? 86.413  158.562 155.942 1.00 24.26  ? 285 ILE D CB  1 
ATOM   9273  C  CG1 . ILE D  1 264 ? 87.731  158.683 155.194 1.00 25.27  ? 285 ILE D CG1 1 
ATOM   9274  C  CG2 . ILE D  1 264 ? 86