data_6VVT
# 
_entry.id   6VVT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.336 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6VVT         
WWPDB D_1000247041 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6VVT 
_pdbx_database_status.recvd_initial_deposition_date   2020-02-18 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lilic, M.'      1 ? 
'Darst, S.A.'    2 ? 
'Campbell, E.A.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            117 
_citation.language                  ? 
_citation.page_first                30423 
_citation.page_last                 30432 
_citation.title                     
'The antibiotic sorangicin A inhibits promoter DNA unwinding in a Mycobacterium tuberculosis rifampicin-resistant RNA polymerase.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.2013706117 
_citation.pdbx_database_id_PubMed   33199626 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lilic, M.'      1  ? 
primary 'Chen, J.'       2  ? 
primary 'Boyaci, H.'     3  ? 
primary 'Braffman, N.'   4  ? 
primary 'Hubin, E.A.'    5  ? 
primary 'Herrmann, J.'   6  ? 
primary 'Muller, R.'     7  ? 
primary 'Mooney, R.'     8  ? 
primary 'Landick, R.'    9  ? 
primary 'Darst, S.A.'    10 ? 
primary 'Campbell, E.A.' 11 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   111.360 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6VVT 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     129.217 
_cell.length_a_esd                 ? 
_cell.length_b                     162.212 
_cell.length_b_esd                 ? 
_cell.length_c                     136.295 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6VVT 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'RNA polymerase-binding protein RbpA'       13078.731  1  ?       ? ? ? 
2  polymer     nat 'DNA-directed RNA polymerase subunit alpha' 37959.441  2  2.7.7.6 ? ? ? 
3  polymer     nat 'DNA-directed RNA polymerase subunit beta'  128706.219 1  2.7.7.6 ? ? ? 
4  polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
146712.891 1  2.7.7.6 ? ? ? 
5  polymer     nat 'DNA-directed RNA polymerase subunit omega' 11544.763  1  2.7.7.6 ? ? ? 
6  polymer     man 'RNA polymerase sigma factor SigA'          51573.551  1  ?       ? ? ? 
7  polymer     syn 'DNA (31-MER)'                              9565.193   1  ?       ? ? ? 
8  polymer     syn 'DNA (26-MER)'                              7930.155   1  ?       ? ? ? 
9  non-polymer syn 'SORANGICIN A'                              807.020    1  ?       ? ? ? 
10 non-polymer syn 1,2-ETHANEDIOL                              62.068     1  ?       ? ? ? 
11 non-polymer syn 'ZINC ION'                                  65.409     2  ?       ? ? ? 
12 non-polymer syn 'SULFATE ION'                               96.063     9  ?       ? ? ? 
13 water       nat water                                       18.015     15 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
2 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha' 
3 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'    
4 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
5 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MADRVLRGSRLGAVSYETDRNHDLAPRQVARYRTDNGEEFDVPFADDAEIPGTWLCRNGLEGTLIEGDVPEPKKVKPPRT
HWDMLLERRSVEELEELLKERLDLIKAKRRGTGS
;
;MADRVLRGSRLGAVSYETDRNHDLAPRQVARYRTDNGEEFDVPFADDAEIPGTWLCRNGLEGTLIEGDVPEPKKVKPPRT
HWDMLLERRSVEELEELLKERLDLIKAKRRGTGS
;
J   ? 
2 'polypeptide(L)'        no no 
;MLISQRPTLSEETVAENRSRFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTDIILNL
KGLVVSSDDDEPVTMYLRKQGPGVVTAGDIVPPAGVTVHNPDMHIATLNDKGKLEVELVVERGRGYVPAVQNKASGAEIG
RIPVDSIYSPVLKVTYKVEATRVEQRTDFDKLIIDVETKNSISPRDALASAGGTLVELFGLARELNADSEHIEIGPSPAE
ADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPATFDPSEV
AGYDAATGTWTSDAGYDLDDNQDYAETEQL
;
;MLISQRPTLSEETVAENRSRFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTDIILNL
KGLVVSSDDDEPVTMYLRKQGPGVVTAGDIVPPAGVTVHNPDMHIATLNDKGKLEVELVVERGRGYVPAVQNKASGAEIG
RIPVDSIYSPVLKVTYKVEATRVEQRTDFDKLIIDVETKNSISPRDALASAGGTLVELFGLARELNADSEHIEIGPSPAE
ADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPATFDPSEV
AGYDAATGTWTSDAGYDLDDNQDYAETEQL
;
A,B ? 
3 'polypeptide(L)'        no no 
;MLEGCILAVSSQSKSNAITNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLVGSDRWRQAAIDRGEENPVGGLEEV
LAELSPIEDFSGSMSLSFSDPRFDEVKASVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMMTEKGTFIIN
GTERVVVSQLVRSPGVYFDETIDKSTEKTLHSVKVIPGRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKALGWTNEQIV
ERFGFSEIMMGTLEKDTTSGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNAGKPIT
SSTLTEEDVVATIEYLVRLHEGQTSMTVPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQDV
EAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLLALGPGGLSRERAGLEVRDVHPSHYGRMCPIETP
EGPNIGLIGSLSVYARVNPFGFIETPYRKVENGVVTDQIDYLTADEEDRHVVAQANSPTDENGRFTEDRVMVRKKGGEVE
FVSADQVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVADKTGV
IEEVSADYITVMADDGTRQSYRLRKFARSNHGTCANQRPIVDAGQRVEAGQVIADGPCTQNGEMALGKNLLVAIMPWEGH
NYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPK
GETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRH
GNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLGWVAKAGWNIDVAAGVPDWASKLPEELYSAPAD
STVATPVFDGAQEGELAGLLGSTLPNRDGEVMVDADGKSTLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPY
SMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQ
SLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNESASVEDLA
;
;MLEGCILAVSSQSKSNAITNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLVGSDRWRQAAIDRGEENPVGGLEEV
LAELSPIEDFSGSMSLSFSDPRFDEVKASVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMMTEKGTFIIN
GTERVVVSQLVRSPGVYFDETIDKSTEKTLHSVKVIPGRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKALGWTNEQIV
ERFGFSEIMMGTLEKDTTSGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNAGKPIT
SSTLTEEDVVATIEYLVRLHEGQTSMTVPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQDV
EAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLLALGPGGLSRERAGLEVRDVHPSHYGRMCPIETP
EGPNIGLIGSLSVYARVNPFGFIETPYRKVENGVVTDQIDYLTADEEDRHVVAQANSPTDENGRFTEDRVMVRKKGGEVE
FVSADQVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVADKTGV
IEEVSADYITVMADDGTRQSYRLRKFARSNHGTCANQRPIVDAGQRVEAGQVIADGPCTQNGEMALGKNLLVAIMPWEGH
NYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPK
GETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRH
GNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLGWVAKAGWNIDVAAGVPDWASKLPEELYSAPAD
STVATPVFDGAQEGELAGLLGSTLPNRDGEVMVDADGKSTLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPY
SMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQ
SLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNESASVEDLA
;
C   ? 
4 'polypeptide(L)'        no no 
;MLDVNFFDELRIGLATADDIRNWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDDEMRHNELSTLEAEMAVEKK
AVEDQRDADLEARAQKLEADLAELEAEGAKSDVRRKVRDSGEREMRQLRDRAQRELDRLDEIWNTFTKLAPKQLIVDEVL
YRELQDRYGEYFTGAMGAESIKKLIENFDIDAEAESLREVIRSGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPQLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGKPLAMPRLDMVTGLYYLTTLVEGATGEYQAATKDAPEQGVYSSPAEAIMAMDRGALSVRAKIKVRLTEL
RPPTDLEAQLFENGWKPGDAWTAETTLGRVMFNELLPKSYPFVNEQMHKKVQARIINDLAERFPMIVVAQTVDKLKDAGF
YWATRSGVTVSMADVLVPPQKQEILERHEAEADAIERKYQRGALNHTERNESLVKIWQDATEEVGKALEEFYPADNPIIT
IVKSGATGNLTQTRTLAGMKGLVTNPKGEFIPRPIKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDVS
QDVIVREHDCETERGINVTLAERGPDGTLIRDAHVETSAFARTLATDAVDANGNVIIERGHDLGDPAIDALLAAGITTVK
VRSVLTCTSATGVCAMCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVTGGADIVGGLPRVQELFEARV
PRNKAPIADVAGRVRLEESDKFFKITIVPDDGGEEVVYDKLSKRQRLRVITHEDGTEGVLSDGDHVEVGDQLMEGAADPH
EVLRVQGPREVQIHLVKEVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLTERAEFEAENRRVVAEGGE
PAAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGISRYRNIQVQPTEEAR
AAAYTIPSYEDQYYSPDFGQATGAAVPLDDYGYSDYR
;
;MLDVNFFDELRIGLATADDIRNWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDDEMRHNELSTLEAEMAVEKK
AVEDQRDADLEARAQKLEADLAELEAEGAKSDVRRKVRDSGEREMRQLRDRAQRELDRLDEIWNTFTKLAPKQLIVDEVL
YRELQDRYGEYFTGAMGAESIKKLIENFDIDAEAESLREVIRSGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPQLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGKPLAMPRLDMVTGLYYLTTLVEGATGEYQAATKDAPEQGVYSSPAEAIMAMDRGALSVRAKIKVRLTEL
RPPTDLEAQLFENGWKPGDAWTAETTLGRVMFNELLPKSYPFVNEQMHKKVQARIINDLAERFPMIVVAQTVDKLKDAGF
YWATRSGVTVSMADVLVPPQKQEILERHEAEADAIERKYQRGALNHTERNESLVKIWQDATEEVGKALEEFYPADNPIIT
IVKSGATGNLTQTRTLAGMKGLVTNPKGEFIPRPIKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDVS
QDVIVREHDCETERGINVTLAERGPDGTLIRDAHVETSAFARTLATDAVDANGNVIIERGHDLGDPAIDALLAAGITTVK
VRSVLTCTSATGVCAMCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVTGGADIVGGLPRVQELFEARV
PRNKAPIADVAGRVRLEESDKFFKITIVPDDGGEEVVYDKLSKRQRLRVITHEDGTEGVLSDGDHVEVGDQLMEGAADPH
EVLRVQGPREVQIHLVKEVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLTERAEFEAENRRVVAEGGE
PAAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGISRYRNIQVQPTEEAR
AAAYTIPSYEDQYYSPDFGQATGAAVPLDDYGYSDYR
;
D   ? 
5 'polypeptide(L)'        no no 
;MSTPHADAQLNAADDLGIDSSAASAYDTPLGITNPPIDELLSRASSKYALVIYAAKRARQINDYYNQLGDGILEYVGPLV
EPGLQEKPLSIALREIHGDLLEHTEGE
;
;MSTPHADAQLNAADDLGIDSSAASAYDTPLGITNPPIDELLSRASSKYALVIYAAKRARQINDYYNQLGDGILEYVGPLV
EPGLQEKPLSIALREIHGDLLEHTEGE
;
E   ? 
6 'polypeptide(L)'        no no 
;MAATKASPATEEPVKRTATKTPAKKAPAKRAAKSAAAKAGGKAPAKKAPAKRAAKGTAAKPEDGVTDDLEVTDDLEAEPG
EDLDVEDTDLELDDLDSDDDTAVEDEEEEADAATPAVATAKAADDDIDEPSEKDKASGDFVWDEEESEALRQARKDAELT
ASADSVRAYLKQIGKVALLNAEEEVELAKRIEAGLYATQKLAELAEKGEKLPVQQRRDMQWICRDGDRAKNHLLEANLRL
VVSLAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRI
QRELLQDLGREPTPEELAKEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQS
VLETLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD
;
;MAATKASPATEEPVKRTATKTPAKKAPAKRAAKSAAAKAGGKAPAKKAPAKRAAKGTAAKPEDGVTDDLEVTDDLEAEPG
EDLDVEDTDLELDDLDSDDDTAVEDEEEEADAATPAVATAKAADDDIDEPSEKDKASGDFVWDEEESEALRQARKDAELT
ASADSVRAYLKQIGKVALLNAEEEVELAKRIEAGLYATQKLAELAEKGEKLPVQQRRDMQWICRDGDRAKNHLLEANLRL
VVSLAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRI
QRELLQDLGREPTPEELAKEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQS
VLETLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD
;
F   ? 
7 polydeoxyribonucleotide no no 
;(DG)(DC)(DT)(DT)(DG)(DA)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DT)(DA)(DA)(DA)(DT)
(DT)(DG)(DT)(DG)(DC)(DT)(DA)(DT)(DA)(DC)(DT)
;
GCTTGACAAAAGTGTTAAATTGTGCTATACT O   ? 
8 polydeoxyribonucleotide no no 
;(DA)(DG)(DC)(DA)(DC)(DA)(DA)(DT)(DT)(DT)(DA)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DT)(DC)(DA)(DA)(DG)(DC)
;
AGCACAATTTAACACTTTTGTCAAGC P   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    ALA n 
1 3    ASP n 
1 4    ARG n 
1 5    VAL n 
1 6    LEU n 
1 7    ARG n 
1 8    GLY n 
1 9    SER n 
1 10   ARG n 
1 11   LEU n 
1 12   GLY n 
1 13   ALA n 
1 14   VAL n 
1 15   SER n 
1 16   TYR n 
1 17   GLU n 
1 18   THR n 
1 19   ASP n 
1 20   ARG n 
1 21   ASN n 
1 22   HIS n 
1 23   ASP n 
1 24   LEU n 
1 25   ALA n 
1 26   PRO n 
1 27   ARG n 
1 28   GLN n 
1 29   VAL n 
1 30   ALA n 
1 31   ARG n 
1 32   TYR n 
1 33   ARG n 
1 34   THR n 
1 35   ASP n 
1 36   ASN n 
1 37   GLY n 
1 38   GLU n 
1 39   GLU n 
1 40   PHE n 
1 41   ASP n 
1 42   VAL n 
1 43   PRO n 
1 44   PHE n 
1 45   ALA n 
1 46   ASP n 
1 47   ASP n 
1 48   ALA n 
1 49   GLU n 
1 50   ILE n 
1 51   PRO n 
1 52   GLY n 
1 53   THR n 
1 54   TRP n 
1 55   LEU n 
1 56   CYS n 
1 57   ARG n 
1 58   ASN n 
1 59   GLY n 
1 60   LEU n 
1 61   GLU n 
1 62   GLY n 
1 63   THR n 
1 64   LEU n 
1 65   ILE n 
1 66   GLU n 
1 67   GLY n 
1 68   ASP n 
1 69   VAL n 
1 70   PRO n 
1 71   GLU n 
1 72   PRO n 
1 73   LYS n 
1 74   LYS n 
1 75   VAL n 
1 76   LYS n 
1 77   PRO n 
1 78   PRO n 
1 79   ARG n 
1 80   THR n 
1 81   HIS n 
1 82   TRP n 
1 83   ASP n 
1 84   MET n 
1 85   LEU n 
1 86   LEU n 
1 87   GLU n 
1 88   ARG n 
1 89   ARG n 
1 90   SER n 
1 91   VAL n 
1 92   GLU n 
1 93   GLU n 
1 94   LEU n 
1 95   GLU n 
1 96   GLU n 
1 97   LEU n 
1 98   LEU n 
1 99   LYS n 
1 100  GLU n 
1 101  ARG n 
1 102  LEU n 
1 103  ASP n 
1 104  LEU n 
1 105  ILE n 
1 106  LYS n 
1 107  ALA n 
1 108  LYS n 
1 109  ARG n 
1 110  ARG n 
1 111  GLY n 
1 112  THR n 
1 113  GLY n 
1 114  SER n 
2 1    MET n 
2 2    LEU n 
2 3    ILE n 
2 4    SER n 
2 5    GLN n 
2 6    ARG n 
2 7    PRO n 
2 8    THR n 
2 9    LEU n 
2 10   SER n 
2 11   GLU n 
2 12   GLU n 
2 13   THR n 
2 14   VAL n 
2 15   ALA n 
2 16   GLU n 
2 17   ASN n 
2 18   ARG n 
2 19   SER n 
2 20   ARG n 
2 21   PHE n 
2 22   VAL n 
2 23   ILE n 
2 24   GLU n 
2 25   PRO n 
2 26   LEU n 
2 27   GLU n 
2 28   PRO n 
2 29   GLY n 
2 30   PHE n 
2 31   GLY n 
2 32   TYR n 
2 33   THR n 
2 34   LEU n 
2 35   GLY n 
2 36   ASN n 
2 37   SER n 
2 38   LEU n 
2 39   ARG n 
2 40   ARG n 
2 41   THR n 
2 42   LEU n 
2 43   LEU n 
2 44   SER n 
2 45   SER n 
2 46   ILE n 
2 47   PRO n 
2 48   GLY n 
2 49   ALA n 
2 50   ALA n 
2 51   VAL n 
2 52   THR n 
2 53   SER n 
2 54   ILE n 
2 55   ARG n 
2 56   ILE n 
2 57   ASP n 
2 58   GLY n 
2 59   VAL n 
2 60   LEU n 
2 61   HIS n 
2 62   GLU n 
2 63   PHE n 
2 64   THR n 
2 65   THR n 
2 66   VAL n 
2 67   PRO n 
2 68   GLY n 
2 69   VAL n 
2 70   LYS n 
2 71   GLU n 
2 72   ASP n 
2 73   VAL n 
2 74   THR n 
2 75   ASP n 
2 76   ILE n 
2 77   ILE n 
2 78   LEU n 
2 79   ASN n 
2 80   LEU n 
2 81   LYS n 
2 82   GLY n 
2 83   LEU n 
2 84   VAL n 
2 85   VAL n 
2 86   SER n 
2 87   SER n 
2 88   ASP n 
2 89   ASP n 
2 90   ASP n 
2 91   GLU n 
2 92   PRO n 
2 93   VAL n 
2 94   THR n 
2 95   MET n 
2 96   TYR n 
2 97   LEU n 
2 98   ARG n 
2 99   LYS n 
2 100  GLN n 
2 101  GLY n 
2 102  PRO n 
2 103  GLY n 
2 104  VAL n 
2 105  VAL n 
2 106  THR n 
2 107  ALA n 
2 108  GLY n 
2 109  ASP n 
2 110  ILE n 
2 111  VAL n 
2 112  PRO n 
2 113  PRO n 
2 114  ALA n 
2 115  GLY n 
2 116  VAL n 
2 117  THR n 
2 118  VAL n 
2 119  HIS n 
2 120  ASN n 
2 121  PRO n 
2 122  ASP n 
2 123  MET n 
2 124  HIS n 
2 125  ILE n 
2 126  ALA n 
2 127  THR n 
2 128  LEU n 
2 129  ASN n 
2 130  ASP n 
2 131  LYS n 
2 132  GLY n 
2 133  LYS n 
2 134  LEU n 
2 135  GLU n 
2 136  VAL n 
2 137  GLU n 
2 138  LEU n 
2 139  VAL n 
2 140  VAL n 
2 141  GLU n 
2 142  ARG n 
2 143  GLY n 
2 144  ARG n 
2 145  GLY n 
2 146  TYR n 
2 147  VAL n 
2 148  PRO n 
2 149  ALA n 
2 150  VAL n 
2 151  GLN n 
2 152  ASN n 
2 153  LYS n 
2 154  ALA n 
2 155  SER n 
2 156  GLY n 
2 157  ALA n 
2 158  GLU n 
2 159  ILE n 
2 160  GLY n 
2 161  ARG n 
2 162  ILE n 
2 163  PRO n 
2 164  VAL n 
2 165  ASP n 
2 166  SER n 
2 167  ILE n 
2 168  TYR n 
2 169  SER n 
2 170  PRO n 
2 171  VAL n 
2 172  LEU n 
2 173  LYS n 
2 174  VAL n 
2 175  THR n 
2 176  TYR n 
2 177  LYS n 
2 178  VAL n 
2 179  GLU n 
2 180  ALA n 
2 181  THR n 
2 182  ARG n 
2 183  VAL n 
2 184  GLU n 
2 185  GLN n 
2 186  ARG n 
2 187  THR n 
2 188  ASP n 
2 189  PHE n 
2 190  ASP n 
2 191  LYS n 
2 192  LEU n 
2 193  ILE n 
2 194  ILE n 
2 195  ASP n 
2 196  VAL n 
2 197  GLU n 
2 198  THR n 
2 199  LYS n 
2 200  ASN n 
2 201  SER n 
2 202  ILE n 
2 203  SER n 
2 204  PRO n 
2 205  ARG n 
2 206  ASP n 
2 207  ALA n 
2 208  LEU n 
2 209  ALA n 
2 210  SER n 
2 211  ALA n 
2 212  GLY n 
2 213  GLY n 
2 214  THR n 
2 215  LEU n 
2 216  VAL n 
2 217  GLU n 
2 218  LEU n 
2 219  PHE n 
2 220  GLY n 
2 221  LEU n 
2 222  ALA n 
2 223  ARG n 
2 224  GLU n 
2 225  LEU n 
2 226  ASN n 
2 227  ALA n 
2 228  ASP n 
2 229  SER n 
2 230  GLU n 
2 231  HIS n 
2 232  ILE n 
2 233  GLU n 
2 234  ILE n 
2 235  GLY n 
2 236  PRO n 
2 237  SER n 
2 238  PRO n 
2 239  ALA n 
2 240  GLU n 
2 241  ALA n 
2 242  ASP n 
2 243  HIS n 
2 244  ILE n 
2 245  ALA n 
2 246  SER n 
2 247  PHE n 
2 248  ALA n 
2 249  LEU n 
2 250  PRO n 
2 251  ILE n 
2 252  ASP n 
2 253  ASP n 
2 254  LEU n 
2 255  ASP n 
2 256  LEU n 
2 257  THR n 
2 258  VAL n 
2 259  ARG n 
2 260  SER n 
2 261  TYR n 
2 262  ASN n 
2 263  CYS n 
2 264  LEU n 
2 265  LYS n 
2 266  ARG n 
2 267  GLU n 
2 268  GLY n 
2 269  VAL n 
2 270  HIS n 
2 271  THR n 
2 272  VAL n 
2 273  GLY n 
2 274  GLU n 
2 275  LEU n 
2 276  VAL n 
2 277  ALA n 
2 278  ARG n 
2 279  THR n 
2 280  GLU n 
2 281  SER n 
2 282  ASP n 
2 283  LEU n 
2 284  LEU n 
2 285  ASP n 
2 286  ILE n 
2 287  ARG n 
2 288  ASN n 
2 289  PHE n 
2 290  GLY n 
2 291  GLN n 
2 292  LYS n 
2 293  SER n 
2 294  ILE n 
2 295  ASP n 
2 296  GLU n 
2 297  VAL n 
2 298  LYS n 
2 299  ILE n 
2 300  LYS n 
2 301  LEU n 
2 302  HIS n 
2 303  GLN n 
2 304  LEU n 
2 305  GLY n 
2 306  LEU n 
2 307  SER n 
2 308  LEU n 
2 309  LYS n 
2 310  ASP n 
2 311  SER n 
2 312  PRO n 
2 313  ALA n 
2 314  THR n 
2 315  PHE n 
2 316  ASP n 
2 317  PRO n 
2 318  SER n 
2 319  GLU n 
2 320  VAL n 
2 321  ALA n 
2 322  GLY n 
2 323  TYR n 
2 324  ASP n 
2 325  ALA n 
2 326  ALA n 
2 327  THR n 
2 328  GLY n 
2 329  THR n 
2 330  TRP n 
2 331  THR n 
2 332  SER n 
2 333  ASP n 
2 334  ALA n 
2 335  GLY n 
2 336  TYR n 
2 337  ASP n 
2 338  LEU n 
2 339  ASP n 
2 340  ASP n 
2 341  ASN n 
2 342  GLN n 
2 343  ASP n 
2 344  TYR n 
2 345  ALA n 
2 346  GLU n 
2 347  THR n 
2 348  GLU n 
2 349  GLN n 
2 350  LEU n 
3 1    MET n 
3 2    LEU n 
3 3    GLU n 
3 4    GLY n 
3 5    CYS n 
3 6    ILE n 
3 7    LEU n 
3 8    ALA n 
3 9    VAL n 
3 10   SER n 
3 11   SER n 
3 12   GLN n 
3 13   SER n 
3 14   LYS n 
3 15   SER n 
3 16   ASN n 
3 17   ALA n 
3 18   ILE n 
3 19   THR n 
3 20   ASN n 
3 21   ASN n 
3 22   SER n 
3 23   VAL n 
3 24   PRO n 
3 25   GLY n 
3 26   ALA n 
3 27   PRO n 
3 28   ASN n 
3 29   ARG n 
3 30   VAL n 
3 31   SER n 
3 32   PHE n 
3 33   ALA n 
3 34   LYS n 
3 35   LEU n 
3 36   ARG n 
3 37   GLU n 
3 38   PRO n 
3 39   LEU n 
3 40   GLU n 
3 41   VAL n 
3 42   PRO n 
3 43   GLY n 
3 44   LEU n 
3 45   LEU n 
3 46   ASP n 
3 47   VAL n 
3 48   GLN n 
3 49   THR n 
3 50   ASP n 
3 51   SER n 
3 52   PHE n 
3 53   GLU n 
3 54   TRP n 
3 55   LEU n 
3 56   VAL n 
3 57   GLY n 
3 58   SER n 
3 59   ASP n 
3 60   ARG n 
3 61   TRP n 
3 62   ARG n 
3 63   GLN n 
3 64   ALA n 
3 65   ALA n 
3 66   ILE n 
3 67   ASP n 
3 68   ARG n 
3 69   GLY n 
3 70   GLU n 
3 71   GLU n 
3 72   ASN n 
3 73   PRO n 
3 74   VAL n 
3 75   GLY n 
3 76   GLY n 
3 77   LEU n 
3 78   GLU n 
3 79   GLU n 
3 80   VAL n 
3 81   LEU n 
3 82   ALA n 
3 83   GLU n 
3 84   LEU n 
3 85   SER n 
3 86   PRO n 
3 87   ILE n 
3 88   GLU n 
3 89   ASP n 
3 90   PHE n 
3 91   SER n 
3 92   GLY n 
3 93   SER n 
3 94   MET n 
3 95   SER n 
3 96   LEU n 
3 97   SER n 
3 98   PHE n 
3 99   SER n 
3 100  ASP n 
3 101  PRO n 
3 102  ARG n 
3 103  PHE n 
3 104  ASP n 
3 105  GLU n 
3 106  VAL n 
3 107  LYS n 
3 108  ALA n 
3 109  SER n 
3 110  VAL n 
3 111  ASP n 
3 112  GLU n 
3 113  CYS n 
3 114  LYS n 
3 115  ASP n 
3 116  LYS n 
3 117  ASP n 
3 118  MET n 
3 119  THR n 
3 120  TYR n 
3 121  ALA n 
3 122  ALA n 
3 123  PRO n 
3 124  LEU n 
3 125  PHE n 
3 126  VAL n 
3 127  THR n 
3 128  ALA n 
3 129  GLU n 
3 130  PHE n 
3 131  ILE n 
3 132  ASN n 
3 133  ASN n 
3 134  ASN n 
3 135  THR n 
3 136  GLY n 
3 137  GLU n 
3 138  ILE n 
3 139  LYS n 
3 140  SER n 
3 141  GLN n 
3 142  THR n 
3 143  VAL n 
3 144  PHE n 
3 145  MET n 
3 146  GLY n 
3 147  ASP n 
3 148  PHE n 
3 149  PRO n 
3 150  MET n 
3 151  MET n 
3 152  THR n 
3 153  GLU n 
3 154  LYS n 
3 155  GLY n 
3 156  THR n 
3 157  PHE n 
3 158  ILE n 
3 159  ILE n 
3 160  ASN n 
3 161  GLY n 
3 162  THR n 
3 163  GLU n 
3 164  ARG n 
3 165  VAL n 
3 166  VAL n 
3 167  VAL n 
3 168  SER n 
3 169  GLN n 
3 170  LEU n 
3 171  VAL n 
3 172  ARG n 
3 173  SER n 
3 174  PRO n 
3 175  GLY n 
3 176  VAL n 
3 177  TYR n 
3 178  PHE n 
3 179  ASP n 
3 180  GLU n 
3 181  THR n 
3 182  ILE n 
3 183  ASP n 
3 184  LYS n 
3 185  SER n 
3 186  THR n 
3 187  GLU n 
3 188  LYS n 
3 189  THR n 
3 190  LEU n 
3 191  HIS n 
3 192  SER n 
3 193  VAL n 
3 194  LYS n 
3 195  VAL n 
3 196  ILE n 
3 197  PRO n 
3 198  GLY n 
3 199  ARG n 
3 200  GLY n 
3 201  ALA n 
3 202  TRP n 
3 203  LEU n 
3 204  GLU n 
3 205  PHE n 
3 206  ASP n 
3 207  VAL n 
3 208  ASP n 
3 209  LYS n 
3 210  ARG n 
3 211  ASP n 
3 212  THR n 
3 213  VAL n 
3 214  GLY n 
3 215  VAL n 
3 216  ARG n 
3 217  ILE n 
3 218  ASP n 
3 219  ARG n 
3 220  LYS n 
3 221  ARG n 
3 222  ARG n 
3 223  GLN n 
3 224  PRO n 
3 225  VAL n 
3 226  THR n 
3 227  VAL n 
3 228  LEU n 
3 229  LEU n 
3 230  LYS n 
3 231  ALA n 
3 232  LEU n 
3 233  GLY n 
3 234  TRP n 
3 235  THR n 
3 236  ASN n 
3 237  GLU n 
3 238  GLN n 
3 239  ILE n 
3 240  VAL n 
3 241  GLU n 
3 242  ARG n 
3 243  PHE n 
3 244  GLY n 
3 245  PHE n 
3 246  SER n 
3 247  GLU n 
3 248  ILE n 
3 249  MET n 
3 250  MET n 
3 251  GLY n 
3 252  THR n 
3 253  LEU n 
3 254  GLU n 
3 255  LYS n 
3 256  ASP n 
3 257  THR n 
3 258  THR n 
3 259  SER n 
3 260  GLY n 
3 261  THR n 
3 262  ASP n 
3 263  GLU n 
3 264  ALA n 
3 265  LEU n 
3 266  LEU n 
3 267  ASP n 
3 268  ILE n 
3 269  TYR n 
3 270  ARG n 
3 271  LYS n 
3 272  LEU n 
3 273  ARG n 
3 274  PRO n 
3 275  GLY n 
3 276  GLU n 
3 277  PRO n 
3 278  PRO n 
3 279  THR n 
3 280  LYS n 
3 281  GLU n 
3 282  SER n 
3 283  ALA n 
3 284  GLN n 
3 285  THR n 
3 286  LEU n 
3 287  LEU n 
3 288  GLU n 
3 289  ASN n 
3 290  LEU n 
3 291  PHE n 
3 292  PHE n 
3 293  LYS n 
3 294  GLU n 
3 295  LYS n 
3 296  ARG n 
3 297  TYR n 
3 298  ASP n 
3 299  LEU n 
3 300  ALA n 
3 301  ARG n 
3 302  VAL n 
3 303  GLY n 
3 304  ARG n 
3 305  TYR n 
3 306  LYS n 
3 307  VAL n 
3 308  ASN n 
3 309  LYS n 
3 310  LYS n 
3 311  LEU n 
3 312  GLY n 
3 313  LEU n 
3 314  ASN n 
3 315  ALA n 
3 316  GLY n 
3 317  LYS n 
3 318  PRO n 
3 319  ILE n 
3 320  THR n 
3 321  SER n 
3 322  SER n 
3 323  THR n 
3 324  LEU n 
3 325  THR n 
3 326  GLU n 
3 327  GLU n 
3 328  ASP n 
3 329  VAL n 
3 330  VAL n 
3 331  ALA n 
3 332  THR n 
3 333  ILE n 
3 334  GLU n 
3 335  TYR n 
3 336  LEU n 
3 337  VAL n 
3 338  ARG n 
3 339  LEU n 
3 340  HIS n 
3 341  GLU n 
3 342  GLY n 
3 343  GLN n 
3 344  THR n 
3 345  SER n 
3 346  MET n 
3 347  THR n 
3 348  VAL n 
3 349  PRO n 
3 350  GLY n 
3 351  GLY n 
3 352  VAL n 
3 353  GLU n 
3 354  VAL n 
3 355  PRO n 
3 356  VAL n 
3 357  GLU n 
3 358  VAL n 
3 359  ASP n 
3 360  ASP n 
3 361  ILE n 
3 362  ASP n 
3 363  HIS n 
3 364  PHE n 
3 365  GLY n 
3 366  ASN n 
3 367  ARG n 
3 368  ARG n 
3 369  LEU n 
3 370  ARG n 
3 371  THR n 
3 372  VAL n 
3 373  GLY n 
3 374  GLU n 
3 375  LEU n 
3 376  ILE n 
3 377  GLN n 
3 378  ASN n 
3 379  GLN n 
3 380  ILE n 
3 381  ARG n 
3 382  VAL n 
3 383  GLY n 
3 384  LEU n 
3 385  SER n 
3 386  ARG n 
3 387  MET n 
3 388  GLU n 
3 389  ARG n 
3 390  VAL n 
3 391  VAL n 
3 392  ARG n 
3 393  GLU n 
3 394  ARG n 
3 395  MET n 
3 396  THR n 
3 397  THR n 
3 398  GLN n 
3 399  ASP n 
3 400  VAL n 
3 401  GLU n 
3 402  ALA n 
3 403  ILE n 
3 404  THR n 
3 405  PRO n 
3 406  GLN n 
3 407  THR n 
3 408  LEU n 
3 409  ILE n 
3 410  ASN n 
3 411  ILE n 
3 412  ARG n 
3 413  PRO n 
3 414  VAL n 
3 415  VAL n 
3 416  ALA n 
3 417  ALA n 
3 418  ILE n 
3 419  LYS n 
3 420  GLU n 
3 421  PHE n 
3 422  PHE n 
3 423  GLY n 
3 424  THR n 
3 425  SER n 
3 426  GLN n 
3 427  LEU n 
3 428  SER n 
3 429  GLN n 
3 430  PHE n 
3 431  MET n 
3 432  ASP n 
3 433  GLN n 
3 434  ASN n 
3 435  ASN n 
3 436  PRO n 
3 437  LEU n 
3 438  SER n 
3 439  GLY n 
3 440  LEU n 
3 441  THR n 
3 442  HIS n 
3 443  LYS n 
3 444  ARG n 
3 445  ARG n 
3 446  LEU n 
3 447  LEU n 
3 448  ALA n 
3 449  LEU n 
3 450  GLY n 
3 451  PRO n 
3 452  GLY n 
3 453  GLY n 
3 454  LEU n 
3 455  SER n 
3 456  ARG n 
3 457  GLU n 
3 458  ARG n 
3 459  ALA n 
3 460  GLY n 
3 461  LEU n 
3 462  GLU n 
3 463  VAL n 
3 464  ARG n 
3 465  ASP n 
3 466  VAL n 
3 467  HIS n 
3 468  PRO n 
3 469  SER n 
3 470  HIS n 
3 471  TYR n 
3 472  GLY n 
3 473  ARG n 
3 474  MET n 
3 475  CYS n 
3 476  PRO n 
3 477  ILE n 
3 478  GLU n 
3 479  THR n 
3 480  PRO n 
3 481  GLU n 
3 482  GLY n 
3 483  PRO n 
3 484  ASN n 
3 485  ILE n 
3 486  GLY n 
3 487  LEU n 
3 488  ILE n 
3 489  GLY n 
3 490  SER n 
3 491  LEU n 
3 492  SER n 
3 493  VAL n 
3 494  TYR n 
3 495  ALA n 
3 496  ARG n 
3 497  VAL n 
3 498  ASN n 
3 499  PRO n 
3 500  PHE n 
3 501  GLY n 
3 502  PHE n 
3 503  ILE n 
3 504  GLU n 
3 505  THR n 
3 506  PRO n 
3 507  TYR n 
3 508  ARG n 
3 509  LYS n 
3 510  VAL n 
3 511  GLU n 
3 512  ASN n 
3 513  GLY n 
3 514  VAL n 
3 515  VAL n 
3 516  THR n 
3 517  ASP n 
3 518  GLN n 
3 519  ILE n 
3 520  ASP n 
3 521  TYR n 
3 522  LEU n 
3 523  THR n 
3 524  ALA n 
3 525  ASP n 
3 526  GLU n 
3 527  GLU n 
3 528  ASP n 
3 529  ARG n 
3 530  HIS n 
3 531  VAL n 
3 532  VAL n 
3 533  ALA n 
3 534  GLN n 
3 535  ALA n 
3 536  ASN n 
3 537  SER n 
3 538  PRO n 
3 539  THR n 
3 540  ASP n 
3 541  GLU n 
3 542  ASN n 
3 543  GLY n 
3 544  ARG n 
3 545  PHE n 
3 546  THR n 
3 547  GLU n 
3 548  ASP n 
3 549  ARG n 
3 550  VAL n 
3 551  MET n 
3 552  VAL n 
3 553  ARG n 
3 554  LYS n 
3 555  LYS n 
3 556  GLY n 
3 557  GLY n 
3 558  GLU n 
3 559  VAL n 
3 560  GLU n 
3 561  PHE n 
3 562  VAL n 
3 563  SER n 
3 564  ALA n 
3 565  ASP n 
3 566  GLN n 
3 567  VAL n 
3 568  ASP n 
3 569  TYR n 
3 570  MET n 
3 571  ASP n 
3 572  VAL n 
3 573  SER n 
3 574  PRO n 
3 575  ARG n 
3 576  GLN n 
3 577  MET n 
3 578  VAL n 
3 579  SER n 
3 580  VAL n 
3 581  ALA n 
3 582  THR n 
3 583  ALA n 
3 584  MET n 
3 585  ILE n 
3 586  PRO n 
3 587  PHE n 
3 588  LEU n 
3 589  GLU n 
3 590  HIS n 
3 591  ASP n 
3 592  ASP n 
3 593  ALA n 
3 594  ASN n 
3 595  ARG n 
3 596  ALA n 
3 597  LEU n 
3 598  MET n 
3 599  GLY n 
3 600  ALA n 
3 601  ASN n 
3 602  MET n 
3 603  GLN n 
3 604  ARG n 
3 605  GLN n 
3 606  ALA n 
3 607  VAL n 
3 608  PRO n 
3 609  LEU n 
3 610  VAL n 
3 611  ARG n 
3 612  SER n 
3 613  GLU n 
3 614  ALA n 
3 615  PRO n 
3 616  LEU n 
3 617  VAL n 
3 618  GLY n 
3 619  THR n 
3 620  GLY n 
3 621  MET n 
3 622  GLU n 
3 623  LEU n 
3 624  ARG n 
3 625  ALA n 
3 626  ALA n 
3 627  ILE n 
3 628  ASP n 
3 629  ALA n 
3 630  GLY n 
3 631  ASP n 
3 632  VAL n 
3 633  VAL n 
3 634  VAL n 
3 635  ALA n 
3 636  ASP n 
3 637  LYS n 
3 638  THR n 
3 639  GLY n 
3 640  VAL n 
3 641  ILE n 
3 642  GLU n 
3 643  GLU n 
3 644  VAL n 
3 645  SER n 
3 646  ALA n 
3 647  ASP n 
3 648  TYR n 
3 649  ILE n 
3 650  THR n 
3 651  VAL n 
3 652  MET n 
3 653  ALA n 
3 654  ASP n 
3 655  ASP n 
3 656  GLY n 
3 657  THR n 
3 658  ARG n 
3 659  GLN n 
3 660  SER n 
3 661  TYR n 
3 662  ARG n 
3 663  LEU n 
3 664  ARG n 
3 665  LYS n 
3 666  PHE n 
3 667  ALA n 
3 668  ARG n 
3 669  SER n 
3 670  ASN n 
3 671  HIS n 
3 672  GLY n 
3 673  THR n 
3 674  CYS n 
3 675  ALA n 
3 676  ASN n 
3 677  GLN n 
3 678  ARG n 
3 679  PRO n 
3 680  ILE n 
3 681  VAL n 
3 682  ASP n 
3 683  ALA n 
3 684  GLY n 
3 685  GLN n 
3 686  ARG n 
3 687  VAL n 
3 688  GLU n 
3 689  ALA n 
3 690  GLY n 
3 691  GLN n 
3 692  VAL n 
3 693  ILE n 
3 694  ALA n 
3 695  ASP n 
3 696  GLY n 
3 697  PRO n 
3 698  CYS n 
3 699  THR n 
3 700  GLN n 
3 701  ASN n 
3 702  GLY n 
3 703  GLU n 
3 704  MET n 
3 705  ALA n 
3 706  LEU n 
3 707  GLY n 
3 708  LYS n 
3 709  ASN n 
3 710  LEU n 
3 711  LEU n 
3 712  VAL n 
3 713  ALA n 
3 714  ILE n 
3 715  MET n 
3 716  PRO n 
3 717  TRP n 
3 718  GLU n 
3 719  GLY n 
3 720  HIS n 
3 721  ASN n 
3 722  TYR n 
3 723  GLU n 
3 724  ASP n 
3 725  ALA n 
3 726  ILE n 
3 727  ILE n 
3 728  LEU n 
3 729  SER n 
3 730  ASN n 
3 731  ARG n 
3 732  LEU n 
3 733  VAL n 
3 734  GLU n 
3 735  GLU n 
3 736  ASP n 
3 737  VAL n 
3 738  LEU n 
3 739  THR n 
3 740  SER n 
3 741  ILE n 
3 742  HIS n 
3 743  ILE n 
3 744  GLU n 
3 745  GLU n 
3 746  HIS n 
3 747  GLU n 
3 748  ILE n 
3 749  ASP n 
3 750  ALA n 
3 751  ARG n 
3 752  ASP n 
3 753  THR n 
3 754  LYS n 
3 755  LEU n 
3 756  GLY n 
3 757  ALA n 
3 758  GLU n 
3 759  GLU n 
3 760  ILE n 
3 761  THR n 
3 762  ARG n 
3 763  ASP n 
3 764  ILE n 
3 765  PRO n 
3 766  ASN n 
3 767  VAL n 
3 768  SER n 
3 769  ASP n 
3 770  GLU n 
3 771  VAL n 
3 772  LEU n 
3 773  ALA n 
3 774  ASP n 
3 775  LEU n 
3 776  ASP n 
3 777  GLU n 
3 778  ARG n 
3 779  GLY n 
3 780  ILE n 
3 781  VAL n 
3 782  ARG n 
3 783  ILE n 
3 784  GLY n 
3 785  ALA n 
3 786  GLU n 
3 787  VAL n 
3 788  ARG n 
3 789  ASP n 
3 790  GLY n 
3 791  ASP n 
3 792  ILE n 
3 793  LEU n 
3 794  VAL n 
3 795  GLY n 
3 796  LYS n 
3 797  VAL n 
3 798  THR n 
3 799  PRO n 
3 800  LYS n 
3 801  GLY n 
3 802  GLU n 
3 803  THR n 
3 804  GLU n 
3 805  LEU n 
3 806  THR n 
3 807  PRO n 
3 808  GLU n 
3 809  GLU n 
3 810  ARG n 
3 811  LEU n 
3 812  LEU n 
3 813  ARG n 
3 814  ALA n 
3 815  ILE n 
3 816  PHE n 
3 817  GLY n 
3 818  GLU n 
3 819  LYS n 
3 820  ALA n 
3 821  ARG n 
3 822  GLU n 
3 823  VAL n 
3 824  ARG n 
3 825  ASP n 
3 826  THR n 
3 827  SER n 
3 828  LEU n 
3 829  LYS n 
3 830  VAL n 
3 831  PRO n 
3 832  HIS n 
3 833  GLY n 
3 834  GLU n 
3 835  SER n 
3 836  GLY n 
3 837  LYS n 
3 838  VAL n 
3 839  ILE n 
3 840  GLY n 
3 841  ILE n 
3 842  ARG n 
3 843  VAL n 
3 844  PHE n 
3 845  SER n 
3 846  ARG n 
3 847  GLU n 
3 848  ASP n 
3 849  ASP n 
3 850  ASP n 
3 851  GLU n 
3 852  LEU n 
3 853  PRO n 
3 854  ALA n 
3 855  GLY n 
3 856  VAL n 
3 857  ASN n 
3 858  GLU n 
3 859  LEU n 
3 860  VAL n 
3 861  ARG n 
3 862  VAL n 
3 863  TYR n 
3 864  VAL n 
3 865  ALA n 
3 866  GLN n 
3 867  LYS n 
3 868  ARG n 
3 869  LYS n 
3 870  ILE n 
3 871  SER n 
3 872  ASP n 
3 873  GLY n 
3 874  ASP n 
3 875  LYS n 
3 876  LEU n 
3 877  ALA n 
3 878  GLY n 
3 879  ARG n 
3 880  HIS n 
3 881  GLY n 
3 882  ASN n 
3 883  LYS n 
3 884  GLY n 
3 885  VAL n 
3 886  ILE n 
3 887  GLY n 
3 888  LYS n 
3 889  ILE n 
3 890  LEU n 
3 891  PRO n 
3 892  VAL n 
3 893  GLU n 
3 894  ASP n 
3 895  MET n 
3 896  PRO n 
3 897  PHE n 
3 898  LEU n 
3 899  PRO n 
3 900  ASP n 
3 901  GLY n 
3 902  THR n 
3 903  PRO n 
3 904  VAL n 
3 905  ASP n 
3 906  ILE n 
3 907  ILE n 
3 908  LEU n 
3 909  ASN n 
3 910  THR n 
3 911  HIS n 
3 912  GLY n 
3 913  VAL n 
3 914  PRO n 
3 915  ARG n 
3 916  ARG n 
3 917  MET n 
3 918  ASN n 
3 919  ILE n 
3 920  GLY n 
3 921  GLN n 
3 922  ILE n 
3 923  LEU n 
3 924  GLU n 
3 925  THR n 
3 926  HIS n 
3 927  LEU n 
3 928  GLY n 
3 929  TRP n 
3 930  VAL n 
3 931  ALA n 
3 932  LYS n 
3 933  ALA n 
3 934  GLY n 
3 935  TRP n 
3 936  ASN n 
3 937  ILE n 
3 938  ASP n 
3 939  VAL n 
3 940  ALA n 
3 941  ALA n 
3 942  GLY n 
3 943  VAL n 
3 944  PRO n 
3 945  ASP n 
3 946  TRP n 
3 947  ALA n 
3 948  SER n 
3 949  LYS n 
3 950  LEU n 
3 951  PRO n 
3 952  GLU n 
3 953  GLU n 
3 954  LEU n 
3 955  TYR n 
3 956  SER n 
3 957  ALA n 
3 958  PRO n 
3 959  ALA n 
3 960  ASP n 
3 961  SER n 
3 962  THR n 
3 963  VAL n 
3 964  ALA n 
3 965  THR n 
3 966  PRO n 
3 967  VAL n 
3 968  PHE n 
3 969  ASP n 
3 970  GLY n 
3 971  ALA n 
3 972  GLN n 
3 973  GLU n 
3 974  GLY n 
3 975  GLU n 
3 976  LEU n 
3 977  ALA n 
3 978  GLY n 
3 979  LEU n 
3 980  LEU n 
3 981  GLY n 
3 982  SER n 
3 983  THR n 
3 984  LEU n 
3 985  PRO n 
3 986  ASN n 
3 987  ARG n 
3 988  ASP n 
3 989  GLY n 
3 990  GLU n 
3 991  VAL n 
3 992  MET n 
3 993  VAL n 
3 994  ASP n 
3 995  ALA n 
3 996  ASP n 
3 997  GLY n 
3 998  LYS n 
3 999  SER n 
3 1000 THR n 
3 1001 LEU n 
3 1002 PHE n 
3 1003 ASP n 
3 1004 GLY n 
3 1005 ARG n 
3 1006 SER n 
3 1007 GLY n 
3 1008 GLU n 
3 1009 PRO n 
3 1010 PHE n 
3 1011 PRO n 
3 1012 TYR n 
3 1013 PRO n 
3 1014 VAL n 
3 1015 THR n 
3 1016 VAL n 
3 1017 GLY n 
3 1018 TYR n 
3 1019 MET n 
3 1020 TYR n 
3 1021 ILE n 
3 1022 LEU n 
3 1023 LYS n 
3 1024 LEU n 
3 1025 HIS n 
3 1026 HIS n 
3 1027 LEU n 
3 1028 VAL n 
3 1029 ASP n 
3 1030 ASP n 
3 1031 LYS n 
3 1032 ILE n 
3 1033 HIS n 
3 1034 ALA n 
3 1035 ARG n 
3 1036 SER n 
3 1037 THR n 
3 1038 GLY n 
3 1039 PRO n 
3 1040 TYR n 
3 1041 SER n 
3 1042 MET n 
3 1043 ILE n 
3 1044 THR n 
3 1045 GLN n 
3 1046 GLN n 
3 1047 PRO n 
3 1048 LEU n 
3 1049 GLY n 
3 1050 GLY n 
3 1051 LYS n 
3 1052 ALA n 
3 1053 GLN n 
3 1054 PHE n 
3 1055 GLY n 
3 1056 GLY n 
3 1057 GLN n 
3 1058 ARG n 
3 1059 PHE n 
3 1060 GLY n 
3 1061 GLU n 
3 1062 MET n 
3 1063 GLU n 
3 1064 CYS n 
3 1065 TRP n 
3 1066 ALA n 
3 1067 MET n 
3 1068 GLN n 
3 1069 ALA n 
3 1070 TYR n 
3 1071 GLY n 
3 1072 ALA n 
3 1073 ALA n 
3 1074 TYR n 
3 1075 THR n 
3 1076 LEU n 
3 1077 GLN n 
3 1078 GLU n 
3 1079 LEU n 
3 1080 LEU n 
3 1081 THR n 
3 1082 ILE n 
3 1083 LYS n 
3 1084 SER n 
3 1085 ASP n 
3 1086 ASP n 
3 1087 THR n 
3 1088 VAL n 
3 1089 GLY n 
3 1090 ARG n 
3 1091 VAL n 
3 1092 LYS n 
3 1093 VAL n 
3 1094 TYR n 
3 1095 GLU n 
3 1096 ALA n 
3 1097 ILE n 
3 1098 VAL n 
3 1099 LYS n 
3 1100 GLY n 
3 1101 GLU n 
3 1102 ASN n 
3 1103 ILE n 
3 1104 PRO n 
3 1105 GLU n 
3 1106 PRO n 
3 1107 GLY n 
3 1108 ILE n 
3 1109 PRO n 
3 1110 GLU n 
3 1111 SER n 
3 1112 PHE n 
3 1113 LYS n 
3 1114 VAL n 
3 1115 LEU n 
3 1116 LEU n 
3 1117 LYS n 
3 1118 GLU n 
3 1119 LEU n 
3 1120 GLN n 
3 1121 SER n 
3 1122 LEU n 
3 1123 CYS n 
3 1124 LEU n 
3 1125 ASN n 
3 1126 VAL n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 LEU n 
3 1130 SER n 
3 1131 SER n 
3 1132 ASP n 
3 1133 GLY n 
3 1134 ALA n 
3 1135 ALA n 
3 1136 ILE n 
3 1137 GLU n 
3 1138 MET n 
3 1139 ARG n 
3 1140 ASP n 
3 1141 GLY n 
3 1142 ASP n 
3 1143 ASP n 
3 1144 GLU n 
3 1145 ASP n 
3 1146 LEU n 
3 1147 GLU n 
3 1148 ARG n 
3 1149 ALA n 
3 1150 ALA n 
3 1151 ALA n 
3 1152 ASN n 
3 1153 LEU n 
3 1154 GLY n 
3 1155 ILE n 
3 1156 ASN n 
3 1157 LEU n 
3 1158 SER n 
3 1159 ARG n 
3 1160 ASN n 
3 1161 GLU n 
3 1162 SER n 
3 1163 ALA n 
3 1164 SER n 
3 1165 VAL n 
3 1166 GLU n 
3 1167 ASP n 
3 1168 LEU n 
3 1169 ALA n 
4 1    MET n 
4 2    LEU n 
4 3    ASP n 
4 4    VAL n 
4 5    ASN n 
4 6    PHE n 
4 7    PHE n 
4 8    ASP n 
4 9    GLU n 
4 10   LEU n 
4 11   ARG n 
4 12   ILE n 
4 13   GLY n 
4 14   LEU n 
4 15   ALA n 
4 16   THR n 
4 17   ALA n 
4 18   ASP n 
4 19   ASP n 
4 20   ILE n 
4 21   ARG n 
4 22   ASN n 
4 23   TRP n 
4 24   SER n 
4 25   TYR n 
4 26   GLY n 
4 27   GLU n 
4 28   VAL n 
4 29   LYS n 
4 30   LYS n 
4 31   PRO n 
4 32   GLU n 
4 33   THR n 
4 34   ILE n 
4 35   ASN n 
4 36   TYR n 
4 37   ARG n 
4 38   THR n 
4 39   LEU n 
4 40   LYS n 
4 41   PRO n 
4 42   GLU n 
4 43   LYS n 
4 44   ASP n 
4 45   GLY n 
4 46   LEU n 
4 47   PHE n 
4 48   CYS n 
4 49   GLU n 
4 50   LYS n 
4 51   ILE n 
4 52   PHE n 
4 53   GLY n 
4 54   PRO n 
4 55   THR n 
4 56   ARG n 
4 57   ASP n 
4 58   TRP n 
4 59   GLU n 
4 60   CYS n 
4 61   TYR n 
4 62   CYS n 
4 63   GLY n 
4 64   LYS n 
4 65   TYR n 
4 66   LYS n 
4 67   ARG n 
4 68   VAL n 
4 69   ARG n 
4 70   PHE n 
4 71   LYS n 
4 72   GLY n 
4 73   ILE n 
4 74   ILE n 
4 75   CYS n 
4 76   GLU n 
4 77   ARG n 
4 78   CYS n 
4 79   GLY n 
4 80   VAL n 
4 81   GLU n 
4 82   VAL n 
4 83   THR n 
4 84   ARG n 
4 85   ALA n 
4 86   LYS n 
4 87   VAL n 
4 88   ARG n 
4 89   ARG n 
4 90   GLU n 
4 91   ARG n 
4 92   MET n 
4 93   GLY n 
4 94   HIS n 
4 95   ILE n 
4 96   GLU n 
4 97   LEU n 
4 98   ALA n 
4 99   ALA n 
4 100  PRO n 
4 101  VAL n 
4 102  THR n 
4 103  HIS n 
4 104  ILE n 
4 105  TRP n 
4 106  TYR n 
4 107  PHE n 
4 108  LYS n 
4 109  GLY n 
4 110  VAL n 
4 111  PRO n 
4 112  SER n 
4 113  ARG n 
4 114  LEU n 
4 115  GLY n 
4 116  TYR n 
4 117  LEU n 
4 118  LEU n 
4 119  ASP n 
4 120  LEU n 
4 121  ALA n 
4 122  PRO n 
4 123  LYS n 
4 124  ASP n 
4 125  LEU n 
4 126  GLU n 
4 127  LYS n 
4 128  ILE n 
4 129  ILE n 
4 130  TYR n 
4 131  PHE n 
4 132  ALA n 
4 133  ALA n 
4 134  TYR n 
4 135  VAL n 
4 136  ILE n 
4 137  THR n 
4 138  SER n 
4 139  VAL n 
4 140  ASP n 
4 141  ASP n 
4 142  GLU n 
4 143  MET n 
4 144  ARG n 
4 145  HIS n 
4 146  ASN n 
4 147  GLU n 
4 148  LEU n 
4 149  SER n 
4 150  THR n 
4 151  LEU n 
4 152  GLU n 
4 153  ALA n 
4 154  GLU n 
4 155  MET n 
4 156  ALA n 
4 157  VAL n 
4 158  GLU n 
4 159  LYS n 
4 160  LYS n 
4 161  ALA n 
4 162  VAL n 
4 163  GLU n 
4 164  ASP n 
4 165  GLN n 
4 166  ARG n 
4 167  ASP n 
4 168  ALA n 
4 169  ASP n 
4 170  LEU n 
4 171  GLU n 
4 172  ALA n 
4 173  ARG n 
4 174  ALA n 
4 175  GLN n 
4 176  LYS n 
4 177  LEU n 
4 178  GLU n 
4 179  ALA n 
4 180  ASP n 
4 181  LEU n 
4 182  ALA n 
4 183  GLU n 
4 184  LEU n 
4 185  GLU n 
4 186  ALA n 
4 187  GLU n 
4 188  GLY n 
4 189  ALA n 
4 190  LYS n 
4 191  SER n 
4 192  ASP n 
4 193  VAL n 
4 194  ARG n 
4 195  ARG n 
4 196  LYS n 
4 197  VAL n 
4 198  ARG n 
4 199  ASP n 
4 200  SER n 
4 201  GLY n 
4 202  GLU n 
4 203  ARG n 
4 204  GLU n 
4 205  MET n 
4 206  ARG n 
4 207  GLN n 
4 208  LEU n 
4 209  ARG n 
4 210  ASP n 
4 211  ARG n 
4 212  ALA n 
4 213  GLN n 
4 214  ARG n 
4 215  GLU n 
4 216  LEU n 
4 217  ASP n 
4 218  ARG n 
4 219  LEU n 
4 220  ASP n 
4 221  GLU n 
4 222  ILE n 
4 223  TRP n 
4 224  ASN n 
4 225  THR n 
4 226  PHE n 
4 227  THR n 
4 228  LYS n 
4 229  LEU n 
4 230  ALA n 
4 231  PRO n 
4 232  LYS n 
4 233  GLN n 
4 234  LEU n 
4 235  ILE n 
4 236  VAL n 
4 237  ASP n 
4 238  GLU n 
4 239  VAL n 
4 240  LEU n 
4 241  TYR n 
4 242  ARG n 
4 243  GLU n 
4 244  LEU n 
4 245  GLN n 
4 246  ASP n 
4 247  ARG n 
4 248  TYR n 
4 249  GLY n 
4 250  GLU n 
4 251  TYR n 
4 252  PHE n 
4 253  THR n 
4 254  GLY n 
4 255  ALA n 
4 256  MET n 
4 257  GLY n 
4 258  ALA n 
4 259  GLU n 
4 260  SER n 
4 261  ILE n 
4 262  LYS n 
4 263  LYS n 
4 264  LEU n 
4 265  ILE n 
4 266  GLU n 
4 267  ASN n 
4 268  PHE n 
4 269  ASP n 
4 270  ILE n 
4 271  ASP n 
4 272  ALA n 
4 273  GLU n 
4 274  ALA n 
4 275  GLU n 
4 276  SER n 
4 277  LEU n 
4 278  ARG n 
4 279  GLU n 
4 280  VAL n 
4 281  ILE n 
4 282  ARG n 
4 283  SER n 
4 284  GLY n 
4 285  LYS n 
4 286  GLY n 
4 287  GLN n 
4 288  LYS n 
4 289  LYS n 
4 290  LEU n 
4 291  ARG n 
4 292  ALA n 
4 293  LEU n 
4 294  LYS n 
4 295  ARG n 
4 296  LEU n 
4 297  LYS n 
4 298  VAL n 
4 299  VAL n 
4 300  ALA n 
4 301  ALA n 
4 302  PHE n 
4 303  GLN n 
4 304  GLN n 
4 305  SER n 
4 306  GLY n 
4 307  ASN n 
4 308  SER n 
4 309  PRO n 
4 310  MET n 
4 311  GLY n 
4 312  MET n 
4 313  VAL n 
4 314  LEU n 
4 315  ASP n 
4 316  ALA n 
4 317  VAL n 
4 318  PRO n 
4 319  VAL n 
4 320  ILE n 
4 321  PRO n 
4 322  PRO n 
4 323  GLU n 
4 324  LEU n 
4 325  ARG n 
4 326  PRO n 
4 327  MET n 
4 328  VAL n 
4 329  GLN n 
4 330  LEU n 
4 331  ASP n 
4 332  GLY n 
4 333  GLY n 
4 334  ARG n 
4 335  PHE n 
4 336  ALA n 
4 337  THR n 
4 338  SER n 
4 339  ASP n 
4 340  LEU n 
4 341  ASN n 
4 342  ASP n 
4 343  LEU n 
4 344  TYR n 
4 345  ARG n 
4 346  ARG n 
4 347  VAL n 
4 348  ILE n 
4 349  ASN n 
4 350  ARG n 
4 351  ASN n 
4 352  ASN n 
4 353  ARG n 
4 354  LEU n 
4 355  LYS n 
4 356  ARG n 
4 357  LEU n 
4 358  ILE n 
4 359  ASP n 
4 360  LEU n 
4 361  GLY n 
4 362  ALA n 
4 363  PRO n 
4 364  GLU n 
4 365  ILE n 
4 366  ILE n 
4 367  VAL n 
4 368  ASN n 
4 369  ASN n 
4 370  GLU n 
4 371  LYS n 
4 372  ARG n 
4 373  MET n 
4 374  LEU n 
4 375  GLN n 
4 376  GLU n 
4 377  SER n 
4 378  VAL n 
4 379  ASP n 
4 380  ALA n 
4 381  LEU n 
4 382  PHE n 
4 383  ASP n 
4 384  ASN n 
4 385  GLY n 
4 386  ARG n 
4 387  ARG n 
4 388  GLY n 
4 389  ARG n 
4 390  PRO n 
4 391  VAL n 
4 392  THR n 
4 393  GLY n 
4 394  PRO n 
4 395  GLY n 
4 396  ASN n 
4 397  ARG n 
4 398  PRO n 
4 399  LEU n 
4 400  LYS n 
4 401  SER n 
4 402  LEU n 
4 403  SER n 
4 404  ASP n 
4 405  LEU n 
4 406  LEU n 
4 407  LYS n 
4 408  GLY n 
4 409  LYS n 
4 410  GLN n 
4 411  GLY n 
4 412  ARG n 
4 413  PHE n 
4 414  ARG n 
4 415  GLN n 
4 416  ASN n 
4 417  LEU n 
4 418  LEU n 
4 419  GLY n 
4 420  LYS n 
4 421  ARG n 
4 422  VAL n 
4 423  ASP n 
4 424  TYR n 
4 425  SER n 
4 426  GLY n 
4 427  ARG n 
4 428  SER n 
4 429  VAL n 
4 430  ILE n 
4 431  VAL n 
4 432  VAL n 
4 433  GLY n 
4 434  PRO n 
4 435  GLN n 
4 436  LEU n 
4 437  LYS n 
4 438  LEU n 
4 439  HIS n 
4 440  GLN n 
4 441  CYS n 
4 442  GLY n 
4 443  LEU n 
4 444  PRO n 
4 445  LYS n 
4 446  LEU n 
4 447  MET n 
4 448  ALA n 
4 449  LEU n 
4 450  GLU n 
4 451  LEU n 
4 452  PHE n 
4 453  LYS n 
4 454  PRO n 
4 455  PHE n 
4 456  VAL n 
4 457  MET n 
4 458  LYS n 
4 459  ARG n 
4 460  LEU n 
4 461  VAL n 
4 462  ASP n 
4 463  LEU n 
4 464  ASN n 
4 465  HIS n 
4 466  ALA n 
4 467  GLN n 
4 468  ASN n 
4 469  ILE n 
4 470  LYS n 
4 471  SER n 
4 472  ALA n 
4 473  LYS n 
4 474  ARG n 
4 475  MET n 
4 476  VAL n 
4 477  GLU n 
4 478  ARG n 
4 479  GLN n 
4 480  ARG n 
4 481  PRO n 
4 482  GLN n 
4 483  VAL n 
4 484  TRP n 
4 485  ASP n 
4 486  VAL n 
4 487  LEU n 
4 488  GLU n 
4 489  GLU n 
4 490  VAL n 
4 491  ILE n 
4 492  ALA n 
4 493  GLU n 
4 494  HIS n 
4 495  PRO n 
4 496  VAL n 
4 497  LEU n 
4 498  LEU n 
4 499  ASN n 
4 500  ARG n 
4 501  ALA n 
4 502  PRO n 
4 503  THR n 
4 504  LEU n 
4 505  HIS n 
4 506  ARG n 
4 507  LEU n 
4 508  GLY n 
4 509  ILE n 
4 510  GLN n 
4 511  ALA n 
4 512  PHE n 
4 513  GLU n 
4 514  PRO n 
4 515  GLN n 
4 516  LEU n 
4 517  VAL n 
4 518  GLU n 
4 519  GLY n 
4 520  LYS n 
4 521  ALA n 
4 522  ILE n 
4 523  GLN n 
4 524  LEU n 
4 525  HIS n 
4 526  PRO n 
4 527  LEU n 
4 528  VAL n 
4 529  CYS n 
4 530  GLU n 
4 531  ALA n 
4 532  PHE n 
4 533  ASN n 
4 534  ALA n 
4 535  ASP n 
4 536  PHE n 
4 537  ASP n 
4 538  GLY n 
4 539  ASP n 
4 540  GLN n 
4 541  MET n 
4 542  ALA n 
4 543  VAL n 
4 544  HIS n 
4 545  LEU n 
4 546  PRO n 
4 547  LEU n 
4 548  SER n 
4 549  ALA n 
4 550  GLU n 
4 551  ALA n 
4 552  GLN n 
4 553  ALA n 
4 554  GLU n 
4 555  ALA n 
4 556  ARG n 
4 557  ILE n 
4 558  LEU n 
4 559  MET n 
4 560  LEU n 
4 561  SER n 
4 562  SER n 
4 563  ASN n 
4 564  ASN n 
4 565  ILE n 
4 566  LEU n 
4 567  SER n 
4 568  PRO n 
4 569  ALA n 
4 570  SER n 
4 571  GLY n 
4 572  LYS n 
4 573  PRO n 
4 574  LEU n 
4 575  ALA n 
4 576  MET n 
4 577  PRO n 
4 578  ARG n 
4 579  LEU n 
4 580  ASP n 
4 581  MET n 
4 582  VAL n 
4 583  THR n 
4 584  GLY n 
4 585  LEU n 
4 586  TYR n 
4 587  TYR n 
4 588  LEU n 
4 589  THR n 
4 590  THR n 
4 591  LEU n 
4 592  VAL n 
4 593  GLU n 
4 594  GLY n 
4 595  ALA n 
4 596  THR n 
4 597  GLY n 
4 598  GLU n 
4 599  TYR n 
4 600  GLN n 
4 601  ALA n 
4 602  ALA n 
4 603  THR n 
4 604  LYS n 
4 605  ASP n 
4 606  ALA n 
4 607  PRO n 
4 608  GLU n 
4 609  GLN n 
4 610  GLY n 
4 611  VAL n 
4 612  TYR n 
4 613  SER n 
4 614  SER n 
4 615  PRO n 
4 616  ALA n 
4 617  GLU n 
4 618  ALA n 
4 619  ILE n 
4 620  MET n 
4 621  ALA n 
4 622  MET n 
4 623  ASP n 
4 624  ARG n 
4 625  GLY n 
4 626  ALA n 
4 627  LEU n 
4 628  SER n 
4 629  VAL n 
4 630  ARG n 
4 631  ALA n 
4 632  LYS n 
4 633  ILE n 
4 634  LYS n 
4 635  VAL n 
4 636  ARG n 
4 637  LEU n 
4 638  THR n 
4 639  GLU n 
4 640  LEU n 
4 641  ARG n 
4 642  PRO n 
4 643  PRO n 
4 644  THR n 
4 645  ASP n 
4 646  LEU n 
4 647  GLU n 
4 648  ALA n 
4 649  GLN n 
4 650  LEU n 
4 651  PHE n 
4 652  GLU n 
4 653  ASN n 
4 654  GLY n 
4 655  TRP n 
4 656  LYS n 
4 657  PRO n 
4 658  GLY n 
4 659  ASP n 
4 660  ALA n 
4 661  TRP n 
4 662  THR n 
4 663  ALA n 
4 664  GLU n 
4 665  THR n 
4 666  THR n 
4 667  LEU n 
4 668  GLY n 
4 669  ARG n 
4 670  VAL n 
4 671  MET n 
4 672  PHE n 
4 673  ASN n 
4 674  GLU n 
4 675  LEU n 
4 676  LEU n 
4 677  PRO n 
4 678  LYS n 
4 679  SER n 
4 680  TYR n 
4 681  PRO n 
4 682  PHE n 
4 683  VAL n 
4 684  ASN n 
4 685  GLU n 
4 686  GLN n 
4 687  MET n 
4 688  HIS n 
4 689  LYS n 
4 690  LYS n 
4 691  VAL n 
4 692  GLN n 
4 693  ALA n 
4 694  ARG n 
4 695  ILE n 
4 696  ILE n 
4 697  ASN n 
4 698  ASP n 
4 699  LEU n 
4 700  ALA n 
4 701  GLU n 
4 702  ARG n 
4 703  PHE n 
4 704  PRO n 
4 705  MET n 
4 706  ILE n 
4 707  VAL n 
4 708  VAL n 
4 709  ALA n 
4 710  GLN n 
4 711  THR n 
4 712  VAL n 
4 713  ASP n 
4 714  LYS n 
4 715  LEU n 
4 716  LYS n 
4 717  ASP n 
4 718  ALA n 
4 719  GLY n 
4 720  PHE n 
4 721  TYR n 
4 722  TRP n 
4 723  ALA n 
4 724  THR n 
4 725  ARG n 
4 726  SER n 
4 727  GLY n 
4 728  VAL n 
4 729  THR n 
4 730  VAL n 
4 731  SER n 
4 732  MET n 
4 733  ALA n 
4 734  ASP n 
4 735  VAL n 
4 736  LEU n 
4 737  VAL n 
4 738  PRO n 
4 739  PRO n 
4 740  GLN n 
4 741  LYS n 
4 742  GLN n 
4 743  GLU n 
4 744  ILE n 
4 745  LEU n 
4 746  GLU n 
4 747  ARG n 
4 748  HIS n 
4 749  GLU n 
4 750  ALA n 
4 751  GLU n 
4 752  ALA n 
4 753  ASP n 
4 754  ALA n 
4 755  ILE n 
4 756  GLU n 
4 757  ARG n 
4 758  LYS n 
4 759  TYR n 
4 760  GLN n 
4 761  ARG n 
4 762  GLY n 
4 763  ALA n 
4 764  LEU n 
4 765  ASN n 
4 766  HIS n 
4 767  THR n 
4 768  GLU n 
4 769  ARG n 
4 770  ASN n 
4 771  GLU n 
4 772  SER n 
4 773  LEU n 
4 774  VAL n 
4 775  LYS n 
4 776  ILE n 
4 777  TRP n 
4 778  GLN n 
4 779  ASP n 
4 780  ALA n 
4 781  THR n 
4 782  GLU n 
4 783  GLU n 
4 784  VAL n 
4 785  GLY n 
4 786  LYS n 
4 787  ALA n 
4 788  LEU n 
4 789  GLU n 
4 790  GLU n 
4 791  PHE n 
4 792  TYR n 
4 793  PRO n 
4 794  ALA n 
4 795  ASP n 
4 796  ASN n 
4 797  PRO n 
4 798  ILE n 
4 799  ILE n 
4 800  THR n 
4 801  ILE n 
4 802  VAL n 
4 803  LYS n 
4 804  SER n 
4 805  GLY n 
4 806  ALA n 
4 807  THR n 
4 808  GLY n 
4 809  ASN n 
4 810  LEU n 
4 811  THR n 
4 812  GLN n 
4 813  THR n 
4 814  ARG n 
4 815  THR n 
4 816  LEU n 
4 817  ALA n 
4 818  GLY n 
4 819  MET n 
4 820  LYS n 
4 821  GLY n 
4 822  LEU n 
4 823  VAL n 
4 824  THR n 
4 825  ASN n 
4 826  PRO n 
4 827  LYS n 
4 828  GLY n 
4 829  GLU n 
4 830  PHE n 
4 831  ILE n 
4 832  PRO n 
4 833  ARG n 
4 834  PRO n 
4 835  ILE n 
4 836  LYS n 
4 837  SER n 
4 838  SER n 
4 839  PHE n 
4 840  ARG n 
4 841  GLU n 
4 842  GLY n 
4 843  LEU n 
4 844  THR n 
4 845  VAL n 
4 846  LEU n 
4 847  GLU n 
4 848  TYR n 
4 849  PHE n 
4 850  ILE n 
4 851  ASN n 
4 852  THR n 
4 853  HIS n 
4 854  GLY n 
4 855  ALA n 
4 856  ARG n 
4 857  LYS n 
4 858  GLY n 
4 859  LEU n 
4 860  ALA n 
4 861  ASP n 
4 862  THR n 
4 863  ALA n 
4 864  LEU n 
4 865  ARG n 
4 866  THR n 
4 867  ALA n 
4 868  ASP n 
4 869  SER n 
4 870  GLY n 
4 871  TYR n 
4 872  LEU n 
4 873  THR n 
4 874  ARG n 
4 875  ARG n 
4 876  LEU n 
4 877  VAL n 
4 878  ASP n 
4 879  VAL n 
4 880  SER n 
4 881  GLN n 
4 882  ASP n 
4 883  VAL n 
4 884  ILE n 
4 885  VAL n 
4 886  ARG n 
4 887  GLU n 
4 888  HIS n 
4 889  ASP n 
4 890  CYS n 
4 891  GLU n 
4 892  THR n 
4 893  GLU n 
4 894  ARG n 
4 895  GLY n 
4 896  ILE n 
4 897  ASN n 
4 898  VAL n 
4 899  THR n 
4 900  LEU n 
4 901  ALA n 
4 902  GLU n 
4 903  ARG n 
4 904  GLY n 
4 905  PRO n 
4 906  ASP n 
4 907  GLY n 
4 908  THR n 
4 909  LEU n 
4 910  ILE n 
4 911  ARG n 
4 912  ASP n 
4 913  ALA n 
4 914  HIS n 
4 915  VAL n 
4 916  GLU n 
4 917  THR n 
4 918  SER n 
4 919  ALA n 
4 920  PHE n 
4 921  ALA n 
4 922  ARG n 
4 923  THR n 
4 924  LEU n 
4 925  ALA n 
4 926  THR n 
4 927  ASP n 
4 928  ALA n 
4 929  VAL n 
4 930  ASP n 
4 931  ALA n 
4 932  ASN n 
4 933  GLY n 
4 934  ASN n 
4 935  VAL n 
4 936  ILE n 
4 937  ILE n 
4 938  GLU n 
4 939  ARG n 
4 940  GLY n 
4 941  HIS n 
4 942  ASP n 
4 943  LEU n 
4 944  GLY n 
4 945  ASP n 
4 946  PRO n 
4 947  ALA n 
4 948  ILE n 
4 949  ASP n 
4 950  ALA n 
4 951  LEU n 
4 952  LEU n 
4 953  ALA n 
4 954  ALA n 
4 955  GLY n 
4 956  ILE n 
4 957  THR n 
4 958  THR n 
4 959  VAL n 
4 960  LYS n 
4 961  VAL n 
4 962  ARG n 
4 963  SER n 
4 964  VAL n 
4 965  LEU n 
4 966  THR n 
4 967  CYS n 
4 968  THR n 
4 969  SER n 
4 970  ALA n 
4 971  THR n 
4 972  GLY n 
4 973  VAL n 
4 974  CYS n 
4 975  ALA n 
4 976  MET n 
4 977  CYS n 
4 978  TYR n 
4 979  GLY n 
4 980  ARG n 
4 981  SER n 
4 982  MET n 
4 983  ALA n 
4 984  THR n 
4 985  GLY n 
4 986  LYS n 
4 987  LEU n 
4 988  VAL n 
4 989  ASP n 
4 990  ILE n 
4 991  GLY n 
4 992  GLU n 
4 993  ALA n 
4 994  VAL n 
4 995  GLY n 
4 996  ILE n 
4 997  VAL n 
4 998  ALA n 
4 999  ALA n 
4 1000 GLN n 
4 1001 SER n 
4 1002 ILE n 
4 1003 GLY n 
4 1004 GLU n 
4 1005 PRO n 
4 1006 GLY n 
4 1007 THR n 
4 1008 GLN n 
4 1009 LEU n 
4 1010 THR n 
4 1011 MET n 
4 1012 ARG n 
4 1013 THR n 
4 1014 PHE n 
4 1015 HIS n 
4 1016 GLN n 
4 1017 GLY n 
4 1018 GLY n 
4 1019 VAL n 
4 1020 THR n 
4 1021 GLY n 
4 1022 GLY n 
4 1023 ALA n 
4 1024 ASP n 
4 1025 ILE n 
4 1026 VAL n 
4 1027 GLY n 
4 1028 GLY n 
4 1029 LEU n 
4 1030 PRO n 
4 1031 ARG n 
4 1032 VAL n 
4 1033 GLN n 
4 1034 GLU n 
4 1035 LEU n 
4 1036 PHE n 
4 1037 GLU n 
4 1038 ALA n 
4 1039 ARG n 
4 1040 VAL n 
4 1041 PRO n 
4 1042 ARG n 
4 1043 ASN n 
4 1044 LYS n 
4 1045 ALA n 
4 1046 PRO n 
4 1047 ILE n 
4 1048 ALA n 
4 1049 ASP n 
4 1050 VAL n 
4 1051 ALA n 
4 1052 GLY n 
4 1053 ARG n 
4 1054 VAL n 
4 1055 ARG n 
4 1056 LEU n 
4 1057 GLU n 
4 1058 GLU n 
4 1059 SER n 
4 1060 ASP n 
4 1061 LYS n 
4 1062 PHE n 
4 1063 PHE n 
4 1064 LYS n 
4 1065 ILE n 
4 1066 THR n 
4 1067 ILE n 
4 1068 VAL n 
4 1069 PRO n 
4 1070 ASP n 
4 1071 ASP n 
4 1072 GLY n 
4 1073 GLY n 
4 1074 GLU n 
4 1075 GLU n 
4 1076 VAL n 
4 1077 VAL n 
4 1078 TYR n 
4 1079 ASP n 
4 1080 LYS n 
4 1081 LEU n 
4 1082 SER n 
4 1083 LYS n 
4 1084 ARG n 
4 1085 GLN n 
4 1086 ARG n 
4 1087 LEU n 
4 1088 ARG n 
4 1089 VAL n 
4 1090 ILE n 
4 1091 THR n 
4 1092 HIS n 
4 1093 GLU n 
4 1094 ASP n 
4 1095 GLY n 
4 1096 THR n 
4 1097 GLU n 
4 1098 GLY n 
4 1099 VAL n 
4 1100 LEU n 
4 1101 SER n 
4 1102 ASP n 
4 1103 GLY n 
4 1104 ASP n 
4 1105 HIS n 
4 1106 VAL n 
4 1107 GLU n 
4 1108 VAL n 
4 1109 GLY n 
4 1110 ASP n 
4 1111 GLN n 
4 1112 LEU n 
4 1113 MET n 
4 1114 GLU n 
4 1115 GLY n 
4 1116 ALA n 
4 1117 ALA n 
4 1118 ASP n 
4 1119 PRO n 
4 1120 HIS n 
4 1121 GLU n 
4 1122 VAL n 
4 1123 LEU n 
4 1124 ARG n 
4 1125 VAL n 
4 1126 GLN n 
4 1127 GLY n 
4 1128 PRO n 
4 1129 ARG n 
4 1130 GLU n 
4 1131 VAL n 
4 1132 GLN n 
4 1133 ILE n 
4 1134 HIS n 
4 1135 LEU n 
4 1136 VAL n 
4 1137 LYS n 
4 1138 GLU n 
4 1139 VAL n 
4 1140 GLN n 
4 1141 GLU n 
4 1142 VAL n 
4 1143 TYR n 
4 1144 ARG n 
4 1145 ALA n 
4 1146 GLN n 
4 1147 GLY n 
4 1148 VAL n 
4 1149 SER n 
4 1150 ILE n 
4 1151 HIS n 
4 1152 ASP n 
4 1153 LYS n 
4 1154 HIS n 
4 1155 ILE n 
4 1156 GLU n 
4 1157 VAL n 
4 1158 ILE n 
4 1159 VAL n 
4 1160 ARG n 
4 1161 GLN n 
4 1162 MET n 
4 1163 LEU n 
4 1164 ARG n 
4 1165 ARG n 
4 1166 VAL n 
4 1167 THR n 
4 1168 ILE n 
4 1169 ILE n 
4 1170 ASP n 
4 1171 SER n 
4 1172 GLY n 
4 1173 SER n 
4 1174 THR n 
4 1175 GLU n 
4 1176 PHE n 
4 1177 LEU n 
4 1178 PRO n 
4 1179 GLY n 
4 1180 SER n 
4 1181 LEU n 
4 1182 THR n 
4 1183 GLU n 
4 1184 ARG n 
4 1185 ALA n 
4 1186 GLU n 
4 1187 PHE n 
4 1188 GLU n 
4 1189 ALA n 
4 1190 GLU n 
4 1191 ASN n 
4 1192 ARG n 
4 1193 ARG n 
4 1194 VAL n 
4 1195 VAL n 
4 1196 ALA n 
4 1197 GLU n 
4 1198 GLY n 
4 1199 GLY n 
4 1200 GLU n 
4 1201 PRO n 
4 1202 ALA n 
4 1203 ALA n 
4 1204 GLY n 
4 1205 ARG n 
4 1206 PRO n 
4 1207 VAL n 
4 1208 LEU n 
4 1209 MET n 
4 1210 GLY n 
4 1211 ILE n 
4 1212 THR n 
4 1213 LYS n 
4 1214 ALA n 
4 1215 SER n 
4 1216 LEU n 
4 1217 ALA n 
4 1218 THR n 
4 1219 ASP n 
4 1220 SER n 
4 1221 TRP n 
4 1222 LEU n 
4 1223 SER n 
4 1224 ALA n 
4 1225 ALA n 
4 1226 SER n 
4 1227 PHE n 
4 1228 GLN n 
4 1229 GLU n 
4 1230 THR n 
4 1231 THR n 
4 1232 ARG n 
4 1233 VAL n 
4 1234 LEU n 
4 1235 THR n 
4 1236 ASP n 
4 1237 ALA n 
4 1238 ALA n 
4 1239 ILE n 
4 1240 ASN n 
4 1241 CYS n 
4 1242 ARG n 
4 1243 SER n 
4 1244 ASP n 
4 1245 LYS n 
4 1246 LEU n 
4 1247 ASN n 
4 1248 GLY n 
4 1249 LEU n 
4 1250 LYS n 
4 1251 GLU n 
4 1252 ASN n 
4 1253 VAL n 
4 1254 ILE n 
4 1255 ILE n 
4 1256 GLY n 
4 1257 LYS n 
4 1258 LEU n 
4 1259 ILE n 
4 1260 PRO n 
4 1261 ALA n 
4 1262 GLY n 
4 1263 THR n 
4 1264 GLY n 
4 1265 ILE n 
4 1266 SER n 
4 1267 ARG n 
4 1268 TYR n 
4 1269 ARG n 
4 1270 ASN n 
4 1271 ILE n 
4 1272 GLN n 
4 1273 VAL n 
4 1274 GLN n 
4 1275 PRO n 
4 1276 THR n 
4 1277 GLU n 
4 1278 GLU n 
4 1279 ALA n 
4 1280 ARG n 
4 1281 ALA n 
4 1282 ALA n 
4 1283 ALA n 
4 1284 TYR n 
4 1285 THR n 
4 1286 ILE n 
4 1287 PRO n 
4 1288 SER n 
4 1289 TYR n 
4 1290 GLU n 
4 1291 ASP n 
4 1292 GLN n 
4 1293 TYR n 
4 1294 TYR n 
4 1295 SER n 
4 1296 PRO n 
4 1297 ASP n 
4 1298 PHE n 
4 1299 GLY n 
4 1300 GLN n 
4 1301 ALA n 
4 1302 THR n 
4 1303 GLY n 
4 1304 ALA n 
4 1305 ALA n 
4 1306 VAL n 
4 1307 PRO n 
4 1308 LEU n 
4 1309 ASP n 
4 1310 ASP n 
4 1311 TYR n 
4 1312 GLY n 
4 1313 TYR n 
4 1314 SER n 
4 1315 ASP n 
4 1316 TYR n 
4 1317 ARG n 
5 1    MET n 
5 2    SER n 
5 3    THR n 
5 4    PRO n 
5 5    HIS n 
5 6    ALA n 
5 7    ASP n 
5 8    ALA n 
5 9    GLN n 
5 10   LEU n 
5 11   ASN n 
5 12   ALA n 
5 13   ALA n 
5 14   ASP n 
5 15   ASP n 
5 16   LEU n 
5 17   GLY n 
5 18   ILE n 
5 19   ASP n 
5 20   SER n 
5 21   SER n 
5 22   ALA n 
5 23   ALA n 
5 24   SER n 
5 25   ALA n 
5 26   TYR n 
5 27   ASP n 
5 28   THR n 
5 29   PRO n 
5 30   LEU n 
5 31   GLY n 
5 32   ILE n 
5 33   THR n 
5 34   ASN n 
5 35   PRO n 
5 36   PRO n 
5 37   ILE n 
5 38   ASP n 
5 39   GLU n 
5 40   LEU n 
5 41   LEU n 
5 42   SER n 
5 43   ARG n 
5 44   ALA n 
5 45   SER n 
5 46   SER n 
5 47   LYS n 
5 48   TYR n 
5 49   ALA n 
5 50   LEU n 
5 51   VAL n 
5 52   ILE n 
5 53   TYR n 
5 54   ALA n 
5 55   ALA n 
5 56   LYS n 
5 57   ARG n 
5 58   ALA n 
5 59   ARG n 
5 60   GLN n 
5 61   ILE n 
5 62   ASN n 
5 63   ASP n 
5 64   TYR n 
5 65   TYR n 
5 66   ASN n 
5 67   GLN n 
5 68   LEU n 
5 69   GLY n 
5 70   ASP n 
5 71   GLY n 
5 72   ILE n 
5 73   LEU n 
5 74   GLU n 
5 75   TYR n 
5 76   VAL n 
5 77   GLY n 
5 78   PRO n 
5 79   LEU n 
5 80   VAL n 
5 81   GLU n 
5 82   PRO n 
5 83   GLY n 
5 84   LEU n 
5 85   GLN n 
5 86   GLU n 
5 87   LYS n 
5 88   PRO n 
5 89   LEU n 
5 90   SER n 
5 91   ILE n 
5 92   ALA n 
5 93   LEU n 
5 94   ARG n 
5 95   GLU n 
5 96   ILE n 
5 97   HIS n 
5 98   GLY n 
5 99   ASP n 
5 100  LEU n 
5 101  LEU n 
5 102  GLU n 
5 103  HIS n 
5 104  THR n 
5 105  GLU n 
5 106  GLY n 
5 107  GLU n 
6 1    MET n 
6 2    ALA n 
6 3    ALA n 
6 4    THR n 
6 5    LYS n 
6 6    ALA n 
6 7    SER n 
6 8    PRO n 
6 9    ALA n 
6 10   THR n 
6 11   GLU n 
6 12   GLU n 
6 13   PRO n 
6 14   VAL n 
6 15   LYS n 
6 16   ARG n 
6 17   THR n 
6 18   ALA n 
6 19   THR n 
6 20   LYS n 
6 21   THR n 
6 22   PRO n 
6 23   ALA n 
6 24   LYS n 
6 25   LYS n 
6 26   ALA n 
6 27   PRO n 
6 28   ALA n 
6 29   LYS n 
6 30   ARG n 
6 31   ALA n 
6 32   ALA n 
6 33   LYS n 
6 34   SER n 
6 35   ALA n 
6 36   ALA n 
6 37   ALA n 
6 38   LYS n 
6 39   ALA n 
6 40   GLY n 
6 41   GLY n 
6 42   LYS n 
6 43   ALA n 
6 44   PRO n 
6 45   ALA n 
6 46   LYS n 
6 47   LYS n 
6 48   ALA n 
6 49   PRO n 
6 50   ALA n 
6 51   LYS n 
6 52   ARG n 
6 53   ALA n 
6 54   ALA n 
6 55   LYS n 
6 56   GLY n 
6 57   THR n 
6 58   ALA n 
6 59   ALA n 
6 60   LYS n 
6 61   PRO n 
6 62   GLU n 
6 63   ASP n 
6 64   GLY n 
6 65   VAL n 
6 66   THR n 
6 67   ASP n 
6 68   ASP n 
6 69   LEU n 
6 70   GLU n 
6 71   VAL n 
6 72   THR n 
6 73   ASP n 
6 74   ASP n 
6 75   LEU n 
6 76   GLU n 
6 77   ALA n 
6 78   GLU n 
6 79   PRO n 
6 80   GLY n 
6 81   GLU n 
6 82   ASP n 
6 83   LEU n 
6 84   ASP n 
6 85   VAL n 
6 86   GLU n 
6 87   ASP n 
6 88   THR n 
6 89   ASP n 
6 90   LEU n 
6 91   GLU n 
6 92   LEU n 
6 93   ASP n 
6 94   ASP n 
6 95   LEU n 
6 96   ASP n 
6 97   SER n 
6 98   ASP n 
6 99   ASP n 
6 100  ASP n 
6 101  THR n 
6 102  ALA n 
6 103  VAL n 
6 104  GLU n 
6 105  ASP n 
6 106  GLU n 
6 107  GLU n 
6 108  GLU n 
6 109  GLU n 
6 110  ALA n 
6 111  ASP n 
6 112  ALA n 
6 113  ALA n 
6 114  THR n 
6 115  PRO n 
6 116  ALA n 
6 117  VAL n 
6 118  ALA n 
6 119  THR n 
6 120  ALA n 
6 121  LYS n 
6 122  ALA n 
6 123  ALA n 
6 124  ASP n 
6 125  ASP n 
6 126  ASP n 
6 127  ILE n 
6 128  ASP n 
6 129  GLU n 
6 130  PRO n 
6 131  SER n 
6 132  GLU n 
6 133  LYS n 
6 134  ASP n 
6 135  LYS n 
6 136  ALA n 
6 137  SER n 
6 138  GLY n 
6 139  ASP n 
6 140  PHE n 
6 141  VAL n 
6 142  TRP n 
6 143  ASP n 
6 144  GLU n 
6 145  GLU n 
6 146  GLU n 
6 147  SER n 
6 148  GLU n 
6 149  ALA n 
6 150  LEU n 
6 151  ARG n 
6 152  GLN n 
6 153  ALA n 
6 154  ARG n 
6 155  LYS n 
6 156  ASP n 
6 157  ALA n 
6 158  GLU n 
6 159  LEU n 
6 160  THR n 
6 161  ALA n 
6 162  SER n 
6 163  ALA n 
6 164  ASP n 
6 165  SER n 
6 166  VAL n 
6 167  ARG n 
6 168  ALA n 
6 169  TYR n 
6 170  LEU n 
6 171  LYS n 
6 172  GLN n 
6 173  ILE n 
6 174  GLY n 
6 175  LYS n 
6 176  VAL n 
6 177  ALA n 
6 178  LEU n 
6 179  LEU n 
6 180  ASN n 
6 181  ALA n 
6 182  GLU n 
6 183  GLU n 
6 184  GLU n 
6 185  VAL n 
6 186  GLU n 
6 187  LEU n 
6 188  ALA n 
6 189  LYS n 
6 190  ARG n 
6 191  ILE n 
6 192  GLU n 
6 193  ALA n 
6 194  GLY n 
6 195  LEU n 
6 196  TYR n 
6 197  ALA n 
6 198  THR n 
6 199  GLN n 
6 200  LYS n 
6 201  LEU n 
6 202  ALA n 
6 203  GLU n 
6 204  LEU n 
6 205  ALA n 
6 206  GLU n 
6 207  LYS n 
6 208  GLY n 
6 209  GLU n 
6 210  LYS n 
6 211  LEU n 
6 212  PRO n 
6 213  VAL n 
6 214  GLN n 
6 215  GLN n 
6 216  ARG n 
6 217  ARG n 
6 218  ASP n 
6 219  MET n 
6 220  GLN n 
6 221  TRP n 
6 222  ILE n 
6 223  CYS n 
6 224  ARG n 
6 225  ASP n 
6 226  GLY n 
6 227  ASP n 
6 228  ARG n 
6 229  ALA n 
6 230  LYS n 
6 231  ASN n 
6 232  HIS n 
6 233  LEU n 
6 234  LEU n 
6 235  GLU n 
6 236  ALA n 
6 237  ASN n 
6 238  LEU n 
6 239  ARG n 
6 240  LEU n 
6 241  VAL n 
6 242  VAL n 
6 243  SER n 
6 244  LEU n 
6 245  ALA n 
6 246  LYS n 
6 247  ARG n 
6 248  TYR n 
6 249  THR n 
6 250  GLY n 
6 251  ARG n 
6 252  GLY n 
6 253  MET n 
6 254  ALA n 
6 255  PHE n 
6 256  LEU n 
6 257  ASP n 
6 258  LEU n 
6 259  ILE n 
6 260  GLN n 
6 261  GLU n 
6 262  GLY n 
6 263  ASN n 
6 264  LEU n 
6 265  GLY n 
6 266  LEU n 
6 267  ILE n 
6 268  ARG n 
6 269  ALA n 
6 270  VAL n 
6 271  GLU n 
6 272  LYS n 
6 273  PHE n 
6 274  ASP n 
6 275  TYR n 
6 276  THR n 
6 277  LYS n 
6 278  GLY n 
6 279  TYR n 
6 280  LYS n 
6 281  PHE n 
6 282  SER n 
6 283  THR n 
6 284  TYR n 
6 285  ALA n 
6 286  THR n 
6 287  TRP n 
6 288  TRP n 
6 289  ILE n 
6 290  ARG n 
6 291  GLN n 
6 292  ALA n 
6 293  ILE n 
6 294  THR n 
6 295  ARG n 
6 296  ALA n 
6 297  MET n 
6 298  ALA n 
6 299  ASP n 
6 300  GLN n 
6 301  ALA n 
6 302  ARG n 
6 303  THR n 
6 304  ILE n 
6 305  ARG n 
6 306  ILE n 
6 307  PRO n 
6 308  VAL n 
6 309  HIS n 
6 310  MET n 
6 311  VAL n 
6 312  GLU n 
6 313  VAL n 
6 314  ILE n 
6 315  ASN n 
6 316  LYS n 
6 317  LEU n 
6 318  GLY n 
6 319  ARG n 
6 320  ILE n 
6 321  GLN n 
6 322  ARG n 
6 323  GLU n 
6 324  LEU n 
6 325  LEU n 
6 326  GLN n 
6 327  ASP n 
6 328  LEU n 
6 329  GLY n 
6 330  ARG n 
6 331  GLU n 
6 332  PRO n 
6 333  THR n 
6 334  PRO n 
6 335  GLU n 
6 336  GLU n 
6 337  LEU n 
6 338  ALA n 
6 339  LYS n 
6 340  GLU n 
6 341  MET n 
6 342  ASP n 
6 343  ILE n 
6 344  THR n 
6 345  PRO n 
6 346  GLU n 
6 347  LYS n 
6 348  VAL n 
6 349  LEU n 
6 350  GLU n 
6 351  ILE n 
6 352  GLN n 
6 353  GLN n 
6 354  TYR n 
6 355  ALA n 
6 356  ARG n 
6 357  GLU n 
6 358  PRO n 
6 359  ILE n 
6 360  SER n 
6 361  LEU n 
6 362  ASP n 
6 363  GLN n 
6 364  THR n 
6 365  ILE n 
6 366  GLY n 
6 367  ASP n 
6 368  GLU n 
6 369  GLY n 
6 370  ASP n 
6 371  SER n 
6 372  GLN n 
6 373  LEU n 
6 374  GLY n 
6 375  ASP n 
6 376  PHE n 
6 377  ILE n 
6 378  GLU n 
6 379  ASP n 
6 380  SER n 
6 381  GLU n 
6 382  ALA n 
6 383  VAL n 
6 384  VAL n 
6 385  ALA n 
6 386  VAL n 
6 387  ASP n 
6 388  ALA n 
6 389  VAL n 
6 390  SER n 
6 391  PHE n 
6 392  THR n 
6 393  LEU n 
6 394  LEU n 
6 395  GLN n 
6 396  ASP n 
6 397  GLN n 
6 398  LEU n 
6 399  GLN n 
6 400  SER n 
6 401  VAL n 
6 402  LEU n 
6 403  GLU n 
6 404  THR n 
6 405  LEU n 
6 406  SER n 
6 407  GLU n 
6 408  ARG n 
6 409  GLU n 
6 410  ALA n 
6 411  GLY n 
6 412  VAL n 
6 413  VAL n 
6 414  ARG n 
6 415  LEU n 
6 416  ARG n 
6 417  PHE n 
6 418  GLY n 
6 419  LEU n 
6 420  THR n 
6 421  ASP n 
6 422  GLY n 
6 423  GLN n 
6 424  PRO n 
6 425  ARG n 
6 426  THR n 
6 427  LEU n 
6 428  ASP n 
6 429  GLU n 
6 430  ILE n 
6 431  GLY n 
6 432  GLN n 
6 433  VAL n 
6 434  TYR n 
6 435  GLY n 
6 436  VAL n 
6 437  THR n 
6 438  ARG n 
6 439  GLU n 
6 440  ARG n 
6 441  ILE n 
6 442  ARG n 
6 443  GLN n 
6 444  ILE n 
6 445  GLU n 
6 446  SER n 
6 447  LYS n 
6 448  THR n 
6 449  MET n 
6 450  SER n 
6 451  LYS n 
6 452  LEU n 
6 453  ARG n 
6 454  HIS n 
6 455  PRO n 
6 456  SER n 
6 457  ARG n 
6 458  SER n 
6 459  GLN n 
6 460  VAL n 
6 461  LEU n 
6 462  ARG n 
6 463  ASP n 
6 464  TYR n 
6 465  LEU n 
6 466  ASP n 
7 1    DG  n 
7 2    DC  n 
7 3    DT  n 
7 4    DT  n 
7 5    DG  n 
7 6    DA  n 
7 7    DC  n 
7 8    DA  n 
7 9    DA  n 
7 10   DA  n 
7 11   DA  n 
7 12   DG  n 
7 13   DT  n 
7 14   DG  n 
7 15   DT  n 
7 16   DT  n 
7 17   DA  n 
7 18   DA  n 
7 19   DA  n 
7 20   DT  n 
7 21   DT  n 
7 22   DG  n 
7 23   DT  n 
7 24   DG  n 
7 25   DC  n 
7 26   DT  n 
7 27   DA  n 
7 28   DT  n 
7 29   DA  n 
7 30   DC  n 
7 31   DT  n 
8 1    DA  n 
8 2    DG  n 
8 3    DC  n 
8 4    DA  n 
8 5    DC  n 
8 6    DA  n 
8 7    DA  n 
8 8    DT  n 
8 9    DT  n 
8 10   DT  n 
8 11   DA  n 
8 12   DA  n 
8 13   DC  n 
8 14   DA  n 
8 15   DC  n 
8 16   DT  n 
8 17   DT  n 
8 18   DT  n 
8 19   DT  n 
8 20   DG  n 
8 21   DT  n 
8 22   DC  n 
8 23   DA  n 
8 24   DA  n 
8 25   DG  n 
8 26   DC  n 
# 
_entity_src_gen.entity_id                          6 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   466 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'sigA, MSMEG_2758' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC 700084 / mc(2)155' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     246196 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     866768 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample 1 350  ? 'Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)' 246196 ? ? 'ATCC 700084 / mc(2)155' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
2 1 sample ? ?    ? 'Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)' 246196 ? ? 'ATCC 700084 / mc(2)155' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
3 1 sample 1 1169 ? 'Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)' 246196 ? ? 'ATCC 700084 / mc(2)155' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
4 1 sample 1 1317 ? 'Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)' 246196 ? ? 'ATCC 700084 / mc(2)155' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
5 1 sample 1 107  ? 'Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)' 246196 ? ? 'ATCC 700084 / mc(2)155' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
7 1 sample 1 31 'synthetic construct' ? 32630 ? 
8 1 sample 1 26 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RBPA_MYCS2   A0QZ11 ? 1 
;MADRVLRGSRLGAVSYETDRNHDLAPRQVARYRTDNGEEFDVPFADDAEIPGTWLCRNGLEGTLIEGDVPEPKKVKPPRT
HWDMLLERRSVEELEELLKERLDLIKAKRRGTGS
;
1 
2 UNP RPOA_MYCS2   A0QSL8 ? 2 
;MLISQRPTLSEETVAENRSRFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTDIILNL
KGLVVSSDDDEPVTMYLRKQGPGVVTAGDIVPPAGVTVHNPDMHIATLNDKGKLEVELVVERGRGYVPAVQNKASGAEIG
RIPVDSIYSPVLKVTYKVEATRVEQRTDFDKLIIDVETKNSISPRDALASAGGTLVELFGLARELNADSEHIEIGPSPAE
ADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPATFDPSEV
AGYDAATGTWTSDAGYDLDDNQDYAETEQL
;
1 
3 UNP RPOB_MYCS2   P60281 ? 3 
;MLEGCILAVSSQSKSNAITNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLVGSDRWRQAAIDRGEENPVGGLEEV
LAELSPIEDFSGSMSLSFSDPRFDEVKASVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMMTEKGTFIIN
GTERVVVSQLVRSPGVYFDETIDKSTEKTLHSVKVIPGRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKALGWTNEQIV
ERFGFSEIMMGTLEKDTTSGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLNAGKPIT
SSTLTEEDVVATIEYLVRLHEGQTSMTVPGGVEVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQDV
EAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETP
EGPNIGLIGSLSVYARVNPFGFIETPYRKVENGVVTDQIDYLTADEEDRHVVAQANSPTDENGRFTEDRVMVRKKGGEVE
FVSADQVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVADKTGV
IEEVSADYITVMADDGTRQSYRLRKFARSNHGTCANQRPIVDAGQRVEAGQVIADGPCTQNGEMALGKNLLVAIMPWEGH
NYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVGKVTPK
GETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRH
GNKGVIGKILPVEDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLGWVAKAGWNIDVAAGVPDWASKLPEELYSAPAD
STVATPVFDGAQEGELAGLLGSTLPNRDGEVMVDADGKSTLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPY
SMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQ
SLCLNVEVLSSDGAAIEMRDGDDEDLERAAANLGINLSRNESASVEDLA
;
1 
4 UNP RPOC_MYCS2   A0QS66 ? 4 
;MLDVNFFDELRIGLATADDIRNWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDDEMRHNELSTLEAEMAVEKK
AVEDQRDADLEARAQKLEADLAELEAEGAKSDVRRKVRDSGEREMRQLRDRAQRELDRLDEIWNTFTKLAPKQLIVDEVL
YRELQDRYGEYFTGAMGAESIKKLIENFDIDAEAESLREVIRSGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPQLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGKPLAMPRLDMVTGLYYLTTLVEGATGEYQAATKDAPEQGVYSSPAEAIMAMDRGALSVRAKIKVRLTEL
RPPTDLEAQLFENGWKPGDAWTAETTLGRVMFNELLPKSYPFVNEQMHKKVQARIINDLAERFPMIVVAQTVDKLKDAGF
YWATRSGVTVSMADVLVPPQKQEILERHEAEADAIERKYQRGALNHTERNESLVKIWQDATEEVGKALEEFYPADNPIIT
IVKSGATGNLTQTRTLAGMKGLVTNPKGEFIPRPIKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDVS
QDVIVREHDCETERGINVTLAERGPDGTLIRDAHVETSAFARTLATDAVDANGNVIIERGHDLGDPAIDALLAAGITTVK
VRSVLTCTSATGVCAMCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVTGGADIVGGLPRVQELFEARV
PRNKAPIADVAGRVRLEESDKFFKITIVPDDGGEEVVYDKLSKRQRLRVITHEDGTEGVLSDGDHVEVGDQLMEGAADPH
EVLRVQGPREVQIHLVKEVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLTERAEFEAENRRVVAEGGE
PAAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGISRYRNIQVQPTEEAR
AAAYTIPSYEDQYYSPDFGQATGAAVPLDDYGYSDYR
;
1 
5 UNP RPOZ_MYCS2   A0QWT1 ? 5 
;MSTPHADAQLNAADDLGIDSSAASAYDTPLGITNPPIDELLSRASSKYALVIYAAKRARQINDYYNQLGDGILEYVGPLV
EPGLQEKPLSIALREIHGDLLEHTEGE
;
1 
6 UNP A0QW02_MYCS2 A0QW02 ? 6 
;MAATKASPATEEPVKRTATKTPAKKAPAKRAAKSAAAKAGGKAPAKKAPAKRAAKGTAAKPEDGVTDDLEVTDDLEAEPG
EDLDVEDTDLELDDLDSDDDTAVEDEEEEADAATPAVATAKAADDDIDEPSEKDKASGDFVWDEEESEALRQARKDAELT
ASADSVRAYLKQIGKVALLNAEEEVELAKRIEAGLYATQKLAELAEKGEKLPVQQRRDMQWICRDGDRAKNHLLEANLRL
VVSLAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRI
QRELLQDLGREPTPEELAKEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQS
VLETLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD
;
1 
7 PDB 6VVT         6VVT   ? 7 ? 1 
8 PDB 6VVT         6VVT   ? 8 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6VVT J 1 ? 114  ? A0QZ11 1 ? 114  ? 1 114  
2 2 6VVT A 1 ? 350  ? A0QSL8 1 ? 350  ? 1 350  
3 2 6VVT B 1 ? 350  ? A0QSL8 1 ? 350  ? 1 350  
4 3 6VVT C 1 ? 1169 ? P60281 1 ? 1169 ? 1 1169 
5 4 6VVT D 1 ? 1317 ? A0QS66 1 ? 1317 ? 1 1317 
6 5 6VVT E 1 ? 107  ? A0QWT1 1 ? 107  ? 1 107  
7 6 6VVT F 1 ? 466  ? A0QW02 1 ? 466  ? 1 466  
8 7 6VVT O 1 ? 31   ? 6VVT   1 ? 31   ? 1 31   
9 8 6VVT P 1 ? 26   ? 6VVT   1 ? 26   ? 1 26   
# 
_struct_ref_seq_dif.align_id                     4 
_struct_ref_seq_dif.pdbx_pdb_id_code             6VVT 
_struct_ref_seq_dif.mon_id                       LEU 
_struct_ref_seq_dif.pdbx_pdb_strand_id           C 
_struct_ref_seq_dif.seq_num                      447 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P60281 
_struct_ref_seq_dif.db_mon_id                    SER 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          447 
_struct_ref_seq_dif.details                      variant 
_struct_ref_seq_dif.pdbx_auth_seq_num            447 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                 'C10 H15 N2 O8 P' 322.208 
EDO non-polymer         . 1,2-ETHANEDIOL                       'ETHYLENE GLYCOL' 'C2 H6 O2'        62.068  
GLN 'L-peptide linking' y GLUTAMINE                            ?                 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?                 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?                 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?                 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ?                 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                        ?                 'O4 S -2'         96.063  
SRN non-polymer         . 'SORANGICIN A'                       ?                 'C47 H66 O11'     807.020 
THR 'L-peptide linking' y THREONINE                            ?                 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ?                 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6VVT 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.99 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         58.85 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'0.1 M Bis-Tris, pH 6.0, 0.2 M lithium sulfate, 20% w/v PEG3350, 2.5% v/v ethylene glycol, 1% v/v DMSO' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     80 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-11-20 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'cryo-cooled double crystal Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9792 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6VVT 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.900 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       112933 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.600 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.700 
_reflns.pdbx_Rmerge_I_obs                0.155 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            4.900 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.884 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.173 
_reflns.pdbx_Rpim_I_all                  0.078 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         527429 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_CC_star 
_reflns_shell.pdbx_R_split 
2.900 3.000  ? ? ? ? ? ? 9577  82.200 ? ? ? ? ?     ? ? ? ? ? ? ? ? 3.100 ? 0.537 ? ? ?     6.856 ? 1  1 0.123 ? ? 
3.000 3.120  ? ? ? ? ? ? 10855 93.200 ? ? ? ? 5.218 ? ? ? ? ? ? ? ? 4.000 ? 0.588 ? ? 5.922 2.727 ? 2  1 0.263 ? ? 
3.120 3.270  ? ? ? ? ? ? 11391 97.700 ? ? ? ? 2.024 ? ? ? ? ? ? ? ? 4.400 ? 0.655 ? ? 2.278 1.019 ? 3  1 0.412 ? ? 
3.270 3.440  ? ? ? ? ? ? 11467 98.600 ? ? ? ? 1.225 ? ? ? ? ? ? ? ? 4.700 ? 0.695 ? ? 1.373 0.606 ? 4  1 0.626 ? ? 
3.440 3.650  ? ? ? ? ? ? 11603 99.500 ? ? ? ? 0.682 ? ? ? ? ? ? ? ? 5.100 ? 0.685 ? ? 0.757 0.321 ? 5  1 0.818 ? ? 
3.650 3.940  ? ? ? ? ? ? 11598 99.000 ? ? ? ? 0.436 ? ? ? ? ? ? ? ? 5.000 ? 0.931 ? ? 0.486 0.209 ? 6  1 0.917 ? ? 
3.940 4.330  ? ? ? ? ? ? 11508 98.500 ? ? ? ? 0.222 ? ? ? ? ? ? ? ? 4.800 ? 0.895 ? ? 0.248 0.109 ? 7  1 0.971 ? ? 
4.330 4.960  ? ? ? ? ? ? 11629 99.400 ? ? ? ? 0.135 ? ? ? ? ? ? ? ? 5.200 ? 1.099 ? ? 0.149 0.062 ? 8  1 0.990 ? ? 
4.960 6.240  ? ? ? ? ? ? 11577 98.600 ? ? ? ? 0.098 ? ? ? ? ? ? ? ? 5.000 ? 0.930 ? ? 0.109 0.046 ? 9  1 0.993 ? ? 
6.240 50.000 ? ? ? ? ? ? 11728 98.800 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 5.000 ? 1.469 ? ? 0.049 0.021 ? 10 1 0.999 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                328.730 
_refine.B_iso_mean                               96.6844 
_refine.B_iso_min                                30.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6VVT 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.9010 
_refine.ls_d_res_low                             49.7460 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     95479 
_refine.ls_number_reflns_R_free                  1709 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    82.6000 
_refine.ls_percent_reflns_R_free                 1.7900 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2408 
_refine.ls_R_factor_R_free                       0.2747 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2402 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.330 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 5TW1' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 36.3600 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4400 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.9010 
_refine_hist.d_res_low                        49.7460 
_refine_hist.number_atoms_solvent             19 
_refine_hist.number_atoms_total               23759 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       3056 
_refine_hist.pdbx_B_iso_mean_ligand           108.10 
_refine_hist.pdbx_B_iso_mean_solvent          71.01 
_refine_hist.pdbx_number_atoms_protein        22464 
_refine_hist.pdbx_number_atoms_nucleic_acid   1161 
_refine_hist.pdbx_number_atoms_ligand         115 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.002  ? 24237 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.440  ? 33162 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.037  ? 3876  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 4152  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 14.782 ? 14497 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.9011 2.9864 . . 18  427  5.0000   . . . 0.9390 0.0000 0.7259 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9864 3.0828 . . 17  655  7.0000   . . . 0.6553 0.0000 0.8562 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0828 3.1930 . . 156 8408 90.0000  . . . 0.3706 0.0000 0.3967 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1930 3.3208 . . 153 9228 97.0000  . . . 0.3576 0.0000 0.3447 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3208 3.4719 . . 173 9368 100.0000 . . . 0.3739 0.0000 0.3239 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4719 3.6549 . . 173 9381 99.0000  . . . 0.3606 0.0000 0.3066 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6549 3.8838 . . 161 9341 99.0000  . . . 0.3194 0.0000 0.2736 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8838 4.1835 . . 169 9274 98.0000  . . . 0.2917 0.0000 0.2435 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1835 4.6043 . . 175 9457 100.0000 . . . 0.2494 0.0000 0.2109 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.6043 5.2699 . . 163 9356 99.0000  . . . 0.2189 0.0000 0.2172 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.2699 6.6370 . . 180 9389 99.0000  . . . 0.2707 0.0000 0.2410 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.6370 49.74  . . 171 9486 99.0000  . . . 0.2309 0.0000 0.1912 . . . . . . . . . . . 
# 
_struct.entry_id                     6VVT 
_struct.title                        
;Crystal structure of a Mycobacterium smegmatis transcription initiation complex with Rifampicin-resistant RNA polymerase and antibiotic Sorangicin
;
_struct.pdbx_descriptor              
;RNA polymerase-binding protein RbpA, DNA-directed RNA polymerase subunit alpha, DNA-directed RNA polymerase subunit beta, DNA-directed RNA polymerase subunit beta', DNA-directed RNA polymerase subunit omega, RNA polymerase sigma factor SigA/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6VVT 
_struct_keywords.text            'DNA binding, antibiotic, TRANSCRIPTION, TRANSFERASE-DNA-ANTIBIOTIC complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION,TRANSFERASE/DNA/ANTIBIOTIC 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 2  ? 
D  N N 3  ? 
E  N N 4  ? 
F  N N 5  ? 
G  N N 6  ? 
H  N N 7  ? 
I  N N 8  ? 
J  N N 9  ? 
K  N N 10 ? 
L  N N 11 ? 
M  N N 11 ? 
N  N N 12 ? 
O  N N 12 ? 
P  N N 12 ? 
Q  N N 12 ? 
R  N N 12 ? 
S  N N 12 ? 
T  N N 12 ? 
U  N N 12 ? 
V  N N 12 ? 
W  N N 13 ? 
X  N N 13 ? 
Y  N N 13 ? 
Z  N N 13 ? 
AA N N 13 ? 
BA N N 13 ? 
CA N N 13 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 THR A 80   ? GLU A 87   ? THR J 80   GLU J 87   1 ? 8  
HELX_P HELX_P2   AA2 SER A 90   ? ARG A 109  ? SER J 90   ARG J 109  1 ? 20 
HELX_P HELX_P3   AA3 PHE B 30   ? ILE B 46   ? PHE A 30   ILE A 46   1 ? 17 
HELX_P HELX_P4   AA4 ASP B 72   ? LYS B 81   ? ASP A 72   LYS A 81   1 ? 10 
HELX_P HELX_P5   AA5 SER B 203  ? PHE B 219  ? SER A 203  PHE A 219  1 ? 17 
HELX_P HELX_P6   AA6 GLY C 29   ? SER C 45   ? GLY B 29   SER B 45   1 ? 17 
HELX_P HELX_P7   AA7 ASP C 72   ? GLY C 82   ? ASP B 72   GLY B 82   1 ? 11 
HELX_P HELX_P8   AA8 SER C 203  ? GLU C 224  ? SER B 203  GLU B 224  1 ? 22 
HELX_P HELX_P9   AA9 LEU D 45   ? GLY D 57   ? LEU C 45   GLY C 57   1 ? 13 
HELX_P HELX_P10  AB1 SER D 58   ? ARG D 68   ? SER C 58   ARG C 68   1 ? 11 
HELX_P HELX_P11  AB2 GLY D 75   ? SER D 85   ? GLY C 75   SER C 85   1 ? 11 
HELX_P HELX_P12  AB3 SER D 109  ? ASP D 117  ? SER C 109  ASP C 117  1 ? 9  
HELX_P HELX_P13  AB4 THR D 371  ? GLN D 398  ? THR C 371  GLN C 398  1 ? 28 
HELX_P HELX_P14  AB5 THR D 404  ? ILE D 409  ? THR C 404  ILE C 409  1 ? 6  
HELX_P HELX_P15  AB6 ILE D 411  ? GLY D 423  ? ILE C 411  GLY C 423  1 ? 13 
HELX_P HELX_P16  AB7 ASN D 435  ? LYS D 443  ? ASN C 435  LYS C 443  1 ? 9  
HELX_P HELX_P17  AB8 HIS D 467  ? TYR D 471  ? HIS C 467  TYR C 471  5 ? 5  
HELX_P HELX_P18  AB9 ALA D 524  ? HIS D 530  ? ALA C 524  HIS C 530  1 ? 7  
HELX_P HELX_P19  AC1 ALA D 581  ? ILE D 585  ? ALA C 581  ILE C 585  5 ? 5  
HELX_P HELX_P20  AC2 ASP D 592  ? ARG D 604  ? ASP C 592  ARG C 604  1 ? 13 
HELX_P HELX_P21  AC3 GLY D 620  ? GLY D 630  ? GLY C 620  GLY C 630  1 ? 11 
HELX_P HELX_P22  AC4 ASN D 730  ? GLU D 735  ? ASN C 730  GLU C 735  1 ? 6  
HELX_P HELX_P23  AC5 THR D 806  ? GLY D 817  ? THR C 806  GLY C 817  1 ? 12 
HELX_P HELX_P24  AC6 ASN D 918  ? GLY D 934  ? ASN C 918  GLY C 934  1 ? 17 
HELX_P HELX_P25  AC7 PRO D 944  ? LEU D 950  ? PRO C 944  LEU C 950  5 ? 7  
HELX_P HELX_P26  AC8 GLN D 972  ? SER D 982  ? GLN C 972  SER C 982  1 ? 11 
HELX_P HELX_P27  AC9 LEU D 1027 ? ILE D 1032 ? LEU C 1027 ILE C 1032 1 ? 6  
HELX_P HELX_P28  AD1 GLY D 1060 ? GLY D 1071 ? GLY C 1060 GLY C 1071 1 ? 12 
HELX_P HELX_P29  AD2 ALA D 1072 ? THR D 1081 ? ALA C 1072 THR C 1081 1 ? 10 
HELX_P HELX_P30  AD3 VAL D 1088 ? GLY D 1100 ? VAL C 1088 GLY C 1100 1 ? 13 
HELX_P HELX_P31  AD4 PRO D 1109 ? LEU D 1122 ? PRO C 1109 LEU C 1122 1 ? 14 
HELX_P HELX_P32  AD5 THR E 16   ? SER E 24   ? THR D 16   SER D 24   1 ? 9  
HELX_P HELX_P33  AD6 ARG E 84   ? GLU E 90   ? ARG D 84   GLU D 90   5 ? 7  
HELX_P HELX_P34  AD7 HIS E 103  ? LYS E 108  ? HIS D 103  LYS D 108  1 ? 6  
HELX_P HELX_P35  AD8 SER E 112  ? ASP E 119  ? SER D 112  ASP D 119  1 ? 8  
HELX_P HELX_P36  AD9 ALA E 121  ? TYR E 130  ? ALA D 121  TYR D 130  1 ? 10 
HELX_P HELX_P37  AE1 ASP E 140  ? GLU E 147  ? ASP D 140  GLU D 147  1 ? 8  
HELX_P HELX_P38  AE2 GLU E 147  ? GLU E 187  ? GLU D 147  GLU D 187  1 ? 41 
HELX_P HELX_P39  AE3 LYS E 190  ? LYS E 228  ? LYS D 190  LYS D 228  1 ? 39 
HELX_P HELX_P40  AE4 GLU E 238  ? ARG E 247  ? GLU D 238  ARG D 247  1 ? 10 
HELX_P HELX_P41  AE5 MET E 256  ? ASN E 267  ? MET D 256  ASN D 267  1 ? 12 
HELX_P HELX_P42  AE6 ASP E 269  ? SER E 276  ? ASP D 269  SER D 276  1 ? 8  
HELX_P HELX_P43  AE7 LEU E 277  ? GLU E 279  ? LEU D 277  GLU D 279  5 ? 3  
HELX_P HELX_P44  AE8 GLY E 286  ? SER E 305  ? GLY D 286  SER D 305  1 ? 20 
HELX_P HELX_P45  AE9 SER E 308  ? GLY E 311  ? SER D 308  GLY D 311  5 ? 4  
HELX_P HELX_P46  AF1 SER E 338  ? LEU E 360  ? SER D 338  LEU D 360  1 ? 23 
HELX_P HELX_P47  AF2 PRO E 363  ? ASN E 384  ? PRO D 363  ASN D 384  1 ? 22 
HELX_P HELX_P48  AF3 SER E 401  ? LYS E 407  ? SER D 401  LYS D 407  1 ? 7  
HELX_P HELX_P49  AF4 LYS E 445  ? LEU E 463  ? LYS D 445  LEU D 463  1 ? 19 
HELX_P HELX_P50  AF5 ASN E 468  ? ARG E 478  ? ASN D 468  ARG D 478  1 ? 11 
HELX_P HELX_P51  AF6 GLN E 482  ? ALA E 492  ? GLN D 482  ALA D 492  1 ? 11 
HELX_P HELX_P52  AF7 HIS E 505  ? LEU E 507  ? HIS D 505  LEU D 507  5 ? 3  
HELX_P HELX_P53  AF8 VAL E 528  ? ASN E 533  ? VAL D 528  ASN D 533  1 ? 6  
HELX_P HELX_P54  AF9 SER E 548  ? LEU E 558  ? SER D 548  LEU D 558  1 ? 11 
HELX_P HELX_P55  AG1 LEU E 579  ? THR E 590  ? LEU D 579  THR D 590  1 ? 12 
HELX_P HELX_P56  AG2 SER E 614  ? ARG E 624  ? SER D 614  ARG D 624  1 ? 11 
HELX_P HELX_P57  AG3 PRO E 643  ? PHE E 651  ? PRO D 643  PHE D 651  1 ? 9  
HELX_P HELX_P58  AG4 THR E 666  ? GLU E 674  ? THR D 666  GLU D 674  1 ? 9  
HELX_P HELX_P59  AG5 HIS E 688  ? PHE E 703  ? HIS D 688  PHE D 703  1 ? 16 
HELX_P HELX_P60  AG6 PRO E 704  ? SER E 726  ? PRO D 704  SER D 726  1 ? 23 
HELX_P HELX_P61  AG7 PRO E 738  ? GLY E 762  ? PRO D 738  GLY D 762  1 ? 25 
HELX_P HELX_P62  AG8 HIS E 766  ? GLU E 790  ? HIS D 766  GLU D 790  1 ? 25 
HELX_P HELX_P63  AG9 ASN E 796  ? GLY E 805  ? ASN D 796  GLY D 805  1 ? 10 
HELX_P HELX_P64  AH1 THR E 844  ? GLN E 881  ? THR D 844  GLN D 881  1 ? 38 
HELX_P HELX_P65  AH2 HIS E 914  ? ALA E 919  ? HIS D 914  ALA D 919  1 ? 6  
HELX_P HELX_P66  AH3 GLY E 944  ? GLY E 955  ? GLY D 944  GLY D 955  1 ? 12 
HELX_P HELX_P67  AH4 ALA E 975  ? GLY E 979  ? ALA D 975  GLY D 979  1 ? 5  
HELX_P HELX_P68  AH5 ALA E 993  ? GLU E 1004 ? ALA D 993  GLU D 1004 1 ? 12 
HELX_P HELX_P69  AH6 PRO E 1005 ? LEU E 1009 ? PRO D 1005 LEU D 1009 5 ? 5  
HELX_P HELX_P70  AH7 GLY E 1028 ? GLU E 1037 ? GLY D 1028 GLU D 1037 1 ? 10 
HELX_P HELX_P71  AH8 SER E 1082 ? ARG E 1086 ? SER D 1082 ARG D 1086 5 ? 5  
HELX_P HELX_P72  AH9 ASP E 1118 ? GLY E 1127 ? ASP D 1118 GLY D 1127 1 ? 10 
HELX_P HELX_P73  AI1 GLY E 1127 ? GLN E 1146 ? GLY D 1127 GLN D 1146 1 ? 20 
HELX_P HELX_P74  AI2 HIS E 1151 ? GLN E 1161 ? HIS D 1151 GLN D 1161 1 ? 11 
HELX_P HELX_P75  AI3 ARG E 1184 ? ALA E 1189 ? ARG D 1184 ALA D 1189 1 ? 6  
HELX_P HELX_P76  AI4 GLY E 1210 ? ALA E 1217 ? GLY D 1210 ALA D 1217 1 ? 8  
HELX_P HELX_P77  AI5 SER E 1220 ? GLN E 1228 ? SER D 1220 GLN D 1228 1 ? 9  
HELX_P HELX_P78  AI6 GLU E 1229 ? CYS E 1241 ? GLU D 1229 CYS D 1241 1 ? 13 
HELX_P HELX_P79  AI7 GLY E 1248 ? GLY E 1256 ? GLY D 1248 GLY D 1256 1 ? 9  
HELX_P HELX_P80  AI8 ALA E 1261 ? GLY E 1264 ? ALA D 1261 GLY D 1264 5 ? 4  
HELX_P HELX_P81  AI9 ILE E 1265 ? ASN E 1270 ? ILE D 1265 ASN D 1270 1 ? 6  
HELX_P HELX_P82  AJ1 THR E 1276 ? ALA E 1283 ? THR D 1276 ALA D 1283 1 ? 8  
HELX_P HELX_P83  AJ2 LEU F 30   ? ASN F 34   ? LEU E 30   ASN E 34   5 ? 5  
HELX_P HELX_P84  AJ3 PRO F 36   ? SER F 42   ? PRO E 36   SER E 42   1 ? 7  
HELX_P HELX_P85  AJ4 SER F 46   ? ASN F 66   ? SER E 46   ASN E 66   1 ? 21 
HELX_P HELX_P86  AJ5 LYS F 87   ? GLY F 98   ? LYS E 87   GLY E 98   1 ? 12 
HELX_P HELX_P87  AJ6 ASP G 164  ? GLY G 174  ? ASP F 164  GLY F 174  1 ? 11 
HELX_P HELX_P88  AJ7 ASN G 180  ? LYS G 207  ? ASN F 180  LYS F 207  1 ? 28 
HELX_P HELX_P89  AJ8 PRO G 212  ? LYS G 246  ? PRO F 212  LYS F 246  1 ? 35 
HELX_P HELX_P90  AJ9 ARG G 247  ? THR G 249  ? ARG F 247  THR F 249  5 ? 3  
HELX_P HELX_P91  AK1 ALA G 254  ? PHE G 273  ? ALA F 254  PHE F 273  1 ? 20 
HELX_P HELX_P92  AK2 ASP G 274  ? GLY G 278  ? ASP F 274  GLY F 278  5 ? 5  
HELX_P HELX_P93  AK3 LYS G 280  ? ALA G 301  ? LYS F 280  ALA F 301  1 ? 22 
HELX_P HELX_P94  AK4 PRO G 307  ? GLY G 329  ? PRO F 307  GLY F 329  1 ? 23 
HELX_P HELX_P95  AK5 THR G 333  ? ASP G 342  ? THR F 333  ASP F 342  1 ? 10 
HELX_P HELX_P96  AK6 THR G 344  ? ARG G 356  ? THR F 344  ARG F 356  1 ? 13 
HELX_P HELX_P97  AK7 GLY G 366  ? ASP G 370  ? GLY F 366  ASP F 370  5 ? 5  
HELX_P HELX_P98  AK8 GLN G 372  ? ILE G 377  ? GLN F 372  ILE F 377  5 ? 6  
HELX_P HELX_P99  AK9 VAL G 384  ? LEU G 405  ? VAL F 384  LEU F 405  1 ? 22 
HELX_P HELX_P100 AL1 SER G 406  ? GLY G 418  ? SER F 406  GLY F 418  1 ? 13 
HELX_P HELX_P101 AL2 THR G 426  ? GLY G 435  ? THR F 426  GLY F 435  1 ? 10 
HELX_P HELX_P102 AL3 THR G 437  ? ARG G 453  ? THR F 437  ARG F 453  1 ? 17 
HELX_P HELX_P103 AL4 HIS G 454  ? GLN G 459  ? HIS F 454  GLN F 459  1 ? 6  
HELX_P HELX_P104 AL5 VAL G 460  ? LEU G 465  ? VAL F 460  LEU F 465  5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? E CYS 60  SG ? ? ? 1_555 M ZN .  ZN ? ? D CYS 60  D ZN 2002 1_555 ? ? ? ? ? ? ?            2.221 ? ? 
metalc2  metalc ? ? E CYS 62  SG ? ? ? 1_555 M ZN .  ZN ? ? D CYS 62  D ZN 2002 1_555 ? ? ? ? ? ? ?            2.216 ? ? 
metalc3  metalc ? ? E CYS 75  SG ? ? ? 1_555 M ZN .  ZN ? ? D CYS 75  D ZN 2002 1_555 ? ? ? ? ? ? ?            2.325 ? ? 
metalc4  metalc ? ? E CYS 78  SG ? ? ? 1_555 M ZN .  ZN ? ? D CYS 78  D ZN 2002 1_555 ? ? ? ? ? ? ?            2.180 ? ? 
metalc5  metalc ? ? E CYS 890 SG ? ? ? 1_555 L ZN .  ZN ? ? D CYS 890 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.289 ? ? 
metalc6  metalc ? ? E CYS 967 SG ? ? ? 1_555 L ZN .  ZN ? ? D CYS 967 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.234 ? ? 
metalc7  metalc ? ? E CYS 974 SG ? ? ? 1_555 L ZN .  ZN ? ? D CYS 974 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.415 ? ? 
metalc8  metalc ? ? E CYS 977 SG ? ? ? 1_555 L ZN .  ZN ? ? D CYS 977 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.177 ? ? 
hydrog1  hydrog ? ? H DG  1   N1 ? ? ? 1_555 I DC 26 N3 ? ? O DG  1   P DC 26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog2  hydrog ? ? H DG  1   N2 ? ? ? 1_555 I DC 26 O2 ? ? O DG  1   P DC 26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog3  hydrog ? ? H DG  1   O6 ? ? ? 1_555 I DC 26 N4 ? ? O DG  1   P DC 26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog4  hydrog ? ? H DC  2   N3 ? ? ? 1_555 I DG 25 N1 ? ? O DC  2   P DG 25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog5  hydrog ? ? H DC  2   N4 ? ? ? 1_555 I DG 25 O6 ? ? O DC  2   P DG 25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog6  hydrog ? ? H DC  2   O2 ? ? ? 1_555 I DG 25 N2 ? ? O DC  2   P DG 25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog7  hydrog ? ? H DT  3   N3 ? ? ? 1_555 I DA 24 N1 ? ? O DT  3   P DA 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog8  hydrog ? ? H DT  3   O4 ? ? ? 1_555 I DA 24 N6 ? ? O DT  3   P DA 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog9  hydrog ? ? H DT  4   N3 ? ? ? 1_555 I DA 23 N1 ? ? O DT  4   P DA 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog10 hydrog ? ? H DT  4   O4 ? ? ? 1_555 I DA 23 N6 ? ? O DT  4   P DA 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog11 hydrog ? ? H DG  5   N1 ? ? ? 1_555 I DC 22 N3 ? ? O DG  5   P DC 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog12 hydrog ? ? H DG  5   N2 ? ? ? 1_555 I DC 22 O2 ? ? O DG  5   P DC 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog13 hydrog ? ? H DG  5   O6 ? ? ? 1_555 I DC 22 N4 ? ? O DG  5   P DC 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog14 hydrog ? ? H DA  6   N1 ? ? ? 1_555 I DG 20 N1 ? ? O DA  6   P DG 20   1_555 ? ? ? ? ? ? TYPE_8_PAIR  ?     ? ? 
hydrog15 hydrog ? ? H DA  6   N6 ? ? ? 1_555 I DG 20 O6 ? ? O DA  6   P DG 20   1_555 ? ? ? ? ? ? TYPE_8_PAIR  ?     ? ? 
hydrog16 hydrog ? ? H DA  6   N1 ? ? ? 1_555 I DT 21 N3 ? ? O DA  6   P DT 21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog17 hydrog ? ? H DA  6   N6 ? ? ? 1_555 I DT 21 O4 ? ? O DA  6   P DT 21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog18 hydrog ? ? H DC  7   O2 ? ? ? 1_555 I DG 20 N2 ? ? O DC  7   P DG 20   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? ? 
hydrog19 hydrog ? ? H DA  8   N1 ? ? ? 1_555 I DT 19 N3 ? ? O DA  8   P DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog20 hydrog ? ? H DA  8   N6 ? ? ? 1_555 I DT 19 O4 ? ? O DA  8   P DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog21 hydrog ? ? H DA  9   N1 ? ? ? 1_555 I DT 18 N3 ? ? O DA  9   P DT 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog22 hydrog ? ? H DA  9   N6 ? ? ? 1_555 I DT 18 O4 ? ? O DA  9   P DT 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog23 hydrog ? ? H DA  10  N6 ? ? ? 1_555 I DT 16 O4 ? ? O DA  10  P DT 16   1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? ? 
hydrog24 hydrog ? ? H DA  10  N1 ? ? ? 1_555 I DT 17 N3 ? ? O DA  10  P DT 17   1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? ? 
hydrog25 hydrog ? ? H DA  11  N1 ? ? ? 1_555 I DT 16 N3 ? ? O DA  11  P DT 16   1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? ? 
hydrog26 hydrog ? ? H DG  12  N1 ? ? ? 1_555 I DC 15 N3 ? ? O DG  12  P DC 15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog27 hydrog ? ? H DG  12  N2 ? ? ? 1_555 I DC 15 O2 ? ? O DG  12  P DC 15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog28 hydrog ? ? H DG  12  O6 ? ? ? 1_555 I DC 15 N4 ? ? O DG  12  P DC 15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog29 hydrog ? ? H DT  13  N3 ? ? ? 1_555 I DA 14 N1 ? ? O DT  13  P DA 14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog30 hydrog ? ? H DT  13  O4 ? ? ? 1_555 I DA 14 N6 ? ? O DT  13  P DA 14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog31 hydrog ? ? H DG  14  N1 ? ? ? 1_555 I DC 13 N3 ? ? O DG  14  P DC 13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog32 hydrog ? ? H DG  14  N2 ? ? ? 1_555 I DC 13 O2 ? ? O DG  14  P DC 13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog33 hydrog ? ? H DG  14  O6 ? ? ? 1_555 I DC 13 N4 ? ? O DG  14  P DC 13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog34 hydrog ? ? H DT  15  N3 ? ? ? 1_555 I DA 12 N1 ? ? O DT  15  P DA 12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog35 hydrog ? ? H DT  15  O4 ? ? ? 1_555 I DA 12 N6 ? ? O DT  15  P DA 12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog36 hydrog ? ? H DT  16  N3 ? ? ? 1_555 I DA 11 N1 ? ? O DT  16  P DA 11   1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? ? 
hydrog37 hydrog ? ? H DA  17  N1 ? ? ? 1_555 I DT 10 N3 ? ? O DA  17  P DT 10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog38 hydrog ? ? H DA  17  N6 ? ? ? 1_555 I DT 10 O4 ? ? O DA  17  P DT 10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog39 hydrog ? ? H DA  18  N1 ? ? ? 1_555 I DT 9  N3 ? ? O DA  18  P DT 9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog40 hydrog ? ? H DA  18  N6 ? ? ? 1_555 I DT 9  O4 ? ? O DA  18  P DT 9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog41 hydrog ? ? H DA  19  N1 ? ? ? 1_555 I DT 8  N3 ? ? O DA  19  P DT 8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog42 hydrog ? ? H DA  19  N6 ? ? ? 1_555 I DT 8  O4 ? ? O DA  19  P DT 8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog43 hydrog ? ? H DT  20  N3 ? ? ? 1_555 I DA 7  N1 ? ? O DT  20  P DA 7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog44 hydrog ? ? H DT  20  O4 ? ? ? 1_555 I DA 7  N6 ? ? O DT  20  P DA 7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog45 hydrog ? ? H DT  21  N3 ? ? ? 1_555 I DA 6  N1 ? ? O DT  21  P DA 6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog46 hydrog ? ? H DT  21  O4 ? ? ? 1_555 I DA 6  N6 ? ? O DT  21  P DA 6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog47 hydrog ? ? H DG  22  N1 ? ? ? 1_555 I DC 5  N3 ? ? O DG  22  P DC 5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog48 hydrog ? ? H DG  22  N2 ? ? ? 1_555 I DC 5  O2 ? ? O DG  22  P DC 5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog49 hydrog ? ? H DG  22  O6 ? ? ? 1_555 I DC 5  N4 ? ? O DG  22  P DC 5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog50 hydrog ? ? H DT  23  N3 ? ? ? 1_555 I DA 4  N1 ? ? O DT  23  P DA 4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog51 hydrog ? ? H DT  23  O4 ? ? ? 1_555 I DA 4  N6 ? ? O DT  23  P DA 4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog52 hydrog ? ? H DG  24  N1 ? ? ? 1_555 I DC 3  N3 ? ? O DG  24  P DC 3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog53 hydrog ? ? H DG  24  N2 ? ? ? 1_555 I DC 3  O2 ? ? O DG  24  P DC 3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog54 hydrog ? ? H DG  24  O6 ? ? ? 1_555 I DC 3  N4 ? ? O DG  24  P DC 3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog55 hydrog ? ? H DC  25  N3 ? ? ? 1_555 I DG 2  N1 ? ? O DC  25  P DG 2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog56 hydrog ? ? H DC  25  N4 ? ? ? 1_555 I DG 2  O6 ? ? O DC  25  P DG 2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog57 hydrog ? ? H DC  25  O2 ? ? ? 1_555 I DG 2  N2 ? ? O DC  25  P DG 2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog58 hydrog ? ? H DT  26  N3 ? ? ? 1_555 I DA 1  N1 ? ? O DT  26  P DA 1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog59 hydrog ? ? H DT  26  O4 ? ? ? 1_555 I DA 1  N6 ? ? O DT  26  P DA 1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLU 24   B . ? GLU 24   A PRO 25   B ? PRO 25   A 1 -9.24 
2  GLY 48   B . ? GLY 48   A ALA 49   B ? ALA 49   A 1 1.54  
3  GLU 24   C . ? GLU 24   B PRO 25   C ? PRO 25   B 1 -7.77 
4  PRO 28   C . ? PRO 28   B GLY 29   C ? GLY 29   B 1 -0.92 
5  SER 85   D . ? SER 85   C PRO 86   D ? PRO 86   C 1 0.07  
6  VAL 110  E . ? VAL 110  D PRO 111  E ? PRO 111  D 1 -2.30 
7  ALA 501  E . ? ALA 501  D PRO 502  E ? PRO 502  D 1 -0.13 
8  ASP 1071 E . ? ASP 1071 D GLY 1072 E ? GLY 1072 D 1 -1.56 
9  ASN 34   F . ? ASN 34   E PRO 35   F ? PRO 35   E 1 -1.17 
10 LEU 68   F . ? LEU 68   E GLY 69   F ? GLY 69   E 1 -2.92 
11 GLY 77   F . ? GLY 77   E PRO 78   F ? PRO 78   E 1 0.97  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 5 ? 
AA4 ? 4 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 3 ? 
AB6 ? 3 ? 
AB7 ? 3 ? 
AB8 ? 5 ? 
AB9 ? 3 ? 
AC1 ? 4 ? 
AC2 ? 2 ? 
AC3 ? 2 ? 
AC4 ? 8 ? 
AC5 ? 4 ? 
AC6 ? 3 ? 
AC7 ? 2 ? 
AC8 ? 8 ? 
AC9 ? 2 ? 
AD1 ? 2 ? 
AD2 ? 2 ? 
AD3 ? 3 ? 
AD4 ? 3 ? 
AD5 ? 2 ? 
AD6 ? 3 ? 
AD7 ? 2 ? 
AD8 ? 2 ? 
AD9 ? 2 ? 
AE1 ? 4 ? 
AE2 ? 2 ? 
AE3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? parallel      
AB3 2 3 ? parallel      
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB6 1 2 ? parallel      
AB6 2 3 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? parallel      
AB8 4 5 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC4 4 5 ? parallel      
AC4 5 6 ? anti-parallel 
AC4 6 7 ? parallel      
AC4 7 8 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC8 4 5 ? anti-parallel 
AC8 5 6 ? parallel      
AC8 6 7 ? anti-parallel 
AC8 7 8 ? parallel      
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? parallel      
AD5 1 2 ? anti-parallel 
AD6 1 2 ? parallel      
AD6 2 3 ? anti-parallel 
AD7 1 2 ? parallel      
AD8 1 2 ? anti-parallel 
AD9 1 2 ? parallel      
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE1 3 4 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLU A 39   ? PHE A 44   ? GLU J 39   PHE J 44   
AA1 2 GLN A 28   ? THR A 34   ? GLN J 28   THR J 34   
AA1 3 GLU A 61   ? LEU A 64   ? GLU J 61   LEU J 64   
AA1 4 THR A 53   ? LEU A 55   ? THR J 53   LEU J 55   
AA2 1 THR B 8    ? SER B 10   ? THR A 8    SER A 10   
AA2 2 ARG B 18   ? LEU B 26   ? ARG A 18   LEU A 26   
AA2 3 ASP B 190  ? THR B 198  ? ASP A 190  THR A 198  
AA2 4 VAL B 171  ? VAL B 178  ? VAL A 171  VAL A 178  
AA3 1 ILE B 110  ? VAL B 111  ? ILE A 110  VAL A 111  
AA3 2 VAL B 93   ? GLN B 100  ? VAL A 93   GLN A 100  
AA3 3 LYS B 133  ? VAL B 147  ? LYS A 133  VAL A 147  
AA3 4 PRO B 47   ? ILE B 56   ? PRO A 47   ILE A 56   
AA3 5 ILE B 162  ? PRO B 163  ? ILE A 162  PRO A 163  
AA4 1 ILE B 110  ? VAL B 111  ? ILE A 110  VAL A 111  
AA4 2 VAL B 93   ? GLN B 100  ? VAL A 93   GLN A 100  
AA4 3 LYS B 133  ? VAL B 147  ? LYS A 133  VAL A 147  
AA4 4 SER B 166  ? TYR B 168  ? SER A 166  TYR A 168  
AA5 1 VAL B 85   ? SER B 87   ? VAL A 85   SER A 87   
AA5 2 VAL B 116  ? VAL B 118  ? VAL A 116  VAL A 118  
AA6 1 GLY B 103  ? THR B 106  ? GLY A 103  THR A 106  
AA6 2 HIS B 124  ? LEU B 128  ? HIS A 124  LEU A 128  
AA7 1 THR C 8    ? ALA C 15   ? THR B 8    ALA B 15   
AA7 2 ARG C 18   ? LEU C 26   ? ARG B 18   LEU B 26   
AA7 3 PHE C 189  ? THR C 198  ? PHE B 189  THR B 198  
AA7 4 VAL C 171  ? THR C 181  ? VAL B 171  THR B 181  
AA8 1 VAL C 93   ? LYS C 99   ? VAL B 93   LYS B 99   
AA8 2 LEU C 134  ? ARG C 144  ? LEU B 134  ARG B 144  
AA8 3 PRO C 47   ? ILE C 56   ? PRO B 47   ILE B 56   
AA8 4 ILE C 162  ? PRO C 163  ? ILE B 162  PRO B 163  
AA9 1 VAL C 85   ? SER C 87   ? VAL B 85   SER B 87   
AA9 2 VAL C 116  ? VAL C 118  ? VAL B 116  VAL B 118  
AB1 1 VAL C 104  ? VAL C 105  ? VAL B 104  VAL B 105  
AB1 2 ALA C 126  ? THR C 127  ? ALA B 126  THR B 127  
AB2 1 TYR C 146  ? VAL C 147  ? TYR B 146  VAL B 147  
AB2 2 SER C 166  ? ILE C 167  ? SER B 166  ILE B 167  
AB3 1 VAL D 30   ? SER D 31   ? VAL C 30   SER C 31   
AB3 2 VAL D 963  ? ALA D 964  ? VAL C 963  ALA C 964  
AB3 3 VAL D 617  ? GLY D 618  ? VAL C 617  GLY C 618  
AB4 1 ARG D 102  ? PHE D 103  ? ARG C 102  PHE C 103  
AB4 2 ALA D 121  ? VAL D 126  ? ALA C 121  VAL C 126  
AB4 3 VAL D 143  ? PRO D 149  ? VAL C 143  PRO C 149  
AB5 1 PHE D 157  ? ILE D 159  ? PHE C 157  ILE C 159  
AB5 2 THR D 162  ? VAL D 166  ? THR C 162  VAL C 166  
AB5 3 SER D 428  ? PHE D 430  ? SER C 428  PHE C 430  
AB6 1 SER D 168  ? GLN D 169  ? SER C 168  GLN C 169  
AB6 2 ARG D 445  ? LEU D 447  ? ARG C 445  LEU C 447  
AB6 3 ILE D 488  ? SER D 490  ? ILE C 488  SER C 490  
AB7 1 ARG D 496  ? VAL D 497  ? ARG C 496  VAL C 497  
AB7 2 ILE D 503  ? GLU D 511  ? ILE C 503  GLU C 511  
AB7 3 VAL D 514  ? THR D 523  ? VAL C 514  THR C 523  
AB8 1 ARG D 496  ? VAL D 497  ? ARG C 496  VAL C 497  
AB8 2 ILE D 503  ? GLU D 511  ? ILE C 503  GLU C 511  
AB8 3 TYR D 569  ? ASP D 571  ? TYR C 569  ASP C 571  
AB8 4 VAL D 532  ? ALA D 533  ? VAL C 532  ALA C 533  
AB8 5 VAL D 552  ? ARG D 553  ? VAL C 552  ARG C 553  
AB9 1 VAL D 633  ? VAL D 634  ? VAL C 633  VAL C 634  
AB9 2 VAL D 692  ? ASP D 695  ? VAL C 692  ASP C 695  
AB9 3 ARG D 678  ? PRO D 679  ? ARG C 678  PRO C 679  
AC1 1 ARG D 658  ? ARG D 662  ? ARG C 658  ARG C 662  
AC1 2 TYR D 648  ? ALA D 653  ? TYR C 648  ALA C 653  
AC1 3 GLY D 639  ? VAL D 644  ? GLY C 639  VAL C 644  
AC1 4 ARG D 686  ? VAL D 687  ? ARG C 686  VAL C 687  
AC2 1 ALA D 667  ? ARG D 668  ? ALA C 667  ARG C 668  
AC2 2 CYS D 674  ? ALA D 675  ? CYS C 674  ALA C 675  
AC3 1 THR D 699  ? GLN D 700  ? THR C 699  GLN C 700  
AC3 2 GLU D 703  ? MET D 704  ? GLU C 703  MET C 704  
AC4 1 LYS D 998  ? SER D 999  ? LYS C 998  SER C 999  
AC4 2 VAL D 1014 ? LYS D 1023 ? VAL C 1014 LYS C 1023 
AC4 3 LYS D 875  ? GLY D 878  ? LYS C 875  GLY C 878  
AC4 4 LYS D 883  ? LEU D 890  ? LYS C 883  LEU C 890  
AC4 5 ILE D 726  ? SER D 729  ? ILE C 726  SER C 729  
AC4 6 ILE D 906  ? ILE D 907  ? ILE C 906  ILE C 907  
AC4 7 LYS D 708  ? ALA D 713  ? LYS C 708  ALA C 713  
AC4 8 VAL D 1014 ? LYS D 1023 ? VAL C 1014 LYS C 1023 
AC5 1 SER D 740  ? ARG D 751  ? SER C 740  ARG C 751  
AC5 2 VAL D 856  ? ARG D 868  ? VAL C 856  ARG C 868  
AC5 3 GLY D 836  ? PHE D 844  ? GLY C 836  PHE C 844  
AC5 4 GLU D 786  ? VAL D 787  ? GLU C 786  VAL C 787  
AC6 1 GLU D 759  ? ILE D 760  ? GLU C 759  ILE C 760  
AC6 2 ILE D 792  ? THR D 798  ? ILE C 792  THR C 798  
AC6 3 ARG D 824  ? LYS D 829  ? ARG C 824  LYS C 829  
AC7 1 TRP D 935  ? ASN D 936  ? TRP C 935  ASN C 936  
AC7 2 SER D 956  ? ALA D 957  ? SER C 956  ALA C 957  
AC8 1 HIS D 1033 ? ARG D 1035 ? HIS C 1033 ARG C 1035 
AC8 2 SER E 425  ? VAL E 432  ? SER D 425  VAL D 432  
AC8 3 GLN E 540  ? HIS E 544  ? GLN D 540  HIS D 544  
AC8 4 VAL E 496  ? ASN E 499  ? VAL D 496  ASN D 499  
AC8 5 ILE E 509  ? VAL E 517  ? ILE D 509  VAL D 517  
AC8 6 GLN E 440  ? PRO E 444  ? GLN D 440  PRO D 444  
AC8 7 ILE E 522  ? LEU E 524  ? ILE D 522  LEU D 524  
AC8 8 SER E 425  ? VAL E 432  ? SER D 425  VAL D 432  
AC9 1 GLN D 1057 ? PHE D 1059 ? GLN C 1057 PHE C 1059 
AC9 2 LYS E 420  ? VAL E 422  ? LYS D 420  VAL D 422  
AD1 1 LEU E 10   ? ARG E 11   ? LEU D 10   ARG D 11   
AD1 2 SER E 1243 ? ASP E 1244 ? SER D 1243 ASP D 1244 
AD2 1 GLY E 93   ? THR E 102  ? GLY D 93   THR D 102  
AD2 2 VAL E 313  ? VAL E 319  ? VAL D 313  VAL D 319  
AD3 1 LEU E 234  ? ILE E 235  ? LEU D 234  ILE D 235  
AD3 2 TYR E 134  ? VAL E 139  ? TYR D 134  VAL D 139  
AD3 3 PHE E 252  ? ALA E 255  ? PHE D 252  ALA D 255  
AD4 1 MET E 327  ? GLN E 329  ? MET D 327  GLN D 329  
AD4 2 PHE E 335  ? THR E 337  ? PHE D 335  THR D 337  
AD4 3 ILE G 359  ? SER G 360  ? ILE F 359  SER F 360  
AD5 1 THR E 392  ? GLY E 393  ? THR D 392  GLY D 393  
AD5 2 ARG E 397  ? PRO E 398  ? ARG D 397  PRO D 398  
AD6 1 VAL E 611  ? TYR E 612  ? VAL D 611  TYR D 612  
AD6 2 LYS E 634  ? LEU E 637  ? LYS D 634  LEU D 637  
AD6 3 TRP E 661  ? GLU E 664  ? TRP D 661  GLU D 664  
AD7 1 VAL E 885  ? GLU E 887  ? VAL D 885  GLU D 887  
AD7 2 VAL E 973  ? CYS E 974  ? VAL D 973  CYS D 974  
AD8 1 ILE E 896  ? VAL E 898  ? ILE D 896  VAL D 898  
AD8 2 VAL E 959  ? VAL E 961  ? VAL D 959  VAL D 961  
AD9 1 LYS E 1044 ? ALA E 1045 ? LYS D 1044 ALA D 1045 
AD9 2 ALA E 1116 ? ALA E 1117 ? ALA D 1116 ALA D 1117 
AE1 1 VAL E 1076 ? TYR E 1078 ? VAL D 1076 TYR D 1078 
AE1 2 PHE E 1063 ? PRO E 1069 ? PHE D 1063 PRO D 1069 
AE1 3 GLY E 1052 ? GLU E 1058 ? GLY D 1052 GLU D 1058 
AE1 4 HIS E 1105 ? VAL E 1106 ? HIS D 1105 VAL D 1106 
AE2 1 VAL E 1166 ? ASP E 1170 ? VAL D 1166 ASP D 1170 
AE2 2 ALA E 1203 ? PRO E 1206 ? ALA D 1203 PRO D 1206 
AE3 1 GLN E 1272 ? PRO E 1275 ? GLN D 1272 PRO D 1275 
AE3 2 LEU F 101  ? THR F 104  ? LEU E 101  THR E 104  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O PHE A 44   ? O PHE J 44   N GLN A 28   ? N GLN J 28   
AA1 2 3 N ARG A 33   ? N ARG J 33   O THR A 63   ? O THR J 63   
AA1 3 4 O GLY A 62   ? O GLY J 62   N TRP A 54   ? N TRP J 54   
AA2 1 2 N SER B 10   ? N SER A 10   O VAL B 22   ? O VAL A 22   
AA2 2 3 N PHE B 21   ? N PHE A 21   O ILE B 194  ? O ILE A 194  
AA2 3 4 O GLU B 197  ? O GLU A 197  N LEU B 172  ? N LEU A 172  
AA3 1 2 O VAL B 111  ? O VAL A 111  N TYR B 96   ? N TYR A 96   
AA3 2 3 N MET B 95   ? N MET A 95   O LEU B 138  ? O LEU A 138  
AA3 3 4 O GLY B 143  ? O GLY A 143  N GLY B 48   ? N GLY A 48   
AA3 4 5 N ILE B 54   ? N ILE A 54   O ILE B 162  ? O ILE A 162  
AA4 1 2 O VAL B 111  ? O VAL A 111  N TYR B 96   ? N TYR A 96   
AA4 2 3 N MET B 95   ? N MET A 95   O LEU B 138  ? O LEU A 138  
AA4 3 4 N GLY B 145  ? N GLY A 145  O TYR B 168  ? O TYR A 168  
AA5 1 2 N SER B 86   ? N SER A 86   O THR B 117  ? O THR A 117  
AA6 1 2 N VAL B 105  ? N VAL A 105  O ALA B 126  ? O ALA A 126  
AA7 1 2 N ALA C 15   ? N ALA B 15   O ARG C 18   ? O ARG B 18   
AA7 2 3 N LEU C 26   ? N LEU B 26   O ASP C 190  ? O ASP B 190  
AA7 3 4 O ASP C 195  ? O ASP B 195  N THR C 175  ? N THR B 175  
AA8 1 2 N LEU C 97   ? N LEU B 97   O VAL C 136  ? O VAL B 136  
AA8 2 3 O VAL C 139  ? O VAL B 139  N SER C 53   ? N SER B 53   
AA8 3 4 N ILE C 54   ? N ILE B 54   O ILE C 162  ? O ILE B 162  
AA9 1 2 N SER C 86   ? N SER B 86   O THR C 117  ? O THR B 117  
AB1 1 2 O VAL C 105  ? O VAL B 105  N ALA C 126  ? N ALA B 126  
AB2 1 2 N VAL C 147  ? N VAL B 147  O SER C 166  ? O SER B 166  
AB3 1 2 N VAL D 30   ? N VAL C 30   O ALA D 964  ? O ALA C 964  
AB3 2 3 O VAL D 963  ? O VAL C 963  N GLY D 618  ? N GLY C 618  
AB4 1 2 N ARG D 102  ? N ARG C 102  O PHE D 125  ? O PHE C 125  
AB4 2 3 N ALA D 122  ? N ALA C 122  O PHE D 148  ? O PHE C 148  
AB5 1 2 N PHE D 157  ? N PHE C 157  O ARG D 164  ? O ARG C 164  
AB5 2 3 N VAL D 165  ? N VAL C 165  O GLN D 429  ? O GLN C 429  
AB6 1 2 N SER D 168  ? N SER C 168  O LEU D 447  ? O LEU C 447  
AB6 2 3 N LEU D 446  ? N LEU C 446  O GLY D 489  ? O GLY C 489  
AB7 1 2 N ARG D 496  ? N ARG C 496  O GLU D 504  ? O GLU C 504  
AB7 2 3 N TYR D 507  ? N TYR C 507  O ASP D 520  ? O ASP C 520  
AB8 1 2 N ARG D 496  ? N ARG C 496  O GLU D 504  ? O GLU C 504  
AB8 2 3 N ARG D 508  ? N ARG C 508  O MET D 570  ? O MET C 570  
AB8 3 4 O TYR D 569  ? O TYR C 569  N ALA D 533  ? N ALA C 533  
AB8 4 5 N VAL D 532  ? N VAL C 532  O ARG D 553  ? O ARG C 553  
AB9 1 2 N VAL D 633  ? N VAL C 633  O ILE D 693  ? O ILE C 693  
AB9 2 3 O ASP D 695  ? O ASP C 695  N ARG D 678  ? N ARG C 678  
AC1 1 2 O GLN D 659  ? O GLN C 659  N VAL D 651  ? N VAL C 651  
AC1 2 3 O MET D 652  ? O MET C 652  N VAL D 640  ? N VAL C 640  
AC1 3 4 N GLY D 639  ? N GLY C 639  O VAL D 687  ? O VAL C 687  
AC2 1 2 N ALA D 667  ? N ALA C 667  O ALA D 675  ? O ALA C 675  
AC3 1 2 N GLN D 700  ? N GLN C 700  O GLU D 703  ? O GLU C 703  
AC4 1 2 N SER D 999  ? N SER C 999  O VAL D 1014 ? O VAL C 1014 
AC4 2 3 O LEU D 1022 ? O LEU C 1022 N ALA D 877  ? N ALA C 877  
AC4 3 4 N LEU D 876  ? N LEU C 876  O GLY D 884  ? O GLY C 884  
AC4 4 5 O GLY D 887  ? O GLY C 887  N ILE D 726  ? N ILE C 726  
AC4 5 6 N ILE D 727  ? N ILE C 727  O ILE D 907  ? O ILE C 907  
AC4 6 7 O ILE D 906  ? O ILE C 906  N LEU D 711  ? N LEU C 711  
AC4 7 8 N VAL D 712  ? N VAL C 712  O GLY D 1017 ? O GLY C 1017 
AC5 1 2 N ALA D 750  ? N ALA C 750  O ASN D 857  ? O ASN C 857  
AC5 2 3 O LEU D 859  ? O LEU C 859  N PHE D 844  ? N PHE C 844  
AC5 3 4 O GLY D 836  ? O GLY C 836  N VAL D 787  ? N VAL C 787  
AC6 1 2 N GLU D 759  ? N GLU C 759  O VAL D 797  ? O VAL C 797  
AC6 2 3 N LEU D 793  ? N LEU C 793  O LEU D 828  ? O LEU C 828  
AC7 1 2 N TRP D 935  ? N TRP C 935  O ALA D 957  ? O ALA C 957  
AC8 1 2 N HIS D 1033 ? N HIS C 1033 O ARG E 427  ? O ARG D 427  
AC8 2 3 N GLY E 426  ? N GLY D 426  O VAL E 543  ? O VAL D 543  
AC8 3 4 O ALA E 542  ? O ALA D 542  N ASN E 499  ? N ASN D 499  
AC8 4 5 N LEU E 498  ? N LEU D 498  O GLN E 510  ? O GLN D 510  
AC8 5 6 O GLN E 515  ? O GLN D 515  N LEU E 443  ? N LEU D 443  
AC8 6 7 N GLY E 442  ? N GLY D 442  O GLN E 523  ? O GLN D 523  
AC8 7 8 O ILE E 522  ? O ILE D 522  N VAL E 431  ? N VAL D 431  
AC9 1 2 N GLN D 1057 ? N GLN C 1057 O VAL E 422  ? O VAL D 422  
AD1 1 2 N LEU E 10   ? N LEU D 10   O ASP E 1244 ? O ASP D 1244 
AD2 1 2 N VAL E 101  ? N VAL D 101  O LEU E 314  ? O LEU D 314  
AD3 1 2 O ILE E 235  ? O ILE D 235  N TYR E 134  ? N TYR D 134  
AD3 2 3 N SER E 138  ? N SER D 138  O THR E 253  ? O THR D 253  
AD4 1 2 N VAL E 328  ? N VAL D 328  O ALA E 336  ? O ALA D 336  
AD4 2 3 N THR E 337  ? N THR D 337  O ILE G 359  ? O ILE F 359  
AD5 1 2 N GLY E 393  ? N GLY D 393  O ARG E 397  ? O ARG D 397  
AD6 1 2 N TYR E 612  ? N TYR D 612  O ARG E 636  ? O ARG D 636  
AD6 2 3 N LEU E 637  ? N LEU D 637  O TRP E 661  ? O TRP D 661  
AD7 1 2 N ARG E 886  ? N ARG D 886  O VAL E 973  ? O VAL D 973  
AD8 1 2 N ILE E 896  ? N ILE D 896  O VAL E 961  ? O VAL D 961  
AD9 1 2 N ALA E 1045 ? N ALA D 1045 O ALA E 1116 ? O ALA D 1116 
AE1 1 2 O VAL E 1076 ? O VAL D 1076 N ILE E 1067 ? N ILE D 1067 
AE1 2 3 O THR E 1066 ? O THR D 1066 N ARG E 1055 ? N ARG D 1055 
AE1 3 4 N GLY E 1052 ? N GLY D 1052 O VAL E 1106 ? O VAL D 1106 
AE2 1 2 N THR E 1167 ? N THR D 1167 O ARG E 1205 ? O ARG D 1205 
AE3 1 2 N GLN E 1274 ? N GLN D 1274 O GLU F 102  ? O GLU E 102  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software C SRN 1201 ? 13 'binding site for residue SRN C 1201' 
AC2 Software C EDO 1202 ? 1  'binding site for residue EDO C 1202' 
AC3 Software D ZN  2001 ? 4  'binding site for residue ZN D 2001'  
AC4 Software D ZN  2002 ? 4  'binding site for residue ZN D 2002'  
AC5 Software D SO4 2003 ? 6  'binding site for residue SO4 D 2003' 
AC6 Software D SO4 2004 ? 4  'binding site for residue SO4 D 2004' 
AC7 Software D SO4 2005 ? 4  'binding site for residue SO4 D 2005' 
AC8 Software D SO4 2006 ? 2  'binding site for residue SO4 D 2006' 
AC9 Software D SO4 2007 ? 3  'binding site for residue SO4 D 2007' 
AD1 Software F SO4 501  ? 3  'binding site for residue SO4 F 501'  
AD2 Software F SO4 502  ? 3  'binding site for residue SO4 F 502'  
AD3 Software F SO4 503  ? 5  'binding site for residue SO4 F 503'  
AD4 Software F SO4 504  ? 2  'binding site for residue SO4 F 504'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 VAL D 167  ? VAL C 167  . ? 1_555 ? 
2  AC1 13 GLN D 426  ? GLN C 426  . ? 1_555 ? 
3  AC1 13 SER D 428  ? SER C 428  . ? 1_555 ? 
4  AC1 13 GLN D 429  ? GLN C 429  . ? 1_555 ? 
5  AC1 13 PHE D 430  ? PHE C 430  . ? 1_555 ? 
6  AC1 13 ASP D 432  ? ASP C 432  . ? 1_555 ? 
7  AC1 13 HIS D 442  ? HIS C 442  . ? 1_555 ? 
8  AC1 13 ARG D 445  ? ARG C 445  . ? 1_555 ? 
9  AC1 13 LEU D 447  ? LEU C 447  . ? 1_555 ? 
10 AC1 13 PRO D 480  ? PRO C 480  . ? 1_555 ? 
11 AC1 13 ASN D 484  ? ASN C 484  . ? 1_555 ? 
12 AC1 13 ILE D 488  ? ILE C 488  . ? 1_555 ? 
13 AC1 13 ARG D 604  ? ARG C 604  . ? 1_555 ? 
14 AC2 1  ASN D 1102 ? ASN C 1102 . ? 1_555 ? 
15 AC3 4  CYS E 890  ? CYS D 890  . ? 1_555 ? 
16 AC3 4  CYS E 967  ? CYS D 967  . ? 1_555 ? 
17 AC3 4  CYS E 974  ? CYS D 974  . ? 1_555 ? 
18 AC3 4  CYS E 977  ? CYS D 977  . ? 1_555 ? 
19 AC4 4  CYS E 60   ? CYS D 60   . ? 1_555 ? 
20 AC4 4  CYS E 62   ? CYS D 62   . ? 1_555 ? 
21 AC4 4  CYS E 75   ? CYS D 75   . ? 1_555 ? 
22 AC4 4  CYS E 78   ? CYS D 78   . ? 1_555 ? 
23 AC5 6  ASP E 882  ? ASP D 882  . ? 1_555 ? 
24 AC5 6  VAL E 883  ? VAL D 883  . ? 1_555 ? 
25 AC5 6  THR E 971  ? THR D 971  . ? 1_555 ? 
26 AC5 6  GLY E 972  ? GLY D 972  . ? 1_555 ? 
27 AC5 6  ARG E 1160 ? ARG D 1160 . ? 1_555 ? 
28 AC5 6  ARG E 1164 ? ARG D 1164 . ? 1_555 ? 
29 AC6 4  ARG E 894  ? ARG D 894  . ? 1_555 ? 
30 AC6 4  GLY E 895  ? GLY D 895  . ? 1_555 ? 
31 AC6 4  LYS E 960  ? LYS D 960  . ? 1_555 ? 
32 AC6 4  ARG E 1129 ? ARG D 1129 . ? 1_555 ? 
33 AC7 4  GLU E 887  ? GLU D 887  . ? 1_555 ? 
34 AC7 4  HIS E 888  ? HIS D 888  . ? 1_555 ? 
35 AC7 4  ILE E 990  ? ILE D 990  . ? 1_555 ? 
36 AC7 4  ARG E 1267 ? ARG D 1267 . ? 1_555 ? 
37 AC8 2  ARG E 421  ? ARG D 421  . ? 1_555 ? 
38 AC8 2  ARG E 427  ? ARG D 427  . ? 1_555 ? 
39 AC9 3  ASN E 22   ? ASN D 22   . ? 1_555 ? 
40 AC9 3  TYR E 25   ? TYR D 25   . ? 1_555 ? 
41 AC9 3  ARG A 57   ? ARG J 57   . ? 1_555 ? 
42 AD1 3  ARG E 389  ? ARG D 389  . ? 1_555 ? 
43 AD1 3  ALA G 254  ? ALA F 254  . ? 1_555 ? 
44 AD1 3  PHE G 255  ? PHE F 255  . ? 1_555 ? 
45 AD2 3  ARG G 190  ? ARG F 190  . ? 1_555 ? 
46 AD2 3  ARG G 228  ? ARG F 228  . ? 1_555 ? 
47 AD2 3  HIS G 232  ? HIS F 232  . ? 1_555 ? 
48 AD3 5  TYR D 1012 ? TYR C 1012 . ? 1_556 ? 
49 AD3 5  VAL E 592  ? VAL D 592  . ? 1_556 ? 
50 AD3 5  SER E 628  ? SER D 628  . ? 1_556 ? 
51 AD3 5  ARG E 630  ? ARG D 630  . ? 1_556 ? 
52 AD3 5  LYS G 210  ? LYS F 210  . ? 1_555 ? 
53 AD4 2  SER G 406  ? SER F 406  . ? 1_555 ? 
54 AD4 2  ARG G 408  ? ARG F 408  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6VVT 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.007739 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003026 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006165 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007878 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PRO A  1  26   ? -103.820 39.567  88.644  1.00 115.87 ?  26   PRO J N     1 
ATOM   2     C  CA    . PRO A  1  26   ? -104.658 39.793  89.826  1.00 121.04 ?  26   PRO J CA    1 
ATOM   3     C  C     . PRO A  1  26   ? -105.975 39.023  89.756  1.00 136.05 ?  26   PRO J C     1 
ATOM   4     O  O     . PRO A  1  26   ? -106.788 39.285  88.869  1.00 136.34 ?  26   PRO J O     1 
ATOM   5     C  CB    . PRO A  1  26   ? -104.904 41.301  89.791  1.00 114.62 ?  26   PRO J CB    1 
ATOM   6     C  CG    . PRO A  1  26   ? -104.865 41.638  88.340  1.00 107.97 ?  26   PRO J CG    1 
ATOM   7     C  CD    . PRO A  1  26   ? -103.835 40.723  87.728  1.00 108.07 ?  26   PRO J CD    1 
ATOM   8     N  N     . ARG A  1  27   ? -106.183 38.090  90.683  1.00 140.45 ?  27   ARG J N     1 
ATOM   9     C  CA    . ARG A  1  27   ? -107.378 37.256  90.666  1.00 130.71 ?  27   ARG J CA    1 
ATOM   10    C  C     . ARG A  1  27   ? -107.737 36.839  92.084  1.00 126.61 ?  27   ARG J C     1 
ATOM   11    O  O     . ARG A  1  27   ? -106.895 36.294  92.805  1.00 126.83 ?  27   ARG J O     1 
ATOM   12    C  CB    . ARG A  1  27   ? -107.166 36.016  89.787  1.00 126.85 ?  27   ARG J CB    1 
ATOM   13    C  CG    . ARG A  1  27   ? -106.199 34.995  90.374  1.00 130.99 ?  27   ARG J CG    1 
ATOM   14    C  CD    . ARG A  1  27   ? -105.783 33.955  89.344  1.00 132.35 ?  27   ARG J CD    1 
ATOM   15    N  NE    . ARG A  1  27   ? -106.929 33.335  88.683  1.00 134.24 ?  27   ARG J NE    1 
ATOM   16    C  CZ    . ARG A  1  27   ? -107.478 33.788  87.560  1.00 135.91 ?  27   ARG J CZ    1 
ATOM   17    N  NH1   . ARG A  1  27   ? -106.988 34.872  86.971  1.00 126.86 1  27   ARG J NH1   1 
ATOM   18    N  NH2   . ARG A  1  27   ? -108.518 33.161  87.027  1.00 116.96 ?  27   ARG J NH2   1 
ATOM   19    N  N     . GLN A  1  28   ? -108.980 37.101  92.478  1.00 120.20 ?  28   GLN J N     1 
ATOM   20    C  CA    . GLN A  1  28   ? -109.526 36.616  93.737  1.00 115.34 ?  28   GLN J CA    1 
ATOM   21    C  C     . GLN A  1  28   ? -110.332 35.349  93.488  1.00 112.84 ?  28   GLN J C     1 
ATOM   22    O  O     . GLN A  1  28   ? -111.097 35.268  92.522  1.00 120.53 ?  28   GLN J O     1 
ATOM   23    C  CB    . GLN A  1  28   ? -110.414 37.669  94.405  1.00 114.49 ?  28   GLN J CB    1 
ATOM   24    C  CG    . GLN A  1  28   ? -109.661 38.699  95.227  1.00 125.67 ?  28   GLN J CG    1 
ATOM   25    C  CD    . GLN A  1  28   ? -110.591 39.578  96.040  1.00 119.03 ?  28   GLN J CD    1 
ATOM   26    O  OE1   . GLN A  1  28   ? -111.811 39.517  95.889  1.00 119.57 ?  28   GLN J OE1   1 
ATOM   27    N  NE2   . GLN A  1  28   ? -110.018 40.399  96.913  1.00 119.63 ?  28   GLN J NE2   1 
ATOM   28    N  N     . VAL A  1  29   ? -110.159 34.364  94.362  1.00 102.81 ?  29   VAL J N     1 
ATOM   29    C  CA    . VAL A  1  29   ? -110.820 33.071  94.232  1.00 99.43  ?  29   VAL J CA    1 
ATOM   30    C  C     . VAL A  1  29   ? -111.842 32.959  95.355  1.00 113.89 ?  29   VAL J C     1 
ATOM   31    O  O     . VAL A  1  29   ? -111.478 32.820  96.530  1.00 109.60 ?  29   VAL J O     1 
ATOM   32    C  CB    . VAL A  1  29   ? -109.817 31.911  94.272  1.00 99.90  ?  29   VAL J CB    1 
ATOM   33    C  CG1   . VAL A  1  29   ? -110.474 30.625  93.794  1.00 92.10  ?  29   VAL J CG1   1 
ATOM   34    C  CG2   . VAL A  1  29   ? -108.590 32.240  93.434  1.00 92.79  ?  29   VAL J CG2   1 
ATOM   35    N  N     . ALA A  1  30   ? -113.121 33.022  94.996  1.00 113.89 ?  30   ALA J N     1 
ATOM   36    C  CA    . ALA A  1  30   ? -114.218 32.883  95.941  1.00 106.06 ?  30   ALA J CA    1 
ATOM   37    C  C     . ALA A  1  30   ? -114.985 31.601  95.648  1.00 108.41 ?  30   ALA J C     1 
ATOM   38    O  O     . ALA A  1  30   ? -115.150 31.217  94.486  1.00 108.47 ?  30   ALA J O     1 
ATOM   39    C  CB    . ALA A  1  30   ? -115.162 34.087  95.872  1.00 106.41 ?  30   ALA J CB    1 
ATOM   40    N  N     . ARG A  1  31   ? -115.448 30.941  96.706  1.00 118.49 ?  31   ARG J N     1 
ATOM   41    C  CA    . ARG A  1  31   ? -116.182 29.688  96.596  1.00 110.37 ?  31   ARG J CA    1 
ATOM   42    C  C     . ARG A  1  31   ? -117.573 29.863  97.185  1.00 109.69 ?  31   ARG J C     1 
ATOM   43    O  O     . ARG A  1  31   ? -117.720 30.361  98.306  1.00 116.96 ?  31   ARG J O     1 
ATOM   44    C  CB    . ARG A  1  31   ? -115.443 28.551  97.307  1.00 109.54 ?  31   ARG J CB    1 
ATOM   45    C  CG    . ARG A  1  31   ? -114.168 28.111  96.608  1.00 126.97 ?  31   ARG J CG    1 
ATOM   46    C  CD    . ARG A  1  31   ? -113.350 27.173  97.482  1.00 132.04 ?  31   ARG J CD    1 
ATOM   47    N  NE    . ARG A  1  31   ? -114.112 26.000  97.900  1.00 138.67 ?  31   ARG J NE    1 
ATOM   48    C  CZ    . ARG A  1  31   ? -114.142 24.849  97.235  1.00 140.56 ?  31   ARG J CZ    1 
ATOM   49    N  NH1   . ARG A  1  31   ? -113.451 24.709  96.111  1.00 122.80 1  31   ARG J NH1   1 
ATOM   50    N  NH2   . ARG A  1  31   ? -114.863 23.836  97.694  1.00 147.89 ?  31   ARG J NH2   1 
ATOM   51    N  N     . TYR A  1  32   ? -118.586 29.456  96.428  1.00 105.60 ?  32   TYR J N     1 
ATOM   52    C  CA    . TYR A  1  32   ? -119.972 29.504  96.862  1.00 110.06 ?  32   TYR J CA    1 
ATOM   53    C  C     . TYR A  1  32   ? -120.510 28.092  97.046  1.00 111.78 ?  32   TYR J C     1 
ATOM   54    O  O     . TYR A  1  32   ? -119.999 27.126  96.471  1.00 100.61 ?  32   TYR J O     1 
ATOM   55    C  CB    . TYR A  1  32   ? -120.837 30.272  95.857  1.00 109.28 ?  32   TYR J CB    1 
ATOM   56    C  CG    . TYR A  1  32   ? -120.504 31.742  95.761  1.00 101.62 ?  32   TYR J CG    1 
ATOM   57    C  CD1   . TYR A  1  32   ? -119.467 32.188  94.954  1.00 94.53  ?  32   TYR J CD1   1 
ATOM   58    C  CD2   . TYR A  1  32   ? -121.228 32.686  96.477  1.00 116.94 ?  32   TYR J CD2   1 
ATOM   59    C  CE1   . TYR A  1  32   ? -119.159 33.531  94.864  1.00 103.93 ?  32   TYR J CE1   1 
ATOM   60    C  CE2   . TYR A  1  32   ? -120.928 34.032  96.393  1.00 115.56 ?  32   TYR J CE2   1 
ATOM   61    C  CZ    . TYR A  1  32   ? -119.893 34.448  95.585  1.00 107.23 ?  32   TYR J CZ    1 
ATOM   62    O  OH    . TYR A  1  32   ? -119.590 35.788  95.497  1.00 114.07 ?  32   TYR J OH    1 
ATOM   63    N  N     . ARG A  1  33   ? -121.555 27.981  97.861  1.00 117.10 ?  33   ARG J N     1 
ATOM   64    C  CA    . ARG A  1  33   ? -122.171 26.703  98.185  1.00 117.42 ?  33   ARG J CA    1 
ATOM   65    C  C     . ARG A  1  33   ? -123.645 26.744  97.813  1.00 116.47 ?  33   ARG J C     1 
ATOM   66    O  O     . ARG A  1  33   ? -124.371 27.652  98.231  1.00 121.19 ?  33   ARG J O     1 
ATOM   67    C  CB    . ARG A  1  33   ? -122.001 26.374  99.671  1.00 125.86 ?  33   ARG J CB    1 
ATOM   68    C  CG    . ARG A  1  33   ? -122.673 25.085  100.107 1.00 125.85 ?  33   ARG J CG    1 
ATOM   69    C  CD    . ARG A  1  33   ? -122.114 24.608  101.435 1.00 134.36 ?  33   ARG J CD    1 
ATOM   70    N  NE    . ARG A  1  33   ? -120.693 24.291  101.336 1.00 138.58 ?  33   ARG J NE    1 
ATOM   71    C  CZ    . ARG A  1  33   ? -119.942 23.892  102.358 1.00 147.22 ?  33   ARG J CZ    1 
ATOM   72    N  NH1   . ARG A  1  33   ? -120.478 23.763  103.563 1.00 156.40 1  33   ARG J NH1   1 
ATOM   73    N  NH2   . ARG A  1  33   ? -118.657 23.623  102.175 1.00 145.75 ?  33   ARG J NH2   1 
ATOM   74    N  N     . THR A  1  34   ? -124.080 25.765  97.026  1.00 109.09 ?  34   THR J N     1 
ATOM   75    C  CA    . THR A  1  34   ? -125.467 25.668  96.604  1.00 108.46 ?  34   THR J CA    1 
ATOM   76    C  C     . THR A  1  34   ? -126.281 24.870  97.620  1.00 116.97 ?  34   THR J C     1 
ATOM   77    O  O     . THR A  1  34   ? -125.744 24.179  98.488  1.00 112.67 ?  34   THR J O     1 
ATOM   78    C  CB    . THR A  1  34   ? -125.570 25.024  95.219  1.00 108.75 ?  34   THR J CB    1 
ATOM   79    O  OG1   . THR A  1  34   ? -124.934 23.739  95.236  1.00 111.12 ?  34   THR J OG1   1 
ATOM   80    C  CG2   . THR A  1  34   ? -124.906 25.901  94.169  1.00 101.51 ?  34   THR J CG2   1 
ATOM   81    N  N     . ASP A  1  35   ? -127.605 24.972  97.495  1.00 120.84 ?  35   ASP J N     1 
ATOM   82    C  CA    . ASP A  1  35   ? -128.489 24.285  98.429  1.00 110.79 ?  35   ASP J CA    1 
ATOM   83    C  C     . ASP A  1  35   ? -128.362 22.771  98.316  1.00 109.09 ?  35   ASP J C     1 
ATOM   84    O  O     . ASP A  1  35   ? -128.500 22.060  99.317  1.00 126.00 ?  35   ASP J O     1 
ATOM   85    C  CB    . ASP A  1  35   ? -129.935 24.717  98.190  1.00 112.17 ?  35   ASP J CB    1 
ATOM   86    C  CG    . ASP A  1  35   ? -130.097 26.223  98.166  1.00 128.63 ?  35   ASP J CG    1 
ATOM   87    O  OD1   . ASP A  1  35   ? -129.516 26.900  99.041  1.00 135.55 ?  35   ASP J OD1   1 
ATOM   88    O  OD2   . ASP A  1  35   ? -130.796 26.730  97.264  1.00 137.05 ?  35   ASP J OD2   1 
ATOM   89    N  N     . ASN A  1  36   ? -128.099 22.259  97.112  1.00 100.71 ?  36   ASN J N     1 
ATOM   90    C  CA    . ASN A  1  36   ? -128.040 20.820  96.890  1.00 109.35 ?  36   ASN J CA    1 
ATOM   91    C  C     . ASN A  1  36   ? -126.721 20.197  97.332  1.00 114.58 ?  36   ASN J C     1 
ATOM   92    O  O     . ASN A  1  36   ? -126.642 18.968  97.434  1.00 120.91 ?  36   ASN J O     1 
ATOM   93    C  CB    . ASN A  1  36   ? -128.286 20.510  95.412  1.00 105.31 ?  36   ASN J CB    1 
ATOM   94    C  CG    . ASN A  1  36   ? -127.171 21.013  94.520  1.00 111.11 ?  36   ASN J CG    1 
ATOM   95    O  OD1   . ASN A  1  36   ? -126.470 21.966  94.859  1.00 120.23 ?  36   ASN J OD1   1 
ATOM   96    N  ND2   . ASN A  1  36   ? -126.999 20.372  93.371  1.00 111.76 ?  36   ASN J ND2   1 
ATOM   97    N  N     . GLY A  1  37   ? -125.695 21.000  97.594  1.00 103.85 ?  37   GLY J N     1 
ATOM   98    C  CA    . GLY A  1  37   ? -124.425 20.504  98.096  1.00 113.14 ?  37   GLY J CA    1 
ATOM   99    C  C     . GLY A  1  37   ? -123.248 20.690  97.162  1.00 124.04 ?  37   GLY J C     1 
ATOM   100   O  O     . GLY A  1  37   ? -122.112 20.383  97.556  1.00 114.92 ?  37   GLY J O     1 
ATOM   101   N  N     . GLU A  1  38   ? -123.459 21.176  95.944  1.00 120.61 ?  38   GLU J N     1 
ATOM   102   C  CA    . GLU A  1  38   ? -122.358 21.401  95.021  1.00 113.84 ?  38   GLU J CA    1 
ATOM   103   C  C     . GLU A  1  38   ? -121.677 22.730  95.324  1.00 111.22 ?  38   GLU J C     1 
ATOM   104   O  O     . GLU A  1  38   ? -122.302 23.681  95.803  1.00 117.57 ?  38   GLU J O     1 
ATOM   105   C  CB    . GLU A  1  38   ? -122.855 21.383  93.574  1.00 113.21 ?  38   GLU J CB    1 
ATOM   106   C  CG    . GLU A  1  38   ? -123.679 20.155  93.213  1.00 120.49 ?  38   GLU J CG    1 
ATOM   107   C  CD    . GLU A  1  38   ? -124.041 20.109  91.741  1.00 116.17 ?  38   GLU J CD    1 
ATOM   108   O  OE1   . GLU A  1  38   ? -123.137 20.295  90.900  1.00 107.05 ?  38   GLU J OE1   1 
ATOM   109   O  OE2   . GLU A  1  38   ? -125.230 19.893  91.424  1.00 123.55 ?  38   GLU J OE2   1 
ATOM   110   N  N     . GLU A  1  39   ? -120.378 22.786  95.043  1.00 102.90 ?  39   GLU J N     1 
ATOM   111   C  CA    . GLU A  1  39   ? -119.571 23.972  95.285  1.00 100.07 ?  39   GLU J CA    1 
ATOM   112   C  C     . GLU A  1  39   ? -118.959 24.454  93.976  1.00 105.49 ?  39   GLU J C     1 
ATOM   113   O  O     . GLU A  1  39   ? -118.725 23.667  93.055  1.00 117.29 ?  39   GLU J O     1 
ATOM   114   C  CB    . GLU A  1  39   ? -118.469 23.691  96.312  1.00 113.92 ?  39   GLU J CB    1 
ATOM   115   C  CG    . GLU A  1  39   ? -118.995 23.321  97.690  1.00 130.43 ?  39   GLU J CG    1 
ATOM   116   C  CD    . GLU A  1  39   ? -117.886 23.019  98.679  1.00 143.00 ?  39   GLU J CD    1 
ATOM   117   O  OE1   . GLU A  1  39   ? -116.720 22.897  98.250  1.00 143.02 ?  39   GLU J OE1   1 
ATOM   118   O  OE2   . GLU A  1  39   ? -118.182 22.904  99.888  1.00 144.67 ?  39   GLU J OE2   1 
ATOM   119   N  N     . PHE A  1  40   ? -118.699 25.759  93.903  1.00 101.66 ?  40   PHE J N     1 
ATOM   120   C  CA    . PHE A  1  40   ? -118.178 26.380  92.694  1.00 102.68 ?  40   PHE J CA    1 
ATOM   121   C  C     . PHE A  1  40   ? -117.117 27.410  93.049  1.00 114.27 ?  40   PHE J C     1 
ATOM   122   O  O     . PHE A  1  40   ? -117.214 28.086  94.076  1.00 115.82 ?  40   PHE J O     1 
ATOM   123   C  CB    . PHE A  1  40   ? -119.296 27.054  91.888  1.00 109.68 ?  40   PHE J CB    1 
ATOM   124   C  CG    . PHE A  1  40   ? -120.419 26.132  91.521  1.00 99.53  ?  40   PHE J CG    1 
ATOM   125   C  CD1   . PHE A  1  40   ? -121.522 26.001  92.346  1.00 105.16 ?  40   PHE J CD1   1 
ATOM   126   C  CD2   . PHE A  1  40   ? -120.372 25.397  90.350  1.00 105.19 ?  40   PHE J CD2   1 
ATOM   127   C  CE1   . PHE A  1  40   ? -122.558 25.153  92.009  1.00 120.82 ?  40   PHE J CE1   1 
ATOM   128   C  CE2   . PHE A  1  40   ? -121.404 24.547  90.007  1.00 94.44  ?  40   PHE J CE2   1 
ATOM   129   C  CZ    . PHE A  1  40   ? -122.499 24.424  90.838  1.00 111.25 ?  40   PHE J CZ    1 
ATOM   130   N  N     . ASP A  1  41   ? -116.108 27.525  92.188  1.00 116.10 ?  41   ASP J N     1 
ATOM   131   C  CA    . ASP A  1  41   ? -115.061 28.529  92.321  1.00 105.23 ?  41   ASP J CA    1 
ATOM   132   C  C     . ASP A  1  41   ? -115.296 29.627  91.294  1.00 106.95 ?  41   ASP J C     1 
ATOM   133   O  O     . ASP A  1  41   ? -115.404 29.347  90.095  1.00 110.91 ?  41   ASP J O     1 
ATOM   134   C  CB    . ASP A  1  41   ? -113.676 27.915  92.121  1.00 108.73 ?  41   ASP J CB    1 
ATOM   135   C  CG    . ASP A  1  41   ? -113.425 26.735  93.037  1.00 128.93 ?  41   ASP J CG    1 
ATOM   136   O  OD1   . ASP A  1  41   ? -112.925 26.951  94.161  1.00 136.54 ?  41   ASP J OD1   1 
ATOM   137   O  OD2   . ASP A  1  41   ? -113.724 25.593  92.629  1.00 139.16 ?  41   ASP J OD2   1 
ATOM   138   N  N     . VAL A  1  42   ? -115.376 30.865  91.762  1.00 103.13 ?  42   VAL J N     1 
ATOM   139   C  CA    . VAL A  1  42   ? -115.667 32.016  90.920  1.00 93.29  ?  42   VAL J CA    1 
ATOM   140   C  C     . VAL A  1  42   ? -114.539 33.027  91.080  1.00 98.11  ?  42   VAL J C     1 
ATOM   141   O  O     . VAL A  1  42   ? -114.506 33.790  92.046  1.00 111.18 ?  42   VAL J O     1 
ATOM   142   C  CB    . VAL A  1  42   ? -117.027 32.643  91.276  1.00 100.81 ?  42   VAL J CB    1 
ATOM   143   C  CG1   . VAL A  1  42   ? -117.337 33.804  90.343  1.00 93.92  ?  42   VAL J CG1   1 
ATOM   144   C  CG2   . VAL A  1  42   ? -118.126 31.592  91.219  1.00 115.77 ?  42   VAL J CG2   1 
ATOM   145   N  N     . PRO A  1  43   ? -113.591 33.063  90.146  1.00 103.75 ?  43   PRO J N     1 
ATOM   146   C  CA    . PRO A  1  43   ? -112.504 34.043  90.242  1.00 90.60  ?  43   PRO J CA    1 
ATOM   147   C  C     . PRO A  1  43   ? -113.015 35.461  90.044  1.00 99.69  ?  43   PRO J C     1 
ATOM   148   O  O     . PRO A  1  43   ? -113.809 35.736  89.141  1.00 106.84 ?  43   PRO J O     1 
ATOM   149   C  CB    . PRO A  1  43   ? -111.549 33.634  89.112  1.00 93.74  ?  43   PRO J CB    1 
ATOM   150   C  CG    . PRO A  1  43   ? -111.924 32.221  88.776  1.00 111.96 ?  43   PRO J CG    1 
ATOM   151   C  CD    . PRO A  1  43   ? -113.397 32.129  89.025  1.00 113.31 ?  43   PRO J CD    1 
ATOM   152   N  N     . PHE A  1  44   ? -112.548 36.364  90.902  1.00 110.00 ?  44   PHE J N     1 
ATOM   153   C  CA    . PHE A  1  44   ? -112.864 37.781  90.812  1.00 106.56 ?  44   PHE J CA    1 
ATOM   154   C  C     . PHE A  1  44   ? -111.573 38.586  90.781  1.00 112.59 ?  44   PHE J C     1 
ATOM   155   O  O     . PHE A  1  44   ? -110.473 38.054  90.948  1.00 113.35 ?  44   PHE J O     1 
ATOM   156   C  CB    . PHE A  1  44   ? -113.740 38.246  91.985  1.00 105.76 ?  44   PHE J CB    1 
ATOM   157   C  CG    . PHE A  1  44   ? -115.118 37.650  91.991  1.00 110.78 ?  44   PHE J CG    1 
ATOM   158   C  CD1   . PHE A  1  44   ? -115.420 36.575  92.811  1.00 114.82 ?  44   PHE J CD1   1 
ATOM   159   C  CD2   . PHE A  1  44   ? -116.114 38.167  91.179  1.00 103.79 ?  44   PHE J CD2   1 
ATOM   160   C  CE1   . PHE A  1  44   ? -116.688 36.025  92.819  1.00 113.86 ?  44   PHE J CE1   1 
ATOM   161   C  CE2   . PHE A  1  44   ? -117.384 37.621  91.182  1.00 103.87 ?  44   PHE J CE2   1 
ATOM   162   C  CZ    . PHE A  1  44   ? -117.672 36.550  92.004  1.00 111.74 ?  44   PHE J CZ    1 
ATOM   163   N  N     . ALA A  1  45   ? -111.720 39.889  90.569  1.00 117.40 ?  45   ALA J N     1 
ATOM   164   C  CA    . ALA A  1  45   ? -110.592 40.801  90.667  1.00 125.10 ?  45   ALA J CA    1 
ATOM   165   C  C     . ALA A  1  45   ? -110.243 41.056  92.130  1.00 139.64 ?  45   ALA J C     1 
ATOM   166   O  O     . ALA A  1  45   ? -111.116 41.090  93.002  1.00 142.19 ?  45   ALA J O     1 
ATOM   167   C  CB    . ALA A  1  45   ? -110.906 42.121  89.962  1.00 116.91 ?  45   ALA J CB    1 
ATOM   168   N  N     . ASP A  1  46   ? -108.947 41.239  92.391  1.00 134.38 ?  46   ASP J N     1 
ATOM   169   C  CA    . ASP A  1  46   ? -108.489 41.393  93.769  1.00 133.65 ?  46   ASP J CA    1 
ATOM   170   C  C     . ASP A  1  46   ? -109.111 42.616  94.433  1.00 130.92 ?  46   ASP J C     1 
ATOM   171   O  O     . ASP A  1  46   ? -109.428 42.590  95.628  1.00 132.50 ?  46   ASP J O     1 
ATOM   172   C  CB    . ASP A  1  46   ? -106.965 41.489  93.809  1.00 131.29 ?  46   ASP J CB    1 
ATOM   173   C  CG    . ASP A  1  46   ? -106.289 40.238  93.289  1.00 134.39 ?  46   ASP J CG    1 
ATOM   174   O  OD1   . ASP A  1  46   ? -106.876 39.567  92.416  1.00 135.41 ?  46   ASP J OD1   1 
ATOM   175   O  OD2   . ASP A  1  46   ? -105.173 39.926  93.754  1.00 130.67 ?  46   ASP J OD2   1 
ATOM   176   N  N     . ASP A  1  47   ? -109.304 43.693  93.672  1.00 127.56 ?  47   ASP J N     1 
ATOM   177   C  CA    . ASP A  1  47   ? -109.648 44.979  94.268  1.00 134.83 ?  47   ASP J CA    1 
ATOM   178   C  C     . ASP A  1  47   ? -111.141 45.135  94.532  1.00 137.61 ?  47   ASP J C     1 
ATOM   179   O  O     . ASP A  1  47   ? -111.526 45.894  95.429  1.00 139.06 ?  47   ASP J O     1 
ATOM   180   C  CB    . ASP A  1  47   ? -109.157 46.111  93.365  1.00 134.60 ?  47   ASP J CB    1 
ATOM   181   C  CG    . ASP A  1  47   ? -109.140 45.716  91.899  1.00 137.83 ?  47   ASP J CG    1 
ATOM   182   O  OD1   . ASP A  1  47   ? -108.773 44.559  91.600  1.00 141.70 ?  47   ASP J OD1   1 
ATOM   183   O  OD2   . ASP A  1  47   ? -109.495 46.558  91.048  1.00 120.52 ?  47   ASP J OD2   1 
ATOM   184   N  N     . ALA A  1  48   ? -111.988 44.439  93.784  1.00 130.56 ?  48   ALA J N     1 
ATOM   185   C  CA    . ALA A  1  48   ? -113.419 44.695  93.828  1.00 126.11 ?  48   ALA J CA    1 
ATOM   186   C  C     . ALA A  1  48   ? -114.098 43.916  94.952  1.00 116.24 ?  48   ALA J C     1 
ATOM   187   O  O     . ALA A  1  48   ? -113.575 42.924  95.467  1.00 96.17  ?  48   ALA J O     1 
ATOM   188   C  CB    . ALA A  1  48   ? -114.066 44.348  92.489  1.00 127.82 ?  48   ALA J CB    1 
ATOM   189   N  N     . GLU A  1  49   ? -115.289 44.385  95.321  1.00 126.76 ?  49   GLU J N     1 
ATOM   190   C  CA    . GLU A  1  49   ? -116.074 43.745  96.367  1.00 118.32 ?  49   GLU J CA    1 
ATOM   191   C  C     . GLU A  1  49   ? -116.474 42.335  95.947  1.00 120.24 ?  49   GLU J C     1 
ATOM   192   O  O     . GLU A  1  49   ? -116.637 42.036  94.761  1.00 130.16 ?  49   GLU J O     1 
ATOM   193   C  CB    . GLU A  1  49   ? -117.321 44.579  96.668  1.00 111.30 ?  49   GLU J CB    1 
ATOM   194   C  CG    . GLU A  1  49   ? -117.539 44.892  98.137  1.00 118.79 ?  49   GLU J CG    1 
ATOM   195   C  CD    . GLU A  1  49   ? -118.625 45.933  98.349  1.00 134.17 ?  49   GLU J CD    1 
ATOM   196   O  OE1   . GLU A  1  49   ? -118.649 46.931  97.598  1.00 136.42 ?  49   GLU J OE1   1 
ATOM   197   O  OE2   . GLU A  1  49   ? -119.459 45.748  99.261  1.00 124.64 ?  49   GLU J OE2   1 
ATOM   198   N  N     . ILE A  1  50   ? -116.633 41.463  96.934  1.00 113.41 ?  50   ILE J N     1 
ATOM   199   C  CA    . ILE A  1  50   ? -117.018 40.072  96.718  1.00 100.60 ?  50   ILE J CA    1 
ATOM   200   C  C     . ILE A  1  50   ? -118.476 39.914  97.136  1.00 109.90 ?  50   ILE J C     1 
ATOM   201   O  O     . ILE A  1  50   ? -118.811 40.166  98.301  1.00 112.56 ?  50   ILE J O     1 
ATOM   202   C  CB    . ILE A  1  50   ? -116.116 39.102  97.497  1.00 99.20  ?  50   ILE J CB    1 
ATOM   203   C  CG1   . ILE A  1  50   ? -114.649 39.308  97.114  1.00 108.91 ?  50   ILE J CG1   1 
ATOM   204   C  CG2   . ILE A  1  50   ? -116.532 37.668  97.234  1.00 114.08 ?  50   ILE J CG2   1 
ATOM   205   C  CD1   . ILE A  1  50   ? -113.706 38.334  97.788  1.00 109.05 ?  50   ILE J CD1   1 
ATOM   206   N  N     . PRO A  1  51   ? -119.368 39.506  96.239  1.00 107.63 ?  51   PRO J N     1 
ATOM   207   C  CA    . PRO A  1  51   ? -120.770 39.316  96.627  1.00 107.34 ?  51   PRO J CA    1 
ATOM   208   C  C     . PRO A  1  51   ? -120.928 38.167  97.611  1.00 105.22 ?  51   PRO J C     1 
ATOM   209   O  O     . PRO A  1  51   ? -120.047 37.321  97.779  1.00 105.48 ?  51   PRO J O     1 
ATOM   210   C  CB    . PRO A  1  51   ? -121.471 39.007  95.298  1.00 100.42 ?  51   PRO J CB    1 
ATOM   211   C  CG    . PRO A  1  51   ? -120.538 39.506  94.238  1.00 90.68  ?  51   PRO J CG    1 
ATOM   212   C  CD    . PRO A  1  51   ? -119.161 39.307  94.796  1.00 95.51  ?  51   PRO J CD    1 
ATOM   213   N  N     . GLY A  1  52   ? -122.086 38.146  98.268  1.00 104.96 ?  52   GLY J N     1 
ATOM   214   C  CA    . GLY A  1  52   ? -122.394 37.101  99.224  1.00 111.84 ?  52   GLY J CA    1 
ATOM   215   C  C     . GLY A  1  52   ? -123.156 35.949  98.603  1.00 117.90 ?  52   GLY J C     1 
ATOM   216   O  O     . GLY A  1  52   ? -123.050 34.805  99.055  1.00 116.12 ?  52   GLY J O     1 
ATOM   217   N  N     . THR A  1  53   ? -123.934 36.245  97.565  1.00 120.82 ?  53   THR J N     1 
ATOM   218   C  CA    . THR A  1  53   ? -124.688 35.245  96.824  1.00 113.93 ?  53   THR J CA    1 
ATOM   219   C  C     . THR A  1  53   ? -124.355 35.374  95.345  1.00 101.72 ?  53   THR J C     1 
ATOM   220   O  O     . THR A  1  53   ? -124.190 36.485  94.833  1.00 94.93  ?  53   THR J O     1 
ATOM   221   C  CB    . THR A  1  53   ? -126.197 35.403  97.044  1.00 113.99 ?  53   THR J CB    1 
ATOM   222   O  OG1   . THR A  1  53   ? -126.593 36.740  96.714  1.00 112.64 ?  53   THR J OG1   1 
ATOM   223   C  CG2   . THR A  1  53   ? -126.554 35.119  98.496  1.00 100.72 ?  53   THR J CG2   1 
ATOM   224   N  N     . TRP A  1  54   ? -124.255 34.236  94.661  1.00 100.27 ?  54   TRP J N     1 
ATOM   225   C  CA    . TRP A  1  54   ? -123.797 34.220  93.279  1.00 104.32 ?  54   TRP J CA    1 
ATOM   226   C  C     . TRP A  1  54   ? -124.578 33.192  92.477  1.00 99.52  ?  54   TRP J C     1 
ATOM   227   O  O     . TRP A  1  54   ? -124.671 32.028  92.877  1.00 97.54  ?  54   TRP J O     1 
ATOM   228   C  CB    . TRP A  1  54   ? -122.297 33.914  93.204  1.00 106.61 ?  54   TRP J CB    1 
ATOM   229   C  CG    . TRP A  1  54   ? -121.717 34.117  91.843  1.00 102.79 ?  54   TRP J CG    1 
ATOM   230   C  CD1   . TRP A  1  54   ? -121.338 33.151  90.959  1.00 104.35 ?  54   TRP J CD1   1 
ATOM   231   C  CD2   . TRP A  1  54   ? -121.458 35.371  91.204  1.00 88.05  ?  54   TRP J CD2   1 
ATOM   232   N  NE1   . TRP A  1  54   ? -120.853 33.727  89.809  1.00 108.65 ?  54   TRP J NE1   1 
ATOM   233   C  CE2   . TRP A  1  54   ? -120.918 35.090  89.936  1.00 91.25  ?  54   TRP J CE2   1 
ATOM   234   C  CE3   . TRP A  1  54   ? -121.631 36.705  91.583  1.00 92.40  ?  54   TRP J CE3   1 
ATOM   235   C  CZ2   . TRP A  1  54   ? -120.548 36.094  89.045  1.00 98.03  ?  54   TRP J CZ2   1 
ATOM   236   C  CZ3   . TRP A  1  54   ? -121.264 37.699  90.698  1.00 88.82  ?  54   TRP J CZ3   1 
ATOM   237   C  CH2   . TRP A  1  54   ? -120.728 37.389  89.445  1.00 86.30  ?  54   TRP J CH2   1 
ATOM   238   N  N     . LEU A  1  55   ? -125.130 33.626  91.346  1.00 98.03  ?  55   LEU J N     1 
ATOM   239   C  CA    . LEU A  1  55   ? -125.792 32.718  90.414  1.00 90.98  ?  55   LEU J CA    1 
ATOM   240   C  C     . LEU A  1  55   ? -124.747 31.784  89.815  1.00 91.53  ?  55   LEU J C     1 
ATOM   241   O  O     . LEU A  1  55   ? -123.860 32.225  89.077  1.00 101.80 ?  55   LEU J O     1 
ATOM   242   C  CB    . LEU A  1  55   ? -126.510 33.514  89.328  1.00 77.53  ?  55   LEU J CB    1 
ATOM   243   C  CG    . LEU A  1  55   ? -127.870 32.988  88.862  1.00 78.01  ?  55   LEU J CG    1 
ATOM   244   C  CD1   . LEU A  1  55   ? -128.397 33.819  87.701  1.00 94.91  ?  55   LEU J CD1   1 
ATOM   245   C  CD2   . LEU A  1  55   ? -127.792 31.519  88.485  1.00 88.29  ?  55   LEU J CD2   1 
ATOM   246   N  N     . CYS A  1  56   ? -124.845 30.498  90.128  1.00 81.83  ?  56   CYS J N     1 
ATOM   247   C  CA    . CYS A  1  56   ? -123.816 29.533  89.773  1.00 90.96  ?  56   CYS J CA    1 
ATOM   248   C  C     . CYS A  1  56   ? -124.203 28.739  88.528  1.00 94.01  ?  56   CYS J C     1 
ATOM   249   O  O     . CYS A  1  56   ? -125.346 28.765  88.065  1.00 83.85  ?  56   CYS J O     1 
ATOM   250   C  CB    . CYS A  1  56   ? -123.550 28.583  90.946  1.00 88.61  ?  56   CYS J CB    1 
ATOM   251   S  SG    . CYS A  1  56   ? -122.987 29.402  92.457  1.00 109.92 ?  56   CYS J SG    1 
ATOM   252   N  N     . ARG A  1  57   ? -123.211 28.026  87.985  1.00 92.25  ?  57   ARG J N     1 
ATOM   253   C  CA    . ARG A  1  57   ? -123.450 27.129  86.859  1.00 76.25  ?  57   ARG J CA    1 
ATOM   254   C  C     . ARG A  1  57   ? -124.609 26.180  87.130  1.00 94.01  ?  57   ARG J C     1 
ATOM   255   O  O     . ARG A  1  57   ? -125.333 25.799  86.203  1.00 78.64  ?  57   ARG J O     1 
ATOM   256   C  CB    . ARG A  1  57   ? -122.181 26.330  86.555  1.00 75.15  ?  57   ARG J CB    1 
ATOM   257   C  CG    . ARG A  1  57   ? -121.413 26.784  85.327  1.00 84.23  ?  57   ARG J CG    1 
ATOM   258   C  CD    . ARG A  1  57   ? -120.010 26.190  85.319  1.00 96.39  ?  57   ARG J CD    1 
ATOM   259   N  NE    . ARG A  1  57   ? -119.981 24.844  85.887  1.00 96.02  ?  57   ARG J NE    1 
ATOM   260   C  CZ    . ARG A  1  57   ? -120.056 23.725  85.174  1.00 97.14  ?  57   ARG J CZ    1 
ATOM   261   N  NH1   . ARG A  1  57   ? -120.161 23.781  83.853  1.00 96.39  1  57   ARG J NH1   1 
ATOM   262   N  NH2   . ARG A  1  57   ? -120.024 22.548  85.783  1.00 100.19 ?  57   ARG J NH2   1 
ATOM   263   N  N     . ASN A  1  58   ? -124.797 25.785  88.392  1.00 109.58 ?  58   ASN J N     1 
ATOM   264   C  CA    . ASN A  1  58   ? -125.886 24.878  88.737  1.00 86.97  ?  58   ASN J CA    1 
ATOM   265   C  C     . ASN A  1  58   ? -127.238 25.432  88.313  1.00 88.81  ?  58   ASN J C     1 
ATOM   266   O  O     . ASN A  1  58   ? -128.172 24.664  88.056  1.00 87.31  ?  58   ASN J O     1 
ATOM   267   C  CB    . ASN A  1  58   ? -125.881 24.608  90.243  1.00 89.29  ?  58   ASN J CB    1 
ATOM   268   C  CG    . ASN A  1  58   ? -125.555 23.166  90.578  1.00 121.23 ?  58   ASN J CG    1 
ATOM   269   O  OD1   . ASN A  1  58   ? -125.071 22.414  89.732  1.00 119.03 ?  58   ASN J OD1   1 
ATOM   270   N  ND2   . ASN A  1  58   ? -125.818 22.774  91.820  1.00 129.19 ?  58   ASN J ND2   1 
ATOM   271   N  N     . GLY A  1  59   ? -127.359 26.752  88.221  1.00 93.36  ?  59   GLY J N     1 
ATOM   272   C  CA    . GLY A  1  59   ? -128.643 27.388  88.043  1.00 95.63  ?  59   GLY J CA    1 
ATOM   273   C  C     . GLY A  1  59   ? -129.324 27.785  89.333  1.00 99.41  ?  59   GLY J C     1 
ATOM   274   O  O     . GLY A  1  59   ? -130.437 28.320  89.288  1.00 102.61 ?  59   GLY J O     1 
ATOM   275   N  N     . LEU A  1  60   ? -128.697 27.534  90.478  1.00 100.53 ?  60   LEU J N     1 
ATOM   276   C  CA    . LEU A  1  60   ? -129.228 27.890  91.782  1.00 108.49 ?  60   LEU J CA    1 
ATOM   277   C  C     . LEU A  1  60   ? -128.357 28.963  92.421  1.00 106.18 ?  60   LEU J C     1 
ATOM   278   O  O     . LEU A  1  60   ? -127.221 29.202  92.006  1.00 100.81 ?  60   LEU J O     1 
ATOM   279   C  CB    . LEU A  1  60   ? -129.296 26.662  92.694  1.00 110.94 ?  60   LEU J CB    1 
ATOM   280   C  CG    . LEU A  1  60   ? -130.136 25.490  92.194  1.00 104.47 ?  60   LEU J CG    1 
ATOM   281   C  CD1   . LEU A  1  60   ? -129.983 24.314  93.140  1.00 95.52  ?  60   LEU J CD1   1 
ATOM   282   C  CD2   . LEU A  1  60   ? -131.592 25.905  92.069  1.00 115.90 ?  60   LEU J CD2   1 
ATOM   283   N  N     . GLU A  1  61   ? -128.901 29.611  93.446  1.00 107.11 ?  61   GLU J N     1 
ATOM   284   C  CA    . GLU A  1  61   ? -128.144 30.614  94.180  1.00 95.42  ?  61   GLU J CA    1 
ATOM   285   C  C     . GLU A  1  61   ? -127.170 29.943  95.139  1.00 107.15 ?  61   GLU J C     1 
ATOM   286   O  O     . GLU A  1  61   ? -127.464 28.892  95.715  1.00 117.52 ?  61   GLU J O     1 
ATOM   287   C  CB    . GLU A  1  61   ? -129.096 31.541  94.942  1.00 96.78  ?  61   GLU J CB    1 
ATOM   288   C  CG    . GLU A  1  61   ? -130.133 32.232  94.058  1.00 103.38 ?  61   GLU J CG    1 
ATOM   289   C  CD    . GLU A  1  61   ? -129.499 33.132  93.014  1.00 111.64 ?  61   GLU J CD    1 
ATOM   290   O  OE1   . GLU A  1  61   ? -128.388 33.641  93.268  1.00 111.19 ?  61   GLU J OE1   1 
ATOM   291   O  OE2   . GLU A  1  61   ? -130.105 33.325  91.939  1.00 123.14 -1 61   GLU J OE2   1 
ATOM   292   N  N     . GLY A  1  62   ? -125.994 30.554  95.295  1.00 106.91 ?  62   GLY J N     1 
ATOM   293   C  CA    . GLY A  1  62   ? -125.008 30.048  96.238  1.00 106.79 ?  62   GLY J CA    1 
ATOM   294   C  C     . GLY A  1  62   ? -124.475 31.078  97.218  1.00 115.13 ?  62   GLY J C     1 
ATOM   295   O  O     . GLY A  1  62   ? -124.192 32.215  96.827  1.00 114.49 ?  62   GLY J O     1 
ATOM   296   N  N     . THR A  1  63   ? -124.314 30.700  98.486  1.00 112.85 ?  63   THR J N     1 
ATOM   297   C  CA    . THR A  1  63   ? -123.804 31.612  99.500  1.00 115.24 ?  63   THR J CA    1 
ATOM   298   C  C     . THR A  1  63   ? -122.308 31.386  99.686  1.00 118.99 ?  63   THR J C     1 
ATOM   299   O  O     . THR A  1  63   ? -121.843 30.243  99.721  1.00 118.60 ?  63   THR J O     1 
ATOM   300   C  CB    . THR A  1  63   ? -124.542 31.437  100.831 1.00 116.81 ?  63   THR J CB    1 
ATOM   301   O  OG1   . THR A  1  63   ? -125.958 31.450  100.598 1.00 126.81 ?  63   THR J OG1   1 
ATOM   302   C  CG2   . THR A  1  63   ? -124.205 32.573  101.773 1.00 123.06 ?  63   THR J CG2   1 
ATOM   303   N  N     . LEU A  1  64   ? -121.558 32.481  99.798  1.00 115.99 ?  64   LEU J N     1 
ATOM   304   C  CA    . LEU A  1  64   ? -120.116 32.369  99.954  1.00 114.45 ?  64   LEU J CA    1 
ATOM   305   C  C     . LEU A  1  64   ? -119.781 31.812  101.333 1.00 116.01 ?  64   LEU J C     1 
ATOM   306   O  O     . LEU A  1  64   ? -120.526 31.994  102.300 1.00 125.01 ?  64   LEU J O     1 
ATOM   307   C  CB    . LEU A  1  64   ? -119.445 33.728  99.742  1.00 108.35 ?  64   LEU J CB    1 
ATOM   308   C  CG    . LEU A  1  64   ? -118.029 33.682  99.156  1.00 112.70 ?  64   LEU J CG    1 
ATOM   309   C  CD1   . LEU A  1  64   ? -117.668 35.021  98.542  1.00 108.56 ?  64   LEU J CD1   1 
ATOM   310   C  CD2   . LEU A  1  64   ? -117.006 33.293  100.211 1.00 122.25 ?  64   LEU J CD2   1 
ATOM   311   N  N     . ILE A  1  65   ? -118.645 31.120  101.416 1.00 113.95 ?  65   ILE J N     1 
ATOM   312   C  CA    . ILE A  1  65   ? -118.319 30.373  102.627 1.00 124.46 ?  65   ILE J CA    1 
ATOM   313   C  C     . ILE A  1  65   ? -117.681 31.274  103.678 1.00 127.36 ?  65   ILE J C     1 
ATOM   314   O  O     . ILE A  1  65   ? -117.944 31.126  104.876 1.00 119.15 ?  65   ILE J O     1 
ATOM   315   C  CB    . ILE A  1  65   ? -117.411 29.180  102.280 1.00 121.27 ?  65   ILE J CB    1 
ATOM   316   C  CG1   . ILE A  1  65   ? -118.109 28.255  101.281 1.00 104.54 ?  65   ILE J CG1   1 
ATOM   317   C  CG2   . ILE A  1  65   ? -117.024 28.420  103.539 1.00 124.82 ?  65   ILE J CG2   1 
ATOM   318   C  CD1   . ILE A  1  65   ? -117.278 27.059  100.869 1.00 115.00 ?  65   ILE J CD1   1 
ATOM   319   N  N     . GLU A  1  66   ? -116.833 32.214  103.258 1.00 122.85 ?  66   GLU J N     1 
ATOM   320   C  CA    . GLU A  1  66   ? -116.084 33.056  104.182 1.00 121.90 ?  66   GLU J CA    1 
ATOM   321   C  C     . GLU A  1  66   ? -116.305 34.524  103.850 1.00 124.03 ?  66   GLU J C     1 
ATOM   322   O  O     . GLU A  1  66   ? -116.257 34.915  102.679 1.00 122.06 ?  66   GLU J O     1 
ATOM   323   C  CB    . GLU A  1  66   ? -114.587 32.719  104.137 1.00 100.77 ?  66   GLU J CB    1 
ATOM   324   N  N     . GLY A  1  67   ? -116.544 35.331  104.881 1.00 121.77 ?  67   GLY J N     1 
ATOM   325   C  CA    . GLY A  1  67   ? -116.679 36.765  104.701 1.00 121.07 ?  67   GLY J CA    1 
ATOM   326   C  C     . GLY A  1  67   ? -117.978 37.347  105.218 1.00 129.84 ?  67   GLY J C     1 
ATOM   327   O  O     . GLY A  1  67   ? -118.205 38.556  105.105 1.00 137.44 ?  67   GLY J O     1 
ATOM   328   N  N     . ASP A  1  68   ? -118.835 36.504  105.795 1.00 140.98 ?  68   ASP J N     1 
ATOM   329   C  CA    . ASP A  1  68   ? -120.158 36.927  106.241 1.00 150.80 ?  68   ASP J CA    1 
ATOM   330   C  C     . ASP A  1  68   ? -121.020 37.313  105.045 1.00 141.75 ?  68   ASP J C     1 
ATOM   331   O  O     . ASP A  1  68   ? -120.512 37.817  104.038 1.00 132.06 ?  68   ASP J O     1 
ATOM   332   C  CB    . ASP A  1  68   ? -120.054 38.081  107.240 1.00 145.12 ?  68   ASP J CB    1 
ATOM   333   C  CG    . ASP A  1  68   ? -120.394 37.651  108.656 1.00 147.80 ?  68   ASP J CG    1 
ATOM   334   O  OD1   . ASP A  1  68   ? -121.351 36.865  108.825 1.00 142.95 ?  68   ASP J OD1   1 
ATOM   335   O  OD2   . ASP A  1  68   ? -119.702 38.092  109.598 1.00 154.13 ?  68   ASP J OD2   1 
ATOM   336   N  N     . VAL A  1  69   ? -122.325 37.088  105.153 1.00 136.57 ?  69   VAL J N     1 
ATOM   337   C  CA    . VAL A  1  69   ? -123.211 37.101  103.991 1.00 141.28 ?  69   VAL J CA    1 
ATOM   338   C  C     . VAL A  1  69   ? -123.930 38.432  103.794 1.00 150.35 ?  69   VAL J C     1 
ATOM   339   O  O     . VAL A  1  69   ? -124.232 38.784  102.645 1.00 154.22 ?  69   VAL J O     1 
ATOM   340   C  CB    . VAL A  1  69   ? -124.235 35.960  104.090 1.00 140.99 ?  69   VAL J CB    1 
ATOM   341   C  CG1   . VAL A  1  69   ? -125.281 36.088  102.995 1.00 136.42 ?  69   VAL J CG1   1 
ATOM   342   C  CG2   . VAL A  1  69   ? -123.529 34.619  104.005 1.00 131.33 ?  69   VAL J CG2   1 
ATOM   343   N  N     . PRO A  1  70   ? -124.161 39.236  104.850 1.00 157.81 ?  70   PRO J N     1 
ATOM   344   C  CA    . PRO A  1  70   ? -125.240 40.232  104.799 1.00 164.06 ?  70   PRO J CA    1 
ATOM   345   C  C     . PRO A  1  70   ? -126.227 40.034  103.657 1.00 167.44 ?  70   PRO J C     1 
ATOM   346   O  O     . PRO A  1  70   ? -126.220 40.786  102.677 1.00 168.87 ?  70   PRO J O     1 
ATOM   347   C  CB    . PRO A  1  70   ? -124.461 41.545  104.668 1.00 147.87 ?  70   PRO J CB    1 
ATOM   348   C  CG    . PRO A  1  70   ? -123.127 41.252  105.419 1.00 146.10 ?  70   PRO J CG    1 
ATOM   349   C  CD    . PRO A  1  70   ? -123.076 39.746  105.699 1.00 152.82 ?  70   PRO J CD    1 
ATOM   350   N  N     . GLU A  1  71   ? -127.076 39.013  103.776 1.00 163.72 ?  71   GLU J N     1 
ATOM   351   C  CA    . GLU A  1  71   ? -128.058 38.694  102.748 1.00 161.74 ?  71   GLU J CA    1 
ATOM   352   C  C     . GLU A  1  71   ? -129.380 39.390  103.046 1.00 165.87 ?  71   GLU J C     1 
ATOM   353   O  O     . GLU A  1  71   ? -130.184 38.886  103.841 1.00 157.52 ?  71   GLU J O     1 
ATOM   354   C  CB    . GLU A  1  71   ? -128.264 37.182  102.648 1.00 147.64 ?  71   GLU J CB    1 
ATOM   355   N  N     . PRO A  1  72   ? -129.648 40.557  102.421 1.00 169.41 ?  72   PRO J N     1 
ATOM   356   C  CA    . PRO A  1  72   ? -130.915 41.274  102.662 1.00 165.44 ?  72   PRO J CA    1 
ATOM   357   C  C     . PRO A  1  72   ? -132.052 40.726  101.803 1.00 161.94 ?  72   PRO J C     1 
ATOM   358   O  O     . PRO A  1  72   ? -132.450 41.284  100.780 1.00 152.91 ?  72   PRO J O     1 
ATOM   359   C  CB    . PRO A  1  72   ? -130.556 42.718  102.303 1.00 165.07 ?  72   PRO J CB    1 
ATOM   360   C  CG    . PRO A  1  72   ? -129.366 42.618  101.359 1.00 164.81 ?  72   PRO J CG    1 
ATOM   361   C  CD    . PRO A  1  72   ? -128.851 41.199  101.365 1.00 165.76 ?  72   PRO J CD    1 
ATOM   362   N  N     . LYS A  1  73   ? -132.585 39.584  102.234 1.00 164.49 ?  73   LYS J N     1 
ATOM   363   C  CA    . LYS A  1  73   ? -133.673 38.935  101.515 1.00 162.60 ?  73   LYS J CA    1 
ATOM   364   C  C     . LYS A  1  73   ? -134.804 39.920  101.251 1.00 166.15 ?  73   LYS J C     1 
ATOM   365   O  O     . LYS A  1  73   ? -135.249 40.631  102.156 1.00 162.53 ?  73   LYS J O     1 
ATOM   366   C  CB    . LYS A  1  73   ? -134.184 37.733  102.315 1.00 147.56 ?  73   LYS J CB    1 
ATOM   367   C  CG    . LYS A  1  73   ? -134.498 38.038  103.773 1.00 132.75 ?  73   LYS J CG    1 
ATOM   368   C  CD    . LYS A  1  73   ? -134.846 36.771  104.539 1.00 122.67 ?  73   LYS J CD    1 
ATOM   369   C  CE    . LYS A  1  73   ? -135.069 37.053  106.017 1.00 127.52 ?  73   LYS J CE    1 
ATOM   370   N  NZ    . LYS A  1  73   ? -136.222 37.968  106.248 1.00 143.30 ?  73   LYS J NZ    1 
ATOM   371   N  N     . LYS A  1  74   ? -135.259 39.962  99.995  1.00 163.23 ?  74   LYS J N     1 
ATOM   372   C  CA    . LYS A  1  74   ? -136.322 40.887  99.615  1.00 157.78 ?  74   LYS J CA    1 
ATOM   373   C  C     . LYS A  1  74   ? -137.497 40.822  100.580 1.00 159.74 ?  74   LYS J C     1 
ATOM   374   O  O     . LYS A  1  74   ? -138.175 41.831  100.804 1.00 158.52 ?  74   LYS J O     1 
ATOM   375   C  CB    . LYS A  1  74   ? -136.791 40.594  98.189  1.00 142.78 ?  74   LYS J CB    1 
ATOM   376   N  N     . VAL A  1  75   ? -137.754 39.649  101.158 1.00 164.78 ?  75   VAL J N     1 
ATOM   377   C  CA    . VAL A  1  75   ? -138.790 39.482  102.174 1.00 161.75 ?  75   VAL J CA    1 
ATOM   378   C  C     . VAL A  1  75   ? -140.168 39.877  101.652 1.00 157.88 ?  75   VAL J C     1 
ATOM   379   O  O     . VAL A  1  75   ? -141.022 40.339  102.413 1.00 161.55 ?  75   VAL J O     1 
ATOM   380   C  CB    . VAL A  1  75   ? -138.453 40.273  103.441 1.00 151.64 ?  75   VAL J CB    1 
ATOM   381   N  N     . LYS A  1  76   ? -140.400 39.702  100.351 1.00 145.18 ?  76   LYS J N     1 
ATOM   382   C  CA    . LYS A  1  76   ? -141.711 39.968  99.776  1.00 135.43 ?  76   LYS J CA    1 
ATOM   383   C  C     . LYS A  1  76   ? -142.541 38.693  99.856  1.00 134.33 ?  76   LYS J C     1 
ATOM   384   O  O     . LYS A  1  76   ? -142.222 37.715  99.162  1.00 139.31 ?  76   LYS J O     1 
ATOM   385   C  CB    . LYS A  1  76   ? -141.586 40.451  98.334  1.00 140.16 ?  76   LYS J CB    1 
ATOM   386   C  CG    . LYS A  1  76   ? -141.166 39.391  97.325  1.00 143.47 ?  76   LYS J CG    1 
ATOM   387   C  CD    . LYS A  1  76   ? -142.375 38.844  96.575  1.00 129.78 ?  76   LYS J CD    1 
ATOM   388   C  CE    . LYS A  1  76   ? -142.140 37.417  96.103  1.00 114.09 ?  76   LYS J CE    1 
ATOM   389   N  NZ    . LYS A  1  76   ? -140.910 37.291  95.273  1.00 126.83 ?  76   LYS J NZ    1 
ATOM   390   N  N     . PRO A  1  77   ? -143.570 38.636  100.693 1.00 127.21 ?  77   PRO J N     1 
ATOM   391   C  CA    . PRO A  1  77   ? -144.387 37.425  100.780 1.00 114.73 ?  77   PRO J CA    1 
ATOM   392   C  C     . PRO A  1  77   ? -145.291 37.297  99.568  1.00 110.33 ?  77   PRO J C     1 
ATOM   393   O  O     . PRO A  1  77   ? -146.179 38.136  99.353  1.00 117.09 ?  77   PRO J O     1 
ATOM   394   C  CB    . PRO A  1  77   ? -145.201 37.640  102.064 1.00 123.97 ?  77   PRO J CB    1 
ATOM   395   C  CG    . PRO A  1  77   ? -145.297 39.121  102.189 1.00 126.10 ?  77   PRO J CG    1 
ATOM   396   C  CD    . PRO A  1  77   ? -144.000 39.667  101.654 1.00 131.83 ?  77   PRO J CD    1 
ATOM   397   N  N     . PRO A  1  78   ? -145.095 36.265  98.750  1.00 96.04  ?  78   PRO J N     1 
ATOM   398   C  CA    . PRO A  1  78   ? -145.937 36.105  97.559  1.00 95.14  ?  78   PRO J CA    1 
ATOM   399   C  C     . PRO A  1  78   ? -147.404 35.974  97.937  1.00 92.39  ?  78   PRO J C     1 
ATOM   400   O  O     . PRO A  1  78   ? -147.764 35.254  98.870  1.00 93.34  ?  78   PRO J O     1 
ATOM   401   C  CB    . PRO A  1  78   ? -145.400 34.823  96.913  1.00 98.41  ?  78   PRO J CB    1 
ATOM   402   C  CG    . PRO A  1  78   ? -144.712 34.095  98.022  1.00 94.37  ?  78   PRO J CG    1 
ATOM   403   C  CD    . PRO A  1  78   ? -144.134 35.162  98.902  1.00 89.25  ?  78   PRO J CD    1 
ATOM   404   N  N     . ARG A  1  79   ? -148.252 36.686  97.199  1.00 88.66  ?  79   ARG J N     1 
ATOM   405   C  CA    . ARG A  1  79   ? -149.678 36.699  97.493  1.00 81.75  ?  79   ARG J CA    1 
ATOM   406   C  C     . ARG A  1  79   ? -150.265 35.301  97.344  1.00 82.16  ?  79   ARG J C     1 
ATOM   407   O  O     . ARG A  1  79   ? -150.021 34.613  96.348  1.00 93.57  ?  79   ARG J O     1 
ATOM   408   C  CB    . ARG A  1  79   ? -150.384 37.684  96.563  1.00 70.80  ?  79   ARG J CB    1 
ATOM   409   C  CG    . ARG A  1  79   ? -151.761 38.120  97.020  1.00 87.80  ?  79   ARG J CG    1 
ATOM   410   C  CD    . ARG A  1  79   ? -152.068 39.520  96.502  1.00 66.27  ?  79   ARG J CD    1 
ATOM   411   N  NE    . ARG A  1  79   ? -153.501 39.779  96.418  1.00 56.57  ?  79   ARG J NE    1 
ATOM   412   C  CZ    . ARG A  1  79   ? -154.257 39.427  95.383  1.00 78.10  ?  79   ARG J CZ    1 
ATOM   413   N  NH1   . ARG A  1  79   ? -153.716 38.794  94.348  1.00 63.13  ?  79   ARG J NH1   1 
ATOM   414   N  NH2   . ARG A  1  79   ? -155.553 39.705  95.382  1.00 87.06  ?  79   ARG J NH2   1 
ATOM   415   N  N     . THR A  1  80   ? -151.038 34.880  98.340  1.00 79.37  ?  80   THR J N     1 
ATOM   416   C  CA    . THR A  1  80   ? -151.599 33.538  98.397  1.00 74.32  ?  80   THR J CA    1 
ATOM   417   C  C     . THR A  1  80   ? -153.119 33.586  98.298  1.00 69.41  ?  80   THR J C     1 
ATOM   418   O  O     . THR A  1  80   ? -153.741 34.650  98.345  1.00 72.45  ?  80   THR J O     1 
ATOM   419   C  CB    . THR A  1  80   ? -151.182 32.826  99.689  1.00 74.54  ?  80   THR J CB    1 
ATOM   420   O  OG1   . THR A  1  80   ? -151.667 33.561  100.820 1.00 77.75  ?  80   THR J OG1   1 
ATOM   421   C  CG2   . THR A  1  80   ? -149.666 32.715  99.773  1.00 85.38  ?  80   THR J CG2   1 
ATOM   422   N  N     . HIS A  1  81   ? -153.714 32.398  98.162  1.00 61.75  ?  81   HIS J N     1 
ATOM   423   C  CA    . HIS A  1  81   ? -155.168 32.301  98.087  1.00 55.60  ?  81   HIS J CA    1 
ATOM   424   C  C     . HIS A  1  81   ? -155.828 32.822  99.356  1.00 70.34  ?  81   HIS J C     1 
ATOM   425   O  O     . HIS A  1  81   ? -156.938 33.363  99.303  1.00 76.04  ?  81   HIS J O     1 
ATOM   426   C  CB    . HIS A  1  81   ? -155.580 30.852  97.825  1.00 65.47  ?  81   HIS J CB    1 
ATOM   427   C  CG    . HIS A  1  81   ? -157.024 30.682  97.466  1.00 71.17  ?  81   HIS J CG    1 
ATOM   428   N  ND1   . HIS A  1  81   ? -157.601 29.445  97.274  1.00 72.88  ?  81   HIS J ND1   1 
ATOM   429   C  CD2   . HIS A  1  81   ? -158.005 31.591  97.259  1.00 69.82  ?  81   HIS J CD2   1 
ATOM   430   C  CE1   . HIS A  1  81   ? -158.876 29.599  96.967  1.00 68.71  ?  81   HIS J CE1   1 
ATOM   431   N  NE2   . HIS A  1  81   ? -159.147 30.892  96.951  1.00 74.27  ?  81   HIS J NE2   1 
ATOM   432   N  N     . TRP A  1  82   ? -155.163 32.671  100.504 1.00 74.48  ?  82   TRP J N     1 
ATOM   433   C  CA    . TRP A  1  82   ? -155.715 33.192  101.749 1.00 59.43  ?  82   TRP J CA    1 
ATOM   434   C  C     . TRP A  1  82   ? -155.828 34.710  101.707 1.00 69.45  ?  82   TRP J C     1 
ATOM   435   O  O     . TRP A  1  82   ? -156.822 35.280  102.174 1.00 85.84  ?  82   TRP J O     1 
ATOM   436   C  CB    . TRP A  1  82   ? -154.852 32.745  102.930 1.00 69.93  ?  82   TRP J CB    1 
ATOM   437   C  CG    . TRP A  1  82   ? -155.201 33.411  104.226 1.00 71.26  ?  82   TRP J CG    1 
ATOM   438   C  CD1   . TRP A  1  82   ? -154.430 34.291  104.928 1.00 70.48  ?  82   TRP J CD1   1 
ATOM   439   C  CD2   . TRP A  1  82   ? -156.413 33.254  104.975 1.00 70.70  ?  82   TRP J CD2   1 
ATOM   440   N  NE1   . TRP A  1  82   ? -155.085 34.689  106.068 1.00 80.62  ?  82   TRP J NE1   1 
ATOM   441   C  CE2   . TRP A  1  82   ? -156.305 34.067  106.119 1.00 77.97  ?  82   TRP J CE2   1 
ATOM   442   C  CE3   . TRP A  1  82   ? -157.578 32.505  104.787 1.00 67.44  ?  82   TRP J CE3   1 
ATOM   443   C  CZ2   . TRP A  1  82   ? -157.318 34.152  107.071 1.00 80.94  ?  82   TRP J CZ2   1 
ATOM   444   C  CZ3   . TRP A  1  82   ? -158.582 32.589  105.734 1.00 63.13  ?  82   TRP J CZ3   1 
ATOM   445   C  CH2   . TRP A  1  82   ? -158.445 33.407  106.861 1.00 76.88  ?  82   TRP J CH2   1 
ATOM   446   N  N     . ASP A  1  83   ? -154.822 35.384  101.145 1.00 70.74  ?  83   ASP J N     1 
ATOM   447   C  CA    . ASP A  1  83   ? -154.870 36.839  101.051 1.00 70.97  ?  83   ASP J CA    1 
ATOM   448   C  C     . ASP A  1  83   ? -156.052 37.298  100.207 1.00 71.04  ?  83   ASP J C     1 
ATOM   449   O  O     . ASP A  1  83   ? -156.704 38.299  100.527 1.00 83.63  ?  83   ASP J O     1 
ATOM   450   C  CB    . ASP A  1  83   ? -153.561 37.372  100.470 1.00 67.69  ?  83   ASP J CB    1 
ATOM   451   C  CG    . ASP A  1  83   ? -152.352 36.979  101.295 1.00 80.79  ?  83   ASP J CG    1 
ATOM   452   O  OD1   . ASP A  1  83   ? -152.507 36.774  102.518 1.00 91.64  ?  83   ASP J OD1   1 
ATOM   453   O  OD2   . ASP A  1  83   ? -151.247 36.878  100.721 1.00 80.30  ?  83   ASP J OD2   1 
ATOM   454   N  N     . MET A  1  84   ? -156.343 36.578  99.121  1.00 65.35  ?  84   MET J N     1 
ATOM   455   C  CA    . MET A  1  84   ? -157.439 36.970  98.242  1.00 62.90  ?  84   MET J CA    1 
ATOM   456   C  C     . MET A  1  84   ? -158.795 36.731  98.892  1.00 76.31  ?  84   MET J C     1 
ATOM   457   O  O     . MET A  1  84   ? -159.762 37.436  98.580  1.00 82.34  ?  84   MET J O     1 
ATOM   458   C  CB    . MET A  1  84   ? -157.343 36.208  96.923  1.00 63.09  ?  84   MET J CB    1 
ATOM   459   C  CG    . MET A  1  84   ? -155.990 36.326  96.244  1.00 64.61  ?  84   MET J CG    1 
ATOM   460   S  SD    . MET A  1  84   ? -155.826 35.200  94.850  1.00 73.24  ?  84   MET J SD    1 
ATOM   461   C  CE    . MET A  1  84   ? -157.275 35.645  93.891  1.00 83.04  ?  84   MET J CE    1 
ATOM   462   N  N     . LEU A  1  85   ? -158.888 35.745  99.785  1.00 74.67  ?  85   LEU J N     1 
ATOM   463   C  CA    . LEU A  1  85   ? -160.148 35.476  100.469 1.00 70.39  ?  85   LEU J CA    1 
ATOM   464   C  C     . LEU A  1  85   ? -160.361 36.423  101.642 1.00 75.30  ?  85   LEU J C     1 
ATOM   465   O  O     . LEU A  1  85   ? -161.480 36.898  101.866 1.00 81.48  ?  85   LEU J O     1 
ATOM   466   C  CB    . LEU A  1  85   ? -160.185 34.026  100.949 1.00 72.26  ?  85   LEU J CB    1 
ATOM   467   C  CG    . LEU A  1  85   ? -161.382 33.641  101.818 1.00 64.97  ?  85   LEU J CG    1 
ATOM   468   C  CD1   . LEU A  1  85   ? -162.678 33.789  101.037 1.00 69.88  ?  85   LEU J CD1   1 
ATOM   469   C  CD2   . LEU A  1  85   ? -161.223 32.224  102.343 1.00 54.43  ?  85   LEU J CD2   1 
ATOM   470   N  N     . LEU A  1  86   ? -159.301 36.706  102.402 1.00 75.53  ?  86   LEU J N     1 
ATOM   471   C  CA    . LEU A  1  86   ? -159.438 37.582  103.559 1.00 77.54  ?  86   LEU J CA    1 
ATOM   472   C  C     . LEU A  1  86   ? -159.894 38.978  103.155 1.00 81.92  ?  86   LEU J C     1 
ATOM   473   O  O     . LEU A  1  86   ? -160.625 39.633  103.907 1.00 89.19  ?  86   LEU J O     1 
ATOM   474   C  CB    . LEU A  1  86   ? -158.115 37.652  104.322 1.00 68.74  ?  86   LEU J CB    1 
ATOM   475   C  CG    . LEU A  1  86   ? -158.177 38.286  105.713 1.00 74.59  ?  86   LEU J CG    1 
ATOM   476   C  CD1   . LEU A  1  86   ? -159.097 37.483  106.618 1.00 83.58  ?  86   LEU J CD1   1 
ATOM   477   C  CD2   . LEU A  1  86   ? -156.789 38.397  106.322 1.00 60.43  ?  86   LEU J CD2   1 
ATOM   478   N  N     . GLU A  1  87   ? -159.489 39.446  101.975 1.00 76.50  ?  87   GLU J N     1 
ATOM   479   C  CA    . GLU A  1  87   ? -159.819 40.796  101.537 1.00 86.04  ?  87   GLU J CA    1 
ATOM   480   C  C     . GLU A  1  87   ? -161.248 40.929  101.027 1.00 78.23  ?  87   GLU J C     1 
ATOM   481   O  O     . GLU A  1  87   ? -161.635 42.024  100.605 1.00 87.51  ?  87   GLU J O     1 
ATOM   482   C  CB    . GLU A  1  87   ? -158.834 41.257  100.457 1.00 84.64  ?  87   GLU J CB    1 
ATOM   483   C  CG    . GLU A  1  87   ? -158.809 40.395  99.207  1.00 93.73  ?  87   GLU J CG    1 
ATOM   484   C  CD    . GLU A  1  87   ? -157.709 40.805  98.243  1.00 91.19  ?  87   GLU J CD    1 
ATOM   485   O  OE1   . GLU A  1  87   ? -156.792 41.541  98.665  1.00 77.96  ?  87   GLU J OE1   1 
ATOM   486   O  OE2   . GLU A  1  87   ? -157.762 40.394  97.064  1.00 93.83  ?  87   GLU J OE2   1 
ATOM   487   N  N     . ARG A  1  88   ? -162.038 39.861  101.054 1.00 64.68  ?  88   ARG J N     1 
ATOM   488   C  CA    . ARG A  1  88   ? -163.457 39.948  100.728 1.00 73.38  ?  88   ARG J CA    1 
ATOM   489   C  C     . ARG A  1  88   ? -164.353 39.431  101.839 1.00 81.14  ?  88   ARG J C     1 
ATOM   490   O  O     . ARG A  1  88   ? -165.429 39.991  102.068 1.00 97.63  ?  88   ARG J O     1 
ATOM   491   C  CB    . ARG A  1  88   ? -163.761 39.185  99.429  1.00 71.39  ?  88   ARG J CB    1 
ATOM   492   C  CG    . ARG A  1  88   ? -163.605 37.677  99.524  1.00 73.39  ?  88   ARG J CG    1 
ATOM   493   C  CD    . ARG A  1  88   ? -164.169 36.996  98.281  1.00 76.50  ?  88   ARG J CD    1 
ATOM   494   N  NE    . ARG A  1  88   ? -164.039 35.543  98.340  1.00 69.44  ?  88   ARG J NE    1 
ATOM   495   C  CZ    . ARG A  1  88   ? -163.070 34.852  97.748  1.00 65.74  ?  88   ARG J CZ    1 
ATOM   496   N  NH1   . ARG A  1  88   ? -162.138 35.476  97.040  1.00 75.53  ?  88   ARG J NH1   1 
ATOM   497   N  NH2   . ARG A  1  88   ? -163.035 33.533  97.860  1.00 75.44  ?  88   ARG J NH2   1 
ATOM   498   N  N     . ARG A  1  89   ? -163.938 38.381  102.541 1.00 80.64  ?  89   ARG J N     1 
ATOM   499   C  CA    . ARG A  1  89   ? -164.672 37.855  103.684 1.00 76.06  ?  89   ARG J CA    1 
ATOM   500   C  C     . ARG A  1  89   ? -164.037 38.359  104.971 1.00 81.01  ?  89   ARG J C     1 
ATOM   501   O  O     . ARG A  1  89   ? -162.829 38.198  105.176 1.00 84.17  ?  89   ARG J O     1 
ATOM   502   C  CB    . ARG A  1  89   ? -164.679 36.326  103.679 1.00 77.39  ?  89   ARG J CB    1 
ATOM   503   C  CG    . ARG A  1  89   ? -165.371 35.699  102.488 1.00 77.22  ?  89   ARG J CG    1 
ATOM   504   C  CD    . ARG A  1  89   ? -166.860 35.964  102.513 1.00 69.30  ?  89   ARG J CD    1 
ATOM   505   N  NE    . ARG A  1  89   ? -167.526 35.333  101.380 1.00 66.66  ?  89   ARG J NE    1 
ATOM   506   C  CZ    . ARG A  1  89   ? -167.603 35.874  100.171 1.00 68.27  ?  89   ARG J CZ    1 
ATOM   507   N  NH1   . ARG A  1  89   ? -167.052 37.057  99.940  1.00 82.82  ?  89   ARG J NH1   1 
ATOM   508   N  NH2   . ARG A  1  89   ? -168.226 35.234  99.192  1.00 79.75  ?  89   ARG J NH2   1 
ATOM   509   N  N     . SER A  1  90   ? -164.847 38.970  105.830 1.00 88.27  ?  90   SER J N     1 
ATOM   510   C  CA    . SER A  1  90   ? -164.391 39.287  107.174 1.00 87.48  ?  90   SER J CA    1 
ATOM   511   C  C     . SER A  1  90   ? -164.319 38.012  108.006 1.00 95.27  ?  90   SER J C     1 
ATOM   512   O  O     . SER A  1  90   ? -165.092 37.071  107.805 1.00 102.37 ?  90   SER J O     1 
ATOM   513   C  CB    . SER A  1  90   ? -165.327 40.296  107.839 1.00 103.86 ?  90   SER J CB    1 
ATOM   514   O  OG    . SER A  1  90   ? -164.856 40.646  109.129 1.00 128.79 ?  90   SER J OG    1 
ATOM   515   N  N     . VAL A  1  91   ? -163.376 37.986  108.952 1.00 89.09  ?  91   VAL J N     1 
ATOM   516   C  CA    . VAL A  1  91   ? -163.148 36.772  109.735 1.00 87.80  ?  91   VAL J CA    1 
ATOM   517   C  C     . VAL A  1  91   ? -164.443 36.271  110.357 1.00 89.45  ?  91   VAL J C     1 
ATOM   518   O  O     . VAL A  1  91   ? -164.607 35.066  110.586 1.00 91.10  ?  91   VAL J O     1 
ATOM   519   C  CB    . VAL A  1  91   ? -162.066 37.015  110.809 1.00 77.66  ?  91   VAL J CB    1 
ATOM   520   C  CG1   . VAL A  1  91   ? -160.995 37.960  110.282 1.00 82.53  ?  91   VAL J CG1   1 
ATOM   521   C  CG2   . VAL A  1  91   ? -162.690 37.545  112.092 1.00 95.42  ?  91   VAL J CG2   1 
ATOM   522   N  N     . GLU A  1  92   ? -165.384 37.176  110.635 1.00 91.48  ?  92   GLU J N     1 
ATOM   523   C  CA    . GLU A  1  92   ? -166.668 36.762  111.192 1.00 88.33  ?  92   GLU J CA    1 
ATOM   524   C  C     . GLU A  1  92   ? -167.478 35.974  110.168 1.00 87.17  ?  92   GLU J C     1 
ATOM   525   O  O     . GLU A  1  92   ? -168.021 34.906  110.478 1.00 84.93  ?  92   GLU J O     1 
ATOM   526   C  CB    . GLU A  1  92   ? -167.454 37.981  111.676 1.00 90.39  ?  92   GLU J CB    1 
ATOM   527   C  CG    . GLU A  1  92   ? -166.757 38.807  112.750 1.00 107.14 ?  92   GLU J CG    1 
ATOM   528   C  CD    . GLU A  1  92   ? -165.637 39.671  112.196 1.00 115.54 ?  92   GLU J CD    1 
ATOM   529   O  OE1   . GLU A  1  92   ? -164.935 39.218  111.268 1.00 106.74 ?  92   GLU J OE1   1 
ATOM   530   O  OE2   . GLU A  1  92   ? -165.463 40.808  112.686 1.00 123.78 ?  92   GLU J OE2   1 
ATOM   531   N  N     . GLU A  1  93   ? -167.574 36.489  108.940 1.00 80.12  ?  93   GLU J N     1 
ATOM   532   C  CA    . GLU A  1  93   ? -168.284 35.764  107.892 1.00 69.47  ?  93   GLU J CA    1 
ATOM   533   C  C     . GLU A  1  93   ? -167.694 34.375  107.691 1.00 80.94  ?  93   GLU J C     1 
ATOM   534   O  O     . GLU A  1  93   ? -168.429 33.401  107.486 1.00 77.59  ?  93   GLU J O     1 
ATOM   535   C  CB    . GLU A  1  93   ? -168.245 36.562  106.589 1.00 85.46  ?  93   GLU J CB    1 
ATOM   536   C  CG    . GLU A  1  93   ? -169.028 37.866  106.633 1.00 96.65  ?  93   GLU J CG    1 
ATOM   537   C  CD    . GLU A  1  93   ? -168.539 38.873  105.611 1.00 91.41  ?  93   GLU J CD    1 
ATOM   538   O  OE1   . GLU A  1  93   ? -167.319 38.906  105.348 1.00 91.22  ?  93   GLU J OE1   1 
ATOM   539   O  OE2   . GLU A  1  93   ? -169.372 39.631  105.070 1.00 106.40 ?  93   GLU J OE2   1 
ATOM   540   N  N     . LEU A  1  94   ? -166.365 34.262  107.753 1.00 78.80  ?  94   LEU J N     1 
ATOM   541   C  CA    . LEU A  1  94   ? -165.725 32.957  107.620 1.00 83.87  ?  94   LEU J CA    1 
ATOM   542   C  C     . LEU A  1  94   ? -166.039 32.067  108.814 1.00 91.50  ?  94   LEU J C     1 
ATOM   543   O  O     . LEU A  1  94   ? -166.286 30.866  108.655 1.00 95.54  ?  94   LEU J O     1 
ATOM   544   C  CB    . LEU A  1  94   ? -164.215 33.130  107.466 1.00 76.78  ?  94   LEU J CB    1 
ATOM   545   C  CG    . LEU A  1  94   ? -163.757 34.028  106.319 1.00 73.05  ?  94   LEU J CG    1 
ATOM   546   C  CD1   . LEU A  1  94   ? -162.263 34.280  106.415 1.00 69.25  ?  94   LEU J CD1   1 
ATOM   547   C  CD2   . LEU A  1  94   ? -164.120 33.399  104.982 1.00 73.75  ?  94   LEU J CD2   1 
ATOM   548   N  N     . GLU A  1  95   ? -166.026 32.639  110.020 1.00 86.85  ?  95   GLU J N     1 
ATOM   549   C  CA    . GLU A  1  95   ? -166.353 31.863  111.210 1.00 76.34  ?  95   GLU J CA    1 
ATOM   550   C  C     . GLU A  1  95   ? -167.773 31.316  111.135 1.00 79.76  ?  95   GLU J C     1 
ATOM   551   O  O     . GLU A  1  95   ? -168.019 30.154  111.480 1.00 84.21  ?  95   GLU J O     1 
ATOM   552   C  CB    . GLU A  1  95   ? -166.170 32.726  112.457 1.00 77.92  ?  95   GLU J CB    1 
ATOM   553   C  CG    . GLU A  1  95   ? -166.322 31.978  113.765 1.00 92.22  ?  95   GLU J CG    1 
ATOM   554   C  CD    . GLU A  1  95   ? -165.317 30.857  113.907 1.00 98.87  ?  95   GLU J CD    1 
ATOM   555   O  OE1   . GLU A  1  95   ? -165.503 29.806  113.258 1.00 111.53 ?  95   GLU J OE1   1 
ATOM   556   O  OE2   . GLU A  1  95   ? -164.334 31.032  114.658 1.00 97.90  ?  95   GLU J OE2   1 
ATOM   557   N  N     . GLU A  1  96   ? -168.722 32.139  110.682 1.00 79.24  ?  96   GLU J N     1 
ATOM   558   C  CA    . GLU A  1  96   ? -170.099 31.676  110.557 1.00 90.22  ?  96   GLU J CA    1 
ATOM   559   C  C     . GLU A  1  96   ? -170.210 30.551  109.537 1.00 84.06  ?  96   GLU J C     1 
ATOM   560   O  O     . GLU A  1  96   ? -170.915 29.561  109.765 1.00 83.51  ?  96   GLU J O     1 
ATOM   561   C  CB    . GLU A  1  96   ? -171.013 32.839  110.173 1.00 105.89 ?  96   GLU J CB    1 
ATOM   562   C  CG    . GLU A  1  96   ? -172.489 32.475  110.133 1.00 111.83 ?  96   GLU J CG    1 
ATOM   563   C  CD    . GLU A  1  96   ? -173.341 33.560  109.503 1.00 122.74 ?  96   GLU J CD    1 
ATOM   564   O  OE1   . GLU A  1  96   ? -174.256 33.219  108.722 1.00 117.97 ?  96   GLU J OE1   1 
ATOM   565   O  OE2   . GLU A  1  96   ? -173.091 34.753  109.782 1.00 108.36 ?  96   GLU J OE2   1 
ATOM   566   N  N     . LEU A  1  97   ? -169.524 30.688  108.400 1.00 87.41  ?  97   LEU J N     1 
ATOM   567   C  CA    . LEU A  1  97   ? -169.541 29.626  107.400 1.00 92.78  ?  97   LEU J CA    1 
ATOM   568   C  C     . LEU A  1  97   ? -168.998 28.326  107.978 1.00 89.96  ?  97   LEU J C     1 
ATOM   569   O  O     . LEU A  1  97   ? -169.587 27.255  107.783 1.00 91.39  ?  97   LEU J O     1 
ATOM   570   C  CB    . LEU A  1  97   ? -168.730 30.045  106.174 1.00 71.71  ?  97   LEU J CB    1 
ATOM   571   C  CG    . LEU A  1  97   ? -169.143 29.459  104.821 1.00 68.50  ?  97   LEU J CG    1 
ATOM   572   C  CD1   . LEU A  1  97   ? -168.076 29.734  103.770 1.00 89.20  ?  97   LEU J CD1   1 
ATOM   573   C  CD2   . LEU A  1  97   ? -169.437 27.973  104.914 1.00 87.83  ?  97   LEU J CD2   1 
ATOM   574   N  N     . LEU A  1  98   ? -167.877 28.400  108.699 1.00 76.97  ?  98   LEU J N     1 
ATOM   575   C  CA    . LEU A  1  98   ? -167.282 27.194  109.262 1.00 71.05  ?  98   LEU J CA    1 
ATOM   576   C  C     . LEU A  1  98   ? -168.232 26.515  110.241 1.00 81.34  ?  98   LEU J C     1 
ATOM   577   O  O     . LEU A  1  98   ? -168.284 25.282  110.315 1.00 84.97  ?  98   LEU J O     1 
ATOM   578   C  CB    . LEU A  1  98   ? -165.955 27.537  109.939 1.00 65.38  ?  98   LEU J CB    1 
ATOM   579   C  CG    . LEU A  1  98   ? -165.095 26.354  110.381 1.00 78.42  ?  98   LEU J CG    1 
ATOM   580   C  CD1   . LEU A  1  98   ? -164.959 25.346  109.250 1.00 74.69  ?  98   LEU J CD1   1 
ATOM   581   C  CD2   . LEU A  1  98   ? -163.728 26.843  110.829 1.00 77.51  ?  98   LEU J CD2   1 
ATOM   582   N  N     . LYS A  1  99   ? -168.993 27.304  111.004 1.00 87.01  ?  99   LYS J N     1 
ATOM   583   C  CA    . LYS A  1  99   ? -169.993 26.718  111.888 1.00 72.08  ?  99   LYS J CA    1 
ATOM   584   C  C     . LYS A  1  99   ? -171.063 25.986  111.090 1.00 71.26  ?  99   LYS J C     1 
ATOM   585   O  O     . LYS A  1  99   ? -171.496 24.893  111.473 1.00 77.13  ?  99   LYS J O     1 
ATOM   586   C  CB    . LYS A  1  99   ? -170.621 27.799  112.768 1.00 59.15  ?  99   LYS J CB    1 
ATOM   587   N  N     . GLU A  1  100  ? -171.500 26.571  109.973 1.00 78.11  ?  100  GLU J N     1 
ATOM   588   C  CA    . GLU A  1  100  ? -172.461 25.891  109.110 1.00 83.36  ?  100  GLU J CA    1 
ATOM   589   C  C     . GLU A  1  100  ? -171.913 24.548  108.648 1.00 86.95  ?  100  GLU J C     1 
ATOM   590   O  O     . GLU A  1  100  ? -172.605 23.524  108.710 1.00 92.86  ?  100  GLU J O     1 
ATOM   591   C  CB    . GLU A  1  100  ? -172.806 26.771  107.908 1.00 92.24  ?  100  GLU J CB    1 
ATOM   592   C  CG    . GLU A  1  100  ? -173.330 28.152  108.259 1.00 98.76  ?  100  GLU J CG    1 
ATOM   593   C  CD    . GLU A  1  100  ? -173.757 28.936  107.032 1.00 115.94 ?  100  GLU J CD    1 
ATOM   594   O  OE1   . GLU A  1  100  ? -174.127 28.304  106.019 1.00 107.37 ?  100  GLU J OE1   1 
ATOM   595   O  OE2   . GLU A  1  100  ? -173.717 30.184  107.078 1.00 132.96 ?  100  GLU J OE2   1 
ATOM   596   N  N     . ARG A  1  101  ? -170.664 24.534  108.177 1.00 86.57  ?  101  ARG J N     1 
ATOM   597   C  CA    . ARG A  1  101  ? -170.056 23.287  107.727 1.00 80.94  ?  101  ARG J CA    1 
ATOM   598   C  C     . ARG A  1  101  ? -169.938 22.287  108.869 1.00 83.74  ?  101  ARG J C     1 
ATOM   599   O  O     . ARG A  1  101  ? -170.264 21.106  108.706 1.00 88.34  ?  101  ARG J O     1 
ATOM   600   C  CB    . ARG A  1  101  ? -168.685 23.570  107.113 1.00 85.93  ?  101  ARG J CB    1 
ATOM   601   C  CG    . ARG A  1  101  ? -168.746 24.315  105.793 1.00 78.63  ?  101  ARG J CG    1 
ATOM   602   C  CD    . ARG A  1  101  ? -169.290 23.418  104.696 1.00 72.28  ?  101  ARG J CD    1 
ATOM   603   N  NE    . ARG A  1  101  ? -170.368 24.052  103.944 1.00 66.96  ?  101  ARG J NE    1 
ATOM   604   C  CZ    . ARG A  1  101  ? -171.003 23.475  102.929 1.00 77.12  ?  101  ARG J CZ    1 
ATOM   605   N  NH1   . ARG A  1  101  ? -170.664 22.250  102.545 1.00 65.79  ?  101  ARG J NH1   1 
ATOM   606   N  NH2   . ARG A  1  101  ? -171.976 24.121  102.298 1.00 72.24  ?  101  ARG J NH2   1 
ATOM   607   N  N     . LEU A  1  102  ? -169.475 22.742  110.035 1.00 84.53  ?  102  LEU J N     1 
ATOM   608   C  CA    . LEU A  1  102  ? -169.336 21.839  111.173 1.00 82.08  ?  102  LEU J CA    1 
ATOM   609   C  C     . LEU A  1  102  ? -170.695 21.354  111.664 1.00 91.01  ?  102  LEU J C     1 
ATOM   610   O  O     . LEU A  1  102  ? -170.873 20.160  111.933 1.00 89.61  ?  102  LEU J O     1 
ATOM   611   C  CB    . LEU A  1  102  ? -168.559 22.527  112.293 1.00 74.93  ?  102  LEU J CB    1 
ATOM   612   C  CG    . LEU A  1  102  ? -167.035 22.440  112.171 1.00 48.74  ?  102  LEU J CG    1 
ATOM   613   C  CD1   . LEU A  1  102  ? -166.591 22.605  110.731 1.00 73.37  ?  102  LEU J CD1   1 
ATOM   614   C  CD2   . LEU A  1  102  ? -166.367 23.484  113.053 1.00 64.77  ?  102  LEU J CD2   1 
ATOM   615   N  N     . ASP A  1  103  ? -171.670 22.259  111.782 1.00 88.28  ?  103  ASP J N     1 
ATOM   616   C  CA    . ASP A  1  103  ? -173.025 21.828  112.105 1.00 82.00  ?  103  ASP J CA    1 
ATOM   617   C  C     . ASP A  1  103  ? -173.580 20.880  111.053 1.00 89.96  ?  103  ASP J C     1 
ATOM   618   O  O     . ASP A  1  103  ? -174.510 20.119  111.345 1.00 106.13 ?  103  ASP J O     1 
ATOM   619   C  CB    . ASP A  1  103  ? -173.949 23.038  112.261 1.00 87.34  ?  103  ASP J CB    1 
ATOM   620   C  CG    . ASP A  1  103  ? -173.585 23.902  113.455 1.00 91.27  ?  103  ASP J CG    1 
ATOM   621   O  OD1   . ASP A  1  103  ? -172.793 23.444  114.306 1.00 85.35  ?  103  ASP J OD1   1 
ATOM   622   O  OD2   . ASP A  1  103  ? -174.098 25.038  113.546 1.00 98.70  ?  103  ASP J OD2   1 
ATOM   623   N  N     . LEU A  1  104  ? -173.030 20.905  109.838 1.00 80.93  ?  104  LEU J N     1 
ATOM   624   C  CA    . LEU A  1  104  ? -173.473 19.985  108.798 1.00 87.23  ?  104  LEU J CA    1 
ATOM   625   C  C     . LEU A  1  104  ? -172.811 18.621  108.950 1.00 86.17  ?  104  LEU J C     1 
ATOM   626   O  O     . LEU A  1  104  ? -173.470 17.588  108.794 1.00 93.63  ?  104  LEU J O     1 
ATOM   627   C  CB    . LEU A  1  104  ? -173.181 20.577  107.418 1.00 82.54  ?  104  LEU J CB    1 
ATOM   628   C  CG    . LEU A  1  104  ? -174.058 20.115  106.251 1.00 98.03  ?  104  LEU J CG    1 
ATOM   629   C  CD1   . LEU A  1  104  ? -173.647 20.814  104.961 1.00 77.50  ?  104  LEU J CD1   1 
ATOM   630   C  CD2   . LEU A  1  104  ? -174.013 18.602  106.082 1.00 100.78 ?  104  LEU J CD2   1 
ATOM   631   N  N     . ILE A  1  105  ? -171.511 18.600  109.253 1.00 95.33  ?  105  ILE J N     1 
ATOM   632   C  CA    . ILE A  1  105  ? -170.813 17.331  109.439 1.00 93.84  ?  105  ILE J CA    1 
ATOM   633   C  C     . ILE A  1  105  ? -171.322 16.618  110.685 1.00 97.91  ?  105  ILE J C     1 
ATOM   634   O  O     . ILE A  1  105  ? -171.445 15.387  110.705 1.00 105.07 ?  105  ILE J O     1 
ATOM   635   C  CB    . ILE A  1  105  ? -169.292 17.557  109.495 1.00 87.08  ?  105  ILE J CB    1 
ATOM   636   C  CG1   . ILE A  1  105  ? -168.599 16.353  110.134 1.00 103.07 ?  105  ILE J CG1   1 
ATOM   637   C  CG2   . ILE A  1  105  ? -168.965 18.830  110.254 1.00 90.56  ?  105  ILE J CG2   1 
ATOM   638   C  CD1   . ILE A  1  105  ? -167.123 16.565  110.390 1.00 112.65 ?  105  ILE J CD1   1 
ATOM   639   N  N     . LYS A  1  106  ? -171.619 17.373  111.747 1.00 93.05  ?  106  LYS J N     1 
ATOM   640   C  CA    . LYS A  1  106  ? -172.210 16.767  112.935 1.00 92.56  ?  106  LYS J CA    1 
ATOM   641   C  C     . LYS A  1  106  ? -173.526 16.077  112.601 1.00 99.91  ?  106  LYS J C     1 
ATOM   642   O  O     . LYS A  1  106  ? -173.770 14.943  113.029 1.00 108.92 ?  106  LYS J O     1 
ATOM   643   C  CB    . LYS A  1  106  ? -172.425 17.823  114.019 1.00 88.18  ?  106  LYS J CB    1 
ATOM   644   C  CG    . LYS A  1  106  ? -171.364 17.850  115.110 1.00 92.14  ?  106  LYS J CG    1 
ATOM   645   C  CD    . LYS A  1  106  ? -170.046 18.408  114.604 1.00 108.78 ?  106  LYS J CD    1 
ATOM   646   C  CE    . LYS A  1  106  ? -169.218 18.963  115.752 1.00 116.81 ?  106  LYS J CE    1 
ATOM   647   N  NZ    . LYS A  1  106  ? -169.932 20.073  116.447 1.00 111.02 ?  106  LYS J NZ    1 
ATOM   648   N  N     . ALA A  1  107  ? -174.387 16.748  111.832 1.00 85.83  ?  107  ALA J N     1 
ATOM   649   C  CA    . ALA A  1  107  ? -175.679 16.166  111.487 1.00 90.42  ?  107  ALA J CA    1 
ATOM   650   C  C     . ALA A  1  107  ? -175.514 14.865  110.711 1.00 78.68  ?  107  ALA J C     1 
ATOM   651   O  O     . ALA A  1  107  ? -176.312 13.934  110.869 1.00 101.86 ?  107  ALA J O     1 
ATOM   652   C  CB    . ALA A  1  107  ? -176.507 17.169  110.684 1.00 93.13  ?  107  ALA J CB    1 
ATOM   653   N  N     . LYS A  1  108  ? -174.483 14.780  109.868 1.00 84.72  ?  108  LYS J N     1 
ATOM   654   C  CA    . LYS A  1  108  ? -174.289 13.581  109.059 1.00 104.61 ?  108  LYS J CA    1 
ATOM   655   C  C     . LYS A  1  108  ? -174.040 12.353  109.925 1.00 113.22 ?  108  LYS J C     1 
ATOM   656   O  O     . LYS A  1  108  ? -174.440 11.242  109.556 1.00 114.17 ?  108  LYS J O     1 
ATOM   657   C  CB    . LYS A  1  108  ? -173.134 13.796  108.078 1.00 102.36 ?  108  LYS J CB    1 
ATOM   658   C  CG    . LYS A  1  108  ? -172.929 12.669  107.072 1.00 101.35 ?  108  LYS J CG    1 
ATOM   659   C  CD    . LYS A  1  108  ? -172.176 11.496  107.683 1.00 117.57 ?  108  LYS J CD    1 
ATOM   660   C  CE    . LYS A  1  108  ? -170.863 11.950  108.304 1.00 115.83 ?  108  LYS J CE    1 
ATOM   661   N  NZ    . LYS A  1  108  ? -170.137 10.822  108.957 1.00 95.26  ?  108  LYS J NZ    1 
ATOM   662   N  N     . ARG A  1  109  ? -173.383 12.525  111.068 1.00 105.30 ?  109  ARG J N     1 
ATOM   663   C  CA    . ARG A  1  109  ? -173.116 11.411  111.971 1.00 104.72 ?  109  ARG J CA    1 
ATOM   664   C  C     . ARG A  1  109  ? -174.411 10.745  112.428 1.00 110.67 ?  109  ARG J C     1 
ATOM   665   O  O     . ARG A  1  109  ? -175.041 11.180  113.392 1.00 100.30 ?  109  ARG J O     1 
ATOM   666   C  CB    . ARG A  1  109  ? -172.312 11.887  113.183 1.00 98.16  ?  109  ARG J CB    1 
ATOM   667   C  CG    . ARG A  1  109  ? -170.859 12.191  112.875 1.00 90.59  ?  109  ARG J CG    1 
ATOM   668   C  CD    . ARG A  1  109  ? -170.203 12.979  113.994 1.00 104.24 ?  109  ARG J CD    1 
ATOM   669   N  NE    . ARG A  1  109  ? -168.799 13.257  113.706 1.00 126.81 ?  109  ARG J NE    1 
ATOM   670   C  CZ    . ARG A  1  109  ? -168.067 14.162  114.346 1.00 119.84 ?  109  ARG J CZ    1 
ATOM   671   N  NH1   . ARG A  1  109  ? -168.606 14.893  115.314 1.00 117.52 ?  109  ARG J NH1   1 
ATOM   672   N  NH2   . ARG A  1  109  ? -166.797 14.341  114.013 1.00 109.62 ?  109  ARG J NH2   1 
ATOM   673   N  N     . MET B  2  1    ? -79.098  32.326  -14.672 1.00 124.75 ?  1    MET A N     1 
ATOM   674   C  CA    . MET B  2  1    ? -80.311  32.845  -15.291 1.00 130.92 ?  1    MET A CA    1 
ATOM   675   C  C     . MET B  2  1    ? -80.874  34.016  -14.488 1.00 137.85 ?  1    MET A C     1 
ATOM   676   O  O     . MET B  2  1    ? -82.083  34.115  -14.282 1.00 139.46 ?  1    MET A O     1 
ATOM   677   C  CB    . MET B  2  1    ? -81.361  31.739  -15.419 1.00 124.14 ?  1    MET A CB    1 
ATOM   678   C  CG    . MET B  2  1    ? -82.587  32.134  -16.229 1.00 143.78 ?  1    MET A CG    1 
ATOM   679   S  SD    . MET B  2  1    ? -83.936  30.949  -16.074 1.00 177.70 ?  1    MET A SD    1 
ATOM   680   C  CE    . MET B  2  1    ? -84.275  31.054  -14.318 1.00 142.56 ?  1    MET A CE    1 
ATOM   681   N  N     . LEU B  2  2    ? -79.988  34.904  -14.034 1.00 130.94 ?  2    LEU A N     1 
ATOM   682   C  CA    . LEU B  2  2    ? -80.391  36.052  -13.222 1.00 116.15 ?  2    LEU A CA    1 
ATOM   683   C  C     . LEU B  2  2    ? -80.777  37.198  -14.151 1.00 117.94 ?  2    LEU A C     1 
ATOM   684   O  O     . LEU B  2  2    ? -80.035  38.163  -14.346 1.00 131.49 ?  2    LEU A O     1 
ATOM   685   C  CB    . LEU B  2  2    ? -79.278  36.467  -12.267 1.00 106.34 ?  2    LEU A CB    1 
ATOM   686   C  CG    . LEU B  2  2    ? -78.510  35.388  -11.506 1.00 125.19 ?  2    LEU A CG    1 
ATOM   687   C  CD1   . LEU B  2  2    ? -77.528  34.702  -12.436 1.00 135.93 ?  2    LEU A CD1   1 
ATOM   688   C  CD2   . LEU B  2  2    ? -77.790  35.989  -10.305 1.00 117.50 ?  2    LEU A CD2   1 
ATOM   689   N  N     . ILE B  2  3    ? -81.967  37.082  -14.737 1.00 109.15 ?  3    ILE A N     1 
ATOM   690   C  CA    . ILE B  2  3    ? -82.517  38.174  -15.530 1.00 124.71 ?  3    ILE A CA    1 
ATOM   691   C  C     . ILE B  2  3    ? -82.671  39.378  -14.610 1.00 129.99 ?  3    ILE A C     1 
ATOM   692   O  O     . ILE B  2  3    ? -83.595  39.437  -13.791 1.00 128.47 ?  3    ILE A O     1 
ATOM   693   C  CB    . ILE B  2  3    ? -83.850  37.783  -16.193 1.00 131.59 ?  3    ILE A CB    1 
ATOM   694   C  CG1   . ILE B  2  3    ? -84.411  38.957  -16.999 1.00 130.08 ?  3    ILE A CG1   1 
ATOM   695   C  CG2   . ILE B  2  3    ? -84.851  37.302  -15.151 1.00 134.66 ?  3    ILE A CG2   1 
ATOM   696   C  CD1   . ILE B  2  3    ? -85.681  38.626  -17.753 1.00 128.06 ?  3    ILE A CD1   1 
ATOM   697   N  N     . SER B  2  4    ? -81.757  40.339  -14.729 1.00 137.38 ?  4    SER A N     1 
ATOM   698   C  CA    . SER B  2  4    ? -81.625  41.432  -13.770 1.00 132.34 ?  4    SER A CA    1 
ATOM   699   C  C     . SER B  2  4    ? -82.174  42.718  -14.375 1.00 122.54 ?  4    SER A C     1 
ATOM   700   O  O     . SER B  2  4    ? -81.604  43.260  -15.329 1.00 119.73 ?  4    SER A O     1 
ATOM   701   C  CB    . SER B  2  4    ? -80.165  41.608  -13.353 1.00 130.47 ?  4    SER A CB    1 
ATOM   702   O  OG    . SER B  2  4    ? -79.674  40.438  -12.724 1.00 118.20 ?  4    SER A OG    1 
ATOM   703   N  N     . GLN B  2  5    ? -83.280  43.200  -13.813 1.00 113.59 ?  5    GLN A N     1 
ATOM   704   C  CA    . GLN B  2  5    ? -83.806  44.523  -14.136 1.00 119.72 ?  5    GLN A CA    1 
ATOM   705   C  C     . GLN B  2  5    ? -84.574  44.993  -12.905 1.00 127.33 ?  5    GLN A C     1 
ATOM   706   O  O     . GLN B  2  5    ? -85.698  44.540  -12.663 1.00 130.79 ?  5    GLN A O     1 
ATOM   707   C  CB    . GLN B  2  5    ? -84.685  44.499  -15.381 1.00 113.82 ?  5    GLN A CB    1 
ATOM   708   C  CG    . GLN B  2  5    ? -85.577  43.276  -15.500 1.00 120.80 ?  5    GLN A CG    1 
ATOM   709   C  CD    . GLN B  2  5    ? -86.403  43.285  -16.775 1.00 127.29 ?  5    GLN A CD    1 
ATOM   710   O  OE1   . GLN B  2  5    ? -86.797  44.343  -17.265 1.00 136.28 ?  5    GLN A OE1   1 
ATOM   711   N  NE2   . GLN B  2  5    ? -86.657  42.101  -17.326 1.00 114.37 ?  5    GLN A NE2   1 
ATOM   712   N  N     . ARG B  2  6    ? -83.957  45.896  -12.144 1.00 115.21 ?  6    ARG A N     1 
ATOM   713   C  CA    . ARG B  2  6    ? -84.452  46.390  -10.863 1.00 104.93 ?  6    ARG A CA    1 
ATOM   714   C  C     . ARG B  2  6    ? -85.956  46.634  -10.905 1.00 117.90 ?  6    ARG A C     1 
ATOM   715   O  O     . ARG B  2  6    ? -86.499  47.006  -11.954 1.00 109.65 ?  6    ARG A O     1 
ATOM   716   C  CB    . ARG B  2  6    ? -83.718  47.677  -10.478 1.00 120.23 ?  6    ARG A CB    1 
ATOM   717   C  CG    . ARG B  2  6    ? -82.213  47.621  -10.707 1.00 118.43 ?  6    ARG A CG    1 
ATOM   718   C  CD    . ARG B  2  6    ? -81.585  49.005  -10.616 1.00 129.48 ?  6    ARG A CD    1 
ATOM   719   N  NE    . ARG B  2  6    ? -80.229  49.028  -11.158 1.00 128.38 ?  6    ARG A NE    1 
ATOM   720   C  CZ    . ARG B  2  6    ? -79.491  50.128  -11.286 1.00 125.60 ?  6    ARG A CZ    1 
ATOM   721   N  NH1   . ARG B  2  6    ? -79.975  51.304  -10.909 1.00 102.15 ?  6    ARG A NH1   1 
ATOM   722   N  NH2   . ARG B  2  6    ? -78.267  50.051  -11.792 1.00 109.66 ?  6    ARG A NH2   1 
ATOM   723   N  N     . PRO B  2  7    ? -86.662  46.433  -9.794  1.00 127.54 ?  7    PRO A N     1 
ATOM   724   C  CA    . PRO B  2  7    ? -88.103  46.700  -9.781  1.00 114.03 ?  7    PRO A CA    1 
ATOM   725   C  C     . PRO B  2  7    ? -88.396  48.182  -9.954  1.00 117.66 ?  7    PRO A C     1 
ATOM   726   O  O     . PRO B  2  7    ? -87.630  49.049  -9.524  1.00 113.78 ?  7    PRO A O     1 
ATOM   727   C  CB    . PRO B  2  7    ? -88.545  46.202  -8.401  1.00 107.85 ?  7    PRO A CB    1 
ATOM   728   C  CG    . PRO B  2  7    ? -87.306  46.279  -7.562  1.00 102.64 ?  7    PRO A CG    1 
ATOM   729   C  CD    . PRO B  2  7    ? -86.173  45.951  -8.490  1.00 118.80 ?  7    PRO A CD    1 
ATOM   730   N  N     . THR B  2  8    ? -89.527  48.466  -10.595 1.00 115.61 ?  8    THR A N     1 
ATOM   731   C  CA    . THR B  2  8    ? -89.941  49.829  -10.902 1.00 117.55 ?  8    THR A CA    1 
ATOM   732   C  C     . THR B  2  8    ? -91.323  50.085  -10.318 1.00 111.83 ?  8    THR A C     1 
ATOM   733   O  O     . THR B  2  8    ? -92.263  49.328  -10.581 1.00 109.00 ?  8    THR A O     1 
ATOM   734   C  CB    . THR B  2  8    ? -89.954  50.074  -12.414 1.00 109.56 ?  8    THR A CB    1 
ATOM   735   O  OG1   . THR B  2  8    ? -90.904  49.196  -13.033 1.00 110.68 ?  8    THR A OG1   1 
ATOM   736   C  CG2   . THR B  2  8    ? -88.576  49.816  -13.003 1.00 112.33 ?  8    THR A CG2   1 
ATOM   737   N  N     . LEU B  2  9    ? -91.442  51.152  -9.532  1.00 103.15 ?  9    LEU A N     1 
ATOM   738   C  CA    . LEU B  2  9    ? -92.699  51.542  -8.901  1.00 102.37 ?  9    LEU A CA    1 
ATOM   739   C  C     . LEU B  2  9    ? -93.236  52.778  -9.612  1.00 99.06  ?  9    LEU A C     1 
ATOM   740   O  O     . LEU B  2  9    ? -92.704  53.881  -9.442  1.00 90.17  ?  9    LEU A O     1 
ATOM   741   C  CB    . LEU B  2  9    ? -92.504  51.805  -7.409  1.00 105.77 ?  9    LEU A CB    1 
ATOM   742   C  CG    . LEU B  2  9    ? -93.703  52.413  -6.678  1.00 101.90 ?  9    LEU A CG    1 
ATOM   743   C  CD1   . LEU B  2  9    ? -94.977  51.642  -6.991  1.00 97.71  ?  9    LEU A CD1   1 
ATOM   744   C  CD2   . LEU B  2  9    ? -93.455  52.447  -5.180  1.00 93.50  ?  9    LEU A CD2   1 
ATOM   745   N  N     . SER B  2  10   ? -94.289  52.593  -10.403 1.00 89.79  ?  10   SER A N     1 
ATOM   746   C  CA    . SER B  2  10   ? -94.935  53.674  -11.131 1.00 95.28  ?  10   SER A CA    1 
ATOM   747   C  C     . SER B  2  10   ? -96.311  53.945  -10.537 1.00 99.61  ?  10   SER A C     1 
ATOM   748   O  O     . SER B  2  10   ? -97.061  53.012  -10.233 1.00 100.90 ?  10   SER A O     1 
ATOM   749   C  CB    . SER B  2  10   ? -95.064  53.337  -12.619 1.00 111.68 ?  10   SER A CB    1 
ATOM   750   O  OG    . SER B  2  10   ? -95.827  52.159  -12.811 1.00 100.84 ?  10   SER A OG    1 
ATOM   751   N  N     . GLU B  2  11   ? -96.637  55.224  -10.375 1.00 115.41 ?  11   GLU A N     1 
ATOM   752   C  CA    . GLU B  2  11   ? -97.899  55.625  -9.767  1.00 105.30 ?  11   GLU A CA    1 
ATOM   753   C  C     . GLU B  2  11   ? -99.046  55.429  -10.758 1.00 97.08  ?  11   GLU A C     1 
ATOM   754   O  O     . GLU B  2  11   ? -98.876  54.898  -11.859 1.00 107.03 ?  11   GLU A O     1 
ATOM   755   C  CB    . GLU B  2  11   ? -97.823  57.070  -9.282  1.00 116.10 ?  11   GLU A CB    1 
ATOM   756   C  CG    . GLU B  2  11   ? -96.978  57.278  -8.035  1.00 130.86 ?  11   GLU A CG    1 
ATOM   757   C  CD    . GLU B  2  11   ? -97.144  58.669  -7.448  1.00 132.51 ?  11   GLU A CD    1 
ATOM   758   O  OE1   . GLU B  2  11   ? -97.914  59.469  -8.022  1.00 124.95 ?  11   GLU A OE1   1 
ATOM   759   O  OE2   . GLU B  2  11   ? -96.508  58.962  -6.413  1.00 125.44 ?  11   GLU A OE2   1 
ATOM   760   N  N     . GLU B  2  12   ? -100.236 55.861  -10.361 1.00 91.27  ?  12   GLU A N     1 
ATOM   761   C  CA    . GLU B  2  12   ? -101.428 55.840  -11.203 1.00 94.43  ?  12   GLU A CA    1 
ATOM   762   C  C     . GLU B  2  12   ? -102.485 56.697  -10.519 1.00 110.94 ?  12   GLU A C     1 
ATOM   763   O  O     . GLU B  2  12   ? -102.234 57.315  -9.480  1.00 115.40 ?  12   GLU A O     1 
ATOM   764   C  CB    . GLU B  2  12   ? -101.942 54.420  -11.441 1.00 93.99  ?  12   GLU A CB    1 
ATOM   765   C  CG    . GLU B  2  12   ? -101.453 53.777  -12.724 1.00 108.17 ?  12   GLU A CG    1 
ATOM   766   C  CD    . GLU B  2  12   ? -102.395 52.694  -13.219 1.00 120.18 ?  12   GLU A CD    1 
ATOM   767   O  OE1   . GLU B  2  12   ? -103.595 52.748  -12.872 1.00 123.26 ?  12   GLU A OE1   1 
ATOM   768   O  OE2   . GLU B  2  12   ? -101.937 51.791  -13.952 1.00 107.00 ?  12   GLU A OE2   1 
ATOM   769   N  N     . THR B  2  13   ? -103.677 56.722  -11.111 1.00 111.53 ?  13   THR A N     1 
ATOM   770   C  CA    . THR B  2  13   ? -104.795 57.469  -10.551 1.00 112.08 ?  13   THR A CA    1 
ATOM   771   C  C     . THR B  2  13   ? -106.095 56.815  -10.990 1.00 107.70 ?  13   THR A C     1 
ATOM   772   O  O     . THR B  2  13   ? -106.290 56.554  -12.182 1.00 110.86 ?  13   THR A O     1 
ATOM   773   C  CB    . THR B  2  13   ? -104.768 58.939  -10.990 1.00 112.40 ?  13   THR A CB    1 
ATOM   774   O  OG1   . THR B  2  13   ? -104.634 59.015  -12.415 1.00 123.92 ?  13   THR A OG1   1 
ATOM   775   C  CG2   . THR B  2  13   ? -103.613 59.682  -10.330 1.00 94.40  ?  13   THR A CG2   1 
ATOM   776   N  N     . VAL B  2  14   ? -106.967 56.541  -10.020 1.00 99.08  ?  14   VAL A N     1 
ATOM   777   C  CA    . VAL B  2  14   ? -108.313 56.041  -10.272 1.00 100.31 ?  14   VAL A CA    1 
ATOM   778   C  C     . VAL B  2  14   ? -109.367 57.044  -9.818  1.00 95.66  ?  14   VAL A C     1 
ATOM   779   O  O     . VAL B  2  14   ? -110.319 57.338  -10.548 1.00 90.96  ?  14   VAL A O     1 
ATOM   780   C  CB    . VAL B  2  14   ? -108.539 54.670  -9.599  1.00 104.64 ?  14   VAL A CB    1 
ATOM   781   C  CG1   . VAL B  2  14   ? -107.974 54.683  -8.186  1.00 102.93 ?  14   VAL A CG1   1 
ATOM   782   C  CG2   . VAL B  2  14   ? -110.023 54.327  -9.585  1.00 96.91  ?  14   VAL A CG2   1 
ATOM   783   N  N     . ALA B  2  15   ? -109.207 57.585  -8.615  1.00 101.02 ?  15   ALA A N     1 
ATOM   784   C  CA    . ALA B  2  15   ? -110.000 58.712  -8.141  1.00 102.59 ?  15   ALA A CA    1 
ATOM   785   C  C     . ALA B  2  15   ? -109.011 59.695  -7.513  1.00 111.00 ?  15   ALA A C     1 
ATOM   786   O  O     . ALA B  2  15   ? -107.786 59.617  -7.691  1.00 113.70 ?  15   ALA A O     1 
ATOM   787   C  CB    . ALA B  2  15   ? -111.103 58.245  -7.176  1.00 107.88 ?  15   ALA A CB    1 
ATOM   788   N  N     . GLU B  2  16   ? -109.529 60.629  -6.725  1.00 108.71 ?  16   GLU A N     1 
ATOM   789   C  CA    . GLU B  2  16   ? -108.651 61.555  -6.022  1.00 120.26 ?  16   GLU A CA    1 
ATOM   790   C  C     . GLU B  2  16   ? -108.189 61.003  -4.681  1.00 117.86 ?  16   GLU A C     1 
ATOM   791   O  O     . GLU B  2  16   ? -107.020 61.164  -4.314  1.00 118.32 ?  16   GLU A O     1 
ATOM   792   C  CB    . GLU B  2  16   ? -109.348 62.902  -5.815  1.00 119.11 ?  16   GLU A CB    1 
ATOM   793   C  CG    . GLU B  2  16   ? -108.501 63.908  -5.032  1.00 135.80 ?  16   GLU A CG    1 
ATOM   794   C  CD    . GLU B  2  16   ? -107.037 63.876  -5.422  1.00 149.50 ?  16   GLU A CD    1 
ATOM   795   O  OE1   . GLU B  2  16   ? -106.201 63.607  -4.537  1.00 146.75 ?  16   GLU A OE1   1 
ATOM   796   O  OE2   . GLU B  2  16   ? -106.723 64.100  -6.610  1.00 155.16 ?  16   GLU A OE2   1 
ATOM   797   N  N     . ASN B  2  17   ? -109.078 60.325  -3.954  1.00 125.57 ?  17   ASN A N     1 
ATOM   798   C  CA    . ASN B  2  17   ? -108.704 59.771  -2.659  1.00 120.80 ?  17   ASN A CA    1 
ATOM   799   C  C     . ASN B  2  17   ? -107.872 58.502  -2.794  1.00 109.20 ?  17   ASN A C     1 
ATOM   800   O  O     . ASN B  2  17   ? -107.065 58.203  -1.907  1.00 106.49 ?  17   ASN A O     1 
ATOM   801   C  CB    . ASN B  2  17   ? -109.956 59.495  -1.826  1.00 111.52 ?  17   ASN A CB    1 
ATOM   802   C  CG    . ASN B  2  17   ? -110.949 58.606  -2.548  1.00 113.78 ?  17   ASN A CG    1 
ATOM   803   O  OD1   . ASN B  2  17   ? -111.036 58.621  -3.776  1.00 120.15 ?  17   ASN A OD1   1 
ATOM   804   N  ND2   . ASN B  2  17   ? -111.707 57.826  -1.786  1.00 119.63 ?  17   ASN A ND2   1 
ATOM   805   N  N     . ARG B  2  18   ? -108.038 57.754  -3.884  1.00 104.12 ?  18   ARG A N     1 
ATOM   806   C  CA    . ARG B  2  18   ? -107.294 56.520  -4.091  1.00 99.42  ?  18   ARG A CA    1 
ATOM   807   C  C     . ARG B  2  18   ? -106.648 56.515  -5.469  1.00 105.61 ?  18   ARG A C     1 
ATOM   808   O  O     . ARG B  2  18   ? -107.144 57.136  -6.413  1.00 118.37 ?  18   ARG A O     1 
ATOM   809   C  CB    . ARG B  2  18   ? -108.187 55.279  -3.938  1.00 95.40  ?  18   ARG A CB    1 
ATOM   810   C  CG    . ARG B  2  18   ? -109.156 55.030  -5.082  1.00 96.91  ?  18   ARG A CG    1 
ATOM   811   C  CD    . ARG B  2  18   ? -109.587 53.567  -5.092  1.00 102.14 ?  18   ARG A CD    1 
ATOM   812   N  NE    . ARG B  2  18   ? -110.724 53.314  -5.973  1.00 98.06  ?  18   ARG A NE    1 
ATOM   813   C  CZ    . ARG B  2  18   ? -111.193 52.101  -6.251  1.00 96.17  ?  18   ARG A CZ    1 
ATOM   814   N  NH1   . ARG B  2  18   ? -110.619 51.029  -5.723  1.00 96.83  ?  18   ARG A NH1   1 
ATOM   815   N  NH2   . ARG B  2  18   ? -112.233 51.958  -7.059  1.00 106.93 ?  18   ARG A NH2   1 
ATOM   816   N  N     . SER B  2  19   ? -105.527 55.805  -5.568  1.00 98.33  ?  19   SER A N     1 
ATOM   817   C  CA    . SER B  2  19   ? -104.790 55.672  -6.816  1.00 106.49 ?  19   SER A CA    1 
ATOM   818   C  C     . SER B  2  19   ? -103.997 54.375  -6.771  1.00 103.84 ?  19   SER A C     1 
ATOM   819   O  O     . SER B  2  19   ? -103.486 53.990  -5.716  1.00 98.18  ?  19   SER A O     1 
ATOM   820   C  CB    . SER B  2  19   ? -103.855 56.865  -7.047  1.00 111.49 ?  19   SER A CB    1 
ATOM   821   O  OG    . SER B  2  19   ? -102.920 56.994  -5.988  1.00 107.06 ?  19   SER A OG    1 
ATOM   822   N  N     . ARG B  2  20   ? -103.897 53.707  -7.917  1.00 100.60 ?  20   ARG A N     1 
ATOM   823   C  CA    . ARG B  2  20   ? -103.198 52.434  -7.975  1.00 93.48  ?  20   ARG A CA    1 
ATOM   824   C  C     . ARG B  2  20   ? -101.686 52.638  -8.016  1.00 94.29  ?  20   ARG A C     1 
ATOM   825   O  O     . ARG B  2  20   ? -101.180 53.701  -8.387  1.00 112.28 ?  20   ARG A O     1 
ATOM   826   C  CB    . ARG B  2  20   ? -103.641 51.624  -9.193  1.00 81.32  ?  20   ARG A CB    1 
ATOM   827   C  CG    . ARG B  2  20   ? -105.015 51.000  -9.053  1.00 89.39  ?  20   ARG A CG    1 
ATOM   828   C  CD    . ARG B  2  20   ? -105.389 50.216  -10.297 1.00 87.68  ?  20   ARG A CD    1 
ATOM   829   N  NE    . ARG B  2  20   ? -106.685 49.561  -10.157 1.00 96.62  ?  20   ARG A NE    1 
ATOM   830   C  CZ    . ARG B  2  20   ? -107.852 50.171  -10.337 1.00 113.26 ?  20   ARG A CZ    1 
ATOM   831   N  NH1   . ARG B  2  20   ? -107.887 51.457  -10.662 1.00 109.73 ?  20   ARG A NH1   1 
ATOM   832   N  NH2   . ARG B  2  20   ? -108.986 49.497  -10.191 1.00 112.67 ?  20   ARG A NH2   1 
ATOM   833   N  N     . PHE B  2  21   ? -100.967 51.591  -7.621  1.00 82.64  ?  21   PHE A N     1 
ATOM   834   C  CA    . PHE B  2  21   ? -99.513  51.557  -7.687  1.00 97.63  ?  21   PHE A CA    1 
ATOM   835   C  C     . PHE B  2  21   ? -99.094  50.190  -8.202  1.00 106.60 ?  21   PHE A C     1 
ATOM   836   O  O     . PHE B  2  21   ? -99.583  49.167  -7.715  1.00 108.96 ?  21   PHE A O     1 
ATOM   837   C  CB    . PHE B  2  21   ? -98.880  51.827  -6.316  1.00 90.93  ?  21   PHE A CB    1 
ATOM   838   C  CG    . PHE B  2  21   ? -99.219  53.174  -5.745  1.00 97.32  ?  21   PHE A CG    1 
ATOM   839   C  CD1   . PHE B  2  21   ? -100.371 53.354  -4.997  1.00 97.24  ?  21   PHE A CD1   1 
ATOM   840   C  CD2   . PHE B  2  21   ? -98.385  54.259  -5.951  1.00 108.69 ?  21   PHE A CD2   1 
ATOM   841   C  CE1   . PHE B  2  21   ? -100.686 54.592  -4.468  1.00 92.29  ?  21   PHE A CE1   1 
ATOM   842   C  CE2   . PHE B  2  21   ? -98.694  55.500  -5.424  1.00 115.67 ?  21   PHE A CE2   1 
ATOM   843   C  CZ    . PHE B  2  21   ? -99.848  55.666  -4.681  1.00 98.99  ?  21   PHE A CZ    1 
ATOM   844   N  N     . VAL B  2  22   ? -98.201  50.175  -9.187  1.00 102.15 ?  22   VAL A N     1 
ATOM   845   C  CA    . VAL B  2  22   ? -97.736  48.943  -9.811  1.00 93.11  ?  22   VAL A CA    1 
ATOM   846   C  C     . VAL B  2  22   ? -96.225  48.856  -9.661  1.00 91.99  ?  22   VAL A C     1 
ATOM   847   O  O     . VAL B  2  22   ? -95.512  49.844  -9.869  1.00 101.58 ?  22   VAL A O     1 
ATOM   848   C  CB    . VAL B  2  22   ? -98.144  48.870  -11.297 1.00 92.70  ?  22   VAL A CB    1 
ATOM   849   C  CG1   . VAL B  2  22   ? -97.839  50.186  -11.996 1.00 114.88 ?  22   VAL A CG1   1 
ATOM   850   C  CG2   . VAL B  2  22   ? -97.429  47.717  -11.985 1.00 97.39  ?  22   VAL A CG2   1 
ATOM   851   N  N     . ILE B  2  23   ? -95.741  47.671  -9.299  1.00 92.01  ?  23   ILE A N     1 
ATOM   852   C  CA    . ILE B  2  23   ? -94.315  47.412  -9.130  1.00 104.92 ?  23   ILE A CA    1 
ATOM   853   C  C     . ILE B  2  23   ? -93.953  46.202  -9.979  1.00 111.69 ?  23   ILE A C     1 
ATOM   854   O  O     . ILE B  2  23   ? -94.498  45.110  -9.774  1.00 94.02  ?  23   ILE A O     1 
ATOM   855   C  CB    . ILE B  2  23   ? -93.939  47.173  -7.659  1.00 92.06  ?  23   ILE A CB    1 
ATOM   856   C  CG1   . ILE B  2  23   ? -94.232  48.421  -6.825  1.00 103.09 ?  23   ILE A CG1   1 
ATOM   857   C  CG2   . ILE B  2  23   ? -92.474  46.778  -7.541  1.00 83.55  ?  23   ILE A CG2   1 
ATOM   858   C  CD1   . ILE B  2  23   ? -93.816  48.298  -5.375  1.00 101.92 ?  23   ILE A CD1   1 
ATOM   859   N  N     . GLU B  2  24   ? -93.037  46.393  -10.925 1.00 119.02 ?  24   GLU A N     1 
ATOM   860   C  CA    . GLU B  2  24   ? -92.609  45.317  -11.810 1.00 108.13 ?  24   GLU A CA    1 
ATOM   861   C  C     . GLU B  2  24   ? -91.154  45.475  -12.222 1.00 106.12 ?  24   GLU A C     1 
ATOM   862   O  O     . GLU B  2  24   ? -90.670  46.592  -12.394 1.00 107.46 ?  24   GLU A O     1 
ATOM   863   C  CB    . GLU B  2  24   ? -93.491  45.262  -13.059 1.00 105.52 ?  24   GLU A CB    1 
ATOM   864   C  CG    . GLU B  2  24   ? -93.542  46.564  -13.846 1.00 117.66 ?  24   GLU A CG    1 
ATOM   865   C  CD    . GLU B  2  24   ? -94.365  46.447  -15.117 1.00 126.78 ?  24   GLU A CD    1 
ATOM   866   O  OE1   . GLU B  2  24   ? -94.471  45.324  -15.657 1.00 124.43 ?  24   GLU A OE1   1 
ATOM   867   O  OE2   . GLU B  2  24   ? -94.913  47.475  -15.571 1.00 117.01 ?  24   GLU A OE2   1 
ATOM   868   N  N     . PRO B  2  25   ? -90.448  44.347  -12.372 1.00 118.74 ?  25   PRO A N     1 
ATOM   869   C  CA    . PRO B  2  25   ? -90.926  43.021  -11.982 1.00 119.36 ?  25   PRO A CA    1 
ATOM   870   C  C     . PRO B  2  25   ? -90.046  42.424  -10.889 1.00 119.69 ?  25   PRO A C     1 
ATOM   871   O  O     . PRO B  2  25   ? -88.994  43.005  -10.601 1.00 121.80 ?  25   PRO A O     1 
ATOM   872   C  CB    . PRO B  2  25   ? -90.801  42.230  -13.282 1.00 107.48 ?  25   PRO A CB    1 
ATOM   873   C  CG    . PRO B  2  25   ? -89.636  42.924  -14.035 1.00 120.91 ?  25   PRO A CG    1 
ATOM   874   C  CD    . PRO B  2  25   ? -89.317  44.224  -13.303 1.00 119.62 ?  25   PRO A CD    1 
ATOM   875   N  N     . LEU B  2  26   ? -90.445  41.304  -10.292 1.00 103.43 ?  26   LEU A N     1 
ATOM   876   C  CA    . LEU B  2  26   ? -89.577  40.617  -9.344  1.00 96.72  ?  26   LEU A CA    1 
ATOM   877   C  C     . LEU B  2  26   ? -89.996  39.152  -9.245  1.00 104.64 ?  26   LEU A C     1 
ATOM   878   O  O     . LEU B  2  26   ? -90.896  38.687  -9.949  1.00 102.82 ?  26   LEU A O     1 
ATOM   879   C  CB    . LEU B  2  26   ? -89.587  41.299  -7.974  1.00 110.03 ?  26   LEU A CB    1 
ATOM   880   C  CG    . LEU B  2  26   ? -88.169  41.404  -7.412  1.00 119.51 ?  26   LEU A CG    1 
ATOM   881   C  CD1   . LEU B  2  26   ? -87.395  42.527  -8.104  1.00 100.90 ?  26   LEU A CD1   1 
ATOM   882   C  CD2   . LEU B  2  26   ? -88.207  41.610  -5.916  1.00 116.08 ?  26   LEU A CD2   1 
ATOM   883   N  N     . GLU B  2  27   ? -89.331  38.430  -8.344  1.00 103.05 ?  27   GLU A N     1 
ATOM   884   C  CA    . GLU B  2  27   ? -89.335  36.975  -8.375  1.00 108.00 ?  27   GLU A CA    1 
ATOM   885   C  C     . GLU B  2  27   ? -90.736  36.415  -8.123  1.00 106.19 ?  27   GLU A C     1 
ATOM   886   O  O     . GLU B  2  27   ? -91.559  37.045  -7.452  1.00 109.40 ?  27   GLU A O     1 
ATOM   887   C  CB    . GLU B  2  27   ? -88.356  36.423  -7.342  1.00 116.20 ?  27   GLU A CB    1 
ATOM   888   C  CG    . GLU B  2  27   ? -86.903  36.836  -7.568  1.00 111.36 ?  27   GLU A CG    1 
ATOM   889   C  CD    . GLU B  2  27   ? -86.342  36.310  -8.882  1.00 124.82 ?  27   GLU A CD    1 
ATOM   890   O  OE1   . GLU B  2  27   ? -87.140  35.862  -9.729  1.00 119.28 ?  27   GLU A OE1   1 
ATOM   891   O  OE2   . GLU B  2  27   ? -85.106  36.338  -9.072  1.00 124.33 ?  27   GLU A OE2   1 
ATOM   892   N  N     . PRO B  2  28   ? -91.039  35.233  -8.659  1.00 111.29 ?  28   PRO A N     1 
ATOM   893   C  CA    . PRO B  2  28   ? -92.373  34.661  -8.456  1.00 112.79 ?  28   PRO A CA    1 
ATOM   894   C  C     . PRO B  2  28   ? -92.605  34.303  -7.002  1.00 115.18 ?  28   PRO A C     1 
ATOM   895   O  O     . PRO B  2  28   ? -91.672  34.021  -6.250  1.00 119.31 ?  28   PRO A O     1 
ATOM   896   C  CB    . PRO B  2  28   ? -92.385  33.416  -9.360  1.00 115.82 ?  28   PRO A CB    1 
ATOM   897   C  CG    . PRO B  2  28   ? -91.248  33.600  -10.319 1.00 103.59 ?  28   PRO A CG    1 
ATOM   898   C  CD    . PRO B  2  28   ? -90.216  34.413  -9.567  1.00 104.60 ?  28   PRO A CD    1 
ATOM   899   N  N     . GLY B  2  29   ? -93.877  34.326  -6.618  1.00 104.75 ?  29   GLY A N     1 
ATOM   900   C  CA    . GLY B  2  29   ? -94.273  34.212  -5.229  1.00 106.16 ?  29   GLY A CA    1 
ATOM   901   C  C     . GLY B  2  29   ? -93.903  35.391  -4.354  1.00 115.93 ?  29   GLY A C     1 
ATOM   902   O  O     . GLY B  2  29   ? -93.873  35.241  -3.127  1.00 114.34 ?  29   GLY A O     1 
ATOM   903   N  N     . PHE B  2  30   ? -93.597  36.552  -4.943  1.00 107.30 ?  30   PHE A N     1 
ATOM   904   C  CA    . PHE B  2  30   ? -93.252  37.761  -4.200  1.00 96.19  ?  30   PHE A CA    1 
ATOM   905   C  C     . PHE B  2  30   ? -94.383  38.772  -4.144  1.00 90.68  ?  30   PHE A C     1 
ATOM   906   O  O     . PHE B  2  30   ? -94.413  39.592  -3.223  1.00 84.85  ?  30   PHE A O     1 
ATOM   907   C  CB    . PHE B  2  30   ? -92.028  38.447  -4.819  1.00 96.81  ?  30   PHE A CB    1 
ATOM   908   C  CG    . PHE B  2  30   ? -90.763  38.261  -4.031  1.00 96.60  ?  30   PHE A CG    1 
ATOM   909   C  CD1   . PHE B  2  30   ? -89.545  38.098  -4.670  1.00 108.71 ?  30   PHE A CD1   1 
ATOM   910   C  CD2   . PHE B  2  30   ? -90.792  38.255  -2.647  1.00 95.61  ?  30   PHE A CD2   1 
ATOM   911   C  CE1   . PHE B  2  30   ? -88.382  37.920  -3.942  1.00 116.22 ?  30   PHE A CE1   1 
ATOM   912   C  CE2   . PHE B  2  30   ? -89.634  38.077  -1.917  1.00 88.51  ?  30   PHE A CE2   1 
ATOM   913   C  CZ    . PHE B  2  30   ? -88.428  37.910  -2.565  1.00 99.47  ?  30   PHE A CZ    1 
ATOM   914   N  N     . GLY B  2  31   ? -95.288  38.753  -5.124  1.00 89.72  ?  31   GLY A N     1 
ATOM   915   C  CA    . GLY B  2  31   ? -96.400  39.683  -5.167  1.00 81.61  ?  31   GLY A CA    1 
ATOM   916   C  C     . GLY B  2  31   ? -97.270  39.622  -3.930  1.00 91.83  ?  31   GLY A C     1 
ATOM   917   O  O     . GLY B  2  31   ? -97.364  40.599  -3.181  1.00 96.98  ?  31   GLY A O     1 
ATOM   918   N  N     . TYR B  2  32   ? -97.902  38.469  -3.699  1.00 88.60  ?  32   TYR A N     1 
ATOM   919   C  CA    . TYR B  2  32   ? -98.792  38.331  -2.551  1.00 76.87  ?  32   TYR A CA    1 
ATOM   920   C  C     . TYR B  2  32   ? -98.082  38.677  -1.249  1.00 80.87  ?  32   TYR A C     1 
ATOM   921   O  O     . TYR B  2  32   ? -98.644  39.367  -0.390  1.00 79.22  ?  32   TYR A O     1 
ATOM   922   C  CB    . TYR B  2  32   ? -99.353  36.910  -2.498  1.00 65.67  ?  32   TYR A CB    1 
ATOM   923   C  CG    . TYR B  2  32   ? -100.354 36.610  -3.589  1.00 58.57  ?  32   TYR A CG    1 
ATOM   924   C  CD1   . TYR B  2  32   ? -101.082 37.629  -4.184  1.00 65.63  ?  32   TYR A CD1   1 
ATOM   925   C  CD2   . TYR B  2  32   ? -100.573 35.309  -4.021  1.00 70.96  ?  32   TYR A CD2   1 
ATOM   926   C  CE1   . TYR B  2  32   ? -102.003 37.363  -5.176  1.00 62.66  ?  32   TYR A CE1   1 
ATOM   927   C  CE2   . TYR B  2  32   ? -101.492 35.034  -5.015  1.00 68.34  ?  32   TYR A CE2   1 
ATOM   928   C  CZ    . TYR B  2  32   ? -102.203 36.067  -5.588  1.00 69.13  ?  32   TYR A CZ    1 
ATOM   929   O  OH    . TYR B  2  32   ? -103.120 35.810  -6.581  1.00 97.83  ?  32   TYR A OH    1 
ATOM   930   N  N     . THR B  2  33   ? -96.841  38.215  -1.085  1.00 85.48  ?  33   THR A N     1 
ATOM   931   C  CA    . THR B  2  33   ? -96.137  38.436  0.174   1.00 80.25  ?  33   THR A CA    1 
ATOM   932   C  C     . THR B  2  33   ? -95.801  39.908  0.372   1.00 91.87  ?  33   THR A C     1 
ATOM   933   O  O     . THR B  2  33   ? -95.942  40.439  1.480   1.00 103.73 ?  33   THR A O     1 
ATOM   934   C  CB    . THR B  2  33   ? -94.869  37.587  0.221   1.00 83.82  ?  33   THR A CB    1 
ATOM   935   O  OG1   . THR B  2  33   ? -95.181  36.243  -0.168  1.00 98.69  ?  33   THR A OG1   1 
ATOM   936   C  CG2   . THR B  2  33   ? -94.298  37.576  1.627   1.00 77.30  ?  33   THR A CG2   1 
ATOM   937   N  N     . LEU B  2  34   ? -95.350  40.584  -0.686  1.00 97.32  ?  34   LEU A N     1 
ATOM   938   C  CA    . LEU B  2  34   ? -95.017  41.999  -0.574  1.00 89.93  ?  34   LEU A CA    1 
ATOM   939   C  C     . LEU B  2  34   ? -96.268  42.866  -0.528  1.00 87.38  ?  34   LEU A C     1 
ATOM   940   O  O     . LEU B  2  34   ? -96.296  43.882  0.175   1.00 88.61  ?  34   LEU A O     1 
ATOM   941   C  CB    . LEU B  2  34   ? -94.118  42.422  -1.737  1.00 95.24  ?  34   LEU A CB    1 
ATOM   942   C  CG    . LEU B  2  34   ? -92.684  41.885  -1.720  1.00 101.90 ?  34   LEU A CG    1 
ATOM   943   C  CD1   . LEU B  2  34   ? -91.956  42.244  -3.005  1.00 97.20  ?  34   LEU A CD1   1 
ATOM   944   C  CD2   . LEU B  2  34   ? -91.929  42.417  -0.509  1.00 95.04  ?  34   LEU A CD2   1 
ATOM   945   N  N     . GLY B  2  35   ? -97.310  42.481  -1.267  1.00 91.01  ?  35   GLY A N     1 
ATOM   946   C  CA    . GLY B  2  35   ? -98.537  43.261  -1.257  1.00 93.79  ?  35   GLY A CA    1 
ATOM   947   C  C     . GLY B  2  35   ? -99.158  43.348  0.124   1.00 91.40  ?  35   GLY A C     1 
ATOM   948   O  O     . GLY B  2  35   ? -99.437  44.439  0.628   1.00 93.77  ?  35   GLY A O     1 
ATOM   949   N  N     . ASN B  2  36   ? -99.383  42.195  0.757   1.00 86.93  ?  36   ASN A N     1 
ATOM   950   C  CA    . ASN B  2  36   ? -99.963  42.201  2.094   1.00 78.09  ?  36   ASN A CA    1 
ATOM   951   C  C     . ASN B  2  36   ? -99.005  42.791  3.119   1.00 82.60  ?  36   ASN A C     1 
ATOM   952   O  O     . ASN B  2  36   ? -99.446  43.292  4.159   1.00 98.36  ?  36   ASN A O     1 
ATOM   953   C  CB    . ASN B  2  36   ? -100.369 40.785  2.503   1.00 78.73  ?  36   ASN A CB    1 
ATOM   954   C  CG    . ASN B  2  36   ? -100.944 40.729  3.906   1.00 91.70  ?  36   ASN A CG    1 
ATOM   955   O  OD1   . ASN B  2  36   ? -102.139 40.953  4.112   1.00 98.08  ?  36   ASN A OD1   1 
ATOM   956   N  ND2   . ASN B  2  36   ? -100.092 40.434  4.882   1.00 91.31  ?  36   ASN A ND2   1 
ATOM   957   N  N     . SER B  2  37   ? -97.699  42.743  2.850   1.00 81.00  ?  37   SER A N     1 
ATOM   958   C  CA    . SER B  2  37   ? -96.743  43.329  3.781   1.00 86.36  ?  37   SER A CA    1 
ATOM   959   C  C     . SER B  2  37   ? -96.898  44.842  3.858   1.00 90.30  ?  37   SER A C     1 
ATOM   960   O  O     . SER B  2  37   ? -96.658  45.437  4.915   1.00 89.56  ?  37   SER A O     1 
ATOM   961   C  CB    . SER B  2  37   ? -95.318  42.952  3.381   1.00 86.61  ?  37   SER A CB    1 
ATOM   962   O  OG    . SER B  2  37   ? -94.407  43.237  4.427   1.00 97.35  ?  37   SER A OG    1 
ATOM   963   N  N     . LEU B  2  38   ? -97.298  45.480  2.757   1.00 91.16  ?  38   LEU A N     1 
ATOM   964   C  CA    . LEU B  2  38   ? -97.618  46.902  2.805   1.00 86.09  ?  38   LEU A CA    1 
ATOM   965   C  C     . LEU B  2  38   ? -99.031  47.131  3.328   1.00 83.79  ?  38   LEU A C     1 
ATOM   966   O  O     . LEU B  2  38   ? -99.264  48.060  4.110   1.00 80.60  ?  38   LEU A O     1 
ATOM   967   C  CB    . LEU B  2  38   ? -97.453  47.530  1.419   1.00 80.70  ?  38   LEU A CB    1 
ATOM   968   C  CG    . LEU B  2  38   ? -96.031  47.711  0.877   1.00 83.29  ?  38   LEU A CG    1 
ATOM   969   C  CD1   . LEU B  2  38   ? -96.064  48.183  -0.570  1.00 80.14  ?  38   LEU A CD1   1 
ATOM   970   C  CD2   . LEU B  2  38   ? -95.237  48.686  1.735   1.00 70.46  ?  38   LEU A CD2   1 
ATOM   971   N  N     . ARG B  2  39   ? -99.980  46.290  2.912   1.00 85.99  ?  39   ARG A N     1 
ATOM   972   C  CA    . ARG B  2  39   ? -101.360 46.439  3.363   1.00 78.03  ?  39   ARG A CA    1 
ATOM   973   C  C     . ARG B  2  39   ? -101.445 46.419  4.884   1.00 69.03  ?  39   ARG A C     1 
ATOM   974   O  O     . ARG B  2  39   ? -102.027 47.322  5.498   1.00 74.98  ?  39   ARG A O     1 
ATOM   975   C  CB    . ARG B  2  39   ? -102.228 45.335  2.759   1.00 72.08  ?  39   ARG A CB    1 
ATOM   976   C  CG    . ARG B  2  39   ? -103.695 45.411  3.142   1.00 59.70  ?  39   ARG A CG    1 
ATOM   977   C  CD    . ARG B  2  39   ? -104.474 44.264  2.521   1.00 86.10  ?  39   ARG A CD    1 
ATOM   978   N  NE    . ARG B  2  39   ? -105.897 44.327  2.837   1.00 94.10  ?  39   ARG A NE    1 
ATOM   979   C  CZ    . ARG B  2  39   ? -106.457 43.734  3.886   1.00 90.58  ?  39   ARG A CZ    1 
ATOM   980   N  NH1   . ARG B  2  39   ? -105.711 43.030  4.727   1.00 92.82  ?  39   ARG A NH1   1 
ATOM   981   N  NH2   . ARG B  2  39   ? -107.762 43.844  4.092   1.00 81.22  ?  39   ARG A NH2   1 
ATOM   982   N  N     . ARG B  2  40   ? -100.865 45.394  5.513   1.00 71.57  ?  40   ARG A N     1 
ATOM   983   C  CA    . ARG B  2  40   ? -100.866 45.332  6.971   1.00 67.24  ?  40   ARG A CA    1 
ATOM   984   C  C     . ARG B  2  40   ? -100.245 46.579  7.583   1.00 78.11  ?  40   ARG A C     1 
ATOM   985   O  O     . ARG B  2  40   ? -100.585 46.951  8.713   1.00 79.43  ?  40   ARG A O     1 
ATOM   986   C  CB    . ARG B  2  40   ? -100.122 44.087  7.455   1.00 80.38  ?  40   ARG A CB    1 
ATOM   987   C  CG    . ARG B  2  40   ? -100.831 42.771  7.179   1.00 76.60  ?  40   ARG A CG    1 
ATOM   988   C  CD    . ARG B  2  40   ? -100.117 41.626  7.884   1.00 76.61  ?  40   ARG A CD    1 
ATOM   989   N  NE    . ARG B  2  40   ? -100.805 41.193  9.101   1.00 78.90  ?  40   ARG A NE    1 
ATOM   990   C  CZ    . ARG B  2  40   ? -100.881 41.908  10.219  1.00 76.07  ?  40   ARG A CZ    1 
ATOM   991   N  NH1   . ARG B  2  40   ? -100.330 43.110  10.285  1.00 95.16  ?  40   ARG A NH1   1 
ATOM   992   N  NH2   . ARG B  2  40   ? -101.521 41.427  11.274  1.00 71.85  ?  40   ARG A NH2   1 
ATOM   993   N  N     . THR B  2  41   ? -99.334  47.234  6.861   1.00 87.95  ?  41   THR A N     1 
ATOM   994   C  CA    . THR B  2  41   ? -98.714  48.449  7.377   1.00 85.11  ?  41   THR A CA    1 
ATOM   995   C  C     . THR B  2  41   ? -99.584  49.673  7.120   1.00 84.05  ?  41   THR A C     1 
ATOM   996   O  O     . THR B  2  41   ? -99.685  50.554  7.981   1.00 91.64  ?  41   THR A O     1 
ATOM   997   C  CB    . THR B  2  41   ? -97.329  48.642  6.760   1.00 76.67  ?  41   THR A CB    1 
ATOM   998   O  OG1   . THR B  2  41   ? -96.549  47.453  6.945   1.00 78.14  ?  41   THR A OG1   1 
ATOM   999   C  CG2   . THR B  2  41   ? -96.618  49.809  7.420   1.00 75.54  ?  41   THR A CG2   1 
ATOM   1000  N  N     . LEU B  2  42   ? -100.219 49.745  5.948   1.00 80.63  ?  42   LEU A N     1 
ATOM   1001  C  CA    . LEU B  2  42   ? -101.092 50.875  5.647   1.00 82.95  ?  42   LEU A CA    1 
ATOM   1002  C  C     . LEU B  2  42   ? -102.259 50.936  6.617   1.00 81.16  ?  42   LEU A C     1 
ATOM   1003  O  O     . LEU B  2  42   ? -102.528 51.979  7.223   1.00 97.72  ?  42   LEU A O     1 
ATOM   1004  C  CB    . LEU B  2  42   ? -101.605 50.777  4.212   1.00 82.28  ?  42   LEU A CB    1 
ATOM   1005  C  CG    . LEU B  2  42   ? -100.587 50.986  3.089   1.00 80.80  ?  42   LEU A CG    1 
ATOM   1006  C  CD1   . LEU B  2  42   ? -101.227 50.810  1.716   1.00 66.57  ?  42   LEU A CD1   1 
ATOM   1007  C  CD2   . LEU B  2  42   ? -99.924  52.355  3.200   1.00 83.08  ?  42   LEU A CD2   1 
ATOM   1008  N  N     . LEU B  2  43   ? -102.956 49.819  6.785   1.00 72.89  ?  43   LEU A N     1 
ATOM   1009  C  CA    . LEU B  2  43   ? -104.189 49.802  7.559   1.00 75.70  ?  43   LEU A CA    1 
ATOM   1010  C  C     . LEU B  2  43   ? -103.938 50.044  9.042   1.00 86.47  ?  43   LEU A C     1 
ATOM   1011  O  O     . LEU B  2  43   ? -104.881 50.040  9.840   1.00 92.54  ?  43   LEU A O     1 
ATOM   1012  C  CB    . LEU B  2  43   ? -104.926 48.470  7.376   1.00 65.44  ?  43   LEU A CB    1 
ATOM   1013  C  CG    . LEU B  2  43   ? -105.754 48.252  6.107   1.00 50.06  ?  43   LEU A CG    1 
ATOM   1014  C  CD1   . LEU B  2  43   ? -104.966 48.619  4.861   1.00 87.86  ?  43   LEU A CD1   1 
ATOM   1015  C  CD2   . LEU B  2  43   ? -106.234 46.805  6.019   1.00 55.66  ?  43   LEU A CD2   1 
ATOM   1016  N  N     . SER B  2  44   ? -102.683 50.274  9.424   1.00 81.48  ?  44   SER A N     1 
ATOM   1017  C  CA    . SER B  2  44   ? -102.344 50.349  10.836  1.00 82.88  ?  44   SER A CA    1 
ATOM   1018  C  C     . SER B  2  44   ? -101.547 51.607  11.162  1.00 92.50  ?  44   SER A C     1 
ATOM   1019  O  O     . SER B  2  44   ? -102.064 52.519  11.813  1.00 110.98 ?  44   SER A O     1 
ATOM   1020  C  CB    . SER B  2  44   ? -101.567 49.096  11.259  1.00 84.95  ?  44   SER A CB    1 
ATOM   1021  O  OG    . SER B  2  44   ? -100.375 48.973  10.507  1.00 100.74 ?  44   SER A OG    1 
ATOM   1022  N  N     . SER B  2  45   ? -100.309 51.694  10.682  1.00 80.63  ?  45   SER A N     1 
ATOM   1023  C  CA    . SER B  2  45   ? -99.365  52.681  11.187  1.00 87.79  ?  45   SER A CA    1 
ATOM   1024  C  C     . SER B  2  45   ? -99.311  53.960  10.357  1.00 93.25  ?  45   SER A C     1 
ATOM   1025  O  O     . SER B  2  45   ? -98.282  54.646  10.369  1.00 101.98 ?  45   SER A O     1 
ATOM   1026  C  CB    . SER B  2  45   ? -97.969  52.066  11.285  1.00 90.98  ?  45   SER A CB    1 
ATOM   1027  O  OG    . SER B  2  45   ? -97.972  50.951  12.158  1.00 90.70  ?  45   SER A OG    1 
ATOM   1028  N  N     . ILE B  2  46   ? -100.383 54.304  9.652   1.00 91.10  ?  46   ILE A N     1 
ATOM   1029  C  CA    . ILE B  2  46   ? -100.440 55.575  8.933   1.00 89.97  ?  46   ILE A CA    1 
ATOM   1030  C  C     . ILE B  2  46   ? -100.909 56.642  9.915   1.00 96.22  ?  46   ILE A C     1 
ATOM   1031  O  O     . ILE B  2  46   ? -102.032 56.555  10.435  1.00 104.62 ?  46   ILE A O     1 
ATOM   1032  C  CB    . ILE B  2  46   ? -101.354 55.486  7.703   1.00 92.05  ?  46   ILE A CB    1 
ATOM   1033  C  CG1   . ILE B  2  46   ? -100.924 54.319  6.814   1.00 94.46  ?  46   ILE A CG1   1 
ATOM   1034  C  CG2   . ILE B  2  46   ? -101.313 56.784  6.923   1.00 88.96  ?  46   ILE A CG2   1 
ATOM   1035  C  CD1   . ILE B  2  46   ? -99.463  54.356  6.420   1.00 84.56  ?  46   ILE A CD1   1 
ATOM   1036  N  N     . PRO B  2  47   ? -100.090 57.650  10.203  1.00 83.09  ?  47   PRO A N     1 
ATOM   1037  C  CA    . PRO B  2  47   ? -100.399 58.561  11.311  1.00 92.30  ?  47   PRO A CA    1 
ATOM   1038  C  C     . PRO B  2  47   ? -101.558 59.498  11.005  1.00 90.62  ?  47   PRO A C     1 
ATOM   1039  O  O     . PRO B  2  47   ? -101.782 59.906  9.863   1.00 85.89  ?  47   PRO A O     1 
ATOM   1040  C  CB    . PRO B  2  47   ? -99.093  59.345  11.498  1.00 88.93  ?  47   PRO A CB    1 
ATOM   1041  C  CG    . PRO B  2  47   ? -98.039  58.527  10.802  1.00 82.84  ?  47   PRO A CG    1 
ATOM   1042  C  CD    . PRO B  2  47   ? -98.745  57.881  9.657   1.00 79.39  ?  47   PRO A CD    1 
ATOM   1043  N  N     . GLY B  2  48   ? -102.298 59.834  12.062  1.00 89.20  ?  48   GLY A N     1 
ATOM   1044  C  CA    . GLY B  2  48   ? -103.344 60.843  12.020  1.00 72.53  ?  48   GLY A CA    1 
ATOM   1045  C  C     . GLY B  2  48   ? -103.059 61.906  13.070  1.00 88.56  ?  48   GLY A C     1 
ATOM   1046  O  O     . GLY B  2  48   ? -102.079 61.750  13.796  1.00 94.41  ?  48   GLY A O     1 
ATOM   1047  N  N     . ALA B  2  49   ? -103.861 62.970  13.197  1.00 83.98  ?  49   ALA A N     1 
ATOM   1048  C  CA    . ALA B  2  49   ? -105.082 63.269  12.434  1.00 89.24  ?  49   ALA A CA    1 
ATOM   1049  C  C     . ALA B  2  49   ? -106.309 62.573  13.027  1.00 91.03  ?  49   ALA A C     1 
ATOM   1050  O  O     . ALA B  2  49   ? -106.931 61.725  12.385  1.00 90.71  ?  49   ALA A O     1 
ATOM   1051  C  CB    . ALA B  2  49   ? -104.922 62.912  10.955  1.00 89.56  ?  49   ALA A CB    1 
ATOM   1052  N  N     . ALA B  2  50   ? -106.659 62.955  14.254  1.00 80.54  ?  50   ALA A N     1 
ATOM   1053  C  CA    . ALA B  2  50   ? -107.838 62.429  14.931  1.00 79.70  ?  50   ALA A CA    1 
ATOM   1054  C  C     . ALA B  2  50   ? -108.131 63.294  16.149  1.00 79.71  ?  50   ALA A C     1 
ATOM   1055  O  O     . ALA B  2  50   ? -107.257 64.006  16.652  1.00 91.02  ?  50   ALA A O     1 
ATOM   1056  C  CB    . ALA B  2  50   ? -107.651 60.965  15.340  1.00 81.30  ?  50   ALA A CB    1 
ATOM   1057  N  N     . VAL B  2  51   ? -109.376 63.218  16.618  1.00 63.19  ?  51   VAL A N     1 
ATOM   1058  C  CA    . VAL B  2  51   ? -109.855 64.017  17.742  1.00 66.29  ?  51   VAL A CA    1 
ATOM   1059  C  C     . VAL B  2  51   ? -109.834 63.162  19.001  1.00 79.03  ?  51   VAL A C     1 
ATOM   1060  O  O     . VAL B  2  51   ? -110.320 62.024  18.999  1.00 91.90  ?  51   VAL A O     1 
ATOM   1061  C  CB    . VAL B  2  51   ? -111.267 64.565  17.472  1.00 64.00  ?  51   VAL A CB    1 
ATOM   1062  C  CG1   . VAL B  2  51   ? -112.181 63.451  16.982  1.00 71.33  ?  51   VAL A CG1   1 
ATOM   1063  C  CG2   . VAL B  2  51   ? -111.835 65.215  18.727  1.00 61.42  ?  51   VAL A CG2   1 
ATOM   1064  N  N     . THR B  2  52   ? -109.276 63.714  20.080  1.00 73.62  ?  52   THR A N     1 
ATOM   1065  C  CA    . THR B  2  52   ? -109.161 62.998  21.344  1.00 67.46  ?  52   THR A CA    1 
ATOM   1066  C  C     . THR B  2  52   ? -110.414 63.174  22.194  1.00 74.73  ?  52   THR A C     1 
ATOM   1067  O  O     . THR B  2  52   ? -111.306 62.321  22.175  1.00 89.45  ?  52   THR A O     1 
ATOM   1068  C  CB    . THR B  2  52   ? -107.927 63.469  22.120  1.00 72.89  ?  52   THR A CB    1 
ATOM   1069  O  OG1   . THR B  2  52   ? -106.743 63.167  21.370  1.00 72.89  ?  52   THR A OG1   1 
ATOM   1070  C  CG2   . THR B  2  52   ? -107.855 62.784  23.480  1.00 89.83  ?  52   THR A CG2   1 
ATOM   1071  N  N     . SER B  2  53   ? -110.483 64.266  22.949  1.00 84.54  ?  53   SER A N     1 
ATOM   1072  C  CA    . SER B  2  53   ? -111.611 64.553  23.820  1.00 80.43  ?  53   SER A CA    1 
ATOM   1073  C  C     . SER B  2  53   ? -112.359 65.782  23.324  1.00 66.40  ?  53   SER A C     1 
ATOM   1074  O  O     . SER B  2  53   ? -111.853 66.561  22.512  1.00 80.51  ?  53   SER A O     1 
ATOM   1075  C  CB    . SER B  2  53   ? -111.149 64.778  25.265  1.00 82.41  ?  53   SER A CB    1 
ATOM   1076  O  OG    . SER B  2  53   ? -110.430 65.995  25.394  1.00 82.50  ?  53   SER A OG    1 
ATOM   1077  N  N     . ILE B  2  54   ? -113.579 65.948  23.835  1.00 59.58  ?  54   ILE A N     1 
ATOM   1078  C  CA    . ILE B  2  54   ? -114.423 67.087  23.502  1.00 68.57  ?  54   ILE A CA    1 
ATOM   1079  C  C     . ILE B  2  54   ? -115.147 67.541  24.762  1.00 71.29  ?  54   ILE A C     1 
ATOM   1080  O  O     . ILE B  2  54   ? -115.276 66.797  25.737  1.00 79.02  ?  54   ILE A O     1 
ATOM   1081  C  CB    . ILE B  2  54   ? -115.436 66.761  22.380  1.00 65.76  ?  54   ILE A CB    1 
ATOM   1082  C  CG1   . ILE B  2  54   ? -116.474 65.740  22.855  1.00 62.65  ?  54   ILE A CG1   1 
ATOM   1083  C  CG2   . ILE B  2  54   ? -114.715 66.250  21.143  1.00 71.36  ?  54   ILE A CG2   1 
ATOM   1084  C  CD1   . ILE B  2  54   ? -117.698 66.358  23.496  1.00 73.00  ?  54   ILE A CD1   1 
ATOM   1085  N  N     . ARG B  2  55   ? -115.623 68.784  24.730  1.00 75.50  ?  55   ARG A N     1 
ATOM   1086  C  CA    . ARG B  2  55   ? -116.315 69.381  25.866  1.00 72.34  ?  55   ARG A CA    1 
ATOM   1087  C  C     . ARG B  2  55   ? -117.501 70.180  25.356  1.00 75.94  ?  55   ARG A C     1 
ATOM   1088  O  O     . ARG B  2  55   ? -117.331 71.109  24.560  1.00 84.89  ?  55   ARG A O     1 
ATOM   1089  C  CB    . ARG B  2  55   ? -115.377 70.276  26.685  1.00 64.18  ?  55   ARG A CB    1 
ATOM   1090  N  N     . ILE B  2  56   ? -118.697 69.816  25.809  1.00 73.68  ?  56   ILE A N     1 
ATOM   1091  C  CA    . ILE B  2  56   ? -119.920 70.556  25.522  1.00 85.48  ?  56   ILE A CA    1 
ATOM   1092  C  C     . ILE B  2  56   ? -120.302 71.303  26.791  1.00 98.93  ?  56   ILE A C     1 
ATOM   1093  O  O     . ILE B  2  56   ? -120.595 70.682  27.820  1.00 104.32 ?  56   ILE A O     1 
ATOM   1094  C  CB    . ILE B  2  56   ? -121.049 69.626  25.054  1.00 81.02  ?  56   ILE A CB    1 
ATOM   1095  C  CG1   . ILE B  2  56   ? -120.678 68.980  23.717  1.00 78.48  ?  56   ILE A CG1   1 
ATOM   1096  C  CG2   . ILE B  2  56   ? -122.362 70.387  24.946  1.00 91.09  ?  56   ILE A CG2   1 
ATOM   1097  C  CD1   . ILE B  2  56   ? -121.741 68.057  23.164  1.00 70.26  ?  56   ILE A CD1   1 
ATOM   1098  N  N     . ASP B  2  57   ? -120.291 72.638  26.721  1.00 94.09  ?  57   ASP A N     1 
ATOM   1099  C  CA    . ASP B  2  57   ? -120.461 73.438  27.931  1.00 112.15 ?  57   ASP A CA    1 
ATOM   1100  C  C     . ASP B  2  57   ? -121.752 73.093  28.662  1.00 104.76 ?  57   ASP A C     1 
ATOM   1101  O  O     . ASP B  2  57   ? -121.786 73.106  29.898  1.00 105.78 ?  57   ASP A O     1 
ATOM   1102  C  CB    . ASP B  2  57   ? -120.425 74.930  27.590  1.00 104.93 ?  57   ASP A CB    1 
ATOM   1103  C  CG    . ASP B  2  57   ? -121.761 75.451  27.090  1.00 122.67 ?  57   ASP A CG    1 
ATOM   1104  O  OD1   . ASP B  2  57   ? -122.466 74.709  26.371  1.00 121.28 ?  57   ASP A OD1   1 
ATOM   1105  O  OD2   . ASP B  2  57   ? -122.109 76.603  27.425  1.00 120.57 ?  57   ASP A OD2   1 
ATOM   1106  N  N     . GLY B  2  58   ? -122.818 72.774  27.926  1.00 82.23  ?  58   GLY A N     1 
ATOM   1107  C  CA    . GLY B  2  58   ? -124.093 72.511  28.569  1.00 91.29  ?  58   GLY A CA    1 
ATOM   1108  C  C     . GLY B  2  58   ? -124.129 71.204  29.335  1.00 100.83 ?  58   GLY A C     1 
ATOM   1109  O  O     . GLY B  2  58   ? -124.870 71.078  30.315  1.00 90.51  ?  58   GLY A O     1 
ATOM   1110  N  N     . VAL B  2  59   ? -123.336 70.223  28.913  1.00 99.75  ?  59   VAL A N     1 
ATOM   1111  C  CA    . VAL B  2  59   ? -123.392 68.880  29.472  1.00 91.96  ?  59   VAL A CA    1 
ATOM   1112  C  C     . VAL B  2  59   ? -122.166 68.637  30.342  1.00 83.25  ?  59   VAL A C     1 
ATOM   1113  O  O     . VAL B  2  59   ? -121.115 69.262  30.180  1.00 89.06  ?  59   VAL A O     1 
ATOM   1114  C  CB    . VAL B  2  59   ? -123.493 67.806  28.370  1.00 80.90  ?  59   VAL A CB    1 
ATOM   1115  C  CG1   . VAL B  2  59   ? -124.585 68.166  27.375  1.00 86.95  ?  59   VAL A CG1   1 
ATOM   1116  C  CG2   . VAL B  2  59   ? -122.156 67.642  27.671  1.00 93.03  ?  59   VAL A CG2   1 
ATOM   1117  N  N     . LEU B  2  60   ? -122.314 67.702  31.284  1.00 91.37  ?  60   LEU A N     1 
ATOM   1118  C  CA    . LEU B  2  60   ? -121.210 67.265  32.126  1.00 91.51  ?  60   LEU A CA    1 
ATOM   1119  C  C     . LEU B  2  60   ? -120.714 65.864  31.801  1.00 86.89  ?  60   LEU A C     1 
ATOM   1120  O  O     . LEU B  2  60   ? -119.566 65.543  32.126  1.00 86.70  ?  60   LEU A O     1 
ATOM   1121  C  CB    . LEU B  2  60   ? -121.607 67.310  33.610  1.00 77.06  ?  60   LEU A CB    1 
ATOM   1122  C  CG    . LEU B  2  60   ? -122.061 68.651  34.187  1.00 83.62  ?  60   LEU A CG    1 
ATOM   1123  C  CD1   . LEU B  2  60   ? -123.506 68.939  33.800  1.00 100.51 ?  60   LEU A CD1   1 
ATOM   1124  C  CD2   . LEU B  2  60   ? -121.887 68.664  35.697  1.00 86.12  ?  60   LEU A CD2   1 
ATOM   1125  N  N     . HIS B  2  61   ? -121.540 65.026  31.180  1.00 80.45  ?  61   HIS A N     1 
ATOM   1126  C  CA    . HIS B  2  61   ? -121.136 63.677  30.808  1.00 76.78  ?  61   HIS A CA    1 
ATOM   1127  C  C     . HIS B  2  61   ? -121.764 63.340  29.459  1.00 75.19  ?  61   HIS A C     1 
ATOM   1128  O  O     . HIS B  2  61   ? -122.359 64.194  28.793  1.00 82.37  ?  61   HIS A O     1 
ATOM   1129  C  CB    . HIS B  2  61   ? -121.511 62.671  31.904  1.00 76.32  ?  61   HIS A CB    1 
ATOM   1130  C  CG    . HIS B  2  61   ? -122.978 62.599  32.190  1.00 72.58  ?  61   HIS A CG    1 
ATOM   1131  N  ND1   . HIS B  2  61   ? -123.892 62.114  31.279  1.00 77.59  ?  61   HIS A ND1   1 
ATOM   1132  C  CD2   . HIS B  2  61   ? -123.688 62.939  33.291  1.00 71.34  ?  61   HIS A CD2   1 
ATOM   1133  C  CE1   . HIS B  2  61   ? -125.103 62.164  31.805  1.00 84.90  ?  61   HIS A CE1   1 
ATOM   1134  N  NE2   . HIS B  2  61   ? -125.007 62.662  33.025  1.00 81.26  ?  61   HIS A NE2   1 
ATOM   1135  N  N     . GLU B  2  62   ? -121.635 62.078  29.059  1.00 70.18  ?  62   GLU A N     1 
ATOM   1136  C  CA    . GLU B  2  62   ? -121.986 61.633  27.718  1.00 72.81  ?  62   GLU A CA    1 
ATOM   1137  C  C     . GLU B  2  62   ? -123.429 61.158  27.587  1.00 77.86  ?  62   GLU A C     1 
ATOM   1138  O  O     . GLU B  2  62   ? -123.911 61.008  26.458  1.00 75.87  ?  62   GLU A O     1 
ATOM   1139  C  CB    . GLU B  2  62   ? -121.036 60.506  27.289  1.00 69.60  ?  62   GLU A CB    1 
ATOM   1140  C  CG    . GLU B  2  62   ? -121.331 59.902  25.927  1.00 92.33  ?  62   GLU A CG    1 
ATOM   1141  C  CD    . GLU B  2  62   ? -120.383 58.769  25.582  1.00 101.85 ?  62   GLU A CD    1 
ATOM   1142  O  OE1   . GLU B  2  62   ? -119.483 58.478  26.400  1.00 101.17 ?  62   GLU A OE1   1 
ATOM   1143  O  OE2   . GLU B  2  62   ? -120.535 58.169  24.495  1.00 98.54  ?  62   GLU A OE2   1 
ATOM   1144  N  N     . PHE B  2  63   ? -124.132 60.930  28.697  1.00 80.92  ?  63   PHE A N     1 
ATOM   1145  C  CA    . PHE B  2  63   ? -125.451 60.307  28.644  1.00 69.65  ?  63   PHE A CA    1 
ATOM   1146  C  C     . PHE B  2  63   ? -126.575 61.287  28.956  1.00 71.11  ?  63   PHE A C     1 
ATOM   1147  O  O     . PHE B  2  63   ? -127.448 60.992  29.779  1.00 73.51  ?  63   PHE A O     1 
ATOM   1148  C  CB    . PHE B  2  63   ? -125.512 59.126  29.614  1.00 73.32  ?  63   PHE A CB    1 
ATOM   1149  C  CG    . PHE B  2  63   ? -124.476 58.072  29.350  1.00 75.20  ?  63   PHE A CG    1 
ATOM   1150  C  CD1   . PHE B  2  63   ? -124.681 57.109  28.376  1.00 69.09  ?  63   PHE A CD1   1 
ATOM   1151  C  CD2   . PHE B  2  63   ? -123.298 58.043  30.075  1.00 69.57  ?  63   PHE A CD2   1 
ATOM   1152  C  CE1   . PHE B  2  63   ? -123.731 56.140  28.130  1.00 66.40  ?  63   PHE A CE1   1 
ATOM   1153  C  CE2   . PHE B  2  63   ? -122.345 57.076  29.834  1.00 67.70  ?  63   PHE A CE2   1 
ATOM   1154  C  CZ    . PHE B  2  63   ? -122.562 56.124  28.860  1.00 72.39  ?  63   PHE A CZ    1 
ATOM   1155  N  N     . THR B  2  64   ? -126.573 62.446  28.301  1.00 82.19  ?  64   THR A N     1 
ATOM   1156  C  CA    . THR B  2  64   ? -127.616 63.443  28.492  1.00 75.46  ?  64   THR A CA    1 
ATOM   1157  C  C     . THR B  2  64   ? -127.949 64.072  27.146  1.00 72.59  ?  64   THR A C     1 
ATOM   1158  O  O     . THR B  2  64   ? -127.309 63.790  26.127  1.00 72.22  ?  64   THR A O     1 
ATOM   1159  C  CB    . THR B  2  64   ? -127.190 64.511  29.506  1.00 80.85  ?  64   THR A CB    1 
ATOM   1160  O  OG1   . THR B  2  64   ? -128.286 65.404  29.747  1.00 92.51  ?  64   THR A OG1   1 
ATOM   1161  C  CG2   . THR B  2  64   ? -125.999 65.302  28.978  1.00 81.18  ?  64   THR A CG2   1 
ATOM   1162  N  N     . THR B  2  65   ? -128.962 64.932  27.144  1.00 66.41  ?  65   THR A N     1 
ATOM   1163  C  CA    . THR B  2  65   ? -129.402 65.631  25.947  1.00 75.62  ?  65   THR A CA    1 
ATOM   1164  C  C     . THR B  2  65   ? -129.116 67.122  26.075  1.00 77.34  ?  65   THR A C     1 
ATOM   1165  O  O     . THR B  2  65   ? -128.804 67.634  27.153  1.00 82.87  ?  65   THR A O     1 
ATOM   1166  C  CB    . THR B  2  65   ? -130.896 65.401  25.695  1.00 77.00  ?  65   THR A CB    1 
ATOM   1167  O  OG1   . THR B  2  65   ? -131.652 65.957  26.777  1.00 85.70  ?  65   THR A OG1   1 
ATOM   1168  C  CG2   . THR B  2  65   ? -131.195 63.914  25.588  1.00 84.34  ?  65   THR A CG2   1 
ATOM   1169  N  N     . VAL B  2  66   ? -129.225 67.814  24.952  1.00 71.42  ?  66   VAL A N     1 
ATOM   1170  C  CA    . VAL B  2  66   ? -129.046 69.262  24.880  1.00 72.69  ?  66   VAL A CA    1 
ATOM   1171  C  C     . VAL B  2  66   ? -130.390 69.884  24.529  1.00 84.92  ?  66   VAL A C     1 
ATOM   1172  O  O     . VAL B  2  66   ? -131.056 69.407  23.603  1.00 92.92  ?  66   VAL A O     1 
ATOM   1173  C  CB    . VAL B  2  66   ? -127.979 69.659  23.843  1.00 80.28  ?  66   VAL A CB    1 
ATOM   1174  C  CG1   . VAL B  2  66   ? -127.864 71.171  23.754  1.00 97.83  ?  66   VAL A CG1   1 
ATOM   1175  C  CG2   . VAL B  2  66   ? -126.638 69.036  24.199  1.00 80.02  ?  66   VAL A CG2   1 
ATOM   1176  N  N     . PRO B  2  67   ? -130.827 70.926  25.234  1.00 80.71  ?  67   PRO A N     1 
ATOM   1177  C  CA    . PRO B  2  67   ? -132.127 71.535  24.921  1.00 66.50  ?  67   PRO A CA    1 
ATOM   1178  C  C     . PRO B  2  67   ? -132.187 71.977  23.468  1.00 76.44  ?  67   PRO A C     1 
ATOM   1179  O  O     . PRO B  2  67   ? -131.341 72.739  22.994  1.00 79.39  ?  67   PRO A O     1 
ATOM   1180  C  CB    . PRO B  2  67   ? -132.198 72.726  25.883  1.00 77.26  ?  67   PRO A CB    1 
ATOM   1181  C  CG    . PRO B  2  67   ? -131.285 72.356  27.009  1.00 78.37  ?  67   PRO A CG    1 
ATOM   1182  C  CD    . PRO B  2  67   ? -130.171 71.576  26.380  1.00 84.90  ?  67   PRO A CD    1 
ATOM   1183  N  N     . GLY B  2  68   ? -133.195 71.478  22.753  1.00 80.78  ?  68   GLY A N     1 
ATOM   1184  C  CA    . GLY B  2  68   ? -133.437 71.852  21.379  1.00 83.98  ?  68   GLY A CA    1 
ATOM   1185  C  C     . GLY B  2  68   ? -132.798 70.946  20.344  1.00 95.02  ?  68   GLY A C     1 
ATOM   1186  O  O     . GLY B  2  68   ? -133.334 70.815  19.239  1.00 98.22  ?  68   GLY A O     1 
ATOM   1187  N  N     . VAL B  2  69   ? -131.663 70.322  20.668  1.00 98.54  ?  69   VAL A N     1 
ATOM   1188  C  CA    . VAL B  2  69   ? -131.007 69.438  19.713  1.00 91.60  ?  69   VAL A CA    1 
ATOM   1189  C  C     . VAL B  2  69   ? -131.823 68.159  19.553  1.00 94.48  ?  69   VAL A C     1 
ATOM   1190  O  O     . VAL B  2  69   ? -132.535 67.725  20.469  1.00 94.83  ?  69   VAL A O     1 
ATOM   1191  C  CB    . VAL B  2  69   ? -129.565 69.124  20.153  1.00 81.23  ?  69   VAL A CB    1 
ATOM   1192  C  CG1   . VAL B  2  69   ? -128.795 70.409  20.407  1.00 84.74  ?  69   VAL A CG1   1 
ATOM   1193  C  CG2   . VAL B  2  69   ? -129.564 68.236  21.392  1.00 96.98  ?  69   VAL A CG2   1 
ATOM   1194  N  N     . LYS B  2  70   ? -131.722 67.552  18.371  1.00 88.55  ?  70   LYS A N     1 
ATOM   1195  C  CA    . LYS B  2  70   ? -132.447 66.324  18.068  1.00 78.97  ?  70   LYS A CA    1 
ATOM   1196  C  C     . LYS B  2  70   ? -131.683 65.078  18.504  1.00 77.71  ?  70   LYS A C     1 
ATOM   1197  O  O     . LYS B  2  70   ? -132.293 64.116  18.983  1.00 79.45  ?  70   LYS A O     1 
ATOM   1198  C  CB    . LYS B  2  70   ? -132.756 66.250  16.570  1.00 71.79  ?  70   LYS A CB    1 
ATOM   1199  C  CG    . LYS B  2  70   ? -133.564 65.033  16.161  1.00 52.77  ?  70   LYS A CG    1 
ATOM   1200  C  CD    . LYS B  2  70   ? -133.814 65.022  14.661  1.00 75.18  ?  70   LYS A CD    1 
ATOM   1201  C  CE    . LYS B  2  70   ? -134.539 63.756  14.231  1.00 95.87  ?  70   LYS A CE    1 
ATOM   1202  N  NZ    . LYS B  2  70   ? -134.759 63.722  12.760  1.00 107.98 ?  70   LYS A NZ    1 
ATOM   1203  N  N     . GLU B  2  71   ? -130.362 65.074  18.348  1.00 85.26  ?  71   GLU A N     1 
ATOM   1204  C  CA    . GLU B  2  71   ? -129.539 63.942  18.753  1.00 86.04  ?  71   GLU A CA    1 
ATOM   1205  C  C     . GLU B  2  71   ? -129.106 64.094  20.205  1.00 80.58  ?  71   GLU A C     1 
ATOM   1206  O  O     . GLU B  2  71   ? -128.761 65.192  20.652  1.00 78.58  ?  71   GLU A O     1 
ATOM   1207  C  CB    . GLU B  2  71   ? -128.300 63.818  17.861  1.00 80.83  ?  71   GLU A CB    1 
ATOM   1208  C  CG    . GLU B  2  71   ? -128.573 63.423  16.415  1.00 87.86  ?  71   GLU A CG    1 
ATOM   1209  C  CD    . GLU B  2  71   ? -129.172 64.551  15.600  1.00 91.26  ?  71   GLU A CD    1 
ATOM   1210  O  OE1   . GLU B  2  71   ? -130.345 64.902  15.839  1.00 94.99  ?  71   GLU A OE1   1 
ATOM   1211  O  OE2   . GLU B  2  71   ? -128.466 65.093  14.725  1.00 95.80  ?  71   GLU A OE2   1 
ATOM   1212  N  N     . ASP B  2  72   ? -129.123 62.985  20.939  1.00 81.70  ?  72   ASP A N     1 
ATOM   1213  C  CA    . ASP B  2  72   ? -128.563 62.987  22.281  1.00 76.08  ?  72   ASP A CA    1 
ATOM   1214  C  C     . ASP B  2  72   ? -127.039 63.060  22.209  1.00 64.34  ?  72   ASP A C     1 
ATOM   1215  O  O     . ASP B  2  72   ? -126.429 62.830  21.162  1.00 77.37  ?  72   ASP A O     1 
ATOM   1216  C  CB    . ASP B  2  72   ? -129.010 61.747  23.059  1.00 77.22  ?  72   ASP A CB    1 
ATOM   1217  C  CG    . ASP B  2  72   ? -128.656 60.449  22.352  1.00 96.27  ?  72   ASP A CG    1 
ATOM   1218  O  OD1   . ASP B  2  72   ? -127.483 60.280  21.956  1.00 102.66 ?  72   ASP A OD1   1 
ATOM   1219  O  OD2   . ASP B  2  72   ? -129.556 59.596  22.190  1.00 96.72  ?  72   ASP A OD2   1 
ATOM   1220  N  N     . VAL B  2  73   ? -126.424 63.392  23.345  1.00 60.49  ?  73   VAL A N     1 
ATOM   1221  C  CA    . VAL B  2  73   ? -124.976 63.583  23.376  1.00 62.00  ?  73   VAL A CA    1 
ATOM   1222  C  C     . VAL B  2  73   ? -124.259 62.328  22.892  1.00 80.50  ?  73   VAL A C     1 
ATOM   1223  O  O     . VAL B  2  73   ? -123.316 62.398  22.095  1.00 81.98  ?  73   VAL A O     1 
ATOM   1224  C  CB    . VAL B  2  73   ? -124.515 63.983  24.788  1.00 63.11  ?  73   VAL A CB    1 
ATOM   1225  C  CG1   . VAL B  2  73   ? -123.001 63.907  24.885  1.00 65.73  ?  73   VAL A CG1   1 
ATOM   1226  C  CG2   . VAL B  2  73   ? -125.004 65.381  25.128  1.00 68.56  ?  73   VAL A CG2   1 
ATOM   1227  N  N     . THR B  2  74   ? -124.692 61.159  23.370  1.00 85.63  ?  74   THR A N     1 
ATOM   1228  C  CA    . THR B  2  74   ? -124.026 59.923  22.975  1.00 74.22  ?  74   THR A CA    1 
ATOM   1229  C  C     . THR B  2  74   ? -124.146 59.681  21.477  1.00 75.51  ?  74   THR A C     1 
ATOM   1230  O  O     . THR B  2  74   ? -123.252 59.079  20.872  1.00 80.20  ?  74   THR A O     1 
ATOM   1231  C  CB    . THR B  2  74   ? -124.600 58.739  23.758  1.00 78.69  ?  74   THR A CB    1 
ATOM   1232  O  OG1   . THR B  2  74   ? -123.548 57.817  24.069  1.00 79.42  ?  74   THR A OG1   1 
ATOM   1233  C  CG2   . THR B  2  74   ? -125.667 58.022  22.941  1.00 85.27  ?  74   THR A CG2   1 
ATOM   1234  N  N     . ASP B  2  75   ? -125.235 60.146  20.860  1.00 81.75  ?  75   ASP A N     1 
ATOM   1235  C  CA    . ASP B  2  75   ? -125.394 59.987  19.419  1.00 80.83  ?  75   ASP A CA    1 
ATOM   1236  C  C     . ASP B  2  75   ? -124.598 61.029  18.647  1.00 76.85  ?  75   ASP A C     1 
ATOM   1237  O  O     . ASP B  2  75   ? -124.159 60.760  17.523  1.00 89.04  ?  75   ASP A O     1 
ATOM   1238  C  CB    . ASP B  2  75   ? -126.873 60.064  19.039  1.00 90.92  ?  75   ASP A CB    1 
ATOM   1239  C  CG    . ASP B  2  75   ? -127.155 59.478  17.669  1.00 110.97 ?  75   ASP A CG    1 
ATOM   1240  O  OD1   . ASP B  2  75   ? -127.528 58.287  17.598  1.00 120.04 ?  75   ASP A OD1   1 
ATOM   1241  O  OD2   . ASP B  2  75   ? -127.001 60.205  16.664  1.00 104.81 ?  75   ASP A OD2   1 
ATOM   1242  N  N     . ILE B  2  76   ? -124.406 62.217  19.224  1.00 79.39  ?  76   ILE A N     1 
ATOM   1243  C  CA    . ILE B  2  76   ? -123.540 63.207  18.595  1.00 75.24  ?  76   ILE A CA    1 
ATOM   1244  C  C     . ILE B  2  76   ? -122.091 62.747  18.640  1.00 75.45  ?  76   ILE A C     1 
ATOM   1245  O  O     . ILE B  2  76   ? -121.312 63.032  17.723  1.00 82.70  ?  76   ILE A O     1 
ATOM   1246  C  CB    . ILE B  2  76   ? -123.715 64.582  19.266  1.00 71.23  ?  76   ILE A CB    1 
ATOM   1247  C  CG1   . ILE B  2  76   ? -125.163 65.058  19.141  1.00 81.42  ?  76   ILE A CG1   1 
ATOM   1248  C  CG2   . ILE B  2  76   ? -122.765 65.598  18.655  1.00 71.39  ?  76   ILE A CG2   1 
ATOM   1249  C  CD1   . ILE B  2  76   ? -125.419 66.397  19.791  1.00 70.46  ?  76   ILE A CD1   1 
ATOM   1250  N  N     . ILE B  2  77   ? -121.703 62.034  19.700  1.00 78.94  ?  77   ILE A N     1 
ATOM   1251  C  CA    . ILE B  2  77   ? -120.352 61.483  19.771  1.00 71.13  ?  77   ILE A CA    1 
ATOM   1252  C  C     . ILE B  2  77   ? -120.134 60.475  18.651  1.00 65.48  ?  77   ILE A C     1 
ATOM   1253  O  O     . ILE B  2  77   ? -119.080 60.459  18.005  1.00 69.06  ?  77   ILE A O     1 
ATOM   1254  C  CB    . ILE B  2  77   ? -120.101 60.855  21.154  1.00 76.65  ?  77   ILE A CB    1 
ATOM   1255  C  CG1   . ILE B  2  77   ? -120.171 61.920  22.250  1.00 82.34  ?  77   ILE A CG1   1 
ATOM   1256  C  CG2   . ILE B  2  77   ? -118.753 60.157  21.182  1.00 78.69  ?  77   ILE A CG2   1 
ATOM   1257  C  CD1   . ILE B  2  77   ? -119.038 62.921  22.200  1.00 89.06  ?  77   ILE A CD1   1 
ATOM   1258  N  N     . LEU B  2  78   ? -121.128 59.620  18.402  1.00 69.20  ?  78   LEU A N     1 
ATOM   1259  C  CA    . LEU B  2  78   ? -121.002 58.639  17.330  1.00 67.08  ?  78   LEU A CA    1 
ATOM   1260  C  C     . LEU B  2  78   ? -120.998 59.304  15.961  1.00 72.66  ?  78   LEU A C     1 
ATOM   1261  O  O     . LEU B  2  78   ? -120.401 58.772  15.018  1.00 83.31  ?  78   LEU A O     1 
ATOM   1262  C  CB    . LEU B  2  78   ? -122.128 57.609  17.423  1.00 72.78  ?  78   LEU A CB    1 
ATOM   1263  C  CG    . LEU B  2  78   ? -122.162 56.794  18.717  1.00 78.83  ?  78   LEU A CG    1 
ATOM   1264  C  CD1   . LEU B  2  78   ? -123.336 55.829  18.717  1.00 78.01  ?  78   LEU A CD1   1 
ATOM   1265  C  CD2   . LEU B  2  78   ? -120.845 56.053  18.922  1.00 65.37  ?  78   LEU A CD2   1 
ATOM   1266  N  N     . ASN B  2  79   ? -121.656 60.458  15.827  1.00 79.30  ?  79   ASN A N     1 
ATOM   1267  C  CA    . ASN B  2  79   ? -121.587 61.197  14.571  1.00 75.79  ?  79   ASN A CA    1 
ATOM   1268  C  C     . ASN B  2  79   ? -120.225 61.858  14.399  1.00 70.06  ?  79   ASN A C     1 
ATOM   1269  O  O     . ASN B  2  79   ? -119.680 61.892  13.289  1.00 75.78  ?  79   ASN A O     1 
ATOM   1270  C  CB    . ASN B  2  79   ? -122.707 62.238  14.507  1.00 64.99  ?  79   ASN A CB    1 
ATOM   1271  C  CG    . ASN B  2  79   ? -124.084 61.607  14.391  1.00 85.26  ?  79   ASN A CG    1 
ATOM   1272  O  OD1   . ASN B  2  79   ? -124.234 60.515  13.844  1.00 98.11  ?  79   ASN A OD1   1 
ATOM   1273  N  ND2   . ASN B  2  79   ? -125.098 62.294  14.905  1.00 95.96  ?  79   ASN A ND2   1 
ATOM   1274  N  N     . LEU B  2  80   ? -119.656 62.381  15.487  1.00 68.06  ?  80   LEU A N     1 
ATOM   1275  C  CA    . LEU B  2  80   ? -118.337 62.998  15.414  1.00 67.83  ?  80   LEU A CA    1 
ATOM   1276  C  C     . LEU B  2  80   ? -117.236 61.986  15.129  1.00 78.06  ?  80   LEU A C     1 
ATOM   1277  O  O     . LEU B  2  80   ? -116.161 62.376  14.661  1.00 86.40  ?  80   LEU A O     1 
ATOM   1278  C  CB    . LEU B  2  80   ? -118.027 63.749  16.711  1.00 67.52  ?  80   LEU A CB    1 
ATOM   1279  C  CG    . LEU B  2  80   ? -118.740 65.084  16.934  1.00 74.18  ?  80   LEU A CG    1 
ATOM   1280  C  CD1   . LEU B  2  80   ? -118.394 65.653  18.301  1.00 71.11  ?  80   LEU A CD1   1 
ATOM   1281  C  CD2   . LEU B  2  80   ? -118.375 66.069  15.834  1.00 84.56  ?  80   LEU A CD2   1 
ATOM   1282  N  N     . LYS B  2  81   ? -117.469 60.701  15.402  1.00 82.93  ?  81   LYS A N     1 
ATOM   1283  C  CA    . LYS B  2  81   ? -116.465 59.697  15.072  1.00 81.13  ?  81   LYS A CA    1 
ATOM   1284  C  C     . LYS B  2  81   ? -116.171 59.678  13.578  1.00 75.08  ?  81   LYS A C     1 
ATOM   1285  O  O     . LYS B  2  81   ? -115.073 59.291  13.166  1.00 75.23  ?  81   LYS A O     1 
ATOM   1286  C  CB    . LYS B  2  81   ? -116.916 58.317  15.547  1.00 67.43  ?  81   LYS A CB    1 
ATOM   1287  C  CG    . LYS B  2  81   ? -116.923 58.155  17.058  1.00 72.61  ?  81   LYS A CG    1 
ATOM   1288  C  CD    . LYS B  2  81   ? -117.501 56.806  17.471  1.00 111.37 ?  81   LYS A CD    1 
ATOM   1289  C  CE    . LYS B  2  81   ? -116.654 55.647  16.958  1.00 91.69  ?  81   LYS A CE    1 
ATOM   1290  N  NZ    . LYS B  2  81   ? -115.310 55.614  17.600  1.00 95.49  ?  81   LYS A NZ    1 
ATOM   1291  N  N     . GLY B  2  82   ? -117.129 60.091  12.752  1.00 74.92  ?  82   GLY A N     1 
ATOM   1292  C  CA    . GLY B  2  82   ? -116.892 60.147  11.322  1.00 89.49  ?  82   GLY A CA    1 
ATOM   1293  C  C     . GLY B  2  82   ? -116.066 61.325  10.861  1.00 94.30  ?  82   GLY A C     1 
ATOM   1294  O  O     . GLY B  2  82   ? -115.920 61.531  9.652   1.00 96.57  ?  82   GLY A O     1 
ATOM   1295  N  N     . LEU B  2  83   ? -115.525 62.112  11.791  1.00 88.45  ?  83   LEU A N     1 
ATOM   1296  C  CA    . LEU B  2  83   ? -114.695 63.250  11.417  1.00 85.60  ?  83   LEU A CA    1 
ATOM   1297  C  C     . LEU B  2  83   ? -113.348 62.770  10.899  1.00 95.99  ?  83   LEU A C     1 
ATOM   1298  O  O     . LEU B  2  83   ? -112.666 61.976  11.554  1.00 107.34 ?  83   LEU A O     1 
ATOM   1299  C  CB    . LEU B  2  83   ? -114.499 64.180  12.609  1.00 77.91  ?  83   LEU A CB    1 
ATOM   1300  C  CG    . LEU B  2  83   ? -115.378 65.432  12.669  1.00 78.88  ?  83   LEU A CG    1 
ATOM   1301  C  CD1   . LEU B  2  83   ? -115.041 66.272  13.890  1.00 64.69  ?  83   LEU A CD1   1 
ATOM   1302  C  CD2   . LEU B  2  83   ? -115.225 66.244  11.395  1.00 89.00  ?  83   LEU A CD2   1 
ATOM   1303  N  N     . VAL B  2  84   ? -112.966 63.255  9.724   1.00 93.03  ?  84   VAL A N     1 
ATOM   1304  C  CA    . VAL B  2  84   ? -111.650 63.002  9.152   1.00 94.60  ?  84   VAL A CA    1 
ATOM   1305  C  C     . VAL B  2  84   ? -110.900 64.328  9.179   1.00 90.30  ?  84   VAL A C     1 
ATOM   1306  O  O     . VAL B  2  84   ? -111.146 65.215  8.354   1.00 96.20  ?  84   VAL A O     1 
ATOM   1307  C  CB    . VAL B  2  84   ? -111.734 62.425  7.735   1.00 86.40  ?  84   VAL A CB    1 
ATOM   1308  C  CG1   . VAL B  2  84   ? -112.693 63.238  6.885   1.00 97.44  ?  84   VAL A CG1   1 
ATOM   1309  C  CG2   . VAL B  2  84   ? -110.352 62.393  7.100   1.00 105.79 ?  84   VAL A CG2   1 
ATOM   1310  N  N     . VAL B  2  85   ? -109.990 64.471  10.136  1.00 91.73  ?  85   VAL A N     1 
ATOM   1311  C  CA    . VAL B  2  85   ? -109.233 65.698  10.318  1.00 71.72  ?  85   VAL A CA    1 
ATOM   1312  C  C     . VAL B  2  85   ? -107.759 65.411  10.043  1.00 88.77  ?  85   VAL A C     1 
ATOM   1313  O  O     . VAL B  2  85   ? -107.323 64.262  9.990   1.00 106.63 ?  85   VAL A O     1 
ATOM   1314  C  CB    . VAL B  2  85   ? -109.433 66.293  11.726  1.00 65.83  ?  85   VAL A CB    1 
ATOM   1315  C  CG1   . VAL B  2  85   ? -108.730 65.438  12.766  1.00 93.60  ?  85   VAL A CG1   1 
ATOM   1316  C  CG2   . VAL B  2  85   ? -108.934 67.725  11.778  1.00 103.85 ?  85   VAL A CG2   1 
ATOM   1317  N  N     . SER B  2  86   ? -106.991 66.482  9.856   1.00 85.09  ?  86   SER A N     1 
ATOM   1318  C  CA    . SER B  2  86   ? -105.555 66.385  9.641   1.00 86.02  ?  86   SER A CA    1 
ATOM   1319  C  C     . SER B  2  86   ? -104.899 67.604  10.267  1.00 84.28  ?  86   SER A C     1 
ATOM   1320  O  O     . SER B  2  86   ? -105.395 68.724  10.119  1.00 99.62  ?  86   SER A O     1 
ATOM   1321  C  CB    . SER B  2  86   ? -105.206 66.303  8.150   1.00 87.17  ?  86   SER A CB    1 
ATOM   1322  O  OG    . SER B  2  86   ? -105.589 67.487  7.473   1.00 76.26  ?  86   SER A OG    1 
ATOM   1323  N  N     . SER B  2  87   ? -103.786 67.383  10.962  1.00 78.91  ?  87   SER A N     1 
ATOM   1324  C  CA    . SER B  2  87   ? -103.131 68.461  11.686  1.00 86.09  ?  87   SER A CA    1 
ATOM   1325  C  C     . SER B  2  87   ? -101.631 68.223  11.743  1.00 93.77  ?  87   SER A C     1 
ATOM   1326  O  O     . SER B  2  87   ? -101.181 67.097  11.971  1.00 99.67  ?  87   SER A O     1 
ATOM   1327  C  CB    . SER B  2  87   ? -103.684 68.586  13.110  1.00 83.09  ?  87   SER A CB    1 
ATOM   1328  O  OG    . SER B  2  87   ? -102.890 69.465  13.887  1.00 101.61 ?  87   SER A OG    1 
ATOM   1329  N  N     . ASP B  2  88   ? -100.865 69.295  11.529  1.00 102.98 ?  88   ASP A N     1 
ATOM   1330  C  CA    . ASP B  2  88   ? -99.446  69.256  11.863  1.00 111.42 ?  88   ASP A CA    1 
ATOM   1331  C  C     . ASP B  2  88   ? -99.259  69.105  13.366  1.00 113.96 ?  88   ASP A C     1 
ATOM   1332  O  O     . ASP B  2  88   ? -98.390  68.351  13.821  1.00 123.75 ?  88   ASP A O     1 
ATOM   1333  C  CB    . ASP B  2  88   ? -98.751  70.518  11.354  1.00 104.98 ?  88   ASP A CB    1 
ATOM   1334  C  CG    . ASP B  2  88   ? -99.119  70.849  9.920   1.00 114.25 ?  88   ASP A CG    1 
ATOM   1335  O  OD1   . ASP B  2  88   ? -100.235 70.485  9.490   1.00 101.29 ?  88   ASP A OD1   1 
ATOM   1336  O  OD2   . ASP B  2  88   ? -98.293  71.474  9.221   1.00 129.47 ?  88   ASP A OD2   1 
ATOM   1337  N  N     . ASP B  2  89   ? -100.073 69.816  14.147  1.00 100.62 ?  89   ASP A N     1 
ATOM   1338  C  CA    . ASP B  2  89   ? -100.186 69.610  15.586  1.00 106.11 ?  89   ASP A CA    1 
ATOM   1339  C  C     . ASP B  2  89   ? -98.837  69.577  16.289  1.00 105.23 ?  89   ASP A C     1 
ATOM   1340  O  O     . ASP B  2  89   ? -98.209  70.621  16.490  1.00 114.54 ?  89   ASP A O     1 
ATOM   1341  C  CB    . ASP B  2  89   ? -100.948 68.315  15.876  1.00 111.20 ?  89   ASP A CB    1 
ATOM   1342  N  N     . ASP B  2  90   ? -98.392  68.382  16.669  1.00 104.14 ?  90   ASP A N     1 
ATOM   1343  C  CA    . ASP B  2  90   ? -97.265  68.119  17.551  1.00 106.44 ?  90   ASP A CA    1 
ATOM   1344  C  C     . ASP B  2  90   ? -97.641  68.391  19.001  1.00 112.45 ?  90   ASP A C     1 
ATOM   1345  O  O     . ASP B  2  90   ? -96.838  68.115  19.890  1.00 118.83 ?  90   ASP A O     1 
ATOM   1346  C  CB    . ASP B  2  90   ? -96.002  68.928  17.192  1.00 125.65 ?  90   ASP A CB    1 
ATOM   1347  N  N     . GLU B  2  91   ? -98.830  68.923  19.271  1.00 107.52 ?  91   GLU A N     1 
ATOM   1348  C  CA    . GLU B  2  91   ? -99.320  69.148  20.623  1.00 107.87 ?  91   GLU A CA    1 
ATOM   1349  C  C     . GLU B  2  91   ? -100.839 69.207  20.574  1.00 104.21 ?  91   GLU A C     1 
ATOM   1350  O  O     . GLU B  2  91   ? -101.421 69.482  19.517  1.00 96.43  ?  91   GLU A O     1 
ATOM   1351  C  CB    . GLU B  2  91   ? -98.751  70.445  21.220  1.00 108.59 ?  91   GLU A CB    1 
ATOM   1352  C  CG    . GLU B  2  91   ? -97.435  70.272  21.956  1.00 110.36 ?  91   GLU A CG    1 
ATOM   1353  C  CD    . GLU B  2  91   ? -96.956  71.562  22.592  1.00 127.78 ?  91   GLU A CD    1 
ATOM   1354  O  OE1   . GLU B  2  91   ? -97.426  72.640  22.172  1.00 125.11 ?  91   GLU A OE1   1 
ATOM   1355  O  OE2   . GLU B  2  91   ? -96.115  71.498  23.515  1.00 125.24 ?  91   GLU A OE2   1 
ATOM   1356  N  N     . PRO B  2  92   ? -101.508 68.944  21.693  1.00 101.20 ?  92   PRO A N     1 
ATOM   1357  C  CA    . PRO B  2  92   ? -102.974 69.035  21.713  1.00 97.45  ?  92   PRO A CA    1 
ATOM   1358  C  C     . PRO B  2  92   ? -103.470 70.441  21.416  1.00 95.96  ?  92   PRO A C     1 
ATOM   1359  O  O     . PRO B  2  92   ? -103.304 71.353  22.233  1.00 99.83  ?  92   PRO A O     1 
ATOM   1360  C  CB    . PRO B  2  92   ? -103.333 68.606  23.142  1.00 85.17  ?  92   PRO A CB    1 
ATOM   1361  C  CG    . PRO B  2  92   ? -102.156 67.812  23.612  1.00 90.03  ?  92   PRO A CG    1 
ATOM   1362  C  CD    . PRO B  2  92   ? -100.963 68.452  22.968  1.00 95.31  ?  92   PRO A CD    1 
ATOM   1363  N  N     . VAL B  2  93   ? -104.072 70.628  20.245  1.00 80.97  ?  93   VAL A N     1 
ATOM   1364  C  CA    . VAL B  2  93   ? -104.692 71.891  19.863  1.00 88.89  ?  93   VAL A CA    1 
ATOM   1365  C  C     . VAL B  2  93   ? -106.201 71.698  19.862  1.00 88.81  ?  93   VAL A C     1 
ATOM   1366  O  O     . VAL B  2  93   ? -106.706 70.684  19.365  1.00 94.85  ?  93   VAL A O     1 
ATOM   1367  C  CB    . VAL B  2  93   ? -104.197 72.377  18.487  1.00 87.20  ?  93   VAL A CB    1 
ATOM   1368  C  CG1   . VAL B  2  93   ? -104.626 71.409  17.396  1.00 78.43  ?  93   VAL A CG1   1 
ATOM   1369  C  CG2   . VAL B  2  93   ? -104.717 73.781  18.202  1.00 103.15 ?  93   VAL A CG2   1 
ATOM   1370  N  N     . THR B  2  94   ? -106.919 72.668  20.419  1.00 88.83  ?  94   THR A N     1 
ATOM   1371  C  CA    . THR B  2  94   ? -108.366 72.581  20.569  1.00 85.96  ?  94   THR A CA    1 
ATOM   1372  C  C     . THR B  2  94   ? -109.056 73.318  19.429  1.00 83.35  ?  94   THR A C     1 
ATOM   1373  O  O     . THR B  2  94   ? -108.657 74.430  19.068  1.00 95.14  ?  94   THR A O     1 
ATOM   1374  C  CB    . THR B  2  94   ? -108.814 73.163  21.912  1.00 83.34  ?  94   THR A CB    1 
ATOM   1375  O  OG1   . THR B  2  94   ? -108.516 74.564  21.953  1.00 115.73 ?  94   THR A OG1   1 
ATOM   1376  C  CG2   . THR B  2  94   ? -108.098 72.468  23.059  1.00 85.21  ?  94   THR A CG2   1 
ATOM   1377  N  N     . MET B  2  95   ? -110.084 72.691  18.864  1.00 79.54  ?  95   MET A N     1 
ATOM   1378  C  CA    . MET B  2  95   ? -110.958 73.341  17.904  1.00 78.24  ?  95   MET A CA    1 
ATOM   1379  C  C     . MET B  2  95   ? -112.180 73.892  18.634  1.00 84.69  ?  95   MET A C     1 
ATOM   1380  O  O     . MET B  2  95   ? -112.327 73.744  19.849  1.00 79.89  ?  95   MET A O     1 
ATOM   1381  C  CB    . MET B  2  95   ? -111.370 72.368  16.803  1.00 82.07  ?  95   MET A CB    1 
ATOM   1382  C  CG    . MET B  2  95   ? -110.217 71.624  16.157  1.00 78.08  ?  95   MET A CG    1 
ATOM   1383  S  SD    . MET B  2  95   ? -110.792 70.409  14.952  1.00 83.33  ?  95   MET A SD    1 
ATOM   1384  C  CE    . MET B  2  95   ? -111.509 71.472  13.700  1.00 101.53 ?  95   MET A CE    1 
ATOM   1385  N  N     . TYR B  2  96   ? -113.077 74.530  17.887  1.00 91.76  ?  96   TYR A N     1 
ATOM   1386  C  CA    . TYR B  2  96   ? -114.268 75.121  18.476  1.00 87.60  ?  96   TYR A CA    1 
ATOM   1387  C  C     . TYR B  2  96   ? -115.439 74.984  17.516  1.00 85.42  ?  96   TYR A C     1 
ATOM   1388  O  O     . TYR B  2  96   ? -115.269 74.995  16.294  1.00 79.39  ?  96   TYR A O     1 
ATOM   1389  C  CB    . TYR B  2  96   ? -114.042 76.596  18.839  1.00 83.23  ?  96   TYR A CB    1 
ATOM   1390  C  CG    . TYR B  2  96   ? -113.072 76.791  19.983  1.00 86.07  ?  96   TYR A CG    1 
ATOM   1391  C  CD1   . TYR B  2  96   ? -113.524 76.871  21.294  1.00 102.75 ?  96   TYR A CD1   1 
ATOM   1392  C  CD2   . TYR B  2  96   ? -111.705 76.882  19.754  1.00 81.98  ?  96   TYR A CD2   1 
ATOM   1393  C  CE1   . TYR B  2  96   ? -112.642 77.042  22.345  1.00 98.52  ?  96   TYR A CE1   1 
ATOM   1394  C  CE2   . TYR B  2  96   ? -110.815 77.052  20.798  1.00 86.94  ?  96   TYR A CE2   1 
ATOM   1395  C  CZ    . TYR B  2  96   ? -111.289 77.132  22.092  1.00 96.38  ?  96   TYR A CZ    1 
ATOM   1396  O  OH    . TYR B  2  96   ? -110.410 77.302  23.136  1.00 99.93  ?  96   TYR A OH    1 
ATOM   1397  N  N     . LEU B  2  97   ? -116.632 74.845  18.090  1.00 77.69  ?  97   LEU A N     1 
ATOM   1398  C  CA    . LEU B  2  97   ? -117.860 74.759  17.309  1.00 78.38  ?  97   LEU A CA    1 
ATOM   1399  C  C     . LEU B  2  97   ? -118.978 75.414  18.100  1.00 91.25  ?  97   LEU A C     1 
ATOM   1400  O  O     . LEU B  2  97   ? -119.329 74.943  19.187  1.00 95.35  ?  97   LEU A O     1 
ATOM   1401  C  CB    . LEU B  2  97   ? -118.216 73.309  16.981  1.00 86.17  ?  97   LEU A CB    1 
ATOM   1402  C  CG    . LEU B  2  97   ? -119.585 73.125  16.321  1.00 84.52  ?  97   LEU A CG    1 
ATOM   1403  C  CD1   . LEU B  2  97   ? -119.669 73.938  15.036  1.00 89.33  ?  97   LEU A CD1   1 
ATOM   1404  C  CD2   . LEU B  2  97   ? -119.868 71.656  16.050  1.00 78.61  ?  97   LEU A CD2   1 
ATOM   1405  N  N     . ARG B  2  98   ? -119.533 76.494  17.557  1.00 95.11  ?  98   ARG A N     1 
ATOM   1406  C  CA    . ARG B  2  98   ? -120.634 77.214  18.184  1.00 90.79  ?  98   ARG A CA    1 
ATOM   1407  C  C     . ARG B  2  98   ? -121.717 77.432  17.139  1.00 87.05  ?  98   ARG A C     1 
ATOM   1408  O  O     . ARG B  2  98   ? -121.462 78.048  16.099  1.00 90.34  ?  98   ARG A O     1 
ATOM   1409  C  CB    . ARG B  2  98   ? -120.159 78.548  18.767  1.00 87.55  ?  98   ARG A CB    1 
ATOM   1410  C  CG    . ARG B  2  98   ? -119.015 78.408  19.759  1.00 99.19  ?  98   ARG A CG    1 
ATOM   1411  C  CD    . ARG B  2  98   ? -118.420 79.758  20.125  1.00 109.05 ?  98   ARG A CD    1 
ATOM   1412  N  NE    . ARG B  2  98   ? -117.222 79.618  20.947  1.00 121.88 ?  98   ARG A NE    1 
ATOM   1413  C  CZ    . ARG B  2  98   ? -116.425 80.627  21.288  1.00 135.45 ?  98   ARG A CZ    1 
ATOM   1414  N  NH1   . ARG B  2  98   ? -116.696 81.857  20.873  1.00 139.45 ?  98   ARG A NH1   1 
ATOM   1415  N  NH2   . ARG B  2  98   ? -115.355 80.404  22.040  1.00 133.48 ?  98   ARG A NH2   1 
ATOM   1416  N  N     . LYS B  2  99   ? -122.913 76.919  17.410  1.00 80.44  ?  99   LYS A N     1 
ATOM   1417  C  CA    . LYS B  2  99   ? -124.047 77.058  16.510  1.00 74.91  ?  99   LYS A CA    1 
ATOM   1418  C  C     . LYS B  2  99   ? -125.267 77.486  17.310  1.00 93.56  ?  99   LYS A C     1 
ATOM   1419  O  O     . LYS B  2  99   ? -125.360 77.232  18.515  1.00 103.83 ?  99   LYS A O     1 
ATOM   1420  C  CB    . LYS B  2  99   ? -124.334 75.752  15.763  1.00 88.98  ?  99   LYS A CB    1 
ATOM   1421  C  CG    . LYS B  2  99   ? -124.998 75.937  14.410  1.00 91.71  ?  99   LYS A CG    1 
ATOM   1422  C  CD    . LYS B  2  99   ? -124.124 76.762  13.480  1.00 92.79  ?  99   LYS A CD    1 
ATOM   1423  C  CE    . LYS B  2  99   ? -124.446 76.474  12.019  1.00 106.75 ?  99   LYS A CE    1 
ATOM   1424  N  NZ    . LYS B  2  99   ? -125.900 76.613  11.726  1.00 109.28 ?  99   LYS A NZ    1 
ATOM   1425  N  N     . GLN B  2  100  ? -126.206 78.139  16.629  1.00 92.92  ?  100  GLN A N     1 
ATOM   1426  C  CA    . GLN B  2  100  ? -127.363 78.720  17.293  1.00 91.79  ?  100  GLN A CA    1 
ATOM   1427  C  C     . GLN B  2  100  ? -128.527 78.795  16.318  1.00 98.99  ?  100  GLN A C     1 
ATOM   1428  O  O     . GLN B  2  100  ? -128.337 78.990  15.114  1.00 112.68 ?  100  GLN A O     1 
ATOM   1429  C  CB    . GLN B  2  100  ? -127.037 80.115  17.846  1.00 97.11  ?  100  GLN A CB    1 
ATOM   1430  C  CG    . GLN B  2  100  ? -128.245 81.013  18.061  1.00 92.42  ?  100  GLN A CG    1 
ATOM   1431  C  CD    . GLN B  2  100  ? -129.163 80.511  19.155  1.00 100.36 ?  100  GLN A CD    1 
ATOM   1432  O  OE1   . GLN B  2  100  ? -130.195 79.897  18.881  1.00 95.51  ?  100  GLN A OE1   1 
ATOM   1433  N  NE2   . GLN B  2  100  ? -128.794 80.774  20.404  1.00 111.58 ?  100  GLN A NE2   1 
ATOM   1434  N  N     . GLY B  2  101  ? -129.736 78.636  16.852  1.00 94.34  ?  101  GLY A N     1 
ATOM   1435  C  CA    . GLY B  2  101  ? -130.942 78.790  16.075  1.00 97.00  ?  101  GLY A CA    1 
ATOM   1436  C  C     . GLY B  2  101  ? -131.224 77.606  15.175  1.00 91.47  ?  101  GLY A C     1 
ATOM   1437  O  O     . GLY B  2  101  ? -130.434 76.661  15.082  1.00 101.82 ?  101  GLY A O     1 
ATOM   1438  N  N     . PRO B  2  102  ? -132.368 77.637  14.493  1.00 86.23  ?  102  PRO A N     1 
ATOM   1439  C  CA    . PRO B  2  102  ? -132.726 76.524  13.608  1.00 95.60  ?  102  PRO A CA    1 
ATOM   1440  C  C     . PRO B  2  102  ? -131.722 76.369  12.477  1.00 101.91 ?  102  PRO A C     1 
ATOM   1441  O  O     . PRO B  2  102  ? -131.157 77.343  11.976  1.00 103.70 ?  102  PRO A O     1 
ATOM   1442  C  CB    . PRO B  2  102  ? -134.112 76.917  13.082  1.00 95.70  ?  102  PRO A CB    1 
ATOM   1443  C  CG    . PRO B  2  102  ? -134.181 78.399  13.260  1.00 95.99  ?  102  PRO A CG    1 
ATOM   1444  C  CD    . PRO B  2  102  ? -133.389 78.697  14.495  1.00 92.24  ?  102  PRO A CD    1 
ATOM   1445  N  N     . GLY B  2  103  ? -131.508 75.125  12.080  1.00 101.06 ?  103  GLY A N     1 
ATOM   1446  C  CA    . GLY B  2  103  ? -130.554 74.799  11.043  1.00 113.66 ?  103  GLY A CA    1 
ATOM   1447  C  C     . GLY B  2  103  ? -129.982 73.416  11.276  1.00 106.24 ?  103  GLY A C     1 
ATOM   1448  O  O     . GLY B  2  103  ? -130.531 72.627  12.040  1.00 105.85 ?  103  GLY A O     1 
ATOM   1449  N  N     . VAL B  2  104  ? -128.867 73.142  10.602  1.00 106.87 ?  104  VAL A N     1 
ATOM   1450  C  CA    . VAL B  2  104  ? -128.181 71.859  10.698  1.00 91.96  ?  104  VAL A CA    1 
ATOM   1451  C  C     . VAL B  2  104  ? -126.707 72.128  10.957  1.00 87.52  ?  104  VAL A C     1 
ATOM   1452  O  O     . VAL B  2  104  ? -126.058 72.841  10.182  1.00 99.72  ?  104  VAL A O     1 
ATOM   1453  C  CB    . VAL B  2  104  ? -128.358 71.010  9.429   1.00 94.56  ?  104  VAL A CB    1 
ATOM   1454  C  CG1   . VAL B  2  104  ? -127.497 69.760  9.507   1.00 97.69  ?  104  VAL A CG1   1 
ATOM   1455  C  CG2   . VAL B  2  104  ? -129.821 70.641  9.236   1.00 98.00  ?  104  VAL A CG2   1 
ATOM   1456  N  N     . VAL B  2  105  ? -126.182 71.564  12.039  1.00 79.66  ?  105  VAL A N     1 
ATOM   1457  C  CA    . VAL B  2  105  ? -124.762 71.688  12.349  1.00 85.78  ?  105  VAL A CA    1 
ATOM   1458  C  C     . VAL B  2  105  ? -123.998 70.613  11.591  1.00 90.09  ?  105  VAL A C     1 
ATOM   1459  O  O     . VAL B  2  105  ? -124.354 69.429  11.639  1.00 92.14  ?  105  VAL A O     1 
ATOM   1460  C  CB    . VAL B  2  105  ? -124.521 71.580  13.863  1.00 76.75  ?  105  VAL A CB    1 
ATOM   1461  C  CG1   . VAL B  2  105  ? -123.040 71.749  14.174  1.00 70.66  ?  105  VAL A CG1   1 
ATOM   1462  C  CG2   . VAL B  2  105  ? -125.345 72.616  14.604  1.00 91.90  ?  105  VAL A CG2   1 
ATOM   1463  N  N     . THR B  2  106  ? -122.948 71.022  10.885  1.00 88.34  ?  106  THR A N     1 
ATOM   1464  C  CA    . THR B  2  106  ? -122.119 70.119  10.102  1.00 83.36  ?  106  THR A CA    1 
ATOM   1465  C  C     . THR B  2  106  ? -120.667 70.277  10.534  1.00 82.60  ?  106  THR A C     1 
ATOM   1466  O  O     . THR B  2  106  ? -120.348 71.030  11.459  1.00 89.19  ?  106  THR A O     1 
ATOM   1467  C  CB    . THR B  2  106  ? -122.271 70.387  8.598   1.00 86.46  ?  106  THR A CB    1 
ATOM   1468  O  OG1   . THR B  2  106  ? -121.939 71.753  8.320   1.00 99.38  ?  106  THR A OG1   1 
ATOM   1469  C  CG2   . THR B  2  106  ? -123.699 70.115  8.151   1.00 87.20  ?  106  THR A CG2   1 
ATOM   1470  N  N     . ALA B  2  107  ? -119.776 69.552  9.854   1.00 82.81  ?  107  ALA A N     1 
ATOM   1471  C  CA    . ALA B  2  107  ? -118.353 69.681  10.146  1.00 80.62  ?  107  ALA A CA    1 
ATOM   1472  C  C     . ALA B  2  107  ? -117.805 71.019  9.671   1.00 91.13  ?  107  ALA A C     1 
ATOM   1473  O  O     . ALA B  2  107  ? -116.829 71.524  10.239  1.00 94.03  ?  107  ALA A O     1 
ATOM   1474  C  CB    . ALA B  2  107  ? -117.579 68.529  9.506   1.00 99.31  ?  107  ALA A CB    1 
ATOM   1475  N  N     . GLY B  2  108  ? -118.412 71.606  8.638   1.00 95.65  ?  108  GLY A N     1 
ATOM   1476  C  CA    . GLY B  2  108  ? -117.967 72.911  8.179   1.00 94.41  ?  108  GLY A CA    1 
ATOM   1477  C  C     . GLY B  2  108  ? -118.097 73.979  9.248   1.00 92.79  ?  108  GLY A C     1 
ATOM   1478  O  O     . GLY B  2  108  ? -117.239 74.857  9.370   1.00 101.03 ?  108  GLY A O     1 
ATOM   1479  N  N     . ASP B  2  109  ? -119.169 73.915  10.042  1.00 83.03  ?  109  ASP A N     1 
ATOM   1480  C  CA    . ASP B  2  109  ? -119.367 74.875  11.121  1.00 82.24  ?  109  ASP A CA    1 
ATOM   1481  C  C     . ASP B  2  109  ? -118.260 74.824  12.166  1.00 87.55  ?  109  ASP A C     1 
ATOM   1482  O  O     . ASP B  2  109  ? -118.226 75.689  13.048  1.00 98.45  ?  109  ASP A O     1 
ATOM   1483  C  CB    . ASP B  2  109  ? -120.721 74.635  11.795  1.00 67.50  ?  109  ASP A CB    1 
ATOM   1484  C  CG    . ASP B  2  109  ? -121.883 74.716  10.821  1.00 95.37  ?  109  ASP A CG    1 
ATOM   1485  O  OD1   . ASP B  2  109  ? -121.851 75.581  9.922   1.00 108.08 ?  109  ASP A OD1   1 
ATOM   1486  O  OD2   . ASP B  2  109  ? -122.830 73.913  10.955  1.00 101.62 ?  109  ASP A OD2   1 
ATOM   1487  N  N     . ILE B  2  110  ? -117.365 73.844  12.094  1.00 82.89  ?  110  ILE A N     1 
ATOM   1488  C  CA    . ILE B  2  110  ? -116.271 73.729  13.052  1.00 84.96  ?  110  ILE A CA    1 
ATOM   1489  C  C     . ILE B  2  110  ? -115.135 74.637  12.602  1.00 89.67  ?  110  ILE A C     1 
ATOM   1490  O  O     . ILE B  2  110  ? -114.634 74.511  11.480  1.00 95.10  ?  110  ILE A O     1 
ATOM   1491  C  CB    . ILE B  2  110  ? -115.797 72.275  13.181  1.00 97.78  ?  110  ILE A CB    1 
ATOM   1492  C  CG1   . ILE B  2  110  ? -116.974 71.355  13.516  1.00 98.91  ?  110  ILE A CG1   1 
ATOM   1493  C  CG2   . ILE B  2  110  ? -114.711 72.163  14.242  1.00 90.62  ?  110  ILE A CG2   1 
ATOM   1494  C  CD1   . ILE B  2  110  ? -116.603 69.889  13.584  1.00 87.98  ?  110  ILE A CD1   1 
ATOM   1495  N  N     . VAL B  2  111  ? -114.729 75.556  13.474  1.00 100.51 ?  111  VAL A N     1 
ATOM   1496  C  CA    . VAL B  2  111  ? -113.652 76.495  13.184  1.00 101.84 ?  111  VAL A CA    1 
ATOM   1497  C  C     . VAL B  2  111  ? -112.331 75.820  13.567  1.00 96.66  ?  111  VAL A C     1 
ATOM   1498  O  O     . VAL B  2  111  ? -112.067 75.656  14.770  1.00 91.47  ?  111  VAL A O     1 
ATOM   1499  C  CB    . VAL B  2  111  ? -113.837 77.819  13.933  1.00 88.53  ?  111  VAL A CB    1 
ATOM   1500  C  CG1   . VAL B  2  111  ? -114.217 77.559  15.381  1.00 103.20 ?  111  VAL A CG1   1 
ATOM   1501  C  CG2   . VAL B  2  111  ? -112.568 78.655  13.854  1.00 78.85  ?  111  VAL A CG2   1 
ATOM   1502  N  N     . PRO B  2  112  ? -111.507 75.419  12.608  1.00 92.67  ?  112  PRO A N     1 
ATOM   1503  C  CA    . PRO B  2  112  ? -110.234 74.780  12.942  1.00 85.75  ?  112  PRO A CA    1 
ATOM   1504  C  C     . PRO B  2  112  ? -109.174 75.817  13.261  1.00 89.45  ?  112  PRO A C     1 
ATOM   1505  O  O     . PRO B  2  112  ? -109.064 76.841  12.569  1.00 97.55  ?  112  PRO A O     1 
ATOM   1506  C  CB    . PRO B  2  112  ? -109.889 74.007  11.663  1.00 98.60  ?  112  PRO A CB    1 
ATOM   1507  C  CG    . PRO B  2  112  ? -110.487 74.841  10.576  1.00 105.85 ?  112  PRO A CG    1 
ATOM   1508  C  CD    . PRO B  2  112  ? -111.748 75.445  11.154  1.00 97.09  ?  112  PRO A CD    1 
ATOM   1509  N  N     . PRO B  2  113  ? -108.369 75.591  14.300  1.00 80.88  ?  113  PRO A N     1 
ATOM   1510  C  CA    . PRO B  2  113  ? -107.286 76.533  14.611  1.00 85.55  ?  113  PRO A CA    1 
ATOM   1511  C  C     . PRO B  2  113  ? -106.231 76.580  13.519  1.00 97.67  ?  113  PRO A C     1 
ATOM   1512  O  O     . PRO B  2  113  ? -106.340 75.879  12.507  1.00 103.40 ?  113  PRO A O     1 
ATOM   1513  C  CB    . PRO B  2  113  ? -106.711 75.987  15.925  1.00 77.56  ?  113  PRO A CB    1 
ATOM   1514  C  CG    . PRO B  2  113  ? -107.074 74.543  15.923  1.00 91.76  ?  113  PRO A CG    1 
ATOM   1515  C  CD    . PRO B  2  113  ? -108.411 74.461  15.243  1.00 93.87  ?  113  PRO A CD    1 
ATOM   1516  N  N     . ALA B  2  114  ? -105.206 77.405  13.713  1.00 104.62 ?  114  ALA A N     1 
ATOM   1517  C  CA    . ALA B  2  114  ? -104.139 77.531  12.729  1.00 107.20 ?  114  ALA A CA    1 
ATOM   1518  C  C     . ALA B  2  114  ? -103.291 76.265  12.714  1.00 102.94 ?  114  ALA A C     1 
ATOM   1519  O  O     . ALA B  2  114  ? -102.719 75.879  13.739  1.00 96.42  ?  114  ALA A O     1 
ATOM   1520  C  CB    . ALA B  2  114  ? -103.277 78.753  13.038  1.00 94.66  ?  114  ALA A CB    1 
ATOM   1521  N  N     . GLY B  2  115  ? -103.210 75.618  11.554  1.00 99.87  ?  115  GLY A N     1 
ATOM   1522  C  CA    . GLY B  2  115  ? -102.420 74.414  11.385  1.00 103.56 ?  115  GLY A CA    1 
ATOM   1523  C  C     . GLY B  2  115  ? -103.224 73.145  11.216  1.00 102.90 ?  115  GLY A C     1 
ATOM   1524  O  O     . GLY B  2  115  ? -102.648 72.114  10.844  1.00 98.62  ?  115  GLY A O     1 
ATOM   1525  N  N     . VAL B  2  116  ? -104.530 73.179  11.477  1.00 92.13  ?  116  VAL A N     1 
ATOM   1526  C  CA    . VAL B  2  116  ? -105.390 72.015  11.323  1.00 84.09  ?  116  VAL A CA    1 
ATOM   1527  C  C     . VAL B  2  116  ? -106.435 72.320  10.258  1.00 90.44  ?  116  VAL A C     1 
ATOM   1528  O  O     . VAL B  2  116  ? -106.677 73.475  9.900   1.00 106.49 ?  116  VAL A O     1 
ATOM   1529  C  CB    . VAL B  2  116  ? -106.067 71.608  12.648  1.00 83.82  ?  116  VAL A CB    1 
ATOM   1530  C  CG1   . VAL B  2  116  ? -105.070 71.674  13.797  1.00 81.54  ?  116  VAL A CG1   1 
ATOM   1531  C  CG2   . VAL B  2  116  ? -107.273 72.491  12.921  1.00 97.19  ?  116  VAL A CG2   1 
ATOM   1532  N  N     . THR B  2  117  ? -107.063 71.259  9.755   1.00 87.27  ?  117  THR A N     1 
ATOM   1533  C  CA    . THR B  2  117  ? -108.038 71.389  8.682   1.00 96.60  ?  117  THR A CA    1 
ATOM   1534  C  C     . THR B  2  117  ? -109.030 70.237  8.742   1.00 95.88  ?  117  THR A C     1 
ATOM   1535  O  O     . THR B  2  117  ? -108.662 69.105  9.066   1.00 99.78  ?  117  THR A O     1 
ATOM   1536  C  CB    . THR B  2  117  ? -107.356 71.419  7.309   1.00 93.57  ?  117  THR A CB    1 
ATOM   1537  O  OG1   . THR B  2  117  ? -108.282 70.990  6.303   1.00 97.77  ?  117  THR A OG1   1 
ATOM   1538  C  CG2   . THR B  2  117  ? -106.135 70.512  7.300   1.00 82.92  ?  117  THR A CG2   1 
ATOM   1539  N  N     . VAL B  2  118  ? -110.286 70.540  8.426   1.00 95.34  ?  118  VAL A N     1 
ATOM   1540  C  CA    . VAL B  2  118  ? -111.357 69.551  8.372   1.00 84.94  ?  118  VAL A CA    1 
ATOM   1541  C  C     . VAL B  2  118  ? -111.619 69.227  6.908   1.00 98.02  ?  118  VAL A C     1 
ATOM   1542  O  O     . VAL B  2  118  ? -111.919 70.124  6.110   1.00 114.18 ?  118  VAL A O     1 
ATOM   1543  C  CB    . VAL B  2  118  ? -112.628 70.062  9.068   1.00 86.98  ?  118  VAL A CB    1 
ATOM   1544  C  CG1   . VAL B  2  118  ? -113.746 69.035  8.952   1.00 107.87 ?  118  VAL A CG1   1 
ATOM   1545  C  CG2   . VAL B  2  118  ? -112.337 70.382  10.529  1.00 61.34  ?  118  VAL A CG2   1 
ATOM   1546  N  N     . HIS B  2  119  ? -111.509 67.947  6.554   1.00 91.62  ?  119  HIS A N     1 
ATOM   1547  C  CA    . HIS B  2  119  ? -111.527 67.518  5.162   1.00 101.12 ?  119  HIS A CA    1 
ATOM   1548  C  C     . HIS B  2  119  ? -112.893 67.024  4.698   1.00 101.43 ?  119  HIS A C     1 
ATOM   1549  O  O     . HIS B  2  119  ? -113.007 66.531  3.570   1.00 113.29 ?  119  HIS A O     1 
ATOM   1550  C  CB    . HIS B  2  119  ? -110.477 66.425  4.941   1.00 96.49  ?  119  HIS A CB    1 
ATOM   1551  C  CG    . HIS B  2  119  ? -109.069 66.888  5.155   1.00 91.77  ?  119  HIS A CG    1 
ATOM   1552  N  ND1   . HIS B  2  119  ? -108.407 67.700  4.259   1.00 105.15 ?  119  HIS A ND1   1 
ATOM   1553  C  CD2   . HIS B  2  119  ? -108.195 66.650  6.161   1.00 96.80  ?  119  HIS A CD2   1 
ATOM   1554  C  CE1   . HIS B  2  119  ? -107.188 67.944  4.705   1.00 107.29 ?  119  HIS A CE1   1 
ATOM   1555  N  NE2   . HIS B  2  119  ? -107.034 67.318  5.857   1.00 89.60  ?  119  HIS A NE2   1 
ATOM   1556  N  N     . ASN B  2  120  ? -113.931 67.144  5.528   1.00 76.45  ?  120  ASN A N     1 
ATOM   1557  C  CA    . ASN B  2  120  ? -115.283 66.719  5.155   1.00 94.23  ?  120  ASN A CA    1 
ATOM   1558  C  C     . ASN B  2  120  ? -116.298 67.634  5.828   1.00 107.51 ?  120  ASN A C     1 
ATOM   1559  O  O     . ASN B  2  120  ? -117.074 67.209  6.693   1.00 111.33 ?  120  ASN A O     1 
ATOM   1560  C  CB    . ASN B  2  120  ? -115.520 65.257  5.533   1.00 112.06 ?  120  ASN A CB    1 
ATOM   1561  C  CG    . ASN B  2  120  ? -115.305 64.990  7.012   1.00 110.91 ?  120  ASN A CG    1 
ATOM   1562  O  OD1   . ASN B  2  120  ? -114.566 65.709  7.684   1.00 99.77  ?  120  ASN A OD1   1 
ATOM   1563  N  ND2   . ASN B  2  120  ? -115.948 63.945  7.525   1.00 106.37 ?  120  ASN A ND2   1 
ATOM   1564  N  N     . PRO B  2  121  ? -116.319 68.913  5.448   1.00 104.34 ?  121  PRO A N     1 
ATOM   1565  C  CA    . PRO B  2  121  ? -117.257 69.854  6.084   1.00 99.23  ?  121  PRO A CA    1 
ATOM   1566  C  C     . PRO B  2  121  ? -118.716 69.501  5.862   1.00 100.73 ?  121  PRO A C     1 
ATOM   1567  O  O     . PRO B  2  121  ? -119.575 69.994  6.604   1.00 102.21 ?  121  PRO A O     1 
ATOM   1568  C  CB    . PRO B  2  121  ? -116.904 71.199  5.431   1.00 82.74  ?  121  PRO A CB    1 
ATOM   1569  C  CG    . PRO B  2  121  ? -115.523 71.013  4.874   1.00 100.53 ?  121  PRO A CG    1 
ATOM   1570  C  CD    . PRO B  2  121  ? -115.453 69.576  4.460   1.00 100.13 ?  121  PRO A CD    1 
ATOM   1571  N  N     . ASP B  2  122  ? -119.027 68.668  4.871   1.00 97.12  ?  122  ASP A N     1 
ATOM   1572  C  CA    . ASP B  2  122  ? -120.408 68.335  4.549   1.00 95.96  ?  122  ASP A CA    1 
ATOM   1573  C  C     . ASP B  2  122  ? -121.008 67.295  5.487   1.00 97.77  ?  122  ASP A C     1 
ATOM   1574  O  O     . ASP B  2  122  ? -122.182 66.942  5.323   1.00 93.02  ?  122  ASP A O     1 
ATOM   1575  C  CB    . ASP B  2  122  ? -120.498 67.839  3.102   1.00 114.41 ?  122  ASP A CB    1 
ATOM   1576  C  CG    . ASP B  2  122  ? -121.903 67.931  2.538   1.00 117.43 ?  122  ASP A CG    1 
ATOM   1577  O  OD1   . ASP B  2  122  ? -122.605 68.917  2.846   1.00 114.21 ?  122  ASP A OD1   1 
ATOM   1578  O  OD2   . ASP B  2  122  ? -122.304 67.018  1.786   1.00 122.21 ?  122  ASP A OD2   1 
ATOM   1579  N  N     . MET B  2  123  ? -120.247 66.797  6.458   1.00 96.64  ?  123  MET A N     1 
ATOM   1580  C  CA    . MET B  2  123  ? -120.765 65.777  7.358   1.00 93.46  ?  123  MET A CA    1 
ATOM   1581  C  C     . MET B  2  123  ? -121.787 66.372  8.317   1.00 98.47  ?  123  MET A C     1 
ATOM   1582  O  O     . MET B  2  123  ? -121.645 67.507  8.780   1.00 101.48 ?  123  MET A O     1 
ATOM   1583  C  CB    . MET B  2  123  ? -119.632 65.129  8.149   1.00 100.81 ?  123  MET A CB    1 
ATOM   1584  C  CG    . MET B  2  123  ? -120.116 64.122  9.185   1.00 95.32  ?  123  MET A CG    1 
ATOM   1585  S  SD    . MET B  2  123  ? -118.780 63.421  10.171  1.00 109.40 ?  123  MET A SD    1 
ATOM   1586  C  CE    . MET B  2  123  ? -118.098 64.902  10.911  1.00 91.89  ?  123  MET A CE    1 
ATOM   1587  N  N     . HIS B  2  124  ? -122.819 65.590  8.620   1.00 95.78  ?  124  HIS A N     1 
ATOM   1588  C  CA    . HIS B  2  124  ? -123.859 66.002  9.551   1.00 89.31  ?  124  HIS A CA    1 
ATOM   1589  C  C     . HIS B  2  124  ? -123.452 65.639  10.973  1.00 82.20  ?  124  HIS A C     1 
ATOM   1590  O  O     . HIS B  2  124  ? -123.032 64.507  11.236  1.00 94.72  ?  124  HIS A O     1 
ATOM   1591  C  CB    . HIS B  2  124  ? -125.192 65.343  9.195   1.00 85.35  ?  124  HIS A CB    1 
ATOM   1592  C  CG    . HIS B  2  124  ? -126.229 65.464  10.266  1.00 86.41  ?  124  HIS A CG    1 
ATOM   1593  N  ND1   . HIS B  2  124  ? -126.304 64.593  11.331  1.00 98.72  ?  124  HIS A ND1   1 
ATOM   1594  C  CD2   . HIS B  2  124  ? -127.236 66.354  10.438  1.00 94.07  ?  124  HIS A CD2   1 
ATOM   1595  C  CE1   . HIS B  2  124  ? -127.311 64.940  12.112  1.00 94.24  ?  124  HIS A CE1   1 
ATOM   1596  N  NE2   . HIS B  2  124  ? -127.892 66.006  11.593  1.00 98.90  ?  124  HIS A NE2   1 
ATOM   1597  N  N     . ILE B  2  125  ? -123.575 66.601  11.885  1.00 86.30  ?  125  ILE A N     1 
ATOM   1598  C  CA    . ILE B  2  125  ? -123.289 66.397  13.304  1.00 78.37  ?  125  ILE A CA    1 
ATOM   1599  C  C     . ILE B  2  125  ? -124.575 66.361  14.122  1.00 82.41  ?  125  ILE A C     1 
ATOM   1600  O  O     . ILE B  2  125  ? -124.865 65.373  14.799  1.00 96.80  ?  125  ILE A O     1 
ATOM   1601  C  CB    . ILE B  2  125  ? -122.317 67.472  13.839  1.00 77.69  ?  125  ILE A CB    1 
ATOM   1602  C  CG1   . ILE B  2  125  ? -120.927 67.300  13.227  1.00 76.93  ?  125  ILE A CG1   1 
ATOM   1603  C  CG2   . ILE B  2  125  ? -122.251 67.421  15.358  1.00 58.22  ?  125  ILE A CG2   1 
ATOM   1604  C  CD1   . ILE B  2  125  ? -119.885 68.218  13.832  1.00 54.62  ?  125  ILE A CD1   1 
ATOM   1605  N  N     . ALA B  2  126  ? -125.360 67.435  14.075  1.00 82.14  ?  126  ALA A N     1 
ATOM   1606  C  CA    . ALA B  2  126  ? -126.590 67.520  14.844  1.00 83.34  ?  126  ALA A CA    1 
ATOM   1607  C  C     . ALA B  2  126  ? -127.535 68.499  14.166  1.00 91.11  ?  126  ALA A C     1 
ATOM   1608  O  O     . ALA B  2  126  ? -127.113 69.378  13.410  1.00 99.97  ?  126  ALA A O     1 
ATOM   1609  C  CB    . ALA B  2  126  ? -126.322 67.949  16.291  1.00 80.72  ?  126  ALA A CB    1 
ATOM   1610  N  N     . THR B  2  127  ? -128.824 68.333  14.446  1.00 83.45  ?  127  THR A N     1 
ATOM   1611  C  CA    . THR B  2  127  ? -129.868 69.198  13.911  1.00 88.18  ?  127  THR A CA    1 
ATOM   1612  C  C     . THR B  2  127  ? -130.453 70.017  15.054  1.00 98.08  ?  127  THR A C     1 
ATOM   1613  O  O     . THR B  2  127  ? -130.969 69.453  16.025  1.00 102.33 ?  127  THR A O     1 
ATOM   1614  C  CB    . THR B  2  127  ? -130.959 68.382  13.217  1.00 81.48  ?  127  THR A CB    1 
ATOM   1615  O  OG1   . THR B  2  127  ? -132.162 68.432  13.994  1.00 87.77  ?  127  THR A OG1   1 
ATOM   1616  C  CG2   . THR B  2  127  ? -130.523 66.932  13.068  1.00 89.12  ?  127  THR A CG2   1 
ATOM   1617  N  N     . LEU B  2  128  ? -130.366 71.338  14.939  1.00 98.33  ?  128  LEU A N     1 
ATOM   1618  C  CA    . LEU B  2  128  ? -130.861 72.253  15.956  1.00 93.95  ?  128  LEU A CA    1 
ATOM   1619  C  C     . LEU B  2  128  ? -132.152 72.913  15.492  1.00 95.70  ?  128  LEU A C     1 
ATOM   1620  O  O     . LEU B  2  128  ? -132.384 73.095  14.294  1.00 100.95 ?  128  LEU A O     1 
ATOM   1621  C  CB    . LEU B  2  128  ? -129.820 73.327  16.287  1.00 86.38  ?  128  LEU A CB    1 
ATOM   1622  C  CG    . LEU B  2  128  ? -128.677 72.914  17.219  1.00 86.95  ?  128  LEU A CG    1 
ATOM   1623  C  CD1   . LEU B  2  128  ? -127.900 71.743  16.643  1.00 91.06  ?  128  LEU A CD1   1 
ATOM   1624  C  CD2   . LEU B  2  128  ? -127.754 74.092  17.496  1.00 86.48  ?  128  LEU A CD2   1 
ATOM   1625  N  N     . ASN B  2  129  ? -132.993 73.271  16.461  1.00 93.06  ?  129  ASN A N     1 
ATOM   1626  C  CA    . ASN B  2  129  ? -134.254 73.945  16.216  1.00 90.40  ?  129  ASN A CA    1 
ATOM   1627  C  C     . ASN B  2  129  ? -134.194 75.357  16.806  1.00 98.44  ?  129  ASN A C     1 
ATOM   1628  O  O     . ASN B  2  129  ? -133.104 75.901  17.039  1.00 103.45 ?  129  ASN A O     1 
ATOM   1629  C  CB    . ASN B  2  129  ? -135.399 73.102  16.789  1.00 90.78  ?  129  ASN A CB    1 
ATOM   1630  C  CG    . ASN B  2  129  ? -135.473 73.165  18.303  1.00 82.79  ?  129  ASN A CG    1 
ATOM   1631  O  OD1   . ASN B  2  129  ? -136.557 73.131  18.883  1.00 97.41  ?  129  ASN A OD1   1 
ATOM   1632  N  ND2   . ASN B  2  129  ? -134.321 73.266  18.950  1.00 94.96  ?  129  ASN A ND2   1 
ATOM   1633  N  N     . ASP B  2  130  ? -135.364 75.947  17.054  1.00 103.46 ?  130  ASP A N     1 
ATOM   1634  C  CA    . ASP B  2  130  ? -135.414 77.312  17.568  1.00 99.83  ?  130  ASP A CA    1 
ATOM   1635  C  C     . ASP B  2  130  ? -134.685 77.424  18.902  1.00 96.12  ?  130  ASP A C     1 
ATOM   1636  O  O     . ASP B  2  130  ? -133.851 78.318  19.094  1.00 93.78  ?  130  ASP A O     1 
ATOM   1637  C  CB    . ASP B  2  130  ? -136.868 77.762  17.705  1.00 97.21  ?  130  ASP A CB    1 
ATOM   1638  C  CG    . ASP B  2  130  ? -137.622 77.698  16.391  1.00 114.78 ?  130  ASP A CG    1 
ATOM   1639  O  OD1   . ASP B  2  130  ? -137.209 76.920  15.505  1.00 111.41 ?  130  ASP A OD1   1 
ATOM   1640  O  OD2   . ASP B  2  130  ? -138.627 78.424  16.244  1.00 128.15 ?  130  ASP A OD2   1 
ATOM   1641  N  N     . LYS B  2  131  ? -134.983 76.522  19.834  1.00 81.60  ?  131  LYS A N     1 
ATOM   1642  C  CA    . LYS B  2  131  ? -134.395 76.555  21.166  1.00 80.27  ?  131  LYS A CA    1 
ATOM   1643  C  C     . LYS B  2  131  ? -133.059 75.824  21.244  1.00 84.74  ?  131  LYS A C     1 
ATOM   1644  O  O     . LYS B  2  131  ? -132.514 75.670  22.342  1.00 85.46  ?  131  LYS A O     1 
ATOM   1645  C  CB    . LYS B  2  131  ? -135.372 75.953  22.182  1.00 61.26  ?  131  LYS A CB    1 
ATOM   1646  C  CG    . LYS B  2  131  ? -136.760 76.570  22.140  1.00 66.00  ?  131  LYS A CG    1 
ATOM   1647  C  CD    . LYS B  2  131  ? -137.721 75.849  23.072  1.00 72.19  ?  131  LYS A CD    1 
ATOM   1648  C  CE    . LYS B  2  131  ? -139.146 76.367  22.920  1.00 84.30  ?  131  LYS A CE    1 
ATOM   1649  N  NZ    . LYS B  2  131  ? -140.111 75.585  23.748  1.00 96.60  ?  131  LYS A NZ    1 
ATOM   1650  N  N     . GLY B  2  132  ? -132.522 75.375  20.112  1.00 82.84  ?  132  GLY A N     1 
ATOM   1651  C  CA    . GLY B  2  132  ? -131.291 74.609  20.107  1.00 82.58  ?  132  GLY A CA    1 
ATOM   1652  C  C     . GLY B  2  132  ? -130.037 75.455  20.036  1.00 88.65  ?  132  GLY A C     1 
ATOM   1653  O  O     . GLY B  2  132  ? -129.854 76.239  19.100  1.00 97.78  ?  132  GLY A O     1 
ATOM   1654  N  N     . LYS B  2  133  ? -129.166 75.303  21.031  1.00 78.35  ?  133  LYS A N     1 
ATOM   1655  C  CA    . LYS B  2  133  ? -127.878 75.980  21.075  1.00 82.39  ?  133  LYS A CA    1 
ATOM   1656  C  C     . LYS B  2  133  ? -126.806 74.964  21.430  1.00 90.10  ?  133  LYS A C     1 
ATOM   1657  O  O     . LYS B  2  133  ? -126.927 74.259  22.437  1.00 94.48  ?  133  LYS A O     1 
ATOM   1658  C  CB    . LYS B  2  133  ? -127.882 77.120  22.096  1.00 92.59  ?  133  LYS A CB    1 
ATOM   1659  C  CG    . LYS B  2  133  ? -126.494 77.585  22.496  1.00 88.39  ?  133  LYS A CG    1 
ATOM   1660  C  CD    . LYS B  2  133  ? -126.530 78.358  23.805  1.00 107.69 ?  133  LYS A CD    1 
ATOM   1661  C  CE    . LYS B  2  133  ? -125.128 78.688  24.290  1.00 118.10 ?  133  LYS A CE    1 
ATOM   1662  N  NZ    . LYS B  2  133  ? -124.404 79.558  23.324  1.00 120.57 ?  133  LYS A NZ    1 
ATOM   1663  N  N     . LEU B  2  134  ? -125.757 74.893  20.612  1.00 89.77  ?  134  LEU A N     1 
ATOM   1664  C  CA    . LEU B  2  134  ? -124.705 73.894  20.779  1.00 86.17  ?  134  LEU A CA    1 
ATOM   1665  C  C     . LEU B  2  134  ? -123.345 74.577  20.750  1.00 89.10  ?  134  LEU A C     1 
ATOM   1666  O  O     . LEU B  2  134  ? -122.918 75.079  19.704  1.00 85.40  ?  134  LEU A O     1 
ATOM   1667  C  CB    . LEU B  2  134  ? -124.796 72.819  19.697  1.00 88.48  ?  134  LEU A CB    1 
ATOM   1668  C  CG    . LEU B  2  134  ? -123.825 71.648  19.848  1.00 96.78  ?  134  LEU A CG    1 
ATOM   1669  C  CD1   . LEU B  2  134  ? -123.924 71.055  21.244  1.00 91.25  ?  134  LEU A CD1   1 
ATOM   1670  C  CD2   . LEU B  2  134  ? -124.100 70.587  18.792  1.00 89.25  ?  134  LEU A CD2   1 
ATOM   1671  N  N     . GLU B  2  135  ? -122.667 74.594  21.895  1.00 91.40  ?  135  GLU A N     1 
ATOM   1672  C  CA    . GLU B  2  135  ? -121.289 75.060  22.003  1.00 95.07  ?  135  GLU A CA    1 
ATOM   1673  C  C     . GLU B  2  135  ? -120.426 73.881  22.421  1.00 90.48  ?  135  GLU A C     1 
ATOM   1674  O  O     . GLU B  2  135  ? -120.621 73.321  23.506  1.00 90.00  ?  135  GLU A O     1 
ATOM   1675  C  CB    . GLU B  2  135  ? -121.157 76.200  23.015  1.00 112.15 ?  135  GLU A CB    1 
ATOM   1676  C  CG    . GLU B  2  135  ? -121.866 77.481  22.629  1.00 114.64 ?  135  GLU A CG    1 
ATOM   1677  C  CD    . GLU B  2  135  ? -121.499 78.632  23.544  1.00 125.38 ?  135  GLU A CD    1 
ATOM   1678  O  OE1   . GLU B  2  135  ? -120.480 78.523  24.259  1.00 119.23 ?  135  GLU A OE1   1 
ATOM   1679  O  OE2   . GLU B  2  135  ? -122.229 79.645  23.550  1.00 143.21 ?  135  GLU A OE2   1 
ATOM   1680  N  N     . VAL B  2  136  ? -119.477 73.508  21.569  1.00 90.73  ?  136  VAL A N     1 
ATOM   1681  C  CA    . VAL B  2  136  ? -118.648 72.332  21.814  1.00 92.25  ?  136  VAL A CA    1 
ATOM   1682  C  C     . VAL B  2  136  ? -117.261 72.576  21.243  1.00 85.81  ?  136  VAL A C     1 
ATOM   1683  O  O     . VAL B  2  136  ? -117.115 72.963  20.080  1.00 88.16  ?  136  VAL A O     1 
ATOM   1684  C  CB    . VAL B  2  136  ? -119.270 71.057  21.209  1.00 81.04  ?  136  VAL A CB    1 
ATOM   1685  C  CG1   . VAL B  2  136  ? -119.788 71.332  19.806  1.00 78.74  ?  136  VAL A CG1   1 
ATOM   1686  C  CG2   . VAL B  2  136  ? -118.247 69.935  21.187  1.00 82.18  ?  136  VAL A CG2   1 
ATOM   1687  N  N     . GLU B  2  137  ? -116.243 72.351  22.067  1.00 82.45  ?  137  GLU A N     1 
ATOM   1688  C  CA    . GLU B  2  137  ? -114.852 72.405  21.650  1.00 89.66  ?  137  GLU A CA    1 
ATOM   1689  C  C     . GLU B  2  137  ? -114.287 70.993  21.574  1.00 85.08  ?  137  GLU A C     1 
ATOM   1690  O  O     . GLU B  2  137  ? -114.678 70.108  22.341  1.00 83.46  ?  137  GLU A O     1 
ATOM   1691  C  CB    . GLU B  2  137  ? -114.020 73.257  22.613  1.00 87.12  ?  137  GLU A CB    1 
ATOM   1692  C  CG    . GLU B  2  137  ? -114.455 73.151  24.063  1.00 92.72  ?  137  GLU A CG    1 
ATOM   1693  C  CD    . GLU B  2  137  ? -113.580 73.966  24.994  1.00 104.56 ?  137  GLU A CD    1 
ATOM   1694  O  OE1   . GLU B  2  137  ? -112.340 73.856  24.893  1.00 109.85 ?  137  GLU A OE1   1 
ATOM   1695  O  OE2   . GLU B  2  137  ? -114.132 74.720  25.823  1.00 105.17 ?  137  GLU A OE2   1 
ATOM   1696  N  N     . LEU B  2  138  ? -113.363 70.786  20.638  1.00 80.42  ?  138  LEU A N     1 
ATOM   1697  C  CA    . LEU B  2  138  ? -112.826 69.463  20.354  1.00 66.09  ?  138  LEU A CA    1 
ATOM   1698  C  C     . LEU B  2  138  ? -111.306 69.520  20.355  1.00 70.16  ?  138  LEU A C     1 
ATOM   1699  O  O     . LEU B  2  138  ? -110.711 70.349  19.659  1.00 88.63  ?  138  LEU A O     1 
ATOM   1700  C  CB    . LEU B  2  138  ? -113.340 68.940  19.007  1.00 60.30  ?  138  LEU A CB    1 
ATOM   1701  C  CG    . LEU B  2  138  ? -114.859 68.958  18.804  1.00 59.97  ?  138  LEU A CG    1 
ATOM   1702  C  CD1   . LEU B  2  138  ? -115.368 70.363  18.520  1.00 71.67  ?  138  LEU A CD1   1 
ATOM   1703  C  CD2   . LEU B  2  138  ? -115.272 68.004  17.693  1.00 71.12  ?  138  LEU A CD2   1 
ATOM   1704  N  N     . VAL B  2  139  ? -110.685 68.641  21.134  1.00 65.39  ?  139  VAL A N     1 
ATOM   1705  C  CA    . VAL B  2  139  ? -109.232 68.571  21.233  1.00 69.98  ?  139  VAL A CA    1 
ATOM   1706  C  C     . VAL B  2  139  ? -108.721 67.593  20.183  1.00 72.91  ?  139  VAL A C     1 
ATOM   1707  O  O     . VAL B  2  139  ? -109.082 66.412  20.195  1.00 79.64  ?  139  VAL A O     1 
ATOM   1708  C  CB    . VAL B  2  139  ? -108.792 68.146  22.641  1.00 73.43  ?  139  VAL A CB    1 
ATOM   1709  C  CG1   . VAL B  2  139  ? -107.273 68.091  22.731  1.00 76.03  ?  139  VAL A CG1   1 
ATOM   1710  C  CG2   . VAL B  2  139  ? -109.362 69.095  23.682  1.00 76.63  ?  139  VAL A CG2   1 
ATOM   1711  N  N     . VAL B  2  140  ? -107.877 68.083  19.278  1.00 80.30  ?  140  VAL A N     1 
ATOM   1712  C  CA    . VAL B  2  140  ? -107.315 67.279  18.199  1.00 72.96  ?  140  VAL A CA    1 
ATOM   1713  C  C     . VAL B  2  140  ? -105.873 66.937  18.540  1.00 80.25  ?  140  VAL A C     1 
ATOM   1714  O  O     . VAL B  2  140  ? -105.080 67.821  18.891  1.00 91.23  ?  140  VAL A O     1 
ATOM   1715  C  CB    . VAL B  2  140  ? -107.400 68.014  16.850  1.00 69.94  ?  140  VAL A CB    1 
ATOM   1716  C  CG1   . VAL B  2  140  ? -106.557 67.303  15.806  1.00 69.19  ?  140  VAL A CG1   1 
ATOM   1717  C  CG2   . VAL B  2  140  ? -108.846 68.108  16.390  1.00 76.08  ?  140  VAL A CG2   1 
ATOM   1718  N  N     . GLU B  2  141  ? -105.533 65.657  18.436  1.00 82.65  ?  141  GLU A N     1 
ATOM   1719  C  CA    . GLU B  2  141  ? -104.188 65.162  18.685  1.00 77.13  ?  141  GLU A CA    1 
ATOM   1720  C  C     . GLU B  2  141  ? -103.699 64.391  17.464  1.00 89.74  ?  141  GLU A C     1 
ATOM   1721  O  O     . GLU B  2  141  ? -104.457 64.110  16.529  1.00 83.96  ?  141  GLU A O     1 
ATOM   1722  C  CB    . GLU B  2  141  ? -104.152 64.276  19.937  1.00 80.14  ?  141  GLU A CB    1 
ATOM   1723  C  CG    . GLU B  2  141  ? -103.190 64.761  21.013  1.00 99.05  ?  141  GLU A CG    1 
ATOM   1724  C  CD    . GLU B  2  141  ? -103.514 64.199  22.385  1.00 99.76  ?  141  GLU A CD    1 
ATOM   1725  O  OE1   . GLU B  2  141  ? -104.682 63.817  22.611  1.00 94.91  ?  141  GLU A OE1   1 
ATOM   1726  O  OE2   . GLU B  2  141  ? -102.602 64.142  23.238  1.00 103.09 ?  141  GLU A OE2   1 
ATOM   1727  N  N     . ARG B  2  142  ? -102.414 64.050  17.476  1.00 93.78  ?  142  ARG A N     1 
ATOM   1728  C  CA    . ARG B  2  142  ? -101.782 63.352  16.365  1.00 89.93  ?  142  ARG A CA    1 
ATOM   1729  C  C     . ARG B  2  142  ? -101.246 62.014  16.855  1.00 94.80  ?  142  ARG A C     1 
ATOM   1730  O  O     . ARG B  2  142  ? -100.462 61.965  17.809  1.00 94.85  ?  142  ARG A O     1 
ATOM   1731  C  CB    . ARG B  2  142  ? -100.659 64.195  15.750  1.00 100.38 ?  142  ARG A CB    1 
ATOM   1732  C  CG    . ARG B  2  142  ? -100.061 63.583  14.494  1.00 113.96 ?  142  ARG A CG    1 
ATOM   1733  C  CD    . ARG B  2  142  ? -99.184  64.561  13.736  1.00 103.17 ?  142  ARG A CD    1 
ATOM   1734  N  NE    . ARG B  2  142  ? -98.811  64.019  12.433  1.00 111.29 ?  142  ARG A NE    1 
ATOM   1735  C  CZ    . ARG B  2  142  ? -98.049  64.651  11.547  1.00 130.36 ?  142  ARG A CZ    1 
ATOM   1736  N  NH1   . ARG B  2  142  ? -97.573  65.857  11.821  1.00 125.38 ?  142  ARG A NH1   1 
ATOM   1737  N  NH2   . ARG B  2  142  ? -97.764  64.076  10.386  1.00 140.49 ?  142  ARG A NH2   1 
ATOM   1738  N  N     . GLY B  2  143  ? -101.667 60.942  16.203  1.00 96.20  ?  143  GLY A N     1 
ATOM   1739  C  CA    . GLY B  2  143  ? -101.209 59.614  16.537  1.00 84.85  ?  143  GLY A CA    1 
ATOM   1740  C  C     . GLY B  2  143  ? -101.364 58.679  15.361  1.00 80.60  ?  143  GLY A C     1 
ATOM   1741  O  O     . GLY B  2  143  ? -101.450 59.110  14.210  1.00 87.07  ?  143  GLY A O     1 
ATOM   1742  N  N     . ARG B  2  144  ? -101.404 57.383  15.662  1.00 86.75  ?  144  ARG A N     1 
ATOM   1743  C  CA    . ARG B  2  144  ? -101.577 56.373  14.629  1.00 87.08  ?  144  ARG A CA    1 
ATOM   1744  C  C     . ARG B  2  144  ? -102.395 55.218  15.185  1.00 82.36  ?  144  ARG A C     1 
ATOM   1745  O  O     . ARG B  2  144  ? -102.444 54.987  16.396  1.00 75.14  ?  144  ARG A O     1 
ATOM   1746  C  CB    . ARG B  2  144  ? -100.228 55.868  14.099  1.00 93.15  ?  144  ARG A CB    1 
ATOM   1747  C  CG    . ARG B  2  144  ? -99.385  55.134  15.130  1.00 97.43  ?  144  ARG A CG    1 
ATOM   1748  C  CD    . ARG B  2  144  ? -98.069  54.660  14.532  1.00 101.51 ?  144  ARG A CD    1 
ATOM   1749  N  NE    . ARG B  2  144  ? -97.229  53.989  15.520  1.00 105.42 ?  144  ARG A NE    1 
ATOM   1750  C  CZ    . ARG B  2  144  ? -96.407  54.620  16.351  1.00 115.13 ?  144  ARG A CZ    1 
ATOM   1751  N  NH1   . ARG B  2  144  ? -96.313  55.943  16.318  1.00 111.63 ?  144  ARG A NH1   1 
ATOM   1752  N  NH2   . ARG B  2  144  ? -95.678  53.930  17.218  1.00 114.44 ?  144  ARG A NH2   1 
ATOM   1753  N  N     . GLY B  2  145  ? -103.042 54.489  14.277  1.00 76.38  ?  145  GLY A N     1 
ATOM   1754  C  CA    . GLY B  2  145  ? -103.842 53.354  14.691  1.00 80.96  ?  145  GLY A CA    1 
ATOM   1755  C  C     . GLY B  2  145  ? -105.128 53.776  15.382  1.00 75.39  ?  145  GLY A C     1 
ATOM   1756  O  O     . GLY B  2  145  ? -105.727 54.810  15.075  1.00 86.57  ?  145  GLY A O     1 
ATOM   1757  N  N     . TYR B  2  146  ? -105.558 52.952  16.335  1.00 80.20  ?  146  TYR A N     1 
ATOM   1758  C  CA    . TYR B  2  146  ? -106.776 53.193  17.101  1.00 71.41  ?  146  TYR A CA    1 
ATOM   1759  C  C     . TYR B  2  146  ? -106.442 53.119  18.582  1.00 72.94  ?  146  TYR A C     1 
ATOM   1760  O  O     . TYR B  2  146  ? -105.906 52.109  19.049  1.00 88.92  ?  146  TYR A O     1 
ATOM   1761  C  CB    . TYR B  2  146  ? -107.865 52.177  16.741  1.00 70.99  ?  146  TYR A CB    1 
ATOM   1762  C  CG    . TYR B  2  146  ? -108.983 52.085  17.755  1.00 75.89  ?  146  TYR A CG    1 
ATOM   1763  C  CD1   . TYR B  2  146  ? -108.957 51.126  18.759  1.00 85.84  ?  146  TYR A CD1   1 
ATOM   1764  C  CD2   . TYR B  2  146  ? -110.063 52.954  17.711  1.00 84.69  ?  146  TYR A CD2   1 
ATOM   1765  C  CE1   . TYR B  2  146  ? -109.974 51.036  19.690  1.00 76.31  ?  146  TYR A CE1   1 
ATOM   1766  C  CE2   . TYR B  2  146  ? -111.087 52.869  18.638  1.00 82.16  ?  146  TYR A CE2   1 
ATOM   1767  C  CZ    . TYR B  2  146  ? -111.035 51.909  19.624  1.00 73.58  ?  146  TYR A CZ    1 
ATOM   1768  O  OH    . TYR B  2  146  ? -112.049 51.821  20.549  1.00 84.62  ?  146  TYR A OH    1 
ATOM   1769  N  N     . VAL B  2  147  ? -106.754 54.182  19.315  1.00 72.94  ?  147  VAL A N     1 
ATOM   1770  C  CA    . VAL B  2  147  ? -106.516 54.261  20.750  1.00 79.17  ?  147  VAL A CA    1 
ATOM   1771  C  C     . VAL B  2  147  ? -107.867 54.391  21.439  1.00 85.37  ?  147  VAL A C     1 
ATOM   1772  O  O     . VAL B  2  147  ? -108.655 55.265  21.072  1.00 82.21  ?  147  VAL A O     1 
ATOM   1773  C  CB    . VAL B  2  147  ? -105.604 55.439  21.135  1.00 77.20  ?  147  VAL A CB    1 
ATOM   1774  C  CG1   . VAL B  2  147  ? -106.185 56.750  20.625  1.00 87.10  ?  147  VAL A CG1   1 
ATOM   1775  C  CG2   . VAL B  2  147  ? -105.410 55.483  22.641  1.00 78.87  ?  147  VAL A CG2   1 
ATOM   1776  N  N     . PRO B  2  148  ? -108.176 53.556  22.431  1.00 90.92  ?  148  PRO A N     1 
ATOM   1777  C  CA    . PRO B  2  148  ? -109.474 53.665  23.109  1.00 89.84  ?  148  PRO A CA    1 
ATOM   1778  C  C     . PRO B  2  148  ? -109.619 54.978  23.859  1.00 94.04  ?  148  PRO A C     1 
ATOM   1779  O  O     . PRO B  2  148  ? -108.748 55.849  23.773  1.00 93.41  ?  148  PRO A O     1 
ATOM   1780  C  CB    . PRO B  2  148  ? -109.474 52.462  24.062  1.00 90.43  ?  148  PRO A CB    1 
ATOM   1781  C  CG    . PRO B  2  148  ? -108.030 52.164  24.292  1.00 87.76  ?  148  PRO A CG    1 
ATOM   1782  C  CD    . PRO B  2  148  ? -107.338 52.486  22.999  1.00 99.25  ?  148  PRO A CD    1 
ATOM   1783  N  N     . ALA B  2  149  ? -110.716 55.129  24.598  1.00 93.17  ?  149  ALA A N     1 
ATOM   1784  C  CA    . ALA B  2  149  ? -110.959 56.364  25.330  1.00 80.25  ?  149  ALA A CA    1 
ATOM   1785  C  C     . ALA B  2  149  ? -109.804 56.666  26.277  1.00 91.42  ?  149  ALA A C     1 
ATOM   1786  O  O     . ALA B  2  149  ? -109.282 55.776  26.954  1.00 103.69 ?  149  ALA A O     1 
ATOM   1787  C  CB    . ALA B  2  149  ? -112.268 56.267  26.112  1.00 98.46  ?  149  ALA A CB    1 
ATOM   1788  N  N     . VAL B  2  150  ? -109.404 57.935  26.314  1.00 92.53  ?  150  VAL A N     1 
ATOM   1789  C  CA    . VAL B  2  150  ? -108.350 58.392  27.212  1.00 86.01  ?  150  VAL A CA    1 
ATOM   1790  C  C     . VAL B  2  150  ? -108.998 58.876  28.502  1.00 87.86  ?  150  VAL A C     1 
ATOM   1791  O  O     . VAL B  2  150  ? -109.023 60.078  28.787  1.00 92.13  ?  150  VAL A O     1 
ATOM   1792  C  CB    . VAL B  2  150  ? -107.499 59.495  26.555  1.00 93.50  ?  150  VAL A CB    1 
ATOM   1793  C  CG1   . VAL B  2  150  ? -108.381 60.661  26.115  1.00 94.09  ?  150  VAL A CG1   1 
ATOM   1794  C  CG2   . VAL B  2  150  ? -106.404 59.962  27.504  1.00 108.72 ?  150  VAL A CG2   1 
ATOM   1795  N  N     . GLN B  2  151  ? -109.527 57.936  29.287  1.00 92.57  ?  151  GLN A N     1 
ATOM   1796  C  CA    . GLN B  2  151  ? -110.300 58.265  30.478  1.00 102.82 ?  151  GLN A CA    1 
ATOM   1797  C  C     . GLN B  2  151  ? -109.595 59.319  31.320  1.00 101.88 ?  151  GLN A C     1 
ATOM   1798  O  O     . GLN B  2  151  ? -108.383 59.254  31.540  1.00 100.74 ?  151  GLN A O     1 
ATOM   1799  C  CB    . GLN B  2  151  ? -110.547 57.003  31.308  1.00 104.81 ?  151  GLN A CB    1 
ATOM   1800  C  CG    . GLN B  2  151  ? -111.375 55.947  30.592  1.00 119.35 ?  151  GLN A CG    1 
ATOM   1801  C  CD    . GLN B  2  151  ? -112.772 56.433  30.248  1.00 116.25 ?  151  GLN A CD    1 
ATOM   1802  O  OE1   . GLN B  2  151  ? -113.286 57.370  30.861  1.00 114.79 ?  151  GLN A OE1   1 
ATOM   1803  N  NE2   . GLN B  2  151  ? -113.392 55.799  29.258  1.00 104.54 ?  151  GLN A NE2   1 
ATOM   1804  N  N     . ASN B  2  152  ? -110.371 60.295  31.789  1.00 103.07 ?  152  ASN A N     1 
ATOM   1805  C  CA    . ASN B  2  152  ? -109.845 61.414  32.561  1.00 107.27 ?  152  ASN A CA    1 
ATOM   1806  C  C     . ASN B  2  152  ? -109.495 61.037  33.996  1.00 103.82 ?  152  ASN A C     1 
ATOM   1807  O  O     . ASN B  2  152  ? -109.201 61.928  34.800  1.00 117.10 ?  152  ASN A O     1 
ATOM   1808  C  CB    . ASN B  2  152  ? -110.844 62.575  32.549  1.00 106.75 ?  152  ASN A CB    1 
ATOM   1809  C  CG    . ASN B  2  152  ? -112.217 62.173  33.048  1.00 107.85 ?  152  ASN A CG    1 
ATOM   1810  O  OD1   . ASN B  2  152  ? -112.355 61.246  33.845  1.00 117.63 ?  152  ASN A OD1   1 
ATOM   1811  N  ND2   . ASN B  2  152  ? -113.244 62.870  32.575  1.00 97.61  ?  152  ASN A ND2   1 
ATOM   1812  N  N     . LYS B  2  153  ? -109.533 59.752  34.340  1.00 104.51 ?  153  LYS A N     1 
ATOM   1813  C  CA    . LYS B  2  153  ? -108.992 59.294  35.613  1.00 111.35 ?  153  LYS A CA    1 
ATOM   1814  C  C     . LYS B  2  153  ? -107.529 58.895  35.496  1.00 114.78 ?  153  LYS A C     1 
ATOM   1815  O  O     . LYS B  2  153  ? -106.758 59.105  36.440  1.00 102.42 ?  153  LYS A O     1 
ATOM   1816  C  CB    . LYS B  2  153  ? -109.809 58.116  36.149  1.00 111.75 ?  153  LYS A CB    1 
ATOM   1817  N  N     . ALA B  2  154  ? -107.133 58.321  34.357  1.00 119.05 ?  154  ALA A N     1 
ATOM   1818  C  CA    . ALA B  2  154  ? -105.718 58.083  34.096  1.00 118.74 ?  154  ALA A CA    1 
ATOM   1819  C  C     . ALA B  2  154  ? -104.993 59.395  33.822  1.00 121.05 ?  154  ALA A C     1 
ATOM   1820  O  O     . ALA B  2  154  ? -103.900 59.635  34.347  1.00 125.30 ?  154  ALA A O     1 
ATOM   1821  C  CB    . ALA B  2  154  ? -105.555 57.113  32.925  1.00 115.78 ?  154  ALA A CB    1 
ATOM   1822  N  N     . SER B  2  155  ? -105.587 60.254  33.001  1.00 116.96 ?  155  SER A N     1 
ATOM   1823  C  CA    . SER B  2  155  ? -105.094 61.608  32.821  1.00 110.16 ?  155  SER A CA    1 
ATOM   1824  C  C     . SER B  2  155  ? -105.780 62.543  33.814  1.00 114.14 ?  155  SER A C     1 
ATOM   1825  O  O     . SER B  2  155  ? -106.701 62.158  34.537  1.00 121.65 ?  155  SER A O     1 
ATOM   1826  C  CB    . SER B  2  155  ? -105.325 62.083  31.385  1.00 104.34 ?  155  SER A CB    1 
ATOM   1827  O  OG    . SER B  2  155  ? -106.708 62.232  31.109  1.00 91.82  ?  155  SER A OG    1 
ATOM   1828  N  N     . GLY B  2  156  ? -105.313 63.787  33.850  1.00 103.57 ?  156  GLY A N     1 
ATOM   1829  C  CA    . GLY B  2  156  ? -105.901 64.779  34.729  1.00 111.76 ?  156  GLY A CA    1 
ATOM   1830  C  C     . GLY B  2  156  ? -106.782 65.759  33.985  1.00 120.95 ?  156  GLY A C     1 
ATOM   1831  O  O     . GLY B  2  156  ? -106.358 66.882  33.692  1.00 129.38 ?  156  GLY A O     1 
ATOM   1832  N  N     . ALA B  2  157  ? -108.013 65.351  33.672  1.00 108.86 ?  157  ALA A N     1 
ATOM   1833  C  CA    . ALA B  2  157  ? -108.904 66.153  32.846  1.00 117.81 ?  157  ALA A CA    1 
ATOM   1834  C  C     . ALA B  2  157  ? -110.086 66.743  33.602  1.00 119.09 ?  157  ALA A C     1 
ATOM   1835  O  O     . ALA B  2  157  ? -110.764 67.622  33.059  1.00 126.76 ?  157  ALA A O     1 
ATOM   1836  C  CB    . ALA B  2  157  ? -109.435 65.316  31.669  1.00 120.14 ?  157  ALA A CB    1 
ATOM   1837  N  N     . GLU B  2  158  ? -110.365 66.278  34.819  1.00 102.58 ?  158  GLU A N     1 
ATOM   1838  C  CA    . GLU B  2  158  ? -111.482 66.794  35.604  1.00 104.09 ?  158  GLU A CA    1 
ATOM   1839  C  C     . GLU B  2  158  ? -112.814 66.323  35.035  1.00 109.96 ?  158  GLU A C     1 
ATOM   1840  O  O     . GLU B  2  158  ? -112.847 65.478  34.135  1.00 123.20 ?  158  GLU A O     1 
ATOM   1841  C  CB    . GLU B  2  158  ? -111.444 68.323  35.674  1.00 101.70 ?  158  GLU A CB    1 
ATOM   1842  C  CG    . GLU B  2  158  ? -110.291 68.883  36.496  1.00 117.86 ?  158  GLU A CG    1 
ATOM   1843  C  CD    . GLU B  2  158  ? -110.376 68.502  37.964  1.00 128.67 ?  158  GLU A CD    1 
ATOM   1844  O  OE1   . GLU B  2  158  ? -111.121 67.556  38.297  1.00 134.33 ?  158  GLU A OE1   1 
ATOM   1845  O  OE2   . GLU B  2  158  ? -109.699 69.154  38.787  1.00 120.55 ?  158  GLU A OE2   1 
ATOM   1846  N  N     . ILE B  2  159  ? -113.915 66.874  35.548  1.00 101.65 ?  159  ILE A N     1 
ATOM   1847  C  CA    . ILE B  2  159  ? -115.235 66.337  35.230  1.00 94.79  ?  159  ILE A CA    1 
ATOM   1848  C  C     . ILE B  2  159  ? -115.760 66.866  33.900  1.00 87.70  ?  159  ILE A C     1 
ATOM   1849  O  O     . ILE B  2  159  ? -116.567 66.200  33.241  1.00 92.54  ?  159  ILE A O     1 
ATOM   1850  C  CB    . ILE B  2  159  ? -116.216 66.637  36.376  1.00 88.22  ?  159  ILE A CB    1 
ATOM   1851  C  CG1   . ILE B  2  159  ? -116.093 65.581  37.478  1.00 87.69  ?  159  ILE A CG1   1 
ATOM   1852  C  CG2   . ILE B  2  159  ? -117.643 66.709  35.856  1.00 85.30  ?  159  ILE A CG2   1 
ATOM   1853  C  CD1   . ILE B  2  159  ? -114.709 65.476  38.085  1.00 102.86 ?  159  ILE A CD1   1 
ATOM   1854  N  N     . GLY B  2  160  ? -115.330 68.050  33.480  1.00 97.90  ?  160  GLY A N     1 
ATOM   1855  C  CA    . GLY B  2  160  ? -115.827 68.619  32.243  1.00 110.44 ?  160  GLY A CA    1 
ATOM   1856  C  C     . GLY B  2  160  ? -115.619 67.733  31.031  1.00 103.04 ?  160  GLY A C     1 
ATOM   1857  O  O     . GLY B  2  160  ? -116.586 67.298  30.397  1.00 78.64  ?  160  GLY A O     1 
ATOM   1858  N  N     . ARG B  2  161  ? -114.359 67.450  30.709  1.00 101.36 ?  161  ARG A N     1 
ATOM   1859  C  CA    . ARG B  2  161  ? -114.034 66.743  29.478  1.00 86.91  ?  161  ARG A CA    1 
ATOM   1860  C  C     . ARG B  2  161  ? -114.703 65.375  29.430  1.00 91.22  ?  161  ARG A C     1 
ATOM   1861  O  O     . ARG B  2  161  ? -114.945 64.735  30.457  1.00 100.84 ?  161  ARG A O     1 
ATOM   1862  C  CB    . ARG B  2  161  ? -112.519 66.574  29.340  1.00 102.44 ?  161  ARG A CB    1 
ATOM   1863  C  CG    . ARG B  2  161  ? -111.745 67.861  29.088  1.00 119.92 ?  161  ARG A CG    1 
ATOM   1864  C  CD    . ARG B  2  161  ? -111.341 68.537  30.388  1.00 124.88 ?  161  ARG A CD    1 
ATOM   1865  N  NE    . ARG B  2  161  ? -110.205 69.434  30.199  1.00 94.96  ?  161  ARG A NE    1 
ATOM   1866  C  CZ    . ARG B  2  161  ? -109.573 70.057  31.188  1.00 85.95  ?  161  ARG A CZ    1 
ATOM   1867  N  NH1   . ARG B  2  161  ? -109.966 69.885  32.441  1.00 83.93  ?  161  ARG A NH1   1 
ATOM   1868  N  NH2   . ARG B  2  161  ? -108.547 70.852  30.922  1.00 114.72 ?  161  ARG A NH2   1 
ATOM   1869  N  N     . ILE B  2  162  ? -114.995 64.927  28.212  1.00 85.95  ?  162  ILE A N     1 
ATOM   1870  C  CA    . ILE B  2  162  ? -115.459 63.563  27.967  1.00 80.76  ?  162  ILE A CA    1 
ATOM   1871  C  C     . ILE B  2  162  ? -114.555 62.938  26.909  1.00 78.90  ?  162  ILE A C     1 
ATOM   1872  O  O     . ILE B  2  162  ? -114.593 63.343  25.737  1.00 77.34  ?  162  ILE A O     1 
ATOM   1873  C  CB    . ILE B  2  162  ? -116.938 63.531  27.545  1.00 71.02  ?  162  ILE A CB    1 
ATOM   1874  C  CG1   . ILE B  2  162  ? -117.143 64.207  26.188  1.00 76.81  ?  162  ILE A CG1   1 
ATOM   1875  C  CG2   . ILE B  2  162  ? -117.805 64.202  28.597  1.00 80.52  ?  162  ILE A CG2   1 
ATOM   1876  C  CD1   . ILE B  2  162  ? -118.555 64.074  25.652  1.00 79.94  ?  162  ILE A CD1   1 
ATOM   1877  N  N     . PRO B  2  163  ? -113.713 61.974  27.272  1.00 69.62  ?  163  PRO A N     1 
ATOM   1878  C  CA    . PRO B  2  163  ? -112.835 61.355  26.274  1.00 72.93  ?  163  PRO A CA    1 
ATOM   1879  C  C     . PRO B  2  163  ? -113.641 60.625  25.214  1.00 76.42  ?  163  PRO A C     1 
ATOM   1880  O  O     . PRO B  2  163  ? -114.772 60.192  25.445  1.00 82.18  ?  163  PRO A O     1 
ATOM   1881  C  CB    . PRO B  2  163  ? -111.985 60.381  27.099  1.00 79.35  ?  163  PRO A CB    1 
ATOM   1882  C  CG    . PRO B  2  163  ? -112.095 60.870  28.511  1.00 88.29  ?  163  PRO A CG    1 
ATOM   1883  C  CD    . PRO B  2  163  ? -113.470 61.452  28.625  1.00 85.02  ?  163  PRO A CD    1 
ATOM   1884  N  N     . VAL B  2  164  ? -113.040 60.491  24.034  1.00 70.57  ?  164  VAL A N     1 
ATOM   1885  C  CA    . VAL B  2  164  ? -113.682 59.842  22.901  1.00 67.87  ?  164  VAL A CA    1 
ATOM   1886  C  C     . VAL B  2  164  ? -112.687 58.902  22.237  1.00 85.40  ?  164  VAL A C     1 
ATOM   1887  O  O     . VAL B  2  164  ? -111.477 59.150  22.229  1.00 89.58  ?  164  VAL A O     1 
ATOM   1888  C  CB    . VAL B  2  164  ? -114.222 60.871  21.883  1.00 63.81  ?  164  VAL A CB    1 
ATOM   1889  C  CG1   . VAL B  2  164  ? -114.874 60.166  20.705  1.00 85.50  ?  164  VAL A CG1   1 
ATOM   1890  C  CG2   . VAL B  2  164  ? -115.207 61.809  22.558  1.00 70.35  ?  164  VAL A CG2   1 
ATOM   1891  N  N     . ASP B  2  165  ? -113.207 57.809  21.683  1.00 90.32  ?  165  ASP A N     1 
ATOM   1892  C  CA    . ASP B  2  165  ? -112.367 56.875  20.946  1.00 79.54  ?  165  ASP A CA    1 
ATOM   1893  C  C     . ASP B  2  165  ? -111.757 57.569  19.735  1.00 77.95  ?  165  ASP A C     1 
ATOM   1894  O  O     . ASP B  2  165  ? -112.469 58.165  18.921  1.00 80.58  ?  165  ASP A O     1 
ATOM   1895  C  CB    . ASP B  2  165  ? -113.186 55.660  20.506  1.00 84.01  ?  165  ASP A CB    1 
ATOM   1896  C  CG    . ASP B  2  165  ? -113.858 54.953  21.671  1.00 92.74  ?  165  ASP A CG    1 
ATOM   1897  O  OD1   . ASP B  2  165  ? -113.278 54.940  22.779  1.00 89.77  ?  165  ASP A OD1   1 
ATOM   1898  O  OD2   . ASP B  2  165  ? -114.968 54.413  21.478  1.00 93.10  ?  165  ASP A OD2   1 
ATOM   1899  N  N     . SER B  2  166  ? -110.435 57.495  19.619  1.00 80.58  ?  166  SER A N     1 
ATOM   1900  C  CA    . SER B  2  166  ? -109.708 58.138  18.534  1.00 77.55  ?  166  SER A CA    1 
ATOM   1901  C  C     . SER B  2  166  ? -109.308 57.108  17.486  1.00 76.47  ?  166  SER A C     1 
ATOM   1902  O  O     . SER B  2  166  ? -108.988 55.962  17.816  1.00 67.50  ?  166  SER A O     1 
ATOM   1903  C  CB    . SER B  2  166  ? -108.466 58.856  19.064  1.00 76.33  ?  166  SER A CB    1 
ATOM   1904  O  OG    . SER B  2  166  ? -108.814 59.806  20.056  1.00 77.21  ?  166  SER A OG    1 
ATOM   1905  N  N     . ILE B  2  167  ? -109.323 57.526  16.222  1.00 80.83  ?  167  ILE A N     1 
ATOM   1906  C  CA    . ILE B  2  167  ? -108.997 56.660  15.092  1.00 80.02  ?  167  ILE A CA    1 
ATOM   1907  C  C     . ILE B  2  167  ? -108.079 57.445  14.162  1.00 77.10  ?  167  ILE A C     1 
ATOM   1908  O  O     . ILE B  2  167  ? -108.551 58.234  13.335  1.00 85.27  ?  167  ILE A O     1 
ATOM   1909  C  CB    . ILE B  2  167  ? -110.245 56.172  14.351  1.00 72.96  ?  167  ILE A CB    1 
ATOM   1910  C  CG1   . ILE B  2  167  ? -111.108 55.307  15.272  1.00 69.69  ?  167  ILE A CG1   1 
ATOM   1911  C  CG2   . ILE B  2  167  ? -109.854 55.395  13.102  1.00 93.97  ?  167  ILE A CG2   1 
ATOM   1912  C  CD1   . ILE B  2  167  ? -112.309 54.696  14.581  1.00 83.04  ?  167  ILE A CD1   1 
ATOM   1913  N  N     . TYR B  2  168  ? -106.769 57.233  14.290  1.00 68.77  ?  168  TYR A N     1 
ATOM   1914  C  CA    . TYR B  2  168  ? -105.782 57.840  13.396  1.00 69.14  ?  168  TYR A CA    1 
ATOM   1915  C  C     . TYR B  2  168  ? -105.493 56.847  12.277  1.00 87.28  ?  168  TYR A C     1 
ATOM   1916  O  O     . TYR B  2  168  ? -104.590 56.015  12.376  1.00 107.70 ?  168  TYR A O     1 
ATOM   1917  C  CB    . TYR B  2  168  ? -104.504 58.197  14.146  1.00 77.30  ?  168  TYR A CB    1 
ATOM   1918  C  CG    . TYR B  2  168  ? -104.706 58.749  15.537  1.00 77.78  ?  168  TYR A CG    1 
ATOM   1919  C  CD1   . TYR B  2  168  ? -104.645 60.114  15.779  1.00 90.70  ?  168  TYR A CD1   1 
ATOM   1920  C  CD2   . TYR B  2  168  ? -104.938 57.905  16.614  1.00 78.69  ?  168  TYR A CD2   1 
ATOM   1921  C  CE1   . TYR B  2  168  ? -104.821 60.623  17.051  1.00 90.20  ?  168  TYR A CE1   1 
ATOM   1922  C  CE2   . TYR B  2  168  ? -105.116 58.405  17.889  1.00 84.60  ?  168  TYR A CE2   1 
ATOM   1923  C  CZ    . TYR B  2  168  ? -105.055 59.763  18.101  1.00 79.10  ?  168  TYR A CZ    1 
ATOM   1924  O  OH    . TYR B  2  168  ? -105.232 60.263  19.369  1.00 89.82  ?  168  TYR A OH    1 
ATOM   1925  N  N     . SER B  2  169  ? -106.266 56.926  11.196  1.00 68.98  ?  169  SER A N     1 
ATOM   1926  C  CA    . SER B  2  169  ? -106.094 56.011  10.068  1.00 94.38  ?  169  SER A CA    1 
ATOM   1927  C  C     . SER B  2  169  ? -106.560 56.697  8.796   1.00 90.69  ?  169  SER A C     1 
ATOM   1928  O  O     . SER B  2  169  ? -107.727 56.584  8.398   1.00 91.86  ?  169  SER A O     1 
ATOM   1929  C  CB    . SER B  2  169  ? -106.845 54.698  10.284  1.00 99.41  ?  169  SER A CB    1 
ATOM   1930  O  OG    . SER B  2  169  ? -106.490 53.741  9.299   1.00 97.09  ?  169  SER A OG    1 
ATOM   1931  N  N     . PRO B  2  170  ? -105.667 57.426  8.124   1.00 76.06  ?  170  PRO A N     1 
ATOM   1932  C  CA    . PRO B  2  170  ? -106.048 58.060  6.853   1.00 57.07  ?  170  PRO A CA    1 
ATOM   1933  C  C     . PRO B  2  170  ? -106.444 57.063  5.785   1.00 79.23  ?  170  PRO A C     1 
ATOM   1934  O  O     . PRO B  2  170  ? -107.213 57.417  4.883   1.00 82.52  ?  170  PRO A O     1 
ATOM   1935  C  CB    . PRO B  2  170  ? -104.786 58.839  6.453   1.00 72.00  ?  170  PRO A CB    1 
ATOM   1936  C  CG    . PRO B  2  170  ? -104.007 58.990  7.720   1.00 78.87  ?  170  PRO A CG    1 
ATOM   1937  C  CD    . PRO B  2  170  ? -104.292 57.761  8.522   1.00 78.74  ?  170  PRO A CD    1 
ATOM   1938  N  N     . VAL B  2  171  ? -105.955 55.828  5.860   1.00 81.96  ?  171  VAL A N     1 
ATOM   1939  C  CA    . VAL B  2  171  ? -106.245 54.821  4.847   1.00 78.53  ?  171  VAL A CA    1 
ATOM   1940  C  C     . VAL B  2  171  ? -107.631 54.243  5.083   1.00 67.82  ?  171  VAL A C     1 
ATOM   1941  O  O     . VAL B  2  171  ? -108.032 53.974  6.221   1.00 63.61  ?  171  VAL A O     1 
ATOM   1942  C  CB    . VAL B  2  171  ? -105.171 53.719  4.855   1.00 73.56  ?  171  VAL A CB    1 
ATOM   1943  C  CG1   . VAL B  2  171  ? -105.009 53.145  6.254   1.00 95.44  ?  171  VAL A CG1   1 
ATOM   1944  C  CG2   . VAL B  2  171  ? -105.530 52.624  3.854   1.00 74.21  ?  171  VAL A CG2   1 
ATOM   1945  N  N     . LEU B  2  172  ? -108.371 54.043  3.995   1.00 70.24  ?  172  LEU A N     1 
ATOM   1946  C  CA    . LEU B  2  172  ? -109.750 53.564  4.066   1.00 74.69  ?  172  LEU A CA    1 
ATOM   1947  C  C     . LEU B  2  172  ? -109.847 52.097  3.674   1.00 82.32  ?  172  LEU A C     1 
ATOM   1948  O  O     . LEU B  2  172  ? -110.123 51.245  4.526   1.00 91.21  ?  172  LEU A O     1 
ATOM   1949  C  CB    . LEU B  2  172  ? -110.653 54.438  3.178   1.00 91.62  ?  172  LEU A CB    1 
ATOM   1950  C  CG    . LEU B  2  172  ? -112.169 54.246  3.230   1.00 85.46  ?  172  LEU A CG    1 
ATOM   1951  C  CD1   . LEU B  2  172  ? -112.888 55.464  2.651   1.00 76.00  ?  172  LEU A CD1   1 
ATOM   1952  C  CD2   . LEU B  2  172  ? -112.572 52.992  2.478   1.00 85.39  ?  172  LEU A CD2   1 
ATOM   1953  N  N     . LYS B  2  173  ? -109.636 51.766  2.395   1.00 78.95  ?  173  LYS A N     1 
ATOM   1954  C  CA    . LYS B  2  173  ? -109.671 50.384  1.940   1.00 67.91  ?  173  LYS A CA    1 
ATOM   1955  C  C     . LYS B  2  173  ? -108.472 50.091  1.048   1.00 77.55  ?  173  LYS A C     1 
ATOM   1956  O  O     . LYS B  2  173  ? -108.071 50.924  0.228   1.00 83.22  ?  173  LYS A O     1 
ATOM   1957  C  CB    . LYS B  2  173  ? -110.985 50.084  1.197   1.00 61.08  ?  173  LYS A CB    1 
ATOM   1958  C  CG    . LYS B  2  173  ? -111.105 48.663  0.650   1.00 75.37  ?  173  LYS A CG    1 
ATOM   1959  C  CD    . LYS B  2  173  ? -112.411 48.475  -0.114  1.00 68.31  ?  173  LYS A CD    1 
ATOM   1960  C  CE    . LYS B  2  173  ? -113.604 48.682  0.798   1.00 67.19  ?  173  LYS A CE    1 
ATOM   1961  N  NZ    . LYS B  2  173  ? -114.884 48.498  0.069   1.00 93.67  ?  173  LYS A NZ    1 
ATOM   1962  N  N     . VAL B  2  174  ? -107.912 48.895  1.205   1.00 87.63  ?  174  VAL A N     1 
ATOM   1963  C  CA    . VAL B  2  174  ? -106.726 48.488  0.461   1.00 80.34  ?  174  VAL A CA    1 
ATOM   1964  C  C     . VAL B  2  174  ? -106.888 47.051  -0.022  1.00 88.40  ?  174  VAL A C     1 
ATOM   1965  O  O     . VAL B  2  174  ? -107.446 46.200  0.679   1.00 90.53  ?  174  VAL A O     1 
ATOM   1966  C  CB    . VAL B  2  174  ? -105.445 48.643  1.309   1.00 61.45  ?  174  VAL A CB    1 
ATOM   1967  C  CG1   . VAL B  2  174  ? -104.252 48.010  0.603   1.00 70.90  ?  174  VAL A CG1   1 
ATOM   1968  C  CG2   . VAL B  2  174  ? -105.173 50.114  1.596   1.00 73.78  ?  174  VAL A CG2   1 
ATOM   1969  N  N     . THR B  2  175  ? -106.395 46.785  -1.230  1.00 78.17  ?  175  THR A N     1 
ATOM   1970  C  CA    . THR B  2  175  ? -106.395 45.443  -1.794  1.00 77.67  ?  175  THR A CA    1 
ATOM   1971  C  C     . THR B  2  175  ? -105.202 45.326  -2.733  1.00 80.56  ?  175  THR A C     1 
ATOM   1972  O  O     . THR B  2  175  ? -104.377 46.237  -2.838  1.00 93.02  ?  175  THR A O     1 
ATOM   1973  C  CB    . THR B  2  175  ? -107.710 45.139  -2.518  1.00 76.11  ?  175  THR A CB    1 
ATOM   1974  O  OG1   . THR B  2  175  ? -107.703 43.780  -2.973  1.00 89.64  ?  175  THR A OG1   1 
ATOM   1975  C  CG2   . THR B  2  175  ? -107.881 46.057  -3.711  1.00 82.74  ?  175  THR A CG2   1 
ATOM   1976  N  N     . TYR B  2  176  ? -105.109 44.190  -3.417  1.00 78.00  ?  176  TYR A N     1 
ATOM   1977  C  CA    . TYR B  2  176  ? -104.047 43.992  -4.396  1.00 82.20  ?  176  TYR A CA    1 
ATOM   1978  C  C     . TYR B  2  176  ? -104.358 42.748  -5.215  1.00 77.02  ?  176  TYR A C     1 
ATOM   1979  O  O     . TYR B  2  176  ? -105.225 41.945  -4.862  1.00 79.37  ?  176  TYR A O     1 
ATOM   1980  C  CB    . TYR B  2  176  ? -102.669 43.881  -3.731  1.00 71.81  ?  176  TYR A CB    1 
ATOM   1981  C  CG    . TYR B  2  176  ? -102.567 42.827  -2.651  1.00 75.81  ?  176  TYR A CG    1 
ATOM   1982  C  CD1   . TYR B  2  176  ? -102.660 41.473  -2.957  1.00 78.12  ?  176  TYR A CD1   1 
ATOM   1983  C  CD2   . TYR B  2  176  ? -102.351 43.183  -1.326  1.00 79.88  ?  176  TYR A CD2   1 
ATOM   1984  C  CE1   . TYR B  2  176  ? -102.560 40.507  -1.971  1.00 83.44  ?  176  TYR A CE1   1 
ATOM   1985  C  CE2   . TYR B  2  176  ? -102.251 42.224  -0.333  1.00 84.96  ?  176  TYR A CE2   1 
ATOM   1986  C  CZ    . TYR B  2  176  ? -102.355 40.889  -0.662  1.00 87.17  ?  176  TYR A CZ    1 
ATOM   1987  O  OH    . TYR B  2  176  ? -102.253 39.934  0.324   1.00 83.14  ?  176  TYR A OH    1 
ATOM   1988  N  N     . LYS B  2  177  ? -103.631 42.602  -6.319  1.00 82.96  ?  177  LYS A N     1 
ATOM   1989  C  CA    . LYS B  2  177  ? -103.767 41.447  -7.194  1.00 108.17 ?  177  LYS A CA    1 
ATOM   1990  C  C     . LYS B  2  177  ? -102.472 41.281  -7.977  1.00 97.91  ?  177  LYS A C     1 
ATOM   1991  O  O     . LYS B  2  177  ? -101.787 42.261  -8.282  1.00 85.60  ?  177  LYS A O     1 
ATOM   1992  C  CB    . LYS B  2  177  ? -104.964 41.595  -8.140  1.00 88.39  ?  177  LYS A CB    1 
ATOM   1993  C  CG    . LYS B  2  177  ? -104.999 42.909  -8.900  1.00 81.11  ?  177  LYS A CG    1 
ATOM   1994  C  CD    . LYS B  2  177  ? -106.202 42.980  -9.827  1.00 96.15  ?  177  LYS A CD    1 
ATOM   1995  C  CE    . LYS B  2  177  ? -106.239 44.301  -10.582 1.00 99.72  ?  177  LYS A CE    1 
ATOM   1996  N  NZ    . LYS B  2  177  ? -107.371 44.362  -11.548 1.00 110.96 ?  177  LYS A NZ    1 
ATOM   1997  N  N     . VAL B  2  178  ? -102.141 40.031  -8.288  1.00 96.10  ?  178  VAL A N     1 
ATOM   1998  C  CA    . VAL B  2  178  ? -100.913 39.702  -9.002  1.00 100.20 ?  178  VAL A CA    1 
ATOM   1999  C  C     . VAL B  2  178  ? -101.273 39.136  -10.367 1.00 119.33 ?  178  VAL A C     1 
ATOM   2000  O  O     . VAL B  2  178  ? -102.330 38.521  -10.552 1.00 116.85 ?  178  VAL A O     1 
ATOM   2001  C  CB    . VAL B  2  178  ? -100.034 38.704  -8.219  1.00 94.93  ?  178  VAL A CB    1 
ATOM   2002  C  CG1   . VAL B  2  178  ? -99.777  39.211  -6.807  1.00 90.12  ?  178  VAL A CG1   1 
ATOM   2003  C  CG2   . VAL B  2  178  ? -100.680 37.324  -8.198  1.00 88.70  ?  178  VAL A CG2   1 
ATOM   2004  N  N     . GLU B  2  179  ? -100.378 39.347  -11.333 1.00 117.98 ?  179  GLU A N     1 
ATOM   2005  C  CA    . GLU B  2  179  ? -100.553 38.833  -12.685 1.00 116.91 ?  179  GLU A CA    1 
ATOM   2006  C  C     . GLU B  2  179  ? -99.197  38.389  -13.237 1.00 121.96 ?  179  GLU A C     1 
ATOM   2007  O  O     . GLU B  2  179  ? -98.682  38.919  -14.218 1.00 128.63 ?  179  GLU A O     1 
ATOM   2008  C  CB    . GLU B  2  179  ? -101.212 39.875  -13.587 1.00 122.11 ?  179  GLU A CB    1 
ATOM   2009  C  CG    . GLU B  2  179  ? -100.461 41.190  -13.672 1.00 121.10 ?  179  GLU A CG    1 
ATOM   2010  C  CD    . GLU B  2  179  ? -101.149 42.195  -14.577 1.00 126.59 ?  179  GLU A CD    1 
ATOM   2011  O  OE1   . GLU B  2  179  ? -100.447 43.051  -15.158 1.00 134.44 ?  179  GLU A OE1   1 
ATOM   2012  O  OE2   . GLU B  2  179  ? -102.390 42.128  -14.708 1.00 110.92 ?  179  GLU A OE2   1 
ATOM   2013  N  N     . ALA B  2  180  ? -98.602  37.392  -12.588 1.00 131.50 ?  180  ALA A N     1 
ATOM   2014  C  CA    . ALA B  2  180  ? -97.359  36.816  -13.081 1.00 130.35 ?  180  ALA A CA    1 
ATOM   2015  C  C     . ALA B  2  180  ? -97.572  36.252  -14.478 1.00 136.86 ?  180  ALA A C     1 
ATOM   2016  O  O     . ALA B  2  180  ? -98.341  35.304  -14.664 1.00 127.57 ?  180  ALA A O     1 
ATOM   2017  C  CB    . ALA B  2  180  ? -96.866  35.727  -12.131 1.00 125.12 ?  180  ALA A CB    1 
ATOM   2018  N  N     . THR B  2  181  ? -96.896  36.839  -15.459 1.00 145.02 ?  181  THR A N     1 
ATOM   2019  C  CA    . THR B  2  181  ? -97.063  36.466  -16.856 1.00 149.78 ?  181  THR A CA    1 
ATOM   2020  C  C     . THR B  2  181  ? -95.969  35.496  -17.283 1.00 146.66 ?  181  THR A C     1 
ATOM   2021  O  O     . THR B  2  181  ? -94.815  35.615  -16.859 1.00 139.21 ?  181  THR A O     1 
ATOM   2022  C  CB    . THR B  2  181  ? -97.043  37.702  -17.758 1.00 136.80 ?  181  THR A CB    1 
ATOM   2023  O  OG1   . THR B  2  181  ? -95.852  38.459  -17.510 1.00 123.73 ?  181  THR A OG1   1 
ATOM   2024  C  CG2   . THR B  2  181  ? -98.263  38.575  -17.491 1.00 120.50 ?  181  THR A CG2   1 
ATOM   2025  N  N     . ARG B  2  182  ? -96.346  34.536  -18.124 1.00 147.29 ?  182  ARG A N     1 
ATOM   2026  C  CA    . ARG B  2  182  ? -95.420  33.552  -18.681 1.00 155.97 ?  182  ARG A CA    1 
ATOM   2027  C  C     . ARG B  2  182  ? -94.627  32.859  -17.574 1.00 153.14 ?  182  ARG A C     1 
ATOM   2028  O  O     . ARG B  2  182  ? -93.396  32.892  -17.530 1.00 156.76 ?  182  ARG A O     1 
ATOM   2029  C  CB    . ARG B  2  182  ? -94.487  34.202  -19.706 1.00 154.78 ?  182  ARG A CB    1 
ATOM   2030  N  N     . VAL B  2  183  ? -95.367  32.219  -16.669 1.00 137.60 ?  183  VAL A N     1 
ATOM   2031  C  CA    . VAL B  2  183  ? -94.761  31.481  -15.568 1.00 141.05 ?  183  VAL A CA    1 
ATOM   2032  C  C     . VAL B  2  183  ? -93.976  30.309  -16.143 1.00 149.48 ?  183  VAL A C     1 
ATOM   2033  O  O     . VAL B  2  183  ? -94.525  29.222  -16.354 1.00 155.76 ?  183  VAL A O     1 
ATOM   2034  C  CB    . VAL B  2  183  ? -95.822  31.000  -14.562 1.00 122.14 ?  183  VAL A CB    1 
ATOM   2035  C  CG1   . VAL B  2  183  ? -95.202  30.800  -13.185 1.00 109.92 ?  183  VAL A CG1   1 
ATOM   2036  C  CG2   . VAL B  2  183  ? -96.978  31.984  -14.505 1.00 125.98 ?  183  VAL A CG2   1 
ATOM   2037  N  N     . GLU B  2  184  ? -92.691  30.528  -16.414 1.00 142.29 ?  184  GLU A N     1 
ATOM   2038  C  CA    . GLU B  2  184  ? -91.766  29.537  -16.962 1.00 152.74 ?  184  GLU A CA    1 
ATOM   2039  C  C     . GLU B  2  184  ? -91.965  29.314  -18.456 1.00 156.33 ?  184  GLU A C     1 
ATOM   2040  O  O     . GLU B  2  184  ? -91.315  28.420  -19.025 1.00 154.96 ?  184  GLU A O     1 
ATOM   2041  C  CB    . GLU B  2  184  ? -91.874  28.189  -16.242 1.00 145.07 ?  184  GLU A CB    1 
ATOM   2042  N  N     . GLN B  2  185  ? -92.840  30.079  -19.114 1.00 148.75 ?  185  GLN A N     1 
ATOM   2043  C  CA    . GLN B  2  185  ? -92.995  29.946  -20.560 1.00 143.29 ?  185  GLN A CA    1 
ATOM   2044  C  C     . GLN B  2  185  ? -91.662  30.152  -21.269 1.00 155.31 ?  185  GLN A C     1 
ATOM   2045  O  O     . GLN B  2  185  ? -91.240  29.324  -22.086 1.00 142.01 ?  185  GLN A O     1 
ATOM   2046  C  CB    . GLN B  2  185  ? -94.040  30.940  -21.068 1.00 127.54 ?  185  GLN A CB    1 
ATOM   2047  N  N     . ARG B  2  186  ? -90.991  31.264  -20.975 1.00 158.78 ?  186  ARG A N     1 
ATOM   2048  C  CA    . ARG B  2  186  ? -89.626  31.500  -21.422 1.00 150.15 ?  186  ARG A CA    1 
ATOM   2049  C  C     . ARG B  2  186  ? -88.785  31.907  -20.221 1.00 150.68 ?  186  ARG A C     1 
ATOM   2050  O  O     . ARG B  2  186  ? -87.790  31.252  -19.895 1.00 152.51 ?  186  ARG A O     1 
ATOM   2051  C  CB    . ARG B  2  186  ? -89.584  32.572  -22.513 1.00 118.33 ?  186  ARG A CB    1 
ATOM   2052  N  N     . THR B  2  187  ? -89.186  32.987  -19.554 1.00 145.85 ?  187  THR A N     1 
ATOM   2053  C  CA    . THR B  2  187  ? -88.610  33.397  -18.283 1.00 147.28 ?  187  THR A CA    1 
ATOM   2054  C  C     . THR B  2  187  ? -89.750  33.775  -17.349 1.00 147.98 ?  187  THR A C     1 
ATOM   2055  O  O     . THR B  2  187  ? -90.750  34.353  -17.784 1.00 143.30 ?  187  THR A O     1 
ATOM   2056  C  CB    . THR B  2  187  ? -87.642  34.576  -18.447 1.00 143.77 ?  187  THR A CB    1 
ATOM   2057  O  OG1   . THR B  2  187  ? -86.852  34.715  -17.260 1.00 143.61 ?  187  THR A OG1   1 
ATOM   2058  C  CG2   . THR B  2  187  ? -88.410  35.867  -18.691 1.00 133.58 ?  187  THR A CG2   1 
ATOM   2059  N  N     . ASP B  2  188  ? -89.608  33.442  -16.070 1.00 140.90 ?  188  ASP A N     1 
ATOM   2060  C  CA    . ASP B  2  188  ? -90.694  33.581  -15.109 1.00 141.99 ?  188  ASP A CA    1 
ATOM   2061  C  C     . ASP B  2  188  ? -90.510  34.843  -14.274 1.00 133.78 ?  188  ASP A C     1 
ATOM   2062  O  O     . ASP B  2  188  ? -89.400  35.136  -13.818 1.00 133.06 ?  188  ASP A O     1 
ATOM   2063  C  CB    . ASP B  2  188  ? -90.772  32.348  -14.208 1.00 134.80 ?  188  ASP A CB    1 
ATOM   2064  N  N     . PHE B  2  189  ? -91.602  35.582  -14.076 1.00 128.67 ?  189  PHE A N     1 
ATOM   2065  C  CA    . PHE B  2  189  ? -91.582  36.802  -13.279 1.00 121.51 ?  189  PHE A CA    1 
ATOM   2066  C  C     . PHE B  2  189  ? -93.015  37.208  -12.966 1.00 127.18 ?  189  PHE A C     1 
ATOM   2067  O  O     . PHE B  2  189  ? -93.957  36.846  -13.677 1.00 131.62 ?  189  PHE A O     1 
ATOM   2068  C  CB    . PHE B  2  189  ? -90.850  37.936  -14.002 1.00 115.36 ?  189  PHE A CB    1 
ATOM   2069  C  CG    . PHE B  2  189  ? -91.698  38.649  -15.008 1.00 129.36 ?  189  PHE A CG    1 
ATOM   2070  C  CD1   . PHE B  2  189  ? -92.282  39.863  -14.697 1.00 122.37 ?  189  PHE A CD1   1 
ATOM   2071  C  CD2   . PHE B  2  189  ? -91.938  38.093  -16.253 1.00 136.15 ?  189  PHE A CD2   1 
ATOM   2072  C  CE1   . PHE B  2  189  ? -93.074  40.519  -15.611 1.00 120.48 ?  189  PHE A CE1   1 
ATOM   2073  C  CE2   . PHE B  2  189  ? -92.731  38.746  -17.172 1.00 126.27 ?  189  PHE A CE2   1 
ATOM   2074  C  CZ    . PHE B  2  189  ? -93.300  39.961  -16.850 1.00 122.31 ?  189  PHE A CZ    1 
ATOM   2075  N  N     . ASP B  2  190  ? -93.165  37.961  -11.881 1.00 117.18 ?  190  ASP A N     1 
ATOM   2076  C  CA    . ASP B  2  190  ? -94.462  38.431  -11.423 1.00 115.42 ?  190  ASP A CA    1 
ATOM   2077  C  C     . ASP B  2  190  ? -94.430  39.943  -11.262 1.00 117.59 ?  190  ASP A C     1 
ATOM   2078  O  O     . ASP B  2  190  ? -93.378  40.541  -11.024 1.00 112.91 ?  190  ASP A O     1 
ATOM   2079  C  CB    . ASP B  2  190  ? -94.844  37.783  -10.093 1.00 114.82 ?  190  ASP A CB    1 
ATOM   2080  C  CG    . ASP B  2  190  ? -94.492  36.316  -10.040 1.00 128.60 ?  190  ASP A CG    1 
ATOM   2081  O  OD1   . ASP B  2  190  ? -93.493  35.897  -10.655 1.00 139.58 ?  190  ASP A OD1   1 
ATOM   2082  O  OD2   . ASP B  2  190  ? -95.207  35.572  -9.357  1.00 127.15 ?  190  ASP A OD2   1 
ATOM   2083  N  N     . LYS B  2  191  ? -95.608  40.554  -11.361 1.00 116.72 ?  191  LYS A N     1 
ATOM   2084  C  CA    . LYS B  2  191  ? -95.779  41.979  -11.125 1.00 113.24 ?  191  LYS A CA    1 
ATOM   2085  C  C     . LYS B  2  191  ? -97.070  42.186  -10.354 1.00 111.77 ?  191  LYS A C     1 
ATOM   2086  O  O     . LYS B  2  191  ? -98.101  41.610  -10.708 1.00 112.59 ?  191  LYS A O     1 
ATOM   2087  C  CB    . LYS B  2  191  ? -95.830  42.774  -12.433 1.00 119.61 ?  191  LYS A CB    1 
ATOM   2088  C  CG    . LYS B  2  191  ? -96.316  44.196  -12.235 1.00 109.95 ?  191  LYS A CG    1 
ATOM   2089  C  CD    . LYS B  2  191  ? -96.590  44.870  -13.554 1.00 116.63 ?  191  LYS A CD    1 
ATOM   2090  C  CE    . LYS B  2  191  ? -97.580  44.065  -14.377 1.00 123.77 ?  191  LYS A CE    1 
ATOM   2091  N  NZ    . LYS B  2  191  ? -98.805  43.713  -13.606 1.00 113.09 ?  191  LYS A NZ    1 
ATOM   2092  N  N     . LEU B  2  192  ? -97.013  43.002  -9.306  1.00 105.32 ?  192  LEU A N     1 
ATOM   2093  C  CA    . LEU B  2  192  ? -98.164  43.249  -8.452  1.00 102.43 ?  192  LEU A CA    1 
ATOM   2094  C  C     . LEU B  2  192  ? -98.673  44.669  -8.655  1.00 107.16 ?  192  LEU A C     1 
ATOM   2095  O  O     . LEU B  2  192  ? -97.937  45.565  -9.078  1.00 112.57 ?  192  LEU A O     1 
ATOM   2096  C  CB    . LEU B  2  192  ? -97.816  43.020  -6.973  1.00 95.96  ?  192  LEU A CB    1 
ATOM   2097  C  CG    . LEU B  2  192  ? -96.766  43.891  -6.272  1.00 96.73  ?  192  LEU A CG    1 
ATOM   2098  C  CD1   . LEU B  2  192  ? -97.269  45.307  -6.036  1.00 100.75 ?  192  LEU A CD1   1 
ATOM   2099  C  CD2   . LEU B  2  192  ? -96.357  43.258  -4.949  1.00 83.51  ?  192  LEU A CD2   1 
ATOM   2100  N  N     . ILE B  2  193  ? -99.950  44.861  -8.333  1.00 88.85  ?  193  ILE A N     1 
ATOM   2101  C  CA    . ILE B  2  193  ? -100.595 46.166  -8.364  1.00 83.81  ?  193  ILE A CA    1 
ATOM   2102  C  C     . ILE B  2  193  ? -101.374 46.340  -7.068  1.00 88.30  ?  193  ILE A C     1 
ATOM   2103  O  O     . ILE B  2  193  ? -102.098 45.434  -6.640  1.00 98.16  ?  193  ILE A O     1 
ATOM   2104  C  CB    . ILE B  2  193  ? -101.519 46.321  -9.592  1.00 80.51  ?  193  ILE A CB    1 
ATOM   2105  C  CG1   . ILE B  2  193  ? -102.802 45.503  -9.424  1.00 88.62  ?  193  ILE A CG1   1 
ATOM   2106  C  CG2   . ILE B  2  193  ? -100.789 45.917  -10.864 1.00 89.30  ?  193  ILE A CG2   1 
ATOM   2107  C  CD1   . ILE B  2  193  ? -103.947 46.272  -8.785  1.00 97.58  ?  193  ILE A CD1   1 
ATOM   2108  N  N     . ILE B  2  194  ? -101.223 47.504  -6.441  1.00 87.18  ?  194  ILE A N     1 
ATOM   2109  C  CA    . ILE B  2  194  ? -101.858 47.807  -5.164  1.00 79.85  ?  194  ILE A CA    1 
ATOM   2110  C  C     . ILE B  2  194  ? -102.908 48.885  -5.386  1.00 87.43  ?  194  ILE A C     1 
ATOM   2111  O  O     . ILE B  2  194  ? -102.694 49.823  -6.164  1.00 106.81 ?  194  ILE A O     1 
ATOM   2112  C  CB    . ILE B  2  194  ? -100.825 48.260  -4.114  1.00 71.25  ?  194  ILE A CB    1 
ATOM   2113  C  CG1   . ILE B  2  194  ? -99.503  47.519  -4.306  1.00 75.84  ?  194  ILE A CG1   1 
ATOM   2114  C  CG2   . ILE B  2  194  ? -101.355 48.021  -2.711  1.00 72.62  ?  194  ILE A CG2   1 
ATOM   2115  C  CD1   . ILE B  2  194  ? -98.433  47.910  -3.306  1.00 72.55  ?  194  ILE A CD1   1 
ATOM   2116  N  N     . ASP B  2  195  ? -104.041 48.753  -4.700  1.00 70.21  ?  195  ASP A N     1 
ATOM   2117  C  CA    . ASP B  2  195  ? -105.132 49.722  -4.768  1.00 81.08  ?  195  ASP A CA    1 
ATOM   2118  C  C     . ASP B  2  195  ? -105.265 50.372  -3.393  1.00 85.15  ?  195  ASP A C     1 
ATOM   2119  O  O     . ASP B  2  195  ? -105.928 49.829  -2.503  1.00 91.82  ?  195  ASP A O     1 
ATOM   2120  C  CB    . ASP B  2  195  ? -106.435 49.053  -5.203  1.00 74.67  ?  195  ASP A CB    1 
ATOM   2121  C  CG    . ASP B  2  195  ? -107.488 50.053  -5.643  1.00 94.02  ?  195  ASP A CG    1 
ATOM   2122  O  OD1   . ASP B  2  195  ? -107.484 51.194  -5.133  1.00 93.78  ?  195  ASP A OD1   1 
ATOM   2123  O  OD2   . ASP B  2  195  ? -108.323 49.695  -6.500  1.00 95.07  ?  195  ASP A OD2   1 
ATOM   2124  N  N     . VAL B  2  196  ? -104.636 51.534  -3.219  1.00 73.27  ?  196  VAL A N     1 
ATOM   2125  C  CA    . VAL B  2  196  ? -104.635 52.251  -1.947  1.00 72.02  ?  196  VAL A CA    1 
ATOM   2126  C  C     . VAL B  2  196  ? -105.680 53.355  -1.994  1.00 83.31  ?  196  VAL A C     1 
ATOM   2127  O  O     . VAL B  2  196  ? -105.833 54.040  -3.014  1.00 84.60  ?  196  VAL A O     1 
ATOM   2128  C  CB    . VAL B  2  196  ? -103.242 52.828  -1.633  1.00 69.89  ?  196  VAL A CB    1 
ATOM   2129  C  CG1   . VAL B  2  196  ? -103.265 53.581  -0.314  1.00 66.56  ?  196  VAL A CG1   1 
ATOM   2130  C  CG2   . VAL B  2  196  ? -102.208 51.718  -1.602  1.00 80.43  ?  196  VAL A CG2   1 
ATOM   2131  N  N     . GLU B  2  197  ? -106.398 53.533  -0.886  1.00 86.50  ?  197  GLU A N     1 
ATOM   2132  C  CA    . GLU B  2  197  ? -107.426 54.557  -0.771  1.00 86.48  ?  197  GLU A CA    1 
ATOM   2133  C  C     . GLU B  2  197  ? -107.331 55.218  0.596   1.00 96.28  ?  197  GLU A C     1 
ATOM   2134  O  O     . GLU B  2  197  ? -107.079 54.548  1.602   1.00 102.55 ?  197  GLU A O     1 
ATOM   2135  C  CB    . GLU B  2  197  ? -108.828 53.970  -0.974  1.00 55.28  ?  197  GLU A CB    1 
ATOM   2136  C  CG    . GLU B  2  197  ? -109.953 54.952  -0.692  1.00 81.56  ?  197  GLU A CG    1 
ATOM   2137  C  CD    . GLU B  2  197  ? -111.319 54.375  -1.010  1.00 93.24  ?  197  GLU A CD    1 
ATOM   2138  O  OE1   . GLU B  2  197  ? -111.386 53.416  -1.806  1.00 89.45  ?  197  GLU A OE1   1 
ATOM   2139  O  OE2   . GLU B  2  197  ? -112.324 54.877  -0.461  1.00 98.00  ?  197  GLU A OE2   1 
ATOM   2140  N  N     . THR B  2  198  ? -107.536 56.531  0.625   1.00 87.59  ?  198  THR A N     1 
ATOM   2141  C  CA    . THR B  2  198  ? -107.430 57.322  1.841   1.00 81.10  ?  198  THR A CA    1 
ATOM   2142  C  C     . THR B  2  198  ? -108.763 57.994  2.145   1.00 94.29  ?  198  THR A C     1 
ATOM   2143  O  O     . THR B  2  198  ? -109.716 57.927  1.364   1.00 99.75  ?  198  THR A O     1 
ATOM   2144  C  CB    . THR B  2  198  ? -106.319 58.374  1.721   1.00 94.39  ?  198  THR A CB    1 
ATOM   2145  O  OG1   . THR B  2  198  ? -106.637 59.292  0.667   1.00 113.01 ?  198  THR A OG1   1 
ATOM   2146  C  CG2   . THR B  2  198  ? -104.986 57.708  1.415   1.00 87.65  ?  198  THR A CG2   1 
ATOM   2147  N  N     . LYS B  2  199  ? -108.818 58.653  3.303   1.00 88.07  ?  199  LYS A N     1 
ATOM   2148  C  CA    . LYS B  2  199  ? -110.015 59.336  3.771   1.00 90.96  ?  199  LYS A CA    1 
ATOM   2149  C  C     . LYS B  2  199  ? -110.032 60.817  3.405   1.00 101.72 ?  199  LYS A C     1 
ATOM   2150  O  O     . LYS B  2  199  ? -110.825 61.576  3.974   1.00 112.73 ?  199  LYS A O     1 
ATOM   2151  C  CB    . LYS B  2  199  ? -110.152 59.183  5.287   1.00 88.47  ?  199  LYS A CB    1 
ATOM   2152  C  CG    . LYS B  2  199  ? -110.311 57.756  5.776   1.00 91.74  ?  199  LYS A CG    1 
ATOM   2153  C  CD    . LYS B  2  199  ? -110.387 57.720  7.296   1.00 80.46  ?  199  LYS A CD    1 
ATOM   2154  C  CE    . LYS B  2  199  ? -110.588 56.306  7.816   1.00 84.05  ?  199  LYS A CE    1 
ATOM   2155  N  NZ    . LYS B  2  199  ? -110.602 56.264  9.304   1.00 80.25  ?  199  LYS A NZ    1 
ATOM   2156  N  N     . ASN B  2  200  ? -109.182 61.241  2.474   1.00 97.03  ?  200  ASN A N     1 
ATOM   2157  C  CA    . ASN B  2  200  ? -108.952 62.624  2.077   1.00 100.91 ?  200  ASN A CA    1 
ATOM   2158  C  C     . ASN B  2  200  ? -107.998 63.331  3.036   1.00 96.09  ?  200  ASN A C     1 
ATOM   2159  O  O     . ASN B  2  200  ? -107.556 64.439  2.730   1.00 103.73 ?  200  ASN A O     1 
ATOM   2160  C  CB    . ASN B  2  200  ? -110.247 63.452  1.962   1.00 93.84  ?  200  ASN A CB    1 
ATOM   2161  C  CG    . ASN B  2  200  ? -111.143 62.980  0.834   1.00 94.33  ?  200  ASN A CG    1 
ATOM   2162  O  OD1   . ASN B  2  200  ? -110.668 62.482  -0.186  1.00 99.72  ?  200  ASN A OD1   1 
ATOM   2163  N  ND2   . ASN B  2  200  ? -112.450 63.137  1.012   1.00 94.26  ?  200  ASN A ND2   1 
ATOM   2164  N  N     . SER B  2  201  ? -107.667 62.740  4.187   1.00 80.85  ?  201  SER A N     1 
ATOM   2165  C  CA    . SER B  2  201  ? -106.690 63.358  5.077   1.00 88.07  ?  201  SER A CA    1 
ATOM   2166  C  C     . SER B  2  201  ? -105.332 63.481  4.400   1.00 94.10  ?  201  SER A C     1 
ATOM   2167  O  O     . SER B  2  201  ? -104.620 64.473  4.593   1.00 107.34 ?  201  SER A O     1 
ATOM   2168  C  CB    . SER B  2  201  ? -106.573 62.554  6.371   1.00 89.26  ?  201  SER A CB    1 
ATOM   2169  O  OG    . SER B  2  201  ? -105.492 63.019  7.163   1.00 90.29  ?  201  SER A OG    1 
ATOM   2170  N  N     . ILE B  2  202  ? -104.951 62.478  3.609   1.00 86.02  ?  202  ILE A N     1 
ATOM   2171  C  CA    . ILE B  2  202  ? -103.720 62.498  2.829   1.00 94.38  ?  202  ILE A CA    1 
ATOM   2172  C  C     . ILE B  2  202  ? -103.965 61.727  1.539   1.00 95.02  ?  202  ILE A C     1 
ATOM   2173  O  O     . ILE B  2  202  ? -104.987 61.057  1.374   1.00 87.39  ?  202  ILE A O     1 
ATOM   2174  C  CB    . ILE B  2  202  ? -102.521 61.897  3.597   1.00 89.06  ?  202  ILE A CB    1 
ATOM   2175  C  CG1   . ILE B  2  202  ? -102.729 60.401  3.830   1.00 70.84  ?  202  ILE A CG1   1 
ATOM   2176  C  CG2   . ILE B  2  202  ? -102.311 62.625  4.917   1.00 103.33 ?  202  ILE A CG2   1 
ATOM   2177  C  CD1   . ILE B  2  202  ? -101.558 59.728  4.511   1.00 83.65  ?  202  ILE A CD1   1 
ATOM   2178  N  N     . SER B  2  203  ? -103.015 61.825  0.614   1.00 98.54  ?  203  SER A N     1 
ATOM   2179  C  CA    . SER B  2  203  ? -103.118 61.162  -0.675  1.00 89.69  ?  203  SER A CA    1 
ATOM   2180  C  C     . SER B  2  203  ? -102.569 59.746  -0.600  1.00 95.06  ?  203  SER A C     1 
ATOM   2181  O  O     . SER B  2  203  ? -101.725 59.433  0.246   1.00 92.56  ?  203  SER A O     1 
ATOM   2182  C  CB    . SER B  2  203  ? -102.358 61.955  -1.735  1.00 95.34  ?  203  SER A CB    1 
ATOM   2183  O  OG    . SER B  2  203  ? -100.967 61.961  -1.462  1.00 105.01 ?  203  SER A OG    1 
ATOM   2184  N  N     . PRO B  2  204  ? -103.031 58.862  -1.486  1.00 96.64  ?  204  PRO A N     1 
ATOM   2185  C  CA    . PRO B  2  204  ? -102.494 57.491  -1.498  1.00 91.57  ?  204  PRO A CA    1 
ATOM   2186  C  C     . PRO B  2  204  ? -100.981 57.446  -1.602  1.00 91.36  ?  204  PRO A C     1 
ATOM   2187  O  O     . PRO B  2  204  ? -100.337 56.627  -0.935  1.00 95.16  ?  204  PRO A O     1 
ATOM   2188  C  CB    . PRO B  2  204  ? -103.167 56.869  -2.728  1.00 83.62  ?  204  PRO A CB    1 
ATOM   2189  C  CG    . PRO B  2  204  ? -104.415 57.666  -2.925  1.00 84.12  ?  204  PRO A CG    1 
ATOM   2190  C  CD    . PRO B  2  204  ? -104.073 59.065  -2.505  1.00 95.45  ?  204  PRO A CD    1 
ATOM   2191  N  N     . ARG B  2  205  ? -100.393 58.316  -2.425  1.00 89.87  ?  205  ARG A N     1 
ATOM   2192  C  CA    . ARG B  2  205  ? -98.944  58.327  -2.588  1.00 93.90  ?  205  ARG A CA    1 
ATOM   2193  C  C     . ARG B  2  205  ? -98.248  58.617  -1.265  1.00 92.43  ?  205  ARG A C     1 
ATOM   2194  O  O     . ARG B  2  205  ? -97.284  57.938  -0.894  1.00 91.90  ?  205  ARG A O     1 
ATOM   2195  C  CB    . ARG B  2  205  ? -98.554  59.361  -3.643  1.00 104.49 ?  205  ARG A CB    1 
ATOM   2196  C  CG    . ARG B  2  205  ? -99.502  59.397  -4.829  1.00 110.29 ?  205  ARG A CG    1 
ATOM   2197  C  CD    . ARG B  2  205  ? -99.502  60.762  -5.488  1.00 114.79 ?  205  ARG A CD    1 
ATOM   2198  N  NE    . ARG B  2  205  ? -100.785 61.057  -6.117  1.00 122.64 ?  205  ARG A NE    1 
ATOM   2199  C  CZ    . ARG B  2  205  ? -101.122 62.247  -6.601  1.00 126.93 ?  205  ARG A CZ    1 
ATOM   2200  N  NH1   . ARG B  2  205  ? -100.268 63.259  -6.528  1.00 122.11 ?  205  ARG A NH1   1 
ATOM   2201  N  NH2   . ARG B  2  205  ? -102.313 62.429  -7.157  1.00 120.99 ?  205  ARG A NH2   1 
ATOM   2202  N  N     . ASP B  2  206  ? -98.727  59.630  -0.537  1.00 93.22  ?  206  ASP A N     1 
ATOM   2203  C  CA    . ASP B  2  206  ? -98.119  59.971  0.745   1.00 91.66  ?  206  ASP A CA    1 
ATOM   2204  C  C     . ASP B  2  206  ? -98.253  58.827  1.741   1.00 93.73  ?  206  ASP A C     1 
ATOM   2205  O  O     . ASP B  2  206  ? -97.303  58.511  2.467   1.00 92.61  ?  206  ASP A O     1 
ATOM   2206  C  CB    . ASP B  2  206  ? -98.749  61.247  1.303   1.00 97.79  ?  206  ASP A CB    1 
ATOM   2207  C  CG    . ASP B  2  206  ? -98.230  62.498  0.623   1.00 115.89 ?  206  ASP A CG    1 
ATOM   2208  O  OD1   . ASP B  2  206  ? -98.677  62.795  -0.505  1.00 117.50 ?  206  ASP A OD1   1 
ATOM   2209  O  OD2   . ASP B  2  206  ? -97.377  63.189  1.220   1.00 125.20 ?  206  ASP A OD2   1 
ATOM   2210  N  N     . ALA B  2  207  ? -99.428  58.196  1.794   1.00 88.19  ?  207  ALA A N     1 
ATOM   2211  C  CA    . ALA B  2  207  ? -99.610  57.054  2.685   1.00 93.71  ?  207  ALA A CA    1 
ATOM   2212  C  C     . ALA B  2  207  ? -98.641  55.932  2.335   1.00 93.86  ?  207  ALA A C     1 
ATOM   2213  O  O     . ALA B  2  207  ? -97.864  55.476  3.183   1.00 86.07  ?  207  ALA A O     1 
ATOM   2214  C  CB    . ALA B  2  207  ? -101.056 56.564  2.621   1.00 88.76  ?  207  ALA A CB    1 
ATOM   2215  N  N     . LEU B  2  208  ? -98.671  55.474  1.081   1.00 92.07  ?  208  LEU A N     1 
ATOM   2216  C  CA    . LEU B  2  208  ? -97.740  54.436  0.653   1.00 84.54  ?  208  LEU A CA    1 
ATOM   2217  C  C     . LEU B  2  208  ? -96.298  54.848  0.920   1.00 92.27  ?  208  LEU A C     1 
ATOM   2218  O  O     . LEU B  2  208  ? -95.463  54.013  1.287   1.00 90.42  ?  208  LEU A O     1 
ATOM   2219  C  CB    . LEU B  2  208  ? -97.950  54.125  -0.829  1.00 87.08  ?  208  LEU A CB    1 
ATOM   2220  C  CG    . LEU B  2  208  ? -96.993  53.111  -1.455  1.00 90.94  ?  208  LEU A CG    1 
ATOM   2221  C  CD1   . LEU B  2  208  ? -96.822  51.910  -0.543  1.00 88.71  ?  208  LEU A CD1   1 
ATOM   2222  C  CD2   . LEU B  2  208  ? -97.505  52.679  -2.820  1.00 96.43  ?  208  LEU A CD2   1 
ATOM   2223  N  N     . ALA B  2  209  ? -95.987  56.134  0.743   1.00 90.39  ?  209  ALA A N     1 
ATOM   2224  C  CA    . ALA B  2  209  ? -94.654  56.620  1.081   1.00 89.92  ?  209  ALA A CA    1 
ATOM   2225  C  C     . ALA B  2  209  ? -94.395  56.510  2.578   1.00 100.71 ?  209  ALA A C     1 
ATOM   2226  O  O     . ALA B  2  209  ? -93.282  56.175  3.001   1.00 99.27  ?  209  ALA A O     1 
ATOM   2227  C  CB    . ALA B  2  209  ? -94.485  58.064  0.608   1.00 93.68  ?  209  ALA A CB    1 
ATOM   2228  N  N     . SER B  2  210  ? -95.413  56.790  3.396   1.00 109.09 ?  210  SER A N     1 
ATOM   2229  C  CA    . SER B  2  210  ? -95.261  56.637  4.840   1.00 106.64 ?  210  SER A CA    1 
ATOM   2230  C  C     . SER B  2  210  ? -95.100  55.171  5.221   1.00 100.99 ?  210  SER A C     1 
ATOM   2231  O  O     . SER B  2  210  ? -94.296  54.837  6.099   1.00 103.78 ?  210  SER A O     1 
ATOM   2232  C  CB    . SER B  2  210  ? -96.459  57.252  5.563   1.00 91.30  ?  210  SER A CB    1 
ATOM   2233  O  OG    . SER B  2  210  ? -97.666  56.625  5.167   1.00 99.75  ?  210  SER A OG    1 
ATOM   2234  N  N     . ALA B  2  211  ? -95.859  54.283  4.575   1.00 99.93  ?  211  ALA A N     1 
ATOM   2235  C  CA    . ALA B  2  211  ? -95.688  52.856  4.821   1.00 100.20 ?  211  ALA A CA    1 
ATOM   2236  C  C     . ALA B  2  211  ? -94.318  52.380  4.356   1.00 99.08  ?  211  ALA A C     1 
ATOM   2237  O  O     . ALA B  2  211  ? -93.651  51.609  5.056   1.00 94.78  ?  211  ALA A O     1 
ATOM   2238  C  CB    . ALA B  2  211  ? -96.798  52.065  4.129   1.00 96.33  ?  211  ALA A CB    1 
ATOM   2239  N  N     . GLY B  2  212  ? -93.882  52.828  3.177   1.00 99.52  ?  212  GLY A N     1 
ATOM   2240  C  CA    . GLY B  2  212  ? -92.552  52.469  2.713   1.00 97.18  ?  212  GLY A CA    1 
ATOM   2241  C  C     . GLY B  2  212  ? -91.474  52.866  3.701   1.00 98.38  ?  212  GLY A C     1 
ATOM   2242  O  O     . GLY B  2  212  ? -90.600  52.067  4.045   1.00 90.37  ?  212  GLY A O     1 
ATOM   2243  N  N     . GLY B  2  213  ? -91.525  54.112  4.177   1.00 108.55 ?  213  GLY A N     1 
ATOM   2244  C  CA    . GLY B  2  213  ? -90.566  54.550  5.174   1.00 107.73 ?  213  GLY A CA    1 
ATOM   2245  C  C     . GLY B  2  213  ? -90.633  53.741  6.453   1.00 106.35 ?  213  GLY A C     1 
ATOM   2246  O  O     . GLY B  2  213  ? -89.621  53.572  7.140   1.00 107.12 ?  213  GLY A O     1 
ATOM   2247  N  N     . THR B  2  214  ? -91.818  53.229  6.791   1.00 104.96 ?  214  THR A N     1 
ATOM   2248  C  CA    . THR B  2  214  ? -91.954  52.415  7.994   1.00 97.65  ?  214  THR A CA    1 
ATOM   2249  C  C     . THR B  2  214  ? -91.274  51.064  7.816   1.00 99.74  ?  214  THR A C     1 
ATOM   2250  O  O     . THR B  2  214  ? -90.517  50.618  8.685   1.00 101.74 ?  214  THR A O     1 
ATOM   2251  C  CB    . THR B  2  214  ? -93.433  52.231  8.342   1.00 97.71  ?  214  THR A CB    1 
ATOM   2252  O  OG1   . THR B  2  214  ? -94.101  53.497  8.300   1.00 111.53 ?  214  THR A OG1   1 
ATOM   2253  C  CG2   . THR B  2  214  ? -93.579  51.640  9.736   1.00 86.05  ?  214  THR A CG2   1 
ATOM   2254  N  N     . LEU B  2  215  ? -91.531  50.398  6.689   1.00 105.62 ?  215  LEU A N     1 
ATOM   2255  C  CA    . LEU B  2  215  ? -90.914  49.100  6.438   1.00 98.99  ?  215  LEU A CA    1 
ATOM   2256  C  C     . LEU B  2  215  ? -89.413  49.239  6.210   1.00 102.34 ?  215  LEU A C     1 
ATOM   2257  O  O     . LEU B  2  215  ? -88.616  48.488  6.786   1.00 92.99  ?  215  LEU A O     1 
ATOM   2258  C  CB    . LEU B  2  215  ? -91.586  48.425  5.241   1.00 95.31  ?  215  LEU A CB    1 
ATOM   2259  C  CG    . LEU B  2  215  ? -92.671  47.398  5.572   1.00 87.10  ?  215  LEU A CG    1 
ATOM   2260  C  CD1   . LEU B  2  215  ? -93.355  47.741  6.882   1.00 84.00  ?  215  LEU A CD1   1 
ATOM   2261  C  CD2   . LEU B  2  215  ? -93.688  47.317  4.445   1.00 88.69  ?  215  LEU A CD2   1 
ATOM   2262  N  N     . VAL B  2  216  ? -89.008  50.199  5.374   1.00 105.00 ?  216  VAL A N     1 
ATOM   2263  C  CA    . VAL B  2  216  ? -87.585  50.396  5.097   1.00 95.11  ?  216  VAL A CA    1 
ATOM   2264  C  C     . VAL B  2  216  ? -86.808  50.553  6.398   1.00 92.16  ?  216  VAL A C     1 
ATOM   2265  O  O     . VAL B  2  216  ? -85.816  49.855  6.641   1.00 95.81  ?  216  VAL A O     1 
ATOM   2266  C  CB    . VAL B  2  216  ? -87.381  51.609  4.173   1.00 96.13  ?  216  VAL A CB    1 
ATOM   2267  C  CG1   . VAL B  2  216  ? -85.914  52.010  4.149   1.00 96.03  ?  216  VAL A CG1   1 
ATOM   2268  C  CG2   . VAL B  2  216  ? -87.875  51.294  2.768   1.00 81.33  ?  216  VAL A CG2   1 
ATOM   2269  N  N     . GLU B  2  217  ? -87.250  51.477  7.256   1.00 95.47  ?  217  GLU A N     1 
ATOM   2270  C  CA    . GLU B  2  217  ? -86.595  51.673  8.543   1.00 106.49 ?  217  GLU A CA    1 
ATOM   2271  C  C     . GLU B  2  217  ? -86.665  50.428  9.412   1.00 105.27 ?  217  GLU A C     1 
ATOM   2272  O  O     . GLU B  2  217  ? -85.888  50.309  10.368  1.00 113.66 ?  217  GLU A O     1 
ATOM   2273  C  CB    . GLU B  2  217  ? -87.235  52.841  9.299   1.00 111.97 ?  217  GLU A CB    1 
ATOM   2274  C  CG    . GLU B  2  217  ? -86.549  53.196  10.618  1.00 110.17 ?  217  GLU A CG    1 
ATOM   2275  C  CD    . GLU B  2  217  ? -85.483  54.270  10.458  1.00 143.18 ?  217  GLU A CD    1 
ATOM   2276  O  OE1   . GLU B  2  217  ? -85.830  55.410  10.077  1.00 147.71 ?  217  GLU A OE1   1 
ATOM   2277  O  OE2   . GLU B  2  217  ? -84.297  53.972  10.708  1.00 154.83 ?  217  GLU A OE2   1 
ATOM   2278  N  N     . LEU B  2  218  ? -87.570  49.497  9.105   1.00 102.09 ?  218  LEU A N     1 
ATOM   2279  C  CA    . LEU B  2  218  ? -87.810  48.393  10.024  1.00 105.86 ?  218  LEU A CA    1 
ATOM   2280  C  C     . LEU B  2  218  ? -86.860  47.227  9.761   1.00 105.29 ?  218  LEU A C     1 
ATOM   2281  O  O     . LEU B  2  218  ? -86.300  46.650  10.699  1.00 103.37 ?  218  LEU A O     1 
ATOM   2282  C  CB    . LEU B  2  218  ? -89.273  47.939  9.912   1.00 104.14 ?  218  LEU A CB    1 
ATOM   2283  C  CG    . LEU B  2  218  ? -89.856  47.230  11.141  1.00 91.26  ?  218  LEU A CG    1 
ATOM   2284  C  CD1   . LEU B  2  218  ? -89.701  48.083  12.393  1.00 73.91  ?  218  LEU A CD1   1 
ATOM   2285  C  CD2   . LEU B  2  218  ? -91.317  46.890  10.901  1.00 90.42  ?  218  LEU A CD2   1 
ATOM   2286  N  N     . PHE B  2  219  ? -86.672  46.855  8.494   1.00 101.10 ?  219  PHE A N     1 
ATOM   2287  C  CA    . PHE B  2  219  ? -85.788  45.745  8.128   1.00 95.31  ?  219  PHE A CA    1 
ATOM   2288  C  C     . PHE B  2  219  ? -84.348  46.121  8.470   1.00 96.10  ?  219  PHE A C     1 
ATOM   2289  O  O     . PHE B  2  219  ? -83.662  46.793  7.696   1.00 97.93  ?  219  PHE A O     1 
ATOM   2290  C  CB    . PHE B  2  219  ? -85.940  45.411  6.647   1.00 85.52  ?  219  PHE A CB    1 
ATOM   2291  C  CG    . PHE B  2  219  ? -87.327  44.971  6.261   1.00 86.86  ?  219  PHE A CG    1 
ATOM   2292  C  CD1   . PHE B  2  219  ? -87.757  43.686  6.538   1.00 89.09  ?  219  PHE A CD1   1 
ATOM   2293  C  CD2   . PHE B  2  219  ? -88.194  45.836  5.613   1.00 89.45  ?  219  PHE A CD2   1 
ATOM   2294  C  CE1   . PHE B  2  219  ? -89.027  43.270  6.183   1.00 62.97  ?  219  PHE A CE1   1 
ATOM   2295  C  CE2   . PHE B  2  219  ? -89.467  45.423  5.253   1.00 88.71  ?  219  PHE A CE2   1 
ATOM   2296  C  CZ    . PHE B  2  219  ? -89.881  44.136  5.540   1.00 67.75  ?  219  PHE A CZ    1 
ATOM   2297  N  N     . GLY B  2  220  ? -83.887  45.687  9.637   1.00 89.68  ?  220  GLY A N     1 
ATOM   2298  C  CA    . GLY B  2  220  ? -82.554  46.004  10.127  1.00 91.56  ?  220  GLY A CA    1 
ATOM   2299  C  C     . GLY B  2  220  ? -81.635  44.803  9.994   1.00 110.42 ?  220  GLY A C     1 
ATOM   2300  O  O     . GLY B  2  220  ? -82.019  43.677  10.323  1.00 98.32  ?  220  GLY A O     1 
ATOM   2301  N  N     . LEU B  2  221  ? -80.425  45.053  9.502   1.00 125.52 ?  221  LEU A N     1 
ATOM   2302  C  CA    . LEU B  2  221  ? -79.404  44.028  9.326   1.00 103.68 ?  221  LEU A CA    1 
ATOM   2303  C  C     . LEU B  2  221  ? -78.174  44.422  10.130  1.00 113.88 ?  221  LEU A C     1 
ATOM   2304  O  O     . LEU B  2  221  ? -77.529  45.432  9.828   1.00 108.52 ?  221  LEU A O     1 
ATOM   2305  C  CB    . LEU B  2  221  ? -79.051  43.855  7.847   1.00 109.32 ?  221  LEU A CB    1 
ATOM   2306  C  CG    . LEU B  2  221  ? -78.957  45.137  7.016   1.00 103.36 ?  221  LEU A CG    1 
ATOM   2307  C  CD1   . LEU B  2  221  ? -77.714  45.124  6.145   1.00 101.43 ?  221  LEU A CD1   1 
ATOM   2308  C  CD2   . LEU B  2  221  ? -80.205  45.306  6.160   1.00 101.53 ?  221  LEU A CD2   1 
ATOM   2309  N  N     . ALA B  2  222  ? -77.855  43.629  11.148  1.00 119.46 ?  222  ALA A N     1 
ATOM   2310  C  CA    . ALA B  2  222  ? -76.700  43.900  11.996  1.00 123.43 ?  222  ALA A CA    1 
ATOM   2311  C  C     . ALA B  2  222  ? -76.221  42.628  12.688  1.00 119.87 ?  222  ALA A C     1 
ATOM   2312  O  O     . ALA B  2  222  ? -76.494  42.412  13.869  1.00 123.63 ?  222  ALA A O     1 
ATOM   2313  C  CB    . ALA B  2  222  ? -77.037  44.970  13.024  1.00 105.45 ?  222  ALA A CB    1 
ATOM   2314  N  N     . LEU C  2  2    ? -92.742  59.607  14.664  1.00 96.78  ?  2    LEU B N     1 
ATOM   2315  C  CA    . LEU C  2  2    ? -93.118  58.505  15.542  1.00 110.83 ?  2    LEU B CA    1 
ATOM   2316  C  C     . LEU C  2  2    ? -91.888  57.722  15.994  1.00 113.56 ?  2    LEU B C     1 
ATOM   2317  O  O     . LEU C  2  2    ? -90.882  57.668  15.287  1.00 122.20 ?  2    LEU B O     1 
ATOM   2318  C  CB    . LEU C  2  2    ? -94.108  57.584  14.844  1.00 107.75 ?  2    LEU B CB    1 
ATOM   2319  N  N     . ILE C  2  3    ? -91.977  57.118  17.177  1.00 109.92 ?  3    ILE B N     1 
ATOM   2320  C  CA    . ILE C  2  3    ? -90.889  56.340  17.757  1.00 114.34 ?  3    ILE B CA    1 
ATOM   2321  C  C     . ILE C  2  3    ? -91.445  55.011  18.247  1.00 119.76 ?  3    ILE B C     1 
ATOM   2322  O  O     . ILE C  2  3    ? -92.543  54.956  18.812  1.00 120.23 ?  3    ILE B O     1 
ATOM   2323  C  CB    . ILE C  2  3    ? -90.195  57.100  18.907  1.00 112.77 ?  3    ILE B CB    1 
ATOM   2324  C  CG1   . ILE C  2  3    ? -89.336  58.240  18.354  1.00 100.66 ?  3    ILE B CG1   1 
ATOM   2325  C  CG2   . ILE C  2  3    ? -89.361  56.148  19.753  1.00 115.63 ?  3    ILE B CG2   1 
ATOM   2326  C  CD1   . ILE C  2  3    ? -88.573  59.003  19.417  1.00 103.72 ?  3    ILE B CD1   1 
ATOM   2327  N  N     . SER C  2  4    ? -90.683  53.939  18.032  1.00 120.51 ?  4    SER B N     1 
ATOM   2328  C  CA    . SER C  2  4    ? -91.103  52.607  18.451  1.00 127.37 ?  4    SER B CA    1 
ATOM   2329  C  C     . SER C  2  4    ? -90.567  52.268  19.837  1.00 132.43 ?  4    SER B C     1 
ATOM   2330  O  O     . SER C  2  4    ? -90.364  53.160  20.667  1.00 132.74 ?  4    SER B O     1 
ATOM   2331  C  CB    . SER C  2  4    ? -90.646  51.555  17.439  1.00 119.58 ?  4    SER B CB    1 
ATOM   2332  O  OG    . SER C  2  4    ? -91.423  51.617  16.256  1.00 113.78 ?  4    SER B OG    1 
ATOM   2333  N  N     . GLN C  2  5    ? -90.332  50.979  20.093  1.00 128.85 ?  5    GLN B N     1 
ATOM   2334  C  CA    . GLN C  2  5    ? -89.898  50.509  21.404  1.00 127.05 ?  5    GLN B CA    1 
ATOM   2335  C  C     . GLN C  2  5    ? -88.582  49.742  21.337  1.00 120.17 ?  5    GLN B C     1 
ATOM   2336  O  O     . GLN C  2  5    ? -88.275  48.964  22.247  1.00 110.43 ?  5    GLN B O     1 
ATOM   2337  C  CB    . GLN C  2  5    ? -90.987  49.650  22.047  1.00 119.98 ?  5    GLN B CB    1 
ATOM   2338  C  CG    . GLN C  2  5    ? -92.340  50.338  22.099  1.00 122.44 ?  5    GLN B CG    1 
ATOM   2339  C  CD    . GLN C  2  5    ? -92.252  51.737  22.675  1.00 122.28 ?  5    GLN B CD    1 
ATOM   2340  O  OE1   . GLN C  2  5    ? -92.855  52.675  22.153  1.00 122.03 ?  5    GLN B OE1   1 
ATOM   2341  N  NE2   . GLN C  2  5    ? -91.497  51.885  23.759  1.00 122.00 ?  5    GLN B NE2   1 
ATOM   2342  N  N     . ARG C  2  6    ? -87.801  49.943  20.277  1.00 122.05 ?  6    ARG B N     1 
ATOM   2343  C  CA    . ARG C  2  6    ? -86.471  49.358  20.154  1.00 121.92 ?  6    ARG B CA    1 
ATOM   2344  C  C     . ARG C  2  6    ? -86.539  47.842  20.008  1.00 112.79 ?  6    ARG B C     1 
ATOM   2345  O  O     . ARG C  2  6    ? -86.145  47.111  20.926  1.00 105.17 ?  6    ARG B O     1 
ATOM   2346  C  CB    . ARG C  2  6    ? -85.609  49.732  21.362  1.00 115.06 ?  6    ARG B CB    1 
ATOM   2347  N  N     . PRO C  2  7    ? -87.030  47.331  18.880  1.00 110.92 ?  7    PRO B N     1 
ATOM   2348  C  CA    . PRO C  2  7    ? -86.961  45.885  18.644  1.00 103.60 ?  7    PRO B CA    1 
ATOM   2349  C  C     . PRO C  2  7    ? -85.535  45.459  18.329  1.00 115.62 ?  7    PRO B C     1 
ATOM   2350  O  O     . PRO C  2  7    ? -84.808  46.145  17.605  1.00 118.48 ?  7    PRO B O     1 
ATOM   2351  C  CB    . PRO C  2  7    ? -87.890  45.677  17.443  1.00 96.89  ?  7    PRO B CB    1 
ATOM   2352  C  CG    . PRO C  2  7    ? -87.844  46.982  16.717  1.00 100.05 ?  7    PRO B CG    1 
ATOM   2353  C  CD    . PRO C  2  7    ? -87.704  48.043  17.780  1.00 112.43 ?  7    PRO B CD    1 
ATOM   2354  N  N     . THR C  2  8    ? -85.137  44.318  18.882  1.00 112.25 ?  8    THR B N     1 
ATOM   2355  C  CA    . THR C  2  8    ? -83.776  43.820  18.756  1.00 107.67 ?  8    THR B CA    1 
ATOM   2356  C  C     . THR C  2  8    ? -83.735  42.585  17.864  1.00 111.65 ?  8    THR B C     1 
ATOM   2357  O  O     . THR C  2  8    ? -84.753  41.934  17.613  1.00 110.84 ?  8    THR B O     1 
ATOM   2358  C  CB    . THR C  2  8    ? -83.184  43.489  20.130  1.00 105.67 ?  8    THR B CB    1 
ATOM   2359  O  OG1   . THR C  2  8    ? -83.875  42.366  20.691  1.00 111.42 ?  8    THR B OG1   1 
ATOM   2360  C  CG2   . THR C  2  8    ? -83.322  44.680  21.066  1.00 112.14 ?  8    THR B CG2   1 
ATOM   2361  N  N     . LEU C  2  9    ? -82.532  42.269  17.387  1.00 109.59 ?  9    LEU B N     1 
ATOM   2362  C  CA    . LEU C  2  9    ? -82.296  41.126  16.511  1.00 104.16 ?  9    LEU B CA    1 
ATOM   2363  C  C     . LEU C  2  9    ? -81.294  40.197  17.184  1.00 106.97 ?  9    LEU B C     1 
ATOM   2364  O  O     . LEU C  2  9    ? -80.114  40.539  17.317  1.00 92.91  ?  9    LEU B O     1 
ATOM   2365  C  CB    . LEU C  2  9    ? -81.793  41.580  15.141  1.00 96.06  ?  9    LEU B CB    1 
ATOM   2366  C  CG    . LEU C  2  9    ? -81.458  40.475  14.136  1.00 100.11 ?  9    LEU B CG    1 
ATOM   2367  C  CD1   . LEU C  2  9    ? -82.607  39.489  14.017  1.00 97.22  ?  9    LEU B CD1   1 
ATOM   2368  C  CD2   . LEU C  2  9    ? -81.127  41.075  12.780  1.00 100.73 ?  9    LEU B CD2   1 
ATOM   2369  N  N     . SER C  2  10   ? -81.765  39.026  17.608  1.00 114.39 ?  10   SER B N     1 
ATOM   2370  C  CA    . SER C  2  10   ? -80.935  38.026  18.261  1.00 112.28 ?  10   SER B CA    1 
ATOM   2371  C  C     . SER C  2  10   ? -80.848  36.779  17.391  1.00 111.12 ?  10   SER B C     1 
ATOM   2372  O  O     . SER C  2  10   ? -81.769  36.469  16.628  1.00 116.64 ?  10   SER B O     1 
ATOM   2373  C  CB    . SER C  2  10   ? -81.489  37.660  19.645  1.00 117.93 ?  10   SER B CB    1 
ATOM   2374  O  OG    . SER C  2  10   ? -80.710  36.646  20.256  1.00 120.11 ?  10   SER B OG    1 
ATOM   2375  N  N     . GLU C  2  11   ? -79.732  36.063  17.514  1.00 119.85 ?  11   GLU B N     1 
ATOM   2376  C  CA    . GLU C  2  11   ? -79.475  34.872  16.716  1.00 122.01 ?  11   GLU B CA    1 
ATOM   2377  C  C     . GLU C  2  11   ? -78.927  33.768  17.606  1.00 116.07 ?  11   GLU B C     1 
ATOM   2378  O  O     . GLU C  2  11   ? -77.993  33.996  18.380  1.00 108.45 ?  11   GLU B O     1 
ATOM   2379  C  CB    . GLU C  2  11   ? -78.490  35.167  15.580  1.00 114.88 ?  11   GLU B CB    1 
ATOM   2380  N  N     . GLU C  2  12   ? -79.510  32.577  17.494  1.00 119.93 ?  12   GLU B N     1 
ATOM   2381  C  CA    . GLU C  2  12   ? -79.039  31.392  18.198  1.00 122.85 ?  12   GLU B CA    1 
ATOM   2382  C  C     . GLU C  2  12   ? -78.632  30.348  17.170  1.00 123.85 ?  12   GLU B C     1 
ATOM   2383  O  O     . GLU C  2  12   ? -79.428  29.989  16.297  1.00 128.22 ?  12   GLU B O     1 
ATOM   2384  C  CB    . GLU C  2  12   ? -80.116  30.834  19.132  1.00 128.89 ?  12   GLU B CB    1 
ATOM   2385  C  CG    . GLU C  2  12   ? -79.599  29.799  20.118  1.00 136.88 ?  12   GLU B CG    1 
ATOM   2386  C  CD    . GLU C  2  12   ? -80.698  29.213  20.986  1.00 140.68 ?  12   GLU B CD    1 
ATOM   2387  O  OE1   . GLU C  2  12   ? -81.726  28.770  20.431  1.00 145.60 ?  12   GLU B OE1   1 
ATOM   2388  O  OE2   . GLU C  2  12   ? -80.533  29.199  22.224  1.00 141.38 ?  12   GLU B OE2   1 
ATOM   2389  N  N     . THR C  2  13   ? -77.396  29.866  17.272  1.00 125.64 ?  13   THR B N     1 
ATOM   2390  C  CA    . THR C  2  13   ? -76.852  28.942  16.284  1.00 136.78 ?  13   THR B CA    1 
ATOM   2391  C  C     . THR C  2  13   ? -77.293  27.519  16.605  1.00 133.16 ?  13   THR B C     1 
ATOM   2392  O  O     . THR C  2  13   ? -76.931  26.970  17.651  1.00 126.53 ?  13   THR B O     1 
ATOM   2393  C  CB    . THR C  2  13   ? -75.328  29.039  16.249  1.00 132.33 ?  13   THR B CB    1 
ATOM   2394  O  OG1   . THR C  2  13   ? -74.937  30.418  16.237  1.00 140.03 ?  13   THR B OG1   1 
ATOM   2395  C  CG2   . THR C  2  13   ? -74.780  28.354  15.005  1.00 126.96 ?  13   THR B CG2   1 
ATOM   2396  N  N     . VAL C  2  14   ? -78.072  26.923  15.702  1.00 126.14 ?  14   VAL B N     1 
ATOM   2397  C  CA    . VAL C  2  14   ? -78.522  25.548  15.893  1.00 122.70 ?  14   VAL B CA    1 
ATOM   2398  C  C     . VAL C  2  14   ? -77.426  24.566  15.502  1.00 136.53 ?  14   VAL B C     1 
ATOM   2399  O  O     . VAL C  2  14   ? -77.125  23.621  16.239  1.00 140.37 ?  14   VAL B O     1 
ATOM   2400  C  CB    . VAL C  2  14   ? -79.816  25.295  15.097  1.00 129.42 ?  14   VAL B CB    1 
ATOM   2401  C  CG1   . VAL C  2  14   ? -80.340  23.891  15.360  1.00 132.22 ?  14   VAL B CG1   1 
ATOM   2402  C  CG2   . VAL C  2  14   ? -80.866  26.340  15.444  1.00 135.33 ?  14   VAL B CG2   1 
ATOM   2403  N  N     . ALA C  2  15   ? -76.815  24.776  14.340  1.00 137.03 ?  15   ALA B N     1 
ATOM   2404  C  CA    . ALA C  2  15   ? -75.734  23.926  13.860  1.00 123.30 ?  15   ALA B CA    1 
ATOM   2405  C  C     . ALA C  2  15   ? -74.757  24.797  13.077  1.00 121.30 ?  15   ALA B C     1 
ATOM   2406  O  O     . ALA C  2  15   ? -74.858  26.027  13.076  1.00 121.45 ?  15   ALA B O     1 
ATOM   2407  C  CB    . ALA C  2  15   ? -76.283  22.766  13.020  1.00 115.36 ?  15   ALA B CB    1 
ATOM   2408  N  N     . GLU C  2  16   ? -73.801  24.151  12.405  1.00 124.23 ?  16   GLU B N     1 
ATOM   2409  C  CA    . GLU C  2  16   ? -72.826  24.899  11.619  1.00 132.56 ?  16   GLU B CA    1 
ATOM   2410  C  C     . GLU C  2  16   ? -73.491  25.672  10.490  1.00 127.10 ?  16   GLU B C     1 
ATOM   2411  O  O     . GLU C  2  16   ? -73.028  26.759  10.124  1.00 130.62 ?  16   GLU B O     1 
ATOM   2412  C  CB    . GLU C  2  16   ? -71.762  23.953  11.061  1.00 133.53 ?  16   GLU B CB    1 
ATOM   2413  N  N     . ASN C  2  17   ? -74.574  25.136  9.928   1.00 114.72 ?  17   ASN B N     1 
ATOM   2414  C  CA    . ASN C  2  17   ? -75.286  25.781  8.832   1.00 119.29 ?  17   ASN B CA    1 
ATOM   2415  C  C     . ASN C  2  17   ? -76.774  25.905  9.133   1.00 124.07 ?  17   ASN B C     1 
ATOM   2416  O  O     . ASN C  2  17   ? -77.602  25.889  8.217   1.00 125.66 ?  17   ASN B O     1 
ATOM   2417  C  CB    . ASN C  2  17   ? -75.067  25.026  7.523   1.00 109.37 ?  17   ASN B CB    1 
ATOM   2418  C  CG    . ASN C  2  17   ? -73.747  25.369  6.869   1.00 119.54 ?  17   ASN B CG    1 
ATOM   2419  O  OD1   . ASN C  2  17   ? -72.956  26.143  7.409   1.00 114.11 ?  17   ASN B OD1   1 
ATOM   2420  N  ND2   . ASN C  2  17   ? -73.498  24.790  5.700   1.00 131.62 ?  17   ASN B ND2   1 
ATOM   2421  N  N     . ARG C  2  18   ? -77.130  26.032  10.409  1.00 126.78 ?  18   ARG B N     1 
ATOM   2422  C  CA    . ARG C  2  18   ? -78.527  26.170  10.808  1.00 121.27 ?  18   ARG B CA    1 
ATOM   2423  C  C     . ARG C  2  18   ? -78.591  27.092  12.014  1.00 123.54 ?  18   ARG B C     1 
ATOM   2424  O  O     . ARG C  2  18   ? -77.979  26.805  13.048  1.00 125.26 ?  18   ARG B O     1 
ATOM   2425  C  CB    . ARG C  2  18   ? -79.143  24.809  11.133  1.00 125.31 ?  18   ARG B CB    1 
ATOM   2426  C  CG    . ARG C  2  18   ? -80.624  24.858  11.469  1.00 123.57 ?  18   ARG B CG    1 
ATOM   2427  C  CD    . ARG C  2  18   ? -81.105  23.521  12.003  1.00 119.70 ?  18   ARG B CD    1 
ATOM   2428  N  NE    . ARG C  2  18   ? -82.552  23.498  12.192  1.00 119.31 ?  18   ARG B NE    1 
ATOM   2429  C  CZ    . ARG C  2  18   ? -83.410  22.964  11.329  1.00 124.17 ?  18   ARG B CZ    1 
ATOM   2430  N  NH1   . ARG C  2  18   ? -82.968  22.400  10.213  1.00 126.77 ?  18   ARG B NH1   1 
ATOM   2431  N  NH2   . ARG C  2  18   ? -84.711  22.989  11.584  1.00 115.01 ?  18   ARG B NH2   1 
ATOM   2432  N  N     . SER C  2  19   ? -79.320  28.197  11.881  1.00 125.10 ?  19   SER B N     1 
ATOM   2433  C  CA    . SER C  2  19   ? -79.451  29.160  12.964  1.00 126.44 ?  19   SER B CA    1 
ATOM   2434  C  C     . SER C  2  19   ? -80.849  29.759  12.935  1.00 119.75 ?  19   SER B C     1 
ATOM   2435  O  O     . SER C  2  19   ? -81.415  29.982  11.861  1.00 122.44 ?  19   SER B O     1 
ATOM   2436  C  CB    . SER C  2  19   ? -78.398  30.270  12.861  1.00 121.04 ?  19   SER B CB    1 
ATOM   2437  O  OG    . SER C  2  19   ? -77.086  29.744  12.966  1.00 124.46 ?  19   SER B OG    1 
ATOM   2438  N  N     . ARG C  2  20   ? -81.395  30.017  14.120  1.00 118.41 ?  20   ARG B N     1 
ATOM   2439  C  CA    . ARG C  2  20   ? -82.702  30.639  14.271  1.00 115.89 ?  20   ARG B CA    1 
ATOM   2440  C  C     . ARG C  2  20   ? -82.532  32.057  14.801  1.00 116.45 ?  20   ARG B C     1 
ATOM   2441  O  O     . ARG C  2  20   ? -81.652  32.321  15.625  1.00 121.79 ?  20   ARG B O     1 
ATOM   2442  C  CB    . ARG C  2  20   ? -83.594  29.830  15.217  1.00 107.44 ?  20   ARG B CB    1 
ATOM   2443  C  CG    . ARG C  2  20   ? -83.336  30.091  16.693  1.00 108.36 ?  20   ARG B CG    1 
ATOM   2444  C  CD    . ARG C  2  20   ? -84.074  29.093  17.571  1.00 114.00 ?  20   ARG B CD    1 
ATOM   2445  N  NE    . ARG C  2  20   ? -84.076  29.497  18.974  1.00 128.93 ?  20   ARG B NE    1 
ATOM   2446  C  CZ    . ARG C  2  20   ? -85.124  30.028  19.595  1.00 128.90 ?  20   ARG B CZ    1 
ATOM   2447  N  NH1   . ARG C  2  20   ? -85.037  30.370  20.874  1.00 128.50 ?  20   ARG B NH1   1 
ATOM   2448  N  NH2   . ARG C  2  20   ? -86.263  30.210  18.941  1.00 127.30 ?  20   ARG B NH2   1 
ATOM   2449  N  N     . PHE C  2  21   ? -83.378  32.965  14.325  1.00 105.55 ?  21   PHE B N     1 
ATOM   2450  C  CA    . PHE C  2  21   ? -83.310  34.367  14.703  1.00 110.03 ?  21   PHE B CA    1 
ATOM   2451  C  C     . PHE C  2  21   ? -84.609  34.789  15.379  1.00 115.28 ?  21   PHE B C     1 
ATOM   2452  O  O     . PHE C  2  21   ? -85.669  34.192  15.168  1.00 120.79 ?  21   PHE B O     1 
ATOM   2453  C  CB    . PHE C  2  21   ? -83.035  35.256  13.484  1.00 123.77 ?  21   PHE B CB    1 
ATOM   2454  C  CG    . PHE C  2  21   ? -81.827  34.840  12.692  1.00 125.86 ?  21   PHE B CG    1 
ATOM   2455  C  CD1   . PHE C  2  21   ? -80.562  35.275  13.052  1.00 118.01 ?  21   PHE B CD1   1 
ATOM   2456  C  CD2   . PHE C  2  21   ? -81.956  34.012  11.589  1.00 116.25 ?  21   PHE B CD2   1 
ATOM   2457  C  CE1   . PHE C  2  21   ? -79.449  34.893  12.328  1.00 123.35 ?  21   PHE B CE1   1 
ATOM   2458  C  CE2   . PHE C  2  21   ? -80.848  33.627  10.860  1.00 111.56 ?  21   PHE B CE2   1 
ATOM   2459  C  CZ    . PHE C  2  21   ? -79.592  34.068  11.230  1.00 123.06 ?  21   PHE B CZ    1 
ATOM   2460  N  N     . VAL C  2  22   ? -84.513  35.831  16.201  1.00 109.42 ?  22   VAL B N     1 
ATOM   2461  C  CA    . VAL C  2  22   ? -85.650  36.344  16.957  1.00 105.17 ?  22   VAL B CA    1 
ATOM   2462  C  C     . VAL C  2  22   ? -85.599  37.865  16.950  1.00 103.40 ?  22   VAL B C     1 
ATOM   2463  O  O     . VAL C  2  22   ? -84.528  38.463  17.100  1.00 105.64 ?  22   VAL B O     1 
ATOM   2464  C  CB    . VAL C  2  22   ? -85.662  35.807  18.404  1.00 107.89 ?  22   VAL B CB    1 
ATOM   2465  C  CG1   . VAL C  2  22   ? -85.659  34.286  18.407  1.00 120.36 ?  22   VAL B CG1   1 
ATOM   2466  C  CG2   . VAL C  2  22   ? -84.476  36.352  19.185  1.00 113.34 ?  22   VAL B CG2   1 
ATOM   2467  N  N     . ILE C  2  23   ? -86.761  38.489  16.775  1.00 101.28 ?  23   ILE B N     1 
ATOM   2468  C  CA    . ILE C  2  23   ? -86.901  39.940  16.810  1.00 99.12  ?  23   ILE B CA    1 
ATOM   2469  C  C     . ILE C  2  23   ? -87.879  40.283  17.924  1.00 106.97 ?  23   ILE B C     1 
ATOM   2470  O  O     . ILE C  2  23   ? -89.014  39.787  17.935  1.00 103.76 ?  23   ILE B O     1 
ATOM   2471  C  CB    . ILE C  2  23   ? -87.378  40.503  15.463  1.00 91.40  ?  23   ILE B CB    1 
ATOM   2472  C  CG1   . ILE C  2  23   ? -86.367  40.172  14.365  1.00 84.00  ?  23   ILE B CG1   1 
ATOM   2473  C  CG2   . ILE C  2  23   ? -87.593  42.005  15.560  1.00 90.56  ?  23   ILE B CG2   1 
ATOM   2474  C  CD1   . ILE C  2  23   ? -86.768  40.671  12.997  1.00 79.77  ?  23   ILE B CD1   1 
ATOM   2475  N  N     . GLU C  2  24   ? -87.444  41.126  18.855  1.00 94.00  ?  24   GLU B N     1 
ATOM   2476  C  CA    . GLU C  2  24   ? -88.234  41.418  20.044  1.00 90.65  ?  24   GLU B CA    1 
ATOM   2477  C  C     . GLU C  2  24   ? -88.018  42.845  20.537  1.00 101.03 ?  24   GLU B C     1 
ATOM   2478  O  O     . GLU C  2  24   ? -86.879  43.284  20.697  1.00 110.74 ?  24   GLU B O     1 
ATOM   2479  C  CB    . GLU C  2  24   ? -87.885  40.428  21.159  1.00 97.07  ?  24   GLU B CB    1 
ATOM   2480  C  CG    . GLU C  2  24   ? -89.069  39.656  21.720  1.00 110.35 ?  24   GLU B CG    1 
ATOM   2481  C  CD    . GLU C  2  24   ? -88.661  38.690  22.818  1.00 114.91 ?  24   GLU B CD    1 
ATOM   2482  O  OE1   . GLU C  2  24   ? -87.447  38.572  23.086  1.00 119.26 ?  24   GLU B OE1   1 
ATOM   2483  O  OE2   . GLU C  2  24   ? -89.554  38.051  23.414  1.00 123.10 ?  24   GLU B OE2   1 
ATOM   2484  N  N     . PRO C  2  25   ? -89.117  43.577  20.775  1.00 98.93  ?  25   PRO B N     1 
ATOM   2485  C  CA    . PRO C  2  25   ? -90.471  43.142  20.435  1.00 94.71  ?  25   PRO B CA    1 
ATOM   2486  C  C     . PRO C  2  25   ? -91.027  43.905  19.237  1.00 95.82  ?  25   PRO B C     1 
ATOM   2487  O  O     . PRO C  2  25   ? -90.578  45.017  18.962  1.00 103.05 ?  25   PRO B O     1 
ATOM   2488  C  CB    . PRO C  2  25   ? -91.253  43.474  21.701  1.00 92.60  ?  25   PRO B CB    1 
ATOM   2489  C  CG    . PRO C  2  25   ? -90.602  44.747  22.176  1.00 87.77  ?  25   PRO B CG    1 
ATOM   2490  C  CD    . PRO C  2  25   ? -89.147  44.705  21.723  1.00 101.14 ?  25   PRO B CD    1 
ATOM   2491  N  N     . LEU C  2  26   ? -91.990  43.318  18.536  1.00 96.59  ?  26   LEU B N     1 
ATOM   2492  C  CA    . LEU C  2  26   ? -92.644  43.977  17.417  1.00 98.80  ?  26   LEU B CA    1 
ATOM   2493  C  C     . LEU C  2  26   ? -94.037  44.441  17.823  1.00 105.97 ?  26   LEU B C     1 
ATOM   2494  O  O     . LEU C  2  26   ? -94.685  43.845  18.688  1.00 99.69  ?  26   LEU B O     1 
ATOM   2495  C  CB    . LEU C  2  26   ? -92.737  43.046  16.206  1.00 106.91 ?  26   LEU B CB    1 
ATOM   2496  C  CG    . LEU C  2  26   ? -91.415  42.652  15.544  1.00 101.06 ?  26   LEU B CG    1 
ATOM   2497  C  CD1   . LEU C  2  26   ? -91.665  41.805  14.306  1.00 96.81  ?  26   LEU B CD1   1 
ATOM   2498  C  CD2   . LEU C  2  26   ? -90.599  43.887  15.197  1.00 85.36  ?  26   LEU B CD2   1 
ATOM   2499  N  N     . GLU C  2  27   ? -94.490  45.517  17.187  1.00 100.74 ?  27   GLU B N     1 
ATOM   2500  C  CA    . GLU C  2  27   ? -95.809  46.051  17.490  1.00 105.09 ?  27   GLU B CA    1 
ATOM   2501  C  C     . GLU C  2  27   ? -96.891  45.199  16.827  1.00 104.69 ?  27   GLU B C     1 
ATOM   2502  O  O     . GLU C  2  27   ? -96.750  44.807  15.665  1.00 108.90 ?  27   GLU B O     1 
ATOM   2503  C  CB    . GLU C  2  27   ? -95.926  47.497  17.015  1.00 114.27 ?  27   GLU B CB    1 
ATOM   2504  C  CG    . GLU C  2  27   ? -94.950  48.450  17.686  1.00 125.93 ?  27   GLU B CG    1 
ATOM   2505  C  CD    . GLU C  2  27   ? -95.065  49.866  17.157  1.00 125.81 ?  27   GLU B CD    1 
ATOM   2506  O  OE1   . GLU C  2  27   ? -95.701  50.057  16.098  1.00 123.38 ?  27   GLU B OE1   1 
ATOM   2507  O  OE2   . GLU C  2  27   ? -94.523  50.789  17.802  1.00 128.06 ?  27   GLU B OE2   1 
ATOM   2508  N  N     . PRO C  2  28   ? -97.979  44.892  17.546  1.00 88.70  ?  28   PRO B N     1 
ATOM   2509  C  CA    . PRO C  2  28   ? -99.107  44.125  17.007  1.00 94.96  ?  28   PRO B CA    1 
ATOM   2510  C  C     . PRO C  2  28   ? -99.730  44.787  15.780  1.00 111.21 ?  28   PRO B C     1 
ATOM   2511  O  O     . PRO C  2  28   ? -100.192 45.926  15.863  1.00 116.57 ?  28   PRO B O     1 
ATOM   2512  C  CB    . PRO C  2  28   ? -100.101 44.098  18.172  1.00 99.64  ?  28   PRO B CB    1 
ATOM   2513  C  CG    . PRO C  2  28   ? -99.264  44.299  19.388  1.00 100.94 ?  28   PRO B CG    1 
ATOM   2514  C  CD    . PRO C  2  28   ? -98.169  45.228  18.967  1.00 92.80  ?  28   PRO B CD    1 
ATOM   2515  N  N     . GLY C  2  29   ? -99.736  44.079  14.656  1.00 106.62 ?  29   GLY B N     1 
ATOM   2516  C  CA    . GLY C  2  29   ? -99.161  42.750  14.590  1.00 94.92  ?  29   GLY B CA    1 
ATOM   2517  C  C     . GLY C  2  29   ? -98.120  42.617  13.498  1.00 84.07  ?  29   GLY B C     1 
ATOM   2518  O  O     . GLY C  2  29   ? -98.319  41.887  12.527  1.00 86.12  ?  29   GLY B O     1 
ATOM   2519  N  N     . PHE C  2  30   ? -97.001  43.328  13.657  1.00 89.76  ?  30   PHE B N     1 
ATOM   2520  C  CA    . PHE C  2  30   ? -95.949  43.309  12.647  1.00 98.89  ?  30   PHE B CA    1 
ATOM   2521  C  C     . PHE C  2  30   ? -95.253  41.960  12.537  1.00 105.98 ?  30   PHE B C     1 
ATOM   2522  O  O     . PHE C  2  30   ? -94.487  41.757  11.589  1.00 104.37 ?  30   PHE B O     1 
ATOM   2523  C  CB    . PHE C  2  30   ? -94.912  44.397  12.937  1.00 82.91  ?  30   PHE B CB    1 
ATOM   2524  C  CG    . PHE C  2  30   ? -95.339  45.768  12.500  1.00 92.83  ?  30   PHE B CG    1 
ATOM   2525  C  CD1   . PHE C  2  30   ? -95.395  46.092  11.154  1.00 90.95  ?  30   PHE B CD1   1 
ATOM   2526  C  CD2   . PHE C  2  30   ? -95.680  46.734  13.431  1.00 98.46  ?  30   PHE B CD2   1 
ATOM   2527  C  CE1   . PHE C  2  30   ? -95.786  47.352  10.745  1.00 90.20  ?  30   PHE B CE1   1 
ATOM   2528  C  CE2   . PHE C  2  30   ? -96.072  47.997  13.028  1.00 101.73 ?  30   PHE B CE2   1 
ATOM   2529  C  CZ    . PHE C  2  30   ? -96.125  48.306  11.683  1.00 99.57  ?  30   PHE B CZ    1 
ATOM   2530  N  N     . GLY C  2  31   ? -95.492  41.041  13.474  1.00 104.94 ?  31   GLY B N     1 
ATOM   2531  C  CA    . GLY C  2  31   ? -94.873  39.730  13.375  1.00 80.85  ?  31   GLY B CA    1 
ATOM   2532  C  C     . GLY C  2  31   ? -95.154  39.059  12.044  1.00 83.01  ?  31   GLY B C     1 
ATOM   2533  O  O     . GLY C  2  31   ? -94.237  38.602  11.357  1.00 87.59  ?  31   GLY B O     1 
ATOM   2534  N  N     . TYR C  2  32   ? -96.430  39.004  11.655  1.00 91.84  ?  32   TYR B N     1 
ATOM   2535  C  CA    . TYR C  2  32   ? -96.810  38.326  10.419  1.00 96.89  ?  32   TYR B CA    1 
ATOM   2536  C  C     . TYR C  2  32   ? -96.581  39.190  9.185   1.00 87.57  ?  32   TYR B C     1 
ATOM   2537  O  O     . TYR C  2  32   ? -96.400  38.653  8.087   1.00 91.57  ?  32   TYR B O     1 
ATOM   2538  C  CB    . TYR C  2  32   ? -98.277  37.895  10.485  1.00 83.16  ?  32   TYR B CB    1 
ATOM   2539  C  CG    . TYR C  2  32   ? -98.529  36.692  11.367  1.00 97.51  ?  32   TYR B CG    1 
ATOM   2540  C  CD1   . TYR C  2  32   ? -98.568  35.410  10.832  1.00 97.24  ?  32   TYR B CD1   1 
ATOM   2541  C  CD2   . TYR C  2  32   ? -98.729  36.837  12.734  1.00 99.98  ?  32   TYR B CD2   1 
ATOM   2542  C  CE1   . TYR C  2  32   ? -98.799  34.307  11.633  1.00 93.93  ?  32   TYR B CE1   1 
ATOM   2543  C  CE2   . TYR C  2  32   ? -98.961  35.740  13.542  1.00 99.42  ?  32   TYR B CE2   1 
ATOM   2544  C  CZ    . TYR C  2  32   ? -98.995  34.478  12.986  1.00 97.33  ?  32   TYR B CZ    1 
ATOM   2545  O  OH    . TYR C  2  32   ? -99.223  33.383  13.786  1.00 112.96 ?  32   TYR B OH    1 
ATOM   2546  N  N     . THR C  2  33   ? -96.586  40.514  9.335   1.00 77.61  ?  33   THR B N     1 
ATOM   2547  C  CA    . THR C  2  33   ? -96.437  41.400  8.186   1.00 92.81  ?  33   THR B CA    1 
ATOM   2548  C  C     . THR C  2  33   ? -95.115  41.146  7.474   1.00 102.90 ?  33   THR B C     1 
ATOM   2549  O  O     . THR C  2  33   ? -95.093  40.687  6.327   1.00 111.49 ?  33   THR B O     1 
ATOM   2550  C  CB    . THR C  2  33   ? -96.520  42.865  8.614   1.00 86.00  ?  33   THR B CB    1 
ATOM   2551  O  OG1   . THR C  2  33   ? -95.226  43.311  9.037   1.00 84.57  ?  33   THR B OG1   1 
ATOM   2552  C  CG2   . THR C  2  33   ? -97.492  43.025  9.764   1.00 91.09  ?  33   THR B CG2   1 
ATOM   2553  N  N     . LEU C  2  34   ? -94.008  41.448  8.152   1.00 89.05  ?  34   LEU B N     1 
ATOM   2554  C  CA    . LEU C  2  34   ? -92.686  41.261  7.572   1.00 91.60  ?  34   LEU B CA    1 
ATOM   2555  C  C     . LEU C  2  34   ? -92.224  39.811  7.613   1.00 93.53  ?  34   LEU B C     1 
ATOM   2556  O  O     . LEU C  2  34   ? -91.349  39.430  6.826   1.00 101.83 ?  34   LEU B O     1 
ATOM   2557  C  CB    . LEU C  2  34   ? -91.676  42.155  8.296   1.00 89.23  ?  34   LEU B CB    1 
ATOM   2558  C  CG    . LEU C  2  34   ? -91.676  42.051  9.823   1.00 84.51  ?  34   LEU B CG    1 
ATOM   2559  C  CD1   . LEU C  2  34   ? -90.946  40.798  10.282  1.00 86.40  ?  34   LEU B CD1   1 
ATOM   2560  C  CD2   . LEU C  2  34   ? -91.080  43.301  10.465  1.00 69.42  ?  34   LEU B CD2   1 
ATOM   2561  N  N     . GLY C  2  35   ? -92.788  38.999  8.503   1.00 86.73  ?  35   GLY B N     1 
ATOM   2562  C  CA    . GLY C  2  35   ? -92.403  37.607  8.622   1.00 85.60  ?  35   GLY B CA    1 
ATOM   2563  C  C     . GLY C  2  35   ? -92.461  36.846  7.314   1.00 88.43  ?  35   GLY B C     1 
ATOM   2564  O  O     . GLY C  2  35   ? -91.428  36.405  6.802   1.00 86.57  ?  35   GLY B O     1 
ATOM   2565  N  N     . ASN C  2  36   ? -93.666  36.685  6.760   1.00 86.72  ?  36   ASN B N     1 
ATOM   2566  C  CA    . ASN C  2  36   ? -93.803  35.937  5.516   1.00 87.29  ?  36   ASN B CA    1 
ATOM   2567  C  C     . ASN C  2  36   ? -92.963  36.547  4.403   1.00 88.09  ?  36   ASN B C     1 
ATOM   2568  O  O     . ASN C  2  36   ? -92.471  35.824  3.529   1.00 93.41  ?  36   ASN B O     1 
ATOM   2569  C  CB    . ASN C  2  36   ? -95.273  35.872  5.099   1.00 93.63  ?  36   ASN B CB    1 
ATOM   2570  C  CG    . ASN C  2  36   ? -95.563  34.710  4.167   1.00 97.41  ?  36   ASN B CG    1 
ATOM   2571  O  OD1   . ASN C  2  36   ? -95.490  34.845  2.946   1.00 89.43  ?  36   ASN B OD1   1 
ATOM   2572  N  ND2   . ASN C  2  36   ? -95.889  33.558  4.743   1.00 97.72  ?  36   ASN B ND2   1 
ATOM   2573  N  N     . SER C  2  37   ? -92.780  37.869  4.420   1.00 95.29  ?  37   SER B N     1 
ATOM   2574  C  CA    . SER C  2  37   ? -91.966  38.513  3.396   1.00 91.43  ?  37   SER B CA    1 
ATOM   2575  C  C     . SER C  2  37   ? -90.487  38.199  3.572   1.00 91.83  ?  37   SER B C     1 
ATOM   2576  O  O     . SER C  2  37   ? -89.739  38.179  2.589   1.00 105.93 ?  37   SER B O     1 
ATOM   2577  C  CB    . SER C  2  37   ? -92.201  40.023  3.413   1.00 89.29  ?  37   SER B CB    1 
ATOM   2578  O  OG    . SER C  2  37   ? -93.558  40.329  3.140   1.00 92.87  ?  37   SER B OG    1 
ATOM   2579  N  N     . LEU C  2  38   ? -90.046  37.953  4.807   1.00 84.07  ?  38   LEU B N     1 
ATOM   2580  C  CA    . LEU C  2  38   ? -88.656  37.567  5.026   1.00 88.02  ?  38   LEU B CA    1 
ATOM   2581  C  C     . LEU C  2  38   ? -88.384  36.171  4.480   1.00 101.10 ?  38   LEU B C     1 
ATOM   2582  O  O     . LEU C  2  38   ? -87.432  35.965  3.718   1.00 102.93 ?  38   LEU B O     1 
ATOM   2583  C  CB    . LEU C  2  38   ? -88.316  37.642  6.514   1.00 83.96  ?  38   LEU B CB    1 
ATOM   2584  C  CG    . LEU C  2  38   ? -87.501  38.865  6.935   1.00 88.83  ?  38   LEU B CG    1 
ATOM   2585  C  CD1   . LEU C  2  38   ? -86.096  38.790  6.363   1.00 91.26  ?  38   LEU B CD1   1 
ATOM   2586  C  CD2   . LEU C  2  38   ? -88.193  40.140  6.483   1.00 101.15 ?  38   LEU B CD2   1 
ATOM   2587  N  N     . ARG C  2  39   ? -89.212  35.195  4.860   1.00 92.36  ?  39   ARG B N     1 
ATOM   2588  C  CA    . ARG C  2  39   ? -89.042  33.845  4.333   1.00 85.61  ?  39   ARG B CA    1 
ATOM   2589  C  C     . ARG C  2  39   ? -89.057  33.847  2.810   1.00 94.39  ?  39   ARG B C     1 
ATOM   2590  O  O     . ARG C  2  39   ? -88.279  33.126  2.173   1.00 117.12 ?  39   ARG B O     1 
ATOM   2591  C  CB    . ARG C  2  39   ? -90.132  32.921  4.878   1.00 75.59  ?  39   ARG B CB    1 
ATOM   2592  C  CG    . ARG C  2  39   ? -90.141  31.544  4.233   1.00 75.40  ?  39   ARG B CG    1 
ATOM   2593  C  CD    . ARG C  2  39   ? -91.251  30.671  4.782   1.00 71.25  ?  39   ARG B CD    1 
ATOM   2594  N  NE    . ARG C  2  39   ? -91.365  29.416  4.044   1.00 80.65  ?  39   ARG B NE    1 
ATOM   2595  C  CZ    . ARG C  2  39   ? -92.165  29.235  2.997   1.00 92.77  ?  39   ARG B CZ    1 
ATOM   2596  N  NH1   . ARG C  2  39   ? -92.924  30.232  2.563   1.00 88.50  1  39   ARG B NH1   1 
ATOM   2597  N  NH2   . ARG C  2  39   ? -92.207  28.059  2.384   1.00 81.32  ?  39   ARG B NH2   1 
ATOM   2598  N  N     . ARG C  2  40   ? -89.931  34.655  2.207   1.00 82.63  ?  40   ARG B N     1 
ATOM   2599  C  CA    . ARG C  2  40   ? -89.995  34.710  0.752   1.00 92.92  ?  40   ARG B CA    1 
ATOM   2600  C  C     . ARG C  2  40   ? -88.757  35.369  0.158   1.00 98.34  ?  40   ARG B C     1 
ATOM   2601  O  O     . ARG C  2  40   ? -88.327  34.994  -0.940  1.00 105.90 ?  40   ARG B O     1 
ATOM   2602  C  CB    . ARG C  2  40   ? -91.255  35.451  0.307   1.00 100.31 ?  40   ARG B CB    1 
ATOM   2603  C  CG    . ARG C  2  40   ? -91.465  35.443  -1.195  1.00 100.79 ?  40   ARG B CG    1 
ATOM   2604  C  CD    . ARG C  2  40   ? -91.239  34.053  -1.758  1.00 94.14  ?  40   ARG B CD    1 
ATOM   2605  N  NE    . ARG C  2  40   ? -92.072  33.058  -1.090  1.00 108.08 ?  40   ARG B NE    1 
ATOM   2606  C  CZ    . ARG C  2  40   ? -91.906  31.745  -1.210  1.00 117.10 ?  40   ARG B CZ    1 
ATOM   2607  N  NH1   . ARG C  2  40   ? -90.930  31.264  -1.969  1.00 100.88 ?  40   ARG B NH1   1 
ATOM   2608  N  NH2   . ARG C  2  40   ? -92.712  30.912  -0.565  1.00 126.18 ?  40   ARG B NH2   1 
ATOM   2609  N  N     . THR C  2  41   ? -88.173  36.344  0.857   1.00 94.16  ?  41   THR B N     1 
ATOM   2610  C  CA    . THR C  2  41   ? -86.989  37.011  0.330   1.00 97.06  ?  41   THR B CA    1 
ATOM   2611  C  C     . THR C  2  41   ? -85.752  36.128  0.454   1.00 101.26 ?  41   THR B C     1 
ATOM   2612  O  O     . THR C  2  41   ? -84.966  36.020  -0.493  1.00 108.60 ?  41   THR B O     1 
ATOM   2613  C  CB    . THR C  2  41   ? -86.772  38.341  1.048   1.00 103.12 ?  41   THR B CB    1 
ATOM   2614  O  OG1   . THR C  2  41   ? -87.896  39.195  0.812   1.00 101.03 ?  41   THR B OG1   1 
ATOM   2615  C  CG2   . THR C  2  41   ? -85.508  39.020  0.535   1.00 99.50  ?  41   THR B CG2   1 
ATOM   2616  N  N     . LEU C  2  42   ? -85.562  35.488  1.611   1.00 94.89  ?  42   LEU B N     1 
ATOM   2617  C  CA    . LEU C  2  42   ? -84.423  34.591  1.775   1.00 92.69  ?  42   LEU B CA    1 
ATOM   2618  C  C     . LEU C  2  42   ? -84.460  33.456  0.758   1.00 98.05  ?  42   LEU B C     1 
ATOM   2619  O  O     . LEU C  2  42   ? -83.418  33.058  0.226   1.00 107.22 ?  42   LEU B O     1 
ATOM   2620  C  CB    . LEU C  2  42   ? -84.389  34.029  3.198   1.00 89.05  ?  42   LEU B CB    1 
ATOM   2621  C  CG    . LEU C  2  42   ? -83.794  34.897  4.310   1.00 89.23  ?  42   LEU B CG    1 
ATOM   2622  C  CD1   . LEU C  2  42   ? -84.729  36.030  4.690   1.00 103.77 ?  42   LEU B CD1   1 
ATOM   2623  C  CD2   . LEU C  2  42   ? -83.461  34.045  5.526   1.00 87.87  ?  42   LEU B CD2   1 
ATOM   2624  N  N     . LEU C  2  43   ? -85.651  32.928  0.469   1.00 95.98  ?  43   LEU B N     1 
ATOM   2625  C  CA    . LEU C  2  43   ? -85.749  31.704  -0.319  1.00 98.55  ?  43   LEU B CA    1 
ATOM   2626  C  C     . LEU C  2  43   ? -85.541  31.959  -1.805  1.00 99.27  ?  43   LEU B C     1 
ATOM   2627  O  O     . LEU C  2  43   ? -84.901  31.150  -2.489  1.00 112.25 ?  43   LEU B O     1 
ATOM   2628  C  CB    . LEU C  2  43   ? -87.106  31.042  -0.084  1.00 101.35 ?  43   LEU B CB    1 
ATOM   2629  C  CG    . LEU C  2  43   ? -87.088  29.663  0.576   1.00 103.84 ?  43   LEU B CG    1 
ATOM   2630  C  CD1   . LEU C  2  43   ? -86.251  29.680  1.846   1.00 90.88  ?  43   LEU B CD1   1 
ATOM   2631  C  CD2   . LEU C  2  43   ? -88.502  29.182  0.871   1.00 95.09  ?  43   LEU B CD2   1 
ATOM   2632  N  N     . SER C  2  44   ? -86.067  33.068  -2.327  1.00 83.36  ?  44   SER B N     1 
ATOM   2633  C  CA    . SER C  2  44   ? -86.108  33.268  -3.770  1.00 92.64  ?  44   SER B CA    1 
ATOM   2634  C  C     . SER C  2  44   ? -85.568  34.631  -4.177  1.00 99.61  ?  44   SER B C     1 
ATOM   2635  O  O     . SER C  2  44   ? -85.951  35.160  -5.228  1.00 98.05  ?  44   SER B O     1 
ATOM   2636  C  CB    . SER C  2  44   ? -87.535  33.096  -4.297  1.00 85.93  ?  44   SER B CB    1 
ATOM   2637  O  OG    . SER C  2  44   ? -88.024  31.811  -3.966  1.00 90.42  ?  44   SER B OG    1 
ATOM   2638  N  N     . SER C  2  45   ? -84.664  35.205  -3.383  1.00 105.02 ?  45   SER B N     1 
ATOM   2639  C  CA    . SER C  2  45   ? -84.117  36.516  -3.713  1.00 103.52 ?  45   SER B CA    1 
ATOM   2640  C  C     . SER C  2  45   ? -82.620  36.639  -3.450  1.00 102.80 ?  45   SER B C     1 
ATOM   2641  O  O     . SER C  2  45   ? -82.086  37.753  -3.519  1.00 108.91 ?  45   SER B O     1 
ATOM   2642  C  CB    . SER C  2  45   ? -84.864  37.612  -2.943  1.00 117.62 ?  45   SER B CB    1 
ATOM   2643  O  OG    . SER C  2  45   ? -84.377  38.893  -3.302  1.00 136.51 ?  45   SER B OG    1 
ATOM   2644  N  N     . ILE C  2  46   ? -81.930  35.550  -3.144  1.00 100.54 ?  46   ILE B N     1 
ATOM   2645  C  CA    . ILE C  2  46   ? -80.495  35.566  -2.886  1.00 105.71 ?  46   ILE B CA    1 
ATOM   2646  C  C     . ILE C  2  46   ? -79.791  34.961  -4.096  1.00 112.57 ?  46   ILE B C     1 
ATOM   2647  O  O     . ILE C  2  46   ? -80.109  33.832  -4.490  1.00 111.88 ?  46   ILE B O     1 
ATOM   2648  C  CB    . ILE C  2  46   ? -80.137  34.816  -1.591  1.00 108.76 ?  46   ILE B CB    1 
ATOM   2649  C  CG1   . ILE C  2  46   ? -80.666  35.574  -0.377  1.00 106.87 ?  46   ILE B CG1   1 
ATOM   2650  C  CG2   . ILE C  2  46   ? -78.626  34.632  -1.480  1.00 119.45 ?  46   ILE B CG2   1 
ATOM   2651  C  CD1   . ILE C  2  46   ? -80.274  34.958  0.952   1.00 95.19  ?  46   ILE B CD1   1 
ATOM   2652  N  N     . PRO C  2  47   ? -78.839  35.661  -4.711  1.00 108.82 ?  47   PRO B N     1 
ATOM   2653  C  CA    . PRO C  2  47   ? -78.178  35.109  -5.897  1.00 100.73 ?  47   PRO B CA    1 
ATOM   2654  C  C     . PRO C  2  47   ? -77.292  33.925  -5.543  1.00 112.97 ?  47   PRO B C     1 
ATOM   2655  O  O     . PRO C  2  47   ? -76.645  33.899  -4.494  1.00 104.26 ?  47   PRO B O     1 
ATOM   2656  C  CB    . PRO C  2  47   ? -77.348  36.284  -6.431  1.00 101.69 ?  47   PRO B CB    1 
ATOM   2657  C  CG    . PRO C  2  47   ? -77.910  37.501  -5.771  1.00 110.43 ?  47   PRO B CG    1 
ATOM   2658  C  CD    . PRO C  2  47   ? -78.403  37.037  -4.432  1.00 109.32 ?  47   PRO B CD    1 
ATOM   2659  N  N     . GLY C  2  48   ? -77.261  32.944  -6.443  1.00 114.97 ?  48   GLY B N     1 
ATOM   2660  C  CA    . GLY C  2  48   ? -76.443  31.762  -6.258  1.00 105.80 ?  48   GLY B CA    1 
ATOM   2661  C  C     . GLY C  2  48   ? -76.383  30.895  -7.499  1.00 113.24 ?  48   GLY B C     1 
ATOM   2662  O  O     . GLY C  2  48   ? -77.321  30.887  -8.302  1.00 117.71 ?  48   GLY B O     1 
ATOM   2663  N  N     . ALA C  2  49   ? -75.288  30.160  -7.665  1.00 117.82 ?  49   ALA B N     1 
ATOM   2664  C  CA    . ALA C  2  49   ? -75.082  29.305  -8.824  1.00 114.27 ?  49   ALA B CA    1 
ATOM   2665  C  C     . ALA C  2  49   ? -75.442  27.860  -8.499  1.00 116.27 ?  49   ALA B C     1 
ATOM   2666  O  O     . ALA C  2  49   ? -75.232  27.384  -7.380  1.00 126.74 ?  49   ALA B O     1 
ATOM   2667  C  CB    . ALA C  2  49   ? -73.631  29.382  -9.307  1.00 117.87 ?  49   ALA B CB    1 
ATOM   2668  N  N     . ALA C  2  50   ? -75.985  27.164  -9.495  1.00 109.66 ?  50   ALA B N     1 
ATOM   2669  C  CA    . ALA C  2  50   ? -76.382  25.773  -9.339  1.00 106.51 ?  50   ALA B CA    1 
ATOM   2670  C  C     . ALA C  2  50   ? -76.350  25.096  -10.703 1.00 101.27 ?  50   ALA B C     1 
ATOM   2671  O  O     . ALA C  2  50   ? -76.045  25.721  -11.723 1.00 117.76 ?  50   ALA B O     1 
ATOM   2672  C  CB    . ALA C  2  50   ? -77.766  25.662  -8.692  1.00 104.83 ?  50   ALA B CB    1 
ATOM   2673  N  N     . VAL C  2  51   ? -76.671  23.806  -10.715 1.00 81.00  ?  51   VAL B N     1 
ATOM   2674  C  CA    . VAL C  2  51   ? -76.654  23.007  -11.935 1.00 80.37  ?  51   VAL B CA    1 
ATOM   2675  C  C     . VAL C  2  51   ? -77.982  23.171  -12.659 1.00 83.17  ?  51   VAL B C     1 
ATOM   2676  O  O     . VAL C  2  51   ? -79.051  23.097  -12.042 1.00 106.15 ?  51   VAL B O     1 
ATOM   2677  C  CB    . VAL C  2  51   ? -76.379  21.528  -11.619 1.00 81.98  ?  51   VAL B CB    1 
ATOM   2678  C  CG1   . VAL C  2  51   ? -76.705  20.662  -12.824 1.00 89.41  ?  51   VAL B CG1   1 
ATOM   2679  C  CG2   . VAL C  2  51   ? -74.929  21.337  -11.195 1.00 76.55  ?  51   VAL B CG2   1 
ATOM   2680  N  N     . THR C  2  52   ? -77.915  23.390  -13.972 1.00 91.16  ?  52   THR B N     1 
ATOM   2681  C  CA    . THR C  2  52   ? -79.101  23.511  -14.814 1.00 91.87  ?  52   THR B CA    1 
ATOM   2682  C  C     . THR C  2  52   ? -79.424  22.199  -15.521 1.00 97.26  ?  52   THR B C     1 
ATOM   2683  O  O     . THR C  2  52   ? -80.477  21.601  -15.283 1.00 94.41  ?  52   THR B O     1 
ATOM   2684  C  CB    . THR C  2  52   ? -78.906  24.633  -15.842 1.00 104.18 ?  52   THR B CB    1 
ATOM   2685  O  OG1   . THR C  2  52   ? -78.881  25.899  -15.173 1.00 120.10 ?  52   THR B OG1   1 
ATOM   2686  C  CG2   . THR C  2  52   ? -80.030  24.621  -16.871 1.00 96.54  ?  52   THR B CG2   1 
ATOM   2687  N  N     . SER C  2  53   ? -78.529  21.742  -16.392 1.00 104.33 ?  53   SER B N     1 
ATOM   2688  C  CA    . SER C  2  53   ? -78.710  20.491  -17.111 1.00 108.02 ?  53   SER B CA    1 
ATOM   2689  C  C     . SER C  2  53   ? -77.380  19.758  -17.176 1.00 106.58 ?  53   SER B C     1 
ATOM   2690  O  O     . SER C  2  53   ? -76.312  20.373  -17.129 1.00 103.66 ?  53   SER B O     1 
ATOM   2691  C  CB    . SER C  2  53   ? -79.256  20.725  -18.527 1.00 112.90 ?  53   SER B CB    1 
ATOM   2692  O  OG    . SER C  2  53   ? -78.408  21.589  -19.264 1.00 118.62 ?  53   SER B OG    1 
ATOM   2693  N  N     . ILE C  2  54   ? -77.455  18.432  -17.280 1.00 111.53 ?  54   ILE B N     1 
ATOM   2694  C  CA    . ILE C  2  54   ? -76.271  17.589  -17.369 1.00 111.88 ?  54   ILE B CA    1 
ATOM   2695  C  C     . ILE C  2  54   ? -76.507  16.514  -18.418 1.00 114.63 ?  54   ILE B C     1 
ATOM   2696  O  O     . ILE C  2  54   ? -77.647  16.125  -18.693 1.00 112.13 ?  54   ILE B O     1 
ATOM   2697  C  CB    . ILE C  2  54   ? -75.913  16.941  -16.015 1.00 106.29 ?  54   ILE B CB    1 
ATOM   2698  C  CG1   . ILE C  2  54   ? -76.923  15.846  -15.668 1.00 94.40  ?  54   ILE B CG1   1 
ATOM   2699  C  CG2   . ILE C  2  54   ? -75.859  17.990  -14.917 1.00 99.20  ?  54   ILE B CG2   1 
ATOM   2700  C  CD1   . ILE C  2  54   ? -76.535  15.018  -14.464 1.00 74.43  ?  54   ILE B CD1   1 
ATOM   2701  N  N     . ARG C  2  55   ? -75.414  16.033  -19.004 1.00 111.26 ?  55   ARG B N     1 
ATOM   2702  C  CA    . ARG C  2  55   ? -75.452  14.929  -19.953 1.00 107.40 ?  55   ARG B CA    1 
ATOM   2703  C  C     . ARG C  2  55   ? -74.375  13.925  -19.575 1.00 109.14 ?  55   ARG B C     1 
ATOM   2704  O  O     . ARG C  2  55   ? -73.238  14.310  -19.280 1.00 100.25 ?  55   ARG B O     1 
ATOM   2705  C  CB    . ARG C  2  55   ? -75.250  15.417  -21.390 1.00 109.31 ?  55   ARG B CB    1 
ATOM   2706  C  CG    . ARG C  2  55   ? -73.865  15.972  -21.680 1.00 122.37 ?  55   ARG B CG    1 
ATOM   2707  C  CD    . ARG C  2  55   ? -73.702  16.212  -23.170 1.00 123.13 ?  55   ARG B CD    1 
ATOM   2708  N  NE    . ARG C  2  55   ? -74.064  15.023  -23.937 1.00 122.21 ?  55   ARG B NE    1 
ATOM   2709  C  CZ    . ARG C  2  55   ? -74.294  15.016  -25.245 1.00 117.90 ?  55   ARG B CZ    1 
ATOM   2710  N  NH1   . ARG C  2  55   ? -74.206  16.141  -25.943 1.00 97.88  ?  55   ARG B NH1   1 
ATOM   2711  N  NH2   . ARG C  2  55   ? -74.618  13.884  -25.855 1.00 122.45 ?  55   ARG B NH2   1 
ATOM   2712  N  N     . ILE C  2  56   ? -74.736  12.644  -19.578 1.00 108.12 ?  56   ILE B N     1 
ATOM   2713  C  CA    . ILE C  2  56   ? -73.846  11.564  -19.168 1.00 114.26 ?  56   ILE B CA    1 
ATOM   2714  C  C     . ILE C  2  56   ? -73.606  10.651  -20.361 1.00 125.66 ?  56   ILE B C     1 
ATOM   2715  O  O     . ILE C  2  56   ? -74.551  10.282  -21.069 1.00 127.89 ?  56   ILE B O     1 
ATOM   2716  C  CB    . ILE C  2  56   ? -74.423  10.775  -17.979 1.00 104.59 ?  56   ILE B CB    1 
ATOM   2717  C  CG1   . ILE C  2  56   ? -73.693  11.153  -16.689 1.00 98.02  ?  56   ILE B CG1   1 
ATOM   2718  C  CG2   . ILE C  2  56   ? -74.340  9.278   -18.239 1.00 99.65  ?  56   ILE B CG2   1 
ATOM   2719  C  CD1   . ILE C  2  56   ? -72.202  10.909  -16.743 1.00 108.46 ?  56   ILE B CD1   1 
ATOM   2720  N  N     . ASP C  2  57   ? -72.344  10.286  -20.575 1.00 115.75 ?  57   ASP B N     1 
ATOM   2721  C  CA    . ASP C  2  57   ? -71.990  9.422   -21.692 1.00 114.90 ?  57   ASP B CA    1 
ATOM   2722  C  C     . ASP C  2  57   ? -72.643  8.054   -21.536 1.00 116.58 ?  57   ASP B C     1 
ATOM   2723  O  O     . ASP C  2  57   ? -72.590  7.444   -20.465 1.00 121.05 ?  57   ASP B O     1 
ATOM   2724  C  CB    . ASP C  2  57   ? -70.472  9.278   -21.786 1.00 107.41 ?  57   ASP B CB    1 
ATOM   2725  N  N     . GLY C  2  58   ? -73.266  7.577   -22.613 1.00 110.09 ?  58   GLY B N     1 
ATOM   2726  C  CA    . GLY C  2  58   ? -73.879  6.269   -22.641 1.00 109.61 ?  58   GLY B CA    1 
ATOM   2727  C  C     . GLY C  2  58   ? -75.386  6.259   -22.496 1.00 114.29 ?  58   GLY B C     1 
ATOM   2728  O  O     . GLY C  2  58   ? -76.011  5.227   -22.773 1.00 117.19 ?  58   GLY B O     1 
ATOM   2729  N  N     . VAL C  2  59   ? -75.988  7.366   -22.079 1.00 117.16 ?  59   VAL B N     1 
ATOM   2730  C  CA    . VAL C  2  59   ? -77.431  7.450   -21.877 1.00 112.93 ?  59   VAL B CA    1 
ATOM   2731  C  C     . VAL C  2  59   ? -77.962  8.536   -22.804 1.00 107.61 ?  59   VAL B C     1 
ATOM   2732  O  O     . VAL C  2  59   ? -77.857  9.732   -22.507 1.00 97.51  ?  59   VAL B O     1 
ATOM   2733  C  CB    . VAL C  2  59   ? -77.801  7.731   -20.417 1.00 115.21 ?  59   VAL B CB    1 
ATOM   2734  C  CG1   . VAL C  2  59   ? -77.504  6.514   -19.551 1.00 122.10 ?  59   VAL B CG1   1 
ATOM   2735  C  CG2   . VAL C  2  59   ? -77.048  8.946   -19.903 1.00 107.77 ?  59   VAL B CG2   1 
ATOM   2736  N  N     . LEU C  2  60   ? -78.540  8.123   -23.929 1.00 112.24 ?  60   LEU B N     1 
ATOM   2737  C  CA    . LEU C  2  60   ? -79.224  9.031   -24.841 1.00 111.55 ?  60   LEU B CA    1 
ATOM   2738  C  C     . LEU C  2  60   ? -80.705  8.708   -24.950 1.00 114.70 ?  60   LEU B C     1 
ATOM   2739  O  O     . LEU C  2  60   ? -81.544  9.608   -24.828 1.00 116.88 ?  60   LEU B O     1 
ATOM   2740  C  CB    . LEU C  2  60   ? -78.569  8.989   -26.233 1.00 110.52 ?  60   LEU B CB    1 
ATOM   2741  C  CG    . LEU C  2  60   ? -77.078  9.328   -26.346 1.00 100.71 ?  60   LEU B CG    1 
ATOM   2742  C  CD1   . LEU C  2  60   ? -76.759  10.646  -25.654 1.00 86.80  ?  60   LEU B CD1   1 
ATOM   2743  C  CD2   . LEU C  2  60   ? -76.211  8.207   -25.787 1.00 114.30 ?  60   LEU B CD2   1 
ATOM   2744  N  N     . HIS C  2  61   ? -81.047  7.442   -25.178 1.00 117.67 ?  61   HIS B N     1 
ATOM   2745  C  CA    . HIS C  2  61   ? -82.421  6.970   -25.109 1.00 110.81 ?  61   HIS B CA    1 
ATOM   2746  C  C     . HIS C  2  61   ? -82.642  6.010   -23.951 1.00 114.96 ?  61   HIS B C     1 
ATOM   2747  O  O     . HIS C  2  61   ? -83.781  5.594   -23.714 1.00 113.52 ?  61   HIS B O     1 
ATOM   2748  C  CB    . HIS C  2  61   ? -82.821  6.298   -26.428 1.00 110.97 ?  61   HIS B CB    1 
ATOM   2749  N  N     . GLU C  2  62   ? -81.584  5.639   -23.234 1.00 125.76 ?  62   GLU B N     1 
ATOM   2750  C  CA    . GLU C  2  62   ? -81.718  4.796   -22.055 1.00 128.22 ?  62   GLU B CA    1 
ATOM   2751  C  C     . GLU C  2  62   ? -82.189  5.642   -20.882 1.00 138.10 ?  62   GLU B C     1 
ATOM   2752  O  O     . GLU C  2  62   ? -81.575  6.662   -20.554 1.00 132.64 ?  62   GLU B O     1 
ATOM   2753  C  CB    . GLU C  2  62   ? -80.390  4.116   -21.724 1.00 125.02 ?  62   GLU B CB    1 
ATOM   2754  N  N     . PHE C  2  63   ? -83.280  5.219   -20.250 1.00 146.69 ?  63   PHE B N     1 
ATOM   2755  C  CA    . PHE C  2  63   ? -83.917  6.015   -19.211 1.00 126.43 ?  63   PHE B CA    1 
ATOM   2756  C  C     . PHE C  2  63   ? -83.591  5.554   -17.801 1.00 110.77 ?  63   PHE B C     1 
ATOM   2757  O  O     . PHE C  2  63   ? -83.522  6.387   -16.892 1.00 93.48  ?  63   PHE B O     1 
ATOM   2758  C  CB    . PHE C  2  63   ? -85.439  5.998   -19.387 1.00 100.95 ?  63   PHE B CB    1 
ATOM   2759  N  N     . THR C  2  64   ? -83.393  4.256   -17.589 1.00 116.18 ?  64   THR B N     1 
ATOM   2760  C  CA    . THR C  2  64   ? -83.384  3.753   -16.223 1.00 105.84 ?  64   THR B CA    1 
ATOM   2761  C  C     . THR C  2  64   ? -81.977  3.646   -15.644 1.00 103.58 ?  64   THR B C     1 
ATOM   2762  O  O     . THR C  2  64   ? -81.703  4.201   -14.575 1.00 101.76 ?  64   THR B O     1 
ATOM   2763  C  CB    . THR C  2  64   ? -84.089  2.391   -16.162 1.00 91.66  ?  64   THR B CB    1 
ATOM   2764  N  N     . THR C  2  65   ? -81.077  2.946   -16.331 1.00 105.18 ?  65   THR B N     1 
ATOM   2765  C  CA    . THR C  2  65   ? -79.814  2.534   -15.742 1.00 109.60 ?  65   THR B CA    1 
ATOM   2766  C  C     . THR C  2  65   ? -78.623  3.136   -16.475 1.00 113.98 ?  65   THR B C     1 
ATOM   2767  O  O     . THR C  2  65   ? -78.722  3.583   -17.622 1.00 112.19 ?  65   THR B O     1 
ATOM   2768  C  CB    . THR C  2  65   ? -79.683  1.010   -15.747 1.00 95.77  ?  65   THR B CB    1 
ATOM   2769  O  OG1   . THR C  2  65   ? -80.961  0.421   -15.480 1.00 104.94 ?  65   THR B OG1   1 
ATOM   2770  C  CG2   . THR C  2  65   ? -78.698  0.564   -14.681 1.00 89.75  ?  65   THR B CG2   1 
ATOM   2771  N  N     . VAL C  2  66   ? -77.489  3.129   -15.782 1.00 105.79 ?  66   VAL B N     1 
ATOM   2772  C  CA    . VAL C  2  66   ? -76.194  3.504   -16.330 1.00 103.86 ?  66   VAL B CA    1 
ATOM   2773  C  C     . VAL C  2  66   ? -75.240  2.341   -16.081 1.00 118.85 ?  66   VAL B C     1 
ATOM   2774  O  O     . VAL C  2  66   ? -74.991  1.986   -14.925 1.00 120.88 ?  66   VAL B O     1 
ATOM   2775  C  CB    . VAL C  2  66   ? -75.645  4.794   -15.699 1.00 103.60 ?  66   VAL B CB    1 
ATOM   2776  C  CG1   . VAL C  2  66   ? -74.238  5.064   -16.203 1.00 110.87 ?  66   VAL B CG1   1 
ATOM   2777  C  CG2   . VAL C  2  66   ? -76.564  5.965   -16.000 1.00 114.60 ?  66   VAL B CG2   1 
ATOM   2778  N  N     . PRO C  2  67   ? -74.683  1.719   -17.117 1.00 120.98 ?  67   PRO B N     1 
ATOM   2779  C  CA    . PRO C  2  67   ? -73.805  0.564   -16.897 1.00 117.46 ?  67   PRO B CA    1 
ATOM   2780  C  C     . PRO C  2  67   ? -72.514  0.955   -16.196 1.00 112.61 ?  67   PRO B C     1 
ATOM   2781  O  O     . PRO C  2  67   ? -71.951  2.030   -16.422 1.00 99.80  ?  67   PRO B O     1 
ATOM   2782  C  CB    . PRO C  2  67   ? -73.528  0.051   -18.316 1.00 113.73 ?  67   PRO B CB    1 
ATOM   2783  C  CG    . PRO C  2  67   ? -74.612  0.649   -19.167 1.00 111.03 ?  67   PRO B CG    1 
ATOM   2784  C  CD    . PRO C  2  67   ? -74.910  1.976   -18.547 1.00 110.96 ?  67   PRO B CD    1 
ATOM   2785  N  N     . GLY C  2  68   ? -72.041  0.053   -15.338 1.00 111.53 ?  68   GLY B N     1 
ATOM   2786  C  CA    . GLY C  2  68   ? -70.802  0.262   -14.619 1.00 111.50 ?  68   GLY B CA    1 
ATOM   2787  C  C     . GLY C  2  68   ? -70.900  1.154   -13.404 1.00 119.71 ?  68   GLY B C     1 
ATOM   2788  O  O     . GLY C  2  68   ? -69.863  1.510   -12.833 1.00 123.62 ?  68   GLY B O     1 
ATOM   2789  N  N     . VAL C  2  69   ? -72.107  1.531   -12.991 1.00 120.56 ?  69   VAL B N     1 
ATOM   2790  C  CA    . VAL C  2  69   ? -72.312  2.379   -11.823 1.00 113.32 ?  69   VAL B CA    1 
ATOM   2791  C  C     . VAL C  2  69   ? -73.483  1.827   -11.024 1.00 124.17 ?  69   VAL B C     1 
ATOM   2792  O  O     . VAL C  2  69   ? -74.521  1.467   -11.590 1.00 122.88 ?  69   VAL B O     1 
ATOM   2793  C  CB    . VAL C  2  69   ? -72.560  3.848   -12.220 1.00 107.35 ?  69   VAL B CB    1 
ATOM   2794  C  CG1   . VAL C  2  69   ? -71.306  4.448   -12.830 1.00 110.08 ?  69   VAL B CG1   1 
ATOM   2795  C  CG2   . VAL C  2  69   ? -73.724  3.941   -13.192 1.00 108.39 ?  69   VAL B CG2   1 
ATOM   2796  N  N     . LYS C  2  70   ? -73.315  1.764   -9.701  1.00 121.84 ?  70   LYS B N     1 
ATOM   2797  C  CA    . LYS C  2  70   ? -74.353  1.188   -8.853  1.00 116.09 ?  70   LYS B CA    1 
ATOM   2798  C  C     . LYS C  2  70   ? -75.586  2.082   -8.796  1.00 119.88 ?  70   LYS B C     1 
ATOM   2799  O  O     . LYS C  2  70   ? -76.718  1.587   -8.821  1.00 122.20 ?  70   LYS B O     1 
ATOM   2800  C  CB    . LYS C  2  70   ? -73.805  0.934   -7.450  1.00 111.27 ?  70   LYS B CB    1 
ATOM   2801  N  N     . GLU C  2  71   ? -75.389  3.397   -8.718  1.00 118.62 ?  71   GLU B N     1 
ATOM   2802  C  CA    . GLU C  2  71   ? -76.517  4.316   -8.638  1.00 108.22 ?  71   GLU B CA    1 
ATOM   2803  C  C     . GLU C  2  71   ? -77.236  4.405   -9.977  1.00 103.30 ?  71   GLU B C     1 
ATOM   2804  O  O     . GLU C  2  71   ? -76.608  4.522   -11.032 1.00 105.09 ?  71   GLU B O     1 
ATOM   2805  C  CB    . GLU C  2  71   ? -76.051  5.708   -8.206  1.00 106.60 ?  71   GLU B CB    1 
ATOM   2806  C  CG    . GLU C  2  71   ? -74.544  5.898   -8.179  1.00 112.05 ?  71   GLU B CG    1 
ATOM   2807  C  CD    . GLU C  2  71   ? -73.894  5.208   -6.996  1.00 120.49 ?  71   GLU B CD    1 
ATOM   2808  O  OE1   . GLU C  2  71   ? -74.460  4.208   -6.507  1.00 116.08 ?  71   GLU B OE1   1 
ATOM   2809  O  OE2   . GLU C  2  71   ? -72.824  5.666   -6.551  1.00 124.67 ?  71   GLU B OE2   1 
ATOM   2810  N  N     . ASP C  2  72   ? -78.564  4.352   -9.928  1.00 112.45 ?  72   ASP B N     1 
ATOM   2811  C  CA    . ASP C  2  72   ? -79.365  4.486   -11.132 1.00 110.20 ?  72   ASP B CA    1 
ATOM   2812  C  C     . ASP C  2  72   ? -79.371  5.938   -11.608 1.00 112.96 ?  72   ASP B C     1 
ATOM   2813  O  O     . ASP C  2  72   ? -78.842  6.842   -10.954 1.00 113.56 ?  72   ASP B O     1 
ATOM   2814  C  CB    . ASP C  2  72   ? -80.791  3.992   -10.885 1.00 105.14 ?  72   ASP B CB    1 
ATOM   2815  C  CG    . ASP C  2  72   ? -81.351  4.466   -9.559  1.00 118.41 ?  72   ASP B CG    1 
ATOM   2816  O  OD1   . ASP C  2  72   ? -80.577  4.551   -8.582  1.00 118.55 ?  72   ASP B OD1   1 
ATOM   2817  O  OD2   . ASP C  2  72   ? -82.565  4.754   -9.492  1.00 116.10 -1 72   ASP B OD2   1 
ATOM   2818  N  N     . VAL C  2  73   ? -79.982  6.154   -12.776 1.00 105.51 ?  73   VAL B N     1 
ATOM   2819  C  CA    . VAL C  2  73   ? -80.027  7.495   -13.357 1.00 106.16 ?  73   VAL B CA    1 
ATOM   2820  C  C     . VAL C  2  73   ? -80.659  8.475   -12.377 1.00 107.06 ?  73   VAL B C     1 
ATOM   2821  O  O     . VAL C  2  73   ? -80.082  9.520   -12.052 1.00 99.54  ?  73   VAL B O     1 
ATOM   2822  C  CB    . VAL C  2  73   ? -80.783  7.474   -14.697 1.00 105.28 ?  73   VAL B CB    1 
ATOM   2823  C  CG1   . VAL C  2  73   ? -80.738  8.844   -15.353 1.00 102.81 ?  73   VAL B CG1   1 
ATOM   2824  C  CG2   . VAL C  2  73   ? -80.202  6.415   -15.619 1.00 104.78 ?  73   VAL B CG2   1 
ATOM   2825  N  N     . THR C  2  74   ? -81.857  8.146   -11.889 1.00 105.00 ?  74   THR B N     1 
ATOM   2826  C  CA    . THR C  2  74   ? -82.558  9.040   -10.972 1.00 105.28 ?  74   THR B CA    1 
ATOM   2827  C  C     . THR C  2  74   ? -81.713  9.337   -9.739  1.00 97.21  ?  74   THR B C     1 
ATOM   2828  O  O     . THR C  2  74   ? -81.477  10.502  -9.399  1.00 97.09  ?  74   THR B O     1 
ATOM   2829  C  CB    . THR C  2  74   ? -83.901  8.428   -10.567 1.00 98.90  ?  74   THR B CB    1 
ATOM   2830  O  OG1   . THR C  2  74   ? -84.700  8.204   -11.736 1.00 103.00 ?  74   THR B OG1   1 
ATOM   2831  C  CG2   . THR C  2  74   ? -84.647  9.358   -9.620  1.00 91.99  ?  74   THR B CG2   1 
ATOM   2832  N  N     . ASP C  2  75   ? -81.246  8.289   -9.057  1.00 93.84  ?  75   ASP B N     1 
ATOM   2833  C  CA    . ASP C  2  75   ? -80.475  8.492   -7.835  1.00 98.20  ?  75   ASP B CA    1 
ATOM   2834  C  C     . ASP C  2  75   ? -79.223  9.318   -8.094  1.00 100.51 ?  75   ASP B C     1 
ATOM   2835  O  O     . ASP C  2  75   ? -78.811  10.107  -7.236  1.00 99.18  ?  75   ASP B O     1 
ATOM   2836  C  CB    . ASP C  2  75   ? -80.107  7.142   -7.219  1.00 111.74 ?  75   ASP B CB    1 
ATOM   2837  C  CG    . ASP C  2  75   ? -80.010  7.198   -5.706  1.00 127.07 ?  75   ASP B CG    1 
ATOM   2838  O  OD1   . ASP C  2  75   ? -80.801  7.941   -5.086  1.00 129.45 ?  75   ASP B OD1   1 
ATOM   2839  O  OD2   . ASP C  2  75   ? -79.147  6.498   -5.136  1.00 127.59 -1 75   ASP B OD2   1 
ATOM   2840  N  N     . ILE C  2  76   ? -78.607  9.158   -9.267  1.00 109.11 ?  76   ILE B N     1 
ATOM   2841  C  CA    . ILE C  2  76   ? -77.410  9.931   -9.580  1.00 113.57 ?  76   ILE B CA    1 
ATOM   2842  C  C     . ILE C  2  76   ? -77.716  11.423  -9.632  1.00 105.12 ?  76   ILE B C     1 
ATOM   2843  O  O     . ILE C  2  76   ? -76.941  12.242  -9.124  1.00 99.36  ?  76   ILE B O     1 
ATOM   2844  C  CB    . ILE C  2  76   ? -76.809  9.458   -10.903 1.00 109.65 ?  76   ILE B CB    1 
ATOM   2845  N  N     . ILE C  2  77   ? -78.844  11.794  -10.240 1.00 104.57 ?  77   ILE B N     1 
ATOM   2846  C  CA    . ILE C  2  77   ? -79.201  13.207  -10.348 1.00 100.60 ?  77   ILE B CA    1 
ATOM   2847  C  C     . ILE C  2  77   ? -79.370  13.818  -8.964  1.00 101.17 ?  77   ILE B C     1 
ATOM   2848  O  O     . ILE C  2  77   ? -78.874  14.916  -8.684  1.00 93.08  ?  77   ILE B O     1 
ATOM   2849  C  CB    . ILE C  2  77   ? -80.474  13.377  -11.196 1.00 91.22  ?  77   ILE B CB    1 
ATOM   2850  C  CG1   . ILE C  2  77   ? -80.293  12.731  -12.570 1.00 92.90  ?  77   ILE B CG1   1 
ATOM   2851  C  CG2   . ILE C  2  77   ? -80.822  14.851  -11.338 1.00 97.36  ?  77   ILE B CG2   1 
ATOM   2852  C  CD1   . ILE C  2  77   ? -81.519  12.824  -13.457 1.00 85.36  ?  77   ILE B CD1   1 
ATOM   2853  N  N     . LEU C  2  78   ? -80.074  13.111  -8.075  1.00 95.45  ?  78   LEU B N     1 
ATOM   2854  C  CA    . LEU C  2  78   ? -80.347  13.654  -6.749  1.00 90.28  ?  78   LEU B CA    1 
ATOM   2855  C  C     . LEU C  2  78   ? -79.056  14.009  -6.022  1.00 101.22 ?  78   LEU B C     1 
ATOM   2856  O  O     . LEU C  2  78   ? -79.008  14.988  -5.266  1.00 97.26  ?  78   LEU B O     1 
ATOM   2857  C  CB    . LEU C  2  78   ? -81.172  12.657  -5.936  1.00 81.62  ?  78   LEU B CB    1 
ATOM   2858  C  CG    . LEU C  2  78   ? -82.420  12.119  -6.643  1.00 93.96  ?  78   LEU B CG    1 
ATOM   2859  C  CD1   . LEU C  2  78   ? -83.309  11.348  -5.675  1.00 77.15  ?  78   LEU B CD1   1 
ATOM   2860  C  CD2   . LEU C  2  78   ? -83.191  13.246  -7.318  1.00 93.50  ?  78   LEU B CD2   1 
ATOM   2861  N  N     . ASN C  2  79   ? -77.995  13.228  -6.239  1.00 103.44 ?  79   ASN B N     1 
ATOM   2862  C  CA    . ASN C  2  79   ? -76.708  13.550  -5.632  1.00 97.41  ?  79   ASN B CA    1 
ATOM   2863  C  C     . ASN C  2  79   ? -76.163  14.863  -6.180  1.00 102.03 ?  79   ASN B C     1 
ATOM   2864  O  O     . ASN C  2  79   ? -75.808  15.770  -5.419  1.00 103.77 ?  79   ASN B O     1 
ATOM   2865  C  CB    . ASN C  2  79   ? -75.713  12.415  -5.873  1.00 89.32  ?  79   ASN B CB    1 
ATOM   2866  C  CG    . ASN C  2  79   ? -76.286  11.055  -5.530  1.00 107.99 ?  79   ASN B CG    1 
ATOM   2867  O  OD1   . ASN C  2  79   ? -76.317  10.657  -4.365  1.00 104.50 ?  79   ASN B OD1   1 
ATOM   2868  N  ND2   . ASN C  2  79   ? -76.739  10.331  -6.547  1.00 106.15 ?  79   ASN B ND2   1 
ATOM   2869  N  N     . LEU C  2  80   ? -76.097  14.982  -7.509  1.00 98.90  ?  80   LEU B N     1 
ATOM   2870  C  CA    . LEU C  2  80   ? -75.572  16.197  -8.121  1.00 91.88  ?  80   LEU B CA    1 
ATOM   2871  C  C     . LEU C  2  80   ? -76.364  17.429  -7.703  1.00 101.82 ?  80   LEU B C     1 
ATOM   2872  O  O     . LEU C  2  80   ? -75.796  18.521  -7.594  1.00 105.39 ?  80   LEU B O     1 
ATOM   2873  C  CB    . LEU C  2  80   ? -75.567  16.056  -9.643  1.00 98.40  ?  80   LEU B CB    1 
ATOM   2874  C  CG    . LEU C  2  80   ? -74.486  15.140  -10.224 1.00 101.78 ?  80   LEU B CG    1 
ATOM   2875  C  CD1   . LEU C  2  80   ? -74.758  14.848  -11.691 1.00 99.61  ?  80   LEU B CD1   1 
ATOM   2876  C  CD2   . LEU C  2  80   ? -73.109  15.764  -10.050 1.00 91.44  ?  80   LEU B CD2   1 
ATOM   2877  N  N     . LYS C  2  81   ? -77.671  17.280  -7.467  1.00 103.66 ?  81   LYS B N     1 
ATOM   2878  C  CA    . LYS C  2  81   ? -78.465  18.418  -7.012  1.00 90.19  ?  81   LYS B CA    1 
ATOM   2879  C  C     . LYS C  2  81   ? -77.896  19.005  -5.727  1.00 91.34  ?  81   LYS B C     1 
ATOM   2880  O  O     . LYS C  2  81   ? -77.891  20.228  -5.543  1.00 102.19 ?  81   LYS B O     1 
ATOM   2881  C  CB    . LYS C  2  81   ? -79.924  18.004  -6.818  1.00 74.57  ?  81   LYS B CB    1 
ATOM   2882  C  CG    . LYS C  2  81   ? -80.716  17.899  -8.113  1.00 72.47  ?  81   LYS B CG    1 
ATOM   2883  C  CD    . LYS C  2  81   ? -82.153  17.473  -7.856  1.00 83.42  ?  81   LYS B CD    1 
ATOM   2884  C  CE    . LYS C  2  81   ? -82.941  17.374  -9.155  1.00 99.45  ?  81   LYS B CE    1 
ATOM   2885  N  NZ    . LYS C  2  81   ? -84.317  16.843  -8.939  1.00 100.55 ?  81   LYS B NZ    1 
ATOM   2886  N  N     . GLY C  2  82   ? -77.406  18.151  -4.828  1.00 91.84  ?  82   GLY B N     1 
ATOM   2887  C  CA    . GLY C  2  82   ? -76.782  18.630  -3.609  1.00 96.92  ?  82   GLY B CA    1 
ATOM   2888  C  C     . GLY C  2  82   ? -75.447  19.317  -3.814  1.00 111.79 ?  82   GLY B C     1 
ATOM   2889  O  O     . GLY C  2  82   ? -74.897  19.860  -2.851  1.00 121.45 ?  82   GLY B O     1 
ATOM   2890  N  N     . LEU C  2  83   ? -74.919  19.303  -5.035  1.00 107.57 ?  83   LEU B N     1 
ATOM   2891  C  CA    . LEU C  2  83   ? -73.648  19.957  -5.318  1.00 103.69 ?  83   LEU B CA    1 
ATOM   2892  C  C     . LEU C  2  83   ? -73.790  21.463  -5.137  1.00 108.28 ?  83   LEU B C     1 
ATOM   2893  O  O     . LEU C  2  83   ? -74.634  22.096  -5.781  1.00 117.80 ?  83   LEU B O     1 
ATOM   2894  C  CB    . LEU C  2  83   ? -73.191  19.629  -6.736  1.00 105.00 ?  83   LEU B CB    1 
ATOM   2895  C  CG    . LEU C  2  83   ? -71.804  20.138  -7.131  1.00 116.90 ?  83   LEU B CG    1 
ATOM   2896  C  CD1   . LEU C  2  83   ? -70.719  19.261  -6.519  1.00 113.91 ?  83   LEU B CD1   1 
ATOM   2897  C  CD2   . LEU C  2  83   ? -71.659  20.216  -8.645  1.00 119.48 ?  83   LEU B CD2   1 
ATOM   2898  N  N     . VAL C  2  84   ? -72.968  22.037  -4.263  1.00 100.42 ?  84   VAL B N     1 
ATOM   2899  C  CA    . VAL C  2  84   ? -72.957  23.472  -4.005  1.00 119.78 ?  84   VAL B CA    1 
ATOM   2900  C  C     . VAL C  2  84   ? -71.680  24.048  -4.602  1.00 119.75 ?  84   VAL B C     1 
ATOM   2901  O  O     . VAL C  2  84   ? -70.572  23.664  -4.207  1.00 113.01 ?  84   VAL B O     1 
ATOM   2902  C  CB    . VAL C  2  84   ? -73.061  23.780  -2.503  1.00 110.45 ?  84   VAL B CB    1 
ATOM   2903  C  CG1   . VAL C  2  84   ? -72.471  22.644  -1.688  1.00 103.65 ?  84   VAL B CG1   1 
ATOM   2904  C  CG2   . VAL C  2  84   ? -72.355  25.089  -2.182  1.00 122.44 ?  84   VAL B CG2   1 
ATOM   2905  N  N     . VAL C  2  85   ? -71.835  24.967  -5.551  1.00 108.62 ?  85   VAL B N     1 
ATOM   2906  C  CA    . VAL C  2  85   ? -70.701  25.564  -6.251  1.00 121.29 ?  85   VAL B CA    1 
ATOM   2907  C  C     . VAL C  2  85   ? -71.040  27.010  -6.580  1.00 128.36 ?  85   VAL B C     1 
ATOM   2908  O  O     . VAL C  2  85   ? -72.083  27.292  -7.178  1.00 130.70 ?  85   VAL B O     1 
ATOM   2909  C  CB    . VAL C  2  85   ? -70.344  24.782  -7.531  1.00 134.78 ?  85   VAL B CB    1 
ATOM   2910  C  CG1   . VAL C  2  85   ? -71.573  24.629  -8.418  1.00 111.73 ?  85   VAL B CG1   1 
ATOM   2911  C  CG2   . VAL C  2  85   ? -69.214  25.476  -8.282  1.00 129.59 ?  85   VAL B CG2   1 
ATOM   2912  N  N     . SER C  2  86   ? -70.156  27.925  -6.191  1.00 121.97 ?  86   SER B N     1 
ATOM   2913  C  CA    . SER C  2  86   ? -70.345  29.349  -6.440  1.00 119.27 ?  86   SER B CA    1 
ATOM   2914  C  C     . SER C  2  86   ? -69.643  29.733  -7.737  1.00 128.27 ?  86   SER B C     1 
ATOM   2915  O  O     . SER C  2  86   ? -68.416  29.625  -7.841  1.00 135.44 ?  86   SER B O     1 
ATOM   2916  C  CB    . SER C  2  86   ? -69.811  30.176  -5.271  1.00 126.74 ?  86   SER B CB    1 
ATOM   2917  O  OG    . SER C  2  86   ? -69.980  31.562  -5.509  1.00 152.88 ?  86   SER B OG    1 
ATOM   2918  N  N     . SER C  2  87   ? -70.420  30.183  -8.719  1.00 121.65 ?  87   SER B N     1 
ATOM   2919  C  CA    . SER C  2  87   ? -69.903  30.592  -10.019 1.00 126.48 ?  87   SER B CA    1 
ATOM   2920  C  C     . SER C  2  87   ? -70.246  32.056  -10.248 1.00 129.56 ?  87   SER B C     1 
ATOM   2921  O  O     . SER C  2  87   ? -71.426  32.416  -10.308 1.00 135.28 ?  87   SER B O     1 
ATOM   2922  C  CB    . SER C  2  87   ? -70.484  29.726  -11.139 1.00 125.08 ?  87   SER B CB    1 
ATOM   2923  O  OG    . SER C  2  87   ? -71.007  30.530  -12.184 1.00 113.96 ?  87   SER B OG    1 
ATOM   2924  N  N     . ASP C  2  88   ? -69.221  32.894  -10.374 1.00 132.66 ?  88   ASP B N     1 
ATOM   2925  C  CA    . ASP C  2  88   ? -69.409  34.306  -10.677 1.00 134.83 ?  88   ASP B CA    1 
ATOM   2926  C  C     . ASP C  2  88   ? -69.424  34.592  -12.173 1.00 133.55 ?  88   ASP B C     1 
ATOM   2927  O  O     . ASP C  2  88   ? -69.509  35.761  -12.565 1.00 124.99 ?  88   ASP B O     1 
ATOM   2928  C  CB    . ASP C  2  88   ? -68.316  35.143  -10.003 1.00 131.59 ?  88   ASP B CB    1 
ATOM   2929  C  CG    . ASP C  2  88   ? -66.957  34.478  -10.058 1.00 132.78 ?  88   ASP B CG    1 
ATOM   2930  O  OD1   . ASP C  2  88   ? -66.848  33.317  -9.611  1.00 139.19 ?  88   ASP B OD1   1 
ATOM   2931  O  OD2   . ASP C  2  88   ? -65.999  35.110  -10.550 1.00 131.29 -1 88   ASP B OD2   1 
ATOM   2932  N  N     . ASP C  2  89   ? -69.348  33.559  -13.014 1.00 137.79 ?  89   ASP B N     1 
ATOM   2933  C  CA    . ASP C  2  89   ? -69.332  33.773  -14.455 1.00 140.55 ?  89   ASP B CA    1 
ATOM   2934  C  C     . ASP C  2  89   ? -70.689  34.214  -14.988 1.00 139.31 ?  89   ASP B C     1 
ATOM   2935  O  O     . ASP C  2  89   ? -70.759  34.740  -16.104 1.00 149.35 ?  89   ASP B O     1 
ATOM   2936  C  CB    . ASP C  2  89   ? -68.877  32.499  -15.169 1.00 146.41 ?  89   ASP B CB    1 
ATOM   2937  C  CG    . ASP C  2  89   ? -68.147  32.788  -16.466 1.00 152.04 ?  89   ASP B CG    1 
ATOM   2938  O  OD1   . ASP C  2  89   ? -68.395  33.856  -17.065 1.00 147.86 ?  89   ASP B OD1   1 
ATOM   2939  O  OD2   . ASP C  2  89   ? -67.321  31.949  -16.885 1.00 145.74 ?  89   ASP B OD2   1 
ATOM   2940  N  N     . ASP C  2  90   ? -71.761  34.004  -14.224 1.00 132.59 ?  90   ASP B N     1 
ATOM   2941  C  CA    . ASP C  2  90   ? -73.095  34.458  -14.601 1.00 136.37 ?  90   ASP B CA    1 
ATOM   2942  C  C     . ASP C  2  90   ? -73.702  33.591  -15.698 1.00 129.44 ?  90   ASP B C     1 
ATOM   2943  O  O     . ASP C  2  90   ? -74.849  33.148  -15.581 1.00 123.71 ?  90   ASP B O     1 
ATOM   2944  C  CB    . ASP C  2  90   ? -73.059  35.922  -15.046 1.00 129.78 ?  90   ASP B CB    1 
ATOM   2945  N  N     . GLU C  2  91   ? -72.951  33.346  -16.762 1.00 126.48 ?  91   GLU B N     1 
ATOM   2946  C  CA    . GLU C  2  91   ? -73.447  32.585  -17.899 1.00 121.40 ?  91   GLU B CA    1 
ATOM   2947  C  C     . GLU C  2  91   ? -73.190  31.101  -17.705 1.00 115.94 ?  91   GLU B C     1 
ATOM   2948  O  O     . GLU C  2  91   ? -72.421  30.687  -16.834 1.00 114.51 ?  91   GLU B O     1 
ATOM   2949  C  CB    . GLU C  2  91   ? -72.799  33.092  -19.183 1.00 123.61 ?  91   GLU B CB    1 
ATOM   2950  C  CG    . GLU C  2  91   ? -73.525  34.275  -19.794 1.00 140.88 ?  91   GLU B CG    1 
ATOM   2951  C  CD    . GLU C  2  91   ? -75.034  34.102  -19.763 1.00 132.80 ?  91   GLU B CD    1 
ATOM   2952  O  OE1   . GLU C  2  91   ? -75.640  34.362  -18.701 1.00 130.63 ?  91   GLU B OE1   1 
ATOM   2953  O  OE2   . GLU C  2  91   ? -75.613  33.694  -20.792 1.00 117.61 ?  91   GLU B OE2   1 
ATOM   2954  N  N     . PRO C  2  92   ? -73.829  30.258  -18.518 1.00 109.50 ?  92   PRO B N     1 
ATOM   2955  C  CA    . PRO C  2  92   ? -73.716  28.803  -18.329 1.00 103.16 ?  92   PRO B CA    1 
ATOM   2956  C  C     . PRO C  2  92   ? -72.302  28.318  -18.616 1.00 99.72  ?  92   PRO B C     1 
ATOM   2957  O  O     . PRO C  2  92   ? -71.812  28.422  -19.742 1.00 114.39 ?  92   PRO B O     1 
ATOM   2958  C  CB    . PRO C  2  92   ? -74.724  28.238  -19.337 1.00 104.88 ?  92   PRO B CB    1 
ATOM   2959  C  CG    . PRO C  2  92   ? -74.829  29.294  -20.390 1.00 103.31 ?  92   PRO B CG    1 
ATOM   2960  C  CD    . PRO C  2  92   ? -74.686  30.603  -19.665 1.00 108.90 ?  92   PRO B CD    1 
ATOM   2961  N  N     . VAL C  2  93   ? -71.651  27.784  -17.587 1.00 97.32  ?  93   VAL B N     1 
ATOM   2962  C  CA    . VAL C  2  93   ? -70.333  27.173  -17.709 1.00 102.04 ?  93   VAL B CA    1 
ATOM   2963  C  C     . VAL C  2  93   ? -70.509  25.662  -17.662 1.00 107.38 ?  93   VAL B C     1 
ATOM   2964  O  O     . VAL C  2  93   ? -71.381  25.152  -16.949 1.00 118.43 ?  93   VAL B O     1 
ATOM   2965  C  CB    . VAL C  2  93   ? -69.377  27.655  -16.600 1.00 99.19  ?  93   VAL B CB    1 
ATOM   2966  C  CG1   . VAL C  2  93   ? -69.659  26.925  -15.295 1.00 98.71  ?  93   VAL B CG1   1 
ATOM   2967  C  CG2   . VAL C  2  93   ? -67.928  27.470  -17.026 1.00 120.10 ?  93   VAL B CG2   1 
ATOM   2968  N  N     . THR C  2  94   ? -69.688  24.948  -18.425 1.00 109.84 ?  94   THR B N     1 
ATOM   2969  C  CA    . THR C  2  94   ? -69.788  23.495  -18.545 1.00 109.71 ?  94   THR B CA    1 
ATOM   2970  C  C     . THR C  2  94   ? -68.569  22.863  -17.881 1.00 107.97 ?  94   THR B C     1 
ATOM   2971  O  O     . THR C  2  94   ? -67.480  22.829  -18.461 1.00 118.73 ?  94   THR B O     1 
ATOM   2972  C  CB    . THR C  2  94   ? -69.904  23.073  -20.007 1.00 116.76 ?  94   THR B CB    1 
ATOM   2973  O  OG1   . THR C  2  94   ? -68.772  23.559  -20.739 1.00 135.50 ?  94   THR B OG1   1 
ATOM   2974  C  CG2   . THR C  2  94   ? -71.180  23.633  -20.620 1.00 110.23 ?  94   THR B CG2   1 
ATOM   2975  N  N     . MET C  2  95   ? -68.759  22.365  -16.663 1.00 113.28 ?  95   MET B N     1 
ATOM   2976  C  CA    . MET C  2  95   ? -67.714  21.631  -15.971 1.00 121.74 ?  95   MET B CA    1 
ATOM   2977  C  C     . MET C  2  95   ? -67.704  20.176  -16.429 1.00 120.40 ?  95   MET B C     1 
ATOM   2978  O  O     . MET C  2  95   ? -68.681  19.663  -16.983 1.00 110.55 ?  95   MET B O     1 
ATOM   2979  C  CB    . MET C  2  95   ? -67.916  21.707  -14.458 1.00 133.16 ?  95   MET B CB    1 
ATOM   2980  C  CG    . MET C  2  95   ? -68.210  23.107  -13.942 1.00 137.59 ?  95   MET B CG    1 
ATOM   2981  S  SD    . MET C  2  95   ? -68.614  23.133  -12.185 1.00 150.94 ?  95   MET B SD    1 
ATOM   2982  C  CE    . MET C  2  95   ? -70.033  22.040  -12.150 1.00 119.37 ?  95   MET B CE    1 
ATOM   2983  N  N     . TYR C  2  96   ? -66.580  19.506  -16.191 1.00 118.76 ?  96   TYR B N     1 
ATOM   2984  C  CA    . TYR C  2  96   ? -66.401  18.127  -16.618 1.00 121.67 ?  96   TYR B CA    1 
ATOM   2985  C  C     . TYR C  2  96   ? -65.909  17.277  -15.457 1.00 123.11 ?  96   TYR B C     1 
ATOM   2986  O  O     . TYR C  2  96   ? -65.019  17.685  -14.706 1.00 121.40 ?  96   TYR B O     1 
ATOM   2987  C  CB    . TYR C  2  96   ? -65.420  18.030  -17.794 1.00 119.85 ?  96   TYR B CB    1 
ATOM   2988  C  CG    . TYR C  2  96   ? -66.003  18.495  -19.109 1.00 124.50 ?  96   TYR B CG    1 
ATOM   2989  C  CD1   . TYR C  2  96   ? -66.867  17.682  -19.832 1.00 118.16 ?  96   TYR B CD1   1 
ATOM   2990  C  CD2   . TYR C  2  96   ? -65.690  19.745  -19.629 1.00 114.29 ?  96   TYR B CD2   1 
ATOM   2991  C  CE1   . TYR C  2  96   ? -67.404  18.100  -21.035 1.00 114.12 ?  96   TYR B CE1   1 
ATOM   2992  C  CE2   . TYR C  2  96   ? -66.223  20.173  -20.832 1.00 106.80 ?  96   TYR B CE2   1 
ATOM   2993  C  CZ    . TYR C  2  96   ? -67.079  19.345  -21.531 1.00 114.42 ?  96   TYR B CZ    1 
ATOM   2994  O  OH    . TYR C  2  96   ? -67.613  19.763  -22.729 1.00 103.63 ?  96   TYR B OH    1 
ATOM   2995  N  N     . LEU C  2  97   ? -66.502  16.093  -15.319 1.00 120.44 ?  97   LEU B N     1 
ATOM   2996  C  CA    . LEU C  2  97   ? -66.106  15.120  -14.307 1.00 123.89 ?  97   LEU B CA    1 
ATOM   2997  C  C     . LEU C  2  97   ? -66.044  13.752  -14.964 1.00 121.06 ?  97   LEU B C     1 
ATOM   2998  O  O     . LEU C  2  97   ? -67.067  13.236  -15.424 1.00 114.60 ?  97   LEU B O     1 
ATOM   2999  C  CB    . LEU C  2  97   ? -67.085  15.110  -13.129 1.00 122.99 ?  97   LEU B CB    1 
ATOM   3000  C  CG    . LEU C  2  97   ? -66.987  13.914  -12.180 1.00 120.28 ?  97   LEU B CG    1 
ATOM   3001  C  CD1   . LEU C  2  97   ? -65.591  13.806  -11.587 1.00 126.99 ?  97   LEU B CD1   1 
ATOM   3002  C  CD2   . LEU C  2  97   ? -68.034  14.013  -11.082 1.00 117.40 ?  97   LEU B CD2   1 
ATOM   3003  N  N     . ARG C  2  98   ? -64.848  13.167  -15.010 1.00 124.07 ?  98   ARG B N     1 
ATOM   3004  C  CA    . ARG C  2  98   ? -64.630  11.890  -15.684 1.00 118.99 ?  98   ARG B CA    1 
ATOM   3005  C  C     . ARG C  2  98   ? -63.606  11.092  -14.891 1.00 109.04 ?  98   ARG B C     1 
ATOM   3006  O  O     . ARG C  2  98   ? -62.426  11.454  -14.855 1.00 99.59  ?  98   ARG B O     1 
ATOM   3007  C  CB    . ARG C  2  98   ? -64.166  12.104  -17.126 1.00 108.73 ?  98   ARG B CB    1 
ATOM   3008  C  CG    . ARG C  2  98   ? -63.088  13.165  -17.269 1.00 120.95 ?  98   ARG B CG    1 
ATOM   3009  C  CD    . ARG C  2  98   ? -63.100  13.786  -18.656 1.00 128.36 ?  98   ARG B CD    1 
ATOM   3010  N  NE    . ARG C  2  98   ? -62.389  15.061  -18.684 1.00 117.16 ?  98   ARG B NE    1 
ATOM   3011  C  CZ    . ARG C  2  98   ? -62.370  15.885  -19.727 1.00 118.67 ?  98   ARG B CZ    1 
ATOM   3012  N  NH1   . ARG C  2  98   ? -63.027  15.572  -20.835 1.00 112.76 ?  98   ARG B NH1   1 
ATOM   3013  N  NH2   . ARG C  2  98   ? -61.697  17.025  -19.660 1.00 134.12 ?  98   ARG B NH2   1 
ATOM   3014  N  N     . LYS C  2  99   ? -64.058  10.013  -14.255 1.00 103.04 ?  99   LYS B N     1 
ATOM   3015  C  CA    . LYS C  2  99   ? -63.191  9.119   -13.504 1.00 108.37 ?  99   LYS B CA    1 
ATOM   3016  C  C     . LYS C  2  99   ? -63.410  7.691   -13.978 1.00 120.46 ?  99   LYS B C     1 
ATOM   3017  O  O     . LYS C  2  99   ? -64.524  7.305   -14.341 1.00 116.18 ?  99   LYS B O     1 
ATOM   3018  C  CB    . LYS C  2  99   ? -63.445  9.217   -11.993 1.00 88.34  ?  99   LYS B CB    1 
ATOM   3019  N  N     . GLN C  2  100  ? -62.335  6.911   -13.974 1.00 128.73 ?  100  GLN B N     1 
ATOM   3020  C  CA    . GLN C  2  100  ? -62.355  5.530   -14.435 1.00 131.45 ?  100  GLN B CA    1 
ATOM   3021  C  C     . GLN C  2  100  ? -62.012  4.594   -13.281 1.00 127.88 ?  100  GLN B C     1 
ATOM   3022  O  O     . GLN C  2  100  ? -61.713  5.025   -12.164 1.00 121.80 ?  100  GLN B O     1 
ATOM   3023  C  CB    . GLN C  2  100  ? -61.382  5.327   -15.599 1.00 136.20 ?  100  GLN B CB    1 
ATOM   3024  C  CG    . GLN C  2  100  ? -59.922  5.511   -15.219 1.00 130.38 ?  100  GLN B CG    1 
ATOM   3025  C  CD    . GLN C  2  100  ? -58.975  4.890   -16.227 1.00 138.91 ?  100  GLN B CD    1 
ATOM   3026  O  OE1   . GLN C  2  100  ? -59.399  4.171   -17.132 1.00 129.81 ?  100  GLN B OE1   1 
ATOM   3027  N  NE2   . GLN C  2  100  ? -57.684  5.164   -16.074 1.00 142.10 ?  100  GLN B NE2   1 
ATOM   3028  N  N     . GLY C  2  101  ? -62.058  3.295   -13.568 1.00 137.20 ?  101  GLY B N     1 
ATOM   3029  C  CA    . GLY C  2  101  ? -61.703  2.282   -12.605 1.00 143.75 ?  101  GLY B CA    1 
ATOM   3030  C  C     . GLY C  2  101  ? -62.640  2.249   -11.416 1.00 140.21 ?  101  GLY B C     1 
ATOM   3031  O  O     . GLY C  2  101  ? -63.300  3.239   -11.084 1.00 136.40 ?  101  GLY B O     1 
ATOM   3032  N  N     . PRO C  2  102  ? -62.720  1.098   -10.751 1.00 151.10 ?  102  PRO B N     1 
ATOM   3033  C  CA    . PRO C  2  102  ? -63.569  0.994   -9.558  1.00 152.68 ?  102  PRO B CA    1 
ATOM   3034  C  C     . PRO C  2  102  ? -63.145  2.000   -8.498  1.00 151.48 ?  102  PRO B C     1 
ATOM   3035  O  O     . PRO C  2  102  ? -61.968  2.096   -8.142  1.00 146.69 ?  102  PRO B O     1 
ATOM   3036  C  CB    . PRO C  2  102  ? -63.349  -0.450  -9.091  1.00 142.84 ?  102  PRO B CB    1 
ATOM   3037  C  CG    . PRO C  2  102  ? -62.881  -1.178  -10.309 1.00 142.13 ?  102  PRO B CG    1 
ATOM   3038  C  CD    . PRO C  2  102  ? -62.080  -0.184  -11.094 1.00 147.05 ?  102  PRO B CD    1 
ATOM   3039  N  N     . GLY C  2  103  ? -64.115  2.752   -7.995  1.00 148.75 ?  103  GLY B N     1 
ATOM   3040  C  CA    . GLY C  2  103  ? -63.822  3.758   -6.994  1.00 142.50 ?  103  GLY B CA    1 
ATOM   3041  C  C     . GLY C  2  103  ? -65.067  4.540   -6.642  1.00 145.34 ?  103  GLY B C     1 
ATOM   3042  O  O     . GLY C  2  103  ? -66.186  4.153   -6.984  1.00 140.86 ?  103  GLY B O     1 
ATOM   3043  N  N     . VAL C  2  104  ? -64.854  5.658   -5.951  1.00 142.37 ?  104  VAL B N     1 
ATOM   3044  C  CA    . VAL C  2  104  ? -65.933  6.522   -5.485  1.00 132.48 ?  104  VAL B CA    1 
ATOM   3045  C  C     . VAL C  2  104  ? -65.680  7.926   -6.015  1.00 132.01 ?  104  VAL B C     1 
ATOM   3046  O  O     . VAL C  2  104  ? -64.682  8.563   -5.651  1.00 132.68 ?  104  VAL B O     1 
ATOM   3047  C  CB    . VAL C  2  104  ? -66.039  6.527   -3.952  1.00 136.32 ?  104  VAL B CB    1 
ATOM   3048  C  CG1   . VAL C  2  104  ? -64.690  6.858   -3.326  1.00 118.74 ?  104  VAL B CG1   1 
ATOM   3049  C  CG2   . VAL C  2  104  ? -67.100  7.521   -3.503  1.00 138.51 ?  104  VAL B CG2   1 
ATOM   3050  N  N     . VAL C  2  105  ? -66.577  8.404   -6.872  1.00 124.91 ?  105  VAL B N     1 
ATOM   3051  C  CA    . VAL C  2  105  ? -66.477  9.759   -7.404  1.00 125.70 ?  105  VAL B CA    1 
ATOM   3052  C  C     . VAL C  2  105  ? -67.105  10.712  -6.397  1.00 125.75 ?  105  VAL B C     1 
ATOM   3053  O  O     . VAL C  2  105  ? -68.291  10.595  -6.071  1.00 116.79 ?  105  VAL B O     1 
ATOM   3054  C  CB    . VAL C  2  105  ? -67.157  9.871   -8.775  1.00 112.73 ?  105  VAL B CB    1 
ATOM   3055  C  CG1   . VAL C  2  105  ? -66.761  11.170  -9.456  1.00 109.44 ?  105  VAL B CG1   1 
ATOM   3056  C  CG2   . VAL C  2  105  ? -66.811  8.677   -9.642  1.00 113.10 ?  105  VAL B CG2   1 
ATOM   3057  N  N     . THR C  2  106  ? -66.312  11.655  -5.896  1.00 125.48 ?  106  THR B N     1 
ATOM   3058  C  CA    . THR C  2  106  ? -66.720  12.511  -4.786  1.00 121.83 ?  106  THR B CA    1 
ATOM   3059  C  C     . THR C  2  106  ? -66.523  13.981  -5.129  1.00 124.66 ?  106  THR B C     1 
ATOM   3060  O  O     . THR C  2  106  ? -65.919  14.744  -4.374  1.00 137.61 ?  106  THR B O     1 
ATOM   3061  C  CB    . THR C  2  106  ? -65.950  12.153  -3.517  1.00 132.84 ?  106  THR B CB    1 
ATOM   3062  O  OG1   . THR C  2  106  ? -64.542  12.224  -3.771  1.00 132.16 ?  106  THR B OG1   1 
ATOM   3063  C  CG2   . THR C  2  106  ? -66.309  10.749  -3.057  1.00 131.21 ?  106  THR B CG2   1 
ATOM   3064  N  N     . ALA C  2  107  ? -67.042  14.407  -6.280  1.00 119.54 ?  107  ALA B N     1 
ATOM   3065  C  CA    . ALA C  2  107  ? -67.049  15.824  -6.632  1.00 135.68 ?  107  ALA B CA    1 
ATOM   3066  C  C     . ALA C  2  107  ? -65.639  16.385  -6.781  1.00 148.68 ?  107  ALA B C     1 
ATOM   3067  O  O     . ALA C  2  107  ? -65.328  17.030  -7.787  1.00 145.32 ?  107  ALA B O     1 
ATOM   3068  C  CB    . ALA C  2  107  ? -67.826  16.630  -5.588  1.00 125.88 ?  107  ALA B CB    1 
ATOM   3069  N  N     . GLY C  2  108  ? -64.779  16.153  -5.791  1.00 152.17 ?  108  GLY B N     1 
ATOM   3070  C  CA    . GLY C  2  108  ? -63.395  16.578  -5.883  1.00 145.04 ?  108  GLY B CA    1 
ATOM   3071  C  C     . GLY C  2  108  ? -62.736  16.117  -7.167  1.00 143.53 ?  108  GLY B C     1 
ATOM   3072  O  O     . GLY C  2  108  ? -61.712  16.664  -7.586  1.00 140.91 ?  108  GLY B O     1 
ATOM   3073  N  N     . ASP C  2  109  ? -63.325  15.101  -7.801  1.00 143.64 ?  109  ASP B N     1 
ATOM   3074  C  CA    . ASP C  2  109  ? -62.833  14.609  -9.079  1.00 145.96 ?  109  ASP B CA    1 
ATOM   3075  C  C     . ASP C  2  109  ? -63.228  15.503  -10.248 1.00 140.39 ?  109  ASP B C     1 
ATOM   3076  O  O     . ASP C  2  109  ? -62.554  15.474  -11.283 1.00 158.89 ?  109  ASP B O     1 
ATOM   3077  C  CB    . ASP C  2  109  ? -63.344  13.187  -9.324  1.00 139.36 ?  109  ASP B CB    1 
ATOM   3078  C  CG    . ASP C  2  109  ? -63.012  12.243  -8.183  1.00 138.63 ?  109  ASP B CG    1 
ATOM   3079  O  OD1   . ASP C  2  109  ? -61.986  12.463  -7.504  1.00 143.69 ?  109  ASP B OD1   1 
ATOM   3080  O  OD2   . ASP C  2  109  ? -63.778  11.280  -7.964  1.00 130.07 ?  109  ASP B OD2   1 
ATOM   3081  N  N     . ILE C  2  110  ? -64.294  16.289  -10.114 1.00 126.89 ?  110  ILE B N     1 
ATOM   3082  C  CA    . ILE C  2  110  ? -64.730  17.166  -11.196 1.00 139.11 ?  110  ILE B CA    1 
ATOM   3083  C  C     . ILE C  2  110  ? -63.809  18.377  -11.257 1.00 139.97 ?  110  ILE B C     1 
ATOM   3084  O  O     . ILE C  2  110  ? -63.589  19.059  -10.249 1.00 139.12 ?  110  ILE B O     1 
ATOM   3085  C  CB    . ILE C  2  110  ? -66.196  17.591  -11.008 1.00 140.44 ?  110  ILE B CB    1 
ATOM   3086  C  CG1   . ILE C  2  110  ? -66.712  18.284  -12.270 1.00 136.02 ?  110  ILE B CG1   1 
ATOM   3087  C  CG2   . ILE C  2  110  ? -66.342  18.532  -9.826  1.00 130.33 ?  110  ILE B CG2   1 
ATOM   3088  C  CD1   . ILE C  2  110  ? -68.077  18.916  -12.104 1.00 129.58 ?  110  ILE B CD1   1 
ATOM   3089  N  N     . VAL C  2  111  ? -63.266  18.644  -12.440 1.00 136.33 ?  111  VAL B N     1 
ATOM   3090  C  CA    . VAL C  2  111  ? -62.382  19.788  -12.647 1.00 136.22 ?  111  VAL B CA    1 
ATOM   3091  C  C     . VAL C  2  111  ? -63.234  21.022  -12.919 1.00 135.54 ?  111  VAL B C     1 
ATOM   3092  O  O     . VAL C  2  111  ? -63.880  21.111  -13.973 1.00 131.73 ?  111  VAL B O     1 
ATOM   3093  C  CB    . VAL C  2  111  ? -61.389  19.527  -13.790 1.00 136.78 ?  111  VAL B CB    1 
ATOM   3094  C  CG1   . VAL C  2  111  ? -62.125  19.062  -15.038 1.00 140.49 ?  111  VAL B CG1   1 
ATOM   3095  C  CG2   . VAL C  2  111  ? -60.574  20.779  -14.078 1.00 119.88 ?  111  VAL B CG2   1 
ATOM   3096  N  N     . PRO C  2  112  ? -63.273  21.986  -12.004 1.00 133.41 ?  112  PRO B N     1 
ATOM   3097  C  CA    . PRO C  2  112  ? -64.102  23.174  -12.209 1.00 125.99 ?  112  PRO B CA    1 
ATOM   3098  C  C     . PRO C  2  112  ? -63.382  24.201  -13.063 1.00 126.91 ?  112  PRO B C     1 
ATOM   3099  O  O     . PRO C  2  112  ? -62.226  24.554  -12.784 1.00 123.02 ?  112  PRO B O     1 
ATOM   3100  C  CB    . PRO C  2  112  ? -64.320  23.692  -10.782 1.00 121.20 ?  112  PRO B CB    1 
ATOM   3101  C  CG    . PRO C  2  112  ? -63.066  23.300  -10.073 1.00 120.46 ?  112  PRO B CG    1 
ATOM   3102  C  CD    . PRO C  2  112  ? -62.631  21.982  -10.678 1.00 127.79 ?  112  PRO B CD    1 
ATOM   3103  N  N     . PRO C  2  113  ? -64.030  24.708  -14.110 1.00 119.34 ?  113  PRO B N     1 
ATOM   3104  C  CA    . PRO C  2  113  ? -63.409  25.761  -14.917 1.00 123.33 ?  113  PRO B CA    1 
ATOM   3105  C  C     . PRO C  2  113  ? -63.180  27.020  -14.095 1.00 115.60 ?  113  PRO B C     1 
ATOM   3106  O  O     . PRO C  2  113  ? -63.802  27.238  -13.053 1.00 114.63 ?  113  PRO B O     1 
ATOM   3107  C  CB    . PRO C  2  113  ? -64.427  26.003  -16.038 1.00 123.98 ?  113  PRO B CB    1 
ATOM   3108  C  CG    . PRO C  2  113  ? -65.724  25.509  -15.486 1.00 110.19 ?  113  PRO B CG    1 
ATOM   3109  C  CD    . PRO C  2  113  ? -65.371  24.351  -14.601 1.00 110.53 ?  113  PRO B CD    1 
ATOM   3110  N  N     . ALA C  2  114  ? -62.268  27.857  -14.581 1.00 123.58 ?  114  ALA B N     1 
ATOM   3111  C  CA    . ALA C  2  114  ? -61.955  29.103  -13.894 1.00 131.23 ?  114  ALA B CA    1 
ATOM   3112  C  C     . ALA C  2  114  ? -63.214  29.938  -13.711 1.00 134.03 ?  114  ALA B C     1 
ATOM   3113  O  O     . ALA C  2  114  ? -63.894  30.276  -14.685 1.00 135.12 ?  114  ALA B O     1 
ATOM   3114  C  CB    . ALA C  2  114  ? -60.903  29.887  -14.678 1.00 120.45 ?  114  ALA B CB    1 
ATOM   3115  N  N     . GLY C  2  115  ? -63.524  30.272  -12.462 1.00 131.04 ?  115  GLY B N     1 
ATOM   3116  C  CA    . GLY C  2  115  ? -64.678  31.081  -12.131 1.00 122.11 ?  115  GLY B CA    1 
ATOM   3117  C  C     . GLY C  2  115  ? -65.714  30.375  -11.289 1.00 120.80 ?  115  GLY B C     1 
ATOM   3118  O  O     . GLY C  2  115  ? -66.586  31.043  -10.720 1.00 134.49 ?  115  GLY B O     1 
ATOM   3119  N  N     . VAL C  2  116  ? -65.651  29.047  -11.195 1.00 116.80 ?  116  VAL B N     1 
ATOM   3120  C  CA    . VAL C  2  116  ? -66.584  28.258  -10.402 1.00 112.07 ?  116  VAL B CA    1 
ATOM   3121  C  C     . VAL C  2  116  ? -65.794  27.513  -9.338  1.00 111.69 ?  116  VAL B C     1 
ATOM   3122  O  O     . VAL C  2  116  ? -64.684  27.034  -9.598  1.00 120.93 ?  116  VAL B O     1 
ATOM   3123  C  CB    . VAL C  2  116  ? -67.386  27.271  -11.277 1.00 107.58 ?  116  VAL B CB    1 
ATOM   3124  C  CG1   . VAL C  2  116  ? -68.076  28.012  -12.412 1.00 105.00 ?  116  VAL B CG1   1 
ATOM   3125  C  CG2   . VAL C  2  116  ? -66.474  26.176  -11.818 1.00 127.56 ?  116  VAL B CG2   1 
ATOM   3126  N  N     . THR C  2  117  ? -66.362  27.423  -8.138  1.00 106.27 ?  117  THR B N     1 
ATOM   3127  C  CA    . THR C  2  117  ? -65.695  26.788  -7.006  1.00 119.90 ?  117  THR B CA    1 
ATOM   3128  C  C     . THR C  2  117  ? -66.698  25.920  -6.264  1.00 120.44 ?  117  THR B C     1 
ATOM   3129  O  O     . THR C  2  117  ? -67.704  26.427  -5.760  1.00 128.61 ?  117  THR B O     1 
ATOM   3130  C  CB    . THR C  2  117  ? -65.090  27.831  -6.060  1.00 115.37 ?  117  THR B CB    1 
ATOM   3131  O  OG1   . THR C  2  117  ? -64.685  27.196  -4.840  1.00 109.68 ?  117  THR B OG1   1 
ATOM   3132  C  CG2   . THR C  2  117  ? -66.107  28.925  -5.753  1.00 114.99 ?  117  THR B CG2   1 
ATOM   3133  N  N     . VAL C  2  118  ? -66.426  24.620  -6.208  1.00 115.11 ?  118  VAL B N     1 
ATOM   3134  C  CA    . VAL C  2  118  ? -67.255  23.690  -5.449  1.00 116.93 ?  118  VAL B CA    1 
ATOM   3135  C  C     . VAL C  2  118  ? -66.918  23.816  -3.971  1.00 115.34 ?  118  VAL B C     1 
ATOM   3136  O  O     . VAL C  2  118  ? -65.747  23.949  -3.593  1.00 115.54 ?  118  VAL B O     1 
ATOM   3137  C  CB    . VAL C  2  118  ? -67.047  22.250  -5.952  1.00 116.61 ?  118  VAL B CB    1 
ATOM   3138  C  CG1   . VAL C  2  118  ? -67.829  21.267  -5.094  1.00 105.78 ?  118  VAL B CG1   1 
ATOM   3139  C  CG2   . VAL C  2  118  ? -67.453  22.136  -7.416  1.00 111.18 ?  118  VAL B CG2   1 
ATOM   3140  N  N     . HIS C  2  119  ? -67.946  23.771  -3.125  1.00 115.47 ?  119  HIS B N     1 
ATOM   3141  C  CA    . HIS C  2  119  ? -67.784  23.988  -1.694  1.00 117.36 ?  119  HIS B CA    1 
ATOM   3142  C  C     . HIS C  2  119  ? -67.954  22.722  -0.864  1.00 108.56 ?  119  HIS B C     1 
ATOM   3143  O  O     . HIS C  2  119  ? -67.742  22.766  0.353   1.00 104.95 ?  119  HIS B O     1 
ATOM   3144  C  CB    . HIS C  2  119  ? -68.770  25.059  -1.210  1.00 112.21 ?  119  HIS B CB    1 
ATOM   3145  C  CG    . HIS C  2  119  ? -68.558  26.403  -1.836  1.00 121.66 ?  119  HIS B CG    1 
ATOM   3146  N  ND1   . HIS C  2  119  ? -67.786  27.383  -1.250  1.00 126.85 ?  119  HIS B ND1   1 
ATOM   3147  C  CD2   . HIS C  2  119  ? -69.015  26.929  -2.997  1.00 117.36 ?  119  HIS B CD2   1 
ATOM   3148  C  CE1   . HIS C  2  119  ? -67.778  28.456  -2.021  1.00 118.97 ?  119  HIS B CE1   1 
ATOM   3149  N  NE2   . HIS C  2  119  ? -68.516  28.207  -3.088  1.00 116.78 ?  119  HIS B NE2   1 
ATOM   3150  N  N     . ASN C  2  120  ? -68.327  21.601  -1.477  1.00 104.20 ?  120  ASN B N     1 
ATOM   3151  C  CA    . ASN C  2  120  ? -68.508  20.330  -0.773  1.00 107.59 ?  120  ASN B CA    1 
ATOM   3152  C  C     . ASN C  2  120  ? -67.689  19.249  -1.469  1.00 122.35 ?  120  ASN B C     1 
ATOM   3153  O  O     . ASN C  2  120  ? -68.239  18.318  -2.071  1.00 113.05 ?  120  ASN B O     1 
ATOM   3154  C  CB    . ASN C  2  120  ? -69.987  19.948  -0.704  1.00 101.82 ?  120  ASN B CB    1 
ATOM   3155  C  CG    . ASN C  2  120  ? -70.676  20.031  -2.053  1.00 115.57 ?  120  ASN B CG    1 
ATOM   3156  O  OD1   . ASN C  2  120  ? -70.249  20.775  -2.937  1.00 123.17 ?  120  ASN B OD1   1 
ATOM   3157  N  ND2   . ASN C  2  120  ? -71.755  19.271  -2.216  1.00 103.83 ?  120  ASN B ND2   1 
ATOM   3158  N  N     . PRO C  2  121  ? -66.359  19.340  -1.396  1.00 132.84 ?  121  PRO B N     1 
ATOM   3159  C  CA    . PRO C  2  121  ? -65.517  18.357  -2.098  1.00 125.08 ?  121  PRO B CA    1 
ATOM   3160  C  C     . PRO C  2  121  ? -65.690  16.933  -1.599  1.00 121.08 ?  121  PRO B C     1 
ATOM   3161  O  O     . PRO C  2  121  ? -65.305  15.995  -2.308  1.00 122.35 ?  121  PRO B O     1 
ATOM   3162  C  CB    . PRO C  2  121  ? -64.091  18.868  -1.843  1.00 113.97 ?  121  PRO B CB    1 
ATOM   3163  C  CG    . PRO C  2  121  ? -64.253  20.312  -1.470  1.00 108.09 ?  121  PRO B CG    1 
ATOM   3164  C  CD    . PRO C  2  121  ? -65.560  20.389  -0.742  1.00 120.69 ?  121  PRO B CD    1 
ATOM   3165  N  N     . ASP C  2  122  ? -66.241  16.734  -0.405  1.00 115.71 ?  122  ASP B N     1 
ATOM   3166  C  CA    . ASP C  2  122  ? -66.452  15.396  0.130   1.00 116.77 ?  122  ASP B CA    1 
ATOM   3167  C  C     . ASP C  2  122  ? -67.781  14.790  -0.299  1.00 117.96 ?  122  ASP B C     1 
ATOM   3168  O  O     . ASP C  2  122  ? -68.120  13.693  0.158   1.00 109.08 ?  122  ASP B O     1 
ATOM   3169  C  CB    . ASP C  2  122  ? -66.368  15.417  1.660   1.00 109.92 ?  122  ASP B CB    1 
ATOM   3170  C  CG    . ASP C  2  122  ? -65.007  15.855  2.165   1.00 124.39 ?  122  ASP B CG    1 
ATOM   3171  O  OD1   . ASP C  2  122  ? -64.010  15.666  1.436   1.00 120.91 ?  122  ASP B OD1   1 
ATOM   3172  O  OD2   . ASP C  2  122  ? -64.934  16.386  3.292   1.00 136.52 ?  122  ASP B OD2   1 
ATOM   3173  N  N     . MET C  2  123  ? -68.533  15.465  -1.165  1.00 116.79 ?  123  MET B N     1 
ATOM   3174  C  CA    . MET C  2  123  ? -69.856  14.983  -1.540  1.00 119.84 ?  123  MET B CA    1 
ATOM   3175  C  C     . MET C  2  123  ? -69.744  13.696  -2.345  1.00 108.38 ?  123  MET B C     1 
ATOM   3176  O  O     . MET C  2  123  ? -68.928  13.593  -3.265  1.00 109.67 ?  123  MET B O     1 
ATOM   3177  C  CB    . MET C  2  123  ? -70.605  16.042  -2.348  1.00 122.85 ?  123  MET B CB    1 
ATOM   3178  C  CG    . MET C  2  123  ? -72.118  15.861  -2.334  1.00 110.42 ?  123  MET B CG    1 
ATOM   3179  S  SD    . MET C  2  123  ? -72.972  16.775  -3.633  1.00 122.53 ?  123  MET B SD    1 
ATOM   3180  C  CE    . MET C  2  123  ? -72.936  15.579  -4.967  1.00 101.92 ?  123  MET B CE    1 
ATOM   3181  N  N     . HIS C  2  124  ? -70.569  12.713  -1.997  1.00 106.42 ?  124  HIS B N     1 
ATOM   3182  C  CA    . HIS C  2  124  ? -70.610  11.447  -2.719  1.00 105.55 ?  124  HIS B CA    1 
ATOM   3183  C  C     . HIS C  2  124  ? -71.493  11.613  -3.949  1.00 101.58 ?  124  HIS B C     1 
ATOM   3184  O  O     . HIS C  2  124  ? -72.712  11.773  -3.829  1.00 120.10 ?  124  HIS B O     1 
ATOM   3185  C  CB    . HIS C  2  124  ? -71.132  10.335  -1.814  1.00 114.22 ?  124  HIS B CB    1 
ATOM   3186  C  CG    . HIS C  2  124  ? -71.408  9.050   -2.532  1.00 114.68 ?  124  HIS B CG    1 
ATOM   3187  N  ND1   . HIS C  2  124  ? -70.536  7.982   -2.508  1.00 111.89 ?  124  HIS B ND1   1 
ATOM   3188  C  CD2   . HIS C  2  124  ? -72.457  8.662   -3.294  1.00 109.56 ?  124  HIS B CD2   1 
ATOM   3189  C  CE1   . HIS C  2  124  ? -71.038  6.992   -3.225  1.00 126.62 ?  124  HIS B CE1   1 
ATOM   3190  N  NE2   . HIS C  2  124  ? -72.202  7.379   -3.714  1.00 121.59 ?  124  HIS B NE2   1 
ATOM   3191  N  N     . ILE C  2  125  ? -70.886  11.577  -5.131  1.00 104.16 ?  125  ILE B N     1 
ATOM   3192  C  CA    . ILE C  2  125  ? -71.655  11.658  -6.367  1.00 108.64 ?  125  ILE B CA    1 
ATOM   3193  C  C     . ILE C  2  125  ? -72.047  10.273  -6.863  1.00 104.37 ?  125  ILE B C     1 
ATOM   3194  O  O     . ILE C  2  125  ? -73.186  10.059  -7.284  1.00 103.06 ?  125  ILE B O     1 
ATOM   3195  C  CB    . ILE C  2  125  ? -70.870  12.436  -7.443  1.00 105.23 ?  125  ILE B CB    1 
ATOM   3196  C  CG1   . ILE C  2  125  ? -70.812  13.926  -7.103  1.00 101.32 ?  125  ILE B CG1   1 
ATOM   3197  C  CG2   . ILE C  2  125  ? -71.512  12.250  -8.805  1.00 96.05  ?  125  ILE B CG2   1 
ATOM   3198  C  CD1   . ILE C  2  125  ? -69.963  14.253  -5.903  1.00 116.03 ?  125  ILE B CD1   1 
ATOM   3199  N  N     . ALA C  2  126  ? -71.128  9.313   -6.815  1.00 113.60 ?  126  ALA B N     1 
ATOM   3200  C  CA    . ALA C  2  126  ? -71.428  7.989   -7.333  1.00 118.89 ?  126  ALA B CA    1 
ATOM   3201  C  C     . ALA C  2  126  ? -70.361  7.008   -6.875  1.00 131.53 ?  126  ALA B C     1 
ATOM   3202  O  O     . ALA C  2  126  ? -69.286  7.396   -6.410  1.00 130.63 ?  126  ALA B O     1 
ATOM   3203  C  CB    . ALA C  2  126  ? -71.527  7.996   -8.862  1.00 120.90 ?  126  ALA B CB    1 
ATOM   3204  N  N     . THR C  2  127  ? -70.687  5.725   -7.006  1.00 139.89 ?  127  THR B N     1 
ATOM   3205  C  CA    . THR C  2  127  ? -69.756  4.629   -6.790  1.00 136.74 ?  127  THR B CA    1 
ATOM   3206  C  C     . THR C  2  127  ? -69.442  3.977   -8.130  1.00 147.52 ?  127  THR B C     1 
ATOM   3207  O  O     . THR C  2  127  ? -70.328  3.828   -8.979  1.00 132.06 ?  127  THR B O     1 
ATOM   3208  C  CB    . THR C  2  127  ? -70.336  3.589   -5.826  1.00 135.14 ?  127  THR B CB    1 
ATOM   3209  O  OG1   . THR C  2  127  ? -69.374  2.550   -5.604  1.00 143.00 ?  127  THR B OG1   1 
ATOM   3210  C  CG2   . THR C  2  127  ? -71.603  2.980   -6.406  1.00 131.84 ?  127  THR B CG2   1 
ATOM   3211  N  N     . LEU C  2  128  ? -68.183  3.588   -8.316  1.00 150.48 ?  128  LEU B N     1 
ATOM   3212  C  CA    . LEU C  2  128  ? -67.695  3.068   -9.587  1.00 138.50 ?  128  LEU B CA    1 
ATOM   3213  C  C     . LEU C  2  128  ? -67.593  1.549   -9.547  1.00 144.03 ?  128  LEU B C     1 
ATOM   3214  O  O     . LEU C  2  128  ? -67.157  0.971   -8.546  1.00 138.64 ?  128  LEU B O     1 
ATOM   3215  C  CB    . LEU C  2  128  ? -66.331  3.671   -9.933  1.00 130.49 ?  128  LEU B CB    1 
ATOM   3216  N  N     . ASN C  2  129  ? -67.987  0.907   -10.647 1.00 139.23 ?  129  ASN B N     1 
ATOM   3217  C  CA    . ASN C  2  129  ? -67.912  -0.539  -10.775 1.00 133.64 ?  129  ASN B CA    1 
ATOM   3218  C  C     . ASN C  2  129  ? -66.537  -0.952  -11.302 1.00 147.38 ?  129  ASN B C     1 
ATOM   3219  O  O     . ASN C  2  129  ? -65.648  -0.125  -11.515 1.00 142.27 ?  129  ASN B O     1 
ATOM   3220  C  CB    . ASN C  2  129  ? -69.030  -1.055  -11.680 1.00 115.48 ?  129  ASN B CB    1 
ATOM   3221  N  N     . ASP C  2  130  ? -66.361  -2.253  -11.525 1.00 155.14 ?  130  ASP B N     1 
ATOM   3222  C  CA    . ASP C  2  130  ? -65.067  -2.772  -11.945 1.00 151.99 ?  130  ASP B CA    1 
ATOM   3223  C  C     . ASP C  2  130  ? -64.716  -2.301  -13.351 1.00 145.59 ?  130  ASP B C     1 
ATOM   3224  O  O     . ASP C  2  130  ? -65.551  -2.327  -14.260 1.00 139.17 ?  130  ASP B O     1 
ATOM   3225  C  CB    . ASP C  2  130  ? -65.062  -4.299  -11.888 1.00 138.66 ?  130  ASP B CB    1 
ATOM   3226  N  N     . LYS C  2  131  ? -63.465  -1.869  -13.522 1.00 150.75 ?  131  LYS B N     1 
ATOM   3227  C  CA    . LYS C  2  131  ? -62.934  -1.467  -14.821 1.00 157.04 ?  131  LYS B CA    1 
ATOM   3228  C  C     . LYS C  2  131  ? -63.904  -0.565  -15.573 1.00 153.41 ?  131  LYS B C     1 
ATOM   3229  O  O     . LYS C  2  131  ? -64.029  -0.664  -16.798 1.00 145.35 ?  131  LYS B O     1 
ATOM   3230  C  CB    . LYS C  2  131  ? -62.598  -2.699  -15.664 1.00 157.61 ?  131  LYS B CB    1 
ATOM   3231  N  N     . GLY C  2  132  ? -64.587  0.312   -14.855 1.00 154.75 ?  132  GLY B N     1 
ATOM   3232  C  CA    . GLY C  2  132  ? -65.588  1.188   -15.444 1.00 147.20 ?  132  GLY B CA    1 
ATOM   3233  C  C     . GLY C  2  132  ? -65.185  2.645   -15.336 1.00 140.39 ?  132  GLY B C     1 
ATOM   3234  O  O     . GLY C  2  132  ? -64.679  3.082   -14.300 1.00 131.29 ?  132  GLY B O     1 
ATOM   3235  N  N     . LYS C  2  133  ? -65.407  3.388   -16.415 1.00 133.07 ?  133  LYS B N     1 
ATOM   3236  C  CA    . LYS C  2  133  ? -65.191  4.824   -16.449 1.00 129.20 ?  133  LYS B CA    1 
ATOM   3237  C  C     . LYS C  2  133  ? -66.524  5.540   -16.621 1.00 137.19 ?  133  LYS B C     1 
ATOM   3238  O  O     . LYS C  2  133  ? -67.500  4.975   -17.123 1.00 127.90 ?  133  LYS B O     1 
ATOM   3239  C  CB    . LYS C  2  133  ? -64.232  5.213   -17.580 1.00 119.74 ?  133  LYS B CB    1 
ATOM   3240  N  N     . LEU C  2  134  ? -66.556  6.800   -16.191 1.00 133.92 ?  134  LEU B N     1 
ATOM   3241  C  CA    . LEU C  2  134  ? -67.760  7.619   -16.273 1.00 118.47 ?  134  LEU B CA    1 
ATOM   3242  C  C     . LEU C  2  134  ? -67.357  9.054   -16.566 1.00 112.44 ?  134  LEU B C     1 
ATOM   3243  O  O     . LEU C  2  134  ? -66.650  9.677   -15.769 1.00 108.44 ?  134  LEU B O     1 
ATOM   3244  C  CB    . LEU C  2  134  ? -68.575  7.541   -14.979 1.00 107.51 ?  134  LEU B CB    1 
ATOM   3245  N  N     . GLU C  2  135  ? -67.801  9.571   -17.708 1.00 113.21 ?  135  GLU B N     1 
ATOM   3246  C  CA    . GLU C  2  135  ? -67.570  10.955  -18.100 1.00 111.98 ?  135  GLU B CA    1 
ATOM   3247  C  C     . GLU C  2  135  ? -68.893  11.702  -18.016 1.00 112.87 ?  135  GLU B C     1 
ATOM   3248  O  O     . GLU C  2  135  ? -69.847  11.362  -18.725 1.00 108.99 ?  135  GLU B O     1 
ATOM   3249  C  CB    . GLU C  2  135  ? -66.987  11.041  -19.511 1.00 107.87 ?  135  GLU B CB    1 
ATOM   3250  N  N     . VAL C  2  136  ? -68.951  12.709  -17.148 1.00 118.87 ?  136  VAL B N     1 
ATOM   3251  C  CA    . VAL C  2  136  ? -70.165  13.479  -16.913 1.00 116.83 ?  136  VAL B CA    1 
ATOM   3252  C  C     . VAL C  2  136  ? -69.885  14.942  -17.225 1.00 122.27 ?  136  VAL B C     1 
ATOM   3253  O  O     . VAL C  2  136  ? -68.896  15.509  -16.744 1.00 108.43 ?  136  VAL B O     1 
ATOM   3254  C  CB    . VAL C  2  136  ? -70.674  13.316  -15.468 1.00 104.73 ?  136  VAL B CB    1 
ATOM   3255  C  CG1   . VAL C  2  136  ? -69.708  13.956  -14.482 1.00 108.11 ?  136  VAL B CG1   1 
ATOM   3256  C  CG2   . VAL C  2  136  ? -72.068  13.910  -15.328 1.00 103.43 ?  136  VAL B CG2   1 
ATOM   3257  N  N     . GLU C  2  137  ? -70.748  15.543  -18.038 1.00 124.77 ?  137  GLU B N     1 
ATOM   3258  C  CA    . GLU C  2  137  ? -70.720  16.971  -18.318 1.00 119.30 ?  137  GLU B CA    1 
ATOM   3259  C  C     . GLU C  2  137  ? -71.966  17.601  -17.714 1.00 121.80 ?  137  GLU B C     1 
ATOM   3260  O  O     . GLU C  2  137  ? -73.073  17.079  -17.884 1.00 114.56 ?  137  GLU B O     1 
ATOM   3261  C  CB    . GLU C  2  137  ? -70.655  17.240  -19.823 1.00 110.38 ?  137  GLU B CB    1 
ATOM   3262  N  N     . LEU C  2  138  ? -71.785  18.714  -17.006 1.00 117.33 ?  138  LEU B N     1 
ATOM   3263  C  CA    . LEU C  2  138  ? -72.876  19.345  -16.276 1.00 107.99 ?  138  LEU B CA    1 
ATOM   3264  C  C     . LEU C  2  138  ? -72.821  20.853  -16.462 1.00 106.00 ?  138  LEU B C     1 
ATOM   3265  O  O     . LEU C  2  138  ? -71.759  21.464  -16.306 1.00 107.09 ?  138  LEU B O     1 
ATOM   3266  C  CB    . LEU C  2  138  ? -72.813  18.986  -14.786 1.00 108.59 ?  138  LEU B CB    1 
ATOM   3267  C  CG    . LEU C  2  138  ? -71.434  18.589  -14.255 1.00 116.35 ?  138  LEU B CG    1 
ATOM   3268  C  CD1   . LEU C  2  138  ? -70.457  19.751  -14.358 1.00 121.42 ?  138  LEU B CD1   1 
ATOM   3269  C  CD2   . LEU C  2  138  ? -71.527  18.082  -12.823 1.00 101.14 ?  138  LEU B CD2   1 
ATOM   3270  N  N     . VAL C  2  139  ? -73.966  21.444  -16.793 1.00 109.44 ?  139  VAL B N     1 
ATOM   3271  C  CA    . VAL C  2  139  ? -74.091  22.885  -16.986 1.00 96.37  ?  139  VAL B CA    1 
ATOM   3272  C  C     . VAL C  2  139  ? -74.343  23.544  -15.638 1.00 97.57  ?  139  VAL B C     1 
ATOM   3273  O  O     . VAL C  2  139  ? -75.054  22.996  -14.786 1.00 107.16 ?  139  VAL B O     1 
ATOM   3274  C  CB    . VAL C  2  139  ? -75.220  23.207  -17.982 1.00 98.83  ?  139  VAL B CB    1 
ATOM   3275  C  CG1   . VAL C  2  139  ? -75.375  24.711  -18.140 1.00 106.29 ?  139  VAL B CG1   1 
ATOM   3276  C  CG2   . VAL C  2  139  ? -74.951  22.547  -19.326 1.00 104.36 ?  139  VAL B CG2   1 
ATOM   3277  N  N     . VAL C  2  140  ? -73.763  24.726  -15.440 1.00 89.27  ?  140  VAL B N     1 
ATOM   3278  C  CA    . VAL C  2  140  ? -73.906  25.469  -14.192 1.00 88.70  ?  140  VAL B CA    1 
ATOM   3279  C  C     . VAL C  2  140  ? -74.018  26.949  -14.523 1.00 110.82 ?  140  VAL B C     1 
ATOM   3280  O  O     . VAL C  2  140  ? -73.073  27.544  -15.052 1.00 123.11 ?  140  VAL B O     1 
ATOM   3281  C  CB    . VAL C  2  140  ? -72.732  25.228  -13.228 1.00 83.00  ?  140  VAL B CB    1 
ATOM   3282  C  CG1   . VAL C  2  140  ? -72.802  26.198  -12.059 1.00 102.02 ?  140  VAL B CG1   1 
ATOM   3283  C  CG2   . VAL C  2  140  ? -72.744  23.795  -12.731 1.00 97.95  ?  140  VAL B CG2   1 
ATOM   3284  N  N     . GLU C  2  141  ? -75.166  27.544  -14.209 1.00 107.81 ?  141  GLU B N     1 
ATOM   3285  C  CA    . GLU C  2  141  ? -75.395  28.969  -14.392 1.00 112.81 ?  141  GLU B CA    1 
ATOM   3286  C  C     . GLU C  2  141  ? -76.052  29.528  -13.140 1.00 119.86 ?  141  GLU B C     1 
ATOM   3287  O  O     . GLU C  2  141  ? -76.905  28.874  -12.533 1.00 130.05 ?  141  GLU B O     1 
ATOM   3288  C  CB    . GLU C  2  141  ? -76.273  29.242  -15.619 1.00 110.66 ?  141  GLU B CB    1 
ATOM   3289  C  CG    . GLU C  2  141  ? -77.599  28.501  -15.611 1.00 97.55  ?  141  GLU B CG    1 
ATOM   3290  C  CD    . GLU C  2  141  ? -78.381  28.695  -16.896 1.00 116.50 ?  141  GLU B CD    1 
ATOM   3291  O  OE1   . GLU C  2  141  ? -77.996  29.570  -17.700 1.00 116.38 ?  141  GLU B OE1   1 
ATOM   3292  O  OE2   . GLU C  2  141  ? -79.376  27.969  -17.105 1.00 126.27 -1 141  GLU B OE2   1 
ATOM   3293  N  N     . ARG C  2  142  ? -75.645  30.734  -12.753 1.00 129.52 ?  142  ARG B N     1 
ATOM   3294  C  CA    . ARG C  2  142  ? -76.212  31.357  -11.567 1.00 120.63 ?  142  ARG B CA    1 
ATOM   3295  C  C     . ARG C  2  142  ? -77.718  31.538  -11.731 1.00 121.59 ?  142  ARG B C     1 
ATOM   3296  O  O     . ARG C  2  142  ? -78.266  31.479  -12.835 1.00 119.36 ?  142  ARG B O     1 
ATOM   3297  C  CB    . ARG C  2  142  ? -75.553  32.709  -11.298 1.00 107.43 ?  142  ARG B CB    1 
ATOM   3298  C  CG    . ARG C  2  142  ? -74.044  32.716  -11.420 1.00 118.50 ?  142  ARG B CG    1 
ATOM   3299  C  CD    . ARG C  2  142  ? -73.494  34.110  -11.169 1.00 124.60 ?  142  ARG B CD    1 
ATOM   3300  N  NE    . ARG C  2  142  ? -73.727  34.549  -9.797  1.00 120.99 ?  142  ARG B NE    1 
ATOM   3301  C  CZ    . ARG C  2  142  ? -73.389  35.745  -9.328  1.00 120.67 ?  142  ARG B CZ    1 
ATOM   3302  N  NH1   . ARG C  2  142  ? -72.803  36.630  -10.123 1.00 116.34 1  142  ARG B NH1   1 
ATOM   3303  N  NH2   . ARG C  2  142  ? -73.639  36.059  -8.064  1.00 111.97 ?  142  ARG B NH2   1 
ATOM   3304  N  N     . GLY C  2  143  ? -78.387  31.766  -10.611 1.00 126.82 ?  143  GLY B N     1 
ATOM   3305  C  CA    . GLY C  2  143  ? -79.819  31.956  -10.641 1.00 119.70 ?  143  GLY B CA    1 
ATOM   3306  C  C     . GLY C  2  143  ? -80.337  32.496  -9.329  1.00 111.28 ?  143  GLY B C     1 
ATOM   3307  O  O     . GLY C  2  143  ? -79.578  33.009  -8.505  1.00 102.48 ?  143  GLY B O     1 
ATOM   3308  N  N     . ARG C  2  144  ? -81.650  32.370  -9.147  1.00 111.08 ?  144  ARG B N     1 
ATOM   3309  C  CA    . ARG C  2  144  ? -82.321  32.867  -7.954  1.00 107.06 ?  144  ARG B CA    1 
ATOM   3310  C  C     . ARG C  2  144  ? -83.469  31.936  -7.598  1.00 95.79  ?  144  ARG B C     1 
ATOM   3311  O  O     . ARG C  2  144  ? -84.256  31.556  -8.470  1.00 98.28  ?  144  ARG B O     1 
ATOM   3312  C  CB    . ARG C  2  144  ? -82.849  34.290  -8.168  1.00 107.18 ?  144  ARG B CB    1 
ATOM   3313  C  CG    . ARG C  2  144  ? -82.751  35.182  -6.945  1.00 106.35 ?  144  ARG B CG    1 
ATOM   3314  C  CD    . ARG C  2  144  ? -81.349  35.743  -6.801  1.00 110.60 ?  144  ARG B CD    1 
ATOM   3315  N  NE    . ARG C  2  144  ? -81.343  37.202  -6.845  1.00 117.27 ?  144  ARG B NE    1 
ATOM   3316  C  CZ    . ARG C  2  144  ? -81.556  37.915  -7.946  1.00 109.80 ?  144  ARG B CZ    1 
ATOM   3317  N  NH1   . ARG C  2  144  ? -81.802  37.303  -9.097  1.00 100.71 1  144  ARG B NH1   1 
ATOM   3318  N  NH2   . ARG C  2  144  ? -81.531  39.241  -7.894  1.00 98.48  ?  144  ARG B NH2   1 
ATOM   3319  N  N     . GLY C  2  145  ? -83.559  31.571  -6.324  1.00 88.04  ?  145  GLY B N     1 
ATOM   3320  C  CA    . GLY C  2  145  ? -84.702  30.792  -5.870  1.00 96.77  ?  145  GLY B CA    1 
ATOM   3321  C  C     . GLY C  2  145  ? -84.611  29.344  -6.308  1.00 87.08  ?  145  GLY B C     1 
ATOM   3322  O  O     . GLY C  2  145  ? -83.583  28.679  -6.136  1.00 91.00  ?  145  GLY B O     1 
ATOM   3323  N  N     . TYR C  2  146  ? -85.705  28.842  -6.877  1.00 79.48  ?  146  TYR B N     1 
ATOM   3324  C  CA    . TYR C  2  146  ? -85.805  27.448  -7.304  1.00 73.68  ?  146  TYR B CA    1 
ATOM   3325  C  C     . TYR C  2  146  ? -86.601  27.409  -8.599  1.00 87.59  ?  146  TYR B C     1 
ATOM   3326  O  O     . TYR C  2  146  ? -87.813  27.645  -8.590  1.00 101.86 ?  146  TYR B O     1 
ATOM   3327  C  CB    . TYR C  2  146  ? -86.467  26.589  -6.226  1.00 80.56  ?  146  TYR B CB    1 
ATOM   3328  C  CG    . TYR C  2  146  ? -86.758  25.165  -6.651  1.00 84.23  ?  146  TYR B CG    1 
ATOM   3329  C  CD1   . TYR C  2  146  ? -87.979  24.825  -7.218  1.00 84.55  ?  146  TYR B CD1   1 
ATOM   3330  C  CD2   . TYR C  2  146  ? -85.813  24.162  -6.481  1.00 86.36  ?  146  TYR B CD2   1 
ATOM   3331  C  CE1   . TYR C  2  146  ? -88.249  23.526  -7.607  1.00 85.97  ?  146  TYR B CE1   1 
ATOM   3332  C  CE2   . TYR C  2  146  ? -86.074  22.860  -6.867  1.00 75.49  ?  146  TYR B CE2   1 
ATOM   3333  C  CZ    . TYR C  2  146  ? -87.295  22.547  -7.429  1.00 82.28  ?  146  TYR B CZ    1 
ATOM   3334  O  OH    . TYR C  2  146  ? -87.562  21.252  -7.816  1.00 81.84  ?  146  TYR B OH    1 
ATOM   3335  N  N     . VAL C  2  147  ? -85.930  27.115  -9.704  1.00 92.20  ?  147  VAL B N     1 
ATOM   3336  C  CA    . VAL C  2  147  ? -86.555  27.037  -11.021 1.00 93.71  ?  147  VAL B CA    1 
ATOM   3337  C  C     . VAL C  2  147  ? -86.681  25.564  -11.395 1.00 90.09  ?  147  VAL B C     1 
ATOM   3338  O  O     . VAL C  2  147  ? -85.667  24.854  -11.438 1.00 87.41  ?  147  VAL B O     1 
ATOM   3339  C  CB    . VAL C  2  147  ? -85.755  27.810  -12.080 1.00 92.70  ?  147  VAL B CB    1 
ATOM   3340  C  CG1   . VAL C  2  147  ? -84.346  27.246  -12.201 1.00 122.52 ?  147  VAL B CG1   1 
ATOM   3341  C  CG2   . VAL C  2  147  ? -86.471  27.765  -13.422 1.00 93.43  ?  147  VAL B CG2   1 
ATOM   3342  N  N     . PRO C  2  148  ? -87.882  25.065  -11.671 1.00 87.94  ?  148  PRO B N     1 
ATOM   3343  C  CA    . PRO C  2  148  ? -88.034  23.651  -12.031 1.00 106.19 ?  148  PRO B CA    1 
ATOM   3344  C  C     . PRO C  2  148  ? -87.355  23.338  -13.357 1.00 111.22 ?  148  PRO B C     1 
ATOM   3345  O  O     . PRO C  2  148  ? -86.850  24.214  -14.063 1.00 98.10  ?  148  PRO B O     1 
ATOM   3346  C  CB    . PRO C  2  148  ? -89.552  23.465  -12.117 1.00 100.53 ?  148  PRO B CB    1 
ATOM   3347  C  CG    . PRO C  2  148  ? -90.084  24.834  -12.388 1.00 105.84 ?  148  PRO B CG    1 
ATOM   3348  C  CD    . PRO C  2  148  ? -89.171  25.776  -11.656 1.00 97.94  ?  148  PRO B CD    1 
ATOM   3349  N  N     . ALA C  2  149  ? -87.348  22.050  -13.689 1.00 110.05 ?  149  ALA B N     1 
ATOM   3350  C  CA    . ALA C  2  149  ? -86.704  21.586  -14.907 1.00 102.30 ?  149  ALA B CA    1 
ATOM   3351  C  C     . ALA C  2  149  ? -87.585  21.850  -16.123 1.00 109.17 ?  149  ALA B C     1 
ATOM   3352  O  O     . ALA C  2  149  ? -88.817  21.809  -16.049 1.00 98.15  ?  149  ALA B O     1 
ATOM   3353  C  CB    . ALA C  2  149  ? -86.381  20.095  -14.812 1.00 100.53 ?  149  ALA B CB    1 
ATOM   3354  N  N     . VAL C  2  150  ? -86.936  22.122  -17.251 1.00 120.19 ?  150  VAL B N     1 
ATOM   3355  C  CA    . VAL C  2  150  ? -87.637  22.390  -18.501 1.00 110.80 ?  150  VAL B CA    1 
ATOM   3356  C  C     . VAL C  2  150  ? -87.495  21.210  -19.456 1.00 100.65 ?  150  VAL B C     1 
ATOM   3357  O  O     . VAL C  2  150  ? -86.461  21.044  -20.104 1.00 89.99  ?  150  VAL B O     1 
ATOM   3358  C  CB    . VAL C  2  150  ? -87.124  23.683  -19.157 1.00 105.92 ?  150  VAL B CB    1 
ATOM   3359  C  CG1   . VAL C  2  150  ? -85.603  23.739  -19.103 1.00 89.48  ?  150  VAL B CG1   1 
ATOM   3360  C  CG2   . VAL C  2  150  ? -87.615  23.777  -20.594 1.00 99.86  ?  150  VAL B CG2   1 
ATOM   3361  N  N     . GLU C  2  158  ? -81.440  18.414  -28.708 1.00 97.48  ?  158  GLU B N     1 
ATOM   3362  C  CA    . GLU C  2  158  ? -80.268  17.742  -28.159 1.00 115.57 ?  158  GLU B CA    1 
ATOM   3363  C  C     . GLU C  2  158  ? -80.618  16.341  -27.668 1.00 135.09 ?  158  GLU B C     1 
ATOM   3364  O  O     . GLU C  2  158  ? -81.587  16.155  -26.928 1.00 136.22 ?  158  GLU B O     1 
ATOM   3365  C  CB    . GLU C  2  158  ? -79.666  18.564  -27.030 1.00 108.12 ?  158  GLU B CB    1 
ATOM   3366  N  N     . ILE C  2  159  ? -79.825  15.358  -28.084 1.00 113.56 ?  159  ILE B N     1 
ATOM   3367  C  CA    . ILE C  2  159  ? -80.024  13.976  -27.671 1.00 111.32 ?  159  ILE B CA    1 
ATOM   3368  C  C     . ILE C  2  159  ? -79.183  13.684  -26.435 1.00 118.77 ?  159  ILE B C     1 
ATOM   3369  O  O     . ILE C  2  159  ? -78.009  14.062  -26.371 1.00 106.47 ?  159  ILE B O     1 
ATOM   3370  C  CB    . ILE C  2  159  ? -79.661  13.016  -28.804 1.00 84.92  ?  159  ILE B CB    1 
ATOM   3371  N  N     . GLY C  2  160  ? -79.789  13.017  -25.455 1.00 114.07 ?  160  GLY B N     1 
ATOM   3372  C  CA    . GLY C  2  160  ? -79.095  12.669  -24.233 1.00 115.32 ?  160  GLY B CA    1 
ATOM   3373  C  C     . GLY C  2  160  ? -78.908  13.799  -23.249 1.00 121.57 ?  160  GLY B C     1 
ATOM   3374  O  O     . GLY C  2  160  ? -78.157  13.636  -22.279 1.00 119.95 ?  160  GLY B O     1 
ATOM   3375  N  N     . ARG C  2  161  ? -79.560  14.938  -23.462 1.00 128.11 ?  161  ARG B N     1 
ATOM   3376  C  CA    . ARG C  2  161  ? -79.471  16.062  -22.542 1.00 114.19 ?  161  ARG B CA    1 
ATOM   3377  C  C     . ARG C  2  161  ? -80.639  15.998  -21.565 1.00 122.75 ?  161  ARG B C     1 
ATOM   3378  O  O     . ARG C  2  161  ? -81.802  15.940  -21.980 1.00 131.48 ?  161  ARG B O     1 
ATOM   3379  C  CB    . ARG C  2  161  ? -79.471  17.386  -23.305 1.00 115.19 ?  161  ARG B CB    1 
ATOM   3380  C  CG    . ARG C  2  161  ? -79.322  18.603  -22.418 1.00 112.03 ?  161  ARG B CG    1 
ATOM   3381  C  CD    . ARG C  2  161  ? -78.181  18.422  -21.435 1.00 109.85 ?  161  ARG B CD    1 
ATOM   3382  N  NE    . ARG C  2  161  ? -77.251  19.546  -21.467 1.00 121.05 ?  161  ARG B NE    1 
ATOM   3383  C  CZ    . ARG C  2  161  ? -76.162  19.590  -22.228 1.00 130.11 ?  161  ARG B CZ    1 
ATOM   3384  N  NH1   . ARG C  2  161  ? -75.864  18.571  -23.023 1.00 145.16 1  161  ARG B NH1   1 
ATOM   3385  N  NH2   . ARG C  2  161  ? -75.370  20.653  -22.194 1.00 140.15 ?  161  ARG B NH2   1 
ATOM   3386  N  N     . ILE C  2  162  ? -80.330  16.016  -20.274 1.00 125.87 ?  162  ILE B N     1 
ATOM   3387  C  CA    . ILE C  2  162  ? -81.324  15.850  -19.221 1.00 124.83 ?  162  ILE B CA    1 
ATOM   3388  C  C     . ILE C  2  162  ? -81.397  17.153  -18.428 1.00 120.47 ?  162  ILE B C     1 
ATOM   3389  O  O     . ILE C  2  162  ? -80.449  17.491  -17.703 1.00 112.58 ?  162  ILE B O     1 
ATOM   3390  C  CB    . ILE C  2  162  ? -80.991  14.661  -18.310 1.00 120.55 ?  162  ILE B CB    1 
ATOM   3391  C  CG1   . ILE C  2  162  ? -81.035  13.354  -19.104 1.00 112.61 ?  162  ILE B CG1   1 
ATOM   3392  C  CG2   . ILE C  2  162  ? -81.947  14.611  -17.126 1.00 120.96 ?  162  ILE B CG2   1 
ATOM   3393  C  CD1   . ILE C  2  162  ? -80.730  12.122  -18.278 1.00 93.61  ?  162  ILE B CD1   1 
ATOM   3394  N  N     . PRO C  2  163  ? -82.479  17.922  -18.542 1.00 120.15 ?  163  PRO B N     1 
ATOM   3395  C  CA    . PRO C  2  163  ? -82.655  19.073  -17.651 1.00 104.12 ?  163  PRO B CA    1 
ATOM   3396  C  C     . PRO C  2  163  ? -83.006  18.607  -16.247 1.00 107.89 ?  163  PRO B C     1 
ATOM   3397  O  O     . PRO C  2  163  ? -83.785  17.669  -16.061 1.00 105.04 ?  163  PRO B O     1 
ATOM   3398  C  CB    . PRO C  2  163  ? -83.814  19.850  -18.289 1.00 106.11 ?  163  PRO B CB    1 
ATOM   3399  C  CG    . PRO C  2  163  ? -83.976  19.272  -19.670 1.00 114.98 ?  163  PRO B CG    1 
ATOM   3400  C  CD    . PRO C  2  163  ? -83.533  17.850  -19.564 1.00 121.80 ?  163  PRO B CD    1 
ATOM   3401  N  N     . VAL C  2  164  ? -82.422  19.272  -15.255 1.00 101.32 ?  164  VAL B N     1 
ATOM   3402  C  CA    . VAL C  2  164  ? -82.629  18.912  -13.860 1.00 105.48 ?  164  VAL B CA    1 
ATOM   3403  C  C     . VAL C  2  164  ? -83.177  20.114  -13.108 1.00 104.09 ?  164  VAL B C     1 
ATOM   3404  O  O     . VAL C  2  164  ? -82.961  21.269  -13.491 1.00 106.69 ?  164  VAL B O     1 
ATOM   3405  C  CB    . VAL C  2  164  ? -81.331  18.404  -13.195 1.00 98.23  ?  164  VAL B CB    1 
ATOM   3406  C  CG1   . VAL C  2  164  ? -80.790  17.196  -13.941 1.00 95.19  ?  164  VAL B CG1   1 
ATOM   3407  C  CG2   . VAL C  2  164  ? -80.295  19.517  -13.134 1.00 101.33 ?  164  VAL B CG2   1 
ATOM   3408  N  N     . ASP C  2  165  ? -83.898  19.830  -12.028 1.00 98.74  ?  165  ASP B N     1 
ATOM   3409  C  CA    . ASP C  2  165  ? -84.385  20.894  -11.164 1.00 91.37  ?  165  ASP B CA    1 
ATOM   3410  C  C     . ASP C  2  165  ? -83.208  21.652  -10.565 1.00 91.97  ?  165  ASP B C     1 
ATOM   3411  O  O     . ASP C  2  165  ? -82.214  21.056  -10.140 1.00 95.29  ?  165  ASP B O     1 
ATOM   3412  C  CB    . ASP C  2  165  ? -85.268  20.313  -10.062 1.00 95.52  ?  165  ASP B CB    1 
ATOM   3413  C  CG    . ASP C  2  165  ? -86.388  19.452  -10.613 1.00 106.34 ?  165  ASP B CG    1 
ATOM   3414  O  OD1   . ASP C  2  165  ? -86.943  19.811  -11.675 1.00 96.75  ?  165  ASP B OD1   1 
ATOM   3415  O  OD2   . ASP C  2  165  ? -86.707  18.416  -9.992  1.00 119.24 -1 165  ASP B OD2   1 
ATOM   3416  N  N     . SER C  2  166  ? -83.322  22.977  -10.534 1.00 84.37  ?  166  SER B N     1 
ATOM   3417  C  CA    . SER C  2  166  ? -82.228  23.854  -10.135 1.00 87.75  ?  166  SER B CA    1 
ATOM   3418  C  C     . SER C  2  166  ? -82.530  24.476  -8.776  1.00 92.61  ?  166  SER B C     1 
ATOM   3419  O  O     . SER C  2  166  ? -83.493  25.232  -8.636  1.00 95.92  ?  166  SER B O     1 
ATOM   3420  C  CB    . SER C  2  166  ? -81.991  24.947  -11.176 1.00 99.04  ?  166  SER B CB    1 
ATOM   3421  O  OG    . SER C  2  166  ? -81.776  24.389  -12.459 1.00 108.03 ?  166  SER B OG    1 
ATOM   3422  N  N     . ILE C  2  167  ? -81.695  24.170  -7.783  1.00 92.00  ?  167  ILE B N     1 
ATOM   3423  C  CA    . ILE C  2  167  ? -81.781  24.787  -6.463  1.00 77.60  ?  167  ILE B CA    1 
ATOM   3424  C  C     . ILE C  2  167  ? -80.832  25.977  -6.395  1.00 84.07  ?  167  ILE B C     1 
ATOM   3425  O  O     . ILE C  2  167  ? -79.714  25.871  -5.878  1.00 88.34  ?  167  ILE B O     1 
ATOM   3426  C  CB    . ILE C  2  167  ? -81.475  23.782  -5.347  1.00 72.01  ?  167  ILE B CB    1 
ATOM   3427  C  CG1   . ILE C  2  167  ? -82.459  22.610  -5.369  1.00 69.47  ?  167  ILE B CG1   1 
ATOM   3428  C  CG2   . ILE C  2  167  ? -81.471  24.489  -3.986  1.00 79.37  ?  167  ILE B CG2   1 
ATOM   3429  C  CD1   . ILE C  2  167  ? -82.238  21.597  -4.279  1.00 77.84  ?  167  ILE B CD1   1 
ATOM   3430  N  N     . TYR C  2  168  ? -81.266  27.119  -6.946  1.00 92.20  ?  168  TYR B N     1 
ATOM   3431  C  CA    . TYR C  2  168  ? -80.363  28.260  -7.099  1.00 95.99  ?  168  TYR B CA    1 
ATOM   3432  C  C     . TYR C  2  168  ? -79.977  28.868  -5.756  1.00 101.11 ?  168  TYR B C     1 
ATOM   3433  O  O     . TYR C  2  168  ? -78.808  29.203  -5.537  1.00 103.63 ?  168  TYR B O     1 
ATOM   3434  C  CB    . TYR C  2  168  ? -81.000  29.321  -7.987  1.00 97.15  ?  168  TYR B CB    1 
ATOM   3435  C  CG    . TYR C  2  168  ? -80.986  28.992  -9.467  1.00 106.12 ?  168  TYR B CG    1 
ATOM   3436  C  CD1   . TYR C  2  168  ? -81.920  29.547  -10.334 1.00 110.58 ?  168  TYR B CD1   1 
ATOM   3437  C  CD2   . TYR C  2  168  ? -80.033  28.134  -9.998  1.00 113.51 ?  168  TYR B CD2   1 
ATOM   3438  C  CE1   . TYR C  2  168  ? -81.908  29.254  -11.687 1.00 105.41 ?  168  TYR B CE1   1 
ATOM   3439  C  CE2   . TYR C  2  168  ? -80.014  27.832  -11.350 1.00 114.43 ?  168  TYR B CE2   1 
ATOM   3440  C  CZ    . TYR C  2  168  ? -80.956  28.396  -12.189 1.00 107.11 ?  168  TYR B CZ    1 
ATOM   3441  O  OH    . TYR C  2  168  ? -80.939  28.097  -13.532 1.00 120.54 ?  168  TYR B OH    1 
ATOM   3442  N  N     . SER C  2  169  ? -80.947  29.053  -4.856  1.00 105.11 ?  169  SER B N     1 
ATOM   3443  C  CA    . SER C  2  169  ? -80.694  29.825  -3.644  1.00 106.01 ?  169  SER B CA    1 
ATOM   3444  C  C     . SER C  2  169  ? -79.867  29.019  -2.643  1.00 93.45  ?  169  SER B C     1 
ATOM   3445  O  O     . SER C  2  169  ? -80.092  27.819  -2.472  1.00 97.96  ?  169  SER B O     1 
ATOM   3446  C  CB    . SER C  2  169  ? -82.009  30.252  -2.999  1.00 112.64 ?  169  SER B CB    1 
ATOM   3447  O  OG    . SER C  2  169  ? -82.699  31.166  -3.832  1.00 109.07 ?  169  SER B OG    1 
ATOM   3448  N  N     . PRO C  2  170  ? -78.901  29.657  -1.972  1.00 91.88  ?  170  PRO B N     1 
ATOM   3449  C  CA    . PRO C  2  170  ? -78.180  28.956  -0.895  1.00 93.47  ?  170  PRO B CA    1 
ATOM   3450  C  C     . PRO C  2  170  ? -79.092  28.510  0.234   1.00 110.48 ?  170  PRO B C     1 
ATOM   3451  O  O     . PRO C  2  170  ? -78.875  27.442  0.818   1.00 116.36 ?  170  PRO B O     1 
ATOM   3452  C  CB    . PRO C  2  170  ? -77.156  30.000  -0.421  1.00 88.55  ?  170  PRO B CB    1 
ATOM   3453  C  CG    . PRO C  2  170  ? -77.038  30.969  -1.556  1.00 102.80 ?  170  PRO B CG    1 
ATOM   3454  C  CD    . PRO C  2  170  ? -78.387  31.016  -2.196  1.00 90.36  ?  170  PRO B CD    1 
ATOM   3455  N  N     . VAL C  2  171  ? -80.114  29.306  0.562   1.00 114.13 ?  171  VAL B N     1 
ATOM   3456  C  CA    . VAL C  2  171  ? -81.060  28.916  1.599   1.00 108.35 ?  171  VAL B CA    1 
ATOM   3457  C  C     . VAL C  2  171  ? -81.776  27.643  1.172   1.00 103.62 ?  171  VAL B C     1 
ATOM   3458  O  O     . VAL C  2  171  ? -82.290  27.547  0.051   1.00 108.42 ?  171  VAL B O     1 
ATOM   3459  C  CB    . VAL C  2  171  ? -82.053  30.055  1.869   1.00 113.61 ?  171  VAL B CB    1 
ATOM   3460  C  CG1   . VAL C  2  171  ? -81.313  31.316  2.307   1.00 113.76 ?  171  VAL B CG1   1 
ATOM   3461  C  CG2   . VAL C  2  171  ? -82.894  30.327  0.628   1.00 112.15 ?  171  VAL B CG2   1 
ATOM   3462  N  N     . LEU C  2  172  ? -81.820  26.660  2.067   1.00 99.48  ?  172  LEU B N     1 
ATOM   3463  C  CA    . LEU C  2  172  ? -82.408  25.355  1.780   1.00 104.70 ?  172  LEU B CA    1 
ATOM   3464  C  C     . LEU C  2  172  ? -83.770  25.146  2.419   1.00 114.00 ?  172  LEU B C     1 
ATOM   3465  O  O     . LEU C  2  172  ? -84.678  24.646  1.755   1.00 107.75 ?  172  LEU B O     1 
ATOM   3466  C  CB    . LEU C  2  172  ? -81.459  24.244  2.230   1.00 113.87 ?  172  LEU B CB    1 
ATOM   3467  C  CG    . LEU C  2  172  ? -81.701  22.874  1.608   1.00 130.00 ?  172  LEU B CG    1 
ATOM   3468  C  CD1   . LEU C  2  172  ? -82.516  22.994  0.328   1.00 121.80 ?  172  LEU B CD1   1 
ATOM   3469  C  CD2   . LEU C  2  172  ? -80.372  22.201  1.332   1.00 130.64 ?  172  LEU B CD2   1 
ATOM   3470  N  N     . LYS C  2  173  ? -83.945  25.534  3.680   1.00 114.30 ?  173  LYS B N     1 
ATOM   3471  C  CA    . LYS C  2  173  ? -85.232  25.432  4.354   1.00 94.91  ?  173  LYS B CA    1 
ATOM   3472  C  C     . LYS C  2  173  ? -85.396  26.615  5.293   1.00 92.41  ?  173  LYS B C     1 
ATOM   3473  O  O     . LYS C  2  173  ? -84.500  26.905  6.090   1.00 90.98  ?  173  LYS B O     1 
ATOM   3474  C  CB    . LYS C  2  173  ? -85.353  24.120  5.136   1.00 97.35  ?  173  LYS B CB    1 
ATOM   3475  C  CG    . LYS C  2  173  ? -86.628  24.015  5.959   1.00 94.82  ?  173  LYS B CG    1 
ATOM   3476  C  CD    . LYS C  2  173  ? -86.813  22.625  6.547   1.00 96.32  ?  173  LYS B CD    1 
ATOM   3477  C  CE    . LYS C  2  173  ? -88.146  22.510  7.266   1.00 99.37  ?  173  LYS B CE    1 
ATOM   3478  N  NZ    . LYS C  2  173  ? -88.438  21.110  7.672   1.00 113.14 ?  173  LYS B NZ    1 
ATOM   3479  N  N     . VAL C  2  174  ? -86.538  27.290  5.198   1.00 94.70  ?  174  VAL B N     1 
ATOM   3480  C  CA    . VAL C  2  174  ? -86.829  28.454  6.026   1.00 93.40  ?  174  VAL B CA    1 
ATOM   3481  C  C     . VAL C  2  174  ? -88.254  28.343  6.548   1.00 94.04  ?  174  VAL B C     1 
ATOM   3482  O  O     . VAL C  2  174  ? -89.179  28.027  5.791   1.00 82.64  ?  174  VAL B O     1 
ATOM   3483  C  CB    . VAL C  2  174  ? -86.640  29.773  5.253   1.00 88.19  ?  174  VAL B CB    1 
ATOM   3484  C  CG1   . VAL C  2  174  ? -87.094  30.948  6.105   1.00 81.48  ?  174  VAL B CG1   1 
ATOM   3485  C  CG2   . VAL C  2  174  ? -85.186  29.942  4.843   1.00 105.33 ?  174  VAL B CG2   1 
ATOM   3486  N  N     . THR C  2  175  ? -88.429  28.611  7.840   1.00 94.39  ?  175  THR B N     1 
ATOM   3487  C  CA    . THR C  2  175  ? -89.738  28.604  8.474   1.00 84.77  ?  175  THR B CA    1 
ATOM   3488  C  C     . THR C  2  175  ? -89.734  29.626  9.600   1.00 94.62  ?  175  THR B C     1 
ATOM   3489  O  O     . THR C  2  175  ? -88.685  29.951  10.163  1.00 96.93  ?  175  THR B O     1 
ATOM   3490  C  CB    . THR C  2  175  ? -90.102  27.216  9.010   1.00 72.41  ?  175  THR B CB    1 
ATOM   3491  O  OG1   . THR C  2  175  ? -91.341  27.289  9.728   1.00 109.23 ?  175  THR B OG1   1 
ATOM   3492  C  CG2   . THR C  2  175  ? -89.012  26.703  9.935   1.00 63.88  ?  175  THR B CG2   1 
ATOM   3493  N  N     . TYR C  2  176  ? -90.920  30.138  9.927   1.00 93.31  ?  176  TYR B N     1 
ATOM   3494  C  CA    . TYR C  2  176  ? -91.034  31.174  10.942  1.00 91.66  ?  176  TYR B CA    1 
ATOM   3495  C  C     . TYR C  2  176  ? -92.264  30.938  11.807  1.00 95.75  ?  176  TYR B C     1 
ATOM   3496  O  O     . TYR C  2  176  ? -93.238  30.311  11.381  1.00 93.99  ?  176  TYR B O     1 
ATOM   3497  C  CB    . TYR C  2  176  ? -91.091  32.579  10.320  1.00 75.78  ?  176  TYR B CB    1 
ATOM   3498  C  CG    . TYR C  2  176  ? -92.389  32.918  9.618   1.00 78.74  ?  176  TYR B CG    1 
ATOM   3499  C  CD1   . TYR C  2  176  ? -93.072  31.969  8.867   1.00 93.35  ?  176  TYR B CD1   1 
ATOM   3500  C  CD2   . TYR C  2  176  ? -92.932  34.194  9.707   1.00 80.50  ?  176  TYR B CD2   1 
ATOM   3501  C  CE1   . TYR C  2  176  ? -94.258  32.283  8.226   1.00 100.76 ?  176  TYR B CE1   1 
ATOM   3502  C  CE2   . TYR C  2  176  ? -94.117  34.516  9.070   1.00 84.35  ?  176  TYR B CE2   1 
ATOM   3503  C  CZ    . TYR C  2  176  ? -94.775  33.557  8.332   1.00 90.91  ?  176  TYR B CZ    1 
ATOM   3504  O  OH    . TYR C  2  176  ? -95.954  33.878  7.699   1.00 87.19  ?  176  TYR B OH    1 
ATOM   3505  N  N     . LYS C  2  177  ? -92.200  31.454  13.033  1.00 92.62  ?  177  LYS B N     1 
ATOM   3506  C  CA    . LYS C  2  177  ? -93.280  31.341  14.002  1.00 88.31  ?  177  LYS B CA    1 
ATOM   3507  C  C     . LYS C  2  177  ? -93.295  32.609  14.843  1.00 89.86  ?  177  LYS B C     1 
ATOM   3508  O  O     . LYS C  2  177  ? -92.299  33.333  14.922  1.00 97.38  ?  177  LYS B O     1 
ATOM   3509  C  CB    . LYS C  2  177  ? -93.116  30.088  14.874  1.00 77.53  ?  177  LYS B CB    1 
ATOM   3510  C  CG    . LYS C  2  177  ? -92.975  30.355  16.363  1.00 77.67  ?  177  LYS B CG    1 
ATOM   3511  C  CD    . LYS C  2  177  ? -94.307  30.199  17.079  1.00 77.67  ?  177  LYS B CD    1 
ATOM   3512  C  CE    . LYS C  2  177  ? -94.864  28.797  16.900  1.00 81.39  ?  177  LYS B CE    1 
ATOM   3513  N  NZ    . LYS C  2  177  ? -96.174  28.629  17.583  1.00 93.69  1  177  LYS B NZ    1 
ATOM   3514  N  N     . VAL C  2  178  ? -94.440  32.880  15.469  1.00 92.24  ?  178  VAL B N     1 
ATOM   3515  C  CA    . VAL C  2  178  ? -94.639  34.116  16.215  1.00 91.72  ?  178  VAL B CA    1 
ATOM   3516  C  C     . VAL C  2  178  ? -95.235  33.806  17.581  1.00 88.90  ?  178  VAL B C     1 
ATOM   3517  O  O     . VAL C  2  178  ? -96.004  32.854  17.747  1.00 101.91 ?  178  VAL B O     1 
ATOM   3518  C  CB    . VAL C  2  178  ? -95.540  35.102  15.444  1.00 84.02  ?  178  VAL B CB    1 
ATOM   3519  C  CG1   . VAL C  2  178  ? -94.744  36.324  15.027  1.00 88.98  ?  178  VAL B CG1   1 
ATOM   3520  C  CG2   . VAL C  2  178  ? -96.130  34.417  14.232  1.00 89.57  ?  178  VAL B CG2   1 
ATOM   3521  N  N     . GLU C  2  179  ? -94.876  34.630  18.563  1.00 78.50  ?  179  GLU B N     1 
ATOM   3522  C  CA    . GLU C  2  179  ? -95.324  34.454  19.938  1.00 101.64 ?  179  GLU B CA    1 
ATOM   3523  C  C     . GLU C  2  179  ? -95.640  35.829  20.518  1.00 101.92 ?  179  GLU B C     1 
ATOM   3524  O  O     . GLU C  2  179  ? -95.619  36.843  19.813  1.00 103.99 ?  179  GLU B O     1 
ATOM   3525  C  CB    . GLU C  2  179  ? -94.266  33.702  20.758  1.00 110.34 ?  179  GLU B CB    1 
ATOM   3526  C  CG    . GLU C  2  179  ? -93.925  32.324  20.213  1.00 98.32  ?  179  GLU B CG    1 
ATOM   3527  C  CD    . GLU C  2  179  ? -92.819  31.644  20.994  1.00 108.99 ?  179  GLU B CD    1 
ATOM   3528  O  OE1   . GLU C  2  179  ? -92.342  30.579  20.547  1.00 115.56 ?  179  GLU B OE1   1 
ATOM   3529  O  OE2   . GLU C  2  179  ? -92.424  32.173  22.055  1.00 115.09 ?  179  GLU B OE2   1 
ATOM   3530  N  N     . ALA C  2  180  ? -95.936  35.864  21.816  1.00 95.11  ?  180  ALA B N     1 
ATOM   3531  C  CA    . ALA C  2  180  ? -96.274  37.098  22.512  1.00 97.77  ?  180  ALA B CA    1 
ATOM   3532  C  C     . ALA C  2  180  ? -95.397  37.234  23.747  1.00 104.37 ?  180  ALA B C     1 
ATOM   3533  O  O     . ALA C  2  180  ? -95.268  36.286  24.527  1.00 116.76 ?  180  ALA B O     1 
ATOM   3534  C  CB    . ALA C  2  180  ? -97.753  37.126  22.906  1.00 101.82 ?  180  ALA B CB    1 
ATOM   3535  N  N     . THR C  2  181  ? -94.800  38.407  23.920  1.00 100.24 ?  181  THR B N     1 
ATOM   3536  C  CA    . THR C  2  181  ? -93.943  38.675  25.069  1.00 113.72 ?  181  THR B CA    1 
ATOM   3537  C  C     . THR C  2  181  ? -94.109  40.141  25.453  1.00 117.17 ?  181  THR B C     1 
ATOM   3538  O  O     . THR C  2  181  ? -95.095  40.786  25.080  1.00 108.73 ?  181  THR B O     1 
ATOM   3539  C  CB    . THR C  2  181  ? -92.480  38.315  24.757  1.00 113.35 ?  181  THR B CB    1 
ATOM   3540  O  OG1   . THR C  2  181  ? -92.041  39.051  23.608  1.00 107.32 ?  181  THR B OG1   1 
ATOM   3541  C  CG2   . THR C  2  181  ? -92.334  36.821  24.496  1.00 113.90 ?  181  THR B CG2   1 
ATOM   3542  N  N     . ARG C  2  182  ? -93.140  40.668  26.202  1.00 125.68 ?  182  ARG B N     1 
ATOM   3543  C  CA    . ARG C  2  182  ? -93.152  42.065  26.617  1.00 120.62 ?  182  ARG B CA    1 
ATOM   3544  C  C     . ARG C  2  182  ? -94.452  42.398  27.336  1.00 112.21 ?  182  ARG B C     1 
ATOM   3545  O  O     . ARG C  2  182  ? -95.365  42.979  26.742  1.00 119.07 ?  182  ARG B O     1 
ATOM   3546  C  CB    . ARG C  2  182  ? -92.959  42.982  25.408  1.00 129.73 ?  182  ARG B CB    1 
ATOM   3547  C  CG    . ARG C  2  182  ? -91.991  44.131  25.640  1.00 127.46 ?  182  ARG B CG    1 
ATOM   3548  C  CD    . ARG C  2  182  ? -92.370  44.940  26.868  1.00 125.58 ?  182  ARG B CD    1 
ATOM   3549  N  NE    . ARG C  2  182  ? -93.794  45.259  26.892  1.00 119.51 ?  182  ARG B NE    1 
ATOM   3550  C  CZ    . ARG C  2  182  ? -94.371  46.161  26.106  1.00 127.93 ?  182  ARG B CZ    1 
ATOM   3551  N  NH1   . ARG C  2  182  ? -93.646  46.833  25.221  1.00 127.36 ?  182  ARG B NH1   1 
ATOM   3552  N  NH2   . ARG C  2  182  ? -95.674  46.387  26.200  1.00 127.12 ?  182  ARG B NH2   1 
ATOM   3553  N  N     . VAL C  2  183  ? -94.542  42.035  28.614  1.00 121.95 ?  183  VAL B N     1 
ATOM   3554  C  CA    . VAL C  2  183  ? -95.746  42.277  29.401  1.00 125.05 ?  183  VAL B CA    1 
ATOM   3555  C  C     . VAL C  2  183  ? -95.993  43.776  29.515  1.00 134.07 ?  183  VAL B C     1 
ATOM   3556  O  O     . VAL C  2  183  ? -96.810  44.339  28.778  1.00 133.72 ?  183  VAL B O     1 
ATOM   3557  C  CB    . VAL C  2  183  ? -95.642  41.629  30.793  1.00 112.46 ?  183  VAL B CB    1 
ATOM   3558  C  CG1   . VAL C  2  183  ? -96.821  42.041  31.658  1.00 110.93 ?  183  VAL B CG1   1 
ATOM   3559  C  CG2   . VAL C  2  183  ? -95.573  40.115  30.666  1.00 108.10 ?  183  VAL B CG2   1 
ATOM   3560  N  N     . GLU C  2  184  ? -95.284  44.432  30.434  1.00 134.82 ?  184  GLU B N     1 
ATOM   3561  C  CA    . GLU C  2  184  ? -95.510  45.845  30.711  1.00 126.23 ?  184  GLU B CA    1 
ATOM   3562  C  C     . GLU C  2  184  ? -96.989  46.087  30.986  1.00 130.44 ?  184  GLU B C     1 
ATOM   3563  O  O     . GLU C  2  184  ? -97.533  45.584  31.974  1.00 128.92 ?  184  GLU B O     1 
ATOM   3564  C  CB    . GLU C  2  184  ? -95.029  46.714  29.547  1.00 112.67 ?  184  GLU B CB    1 
ATOM   3565  C  CG    . GLU C  2  184  ? -94.907  48.192  29.891  1.00 130.75 ?  184  GLU B CG    1 
ATOM   3566  C  CD    . GLU C  2  184  ? -94.489  49.041  28.705  1.00 146.33 ?  184  GLU B CD    1 
ATOM   3567  O  OE1   . GLU C  2  184  ? -94.781  48.645  27.556  1.00 152.23 ?  184  GLU B OE1   1 
ATOM   3568  O  OE2   . GLU C  2  184  ? -93.867  50.103  28.920  1.00 136.41 ?  184  GLU B OE2   1 
ATOM   3569  N  N     . GLN C  2  185  ? -97.650  46.848  30.116  1.00 125.03 ?  185  GLN B N     1 
ATOM   3570  C  CA    . GLN C  2  185  ? -99.088  47.059  30.216  1.00 116.96 ?  185  GLN B CA    1 
ATOM   3571  C  C     . GLN C  2  185  ? -99.878  46.258  29.194  1.00 122.82 ?  185  GLN B C     1 
ATOM   3572  O  O     . GLN C  2  185  ? -101.030 45.900  29.460  1.00 127.13 ?  185  GLN B O     1 
ATOM   3573  C  CB    . GLN C  2  185  ? -99.421  48.546  30.056  1.00 110.30 ?  185  GLN B CB    1 
ATOM   3574  N  N     . ARG C  2  186  ? -99.285  45.964  28.039  1.00 121.07 ?  186  ARG B N     1 
ATOM   3575  C  CA    . ARG C  2  186  ? -99.936  45.221  26.968  1.00 111.79 ?  186  ARG B CA    1 
ATOM   3576  C  C     . ARG C  2  186  ? -99.125  43.962  26.696  1.00 108.14 ?  186  ARG B C     1 
ATOM   3577  O  O     . ARG C  2  186  ? -97.937  44.046  26.366  1.00 117.33 ?  186  ARG B O     1 
ATOM   3578  C  CB    . ARG C  2  186  ? -100.055 46.083  25.709  1.00 104.75 ?  186  ARG B CB    1 
ATOM   3579  C  CG    . ARG C  2  186  ? -100.906 45.487  24.603  1.00 108.75 ?  186  ARG B CG    1 
ATOM   3580  C  CD    . ARG C  2  186  ? -102.038 46.429  24.219  1.00 110.10 ?  186  ARG B CD    1 
ATOM   3581  N  NE    . ARG C  2  186  ? -102.537 46.173  22.870  1.00 113.70 ?  186  ARG B NE    1 
ATOM   3582  C  CZ    . ARG C  2  186  ? -102.119 46.819  21.786  1.00 119.48 ?  186  ARG B CZ    1 
ATOM   3583  N  NH1   . ARG C  2  186  ? -101.194 47.765  21.890  1.00 118.19 ?  186  ARG B NH1   1 
ATOM   3584  N  NH2   . ARG C  2  186  ? -102.625 46.522  20.597  1.00 109.96 ?  186  ARG B NH2   1 
ATOM   3585  N  N     . THR C  2  187  ? -99.763  42.801  26.836  1.00 101.97 ?  187  THR B N     1 
ATOM   3586  C  CA    . THR C  2  187  ? -99.081  41.516  26.746  1.00 102.90 ?  187  THR B CA    1 
ATOM   3587  C  C     . THR C  2  187  ? -99.221  40.856  25.379  1.00 101.44 ?  187  THR B C     1 
ATOM   3588  O  O     . THR C  2  187  ? -98.906  39.670  25.244  1.00 105.56 ?  187  THR B O     1 
ATOM   3589  C  CB    . THR C  2  187  ? -99.601  40.565  27.827  1.00 105.25 ?  187  THR B CB    1 
ATOM   3590  O  OG1   . THR C  2  187  ? -100.948 40.182  27.522  1.00 88.96  ?  187  THR B OG1   1 
ATOM   3591  C  CG2   . THR C  2  187  ? -99.569  41.238  29.190  1.00 109.19 ?  187  THR B CG2   1 
ATOM   3592  N  N     . ASP C  2  188  ? -99.680  41.588  24.365  1.00 102.51 ?  188  ASP B N     1 
ATOM   3593  C  CA    . ASP C  2  188  ? -99.876  41.034  23.031  1.00 92.35  ?  188  ASP B CA    1 
ATOM   3594  C  C     . ASP C  2  188  ? -98.821  41.521  22.041  1.00 102.38 ?  188  ASP B C     1 
ATOM   3595  O  O     . ASP C  2  188  ? -99.071  41.571  20.835  1.00 101.05 ?  188  ASP B O     1 
ATOM   3596  C  CB    . ASP C  2  188  ? -101.277 41.357  22.517  1.00 104.52 ?  188  ASP B CB    1 
ATOM   3597  C  CG    . ASP C  2  188  ? -101.810 42.666  23.058  1.00 111.66 ?  188  ASP B CG    1 
ATOM   3598  O  OD1   . ASP C  2  188  ? -102.185 43.538  22.248  1.00 104.47 ?  188  ASP B OD1   1 
ATOM   3599  O  OD2   . ASP C  2  188  ? -101.869 42.816  24.296  1.00 119.91 ?  188  ASP B OD2   1 
ATOM   3600  N  N     . PHE C  2  189  ? -97.638  41.882  22.534  1.00 110.30 ?  189  PHE B N     1 
ATOM   3601  C  CA    . PHE C  2  189  ? -96.550  42.258  21.642  1.00 103.74 ?  189  PHE B CA    1 
ATOM   3602  C  C     . PHE C  2  189  ? -96.005  41.027  20.927  1.00 106.07 ?  189  PHE B C     1 
ATOM   3603  O  O     . PHE C  2  189  ? -95.945  39.933  21.495  1.00 102.08 ?  189  PHE B O     1 
ATOM   3604  C  CB    . PHE C  2  189  ? -95.435  42.958  22.417  1.00 102.20 ?  189  PHE B CB    1 
ATOM   3605  C  CG    . PHE C  2  189  ? -95.475  44.454  22.313  1.00 110.34 ?  189  PHE B CG    1 
ATOM   3606  C  CD1   . PHE C  2  189  ? -96.306  45.198  23.133  1.00 103.71 ?  189  PHE B CD1   1 
ATOM   3607  C  CD2   . PHE C  2  189  ? -94.685  45.117  21.388  1.00 118.77 ?  189  PHE B CD2   1 
ATOM   3608  C  CE1   . PHE C  2  189  ? -96.348  46.575  23.034  1.00 107.48 ?  189  PHE B CE1   1 
ATOM   3609  C  CE2   . PHE C  2  189  ? -94.721  46.495  21.285  1.00 115.04 ?  189  PHE B CE2   1 
ATOM   3610  C  CZ    . PHE C  2  189  ? -95.553  47.225  22.109  1.00 104.32 ?  189  PHE B CZ    1 
ATOM   3611  N  N     . ASP C  2  190  ? -95.604  41.212  19.673  1.00 108.55 ?  190  ASP B N     1 
ATOM   3612  C  CA    . ASP C  2  190  ? -95.201  40.102  18.823  1.00 99.59  ?  190  ASP B CA    1 
ATOM   3613  C  C     . ASP C  2  190  ? -93.710  39.819  18.948  1.00 95.89  ?  190  ASP B C     1 
ATOM   3614  O  O     . ASP C  2  190  ? -92.894  40.737  19.065  1.00 88.50  ?  190  ASP B O     1 
ATOM   3615  C  CB    . ASP C  2  190  ? -95.547  40.390  17.362  1.00 91.09  ?  190  ASP B CB    1 
ATOM   3616  C  CG    . ASP C  2  190  ? -97.041  40.439  17.117  1.00 111.34 ?  190  ASP B CG    1 
ATOM   3617  O  OD1   . ASP C  2  190  ? -97.794  39.821  17.901  1.00 114.17 ?  190  ASP B OD1   1 
ATOM   3618  O  OD2   . ASP C  2  190  ? -97.460  41.093  16.140  1.00 112.79 ?  190  ASP B OD2   1 
ATOM   3619  N  N     . LYS C  2  191  ? -93.368  38.533  18.921  1.00 97.94  ?  191  LYS B N     1 
ATOM   3620  C  CA    . LYS C  2  191  ? -91.989  38.068  18.846  1.00 90.39  ?  191  LYS B CA    1 
ATOM   3621  C  C     . LYS C  2  191  ? -91.862  37.195  17.608  1.00 92.03  ?  191  LYS B C     1 
ATOM   3622  O  O     . LYS C  2  191  ? -92.596  36.213  17.460  1.00 92.23  ?  191  LYS B O     1 
ATOM   3623  C  CB    . LYS C  2  191  ? -91.594  37.290  20.103  1.00 94.14  ?  191  LYS B CB    1 
ATOM   3624  C  CG    . LYS C  2  191  ? -90.218  36.649  20.026  1.00 98.17  ?  191  LYS B CG    1 
ATOM   3625  C  CD    . LYS C  2  191  ? -89.831  35.989  21.341  1.00 91.14  ?  191  LYS B CD    1 
ATOM   3626  C  CE    . LYS C  2  191  ? -90.796  34.878  21.713  1.00 98.16  ?  191  LYS B CE    1 
ATOM   3627  N  NZ    . LYS C  2  191  ? -90.429  34.246  23.011  1.00 101.14 ?  191  LYS B NZ    1 
ATOM   3628  N  N     . LEU C  2  192  ? -90.942  37.558  16.719  1.00 96.05  ?  192  LEU B N     1 
ATOM   3629  C  CA    . LEU C  2  192  ? -90.780  36.881  15.439  1.00 87.71  ?  192  LEU B CA    1 
ATOM   3630  C  C     . LEU C  2  192  ? -89.646  35.869  15.537  1.00 91.12  ?  192  LEU B C     1 
ATOM   3631  O  O     . LEU C  2  192  ? -88.510  36.232  15.862  1.00 96.74  ?  192  LEU B O     1 
ATOM   3632  C  CB    . LEU C  2  192  ? -90.503  37.887  14.324  1.00 86.10  ?  192  LEU B CB    1 
ATOM   3633  C  CG    . LEU C  2  192  ? -90.324  37.285  12.931  1.00 83.31  ?  192  LEU B CG    1 
ATOM   3634  C  CD1   . LEU C  2  192  ? -91.602  36.599  12.474  1.00 85.58  ?  192  LEU B CD1   1 
ATOM   3635  C  CD2   . LEU C  2  192  ? -89.898  38.354  11.939  1.00 79.60  ?  192  LEU B CD2   1 
ATOM   3636  N  N     . ILE C  2  193  ? -89.956  34.607  15.253  1.00 95.11  ?  193  ILE B N     1 
ATOM   3637  C  CA    . ILE C  2  193  ? -88.972  33.532  15.210  1.00 90.50  ?  193  ILE B CA    1 
ATOM   3638  C  C     . ILE C  2  193  ? -88.861  33.059  13.769  1.00 97.26  ?  193  ILE B C     1 
ATOM   3639  O  O     . ILE C  2  193  ? -89.876  32.752  13.131  1.00 99.28  ?  193  ILE B O     1 
ATOM   3640  C  CB    . ILE C  2  193  ? -89.357  32.369  16.140  1.00 88.65  ?  193  ILE B CB    1 
ATOM   3641  C  CG1   . ILE C  2  193  ? -89.852  32.894  17.488  1.00 93.93  ?  193  ILE B CG1   1 
ATOM   3642  C  CG2   . ILE C  2  193  ? -88.172  31.438  16.341  1.00 97.42  ?  193  ILE B CG2   1 
ATOM   3643  C  CD1   . ILE C  2  193  ? -88.804  33.646  18.275  1.00 104.97 ?  193  ILE B CD1   1 
ATOM   3644  N  N     . ILE C  2  194  ? -87.635  33.002  13.255  1.00 104.92 ?  194  ILE B N     1 
ATOM   3645  C  CA    . ILE C  2  194  ? -87.374  32.553  11.894  1.00 99.13  ?  194  ILE B CA    1 
ATOM   3646  C  C     . ILE C  2  194  ? -86.275  31.501  11.933  1.00 102.12 ?  194  ILE B C     1 
ATOM   3647  O  O     . ILE C  2  194  ? -85.257  31.676  12.612  1.00 108.35 ?  194  ILE B O     1 
ATOM   3648  C  CB    . ILE C  2  194  ? -86.984  33.725  10.969  1.00 94.97  ?  194  ILE B CB    1 
ATOM   3649  C  CG1   . ILE C  2  194  ? -87.148  33.320  9.503   1.00 97.30  ?  194  ILE B CG1   1 
ATOM   3650  C  CG2   . ILE C  2  194  ? -85.559  34.174  11.247  1.00 97.96  ?  194  ILE B CG2   1 
ATOM   3651  C  CD1   . ILE C  2  194  ? -87.002  34.473  8.533   1.00 84.58  ?  194  ILE B CD1   1 
ATOM   3652  N  N     . ASP C  2  195  ? -86.486  30.405  11.208  1.00 99.57  ?  195  ASP B N     1 
ATOM   3653  C  CA    . ASP C  2  195  ? -85.564  29.276  11.188  1.00 91.30  ?  195  ASP B CA    1 
ATOM   3654  C  C     . ASP C  2  195  ? -85.069  29.078  9.763   1.00 99.99  ?  195  ASP B C     1 
ATOM   3655  O  O     . ASP C  2  195  ? -85.867  28.822  8.855   1.00 101.76 ?  195  ASP B O     1 
ATOM   3656  C  CB    . ASP C  2  195  ? -86.242  28.009  11.711  1.00 106.52 ?  195  ASP B CB    1 
ATOM   3657  C  CG    . ASP C  2  195  ? -85.262  26.881  11.957  1.00 126.51 ?  195  ASP B CG    1 
ATOM   3658  O  OD1   . ASP C  2  195  ? -84.076  27.173  12.218  1.00 133.70 ?  195  ASP B OD1   1 
ATOM   3659  O  OD2   . ASP C  2  195  ? -85.677  25.705  11.895  1.00 134.14 -1 195  ASP B OD2   1 
ATOM   3660  N  N     . VAL C  2  196  ? -83.758  29.193  9.570   1.00 101.71 ?  196  VAL B N     1 
ATOM   3661  C  CA    . VAL C  2  196  ? -83.146  29.121  8.249   1.00 105.02 ?  196  VAL B CA    1 
ATOM   3662  C  C     . VAL C  2  196  ? -82.010  28.110  8.286   1.00 117.38 ?  196  VAL B C     1 
ATOM   3663  O  O     . VAL C  2  196  ? -81.127  28.191  9.148   1.00 117.52 ?  196  VAL B O     1 
ATOM   3664  C  CB    . VAL C  2  196  ? -82.627  30.494  7.786   1.00 88.73  ?  196  VAL B CB    1 
ATOM   3665  C  CG1   . VAL C  2  196  ? -81.727  31.102  8.848   1.00 85.20  ?  196  VAL B CG1   1 
ATOM   3666  C  CG2   . VAL C  2  196  ? -81.884  30.358  6.466   1.00 100.51 ?  196  VAL B CG2   1 
ATOM   3667  N  N     . GLU C  2  197  ? -82.033  27.162  7.353   1.00 119.85 ?  197  GLU B N     1 
ATOM   3668  C  CA    . GLU C  2  197  ? -80.952  26.205  7.158   1.00 110.38 ?  197  GLU B CA    1 
ATOM   3669  C  C     . GLU C  2  197  ? -80.245  26.555  5.855   1.00 111.44 ?  197  GLU B C     1 
ATOM   3670  O  O     . GLU C  2  197  ? -80.877  26.593  4.794   1.00 111.68 ?  197  GLU B O     1 
ATOM   3671  C  CB    . GLU C  2  197  ? -81.481  24.771  7.123   1.00 114.60 ?  197  GLU B CB    1 
ATOM   3672  C  CG    . GLU C  2  197  ? -80.396  23.709  7.146   1.00 115.66 ?  197  GLU B CG    1 
ATOM   3673  C  CD    . GLU C  2  197  ? -80.960  22.302  7.122   1.00 126.61 ?  197  GLU B CD    1 
ATOM   3674  O  OE1   . GLU C  2  197  ? -82.136  22.139  6.731   1.00 127.91 ?  197  GLU B OE1   1 
ATOM   3675  O  OE2   . GLU C  2  197  ? -80.230  21.359  7.497   1.00 134.36 ?  197  GLU B OE2   1 
ATOM   3676  N  N     . THR C  2  198  ? -78.945  26.816  5.938   1.00 104.65 ?  198  THR B N     1 
ATOM   3677  C  CA    . THR C  2  198  ? -78.181  27.324  4.811   1.00 100.65 ?  198  THR B CA    1 
ATOM   3678  C  C     . THR C  2  198  ? -77.139  26.307  4.371   1.00 116.56 ?  198  THR B C     1 
ATOM   3679  O  O     . THR C  2  198  ? -76.629  25.525  5.179   1.00 124.80 ?  198  THR B O     1 
ATOM   3680  C  CB    . THR C  2  198  ? -77.481  28.640  5.168   1.00 111.99 ?  198  THR B CB    1 
ATOM   3681  O  OG1   . THR C  2  198  ? -78.333  29.422  6.015   1.00 128.95 ?  198  THR B OG1   1 
ATOM   3682  C  CG2   . THR C  2  198  ? -77.169  29.427  3.909   1.00 121.83 ?  198  THR B CG2   1 
ATOM   3683  N  N     . LYS C  2  199  ? -76.827  26.324  3.079   1.00 111.11 ?  199  LYS B N     1 
ATOM   3684  C  CA    . LYS C  2  199  ? -75.706  25.547  2.581   1.00 108.33 ?  199  LYS B CA    1 
ATOM   3685  C  C     . LYS C  2  199  ? -74.399  26.286  2.859   1.00 119.12 ?  199  LYS B C     1 
ATOM   3686  O  O     . LYS C  2  199  ? -74.371  27.504  3.054   1.00 119.66 ?  199  LYS B O     1 
ATOM   3687  C  CB    . LYS C  2  199  ? -75.860  25.264  1.086   1.00 104.14 ?  199  LYS B CB    1 
ATOM   3688  C  CG    . LYS C  2  199  ? -76.080  26.499  0.232   1.00 105.40 ?  199  LYS B CG    1 
ATOM   3689  C  CD    . LYS C  2  199  ? -76.318  26.126  -1.223  1.00 99.45  ?  199  LYS B CD    1 
ATOM   3690  C  CE    . LYS C  2  199  ? -77.536  25.228  -1.374  1.00 85.27  ?  199  LYS B CE    1 
ATOM   3691  N  NZ    . LYS C  2  199  ? -77.856  24.959  -2.803  1.00 70.35  ?  199  LYS B NZ    1 
ATOM   3692  N  N     . ASN C  2  200  ? -73.304  25.526  2.879   1.00 122.33 ?  200  ASN B N     1 
ATOM   3693  C  CA    . ASN C  2  200  ? -72.012  26.060  3.298   1.00 115.52 ?  200  ASN B CA    1 
ATOM   3694  C  C     . ASN C  2  200  ? -71.462  27.134  2.367   1.00 118.08 ?  200  ASN B C     1 
ATOM   3695  O  O     . ASN C  2  200  ? -70.367  27.641  2.630   1.00 115.56 ?  200  ASN B O     1 
ATOM   3696  C  CB    . ASN C  2  200  ? -71.003  24.919  3.431   1.00 102.22 ?  200  ASN B CB    1 
ATOM   3697  C  CG    . ASN C  2  200  ? -71.133  23.896  2.320   1.00 122.53 ?  200  ASN B CG    1 
ATOM   3698  O  OD1   . ASN C  2  200  ? -71.567  24.216  1.212   1.00 119.85 ?  200  ASN B OD1   1 
ATOM   3699  N  ND2   . ASN C  2  200  ? -70.766  22.654  2.615   1.00 125.97 ?  200  ASN B ND2   1 
ATOM   3700  N  N     . SER C  2  201  ? -72.177  27.501  1.300   1.00 119.24 ?  201  SER B N     1 
ATOM   3701  C  CA    . SER C  2  201  ? -71.687  28.561  0.424   1.00 118.70 ?  201  SER B CA    1 
ATOM   3702  C  C     . SER C  2  201  ? -71.724  29.915  1.123   1.00 127.77 ?  201  SER B C     1 
ATOM   3703  O  O     . SER C  2  201  ? -70.816  30.735  0.947   1.00 138.11 ?  201  SER B O     1 
ATOM   3704  C  CB    . SER C  2  201  ? -72.500  28.597  -0.870  1.00 107.43 ?  201  SER B CB    1 
ATOM   3705  O  OG    . SER C  2  201  ? -73.870  28.845  -0.609  1.00 123.86 ?  201  SER B OG    1 
ATOM   3706  N  N     . ILE C  2  202  ? -72.764  30.167  1.918   1.00 119.25 ?  202  ILE B N     1 
ATOM   3707  C  CA    . ILE C  2  202  ? -72.878  31.394  2.697   1.00 131.70 ?  202  ILE B CA    1 
ATOM   3708  C  C     . ILE C  2  202  ? -73.505  31.061  4.043   1.00 126.86 ?  202  ILE B C     1 
ATOM   3709  O  O     . ILE C  2  202  ? -74.300  30.125  4.167   1.00 122.09 ?  202  ILE B O     1 
ATOM   3710  C  CB    . ILE C  2  202  ? -73.695  32.481  1.959   1.00 130.79 ?  202  ILE B CB    1 
ATOM   3711  C  CG1   . ILE C  2  202  ? -75.083  31.960  1.576   1.00 103.49 ?  202  ILE B CG1   1 
ATOM   3712  C  CG2   . ILE C  2  202  ? -72.944  32.974  0.731   1.00 142.86 ?  202  ILE B CG2   1 
ATOM   3713  C  CD1   . ILE C  2  202  ? -76.115  32.109  2.667   1.00 110.68 ?  202  ILE B CD1   1 
ATOM   3714  N  N     . SER C  2  203  ? -73.135  31.836  5.058   1.00 129.19 ?  203  SER B N     1 
ATOM   3715  C  CA    . SER C  2  203  ? -73.616  31.601  6.409   1.00 118.62 ?  203  SER B CA    1 
ATOM   3716  C  C     . SER C  2  203  ? -75.051  32.092  6.567   1.00 123.60 ?  203  SER B C     1 
ATOM   3717  O  O     . SER C  2  203  ? -75.531  32.911  5.780   1.00 129.20 ?  203  SER B O     1 
ATOM   3718  C  CB    . SER C  2  203  ? -72.714  32.302  7.418   1.00 119.98 ?  203  SER B CB    1 
ATOM   3719  O  OG    . SER C  2  203  ? -72.766  33.710  7.258   1.00 111.26 ?  203  SER B OG    1 
ATOM   3720  N  N     . PRO C  2  204  ? -75.764  31.597  7.583   1.00 121.66 ?  204  PRO B N     1 
ATOM   3721  C  CA    . PRO C  2  204  ? -77.129  32.097  7.816   1.00 115.47 ?  204  PRO B CA    1 
ATOM   3722  C  C     . PRO C  2  204  ? -77.176  33.591  8.079   1.00 121.90 ?  204  PRO B C     1 
ATOM   3723  O  O     . PRO C  2  204  ? -78.114  34.266  7.637   1.00 120.95 ?  204  PRO B O     1 
ATOM   3724  C  CB    . PRO C  2  204  ? -77.593  31.286  9.036   1.00 105.28 ?  204  PRO B CB    1 
ATOM   3725  C  CG    . PRO C  2  204  ? -76.734  30.061  9.030   1.00 120.24 ?  204  PRO B CG    1 
ATOM   3726  C  CD    . PRO C  2  204  ? -75.402  30.512  8.510   1.00 126.96 ?  204  PRO B CD    1 
ATOM   3727  N  N     . ARG C  2  205  ? -76.181  34.131  8.787   1.00 124.64 ?  205  ARG B N     1 
ATOM   3728  C  CA    . ARG C  2  205  ? -76.166  35.562  9.077   1.00 110.22 ?  205  ARG B CA    1 
ATOM   3729  C  C     . ARG C  2  205  ? -76.105  36.383  7.795   1.00 112.67 ?  205  ARG B C     1 
ATOM   3730  O  O     . ARG C  2  205  ? -76.907  37.303  7.595   1.00 114.58 ?  205  ARG B O     1 
ATOM   3731  C  CB    . ARG C  2  205  ? -74.990  35.898  9.993   1.00 100.95 ?  205  ARG B CB    1 
ATOM   3732  C  CG    . ARG C  2  205  ? -75.389  36.176  11.429  1.00 104.89 ?  205  ARG B CG    1 
ATOM   3733  C  CD    . ARG C  2  205  ? -74.228  35.947  12.377  1.00 112.80 ?  205  ARG B CD    1 
ATOM   3734  N  NE    . ARG C  2  205  ? -73.736  34.576  12.289  1.00 127.79 ?  205  ARG B NE    1 
ATOM   3735  C  CZ    . ARG C  2  205  ? -74.364  33.526  12.809  1.00 143.02 ?  205  ARG B CZ    1 
ATOM   3736  N  NH1   . ARG C  2  205  ? -73.847  32.311  12.683  1.00 137.25 ?  205  ARG B NH1   1 
ATOM   3737  N  NH2   . ARG C  2  205  ? -75.514  33.690  13.450  1.00 142.61 ?  205  ARG B NH2   1 
ATOM   3738  N  N     . ASP C  2  206  ? -75.153  36.068  6.912   1.00 117.60 ?  206  ASP B N     1 
ATOM   3739  C  CA    . ASP C  2  206  ? -75.038  36.816  5.664   1.00 111.86 ?  206  ASP B CA    1 
ATOM   3740  C  C     . ASP C  2  206  ? -76.319  36.723  4.845   1.00 111.36 ?  206  ASP B C     1 
ATOM   3741  O  O     . ASP C  2  206  ? -76.759  37.716  4.253   1.00 108.95 ?  206  ASP B O     1 
ATOM   3742  C  CB    . ASP C  2  206  ? -73.851  36.307  4.844   1.00 30.00  ?  206  ASP B CB    1 
ATOM   3743  C  CG    . ASP C  2  206  ? -72.516  36.684  5.456   1.00 30.00  ?  206  ASP B CG    1 
ATOM   3744  O  OD1   . ASP C  2  206  ? -72.494  37.564  6.340   1.00 30.00  ?  206  ASP B OD1   1 
ATOM   3745  O  OD2   . ASP C  2  206  ? -71.438  36.152  5.115   1.00 30.00  ?  206  ASP B OD2   1 
ATOM   3746  N  N     . ALA C  2  207  ? -76.930  35.537  4.797   1.00 105.85 ?  207  ALA B N     1 
ATOM   3747  C  CA    . ALA C  2  207  ? -78.167  35.377  4.040   1.00 102.63 ?  207  ALA B CA    1 
ATOM   3748  C  C     . ALA C  2  207  ? -79.228  36.363  4.508   1.00 107.49 ?  207  ALA B C     1 
ATOM   3749  O  O     . ALA C  2  207  ? -79.960  36.935  3.692   1.00 107.42 ?  207  ALA B O     1 
ATOM   3750  C  CB    . ALA C  2  207  ? -78.676  33.941  4.161   1.00 104.98 ?  207  ALA B CB    1 
ATOM   3751  N  N     . LEU C  2  208  ? -79.321  36.580  5.821   1.00 110.40 ?  208  LEU B N     1 
ATOM   3752  C  CA    . LEU C  2  208  ? -80.303  37.523  6.344   1.00 107.49 ?  208  LEU B CA    1 
ATOM   3753  C  C     . LEU C  2  208  ? -79.990  38.946  5.898   1.00 107.64 ?  208  LEU B C     1 
ATOM   3754  O  O     . LEU C  2  208  ? -80.891  39.688  5.491   1.00 103.67 ?  208  LEU B O     1 
ATOM   3755  C  CB    . LEU C  2  208  ? -80.352  37.430  7.869   1.00 98.13  ?  208  LEU B CB    1 
ATOM   3756  C  CG    . LEU C  2  208  ? -81.690  37.764  8.530   1.00 121.89 ?  208  LEU B CG    1 
ATOM   3757  C  CD1   . LEU C  2  208  ? -82.782  36.844  8.006   1.00 114.82 ?  208  LEU B CD1   1 
ATOM   3758  C  CD2   . LEU C  2  208  ? -81.581  37.660  10.045  1.00 110.98 ?  208  LEU B CD2   1 
ATOM   3759  N  N     . ALA C  2  209  ? -78.716  39.342  5.962   1.00 110.63 ?  209  ALA B N     1 
ATOM   3760  C  CA    . ALA C  2  209  ? -78.336  40.678  5.516   1.00 105.47 ?  209  ALA B CA    1 
ATOM   3761  C  C     . ALA C  2  209  ? -78.682  40.886  4.047   1.00 109.23 ?  209  ALA B C     1 
ATOM   3762  O  O     . ALA C  2  209  ? -79.210  41.939  3.668   1.00 111.55 ?  209  ALA B O     1 
ATOM   3763  C  CB    . ALA C  2  209  ? -76.845  40.909  5.758   1.00 95.10  ?  209  ALA B CB    1 
ATOM   3764  N  N     . SER C  2  210  ? -78.392  39.894  3.203   1.00 109.07 ?  210  SER B N     1 
ATOM   3765  C  CA    . SER C  2  210  ? -78.756  39.994  1.794   1.00 110.04 ?  210  SER B CA    1 
ATOM   3766  C  C     . SER C  2  210  ? -80.266  40.109  1.630   1.00 112.83 ?  210  SER B C     1 
ATOM   3767  O  O     . SER C  2  210  ? -80.761  40.985  0.912   1.00 107.04 ?  210  SER B O     1 
ATOM   3768  C  CB    . SER C  2  210  ? -78.221  38.785  1.026   1.00 107.04 ?  210  SER B CB    1 
ATOM   3769  O  OG    . SER C  2  210  ? -78.670  38.798  -0.318  1.00 108.56 ?  210  SER B OG    1 
ATOM   3770  N  N     . ALA C  2  211  ? -81.017  39.224  2.291   1.00 114.76 ?  211  ALA B N     1 
ATOM   3771  C  CA    . ALA C  2  211  ? -82.472  39.290  2.215   1.00 105.64 ?  211  ALA B CA    1 
ATOM   3772  C  C     . ALA C  2  211  ? -82.991  40.607  2.776   1.00 102.25 ?  211  ALA B C     1 
ATOM   3773  O  O     . ALA C  2  211  ? -83.895  41.223  2.199   1.00 97.13  ?  211  ALA B O     1 
ATOM   3774  C  CB    . ALA C  2  211  ? -83.090  38.106  2.957   1.00 94.13  ?  211  ALA B CB    1 
ATOM   3775  N  N     . GLY C  2  212  ? -82.431  41.055  3.901   1.00 107.13 ?  212  GLY B N     1 
ATOM   3776  C  CA    . GLY C  2  212  ? -82.844  42.330  4.461   1.00 111.57 ?  212  GLY B CA    1 
ATOM   3777  C  C     . GLY C  2  212  ? -82.466  43.503  3.577   1.00 110.41 ?  212  GLY B C     1 
ATOM   3778  O  O     . GLY C  2  212  ? -83.260  44.429  3.384   1.00 105.88 ?  212  GLY B O     1 
ATOM   3779  N  N     . GLY C  2  213  ? -81.251  43.482  3.028   1.00 111.81 ?  213  GLY B N     1 
ATOM   3780  C  CA    . GLY C  2  213  ? -80.842  44.550  2.132   1.00 104.88 ?  213  GLY B CA    1 
ATOM   3781  C  C     . GLY C  2  213  ? -81.723  44.645  0.901   1.00 108.61 ?  213  GLY B C     1 
ATOM   3782  O  O     . GLY C  2  213  ? -82.116  45.739  0.490   1.00 113.48 ?  213  GLY B O     1 
ATOM   3783  N  N     . THR C  2  214  ? -82.047  43.499  0.297   1.00 95.68  ?  214  THR B N     1 
ATOM   3784  C  CA    . THR C  2  214  ? -82.901  43.508  -0.886  1.00 97.55  ?  214  THR B CA    1 
ATOM   3785  C  C     . THR C  2  214  ? -84.311  43.983  -0.560  1.00 109.62 ?  214  THR B C     1 
ATOM   3786  O  O     . THR C  2  214  ? -84.966  44.600  -1.408  1.00 114.68 ?  214  THR B O     1 
ATOM   3787  C  CB    . THR C  2  214  ? -82.945  42.118  -1.520  1.00 98.29  ?  214  THR B CB    1 
ATOM   3788  O  OG1   . THR C  2  214  ? -83.182  41.135  -0.504  1.00 108.79 ?  214  THR B OG1   1 
ATOM   3789  C  CG2   . THR C  2  214  ? -81.631  41.810  -2.226  1.00 123.96 ?  214  THR B CG2   1 
ATOM   3790  N  N     . LEU C  2  215  ? -84.796  43.709  0.652   1.00 109.55 ?  215  LEU B N     1 
ATOM   3791  C  CA    . LEU C  2  215  ? -86.128  44.168  1.032   1.00 107.98 ?  215  LEU B CA    1 
ATOM   3792  C  C     . LEU C  2  215  ? -86.164  45.683  1.188   1.00 107.62 ?  215  LEU B C     1 
ATOM   3793  O  O     . LEU C  2  215  ? -86.991  46.361  0.565   1.00 108.64 ?  215  LEU B O     1 
ATOM   3794  C  CB    . LEU C  2  215  ? -86.575  43.477  2.322   1.00 98.28  ?  215  LEU B CB    1 
ATOM   3795  C  CG    . LEU C  2  215  ? -87.191  42.085  2.158   1.00 91.32  ?  215  LEU B CG    1 
ATOM   3796  C  CD1   . LEU C  2  215  ? -87.376  41.410  3.507   1.00 86.73  ?  215  LEU B CD1   1 
ATOM   3797  C  CD2   . LEU C  2  215  ? -88.519  42.177  1.417   1.00 82.38  ?  215  LEU B CD2   1 
ATOM   3798  N  N     . VAL C  2  216  ? -85.272  46.234  2.015   1.00 106.88 ?  216  VAL B N     1 
ATOM   3799  C  CA    . VAL C  2  216  ? -85.234  47.682  2.212   1.00 102.77 ?  216  VAL B CA    1 
ATOM   3800  C  C     . VAL C  2  216  ? -85.079  48.394  0.874   1.00 97.87  ?  216  VAL B C     1 
ATOM   3801  O  O     . VAL C  2  216  ? -85.771  49.378  0.588   1.00 98.85  ?  216  VAL B O     1 
ATOM   3802  C  CB    . VAL C  2  216  ? -84.108  48.064  3.189   1.00 83.70  ?  216  VAL B CB    1 
ATOM   3803  C  CG1   . VAL C  2  216  ? -82.816  47.365  2.807   1.00 108.10 ?  216  VAL B CG1   1 
ATOM   3804  C  CG2   . VAL C  2  216  ? -83.912  49.570  3.202   1.00 65.33  ?  216  VAL B CG2   1 
ATOM   3805  N  N     . GLU C  2  217  ? -84.166  47.904  0.032   1.00 97.02  ?  217  GLU B N     1 
ATOM   3806  C  CA    . GLU C  2  217  ? -84.019  48.478  -1.301  1.00 115.08 ?  217  GLU B CA    1 
ATOM   3807  C  C     . GLU C  2  217  ? -85.318  48.366  -2.089  1.00 106.61 ?  217  GLU B C     1 
ATOM   3808  O  O     . GLU C  2  217  ? -85.715  49.306  -2.787  1.00 106.64 ?  217  GLU B O     1 
ATOM   3809  C  CB    . GLU C  2  217  ? -82.874  47.791  -2.046  1.00 101.88 ?  217  GLU B CB    1 
ATOM   3810  N  N     . LEU C  2  218  ? -85.999  47.224  -1.981  1.00 99.47  ?  218  LEU B N     1 
ATOM   3811  C  CA    . LEU C  2  218  ? -87.249  47.041  -2.710  1.00 101.76 ?  218  LEU B CA    1 
ATOM   3812  C  C     . LEU C  2  218  ? -88.335  47.966  -2.179  1.00 103.91 ?  218  LEU B C     1 
ATOM   3813  O  O     . LEU C  2  218  ? -89.120  48.521  -2.956  1.00 116.85 ?  218  LEU B O     1 
ATOM   3814  C  CB    . LEU C  2  218  ? -87.692  45.582  -2.628  1.00 99.94  ?  218  LEU B CB    1 
ATOM   3815  C  CG    . LEU C  2  218  ? -88.501  45.046  -3.812  1.00 108.86 ?  218  LEU B CG    1 
ATOM   3816  C  CD1   . LEU C  2  218  ? -88.828  43.580  -3.604  1.00 108.17 ?  218  LEU B CD1   1 
ATOM   3817  C  CD2   . LEU C  2  218  ? -89.771  45.857  -4.025  1.00 103.91 ?  218  LEU B CD2   1 
ATOM   3818  N  N     . PHE C  2  219  ? -88.396  48.145  -0.859  1.00 104.32 ?  219  PHE B N     1 
ATOM   3819  C  CA    . PHE C  2  219  ? -89.364  49.053  -0.259  1.00 105.19 ?  219  PHE B CA    1 
ATOM   3820  C  C     . PHE C  2  219  ? -88.947  50.514  -0.357  1.00 111.36 ?  219  PHE B C     1 
ATOM   3821  O  O     . PHE C  2  219  ? -89.760  51.396  -0.061  1.00 106.35 ?  219  PHE B O     1 
ATOM   3822  C  CB    . PHE C  2  219  ? -89.603  48.674  1.203   1.00 98.95  ?  219  PHE B CB    1 
ATOM   3823  C  CG    . PHE C  2  219  ? -90.543  47.516  1.375   1.00 99.60  ?  219  PHE B CG    1 
ATOM   3824  C  CD1   . PHE C  2  219  ? -91.702  47.433  0.620   1.00 95.52  ?  219  PHE B CD1   1 
ATOM   3825  C  CD2   . PHE C  2  219  ? -90.265  46.505  2.279   1.00 89.44  ?  219  PHE B CD2   1 
ATOM   3826  C  CE1   . PHE C  2  219  ? -92.570  46.370  0.771   1.00 83.61  ?  219  PHE B CE1   1 
ATOM   3827  C  CE2   . PHE C  2  219  ? -91.128  45.437  2.431   1.00 83.79  ?  219  PHE B CE2   1 
ATOM   3828  C  CZ    . PHE C  2  219  ? -92.282  45.370  1.676   1.00 86.32  ?  219  PHE B CZ    1 
ATOM   3829  N  N     . GLY C  2  220  ? -87.708  50.795  -0.762  1.00 112.38 ?  220  GLY B N     1 
ATOM   3830  C  CA    . GLY C  2  220  ? -87.316  52.162  -1.048  1.00 99.17  ?  220  GLY B CA    1 
ATOM   3831  C  C     . GLY C  2  220  ? -88.059  52.777  -2.216  1.00 107.11 ?  220  GLY B C     1 
ATOM   3832  O  O     . GLY C  2  220  ? -87.983  53.997  -2.406  1.00 114.57 ?  220  GLY B O     1 
ATOM   3833  N  N     . LEU C  2  221  ? -88.772  51.965  -3.003  1.00 101.93 ?  221  LEU B N     1 
ATOM   3834  C  CA    . LEU C  2  221  ? -89.536  52.497  -4.126  1.00 108.61 ?  221  LEU B CA    1 
ATOM   3835  C  C     . LEU C  2  221  ? -90.783  53.234  -3.655  1.00 111.12 ?  221  LEU B C     1 
ATOM   3836  O  O     . LEU C  2  221  ? -91.226  54.182  -4.312  1.00 120.76 ?  221  LEU B O     1 
ATOM   3837  C  CB    . LEU C  2  221  ? -89.909  51.368  -5.084  1.00 105.47 ?  221  LEU B CB    1 
ATOM   3838  C  CG    . LEU C  2  221  ? -88.733  50.507  -5.547  1.00 112.06 ?  221  LEU B CG    1 
ATOM   3839  C  CD1   . LEU C  2  221  ? -89.179  49.513  -6.610  1.00 116.03 ?  221  LEU B CD1   1 
ATOM   3840  C  CD2   . LEU C  2  221  ? -87.595  51.381  -6.060  1.00 107.25 ?  221  LEU B CD2   1 
ATOM   3841  N  N     . ALA C  2  222  ? -91.368  52.813  -2.533  1.00 102.58 ?  222  ALA B N     1 
ATOM   3842  C  CA    . ALA C  2  222  ? -92.487  53.554  -1.964  1.00 105.79 ?  222  ALA B CA    1 
ATOM   3843  C  C     . ALA C  2  222  ? -92.011  54.750  -1.151  1.00 107.06 ?  222  ALA B C     1 
ATOM   3844  O  O     . ALA C  2  222  ? -92.703  55.772  -1.092  1.00 109.26 ?  222  ALA B O     1 
ATOM   3845  C  CB    . ALA C  2  222  ? -93.346  52.635  -1.096  1.00 93.42  ?  222  ALA B CB    1 
ATOM   3846  N  N     . ARG C  2  223  ? -90.837  54.640  -0.528  1.00 102.94 ?  223  ARG B N     1 
ATOM   3847  C  CA    . ARG C  2  223  ? -90.287  55.755  0.234   1.00 99.64  ?  223  ARG B CA    1 
ATOM   3848  C  C     . ARG C  2  223  ? -89.968  56.941  -0.666  1.00 108.19 ?  223  ARG B C     1 
ATOM   3849  O  O     . ARG C  2  223  ? -90.225  58.094  -0.298  1.00 108.46 ?  223  ARG B O     1 
ATOM   3850  C  CB    . ARG C  2  223  ? -89.035  55.299  0.978   1.00 103.50 ?  223  ARG B CB    1 
ATOM   3851  C  CG    . ARG C  2  223  ? -88.209  56.426  1.561   1.00 106.19 ?  223  ARG B CG    1 
ATOM   3852  C  CD    . ARG C  2  223  ? -86.837  55.925  1.972   1.00 110.78 ?  223  ARG B CD    1 
ATOM   3853  N  NE    . ARG C  2  223  ? -86.208  56.813  2.941   1.00 122.46 ?  223  ARG B NE    1 
ATOM   3854  C  CZ    . ARG C  2  223  ? -86.487  56.804  4.240   1.00 109.39 ?  223  ARG B CZ    1 
ATOM   3855  N  NH1   . ARG C  2  223  ? -85.872  57.644  5.061   1.00 119.01 ?  223  ARG B NH1   1 
ATOM   3856  N  NH2   . ARG C  2  223  ? -87.387  55.956  4.717   1.00 105.64 ?  223  ARG B NH2   1 
ATOM   3857  N  N     . GLU C  2  224  ? -89.406  56.682  -1.849  1.00 112.14 ?  224  GLU B N     1 
ATOM   3858  C  CA    . GLU C  2  224  ? -88.995  57.768  -2.731  1.00 114.14 ?  224  GLU B CA    1 
ATOM   3859  C  C     . GLU C  2  224  ? -90.168  58.627  -3.190  1.00 114.77 ?  224  GLU B C     1 
ATOM   3860  O  O     . GLU C  2  224  ? -89.959  59.774  -3.600  1.00 120.74 ?  224  GLU B O     1 
ATOM   3861  C  CB    . GLU C  2  224  ? -88.235  57.202  -3.934  1.00 119.03 ?  224  GLU B CB    1 
ATOM   3862  C  CG    . GLU C  2  224  ? -88.872  55.982  -4.583  1.00 111.86 ?  224  GLU B CG    1 
ATOM   3863  C  CD    . GLU C  2  224  ? -89.861  56.341  -5.678  1.00 126.97 ?  224  GLU B CD    1 
ATOM   3864  O  OE1   . GLU C  2  224  ? -90.190  57.537  -5.827  1.00 132.50 ?  224  GLU B OE1   1 
ATOM   3865  O  OE2   . GLU C  2  224  ? -90.304  55.422  -6.399  1.00 128.23 ?  224  GLU B OE2   1 
ATOM   3866  N  N     . LEU C  2  225  ? -91.395  58.105  -3.128  1.00 103.49 ?  225  LEU B N     1 
ATOM   3867  C  CA    . LEU C  2  225  ? -92.565  58.923  -3.424  1.00 101.29 ?  225  LEU B CA    1 
ATOM   3868  C  C     . LEU C  2  225  ? -92.674  60.120  -2.491  1.00 99.34  ?  225  LEU B C     1 
ATOM   3869  O  O     . LEU C  2  225  ? -93.289  61.126  -2.859  1.00 105.92 ?  225  LEU B O     1 
ATOM   3870  C  CB    . LEU C  2  225  ? -93.828  58.073  -3.342  1.00 107.56 ?  225  LEU B CB    1 
ATOM   3871  C  CG    . LEU C  2  225  ? -93.927  56.915  -4.331  1.00 109.33 ?  225  LEU B CG    1 
ATOM   3872  C  CD1   . LEU C  2  225  ? -95.129  56.035  -4.015  1.00 107.78 ?  225  LEU B CD1   1 
ATOM   3873  C  CD2   . LEU C  2  225  ? -94.014  57.447  -5.756  1.00 122.88 ?  225  LEU B CD2   1 
ATOM   3874  N  N     . ASN C  2  226  ? -92.077  60.038  -1.304  1.00 90.29  ?  226  ASN B N     1 
ATOM   3875  C  CA    . ASN C  2  226  ? -92.045  61.150  -0.360  1.00 90.52  ?  226  ASN B CA    1 
ATOM   3876  C  C     . ASN C  2  226  ? -91.307  60.744  0.908   1.00 95.89  ?  226  ASN B C     1 
ATOM   3877  O  O     . ASN C  2  226  ? -91.820  59.948  1.701   1.00 108.91 ?  226  ASN B O     1 
ATOM   3878  C  CB    . ASN C  2  226  ? -93.462  61.620  -0.014  1.00 90.71  ?  226  ASN B CB    1 
ATOM   3879  C  CG    . ASN C  2  226  ? -93.479  62.669  1.094   1.00 103.97 ?  226  ASN B CG    1 
ATOM   3880  O  OD1   . ASN C  2  226  ? -92.480  63.341  1.345   1.00 105.73 ?  226  ASN B OD1   1 
ATOM   3881  N  ND2   . ASN C  2  226  ? -94.624  62.805  1.767   1.00 108.61 ?  226  ASN B ND2   1 
ATOM   3882  N  N     . ALA C  2  227  ? -90.111  61.290  1.116   1.00 92.56  ?  227  ALA B N     1 
ATOM   3883  C  CA    . ALA C  2  227  ? -89.335  60.973  2.307   1.00 96.54  ?  227  ALA B CA    1 
ATOM   3884  C  C     . ALA C  2  227  ? -89.723  61.818  3.513   1.00 99.92  ?  227  ALA B C     1 
ATOM   3885  O  O     . ALA C  2  227  ? -89.069  61.713  4.557   1.00 107.24 ?  227  ALA B O     1 
ATOM   3886  C  CB    . ALA C  2  227  ? -87.839  61.137  2.025   1.00 103.48 ?  227  ALA B CB    1 
ATOM   3887  N  N     . ASP C  2  228  ? -90.768  62.636  3.405   1.00 104.38 ?  228  ASP B N     1 
ATOM   3888  C  CA    . ASP C  2  228  ? -91.197  63.496  4.498   1.00 117.55 ?  228  ASP B CA    1 
ATOM   3889  C  C     . ASP C  2  228  ? -92.322  62.895  5.329   1.00 111.46 ?  228  ASP B C     1 
ATOM   3890  O  O     . ASP C  2  228  ? -92.604  63.409  6.417   1.00 115.56 ?  228  ASP B O     1 
ATOM   3891  C  CB    . ASP C  2  228  ? -91.640  64.861  3.958   1.00 107.88 ?  228  ASP B CB    1 
ATOM   3892  N  N     . SER C  2  229  ? -92.969  61.834  4.852   1.00 98.38  ?  229  SER B N     1 
ATOM   3893  C  CA    . SER C  2  229  ? -94.041  61.214  5.616   1.00 98.54  ?  229  SER B CA    1 
ATOM   3894  C  C     . SER C  2  229  ? -93.519  60.718  6.963   1.00 110.21 ?  229  SER B C     1 
ATOM   3895  O  O     . SER C  2  229  ? -92.313  60.577  7.183   1.00 111.91 ?  229  SER B O     1 
ATOM   3896  C  CB    . SER C  2  229  ? -94.669  60.066  4.828   1.00 102.83 ?  229  SER B CB    1 
ATOM   3897  O  OG    . SER C  2  229  ? -95.365  60.557  3.695   1.00 95.93  ?  229  SER B OG    1 
ATOM   3898  N  N     . GLU C  2  230  ? -94.457  60.441  7.871   1.00 103.62 ?  230  GLU B N     1 
ATOM   3899  C  CA    . GLU C  2  230  ? -94.089  60.204  9.263   1.00 107.98 ?  230  GLU B CA    1 
ATOM   3900  C  C     . GLU C  2  230  ? -93.455  58.831  9.456   1.00 112.96 ?  230  GLU B C     1 
ATOM   3901  O  O     . GLU C  2  230  ? -92.431  58.710  10.140  1.00 118.25 ?  230  GLU B O     1 
ATOM   3902  C  CB    . GLU C  2  230  ? -95.319  60.357  10.157  1.00 116.32 ?  230  GLU B CB    1 
ATOM   3903  C  CG    . GLU C  2  230  ? -95.015  60.863  11.557  1.00 116.81 ?  230  GLU B CG    1 
ATOM   3904  C  CD    . GLU C  2  230  ? -94.375  62.238  11.549  1.00 122.37 ?  230  GLU B CD    1 
ATOM   3905  O  OE1   . GLU C  2  230  ? -93.340  62.419  12.224  1.00 121.84 ?  230  GLU B OE1   1 
ATOM   3906  O  OE2   . GLU C  2  230  ? -94.904  63.137  10.859  1.00 124.21 ?  230  GLU B OE2   1 
ATOM   3907  N  N     . HIS C  2  231  ? -94.040  57.793  8.855   1.00 107.86 ?  231  HIS B N     1 
ATOM   3908  C  CA    . HIS C  2  231  ? -93.668  56.404  9.118   1.00 111.90 ?  231  HIS B CA    1 
ATOM   3909  C  C     . HIS C  2  231  ? -93.311  56.204  10.589  1.00 108.98 ?  231  HIS B C     1 
ATOM   3910  O  O     . HIS C  2  231  ? -93.936  56.809  11.466  1.00 108.52 ?  231  HIS B O     1 
ATOM   3911  C  CB    . HIS C  2  231  ? -92.525  55.951  8.195   1.00 114.16 ?  231  HIS B CB    1 
ATOM   3912  C  CG    . HIS C  2  231  ? -91.240  56.701  8.375   1.00 116.17 ?  231  HIS B CG    1 
ATOM   3913  N  ND1   . HIS C  2  231  ? -90.220  56.245  9.182   1.00 114.18 ?  231  HIS B ND1   1 
ATOM   3914  C  CD2   . HIS C  2  231  ? -90.798  57.858  7.828   1.00 115.12 ?  231  HIS B CD2   1 
ATOM   3915  C  CE1   . HIS C  2  231  ? -89.211  57.098  9.138   1.00 110.73 ?  231  HIS B CE1   1 
ATOM   3916  N  NE2   . HIS C  2  231  ? -89.537  58.086  8.324   1.00 114.74 ?  231  HIS B NE2   1 
ATOM   3917  N  N     . ILE C  2  232  ? -92.321  55.359  10.878  1.00 109.84 ?  232  ILE B N     1 
ATOM   3918  C  CA    . ILE C  2  232  ? -91.932  55.065  12.250  1.00 107.01 ?  232  ILE B CA    1 
ATOM   3919  C  C     . ILE C  2  232  ? -90.422  55.211  12.388  1.00 117.30 ?  232  ILE B C     1 
ATOM   3920  O  O     . ILE C  2  232  ? -89.673  55.139  11.412  1.00 129.78 ?  232  ILE B O     1 
ATOM   3921  C  CB    . ILE C  2  232  ? -92.383  53.656  12.691  1.00 99.96  ?  232  ILE B CB    1 
ATOM   3922  C  CG1   . ILE C  2  232  ? -93.889  53.490  12.480  1.00 104.58 ?  232  ILE B CG1   1 
ATOM   3923  C  CG2   . ILE C  2  232  ? -92.036  53.414  14.148  1.00 102.47 ?  232  ILE B CG2   1 
ATOM   3924  C  CD1   . ILE C  2  232  ? -94.434  52.175  12.993  1.00 107.33 ?  232  ILE B CD1   1 
ATOM   3925  N  N     . GLU C  2  233  ? -89.985  55.426  13.627  1.00 111.31 ?  233  GLU B N     1 
ATOM   3926  C  CA    . GLU C  2  233  ? -88.567  55.572  13.939  1.00 104.32 ?  233  GLU B CA    1 
ATOM   3927  C  C     . GLU C  2  233  ? -87.755  54.407  13.385  1.00 109.06 ?  233  GLU B C     1 
ATOM   3928  O  O     . GLU C  2  233  ? -87.187  53.619  14.141  1.00 114.17 ?  233  GLU B O     1 
ATOM   3929  C  CB    . GLU C  2  233  ? -88.366  55.687  15.444  1.00 101.49 ?  233  GLU B CB    1 
ATOM   3930  N  N     . ASN D  3  21   ? -146.277 46.292  6.316   1.00 121.98 ?  21   ASN C N     1 
ATOM   3931  C  CA    . ASN D  3  21   ? -147.516 46.217  5.549   1.00 139.59 ?  21   ASN C CA    1 
ATOM   3932  C  C     . ASN D  3  21   ? -148.723 46.514  6.432   1.00 148.41 ?  21   ASN C C     1 
ATOM   3933  O  O     . ASN D  3  21   ? -148.827 46.009  7.551   1.00 149.16 ?  21   ASN C O     1 
ATOM   3934  C  CB    . ASN D  3  21   ? -147.656 44.848  4.899   1.00 142.14 ?  21   ASN C CB    1 
ATOM   3935  N  N     . SER D  3  22   ? -149.635 47.338  5.919   1.00 148.97 ?  22   SER C N     1 
ATOM   3936  C  CA    . SER D  3  22   ? -150.862 47.762  6.587   1.00 144.00 ?  22   SER C CA    1 
ATOM   3937  C  C     . SER D  3  22   ? -150.605 48.747  7.720   1.00 141.49 ?  22   SER C C     1 
ATOM   3938  O  O     . SER D  3  22   ? -151.567 49.205  8.350   1.00 139.05 ?  22   SER C O     1 
ATOM   3939  C  CB    . SER D  3  22   ? -151.670 46.576  7.133   1.00 137.40 ?  22   SER C CB    1 
ATOM   3940  O  OG    . SER D  3  22   ? -150.960 45.892  8.151   1.00 129.34 ?  22   SER C OG    1 
ATOM   3941  N  N     . VAL D  3  23   ? -149.352 49.086  8.006   1.00 140.79 ?  23   VAL C N     1 
ATOM   3942  C  CA    . VAL D  3  23   ? -149.028 50.084  9.023   1.00 128.50 ?  23   VAL C CA    1 
ATOM   3943  C  C     . VAL D  3  23   ? -148.600 51.364  8.314   1.00 120.39 ?  23   VAL C C     1 
ATOM   3944  O  O     . VAL D  3  23   ? -147.887 51.300  7.301   1.00 120.86 ?  23   VAL C O     1 
ATOM   3945  C  CB    . VAL D  3  23   ? -147.938 49.577  9.980   1.00 124.65 ?  23   VAL C CB    1 
ATOM   3946  C  CG1   . VAL D  3  23   ? -147.622 50.630  11.030  1.00 112.51 ?  23   VAL C CG1   1 
ATOM   3947  C  CG2   . VAL D  3  23   ? -148.376 48.276  10.639  1.00 114.02 ?  23   VAL C CG2   1 
ATOM   3948  N  N     . PRO D  3  24   ? -149.007 52.540  8.802   1.00 117.48 ?  24   PRO C N     1 
ATOM   3949  C  CA    . PRO D  3  24   ? -148.728 53.786  8.073   1.00 119.88 ?  24   PRO C CA    1 
ATOM   3950  C  C     . PRO D  3  24   ? -147.262 53.970  7.711   1.00 114.98 ?  24   PRO C C     1 
ATOM   3951  O  O     . PRO D  3  24   ? -146.898 53.909  6.532   1.00 117.92 ?  24   PRO C O     1 
ATOM   3952  C  CB    . PRO D  3  24   ? -149.200 54.871  9.049   1.00 104.30 ?  24   PRO C CB    1 
ATOM   3953  C  CG    . PRO D  3  24   ? -150.253 54.198  9.865   1.00 106.87 ?  24   PRO C CG    1 
ATOM   3954  C  CD    . PRO D  3  24   ? -149.794 52.775  10.025  1.00 106.77 ?  24   PRO C CD    1 
ATOM   3955  N  N     . GLY D  3  25   ? -146.414 54.199  8.710   1.00 104.42 ?  25   GLY C N     1 
ATOM   3956  C  CA    . GLY D  3  25   ? -145.011 54.462  8.456   1.00 105.96 ?  25   GLY C CA    1 
ATOM   3957  C  C     . GLY D  3  25   ? -144.158 53.214  8.355   1.00 118.92 ?  25   GLY C C     1 
ATOM   3958  O  O     . GLY D  3  25   ? -142.968 53.241  8.682   1.00 118.22 ?  25   GLY C O     1 
ATOM   3959  N  N     . ALA D  3  26   ? -144.751 52.120  7.898   1.00 112.66 ?  26   ALA C N     1 
ATOM   3960  C  CA    . ALA D  3  26   ? -144.019 50.863  7.801   1.00 91.57  ?  26   ALA C CA    1 
ATOM   3961  C  C     . ALA D  3  26   ? -142.909 50.978  6.762   1.00 90.43  ?  26   ALA C C     1 
ATOM   3962  O  O     . ALA D  3  26   ? -143.155 51.460  5.650   1.00 108.84 ?  26   ALA C O     1 
ATOM   3963  C  CB    . ALA D  3  26   ? -144.966 49.722  7.439   1.00 107.42 ?  26   ALA C CB    1 
ATOM   3964  N  N     . PRO D  3  27   ? -141.686 50.559  7.079   1.00 99.10  ?  27   PRO C N     1 
ATOM   3965  C  CA    . PRO D  3  27   ? -140.618 50.571  6.075   1.00 97.69  ?  27   PRO C CA    1 
ATOM   3966  C  C     . PRO D  3  27   ? -140.835 49.494  5.023   1.00 99.28  ?  27   PRO C C     1 
ATOM   3967  O  O     . PRO D  3  27   ? -141.568 48.523  5.221   1.00 98.45  ?  27   PRO C O     1 
ATOM   3968  C  CB    . PRO D  3  27   ? -139.354 50.299  6.896   1.00 82.35  ?  27   PRO C CB    1 
ATOM   3969  C  CG    . PRO D  3  27   ? -139.844 49.531  8.076   1.00 91.58  ?  27   PRO C CG    1 
ATOM   3970  C  CD    . PRO D  3  27   ? -141.211 50.083  8.389   1.00 106.48 ?  27   PRO C CD    1 
ATOM   3971  N  N     . ASN D  3  28   ? -140.170 49.679  3.884   1.00 99.45  ?  28   ASN C N     1 
ATOM   3972  C  CA    . ASN D  3  28   ? -140.348 48.793  2.738   1.00 104.92 ?  28   ASN C CA    1 
ATOM   3973  C  C     . ASN D  3  28   ? -139.476 47.555  2.915   1.00 104.13 ?  28   ASN C C     1 
ATOM   3974  O  O     . ASN D  3  28   ? -138.253 47.619  2.754   1.00 101.53 ?  28   ASN C O     1 
ATOM   3975  C  CB    . ASN D  3  28   ? -140.010 49.523  1.442   1.00 107.01 ?  28   ASN C CB    1 
ATOM   3976  C  CG    . ASN D  3  28   ? -140.475 48.770  0.212   1.00 112.79 ?  28   ASN C CG    1 
ATOM   3977  O  OD1   . ASN D  3  28   ? -141.371 47.927  0.287   1.00 115.33 ?  28   ASN C OD1   1 
ATOM   3978  N  ND2   . ASN D  3  28   ? -139.869 49.072  -0.931  1.00 99.72  ?  28   ASN C ND2   1 
ATOM   3979  N  N     . ARG D  3  29   ? -140.105 46.428  3.242   1.00 104.29 ?  29   ARG C N     1 
ATOM   3980  C  CA    . ARG D  3  29   ? -139.420 45.147  3.408   1.00 93.73  ?  29   ARG C CA    1 
ATOM   3981  C  C     . ARG D  3  29   ? -140.153 44.118  2.553   1.00 106.15 ?  29   ARG C C     1 
ATOM   3982  O  O     . ARG D  3  29   ? -141.217 43.625  2.939   1.00 107.11 ?  29   ARG C O     1 
ATOM   3983  C  CB    . ARG D  3  29   ? -139.378 44.729  4.874   1.00 96.17  ?  29   ARG C CB    1 
ATOM   3984  C  CG    . ARG D  3  29   ? -138.730 43.378  5.120   1.00 89.88  ?  29   ARG C CG    1 
ATOM   3985  C  CD    . ARG D  3  29   ? -138.634 43.081  6.608   1.00 86.56  ?  29   ARG C CD    1 
ATOM   3986  N  NE    . ARG D  3  29   ? -137.812 44.064  7.308   1.00 88.00  ?  29   ARG C NE    1 
ATOM   3987  C  CZ    . ARG D  3  29   ? -136.487 44.000  7.399   1.00 91.07  ?  29   ARG C CZ    1 
ATOM   3988  N  NH1   . ARG D  3  29   ? -135.827 42.999  6.834   1.00 91.27  ?  29   ARG C NH1   1 
ATOM   3989  N  NH2   . ARG D  3  29   ? -135.820 44.938  8.054   1.00 92.79  ?  29   ARG C NH2   1 
ATOM   3990  N  N     . VAL D  3  30   ? -139.581 43.795  1.391   1.00 101.27 ?  30   VAL C N     1 
ATOM   3991  C  CA    . VAL D  3  30   ? -140.241 42.890  0.459   1.00 97.42  ?  30   VAL C CA    1 
ATOM   3992  C  C     . VAL D  3  30   ? -140.346 41.497  1.070   1.00 105.80 ?  30   VAL C C     1 
ATOM   3993  O  O     . VAL D  3  30   ? -139.461 41.045  1.810   1.00 111.98 ?  30   VAL C O     1 
ATOM   3994  C  CB    . VAL D  3  30   ? -139.488 42.854  -0.883  1.00 98.46  ?  30   VAL C CB    1 
ATOM   3995  C  CG1   . VAL D  3  30   ? -140.468 42.675  -2.033  1.00 109.60 ?  30   VAL C CG1   1 
ATOM   3996  C  CG2   . VAL D  3  30   ? -138.657 44.118  -1.060  1.00 85.83  ?  30   VAL C CG2   1 
ATOM   3997  N  N     . SER D  3  31   ? -141.438 40.806  0.753   1.00 107.38 ?  31   SER C N     1 
ATOM   3998  C  CA    . SER D  3  31   ? -141.749 39.509  1.336   1.00 102.21 ?  31   SER C CA    1 
ATOM   3999  C  C     . SER D  3  31   ? -141.838 38.444  0.251   1.00 106.10 ?  31   SER C C     1 
ATOM   4000  O  O     . SER D  3  31   ? -142.363 38.694  -0.839  1.00 107.22 ?  31   SER C O     1 
ATOM   4001  C  CB    . SER D  3  31   ? -143.066 39.564  2.120   1.00 98.37  ?  31   SER C CB    1 
ATOM   4002  O  OG    . SER D  3  31   ? -143.414 38.288  2.627   1.00 122.90 ?  31   SER C OG    1 
ATOM   4003  N  N     . PHE D  3  32   ? -141.319 37.255  0.558   1.00 109.08 ?  32   PHE C N     1 
ATOM   4004  C  CA    . PHE D  3  32   ? -141.424 36.092  -0.311  1.00 106.38 ?  32   PHE C CA    1 
ATOM   4005  C  C     . PHE D  3  32   ? -142.704 35.300  -0.073  1.00 114.71 ?  32   PHE C C     1 
ATOM   4006  O  O     . PHE D  3  32   ? -142.795 34.142  -0.497  1.00 124.01 ?  32   PHE C O     1 
ATOM   4007  C  CB    . PHE D  3  32   ? -140.211 35.177  -0.121  1.00 92.32  ?  32   PHE C CB    1 
ATOM   4008  C  CG    . PHE D  3  32   ? -138.944 35.711  -0.720  1.00 94.64  ?  32   PHE C CG    1 
ATOM   4009  C  CD1   . PHE D  3  32   ? -138.227 36.710  -0.085  1.00 93.62  ?  32   PHE C CD1   1 
ATOM   4010  C  CD2   . PHE D  3  32   ? -138.462 35.204  -1.914  1.00 107.83 ?  32   PHE C CD2   1 
ATOM   4011  C  CE1   . PHE D  3  32   ? -137.057 37.198  -0.635  1.00 88.67  ?  32   PHE C CE1   1 
ATOM   4012  C  CE2   . PHE D  3  32   ? -137.292 35.690  -2.468  1.00 101.33 ?  32   PHE C CE2   1 
ATOM   4013  C  CZ    . PHE D  3  32   ? -136.589 36.688  -1.827  1.00 85.57  ?  32   PHE C CZ    1 
ATOM   4014  N  N     . ALA D  3  33   ? -143.689 35.893  0.595   1.00 108.13 ?  33   ALA C N     1 
ATOM   4015  C  CA    . ALA D  3  33   ? -144.898 35.164  0.949   1.00 112.72 ?  33   ALA C CA    1 
ATOM   4016  C  C     . ALA D  3  33   ? -145.696 34.809  -0.299  1.00 118.81 ?  33   ALA C C     1 
ATOM   4017  O  O     . ALA D  3  33   ? -145.990 35.673  -1.131  1.00 124.92 ?  33   ALA C O     1 
ATOM   4018  C  CB    . ALA D  3  33   ? -145.754 35.990  1.908   1.00 120.15 ?  33   ALA C CB    1 
ATOM   4019  N  N     . LYS D  3  34   ? -146.042 33.530  -0.428  1.00 124.39 ?  34   LYS C N     1 
ATOM   4020  C  CA    . LYS D  3  34   ? -146.913 33.055  -1.494  1.00 126.11 ?  34   LYS C CA    1 
ATOM   4021  C  C     . LYS D  3  34   ? -148.380 33.042  -1.088  1.00 121.83 ?  34   LYS C C     1 
ATOM   4022  O  O     . LYS D  3  34   ? -149.228 32.636  -1.890  1.00 124.28 ?  34   LYS C O     1 
ATOM   4023  C  CB    . LYS D  3  34   ? -146.493 31.648  -1.937  1.00 121.60 ?  34   LYS C CB    1 
ATOM   4024  C  CG    . LYS D  3  34   ? -145.272 31.607  -2.844  1.00 122.56 ?  34   LYS C CG    1 
ATOM   4025  C  CD    . LYS D  3  34   ? -144.017 32.074  -2.129  1.00 116.93 ?  34   LYS C CD    1 
ATOM   4026  C  CE    . LYS D  3  34   ? -142.809 32.012  -3.050  1.00 122.82 ?  34   LYS C CE    1 
ATOM   4027  N  NZ    . LYS D  3  34   ? -141.568 32.484  -2.377  1.00 124.80 ?  34   LYS C NZ    1 
ATOM   4028  N  N     . LEU D  3  35   ? -148.695 33.469  0.133   1.00 116.50 ?  35   LEU C N     1 
ATOM   4029  C  CA    . LEU D  3  35   ? -150.054 33.456  0.654   1.00 118.91 ?  35   LEU C CA    1 
ATOM   4030  C  C     . LEU D  3  35   ? -150.342 34.782  1.339   1.00 127.83 ?  35   LEU C C     1 
ATOM   4031  O  O     . LEU D  3  35   ? -149.501 35.302  2.079   1.00 136.22 ?  35   LEU C O     1 
ATOM   4032  C  CB    . LEU D  3  35   ? -150.264 32.303  1.650   1.00 113.50 ?  35   LEU C CB    1 
ATOM   4033  C  CG    . LEU D  3  35   ? -150.018 30.865  1.184   1.00 112.22 ?  35   LEU C CG    1 
ATOM   4034  C  CD1   . LEU D  3  35   ? -148.544 30.610  0.899   1.00 109.54 ?  35   LEU C CD1   1 
ATOM   4035  C  CD2   . LEU D  3  35   ? -150.539 29.878  2.218   1.00 115.47 ?  35   LEU C CD2   1 
ATOM   4036  N  N     . ARG D  3  36   ? -151.530 35.326  1.092   1.00 129.10 ?  36   ARG C N     1 
ATOM   4037  C  CA    . ARG D  3  36   ? -151.931 36.559  1.754   1.00 129.30 ?  36   ARG C CA    1 
ATOM   4038  C  C     . ARG D  3  36   ? -152.261 36.299  3.218   1.00 129.32 ?  36   ARG C C     1 
ATOM   4039  O  O     . ARG D  3  36   ? -152.785 35.242  3.577   1.00 128.75 ?  36   ARG C O     1 
ATOM   4040  C  CB    . ARG D  3  36   ? -153.143 37.180  1.060   1.00 137.75 ?  36   ARG C CB    1 
ATOM   4041  C  CG    . ARG D  3  36   ? -152.858 37.810  -0.291  1.00 141.49 ?  36   ARG C CG    1 
ATOM   4042  C  CD    . ARG D  3  36   ? -153.938 38.824  -0.638  1.00 137.54 ?  36   ARG C CD    1 
ATOM   4043  N  NE    . ARG D  3  36   ? -155.232 38.443  -0.079  1.00 136.00 ?  36   ARG C NE    1 
ATOM   4044  C  CZ    . ARG D  3  36   ? -156.101 37.640  -0.683  1.00 128.83 ?  36   ARG C CZ    1 
ATOM   4045  N  NH1   . ARG D  3  36   ? -157.255 37.347  -0.098  1.00 121.29 ?  36   ARG C NH1   1 
ATOM   4046  N  NH2   . ARG D  3  36   ? -155.816 37.129  -1.874  1.00 109.64 ?  36   ARG C NH2   1 
ATOM   4047  N  N     . GLU D  3  37   ? -151.949 37.278  4.063   1.00 132.10 ?  37   GLU C N     1 
ATOM   4048  C  CA    . GLU D  3  37   ? -152.316 37.247  5.472   1.00 135.20 ?  37   GLU C CA    1 
ATOM   4049  C  C     . GLU D  3  37   ? -153.745 37.755  5.621   1.00 135.44 ?  37   GLU C C     1 
ATOM   4050  O  O     . GLU D  3  37   ? -153.971 38.971  5.681   1.00 129.98 ?  37   GLU C O     1 
ATOM   4051  C  CB    . GLU D  3  37   ? -151.346 38.095  6.298   1.00 133.34 ?  37   GLU C CB    1 
ATOM   4052  C  CG    . GLU D  3  37   ? -151.626 38.116  7.794   1.00 128.89 ?  37   GLU C CG    1 
ATOM   4053  C  CD    . GLU D  3  37   ? -151.084 36.895  8.512   1.00 128.92 ?  37   GLU C CD    1 
ATOM   4054  O  OE1   . GLU D  3  37   ? -151.851 36.247  9.255   1.00 123.51 ?  37   GLU C OE1   1 
ATOM   4055  O  OE2   . GLU D  3  37   ? -149.887 36.582  8.331   1.00 129.65 ?  37   GLU C OE2   1 
ATOM   4056  N  N     . PRO D  3  38   ? -154.735 36.862  5.683   1.00 135.96 ?  38   PRO C N     1 
ATOM   4057  C  CA    . PRO D  3  38   ? -156.129 37.335  5.698   1.00 128.11 ?  38   PRO C CA    1 
ATOM   4058  C  C     . PRO D  3  38   ? -156.472 38.157  6.928   1.00 125.42 ?  38   PRO C C     1 
ATOM   4059  O  O     . PRO D  3  38   ? -157.108 39.210  6.804   1.00 127.22 ?  38   PRO C O     1 
ATOM   4060  C  CB    . PRO D  3  38   ? -156.936 36.032  5.636   1.00 119.75 ?  38   PRO C CB    1 
ATOM   4061  C  CG    . PRO D  3  38   ? -156.041 35.012  6.240   1.00 121.83 ?  38   PRO C CG    1 
ATOM   4062  C  CD    . PRO D  3  38   ? -154.643 35.400  5.831   1.00 127.76 ?  38   PRO C CD    1 
ATOM   4063  N  N     . LEU D  3  39   ? -156.070 37.706  8.112   1.00 123.63 ?  39   LEU C N     1 
ATOM   4064  C  CA    . LEU D  3  39   ? -156.378 38.393  9.358   1.00 119.54 ?  39   LEU C CA    1 
ATOM   4065  C  C     . LEU D  3  39   ? -155.139 39.113  9.868   1.00 118.78 ?  39   LEU C C     1 
ATOM   4066  O  O     . LEU D  3  39   ? -154.064 38.512  9.973   1.00 119.38 ?  39   LEU C O     1 
ATOM   4067  C  CB    . LEU D  3  39   ? -156.888 37.411  10.413  1.00 104.29 ?  39   LEU C CB    1 
ATOM   4068  C  CG    . LEU D  3  39   ? -157.059 37.974  11.827  1.00 116.21 ?  39   LEU C CG    1 
ATOM   4069  C  CD1   . LEU D  3  39   ? -157.876 39.261  11.808  1.00 124.05 ?  39   LEU C CD1   1 
ATOM   4070  C  CD2   . LEU D  3  39   ? -157.698 36.935  12.734  1.00 111.87 ?  39   LEU C CD2   1 
ATOM   4071  N  N     . GLU D  3  40   ? -155.288 40.400  10.169  1.00 110.19 ?  40   GLU C N     1 
ATOM   4072  C  CA    . GLU D  3  40   ? -154.200 41.148  10.779  1.00 106.61 ?  40   GLU C CA    1 
ATOM   4073  C  C     . GLU D  3  40   ? -153.911 40.610  12.174  1.00 101.59 ?  40   GLU C C     1 
ATOM   4074  O  O     . GLU D  3  40   ? -154.821 40.216  12.908  1.00 95.88  ?  40   GLU C O     1 
ATOM   4075  C  CB    . GLU D  3  40   ? -154.543 42.635  10.853  1.00 117.38 ?  40   GLU C CB    1 
ATOM   4076  C  CG    . GLU D  3  40   ? -153.880 43.481  9.780   1.00 113.68 ?  40   GLU C CG    1 
ATOM   4077  C  CD    . GLU D  3  40   ? -153.606 44.895  10.252  1.00 127.73 ?  40   GLU C CD    1 
ATOM   4078  O  OE1   . GLU D  3  40   ? -153.887 45.190  11.433  1.00 127.08 ?  40   GLU C OE1   1 
ATOM   4079  O  OE2   . GLU D  3  40   ? -153.107 45.709  9.447   1.00 137.19 ?  40   GLU C OE2   1 
ATOM   4080  N  N     . VAL D  3  41   ? -152.632 40.596  12.535  1.00 108.13 ?  41   VAL C N     1 
ATOM   4081  C  CA    . VAL D  3  41   ? -152.191 40.099  13.836  1.00 95.17  ?  41   VAL C CA    1 
ATOM   4082  C  C     . VAL D  3  41   ? -152.942 40.842  14.935  1.00 85.83  ?  41   VAL C C     1 
ATOM   4083  O  O     . VAL D  3  41   ? -152.959 42.081  14.944  1.00 87.42  ?  41   VAL C O     1 
ATOM   4084  C  CB    . VAL D  3  41   ? -150.672 40.255  14.004  1.00 95.75  ?  41   VAL C CB    1 
ATOM   4085  C  CG1   . VAL D  3  41   ? -150.195 39.508  15.243  1.00 96.81  ?  41   VAL C CG1   1 
ATOM   4086  C  CG2   . VAL D  3  41   ? -149.945 39.771  12.756  1.00 93.95  ?  41   VAL C CG2   1 
ATOM   4087  N  N     . PRO D  3  42   ? -153.574 40.140  15.871  1.00 93.72  ?  42   PRO C N     1 
ATOM   4088  C  CA    . PRO D  3  42   ? -154.276 40.828  16.957  1.00 99.22  ?  42   PRO C CA    1 
ATOM   4089  C  C     . PRO D  3  42   ? -153.301 41.540  17.882  1.00 92.05  ?  42   PRO C C     1 
ATOM   4090  O  O     . PRO D  3  42   ? -152.111 41.220  17.947  1.00 100.92 ?  42   PRO C O     1 
ATOM   4091  C  CB    . PRO D  3  42   ? -155.003 39.694  17.686  1.00 88.24  ?  42   PRO C CB    1 
ATOM   4092  C  CG    . PRO D  3  42   ? -154.167 38.486  17.406  1.00 97.40  ?  42   PRO C CG    1 
ATOM   4093  C  CD    . PRO D  3  42   ? -153.633 38.676  16.010  1.00 102.54 ?  42   PRO C CD    1 
ATOM   4094  N  N     . GLY D  3  43   ? -153.825 42.534  18.601  1.00 93.93  ?  43   GLY C N     1 
ATOM   4095  C  CA    . GLY D  3  43   ? -153.033 43.248  19.583  1.00 96.69  ?  43   GLY C CA    1 
ATOM   4096  C  C     . GLY D  3  43   ? -152.449 42.290  20.592  1.00 94.71  ?  43   GLY C C     1 
ATOM   4097  O  O     . GLY D  3  43   ? -153.064 41.978  21.617  1.00 95.52  ?  43   GLY C O     1 
ATOM   4098  N  N     . LEU D  3  44   ? -151.234 41.818  20.308  1.00 89.01  ?  44   LEU C N     1 
ATOM   4099  C  CA    . LEU D  3  44   ? -150.667 40.694  21.050  1.00 100.56 ?  44   LEU C CA    1 
ATOM   4100  C  C     . LEU D  3  44   ? -150.367 41.074  22.491  1.00 89.75  ?  44   LEU C C     1 
ATOM   4101  O  O     . LEU D  3  44   ? -149.776 40.284  23.232  1.00 99.81  ?  44   LEU C O     1 
ATOM   4102  C  CB    . LEU D  3  44   ? -149.410 40.174  20.359  1.00 90.17  ?  44   LEU C CB    1 
ATOM   4103  C  CG    . LEU D  3  44   ? -148.556 41.203  19.625  1.00 84.52  ?  44   LEU C CG    1 
ATOM   4104  C  CD1   . LEU D  3  44   ? -147.370 41.627  20.479  1.00 91.47  ?  44   LEU C CD1   1 
ATOM   4105  C  CD2   . LEU D  3  44   ? -148.101 40.673  18.265  1.00 77.78  ?  44   LEU C CD2   1 
ATOM   4106  N  N     . LEU D  3  45   ? -150.769 42.283  22.886  1.00 86.58  ?  45   LEU C N     1 
ATOM   4107  C  CA    . LEU D  3  45   ? -150.732 42.703  24.278  1.00 92.64  ?  45   LEU C CA    1 
ATOM   4108  C  C     . LEU D  3  45   ? -152.113 42.687  24.930  1.00 100.49 ?  45   LEU C C     1 
ATOM   4109  O  O     . LEU D  3  45   ? -152.276 43.216  26.037  1.00 102.09 ?  45   LEU C O     1 
ATOM   4110  C  CB    . LEU D  3  45   ? -150.102 44.102  24.394  1.00 86.22  ?  45   LEU C CB    1 
ATOM   4111  C  CG    . LEU D  3  45   ? -148.949 44.223  25.393  1.00 82.49  ?  45   LEU C CG    1 
ATOM   4112  C  CD1   . LEU D  3  45   ? -148.392 45.636  25.384  1.00 98.65  ?  45   LEU C CD1   1 
ATOM   4113  C  CD2   . LEU D  3  45   ? -149.419 43.822  26.790  1.00 95.71  ?  45   LEU C CD2   1 
ATOM   4114  N  N     . ASP D  3  46   ? -153.101 42.079  24.275  1.00 96.07  ?  46   ASP C N     1 
ATOM   4115  C  CA    . ASP D  3  46   ? -154.465 42.101  24.779  1.00 89.91  ?  46   ASP C CA    1 
ATOM   4116  C  C     . ASP D  3  46   ? -154.686 41.110  25.910  1.00 83.77  ?  46   ASP C C     1 
ATOM   4117  O  O     . ASP D  3  46   ? -155.540 41.352  26.767  1.00 88.37  ?  46   ASP C O     1 
ATOM   4118  C  CB    . ASP D  3  46   ? -155.453 41.811  23.646  1.00 92.56  ?  46   ASP C CB    1 
ATOM   4119  C  CG    . ASP D  3  46   ? -155.853 43.064  22.883  1.00 108.54 ?  46   ASP C CG    1 
ATOM   4120  O  OD1   . ASP D  3  46   ? -155.062 43.514  22.029  1.00 100.06 ?  46   ASP C OD1   1 
ATOM   4121  O  OD2   . ASP D  3  46   ? -156.959 43.597  23.133  1.00 126.42 ?  46   ASP C OD2   1 
ATOM   4122  N  N     . VAL D  3  47   ? -153.946 39.998  25.935  1.00 97.14  ?  47   VAL C N     1 
ATOM   4123  C  CA    . VAL D  3  47   ? -154.173 38.972  26.955  1.00 99.60  ?  47   VAL C CA    1 
ATOM   4124  C  C     . VAL D  3  47   ? -154.148 39.563  28.357  1.00 102.16 ?  47   VAL C C     1 
ATOM   4125  O  O     . VAL D  3  47   ? -154.888 39.119  29.242  1.00 101.39 ?  47   VAL C O     1 
ATOM   4126  C  CB    . VAL D  3  47   ? -153.137 37.836  26.802  1.00 93.76  ?  47   VAL C CB    1 
ATOM   4127  C  CG1   . VAL D  3  47   ? -151.727 38.387  26.915  1.00 103.12 ?  47   VAL C CG1   1 
ATOM   4128  C  CG2   . VAL D  3  47   ? -153.379 36.755  27.840  1.00 80.24  ?  47   VAL C CG2   1 
ATOM   4129  N  N     . GLN D  3  48   ? -153.302 40.564  28.585  1.00 101.41 ?  48   GLN C N     1 
ATOM   4130  C  CA    . GLN D  3  48   ? -153.188 41.210  29.887  1.00 101.35 ?  48   GLN C CA    1 
ATOM   4131  C  C     . GLN D  3  48   ? -154.226 42.308  30.088  1.00 97.72  ?  48   GLN C C     1 
ATOM   4132  O  O     . GLN D  3  48   ? -154.775 42.446  31.186  1.00 93.98  ?  48   GLN C O     1 
ATOM   4133  C  CB    . GLN D  3  48   ? -151.782 41.790  30.067  1.00 98.22  ?  48   GLN C CB    1 
ATOM   4134  C  CG    . GLN D  3  48   ? -150.664 40.756  30.105  1.00 83.70  ?  48   GLN C CG    1 
ATOM   4135  C  CD    . GLN D  3  48   ? -150.628 39.981  31.406  1.00 95.78  ?  48   GLN C CD    1 
ATOM   4136  O  OE1   . GLN D  3  48   ? -150.357 38.780  31.419  1.00 108.93 ?  48   GLN C OE1   1 
ATOM   4137  N  NE2   . GLN D  3  48   ? -150.901 40.666  32.510  1.00 88.15  ?  48   GLN C NE2   1 
ATOM   4138  N  N     . THR D  3  49   ? -154.521 43.081  29.042  1.00 95.64  ?  49   THR C N     1 
ATOM   4139  C  CA    . THR D  3  49   ? -155.433 44.210  29.197  1.00 98.37  ?  49   THR C CA    1 
ATOM   4140  C  C     . THR D  3  49   ? -156.877 43.743  29.341  1.00 105.34 ?  49   THR C C     1 
ATOM   4141  O  O     . THR D  3  49   ? -157.594 44.181  30.248  1.00 112.74 ?  49   THR C O     1 
ATOM   4142  C  CB    . THR D  3  49   ? -155.299 45.169  28.013  1.00 88.73  ?  49   THR C CB    1 
ATOM   4143  O  OG1   . THR D  3  49   ? -155.614 44.482  26.796  1.00 93.80  ?  49   THR C OG1   1 
ATOM   4144  C  CG2   . THR D  3  49   ? -153.884 45.716  27.928  1.00 81.25  ?  49   THR C CG2   1 
ATOM   4145  N  N     . ASP D  3  50   ? -157.324 42.853  28.450  1.00 97.43  ?  50   ASP C N     1 
ATOM   4146  C  CA    . ASP D  3  50   ? -158.713 42.406  28.484  1.00 88.41  ?  50   ASP C CA    1 
ATOM   4147  C  C     . ASP D  3  50   ? -159.076 41.819  29.842  1.00 94.15  ?  50   ASP C C     1 
ATOM   4148  O  O     . ASP D  3  50   ? -160.169 42.071  30.364  1.00 98.53  ?  50   ASP C O     1 
ATOM   4149  C  CB    . ASP D  3  50   ? -158.963 41.383  27.376  1.00 71.37  ?  50   ASP C CB    1 
ATOM   4150  C  CG    . ASP D  3  50   ? -158.717 41.951  25.992  1.00 91.14  ?  50   ASP C CG    1 
ATOM   4151  O  OD1   . ASP D  3  50   ? -158.673 43.192  25.854  1.00 92.68  ?  50   ASP C OD1   1 
ATOM   4152  O  OD2   . ASP D  3  50   ? -158.575 41.155  25.040  1.00 101.90 ?  50   ASP C OD2   1 
ATOM   4153  N  N     . SER D  3  51   ? -158.174 41.033  30.432  1.00 87.87  ?  51   SER C N     1 
ATOM   4154  C  CA    . SER D  3  51   ? -158.482 40.395  31.707  1.00 95.89  ?  51   SER C CA    1 
ATOM   4155  C  C     . SER D  3  51   ? -158.580 41.419  32.830  1.00 103.84 ?  51   SER C C     1 
ATOM   4156  O  O     . SER D  3  51   ? -159.495 41.352  33.659  1.00 115.62 ?  51   SER C O     1 
ATOM   4157  C  CB    . SER D  3  51   ? -157.432 39.334  32.031  1.00 111.32 ?  51   SER C CB    1 
ATOM   4158  O  OG    . SER D  3  51   ? -157.758 38.642  33.224  1.00 112.89 ?  51   SER C OG    1 
ATOM   4159  N  N     . PHE D  3  52   ? -157.651 42.376  32.878  1.00 109.57 ?  52   PHE C N     1 
ATOM   4160  C  CA    . PHE D  3  52   ? -157.710 43.393  33.923  1.00 110.56 ?  52   PHE C CA    1 
ATOM   4161  C  C     . PHE D  3  52   ? -158.854 44.369  33.679  1.00 113.47 ?  52   PHE C C     1 
ATOM   4162  O  O     . PHE D  3  52   ? -159.513 44.810  34.628  1.00 126.24 ?  52   PHE C O     1 
ATOM   4163  C  CB    . PHE D  3  52   ? -156.379 44.136  34.020  1.00 95.74  ?  52   PHE C CB    1 
ATOM   4164  C  CG    . PHE D  3  52   ? -156.289 45.061  35.201  1.00 93.09  ?  52   PHE C CG    1 
ATOM   4165  C  CD1   . PHE D  3  52   ? -155.965 44.573  36.457  1.00 93.62  ?  52   PHE C CD1   1 
ATOM   4166  C  CD2   . PHE D  3  52   ? -156.529 46.417  35.056  1.00 83.41  ?  52   PHE C CD2   1 
ATOM   4167  C  CE1   . PHE D  3  52   ? -155.882 45.420  37.547  1.00 96.28  ?  52   PHE C CE1   1 
ATOM   4168  C  CE2   . PHE D  3  52   ? -156.445 47.270  36.141  1.00 93.88  ?  52   PHE C CE2   1 
ATOM   4169  C  CZ    . PHE D  3  52   ? -156.122 46.771  37.388  1.00 95.48  ?  52   PHE C CZ    1 
ATOM   4170  N  N     . GLU D  3  53   ? -159.111 44.715  32.415  1.00 105.89 ?  53   GLU C N     1 
ATOM   4171  C  CA    . GLU D  3  53   ? -160.229 45.603  32.113  1.00 112.77 ?  53   GLU C CA    1 
ATOM   4172  C  C     . GLU D  3  53   ? -161.560 44.946  32.455  1.00 119.72 ?  53   GLU C C     1 
ATOM   4173  O  O     . GLU D  3  53   ? -162.477 45.609  32.954  1.00 118.57 ?  53   GLU C O     1 
ATOM   4174  C  CB    . GLU D  3  53   ? -160.190 46.017  30.643  1.00 103.98 ?  53   GLU C CB    1 
ATOM   4175  C  CG    . GLU D  3  53   ? -160.162 47.521  30.434  1.00 120.20 ?  53   GLU C CG    1 
ATOM   4176  C  CD    . GLU D  3  53   ? -160.029 47.907  28.974  1.00 135.89 ?  53   GLU C CD    1 
ATOM   4177  O  OE1   . GLU D  3  53   ? -159.829 47.003  28.135  1.00 132.91 ?  53   GLU C OE1   1 
ATOM   4178  O  OE2   . GLU D  3  53   ? -160.126 49.114  28.668  1.00 130.42 ?  53   GLU C OE2   1 
ATOM   4179  N  N     . TRP D  3  54   ? -161.688 43.644  32.190  1.00 114.29 ?  54   TRP C N     1 
ATOM   4180  C  CA    . TRP D  3  54   ? -162.872 42.917  32.633  1.00 109.14 ?  54   TRP C CA    1 
ATOM   4181  C  C     . TRP D  3  54   ? -162.964 42.900  34.152  1.00 109.75 ?  54   TRP C C     1 
ATOM   4182  O  O     . TRP D  3  54   ? -164.062 42.987  34.715  1.00 118.77 ?  54   TRP C O     1 
ATOM   4183  C  CB    . TRP D  3  54   ? -162.852 41.493  32.077  1.00 113.65 ?  54   TRP C CB    1 
ATOM   4184  C  CG    . TRP D  3  54   ? -163.723 40.534  32.832  1.00 110.90 ?  54   TRP C CG    1 
ATOM   4185  C  CD1   . TRP D  3  54   ? -165.040 40.264  32.600  1.00 114.11 ?  54   TRP C CD1   1 
ATOM   4186  C  CD2   . TRP D  3  54   ? -163.334 39.712  33.941  1.00 113.73 ?  54   TRP C CD2   1 
ATOM   4187  N  NE1   . TRP D  3  54   ? -165.496 39.328  33.497  1.00 118.93 ?  54   TRP C NE1   1 
ATOM   4188  C  CE2   . TRP D  3  54   ? -164.469 38.974  34.332  1.00 116.94 ?  54   TRP C CE2   1 
ATOM   4189  C  CE3   . TRP D  3  54   ? -162.137 39.532  34.642  1.00 114.56 ?  54   TRP C CE3   1 
ATOM   4190  C  CZ2   . TRP D  3  54   ? -164.442 38.068  35.391  1.00 110.61 ?  54   TRP C CZ2   1 
ATOM   4191  C  CZ3   . TRP D  3  54   ? -162.113 38.633  35.694  1.00 113.41 ?  54   TRP C CZ3   1 
ATOM   4192  C  CH2   . TRP D  3  54   ? -163.258 37.912  36.057  1.00 110.94 ?  54   TRP C CH2   1 
ATOM   4193  N  N     . LEU D  3  55   ? -161.823 42.789  34.832  1.00 107.73 ?  55   LEU C N     1 
ATOM   4194  C  CA    . LEU D  3  55   ? -161.790 42.809  36.288  1.00 105.42 ?  55   LEU C CA    1 
ATOM   4195  C  C     . LEU D  3  55   ? -162.381 44.112  36.806  1.00 116.76 ?  55   LEU C C     1 
ATOM   4196  O  O     . LEU D  3  55   ? -163.466 44.118  37.394  1.00 132.90 ?  55   LEU C O     1 
ATOM   4197  C  CB    . LEU D  3  55   ? -160.358 42.633  36.797  1.00 104.68 ?  55   LEU C CB    1 
ATOM   4198  C  CG    . LEU D  3  55   ? -160.176 42.572  38.315  1.00 114.79 ?  55   LEU C CG    1 
ATOM   4199  C  CD1   . LEU D  3  55   ? -160.750 41.280  38.877  1.00 125.07 ?  55   LEU C CD1   1 
ATOM   4200  C  CD2   . LEU D  3  55   ? -158.708 42.722  38.693  1.00 115.30 ?  55   LEU C CD2   1 
ATOM   4201  N  N     . VAL D  3  56   ? -161.677 45.224  36.578  1.00 121.19 ?  56   VAL C N     1 
ATOM   4202  C  CA    . VAL D  3  56   ? -162.160 46.524  37.025  1.00 127.25 ?  56   VAL C CA    1 
ATOM   4203  C  C     . VAL D  3  56   ? -163.510 46.863  36.411  1.00 125.28 ?  56   VAL C C     1 
ATOM   4204  O  O     . VAL D  3  56   ? -164.260 47.670  36.970  1.00 116.66 ?  56   VAL C O     1 
ATOM   4205  C  CB    . VAL D  3  56   ? -161.122 47.619  36.702  1.00 113.47 ?  56   VAL C CB    1 
ATOM   4206  C  CG1   . VAL D  3  56   ? -161.613 48.975  37.188  1.00 128.43 ?  56   VAL C CG1   1 
ATOM   4207  C  CG2   . VAL D  3  56   ? -159.777 47.275  37.326  1.00 104.68 ?  56   VAL C CG2   1 
ATOM   4208  N  N     . GLY D  3  57   ? -163.843 46.264  35.270  1.00 121.03 ?  57   GLY C N     1 
ATOM   4209  C  CA    . GLY D  3  57   ? -165.112 46.528  34.623  1.00 123.21 ?  57   GLY C CA    1 
ATOM   4210  C  C     . GLY D  3  57   ? -165.163 47.886  33.958  1.00 125.73 ?  57   GLY C C     1 
ATOM   4211  O  O     . GLY D  3  57   ? -166.089 48.669  34.194  1.00 118.57 ?  57   GLY C O     1 
ATOM   4212  N  N     . SER D  3  58   ? -164.168 48.179  33.124  1.00 123.43 ?  58   SER C N     1 
ATOM   4213  C  CA    . SER D  3  58   ? -164.127 49.457  32.431  1.00 124.68 ?  58   SER C CA    1 
ATOM   4214  C  C     . SER D  3  58   ? -165.294 49.577  31.457  1.00 125.65 ?  58   SER C C     1 
ATOM   4215  O  O     . SER D  3  58   ? -165.822 48.581  30.956  1.00 119.19 ?  58   SER C O     1 
ATOM   4216  C  CB    . SER D  3  58   ? -162.802 49.616  31.683  1.00 126.68 ?  58   SER C CB    1 
ATOM   4217  O  OG    . SER D  3  58   ? -162.789 50.808  30.917  1.00 130.85 ?  58   SER C OG    1 
ATOM   4218  N  N     . ASP D  3  59   ? -165.698 50.822  31.191  1.00 130.83 ?  59   ASP C N     1 
ATOM   4219  C  CA    . ASP D  3  59   ? -166.793 51.054  30.255  1.00 129.83 ?  59   ASP C CA    1 
ATOM   4220  C  C     . ASP D  3  59   ? -166.433 50.592  28.850  1.00 130.24 ?  59   ASP C C     1 
ATOM   4221  O  O     . ASP D  3  59   ? -167.322 50.233  28.069  1.00 134.54 ?  59   ASP C O     1 
ATOM   4222  C  CB    . ASP D  3  59   ? -167.179 52.533  30.247  1.00 131.05 ?  59   ASP C CB    1 
ATOM   4223  C  CG    . ASP D  3  59   ? -167.861 52.966  31.531  1.00 135.40 ?  59   ASP C CG    1 
ATOM   4224  O  OD1   . ASP D  3  59   ? -167.680 54.133  31.939  1.00 130.57 ?  59   ASP C OD1   1 
ATOM   4225  O  OD2   . ASP D  3  59   ? -168.580 52.139  32.132  1.00 129.17 ?  59   ASP C OD2   1 
ATOM   4226  N  N     . ARG D  3  60   ? -165.143 50.595  28.508  1.00 129.88 ?  60   ARG C N     1 
ATOM   4227  C  CA    . ARG D  3  60   ? -164.733 50.133  27.186  1.00 138.48 ?  60   ARG C CA    1 
ATOM   4228  C  C     . ARG D  3  60   ? -165.046 48.653  27.003  1.00 140.92 ?  60   ARG C C     1 
ATOM   4229  O  O     . ARG D  3  60   ? -165.428 48.220  25.910  1.00 140.05 ?  60   ARG C O     1 
ATOM   4230  C  CB    . ARG D  3  60   ? -163.243 50.400  26.977  1.00 134.68 ?  60   ARG C CB    1 
ATOM   4231  C  CG    . ARG D  3  60   ? -162.846 50.614  25.524  1.00 120.94 ?  60   ARG C CG    1 
ATOM   4232  C  CD    . ARG D  3  60   ? -161.752 49.652  25.093  1.00 126.25 ?  60   ARG C CD    1 
ATOM   4233  N  NE    . ARG D  3  60   ? -162.245 48.284  24.958  1.00 140.81 ?  60   ARG C NE    1 
ATOM   4234  C  CZ    . ARG D  3  60   ? -161.508 47.264  24.532  1.00 134.18 ?  60   ARG C CZ    1 
ATOM   4235  N  NH1   . ARG D  3  60   ? -160.238 47.454  24.199  1.00 127.97 ?  60   ARG C NH1   1 
ATOM   4236  N  NH2   . ARG D  3  60   ? -162.039 46.052  24.437  1.00 122.22 ?  60   ARG C NH2   1 
ATOM   4237  N  N     . TRP D  3  61   ? -164.889 47.861  28.066  1.00 136.22 ?  61   TRP C N     1 
ATOM   4238  C  CA    . TRP D  3  61   ? -165.229 46.443  27.998  1.00 135.02 ?  61   TRP C CA    1 
ATOM   4239  C  C     . TRP D  3  61   ? -166.737 46.246  27.904  1.00 140.28 ?  61   TRP C C     1 
ATOM   4240  O  O     . TRP D  3  61   ? -167.221 45.462  27.078  1.00 137.26 ?  61   TRP C O     1 
ATOM   4241  C  CB    . TRP D  3  61   ? -164.656 45.713  29.213  1.00 126.84 ?  61   TRP C CB    1 
ATOM   4242  C  CG    . TRP D  3  61   ? -165.435 44.500  29.627  1.00 133.96 ?  61   TRP C CG    1 
ATOM   4243  C  CD1   . TRP D  3  61   ? -165.326 43.239  29.116  1.00 133.11 ?  61   TRP C CD1   1 
ATOM   4244  C  CD2   . TRP D  3  61   ? -166.437 44.434  30.649  1.00 135.33 ?  61   TRP C CD2   1 
ATOM   4245  N  NE1   . TRP D  3  61   ? -166.201 42.392  29.753  1.00 131.98 ?  61   TRP C NE1   1 
ATOM   4246  C  CE2   . TRP D  3  61   ? -166.895 43.101  30.699  1.00 140.41 ?  61   TRP C CE2   1 
ATOM   4247  C  CE3   . TRP D  3  61   ? -166.993 45.372  31.524  1.00 130.58 ?  61   TRP C CE3   1 
ATOM   4248  C  CZ2   . TRP D  3  61   ? -167.882 42.684  31.591  1.00 138.45 ?  61   TRP C CZ2   1 
ATOM   4249  C  CZ3   . TRP D  3  61   ? -167.972 44.955  32.409  1.00 134.63 ?  61   TRP C CZ3   1 
ATOM   4250  C  CH2   . TRP D  3  61   ? -168.407 43.624  32.435  1.00 131.47 ?  61   TRP C CH2   1 
ATOM   4251  N  N     . ARG D  3  62   ? -167.498 46.950  28.747  1.00 141.01 ?  62   ARG C N     1 
ATOM   4252  C  CA    . ARG D  3  62   ? -168.954 46.880  28.662  1.00 141.29 ?  62   ARG C CA    1 
ATOM   4253  C  C     . ARG D  3  62   ? -169.445 47.300  27.283  1.00 142.51 ?  62   ARG C C     1 
ATOM   4254  O  O     . ARG D  3  62   ? -170.337 46.661  26.711  1.00 144.27 ?  62   ARG C O     1 
ATOM   4255  C  CB    . ARG D  3  62   ? -169.585 47.754  29.746  1.00 138.81 ?  62   ARG C CB    1 
ATOM   4256  C  CG    . ARG D  3  62   ? -170.939 48.337  29.366  1.00 137.89 ?  62   ARG C CG    1 
ATOM   4257  C  CD    . ARG D  3  62   ? -171.618 49.012  30.551  1.00 128.53 ?  62   ARG C CD    1 
ATOM   4258  N  NE    . ARG D  3  62   ? -170.750 49.089  31.722  1.00 126.32 ?  62   ARG C NE    1 
ATOM   4259  C  CZ    . ARG D  3  62   ? -170.683 48.154  32.665  1.00 119.56 ?  62   ARG C CZ    1 
ATOM   4260  N  NH1   . ARG D  3  62   ? -171.433 47.064  32.573  1.00 121.31 ?  62   ARG C NH1   1 
ATOM   4261  N  NH2   . ARG D  3  62   ? -169.865 48.307  33.697  1.00 110.95 ?  62   ARG C NH2   1 
ATOM   4262  N  N     . GLN D  3  63   ? -168.875 48.373  26.731  1.00 137.08 ?  63   GLN C N     1 
ATOM   4263  C  CA    . GLN D  3  63   ? -169.269 48.808  25.396  1.00 139.45 ?  63   GLN C CA    1 
ATOM   4264  C  C     . GLN D  3  63   ? -168.853 47.793  24.339  1.00 145.69 ?  63   GLN C C     1 
ATOM   4265  O  O     . GLN D  3  63   ? -169.571 47.584  23.354  1.00 142.50 ?  63   GLN C O     1 
ATOM   4266  C  CB    . GLN D  3  63   ? -168.667 50.179  25.091  1.00 139.92 ?  63   GLN C CB    1 
ATOM   4267  N  N     . ALA D  3  64   ? -167.699 47.150  24.527  1.00 152.64 ?  64   ALA C N     1 
ATOM   4268  C  CA    . ALA D  3  64   ? -167.220 46.172  23.556  1.00 151.74 ?  64   ALA C CA    1 
ATOM   4269  C  C     . ALA D  3  64   ? -167.962 44.845  23.680  1.00 151.70 ?  64   ALA C C     1 
ATOM   4270  O  O     . ALA D  3  64   ? -168.208 44.173  22.671  1.00 140.69 ?  64   ALA C O     1 
ATOM   4271  C  CB    . ALA D  3  64   ? -165.716 45.958  23.724  1.00 138.43 ?  64   ALA C CB    1 
ATOM   4272  N  N     . ALA D  3  65   ? -168.324 44.453  24.902  1.00 149.68 ?  65   ALA C N     1 
ATOM   4273  C  CA    . ALA D  3  65   ? -169.024 43.188  25.098  1.00 149.59 ?  65   ALA C CA    1 
ATOM   4274  C  C     . ALA D  3  65   ? -170.507 43.305  24.765  1.00 152.03 ?  65   ALA C C     1 
ATOM   4275  O  O     . ALA D  3  65   ? -171.097 42.369  24.214  1.00 146.41 ?  65   ALA C O     1 
ATOM   4276  C  CB    . ALA D  3  65   ? -168.837 42.702  26.536  1.00 141.75 ?  65   ALA C CB    1 
ATOM   4277  N  N     . ILE D  3  66   ? -171.123 44.445  25.086  1.00 153.50 ?  66   ILE C N     1 
ATOM   4278  C  CA    . ILE D  3  66   ? -172.554 44.604  24.850  1.00 151.95 ?  66   ILE C CA    1 
ATOM   4279  C  C     . ILE D  3  66   ? -172.879 44.581  23.363  1.00 150.92 ?  66   ILE C C     1 
ATOM   4280  O  O     . ILE D  3  66   ? -173.912 44.036  22.957  1.00 143.37 ?  66   ILE C O     1 
ATOM   4281  C  CB    . ILE D  3  66   ? -173.050 45.902  25.485  1.00 148.66 ?  66   ILE C CB    1 
ATOM   4282  N  N     . ASP D  3  67   ? -172.016 45.166  22.546  1.00 151.44 ?  67   ASP C N     1 
ATOM   4283  C  CA    . ASP D  3  67   ? -172.257 45.213  21.111  1.00 147.43 ?  67   ASP C CA    1 
ATOM   4284  C  C     . ASP D  3  67   ? -172.530 43.827  20.523  1.00 153.66 ?  67   ASP C C     1 
ATOM   4285  O  O     . ASP D  3  67   ? -173.456 43.644  19.742  1.00 150.93 ?  67   ASP C O     1 
ATOM   4286  C  CB    . ASP D  3  67   ? -171.086 45.888  20.395  1.00 30.00  ?  67   ASP C CB    1 
ATOM   4287  C  CG    . ASP D  3  67   ? -171.032 47.385  20.647  1.00 30.00  ?  67   ASP C CG    1 
ATOM   4288  O  OD1   . ASP D  3  67   ? -171.827 48.114  20.021  1.00 30.00  ?  67   ASP C OD1   1 
ATOM   4289  O  OD2   . ASP D  3  67   ? -170.251 47.815  21.518  1.00 30.00  ?  67   ASP C OD2   1 
ATOM   4290  N  N     . ARG D  3  68   ? -171.716 42.857  20.908  1.00 148.57 ?  68   ARG C N     1 
ATOM   4291  C  CA    . ARG D  3  68   ? -171.842 41.479  20.434  1.00 144.88 ?  68   ARG C CA    1 
ATOM   4292  C  C     . ARG D  3  68   ? -171.700 40.542  21.640  1.00 146.59 ?  68   ARG C C     1 
ATOM   4293  O  O     . ARG D  3  68   ? -170.749 39.780  21.764  1.00 150.41 ?  68   ARG C O     1 
ATOM   4294  C  CB    . ARG D  3  68   ? -170.823 41.181  19.329  1.00 139.81 ?  68   ARG C CB    1 
ATOM   4295  N  N     . GLY D  3  69   ? -172.669 40.608  22.544  1.00 142.79 ?  69   GLY C N     1 
ATOM   4296  C  CA    . GLY D  3  69   ? -172.631 39.766  23.723  1.00 147.01 ?  69   GLY C CA    1 
ATOM   4297  C  C     . GLY D  3  69   ? -173.782 40.081  24.654  1.00 150.11 ?  69   GLY C C     1 
ATOM   4298  O  O     . GLY D  3  69   ? -174.694 40.839  24.313  1.00 147.93 ?  69   GLY C O     1 
ATOM   4299  N  N     . GLU D  3  70   ? -173.724 39.484  25.845  1.00 147.15 ?  70   GLU C N     1 
ATOM   4300  C  CA    . GLU D  3  70   ? -174.769 39.691  26.841  1.00 145.87 ?  70   GLU C CA    1 
ATOM   4301  C  C     . GLU D  3  70   ? -174.931 41.173  27.157  1.00 149.29 ?  70   GLU C C     1 
ATOM   4302  O  O     . GLU D  3  70   ? -173.953 41.922  27.230  1.00 155.07 ?  70   GLU C O     1 
ATOM   4303  C  CB    . GLU D  3  70   ? -174.450 38.915  28.120  1.00 136.05 ?  70   GLU C CB    1 
ATOM   4304  N  N     . GLU D  3  71   ? -176.181 41.591  27.358  1.00 142.39 ?  71   GLU C N     1 
ATOM   4305  C  CA    . GLU D  3  71   ? -176.485 42.991  27.629  1.00 146.57 ?  71   GLU C CA    1 
ATOM   4306  C  C     . GLU D  3  71   ? -176.251 43.391  29.080  1.00 147.73 ?  71   GLU C C     1 
ATOM   4307  O  O     . GLU D  3  71   ? -176.316 44.586  29.393  1.00 143.32 ?  71   GLU C O     1 
ATOM   4308  C  CB    . GLU D  3  71   ? -177.936 43.299  27.246  1.00 149.17 ?  71   GLU C CB    1 
ATOM   4309  C  CG    . GLU D  3  71   ? -178.110 43.784  25.818  1.00 144.60 ?  71   GLU C CG    1 
ATOM   4310  C  CD    . GLU D  3  71   ? -177.545 45.176  25.610  1.00 145.25 ?  71   GLU C CD    1 
ATOM   4311  O  OE1   . GLU D  3  71   ? -177.796 45.769  24.540  1.00 134.68 ?  71   GLU C OE1   1 
ATOM   4312  O  OE2   . GLU D  3  71   ? -176.853 45.679  26.521  1.00 140.59 ?  71   GLU C OE2   1 
ATOM   4313  N  N     . ASN D  3  72   ? -175.978 42.437  29.967  1.00 150.74 ?  72   ASN C N     1 
ATOM   4314  C  CA    . ASN D  3  72   ? -175.783 42.709  31.391  1.00 150.43 ?  72   ASN C CA    1 
ATOM   4315  C  C     . ASN D  3  72   ? -174.504 42.034  31.871  1.00 149.55 ?  72   ASN C C     1 
ATOM   4316  O  O     . ASN D  3  72   ? -174.540 41.117  32.701  1.00 151.69 ?  72   ASN C O     1 
ATOM   4317  C  CB    . ASN D  3  72   ? -176.992 42.244  32.203  1.00 133.06 ?  72   ASN C CB    1 
ATOM   4318  C  CG    . ASN D  3  72   ? -176.869 42.580  33.675  1.00 133.86 ?  72   ASN C CG    1 
ATOM   4319  O  OD1   . ASN D  3  72   ? -176.984 43.741  34.070  1.00 131.68 ?  72   ASN C OD1   1 
ATOM   4320  N  ND2   . ASN D  3  72   ? -176.641 41.563  34.499  1.00 128.38 ?  72   ASN C ND2   1 
ATOM   4321  N  N     . PRO D  3  73   ? -173.351 42.463  31.364  1.00 143.88 ?  73   PRO C N     1 
ATOM   4322  C  CA    . PRO D  3  73   ? -172.085 41.915  31.859  1.00 138.14 ?  73   PRO C CA    1 
ATOM   4323  C  C     . PRO D  3  73   ? -171.774 42.425  33.257  1.00 128.22 ?  73   PRO C C     1 
ATOM   4324  O  O     . PRO D  3  73   ? -172.119 43.550  33.627  1.00 119.24 ?  73   PRO C O     1 
ATOM   4325  C  CB    . PRO D  3  73   ? -171.051 42.418  30.842  1.00 136.03 ?  73   PRO C CB    1 
ATOM   4326  C  CG    . PRO D  3  73   ? -171.853 42.892  29.658  1.00 134.76 ?  73   PRO C CG    1 
ATOM   4327  C  CD    . PRO D  3  73   ? -173.146 43.375  30.228  1.00 130.78 ?  73   PRO C CD    1 
ATOM   4328  N  N     . VAL D  3  74   ? -171.109 41.578  34.038  1.00 129.52 ?  74   VAL C N     1 
ATOM   4329  C  CA    . VAL D  3  74   ? -170.756 41.882  35.419  1.00 130.06 ?  74   VAL C CA    1 
ATOM   4330  C  C     . VAL D  3  74   ? -169.239 41.931  35.530  1.00 135.58 ?  74   VAL C C     1 
ATOM   4331  O  O     . VAL D  3  74   ? -168.551 40.995  35.105  1.00 135.20 ?  74   VAL C O     1 
ATOM   4332  C  CB    . VAL D  3  74   ? -171.339 40.846  36.397  1.00 122.57 ?  74   VAL C CB    1 
ATOM   4333  C  CG1   . VAL D  3  74   ? -171.139 41.305  37.834  1.00 113.85 ?  74   VAL C CG1   1 
ATOM   4334  C  CG2   . VAL D  3  74   ? -172.811 40.605  36.101  1.00 125.99 ?  74   VAL C CG2   1 
ATOM   4335  N  N     . GLY D  3  75   ? -168.723 43.018  36.097  1.00 131.01 ?  75   GLY C N     1 
ATOM   4336  C  CA    . GLY D  3  75   ? -167.299 43.116  36.329  1.00 117.69 ?  75   GLY C CA    1 
ATOM   4337  C  C     . GLY D  3  75   ? -166.827 42.149  37.397  1.00 119.51 ?  75   GLY C C     1 
ATOM   4338  O  O     . GLY D  3  75   ? -167.592 41.678  38.239  1.00 131.91 ?  75   GLY C O     1 
ATOM   4339  N  N     . GLY D  3  76   ? -165.528 41.845  37.349  1.00 116.91 ?  76   GLY C N     1 
ATOM   4340  C  CA    . GLY D  3  76   ? -164.959 40.917  38.315  1.00 115.26 ?  76   GLY C CA    1 
ATOM   4341  C  C     . GLY D  3  76   ? -165.298 41.281  39.746  1.00 121.19 ?  76   GLY C C     1 
ATOM   4342  O  O     . GLY D  3  76   ? -165.780 40.448  40.518  1.00 119.35 ?  76   GLY C O     1 
ATOM   4343  N  N     . LEU D  3  77   ? -165.047 42.537  40.123  1.00 125.07 ?  77   LEU C N     1 
ATOM   4344  C  CA    . LEU D  3  77   ? -165.425 42.995  41.456  1.00 120.29 ?  77   LEU C CA    1 
ATOM   4345  C  C     . LEU D  3  77   ? -166.939 43.097  41.593  1.00 133.98 ?  77   LEU C C     1 
ATOM   4346  O  O     . LEU D  3  77   ? -167.496 42.764  42.645  1.00 134.16 ?  77   LEU C O     1 
ATOM   4347  C  CB    . LEU D  3  77   ? -164.763 44.339  41.767  1.00 109.99 ?  77   LEU C CB    1 
ATOM   4348  C  CG    . LEU D  3  77   ? -164.129 45.158  40.637  1.00 120.74 ?  77   LEU C CG    1 
ATOM   4349  C  CD1   . LEU D  3  77   ? -162.852 44.495  40.130  1.00 114.28 ?  77   LEU C CD1   1 
ATOM   4350  C  CD2   . LEU D  3  77   ? -165.113 45.405  39.496  1.00 119.09 ?  77   LEU C CD2   1 
ATOM   4351  N  N     . GLU D  3  78   ? -167.621 43.557  40.541  1.00 134.28 ?  78   GLU C N     1 
ATOM   4352  C  CA    . GLU D  3  78   ? -169.079 43.591  40.571  1.00 134.53 ?  78   GLU C CA    1 
ATOM   4353  C  C     . GLU D  3  78   ? -169.654 42.196  40.777  1.00 129.49 ?  78   GLU C C     1 
ATOM   4354  O  O     . GLU D  3  78   ? -170.619 42.017  41.530  1.00 124.45 ?  78   GLU C O     1 
ATOM   4355  C  CB    . GLU D  3  78   ? -169.617 44.211  39.281  1.00 118.21 ?  78   GLU C CB    1 
ATOM   4356  N  N     . GLU D  3  79   ? -169.069 41.191  40.121  1.00 127.11 ?  79   GLU C N     1 
ATOM   4357  C  CA    . GLU D  3  79   ? -169.532 39.820  40.302  1.00 114.03 ?  79   GLU C CA    1 
ATOM   4358  C  C     . GLU D  3  79   ? -169.198 39.294  41.692  1.00 120.36 ?  79   GLU C C     1 
ATOM   4359  O  O     . GLU D  3  79   ? -169.939 38.465  42.233  1.00 137.10 ?  79   GLU C O     1 
ATOM   4360  C  CB    . GLU D  3  79   ? -168.929 38.914  39.229  1.00 108.09 ?  79   GLU C CB    1 
ATOM   4361  N  N     . VAL D  3  80   ? -168.095 39.757  42.284  1.00 109.86 ?  80   VAL C N     1 
ATOM   4362  C  CA    . VAL D  3  80   ? -167.736 39.309  43.626  1.00 123.16 ?  80   VAL C CA    1 
ATOM   4363  C  C     . VAL D  3  80   ? -168.744 39.818  44.648  1.00 140.34 ?  80   VAL C C     1 
ATOM   4364  O  O     . VAL D  3  80   ? -169.147 39.085  45.560  1.00 147.51 ?  80   VAL C O     1 
ATOM   4365  C  CB    . VAL D  3  80   ? -166.303 39.751  43.974  1.00 121.36 ?  80   VAL C CB    1 
ATOM   4366  C  CG1   . VAL D  3  80   ? -165.989 39.422  45.424  1.00 116.87 ?  80   VAL C CG1   1 
ATOM   4367  C  CG2   . VAL D  3  80   ? -165.301 39.080  43.047  1.00 129.03 ?  80   VAL C CG2   1 
ATOM   4368  N  N     . LEU D  3  81   ? -169.166 41.078  44.519  1.00 144.65 ?  81   LEU C N     1 
ATOM   4369  C  CA    . LEU D  3  81   ? -170.160 41.615  45.442  1.00 145.42 ?  81   LEU C CA    1 
ATOM   4370  C  C     . LEU D  3  81   ? -171.530 40.995  45.201  1.00 136.55 ?  81   LEU C C     1 
ATOM   4371  O  O     . LEU D  3  81   ? -172.293 40.776  46.150  1.00 133.71 ?  81   LEU C O     1 
ATOM   4372  C  CB    . LEU D  3  81   ? -170.232 43.138  45.318  1.00 137.42 ?  81   LEU C CB    1 
ATOM   4373  C  CG    . LEU D  3  81   ? -169.048 43.951  45.851  1.00 121.64 ?  81   LEU C CG    1 
ATOM   4374  C  CD1   . LEU D  3  81   ? -168.057 43.062  46.594  1.00 103.40 ?  81   LEU C CD1   1 
ATOM   4375  C  CD2   . LEU D  3  81   ? -168.361 44.716  44.727  1.00 119.13 ?  81   LEU C CD2   1 
ATOM   4376  N  N     . ALA D  3  82   ? -171.861 40.706  43.941  1.00 136.80 ?  82   ALA C N     1 
ATOM   4377  C  CA    . ALA D  3  82   ? -173.156 40.107  43.633  1.00 137.59 ?  82   ALA C CA    1 
ATOM   4378  C  C     . ALA D  3  82   ? -173.361 38.817  44.417  1.00 138.15 ?  82   ALA C C     1 
ATOM   4379  O  O     . ALA D  3  82   ? -174.429 38.590  44.997  1.00 148.31 ?  82   ALA C O     1 
ATOM   4380  C  CB    . ALA D  3  82   ? -173.275 39.854  42.130  1.00 123.12 ?  82   ALA C CB    1 
ATOM   4381  N  N     . GLU D  3  83   ? -172.340 37.958  44.449  1.00 129.11 ?  83   GLU C N     1 
ATOM   4382  C  CA    . GLU D  3  83   ? -172.448 36.716  45.205  1.00 146.46 ?  83   GLU C CA    1 
ATOM   4383  C  C     . GLU D  3  83   ? -172.345 36.959  46.705  1.00 147.62 ?  83   GLU C C     1 
ATOM   4384  O  O     . GLU D  3  83   ? -172.909 36.193  47.495  1.00 157.40 ?  83   GLU C O     1 
ATOM   4385  C  CB    . GLU D  3  83   ? -171.371 35.730  44.754  1.00 154.21 ?  83   GLU C CB    1 
ATOM   4386  C  CG    . GLU D  3  83   ? -169.965 36.307  44.771  1.00 146.28 ?  83   GLU C CG    1 
ATOM   4387  C  CD    . GLU D  3  83   ? -168.894 35.237  44.833  1.00 141.67 ?  83   GLU C CD    1 
ATOM   4388  O  OE1   . GLU D  3  83   ? -168.608 34.744  45.945  1.00 139.20 ?  83   GLU C OE1   1 
ATOM   4389  O  OE2   . GLU D  3  83   ? -168.346 34.881  43.769  1.00 136.03 ?  83   GLU C OE2   1 
ATOM   4390  N  N     . LEU D  3  84   ? -171.639 38.017  47.116  1.00 135.68 ?  84   LEU C N     1 
ATOM   4391  C  CA    . LEU D  3  84   ? -171.462 38.286  48.540  1.00 144.11 ?  84   LEU C CA    1 
ATOM   4392  C  C     . LEU D  3  84   ? -172.650 39.034  49.135  1.00 138.11 ?  84   LEU C C     1 
ATOM   4393  O  O     . LEU D  3  84   ? -172.931 38.889  50.330  1.00 127.77 ?  84   LEU C O     1 
ATOM   4394  C  CB    . LEU D  3  84   ? -170.170 39.075  48.767  1.00 139.77 ?  84   LEU C CB    1 
ATOM   4395  C  CG    . LEU D  3  84   ? -169.426 38.810  50.080  1.00 127.91 ?  84   LEU C CG    1 
ATOM   4396  C  CD1   . LEU D  3  84   ? -170.233 39.270  51.287  1.00 117.92 ?  84   LEU C CD1   1 
ATOM   4397  C  CD2   . LEU D  3  84   ? -169.080 37.333  50.195  1.00 131.76 ?  84   LEU C CD2   1 
ATOM   4398  N  N     . SER D  3  85   ? -173.347 39.838  48.337  1.00 135.47 ?  85   SER C N     1 
ATOM   4399  C  CA    . SER D  3  85   ? -174.528 40.554  48.816  1.00 138.40 ?  85   SER C CA    1 
ATOM   4400  C  C     . SER D  3  85   ? -175.797 39.745  48.562  1.00 137.25 ?  85   SER C C     1 
ATOM   4401  O  O     . SER D  3  85   ? -175.976 39.194  47.476  1.00 140.01 ?  85   SER C O     1 
ATOM   4402  C  CB    . SER D  3  85   ? -174.642 41.927  48.147  1.00 144.52 ?  85   SER C CB    1 
ATOM   4403  O  OG    . SER D  3  85   ? -174.811 41.797  46.746  1.00 141.59 ?  85   SER C OG    1 
ATOM   4404  N  N     . PRO D  3  86   ? -176.691 39.677  49.563  1.00 129.56 ?  86   PRO C N     1 
ATOM   4405  C  CA    . PRO D  3  86   ? -176.543 40.319  50.876  1.00 126.47 ?  86   PRO C CA    1 
ATOM   4406  C  C     . PRO D  3  86   ? -175.449 39.684  51.730  1.00 126.74 ?  86   PRO C C     1 
ATOM   4407  O  O     . PRO D  3  86   ? -175.130 38.510  51.545  1.00 132.94 ?  86   PRO C O     1 
ATOM   4408  C  CB    . PRO D  3  86   ? -177.917 40.113  51.528  1.00 124.76 ?  86   PRO C CB    1 
ATOM   4409  C  CG    . PRO D  3  86   ? -178.843 39.770  50.403  1.00 129.02 ?  86   PRO C CG    1 
ATOM   4410  C  CD    . PRO D  3  86   ? -178.004 39.026  49.421  1.00 116.18 ?  86   PRO C CD    1 
ATOM   4411  N  N     . ILE D  3  87   ? -174.890 40.460  52.655  1.00 124.71 ?  87   ILE C N     1 
ATOM   4412  C  CA    . ILE D  3  87   ? -173.827 39.980  53.532  1.00 114.53 ?  87   ILE C CA    1 
ATOM   4413  C  C     . ILE D  3  87   ? -174.231 38.692  54.241  1.00 119.39 ?  87   ILE C C     1 
ATOM   4414  O  O     . ILE D  3  87   ? -175.009 38.716  55.194  1.00 123.57 ?  87   ILE C O     1 
ATOM   4415  C  CB    . ILE D  3  87   ? -173.458 41.049  54.549  1.00 82.61  ?  87   ILE C CB    1 
ATOM   4416  N  N     . PHE D  3  98   ? -173.099 45.716  50.546  1.00 128.68 ?  98   PHE C N     1 
ATOM   4417  C  CA    . PHE D  3  98   ? -171.934 45.931  49.695  1.00 99.57  ?  98   PHE C CA    1 
ATOM   4418  C  C     . PHE D  3  98   ? -172.322 45.972  48.222  1.00 102.58 ?  98   PHE C C     1 
ATOM   4419  O  O     . PHE D  3  98   ? -172.751 44.968  47.655  1.00 110.37 ?  98   PHE C O     1 
ATOM   4420  C  CB    . PHE D  3  98   ? -170.892 44.837  49.930  1.00 88.25  ?  98   PHE C CB    1 
ATOM   4421  C  CG    . PHE D  3  98   ? -170.217 44.920  51.268  1.00 104.03 ?  98   PHE C CG    1 
ATOM   4422  C  CD1   . PHE D  3  98   ? -170.161 46.120  51.958  1.00 110.33 ?  98   PHE C CD1   1 
ATOM   4423  C  CD2   . PHE D  3  98   ? -169.636 43.798  51.836  1.00 102.49 ?  98   PHE C CD2   1 
ATOM   4424  C  CE1   . PHE D  3  98   ? -169.538 46.198  53.190  1.00 118.34 ?  98   PHE C CE1   1 
ATOM   4425  C  CE2   . PHE D  3  98   ? -169.012 43.870  53.066  1.00 107.69 ?  98   PHE C CE2   1 
ATOM   4426  C  CZ    . PHE D  3  98   ? -168.963 45.072  53.744  1.00 120.80 ?  98   PHE C CZ    1 
ATOM   4427  N  N     . SER D  3  99   ? -172.170 47.140  47.607  1.00 97.46  ?  99   SER C N     1 
ATOM   4428  C  CA    . SER D  3  99   ? -172.476 47.305  46.192  1.00 117.34 ?  99   SER C CA    1 
ATOM   4429  C  C     . SER D  3  99   ? -171.966 48.669  45.746  1.00 133.56 ?  99   SER C C     1 
ATOM   4430  O  O     . SER D  3  99   ? -171.599 49.517  46.564  1.00 132.46 ?  99   SER C O     1 
ATOM   4431  C  CB    . SER D  3  99   ? -173.977 47.161  45.919  1.00 114.87 ?  99   SER C CB    1 
ATOM   4432  O  OG    . SER D  3  99   ? -174.246 47.174  44.528  1.00 104.28 ?  99   SER C OG    1 
ATOM   4433  N  N     . ASP D  3  100  ? -171.947 48.865  44.427  1.00 130.92 ?  100  ASP C N     1 
ATOM   4434  C  CA    . ASP D  3  100  ? -171.494 50.100  43.798  1.00 131.03 ?  100  ASP C CA    1 
ATOM   4435  C  C     . ASP D  3  100  ? -170.126 50.509  44.331  1.00 131.82 ?  100  ASP C C     1 
ATOM   4436  O  O     . ASP D  3  100  ? -170.017 51.484  45.087  1.00 117.92 ?  100  ASP C O     1 
ATOM   4437  C  CB    . ASP D  3  100  ? -172.505 51.226  44.020  1.00 132.93 ?  100  ASP C CB    1 
ATOM   4438  C  CG    . ASP D  3  100  ? -172.286 52.398  43.080  1.00 132.51 ?  100  ASP C CG    1 
ATOM   4439  O  OD1   . ASP D  3  100  ? -173.055 52.531  42.104  1.00 128.86 ?  100  ASP C OD1   1 
ATOM   4440  O  OD2   . ASP D  3  100  ? -171.339 53.180  43.310  1.00 124.43 ?  100  ASP C OD2   1 
ATOM   4441  N  N     . PRO D  3  101  ? -169.064 49.791  43.969  1.00 140.26 ?  101  PRO C N     1 
ATOM   4442  C  CA    . PRO D  3  101  ? -167.718 50.203  44.382  1.00 135.31 ?  101  PRO C CA    1 
ATOM   4443  C  C     . PRO D  3  101  ? -167.183 51.317  43.495  1.00 129.91 ?  101  PRO C C     1 
ATOM   4444  O  O     . PRO D  3  101  ? -167.421 51.347  42.284  1.00 127.69 ?  101  PRO C O     1 
ATOM   4445  C  CB    . PRO D  3  101  ? -166.896 48.920  44.221  1.00 125.81 ?  101  PRO C CB    1 
ATOM   4446  C  CG    . PRO D  3  101  ? -167.586 48.187  43.119  1.00 120.28 ?  101  PRO C CG    1 
ATOM   4447  C  CD    . PRO D  3  101  ? -169.056 48.500  43.258  1.00 134.66 ?  101  PRO C CD    1 
ATOM   4448  N  N     . ARG D  3  102  ? -166.449 52.237  44.112  1.00 123.27 ?  102  ARG C N     1 
ATOM   4449  C  CA    . ARG D  3  102  ? -165.893 53.391  43.424  1.00 113.66 ?  102  ARG C CA    1 
ATOM   4450  C  C     . ARG D  3  102  ? -164.397 53.210  43.199  1.00 116.08 ?  102  ARG C C     1 
ATOM   4451  O  O     . ARG D  3  102  ? -163.732 52.423  43.878  1.00 106.63 ?  102  ARG C O     1 
ATOM   4452  C  CB    . ARG D  3  102  ? -166.153 54.678  44.215  1.00 103.85 ?  102  ARG C CB    1 
ATOM   4453  N  N     . PHE D  3  103  ? -163.876 53.955  42.226  1.00 125.23 ?  103  PHE C N     1 
ATOM   4454  C  CA    . PHE D  3  103  ? -162.453 53.942  41.894  1.00 116.25 ?  103  PHE C CA    1 
ATOM   4455  C  C     . PHE D  3  103  ? -162.044 55.350  41.488  1.00 121.38 ?  103  PHE C C     1 
ATOM   4456  O  O     . PHE D  3  103  ? -162.374 55.800  40.386  1.00 110.41 ?  103  PHE C O     1 
ATOM   4457  C  CB    . PHE D  3  103  ? -162.147 52.946  40.775  1.00 116.97 ?  103  PHE C CB    1 
ATOM   4458  C  CG    . PHE D  3  103  ? -161.732 51.590  41.267  1.00 121.32 ?  103  PHE C CG    1 
ATOM   4459  C  CD1   . PHE D  3  103  ? -160.430 51.359  41.672  1.00 117.14 ?  103  PHE C CD1   1 
ATOM   4460  C  CD2   . PHE D  3  103  ? -162.641 50.547  41.320  1.00 137.35 ?  103  PHE C CD2   1 
ATOM   4461  C  CE1   . PHE D  3  103  ? -160.042 50.114  42.125  1.00 114.86 ?  103  PHE C CE1   1 
ATOM   4462  C  CE2   . PHE D  3  103  ? -162.258 49.299  41.772  1.00 130.02 ?  103  PHE C CE2   1 
ATOM   4463  C  CZ    . PHE D  3  103  ? -160.956 49.083  42.174  1.00 127.33 ?  103  PHE C CZ    1 
ATOM   4464  N  N     . ASP D  3  104  ? -161.327 56.041  42.370  1.00 122.71 ?  104  ASP C N     1 
ATOM   4465  C  CA    . ASP D  3  104  ? -160.846 57.375  42.053  1.00 133.40 ?  104  ASP C CA    1 
ATOM   4466  C  C     . ASP D  3  104  ? -159.700 57.303  41.047  1.00 138.28 ?  104  ASP C C     1 
ATOM   4467  O  O     . ASP D  3  104  ? -159.136 56.239  40.773  1.00 139.99 ?  104  ASP C O     1 
ATOM   4468  C  CB    . ASP D  3  104  ? -160.394 58.101  43.319  1.00 134.83 ?  104  ASP C CB    1 
ATOM   4469  C  CG    . ASP D  3  104  ? -161.555 58.509  44.203  1.00 137.80 ?  104  ASP C CG    1 
ATOM   4470  O  OD1   . ASP D  3  104  ? -162.666 58.712  43.671  1.00 123.16 ?  104  ASP C OD1   1 
ATOM   4471  O  OD2   . ASP D  3  104  ? -161.355 58.629  45.430  1.00 148.94 ?  104  ASP C OD2   1 
ATOM   4472  N  N     . GLU D  3  105  ? -159.358 58.462  40.490  1.00 134.32 ?  105  GLU C N     1 
ATOM   4473  C  CA    . GLU D  3  105  ? -158.251 58.538  39.549  1.00 116.51 ?  105  GLU C CA    1 
ATOM   4474  C  C     . GLU D  3  105  ? -156.944 58.169  40.241  1.00 113.82 ?  105  GLU C C     1 
ATOM   4475  O  O     . GLU D  3  105  ? -156.785 58.344  41.452  1.00 120.87 ?  105  GLU C O     1 
ATOM   4476  C  CB    . GLU D  3  105  ? -158.165 59.941  38.948  1.00 131.43 ?  105  GLU C CB    1 
ATOM   4477  C  CG    . GLU D  3  105  ? -159.395 60.335  38.145  1.00 135.52 ?  105  GLU C CG    1 
ATOM   4478  C  CD    . GLU D  3  105  ? -159.468 61.826  37.879  1.00 141.32 ?  105  GLU C CD    1 
ATOM   4479  O  OE1   . GLU D  3  105  ? -158.746 62.588  38.558  1.00 139.59 ?  105  GLU C OE1   1 
ATOM   4480  O  OE2   . GLU D  3  105  ? -160.247 62.236  36.992  1.00 139.89 ?  105  GLU C OE2   1 
ATOM   4481  N  N     . VAL D  3  106  ? -156.002 57.646  39.452  1.00 100.91 ?  106  VAL C N     1 
ATOM   4482  C  CA    . VAL D  3  106  ? -154.768 57.125  40.021  1.00 103.19 ?  106  VAL C CA    1 
ATOM   4483  C  C     . VAL D  3  106  ? -154.087 58.194  40.870  1.00 97.12  ?  106  VAL C C     1 
ATOM   4484  O  O     . VAL D  3  106  ? -154.150 59.394  40.575  1.00 90.88  ?  106  VAL C O     1 
ATOM   4485  C  CB    . VAL D  3  106  ? -153.827 56.620  38.914  1.00 108.54 ?  106  VAL C CB    1 
ATOM   4486  C  CG1   . VAL D  3  106  ? -152.629 55.903  39.521  1.00 102.91 ?  106  VAL C CG1   1 
ATOM   4487  C  CG2   . VAL D  3  106  ? -154.579 55.708  37.955  1.00 104.31 ?  106  VAL C CG2   1 
ATOM   4488  N  N     . LYS D  3  107  ? -153.431 57.748  41.944  1.00 103.38 ?  107  LYS C N     1 
ATOM   4489  C  CA    . LYS D  3  107  ? -152.734 58.674  42.832  1.00 106.17 ?  107  LYS C CA    1 
ATOM   4490  C  C     . LYS D  3  107  ? -151.619 59.408  42.095  1.00 105.61 ?  107  LYS C C     1 
ATOM   4491  O  O     . LYS D  3  107  ? -151.636 60.638  41.978  1.00 108.63 ?  107  LYS C O     1 
ATOM   4492  C  CB    . LYS D  3  107  ? -152.176 57.919  44.040  1.00 113.62 ?  107  LYS C CB    1 
ATOM   4493  C  CG    . LYS D  3  107  ? -153.230 57.406  45.006  1.00 103.98 ?  107  LYS C CG    1 
ATOM   4494  C  CD    . LYS D  3  107  ? -152.584 56.680  46.177  1.00 99.74  ?  107  LYS C CD    1 
ATOM   4495  C  CE    . LYS D  3  107  ? -153.607 56.325  47.242  1.00 121.48 ?  107  LYS C CE    1 
ATOM   4496  N  NZ    . LYS D  3  107  ? -154.226 57.540  47.841  1.00 126.70 ?  107  LYS C NZ    1 
ATOM   4497  N  N     . ALA D  3  108  ? -150.634 58.665  41.596  1.00 109.24 ?  108  ALA C N     1 
ATOM   4498  C  CA    . ALA D  3  108  ? -149.492 59.242  40.905  1.00 100.95 ?  108  ALA C CA    1 
ATOM   4499  C  C     . ALA D  3  108  ? -149.285 58.533  39.575  1.00 99.41  ?  108  ALA C C     1 
ATOM   4500  O  O     . ALA D  3  108  ? -149.814 57.445  39.336  1.00 101.05 ?  108  ALA C O     1 
ATOM   4501  C  CB    . ALA D  3  108  ? -148.216 59.156  41.754  1.00 103.19 ?  108  ALA C CB    1 
ATOM   4502  N  N     . SER D  3  109  ? -148.499 59.166  38.709  1.00 100.28 ?  109  SER C N     1 
ATOM   4503  C  CA    . SER D  3  109  ? -148.227 58.622  37.390  1.00 93.64  ?  109  SER C CA    1 
ATOM   4504  C  C     . SER D  3  109  ? -147.229 57.470  37.472  1.00 93.46  ?  109  SER C C     1 
ATOM   4505  O  O     . SER D  3  109  ? -146.487 57.321  38.447  1.00 91.31  ?  109  SER C O     1 
ATOM   4506  C  CB    . SER D  3  109  ? -147.695 59.712  36.458  1.00 109.74 ?  109  SER C CB    1 
ATOM   4507  O  OG    . SER D  3  109  ? -147.391 59.185  35.177  1.00 122.39 ?  109  SER C OG    1 
ATOM   4508  N  N     . VAL D  3  110  ? -147.219 56.649  36.418  1.00 88.76  ?  110  VAL C N     1 
ATOM   4509  C  CA    . VAL D  3  110  ? -146.315 55.500  36.369  1.00 80.25  ?  110  VAL C CA    1 
ATOM   4510  C  C     . VAL D  3  110  ? -144.877 55.942  36.607  1.00 83.64  ?  110  VAL C C     1 
ATOM   4511  O  O     . VAL D  3  110  ? -144.177 55.404  37.474  1.00 79.93  ?  110  VAL C O     1 
ATOM   4512  C  CB    . VAL D  3  110  ? -146.459 54.758  35.028  1.00 63.01  ?  110  VAL C CB    1 
ATOM   4513  C  CG1   . VAL D  3  110  ? -147.681 53.864  35.050  1.00 87.44  ?  110  VAL C CG1   1 
ATOM   4514  C  CG2   . VAL D  3  110  ? -146.552 55.753  33.883  1.00 96.05  ?  110  VAL C CG2   1 
ATOM   4515  N  N     . ASP D  3  111  ? -144.412 56.925  35.832  1.00 93.11  ?  111  ASP C N     1 
ATOM   4516  C  CA    . ASP D  3  111  ? -143.066 57.447  36.045  1.00 95.06  ?  111  ASP C CA    1 
ATOM   4517  C  C     . ASP D  3  111  ? -142.897 57.960  37.468  1.00 96.94  ?  111  ASP C C     1 
ATOM   4518  O  O     . ASP D  3  111  ? -141.852 57.745  38.094  1.00 92.56  ?  111  ASP C O     1 
ATOM   4519  C  CB    . ASP D  3  111  ? -142.760 58.554  35.034  1.00 93.37  ?  111  ASP C CB    1 
ATOM   4520  C  CG    . ASP D  3  111  ? -142.289 58.011  33.700  1.00 121.91 ?  111  ASP C CG    1 
ATOM   4521  O  OD1   . ASP D  3  111  ? -141.848 56.843  33.657  1.00 119.66 ?  111  ASP C OD1   1 
ATOM   4522  O  OD2   . ASP D  3  111  ? -142.350 58.754  32.696  1.00 130.65 ?  111  ASP C OD2   1 
ATOM   4523  N  N     . GLU D  3  112  ? -143.918 58.634  38.001  1.00 95.93  ?  112  GLU C N     1 
ATOM   4524  C  CA    . GLU D  3  112  ? -143.820 59.144  39.362  1.00 94.99  ?  112  GLU C CA    1 
ATOM   4525  C  C     . GLU D  3  112  ? -143.805 58.016  40.383  1.00 87.91  ?  112  GLU C C     1 
ATOM   4526  O  O     . GLU D  3  112  ? -143.205 58.160  41.454  1.00 91.21  ?  112  GLU C O     1 
ATOM   4527  C  CB    . GLU D  3  112  ? -144.971 60.107  39.650  1.00 98.20  ?  112  GLU C CB    1 
ATOM   4528  C  CG    . GLU D  3  112  ? -144.887 60.764  41.018  1.00 113.68 ?  112  GLU C CG    1 
ATOM   4529  C  CD    . GLU D  3  112  ? -145.948 61.828  41.224  1.00 120.75 ?  112  GLU C CD    1 
ATOM   4530  O  OE1   . GLU D  3  112  ? -146.762 62.042  40.301  1.00 119.70 ?  112  GLU C OE1   1 
ATOM   4531  O  OE2   . GLU D  3  112  ? -145.965 62.450  42.307  1.00 113.26 ?  112  GLU C OE2   1 
ATOM   4532  N  N     . CYS D  3  113  ? -144.451 56.890  40.073  1.00 91.08  ?  113  CYS C N     1 
ATOM   4533  C  CA    . CYS D  3  113  ? -144.430 55.755  40.990  1.00 96.36  ?  113  CYS C CA    1 
ATOM   4534  C  C     . CYS D  3  113  ? -143.076 55.056  40.962  1.00 101.62 ?  113  CYS C C     1 
ATOM   4535  O  O     . CYS D  3  113  ? -142.499 54.758  42.014  1.00 104.78 ?  113  CYS C O     1 
ATOM   4536  C  CB    . CYS D  3  113  ? -145.552 54.775  40.647  1.00 87.21  ?  113  CYS C CB    1 
ATOM   4537  S  SG    . CYS D  3  113  ? -147.220 55.405  40.956  1.00 105.40 ?  113  CYS C SG    1 
ATOM   4538  N  N     . LYS D  3  114  ? -142.552 54.786  39.763  1.00 98.71  ?  114  LYS C N     1 
ATOM   4539  C  CA    . LYS D  3  114  ? -141.244 54.147  39.663  1.00 90.12  ?  114  LYS C CA    1 
ATOM   4540  C  C     . LYS D  3  114  ? -140.155 55.004  40.291  1.00 98.68  ?  114  LYS C C     1 
ATOM   4541  O  O     . LYS D  3  114  ? -139.154 54.470  40.786  1.00 97.35  ?  114  LYS C O     1 
ATOM   4542  C  CB    . LYS D  3  114  ? -140.909 53.850  38.201  1.00 92.44  ?  114  LYS C CB    1 
ATOM   4543  C  CG    . LYS D  3  114  ? -141.204 52.420  37.783  1.00 86.55  ?  114  LYS C CG    1 
ATOM   4544  C  CD    . LYS D  3  114  ? -140.907 52.181  36.307  1.00 83.79  ?  114  LYS C CD    1 
ATOM   4545  C  CE    . LYS D  3  114  ? -141.930 52.861  35.411  1.00 81.84  ?  114  LYS C CE    1 
ATOM   4546  N  NZ    . LYS D  3  114  ? -141.767 52.469  33.983  1.00 95.75  ?  114  LYS C NZ    1 
ATOM   4547  N  N     . ASP D  3  115  ? -140.325 56.328  40.283  1.00 99.64  ?  115  ASP C N     1 
ATOM   4548  C  CA    . ASP D  3  115  ? -139.322 57.200  40.883  1.00 105.72 ?  115  ASP C CA    1 
ATOM   4549  C  C     . ASP D  3  115  ? -139.389 57.146  42.405  1.00 111.42 ?  115  ASP C C     1 
ATOM   4550  O  O     . ASP D  3  115  ? -138.376 56.912  43.073  1.00 98.54  ?  115  ASP C O     1 
ATOM   4551  C  CB    . ASP D  3  115  ? -139.512 58.634  40.386  1.00 112.63 ?  115  ASP C CB    1 
ATOM   4552  C  CG    . ASP D  3  115  ? -138.589 59.619  41.077  1.00 121.44 ?  115  ASP C CG    1 
ATOM   4553  O  OD1   . ASP D  3  115  ? -137.426 59.257  41.353  1.00 132.34 ?  115  ASP C OD1   1 
ATOM   4554  O  OD2   . ASP D  3  115  ? -139.036 60.754  41.352  1.00 96.32  ?  115  ASP C OD2   1 
ATOM   4555  N  N     . LYS D  3  116  ? -140.579 57.355  42.971  1.00 116.66 ?  116  LYS C N     1 
ATOM   4556  C  CA    . LYS D  3  116  ? -140.762 57.391  44.417  1.00 106.70 ?  116  LYS C CA    1 
ATOM   4557  C  C     . LYS D  3  116  ? -140.840 56.006  45.050  1.00 113.48 ?  116  LYS C C     1 
ATOM   4558  O  O     . LYS D  3  116  ? -141.021 55.912  46.268  1.00 112.04 ?  116  LYS C O     1 
ATOM   4559  C  CB    . LYS D  3  116  ? -142.021 58.190  44.763  1.00 92.53  ?  116  LYS C CB    1 
ATOM   4560  N  N     . ASP D  3  117  ? -140.708 54.937  44.263  1.00 117.83 ?  117  ASP C N     1 
ATOM   4561  C  CA    . ASP D  3  117  ? -140.733 53.568  44.782  1.00 100.87 ?  117  ASP C CA    1 
ATOM   4562  C  C     . ASP D  3  117  ? -142.075 53.220  45.418  1.00 108.62 ?  117  ASP C C     1 
ATOM   4563  O  O     . ASP D  3  117  ? -142.138 52.434  46.367  1.00 109.19 ?  117  ASP C O     1 
ATOM   4564  C  CB    . ASP D  3  117  ? -139.596 53.330  45.780  1.00 86.82  ?  117  ASP C CB    1 
ATOM   4565  C  CG    . ASP D  3  117  ? -138.255 53.142  45.101  1.00 117.95 ?  117  ASP C CG    1 
ATOM   4566  O  OD1   . ASP D  3  117  ? -138.109 53.581  43.941  1.00 125.54 ?  117  ASP C OD1   1 
ATOM   4567  O  OD2   . ASP D  3  117  ? -137.347 52.554  45.726  1.00 136.74 ?  117  ASP C OD2   1 
ATOM   4568  N  N     . MET D  3  118  ? -143.157 53.795  44.905  1.00 111.49 ?  118  MET C N     1 
ATOM   4569  C  CA    . MET D  3  118  ? -144.501 53.494  45.371  1.00 108.17 ?  118  MET C CA    1 
ATOM   4570  C  C     . MET D  3  118  ? -145.234 52.647  44.338  1.00 109.18 ?  118  MET C C     1 
ATOM   4571  O  O     . MET D  3  118  ? -144.746 52.409  43.230  1.00 115.85 ?  118  MET C O     1 
ATOM   4572  C  CB    . MET D  3  118  ? -145.278 54.781  45.667  1.00 106.47 ?  118  MET C CB    1 
ATOM   4573  C  CG    . MET D  3  118  ? -145.255 55.798  44.545  1.00 110.33 ?  118  MET C CG    1 
ATOM   4574  S  SD    . MET D  3  118  ? -146.084 57.324  45.023  1.00 114.70 ?  118  MET C SD    1 
ATOM   4575  C  CE    . MET D  3  118  ? -145.209 57.718  46.535  1.00 94.72  ?  118  MET C CE    1 
ATOM   4576  N  N     . THR D  3  119  ? -146.424 52.191  44.718  1.00 102.04 ?  119  THR C N     1 
ATOM   4577  C  CA    . THR D  3  119  ? -147.209 51.272  43.905  1.00 100.23 ?  119  THR C CA    1 
ATOM   4578  C  C     . THR D  3  119  ? -148.275 52.032  43.127  1.00 90.47  ?  119  THR C C     1 
ATOM   4579  O  O     . THR D  3  119  ? -149.045 52.804  43.708  1.00 96.60  ?  119  THR C O     1 
ATOM   4580  C  CB    . THR D  3  119  ? -147.859 50.194  44.774  1.00 100.88 ?  119  THR C CB    1 
ATOM   4581  O  OG1   . THR D  3  119  ? -148.833 49.480  44.002  1.00 95.97  ?  119  THR C OG1   1 
ATOM   4582  C  CG2   . THR D  3  119  ? -148.531 50.819  45.989  1.00 118.13 ?  119  THR C CG2   1 
ATOM   4583  N  N     . TYR D  3  120  ? -148.312 51.808  41.815  1.00 94.17  ?  120  TYR C N     1 
ATOM   4584  C  CA    . TYR D  3  120  ? -149.315 52.401  40.933  1.00 88.69  ?  120  TYR C CA    1 
ATOM   4585  C  C     . TYR D  3  120  ? -150.676 51.820  41.288  1.00 103.44 ?  120  TYR C C     1 
ATOM   4586  O  O     . TYR D  3  120  ? -150.999 50.689  40.918  1.00 108.62 ?  120  TYR C O     1 
ATOM   4587  C  CB    . TYR D  3  120  ? -148.955 52.126  39.477  1.00 88.69  ?  120  TYR C CB    1 
ATOM   4588  C  CG    . TYR D  3  120  ? -149.828 52.821  38.456  1.00 82.72  ?  120  TYR C CG    1 
ATOM   4589  C  CD1   . TYR D  3  120  ? -149.668 54.172  38.182  1.00 81.73  ?  120  TYR C CD1   1 
ATOM   4590  C  CD2   . TYR D  3  120  ? -150.791 52.119  37.742  1.00 89.35  ?  120  TYR C CD2   1 
ATOM   4591  C  CE1   . TYR D  3  120  ? -150.453 54.809  37.240  1.00 80.27  ?  120  TYR C CE1   1 
ATOM   4592  C  CE2   . TYR D  3  120  ? -151.581 52.748  36.797  1.00 79.37  ?  120  TYR C CE2   1 
ATOM   4593  C  CZ    . TYR D  3  120  ? -151.407 54.093  36.550  1.00 74.62  ?  120  TYR C CZ    1 
ATOM   4594  O  OH    . TYR D  3  120  ? -152.191 54.725  35.612  1.00 78.93  ?  120  TYR C OH    1 
ATOM   4595  N  N     . ALA D  3  121  ? -151.482 52.591  42.015  1.00 109.27 ?  121  ALA C N     1 
ATOM   4596  C  CA    . ALA D  3  121  ? -152.764 52.099  42.494  1.00 106.53 ?  121  ALA C CA    1 
ATOM   4597  C  C     . ALA D  3  121  ? -153.778 53.233  42.505  1.00 107.36 ?  121  ALA C C     1 
ATOM   4598  O  O     . ALA D  3  121  ? -153.424 54.415  42.511  1.00 111.49 ?  121  ALA C O     1 
ATOM   4599  C  CB    . ALA D  3  121  ? -152.640 51.482  43.892  1.00 111.81 ?  121  ALA C CB    1 
ATOM   4600  N  N     . ALA D  3  122  ? -155.053 52.850  42.508  1.00 113.74 ?  122  ALA C N     1 
ATOM   4601  C  CA    . ALA D  3  122  ? -156.163 53.791  42.613  1.00 119.70 ?  122  ALA C CA    1 
ATOM   4602  C  C     . ALA D  3  122  ? -157.064 53.319  43.746  1.00 125.21 ?  122  ALA C C     1 
ATOM   4603  O  O     . ALA D  3  122  ? -157.581 52.183  43.689  1.00 119.23 ?  122  ALA C O     1 
ATOM   4604  C  CB    . ALA D  3  122  ? -156.936 53.892  41.296  1.00 107.41 ?  122  ALA C CB    1 
ATOM   4605  N  N     . PRO D  3  123  ? -157.276 54.124  44.785  1.00 126.98 ?  123  PRO C N     1 
ATOM   4606  C  CA    . PRO D  3  123  ? -158.116 53.676  45.901  1.00 121.30 ?  123  PRO C CA    1 
ATOM   4607  C  C     . PRO D  3  123  ? -159.528 53.352  45.437  1.00 132.37 ?  123  PRO C C     1 
ATOM   4608  O  O     . PRO D  3  123  ? -160.052 53.954  44.496  1.00 131.80 ?  123  PRO C O     1 
ATOM   4609  C  CB    . PRO D  3  123  ? -158.104 54.874  46.859  1.00 117.86 ?  123  PRO C CB    1 
ATOM   4610  C  CG    . PRO D  3  123  ? -156.877 55.645  46.494  1.00 106.12 ?  123  PRO C CG    1 
ATOM   4611  C  CD    . PRO D  3  123  ? -156.720 55.468  45.015  1.00 126.74 ?  123  PRO C CD    1 
ATOM   4612  N  N     . LEU D  3  124  ? -160.144 52.384  46.111  1.00 125.08 ?  124  LEU C N     1 
ATOM   4613  C  CA    . LEU D  3  124  ? -161.514 51.986  45.828  1.00 122.30 ?  124  LEU C CA    1 
ATOM   4614  C  C     . LEU D  3  124  ? -162.376 52.182  47.066  1.00 126.93 ?  124  LEU C C     1 
ATOM   4615  O  O     . LEU D  3  124  ? -161.908 52.042  48.200  1.00 126.22 ?  124  LEU C O     1 
ATOM   4616  C  CB    . LEU D  3  124  ? -161.602 50.524  45.369  1.00 118.92 ?  124  LEU C CB    1 
ATOM   4617  C  CG    . LEU D  3  124  ? -161.760 49.466  46.464  1.00 103.76 ?  124  LEU C CG    1 
ATOM   4618  C  CD1   . LEU D  3  124  ? -162.203 48.143  45.862  1.00 91.42  ?  124  LEU C CD1   1 
ATOM   4619  C  CD2   . LEU D  3  124  ? -160.466 49.292  47.242  1.00 112.52 ?  124  LEU C CD2   1 
ATOM   4620  N  N     . PHE D  3  125  ? -163.643 52.505  46.834  1.00 125.17 ?  125  PHE C N     1 
ATOM   4621  C  CA    . PHE D  3  125  ? -164.620 52.710  47.890  1.00 110.51 ?  125  PHE C CA    1 
ATOM   4622  C  C     . PHE D  3  125  ? -165.774 51.733  47.712  1.00 118.74 ?  125  PHE C C     1 
ATOM   4623  O  O     . PHE D  3  125  ? -165.934 51.103  46.664  1.00 130.32 ?  125  PHE C O     1 
ATOM   4624  C  CB    . PHE D  3  125  ? -165.138 54.153  47.886  1.00 113.10 ?  125  PHE C CB    1 
ATOM   4625  C  CG    . PHE D  3  125  ? -164.064 55.182  48.085  1.00 113.82 ?  125  PHE C CG    1 
ATOM   4626  C  CD1   . PHE D  3  125  ? -163.057 54.982  49.014  1.00 109.25 ?  125  PHE C CD1   1 
ATOM   4627  C  CD2   . PHE D  3  125  ? -164.057 56.347  47.337  1.00 120.87 ?  125  PHE C CD2   1 
ATOM   4628  C  CE1   . PHE D  3  125  ? -162.068 55.930  49.198  1.00 118.60 ?  125  PHE C CE1   1 
ATOM   4629  C  CE2   . PHE D  3  125  ? -163.069 57.296  47.515  1.00 125.23 ?  125  PHE C CE2   1 
ATOM   4630  C  CZ    . PHE D  3  125  ? -162.073 57.087  48.447  1.00 121.20 ?  125  PHE C CZ    1 
ATOM   4631  N  N     . VAL D  3  126  ? -166.583 51.610  48.758  1.00 119.03 ?  126  VAL C N     1 
ATOM   4632  C  CA    . VAL D  3  126  ? -167.750 50.739  48.721  1.00 126.33 ?  126  VAL C CA    1 
ATOM   4633  C  C     . VAL D  3  126  ? -168.908 51.392  49.466  1.00 119.17 ?  126  VAL C C     1 
ATOM   4634  O  O     . VAL D  3  126  ? -168.803 52.533  49.919  1.00 98.38  ?  126  VAL C O     1 
ATOM   4635  C  CB    . VAL D  3  126  ? -167.432 49.352  49.309  1.00 110.76 ?  126  VAL C CB    1 
ATOM   4636  C  CG1   . VAL D  3  126  ? -168.678 48.482  49.307  1.00 108.92 ?  126  VAL C CG1   1 
ATOM   4637  C  CG2   . VAL D  3  126  ? -166.310 48.685  48.527  1.00 93.46  ?  126  VAL C CG2   1 
ATOM   4638  N  N     . SER D  3  140  ? -175.750 53.119  53.616  1.00 114.86 ?  140  SER C N     1 
ATOM   4639  C  CA    . SER D  3  140  ? -175.297 53.271  54.995  1.00 117.14 ?  140  SER C CA    1 
ATOM   4640  C  C     . SER D  3  140  ? -173.864 53.796  55.054  1.00 127.71 ?  140  SER C C     1 
ATOM   4641  O  O     . SER D  3  140  ? -173.479 54.670  54.278  1.00 114.55 ?  140  SER C O     1 
ATOM   4642  C  CB    . SER D  3  140  ? -175.400 51.939  55.743  1.00 113.36 ?  140  SER C CB    1 
ATOM   4643  O  OG    . SER D  3  140  ? -174.620 50.935  55.117  1.00 114.75 ?  140  SER C OG    1 
ATOM   4644  N  N     . GLN D  3  141  ? -173.081 53.247  55.978  1.00 140.83 ?  141  GLN C N     1 
ATOM   4645  C  CA    . GLN D  3  141  ? -171.705 53.690  56.162  1.00 136.13 ?  141  GLN C CA    1 
ATOM   4646  C  C     . GLN D  3  141  ? -170.864 53.366  54.932  1.00 141.53 ?  141  GLN C C     1 
ATOM   4647  O  O     . GLN D  3  141  ? -170.839 52.222  54.465  1.00 143.51 ?  141  GLN C O     1 
ATOM   4648  C  CB    . GLN D  3  141  ? -171.105 53.025  57.401  1.00 140.78 ?  141  GLN C CB    1 
ATOM   4649  C  CG    . GLN D  3  141  ? -169.641 53.349  57.643  1.00 149.10 ?  141  GLN C CG    1 
ATOM   4650  C  CD    . GLN D  3  141  ? -169.419 54.797  58.029  1.00 151.60 ?  141  GLN C CD    1 
ATOM   4651  O  OE1   . GLN D  3  141  ? -168.824 55.567  57.276  1.00 150.40 ?  141  GLN C OE1   1 
ATOM   4652  N  NE2   . GLN D  3  141  ? -169.894 55.173  59.212  1.00 140.49 ?  141  GLN C NE2   1 
ATOM   4653  N  N     . THR D  3  142  ? -170.176 54.376  54.406  1.00 147.06 ?  142  THR C N     1 
ATOM   4654  C  CA    . THR D  3  142  ? -169.234 54.165  53.317  1.00 142.29 ?  142  THR C CA    1 
ATOM   4655  C  C     . THR D  3  142  ? -167.897 53.680  53.864  1.00 139.05 ?  142  THR C C     1 
ATOM   4656  O  O     . THR D  3  142  ? -167.499 54.018  54.983  1.00 138.66 ?  142  THR C O     1 
ATOM   4657  C  CB    . THR D  3  142  ? -169.030 55.448  52.509  1.00 144.69 ?  142  THR C CB    1 
ATOM   4658  O  OG1   . THR D  3  142  ? -168.966 56.571  53.397  1.00 159.90 ?  142  THR C OG1   1 
ATOM   4659  C  CG2   . THR D  3  142  ? -170.169 55.643  51.514  1.00 140.92 ?  142  THR C CG2   1 
ATOM   4660  N  N     . VAL D  3  143  ? -167.201 52.882  53.059  1.00 132.93 ?  143  VAL C N     1 
ATOM   4661  C  CA    . VAL D  3  143  ? -165.976 52.221  53.492  1.00 134.41 ?  143  VAL C CA    1 
ATOM   4662  C  C     . VAL D  3  143  ? -164.927 52.344  52.397  1.00 125.93 ?  143  VAL C C     1 
ATOM   4663  O  O     . VAL D  3  143  ? -165.218 52.119  51.217  1.00 124.19 ?  143  VAL C O     1 
ATOM   4664  C  CB    . VAL D  3  143  ? -166.219 50.739  53.841  1.00 125.91 ?  143  VAL C CB    1 
ATOM   4665  C  CG1   . VAL D  3  143  ? -164.897 50.014  54.044  1.00 116.03 ?  143  VAL C CG1   1 
ATOM   4666  C  CG2   . VAL D  3  143  ? -167.086 50.628  55.084  1.00 133.33 ?  143  VAL C CG2   1 
ATOM   4667  N  N     . PHE D  3  144  ? -163.709 52.707  52.789  1.00 119.82 ?  144  PHE C N     1 
ATOM   4668  C  CA    . PHE D  3  144  ? -162.560 52.683  51.893  1.00 122.61 ?  144  PHE C CA    1 
ATOM   4669  C  C     . PHE D  3  144  ? -161.845 51.346  52.058  1.00 129.22 ?  144  PHE C C     1 
ATOM   4670  O  O     . PHE D  3  144  ? -161.331 51.044  53.140  1.00 126.60 ?  144  PHE C O     1 
ATOM   4671  C  CB    . PHE D  3  144  ? -161.618 53.849  52.194  1.00 113.20 ?  144  PHE C CB    1 
ATOM   4672  C  CG    . PHE D  3  144  ? -160.215 53.648  51.685  1.00 118.98 ?  144  PHE C CG    1 
ATOM   4673  C  CD1   . PHE D  3  144  ? -159.900 53.871  50.354  1.00 115.16 ?  144  PHE C CD1   1 
ATOM   4674  C  CD2   . PHE D  3  144  ? -159.208 53.248  52.545  1.00 127.00 ?  144  PHE C CD2   1 
ATOM   4675  C  CE1   . PHE D  3  144  ? -158.610 53.691  49.892  1.00 122.77 ?  144  PHE C CE1   1 
ATOM   4676  C  CE2   . PHE D  3  144  ? -157.918 53.066  52.089  1.00 120.28 ?  144  PHE C CE2   1 
ATOM   4677  C  CZ    . PHE D  3  144  ? -157.618 53.290  50.763  1.00 115.68 ?  144  PHE C CZ    1 
ATOM   4678  N  N     . MET D  3  145  ? -161.805 50.553  50.988  1.00 129.04 ?  145  MET C N     1 
ATOM   4679  C  CA    . MET D  3  145  ? -161.241 49.212  51.052  1.00 122.14 ?  145  MET C CA    1 
ATOM   4680  C  C     . MET D  3  145  ? -159.726 49.171  50.894  1.00 129.59 ?  145  MET C C     1 
ATOM   4681  O  O     . MET D  3  145  ? -159.099 48.198  51.335  1.00 133.01 ?  145  MET C O     1 
ATOM   4682  C  CB    . MET D  3  145  ? -161.885 48.325  49.983  1.00 116.14 ?  145  MET C CB    1 
ATOM   4683  C  CG    . MET D  3  145  ? -163.391 48.191  50.140  1.00 112.66 ?  145  MET C CG    1 
ATOM   4684  S  SD    . MET D  3  145  ? -163.823 47.664  51.807  1.00 120.77 ?  145  MET C SD    1 
ATOM   4685  C  CE    . MET D  3  145  ? -163.012 46.068  51.870  1.00 98.22  ?  145  MET C CE    1 
ATOM   4686  N  N     . GLY D  3  146  ? -159.122 50.180  50.275  1.00 124.30 ?  146  GLY C N     1 
ATOM   4687  C  CA    . GLY D  3  146  ? -157.675 50.184  50.103  1.00 124.01 ?  146  GLY C CA    1 
ATOM   4688  C  C     . GLY D  3  146  ? -157.205 50.613  48.727  1.00 127.45 ?  146  GLY C C     1 
ATOM   4689  O  O     . GLY D  3  146  ? -157.988 50.646  47.774  1.00 124.18 ?  146  GLY C O     1 
ATOM   4690  N  N     . ASP D  3  147  ? -155.923 50.946  48.617  1.00 125.50 ?  147  ASP C N     1 
ATOM   4691  C  CA    . ASP D  3  147  ? -155.360 51.327  47.334  1.00 120.85 ?  147  ASP C CA    1 
ATOM   4692  C  C     . ASP D  3  147  ? -155.346 50.112  46.418  1.00 116.22 ?  147  ASP C C     1 
ATOM   4693  O  O     . ASP D  3  147  ? -154.829 49.051  46.783  1.00 117.77 ?  147  ASP C O     1 
ATOM   4694  C  CB    . ASP D  3  147  ? -153.956 51.879  47.526  1.00 126.95 ?  147  ASP C CB    1 
ATOM   4695  C  CG    . ASP D  3  147  ? -153.802 52.638  48.832  1.00 117.27 ?  147  ASP C CG    1 
ATOM   4696  O  OD1   . ASP D  3  147  ? -153.917 53.883  48.827  1.00 108.29 ?  147  ASP C OD1   1 
ATOM   4697  O  OD2   . ASP D  3  147  ? -153.541 51.980  49.859  1.00 119.81 ?  147  ASP C OD2   1 
ATOM   4698  N  N     . PHE D  3  148  ? -155.905 50.272  45.221  1.00 107.81 ?  148  PHE C N     1 
ATOM   4699  C  CA    . PHE D  3  148  ? -156.058 49.163  44.296  1.00 103.51 ?  148  PHE C CA    1 
ATOM   4700  C  C     . PHE D  3  148  ? -155.051 49.284  43.164  1.00 110.84 ?  148  PHE C C     1 
ATOM   4701  O  O     . PHE D  3  148  ? -155.103 50.258  42.398  1.00 114.87 ?  148  PHE C O     1 
ATOM   4702  C  CB    . PHE D  3  148  ? -157.481 49.118  43.743  1.00 106.16 ?  148  PHE C CB    1 
ATOM   4703  C  CG    . PHE D  3  148  ? -157.874 47.773  43.186  1.00 116.60 ?  148  PHE C CG    1 
ATOM   4704  C  CD1   . PHE D  3  148  ? -158.172 46.720  44.035  1.00 108.34 ?  148  PHE C CD1   1 
ATOM   4705  C  CD2   . PHE D  3  148  ? -157.957 47.566  41.817  1.00 113.36 ?  148  PHE C CD2   1 
ATOM   4706  C  CE1   . PHE D  3  148  ? -158.535 45.485  43.532  1.00 108.61 ?  148  PHE C CE1   1 
ATOM   4707  C  CE2   . PHE D  3  148  ? -158.323 46.333  41.308  1.00 105.78 ?  148  PHE C CE2   1 
ATOM   4708  C  CZ    . PHE D  3  148  ? -158.611 45.291  42.167  1.00 109.26 ?  148  PHE C CZ    1 
ATOM   4709  N  N     . PRO D  3  149  ? -154.132 48.330  43.014  1.00 103.67 ?  149  PRO C N     1 
ATOM   4710  C  CA    . PRO D  3  149  ? -153.151 48.415  41.926  1.00 100.76 ?  149  PRO C CA    1 
ATOM   4711  C  C     . PRO D  3  149  ? -153.831 48.500  40.568  1.00 99.85  ?  149  PRO C C     1 
ATOM   4712  O  O     . PRO D  3  149  ? -154.947 48.014  40.374  1.00 95.51  ?  149  PRO C O     1 
ATOM   4713  C  CB    . PRO D  3  149  ? -152.348 47.118  42.070  1.00 91.66  ?  149  PRO C CB    1 
ATOM   4714  C  CG    . PRO D  3  149  ? -152.519 46.727  43.501  1.00 71.72  ?  149  PRO C CG    1 
ATOM   4715  C  CD    . PRO D  3  149  ? -153.906 47.155  43.873  1.00 95.89  ?  149  PRO C CD    1 
ATOM   4716  N  N     . MET D  3  150  ? -153.137 49.125  39.618  1.00 97.58  ?  150  MET C N     1 
ATOM   4717  C  CA    . MET D  3  150  ? -153.666 49.338  38.280  1.00 93.42  ?  150  MET C CA    1 
ATOM   4718  C  C     . MET D  3  150  ? -152.660 48.879  37.237  1.00 95.15  ?  150  MET C C     1 
ATOM   4719  O  O     . MET D  3  150  ? -151.448 48.879  37.471  1.00 95.59  ?  150  MET C O     1 
ATOM   4720  C  CB    . MET D  3  150  ? -154.020 50.810  38.050  1.00 102.22 ?  150  MET C CB    1 
ATOM   4721  C  CG    . MET D  3  150  ? -155.155 51.292  38.926  1.00 114.06 ?  150  MET C CG    1 
ATOM   4722  S  SD    . MET D  3  150  ? -156.613 50.252  38.731  1.00 113.03 ?  150  MET C SD    1 
ATOM   4723  C  CE    . MET D  3  150  ? -157.503 50.639  40.234  1.00 113.22 ?  150  MET C CE    1 
ATOM   4724  N  N     . MET D  3  151  ? -153.180 48.491  36.076  1.00 86.04  ?  151  MET C N     1 
ATOM   4725  C  CA    . MET D  3  151  ? -152.371 47.981  34.978  1.00 87.27  ?  151  MET C CA    1 
ATOM   4726  C  C     . MET D  3  151  ? -152.055 49.104  33.998  1.00 78.88  ?  151  MET C C     1 
ATOM   4727  O  O     . MET D  3  151  ? -152.957 49.822  33.553  1.00 77.64  ?  151  MET C O     1 
ATOM   4728  C  CB    . MET D  3  151  ? -153.092 46.841  34.259  1.00 80.50  ?  151  MET C CB    1 
ATOM   4729  C  CG    . MET D  3  151  ? -152.413 46.398  32.975  1.00 86.16  ?  151  MET C CG    1 
ATOM   4730  S  SD    . MET D  3  151  ? -153.329 45.100  32.126  1.00 87.70  ?  151  MET C SD    1 
ATOM   4731  C  CE    . MET D  3  151  ? -153.286 43.810  33.368  1.00 94.35  ?  151  MET C CE    1 
ATOM   4732  N  N     . THR D  3  152  ? -150.776 49.245  33.661  1.00 73.36  ?  152  THR C N     1 
ATOM   4733  C  CA    . THR D  3  152  ? -150.340 50.262  32.717  1.00 69.81  ?  152  THR C CA    1 
ATOM   4734  C  C     . THR D  3  152  ? -150.848 49.932  31.313  1.00 70.28  ?  152  THR C C     1 
ATOM   4735  O  O     . THR D  3  152  ? -151.475 48.897  31.073  1.00 80.02  ?  152  THR C O     1 
ATOM   4736  C  CB    . THR D  3  152  ? -148.819 50.371  32.728  1.00 66.30  ?  152  THR C CB    1 
ATOM   4737  O  OG1   . THR D  3  152  ? -148.250 49.114  32.340  1.00 80.20  ?  152  THR C OG1   1 
ATOM   4738  C  CG2   . THR D  3  152  ? -148.324 50.728  34.119  1.00 74.25  ?  152  THR C CG2   1 
ATOM   4739  N  N     . GLU D  3  153  ? -150.572 50.834  30.367  1.00 72.34  ?  153  GLU C N     1 
ATOM   4740  C  CA    . GLU D  3  153  ? -150.906 50.551  28.975  1.00 80.95  ?  153  GLU C CA    1 
ATOM   4741  C  C     . GLU D  3  153  ? -150.086 49.389  28.431  1.00 84.06  ?  153  GLU C C     1 
ATOM   4742  O  O     . GLU D  3  153  ? -150.542 48.681  27.525  1.00 89.34  ?  153  GLU C O     1 
ATOM   4743  C  CB    . GLU D  3  153  ? -150.700 51.796  28.109  1.00 92.55  ?  153  GLU C CB    1 
ATOM   4744  C  CG    . GLU D  3  153  ? -149.899 52.906  28.774  1.00 92.93  ?  153  GLU C CG    1 
ATOM   4745  C  CD    . GLU D  3  153  ? -150.771 53.843  29.585  1.00 101.70 ?  153  GLU C CD    1 
ATOM   4746  O  OE1   . GLU D  3  153  ? -151.967 53.976  29.252  1.00 111.37 ?  153  GLU C OE1   1 
ATOM   4747  O  OE2   . GLU D  3  153  ? -150.263 54.443  30.557  1.00 92.14  ?  153  GLU C OE2   1 
ATOM   4748  N  N     . LYS D  3  154  ? -148.884 49.177  28.964  1.00 81.14  ?  154  LYS C N     1 
ATOM   4749  C  CA    . LYS D  3  154  ? -148.040 48.059  28.565  1.00 86.12  ?  154  LYS C CA    1 
ATOM   4750  C  C     . LYS D  3  154  ? -148.464 46.744  29.208  1.00 77.64  ?  154  LYS C C     1 
ATOM   4751  O  O     . LYS D  3  154  ? -147.745 45.747  29.084  1.00 87.23  ?  154  LYS C O     1 
ATOM   4752  C  CB    . LYS D  3  154  ? -146.577 48.353  28.909  1.00 90.61  ?  154  LYS C CB    1 
ATOM   4753  C  CG    . LYS D  3  154  ? -146.100 49.742  28.515  1.00 90.76  ?  154  LYS C CG    1 
ATOM   4754  C  CD    . LYS D  3  154  ? -144.598 49.876  28.728  1.00 114.65 ?  154  LYS C CD    1 
ATOM   4755  C  CE    . LYS D  3  154  ? -144.158 51.332  28.734  1.00 126.03 ?  154  LYS C CE    1 
ATOM   4756  N  NZ    . LYS D  3  154  ? -144.615 52.042  29.963  1.00 111.96 ?  154  LYS C NZ    1 
ATOM   4757  N  N     . GLY D  3  155  ? -149.604 46.720  29.891  1.00 67.55  ?  155  GLY C N     1 
ATOM   4758  C  CA    . GLY D  3  155  ? -150.060 45.506  30.538  1.00 74.70  ?  155  GLY C CA    1 
ATOM   4759  C  C     . GLY D  3  155  ? -149.250 45.102  31.747  1.00 76.72  ?  155  GLY C C     1 
ATOM   4760  O  O     . GLY D  3  155  ? -149.164 43.910  32.056  1.00 89.74  ?  155  GLY C O     1 
ATOM   4761  N  N     . THR D  3  156  ? -148.655 46.063  32.447  1.00 78.60  ?  156  THR C N     1 
ATOM   4762  C  CA    . THR D  3  156  ? -147.816 45.790  33.603  1.00 88.46  ?  156  THR C CA    1 
ATOM   4763  C  C     . THR D  3  156  ? -148.357 46.514  34.829  1.00 88.81  ?  156  THR C C     1 
ATOM   4764  O  O     . THR D  3  156  ? -149.264 47.347  34.744  1.00 82.04  ?  156  THR C O     1 
ATOM   4765  C  CB    . THR D  3  156  ? -146.364 46.213  33.346  1.00 94.85  ?  156  THR C CB    1 
ATOM   4766  O  OG1   . THR D  3  156  ? -146.280 47.643  33.314  1.00 96.75  ?  156  THR C OG1   1 
ATOM   4767  C  CG2   . THR D  3  156  ? -145.877 45.657  32.017  1.00 98.41  ?  156  THR C CG2   1 
ATOM   4768  N  N     . PHE D  3  157  ? -147.778 46.184  35.980  1.00 92.64  ?  157  PHE C N     1 
ATOM   4769  C  CA    . PHE D  3  157  ? -148.118 46.807  37.249  1.00 86.23  ?  157  PHE C CA    1 
ATOM   4770  C  C     . PHE D  3  157  ? -146.868 47.394  37.887  1.00 95.07  ?  157  PHE C C     1 
ATOM   4771  O  O     . PHE D  3  157  ? -145.754 46.903  37.678  1.00 101.19 ?  157  PHE C O     1 
ATOM   4772  C  CB    . PHE D  3  157  ? -148.758 45.803  38.212  1.00 86.15  ?  157  PHE C CB    1 
ATOM   4773  C  CG    . PHE D  3  157  ? -150.085 45.282  37.749  1.00 89.82  ?  157  PHE C CG    1 
ATOM   4774  C  CD1   . PHE D  3  157  ? -150.158 44.204  36.884  1.00 92.50  ?  157  PHE C CD1   1 
ATOM   4775  C  CD2   . PHE D  3  157  ? -151.261 45.869  38.183  1.00 88.11  ?  157  PHE C CD2   1 
ATOM   4776  C  CE1   . PHE D  3  157  ? -151.380 43.723  36.459  1.00 90.50  ?  157  PHE C CE1   1 
ATOM   4777  C  CE2   . PHE D  3  157  ? -152.485 45.393  37.760  1.00 85.32  ?  157  PHE C CE2   1 
ATOM   4778  C  CZ    . PHE D  3  157  ? -152.545 44.319  36.897  1.00 87.11  ?  157  PHE C CZ    1 
ATOM   4779  N  N     . ILE D  3  158  ? -147.061 48.450  38.667  1.00 90.49  ?  158  ILE C N     1 
ATOM   4780  C  CA    . ILE D  3  158  ? -145.992 49.067  39.442  1.00 95.11  ?  158  ILE C CA    1 
ATOM   4781  C  C     . ILE D  3  158  ? -146.285 48.759  40.905  1.00 94.03  ?  158  ILE C C     1 
ATOM   4782  O  O     . ILE D  3  158  ? -147.152 49.386  41.524  1.00 103.63 ?  158  ILE C O     1 
ATOM   4783  C  CB    . ILE D  3  158  ? -145.885 50.575  39.190  1.00 96.89  ?  158  ILE C CB    1 
ATOM   4784  C  CG1   . ILE D  3  158  ? -145.265 50.852  37.816  1.00 88.27  ?  158  ILE C CG1   1 
ATOM   4785  C  CG2   . ILE D  3  158  ? -145.068 51.241  40.287  1.00 101.73 ?  158  ILE C CG2   1 
ATOM   4786  C  CD1   . ILE D  3  158  ? -146.149 50.476  36.648  1.00 89.45  ?  158  ILE C CD1   1 
ATOM   4787  N  N     . ILE D  3  159  ? -145.572 47.787  41.459  1.00 85.94  ?  159  ILE C N     1 
ATOM   4788  C  CA    . ILE D  3  159  ? -145.757 47.357  42.838  1.00 91.80  ?  159  ILE C CA    1 
ATOM   4789  C  C     . ILE D  3  159  ? -144.494 47.740  43.597  1.00 102.59 ?  159  ILE C C     1 
ATOM   4790  O  O     . ILE D  3  159  ? -143.467 47.058  43.506  1.00 94.41  ?  159  ILE C O     1 
ATOM   4791  C  CB    . ILE D  3  159  ? -146.041 45.855  42.936  1.00 95.69  ?  159  ILE C CB    1 
ATOM   4792  C  CG1   . ILE D  3  159  ? -147.141 45.461  41.949  1.00 91.49  ?  159  ILE C CG1   1 
ATOM   4793  C  CG2   . ILE D  3  159  ? -146.433 45.477  44.356  1.00 100.08 ?  159  ILE C CG2   1 
ATOM   4794  C  CD1   . ILE D  3  159  ? -148.394 46.294  42.075  1.00 87.82  ?  159  ILE C CD1   1 
ATOM   4795  N  N     . ASN D  3  160  ? -144.563 48.840  44.348  1.00 99.86  ?  160  ASN C N     1 
ATOM   4796  C  CA    . ASN D  3  160  ? -143.436 49.317  45.148  1.00 106.27 ?  160  ASN C CA    1 
ATOM   4797  C  C     . ASN D  3  160  ? -142.299 49.821  44.262  1.00 108.50 ?  160  ASN C C     1 
ATOM   4798  O  O     . ASN D  3  160  ? -141.123 49.581  44.539  1.00 117.23 ?  160  ASN C O     1 
ATOM   4799  C  CB    . ASN D  3  160  ? -142.936 48.234  46.107  1.00 108.84 ?  160  ASN C CB    1 
ATOM   4800  C  CG    . ASN D  3  160  ? -144.047 47.645  46.953  1.00 103.87 ?  160  ASN C CG    1 
ATOM   4801  O  OD1   . ASN D  3  160  ? -144.099 46.435  47.172  1.00 90.58  ?  160  ASN C OD1   1 
ATOM   4802  N  ND2   . ASN D  3  160  ? -144.950 48.499  47.425  1.00 108.06 ?  160  ASN C ND2   1 
ATOM   4803  N  N     . GLY D  3  161  ? -142.651 50.519  43.185  1.00 105.87 ?  161  GLY C N     1 
ATOM   4804  C  CA    . GLY D  3  161  ? -141.669 51.138  42.321  1.00 105.03 ?  161  GLY C CA    1 
ATOM   4805  C  C     . GLY D  3  161  ? -141.073 50.248  41.253  1.00 95.92  ?  161  GLY C C     1 
ATOM   4806  O  O     . GLY D  3  161  ? -140.257 50.733  40.457  1.00 103.35 ?  161  GLY C O     1 
ATOM   4807  N  N     . THR D  3  162  ? -141.436 48.971  41.209  1.00 96.95  ?  162  THR C N     1 
ATOM   4808  C  CA    . THR D  3  162  ? -140.915 48.042  40.218  1.00 92.90  ?  162  THR C CA    1 
ATOM   4809  C  C     . THR D  3  162  ? -142.030 47.617  39.273  1.00 97.22  ?  162  THR C C     1 
ATOM   4810  O  O     . THR D  3  162  ? -143.192 47.494  39.672  1.00 103.50 ?  162  THR C O     1 
ATOM   4811  C  CB    . THR D  3  162  ? -140.298 46.806  40.878  1.00 71.78  ?  162  THR C CB    1 
ATOM   4812  O  OG1   . THR D  3  162  ? -141.298 46.120  41.645  1.00 88.51  ?  162  THR C OG1   1 
ATOM   4813  C  CG2   . THR D  3  162  ? -139.156 47.211  41.790  1.00 84.97  ?  162  THR C CG2   1 
ATOM   4814  N  N     . GLU D  3  163  ? -141.665 47.398  38.012  1.00 91.09  ?  163  GLU C N     1 
ATOM   4815  C  CA    . GLU D  3  163  ? -142.621 47.039  36.969  1.00 88.13  ?  163  GLU C CA    1 
ATOM   4816  C  C     . GLU D  3  163  ? -142.759 45.520  36.929  1.00 87.05  ?  163  GLU C C     1 
ATOM   4817  O  O     . GLU D  3  163  ? -141.841 44.816  36.493  1.00 88.71  ?  163  GLU C O     1 
ATOM   4818  C  CB    . GLU D  3  163  ? -142.175 47.594  35.617  1.00 90.16  ?  163  GLU C CB    1 
ATOM   4819  C  CG    . GLU D  3  163  ? -143.246 47.537  34.540  1.00 93.70  ?  163  GLU C CG    1 
ATOM   4820  C  CD    . GLU D  3  163  ? -142.932 48.437  33.357  1.00 110.82 ?  163  GLU C CD    1 
ATOM   4821  O  OE1   . GLU D  3  163  ? -141.850 49.067  33.351  1.00 113.76 ?  163  GLU C OE1   1 
ATOM   4822  O  OE2   . GLU D  3  163  ? -143.772 48.517  32.436  1.00 96.82  ?  163  GLU C OE2   1 
ATOM   4823  N  N     . ARG D  3  164  ? -143.902 45.019  37.386  1.00 88.86  ?  164  ARG C N     1 
ATOM   4824  C  CA    . ARG D  3  164  ? -144.184 43.593  37.442  1.00 83.04  ?  164  ARG C CA    1 
ATOM   4825  C  C     . ARG D  3  164  ? -145.162 43.199  36.342  1.00 89.03  ?  164  ARG C C     1 
ATOM   4826  O  O     . ARG D  3  164  ? -145.862 44.037  35.768  1.00 91.43  ?  164  ARG C O     1 
ATOM   4827  C  CB    . ARG D  3  164  ? -144.756 43.196  38.807  1.00 74.80  ?  164  ARG C CB    1 
ATOM   4828  C  CG    . ARG D  3  164  ? -143.725 43.089  39.917  1.00 81.32  ?  164  ARG C CG    1 
ATOM   4829  C  CD    . ARG D  3  164  ? -144.408 42.913  41.264  1.00 86.20  ?  164  ARG C CD    1 
ATOM   4830  N  NE    . ARG D  3  164  ? -143.469 42.571  42.329  1.00 94.50  ?  164  ARG C NE    1 
ATOM   4831  C  CZ    . ARG D  3  164  ? -143.236 41.331  42.749  1.00 99.18  ?  164  ARG C CZ    1 
ATOM   4832  N  NH1   . ARG D  3  164  ? -143.875 40.310  42.192  1.00 95.24  ?  164  ARG C NH1   1 
ATOM   4833  N  NH2   . ARG D  3  164  ? -142.368 41.111  43.727  1.00 96.45  ?  164  ARG C NH2   1 
ATOM   4834  N  N     . VAL D  3  165  ? -145.203 41.898  36.060  1.00 87.68  ?  165  VAL C N     1 
ATOM   4835  C  CA    . VAL D  3  165  ? -146.086 41.335  35.045  1.00 82.24  ?  165  VAL C CA    1 
ATOM   4836  C  C     . VAL D  3  165  ? -146.696 40.055  35.594  1.00 82.67  ?  165  VAL C C     1 
ATOM   4837  O  O     . VAL D  3  165  ? -145.972 39.154  36.030  1.00 88.92  ?  165  VAL C O     1 
ATOM   4838  C  CB    . VAL D  3  165  ? -145.343 41.053  33.725  1.00 80.19  ?  165  VAL C CB    1 
ATOM   4839  C  CG1   . VAL D  3  165  ? -146.266 40.363  32.735  1.00 85.31  ?  165  VAL C CG1   1 
ATOM   4840  C  CG2   . VAL D  3  165  ? -144.799 42.346  33.138  1.00 99.69  ?  165  VAL C CG2   1 
ATOM   4841  N  N     . VAL D  3  166  ? -148.023 39.976  35.576  1.00 89.69  ?  166  VAL C N     1 
ATOM   4842  C  CA    . VAL D  3  166  ? -148.744 38.795  36.035  1.00 94.11  ?  166  VAL C CA    1 
ATOM   4843  C  C     . VAL D  3  166  ? -148.836 37.804  34.884  1.00 92.28  ?  166  VAL C C     1 
ATOM   4844  O  O     . VAL D  3  166  ? -149.227 38.167  33.768  1.00 87.38  ?  166  VAL C O     1 
ATOM   4845  C  CB    . VAL D  3  166  ? -150.141 39.169  36.555  1.00 97.17  ?  166  VAL C CB    1 
ATOM   4846  C  CG1   . VAL D  3  166  ? -150.984 37.919  36.760  1.00 98.05  ?  166  VAL C CG1   1 
ATOM   4847  C  CG2   . VAL D  3  166  ? -150.030 39.958  37.852  1.00 101.85 ?  166  VAL C CG2   1 
ATOM   4848  N  N     . VAL D  3  167  ? -148.476 36.552  35.153  1.00 91.22  ?  167  VAL C N     1 
ATOM   4849  C  CA    . VAL D  3  167  ? -148.457 35.500  34.144  1.00 100.61 ?  167  VAL C CA    1 
ATOM   4850  C  C     . VAL D  3  167  ? -149.779 34.749  34.199  1.00 99.10  ?  167  VAL C C     1 
ATOM   4851  O  O     . VAL D  3  167  ? -150.198 34.292  35.270  1.00 104.31 ?  167  VAL C O     1 
ATOM   4852  C  CB    . VAL D  3  167  ? -147.271 34.544  34.356  1.00 103.16 ?  167  VAL C CB    1 
ATOM   4853  C  CG1   . VAL D  3  167  ? -147.209 33.519  33.235  1.00 89.50  ?  167  VAL C CG1   1 
ATOM   4854  C  CG2   . VAL D  3  167  ? -145.968 35.324  34.446  1.00 97.32  ?  167  VAL C CG2   1 
ATOM   4855  N  N     . SER D  3  168  ? -150.434 34.622  33.049  1.00 86.45  ?  168  SER C N     1 
ATOM   4856  C  CA    . SER D  3  168  ? -151.689 33.887  32.980  1.00 99.91  ?  168  SER C CA    1 
ATOM   4857  C  C     . SER D  3  168  ? -151.452 32.400  33.223  1.00 102.25 ?  168  SER C C     1 
ATOM   4858  O  O     . SER D  3  168  ? -150.527 31.801  32.667  1.00 98.30  ?  168  SER C O     1 
ATOM   4859  C  CB    . SER D  3  168  ? -152.354 34.103  31.622  1.00 100.86 ?  168  SER C CB    1 
ATOM   4860  O  OG    . SER D  3  168  ? -151.433 33.894  30.566  1.00 95.52  ?  168  SER C OG    1 
ATOM   4861  N  N     . GLN D  3  169  ? -152.295 31.806  34.063  1.00 109.87 ?  169  GLN C N     1 
ATOM   4862  C  CA    . GLN D  3  169  ? -152.177 30.403  34.435  1.00 110.39 ?  169  GLN C CA    1 
ATOM   4863  C  C     . GLN D  3  169  ? -153.196 29.567  33.674  1.00 112.74 ?  169  GLN C C     1 
ATOM   4864  O  O     . GLN D  3  169  ? -154.362 29.952  33.547  1.00 114.85 ?  169  GLN C O     1 
ATOM   4865  C  CB    . GLN D  3  169  ? -152.376 30.215  35.940  1.00 107.97 ?  169  GLN C CB    1 
ATOM   4866  C  CG    . GLN D  3  169  ? -152.242 28.772  36.401  1.00 110.38 ?  169  GLN C CG    1 
ATOM   4867  C  CD    . GLN D  3  169  ? -152.524 28.600  37.880  1.00 130.15 ?  169  GLN C CD    1 
ATOM   4868  O  OE1   . GLN D  3  169  ? -153.445 29.211  38.425  1.00 133.69 ?  169  GLN C OE1   1 
ATOM   4869  N  NE2   . GLN D  3  169  ? -151.728 27.766  38.540  1.00 131.59 ?  169  GLN C NE2   1 
ATOM   4870  N  N     . LEU D  3  170  ? -152.750 28.417  33.176  1.00 116.56 ?  170  LEU C N     1 
ATOM   4871  C  CA    . LEU D  3  170  ? -153.607 27.484  32.449  1.00 116.46 ?  170  LEU C CA    1 
ATOM   4872  C  C     . LEU D  3  170  ? -153.926 26.317  33.377  1.00 117.57 ?  170  LEU C C     1 
ATOM   4873  O  O     . LEU D  3  170  ? -153.110 25.410  33.557  1.00 115.12 ?  170  LEU C O     1 
ATOM   4874  C  CB    . LEU D  3  170  ? -152.932 27.015  31.165  1.00 113.09 ?  170  LEU C CB    1 
ATOM   4875  C  CG    . LEU D  3  170  ? -153.705 25.990  30.334  1.00 120.23 ?  170  LEU C CG    1 
ATOM   4876  C  CD1   . LEU D  3  170  ? -155.141 26.443  30.141  1.00 125.64 ?  170  LEU C CD1   1 
ATOM   4877  C  CD2   . LEU D  3  170  ? -153.022 25.755  28.994  1.00 112.06 ?  170  LEU C CD2   1 
ATOM   4878  N  N     . VAL D  3  171  ? -155.114 26.349  33.972  1.00 119.76 ?  171  VAL C N     1 
ATOM   4879  C  CA    . VAL D  3  171  ? -155.579 25.280  34.842  1.00 129.60 ?  171  VAL C CA    1 
ATOM   4880  C  C     . VAL D  3  171  ? -156.758 24.585  34.175  1.00 133.92 ?  171  VAL C C     1 
ATOM   4881  O  O     . VAL D  3  171  ? -157.377 25.105  33.241  1.00 118.18 ?  171  VAL C O     1 
ATOM   4882  C  CB    . VAL D  3  171  ? -155.964 25.795  36.245  1.00 128.55 ?  171  VAL C CB    1 
ATOM   4883  C  CG1   . VAL D  3  171  ? -154.726 26.260  36.996  1.00 131.05 ?  171  VAL C CG1   1 
ATOM   4884  C  CG2   . VAL D  3  171  ? -156.980 26.921  36.135  1.00 118.48 ?  171  VAL C CG2   1 
ATOM   4885  N  N     . ARG D  3  172  ? -157.065 23.387  34.664  1.00 146.94 ?  172  ARG C N     1 
ATOM   4886  C  CA    . ARG D  3  172  ? -158.157 22.601  34.111  1.00 137.14 ?  172  ARG C CA    1 
ATOM   4887  C  C     . ARG D  3  172  ? -159.484 23.019  34.732  1.00 124.30 ?  172  ARG C C     1 
ATOM   4888  O  O     . ARG D  3  172  ? -159.567 23.300  35.931  1.00 109.45 ?  172  ARG C O     1 
ATOM   4889  C  CB    . ARG D  3  172  ? -157.915 21.109  34.342  1.00 127.66 ?  172  ARG C CB    1 
ATOM   4890  N  N     . SER D  3  173  ? -160.523 23.058  33.904  1.00 117.77 ?  173  SER C N     1 
ATOM   4891  C  CA    . SER D  3  173  ? -161.854 23.445  34.359  1.00 122.98 ?  173  SER C CA    1 
ATOM   4892  C  C     . SER D  3  173  ? -162.579 22.268  35.004  1.00 121.05 ?  173  SER C C     1 
ATOM   4893  O  O     . SER D  3  173  ? -163.702 22.408  35.487  1.00 114.19 ?  173  SER C O     1 
ATOM   4894  C  CB    . SER D  3  173  ? -162.679 23.997  33.194  1.00 118.76 ?  173  SER C CB    1 
ATOM   4895  O  OG    . SER D  3  173  ? -162.764 23.057  32.137  1.00 112.95 ?  173  SER C OG    1 
ATOM   4896  N  N     . ASP D  3  362  ? -156.810 16.482  32.689  1.00 129.99 ?  362  ASP C N     1 
ATOM   4897  C  CA    . ASP D  3  362  ? -157.208 15.340  31.875  1.00 132.16 ?  362  ASP C CA    1 
ATOM   4898  C  C     . ASP D  3  362  ? -156.913 15.599  30.400  1.00 136.10 ?  362  ASP C C     1 
ATOM   4899  O  O     . ASP D  3  362  ? -155.754 15.705  29.999  1.00 136.21 ?  362  ASP C O     1 
ATOM   4900  C  CB    . ASP D  3  362  ? -158.684 15.031  32.079  1.00 126.41 ?  362  ASP C CB    1 
ATOM   4901  N  N     . HIS D  3  363  ? -157.970 15.698  29.597  1.00 137.74 ?  363  HIS C N     1 
ATOM   4902  C  CA    . HIS D  3  363  ? -157.806 16.005  28.186  1.00 140.10 ?  363  HIS C CA    1 
ATOM   4903  C  C     . HIS D  3  363  ? -157.200 17.396  28.013  1.00 144.67 ?  363  HIS C C     1 
ATOM   4904  O  O     . HIS D  3  363  ? -157.269 18.253  28.901  1.00 143.08 ?  363  HIS C O     1 
ATOM   4905  C  CB    . HIS D  3  363  ? -159.147 15.911  27.457  1.00 130.03 ?  363  HIS C CB    1 
ATOM   4906  N  N     . PHE D  3  364  ? -156.594 17.614  26.846  1.00 135.70 ?  364  PHE C N     1 
ATOM   4907  C  CA    . PHE D  3  364  ? -155.940 18.892  26.585  1.00 123.78 ?  364  PHE C CA    1 
ATOM   4908  C  C     . PHE D  3  364  ? -156.947 20.039  26.601  1.00 129.05 ?  364  PHE C C     1 
ATOM   4909  O  O     . PHE D  3  364  ? -156.747 21.048  27.292  1.00 136.43 ?  364  PHE C O     1 
ATOM   4910  C  CB    . PHE D  3  364  ? -155.189 18.831  25.254  1.00 125.37 ?  364  PHE C CB    1 
ATOM   4911  N  N     . GLY D  3  365  ? -158.041 19.892  25.844  1.00 131.87 ?  365  GLY C N     1 
ATOM   4912  C  CA    . GLY D  3  365  ? -159.108 20.879  25.823  1.00 136.96 ?  365  GLY C CA    1 
ATOM   4913  C  C     . GLY D  3  365  ? -159.671 21.239  27.177  1.00 139.12 ?  365  GLY C C     1 
ATOM   4914  O  O     . GLY D  3  365  ? -160.148 22.361  27.350  1.00 140.34 ?  365  GLY C O     1 
ATOM   4915  N  N     . ASN D  3  366  ? -159.634 20.316  28.137  1.00 136.27 ?  366  ASN C N     1 
ATOM   4916  C  CA    . ASN D  3  366  ? -160.053 20.581  29.513  1.00 133.57 ?  366  ASN C CA    1 
ATOM   4917  C  C     . ASN D  3  366  ? -159.244 21.664  30.210  1.00 142.25 ?  366  ASN C C     1 
ATOM   4918  O  O     . ASN D  3  366  ? -159.602 22.024  31.325  1.00 129.52 ?  366  ASN C O     1 
ATOM   4919  C  CB    . ASN D  3  366  ? -160.019 19.289  30.327  1.00 129.61 ?  366  ASN C CB    1 
ATOM   4920  N  N     . ARG D  3  367  ? -158.247 22.254  29.575  1.00 142.71 ?  367  ARG C N     1 
ATOM   4921  C  CA    . ARG D  3  367  ? -157.508 23.325  30.226  1.00 128.56 ?  367  ARG C CA    1 
ATOM   4922  C  C     . ARG D  3  367  ? -158.296 24.631  30.166  1.00 125.86 ?  367  ARG C C     1 
ATOM   4923  O  O     . ARG D  3  367  ? -158.802 25.008  29.104  1.00 111.05 ?  367  ARG C O     1 
ATOM   4924  C  CB    . ARG D  3  367  ? -156.132 23.516  29.583  1.00 129.54 ?  367  ARG C CB    1 
ATOM   4925  N  N     . ARG D  3  368  ? -158.361 25.348  31.295  1.00 126.92 ?  368  ARG C N     1 
ATOM   4926  C  CA    . ARG D  3  368  ? -159.165 26.566  31.384  1.00 130.17 ?  368  ARG C CA    1 
ATOM   4927  C  C     . ARG D  3  368  ? -158.378 27.829  31.046  1.00 131.51 ?  368  ARG C C     1 
ATOM   4928  O  O     . ARG D  3  368  ? -158.813 28.620  30.205  1.00 131.62 ?  368  ARG C O     1 
ATOM   4929  C  CB    . ARG D  3  368  ? -159.775 26.699  32.782  1.00 128.62 ?  368  ARG C CB    1 
ATOM   4930  N  N     . LEU D  3  369  ? -157.250 28.050  31.725  1.00 128.93 ?  369  LEU C N     1 
ATOM   4931  C  CA    . LEU D  3  369  ? -156.394 29.210  31.494  1.00 124.59 ?  369  LEU C CA    1 
ATOM   4932  C  C     . LEU D  3  369  ? -156.939 30.443  32.202  1.00 109.67 ?  369  LEU C C     1 
ATOM   4933  O  O     . LEU D  3  369  ? -157.748 31.188  31.640  1.00 89.29  ?  369  LEU C O     1 
ATOM   4934  C  CB    . LEU D  3  369  ? -156.228 29.481  29.996  1.00 121.27 ?  369  LEU C CB    1 
ATOM   4935  N  N     . ARG D  3  370  ? -156.499 30.660  33.439  1.00 113.46 ?  370  ARG C N     1 
ATOM   4936  C  CA    . ARG D  3  370  ? -156.876 31.860  34.175  1.00 107.82 ?  370  ARG C CA    1 
ATOM   4937  C  C     . ARG D  3  370  ? -156.179 33.078  33.582  1.00 116.20 ?  370  ARG C C     1 
ATOM   4938  O  O     . ARG D  3  370  ? -154.961 33.073  33.381  1.00 125.79 ?  370  ARG C O     1 
ATOM   4939  C  CB    . ARG D  3  370  ? -156.506 31.716  35.650  1.00 107.94 ?  370  ARG C CB    1 
ATOM   4940  C  CG    . ARG D  3  370  ? -157.334 30.711  36.428  1.00 113.32 ?  370  ARG C CG    1 
ATOM   4941  C  CD    . ARG D  3  370  ? -156.728 30.475  37.804  1.00 112.88 ?  370  ARG C CD    1 
ATOM   4942  N  NE    . ARG D  3  370  ? -157.664 29.836  38.723  1.00 129.55 ?  370  ARG C NE    1 
ATOM   4943  C  CZ    . ARG D  3  370  ? -157.343 29.417  39.943  1.00 130.93 ?  370  ARG C CZ    1 
ATOM   4944  N  NH1   . ARG D  3  370  ? -156.102 29.563  40.392  1.00 118.96 ?  370  ARG C NH1   1 
ATOM   4945  N  NH2   . ARG D  3  370  ? -158.260 28.848  40.714  1.00 120.13 ?  370  ARG C NH2   1 
ATOM   4946  N  N     . THR D  3  371  ? -156.951 34.122  33.301  1.00 114.50 ?  371  THR C N     1 
ATOM   4947  C  CA    . THR D  3  371  ? -156.385 35.375  32.829  1.00 105.63 ?  371  THR C CA    1 
ATOM   4948  C  C     . THR D  3  371  ? -156.045 36.274  34.015  1.00 106.23 ?  371  THR C C     1 
ATOM   4949  O  O     . THR D  3  371  ? -156.504 36.059  35.140  1.00 110.72 ?  371  THR C O     1 
ATOM   4950  C  CB    . THR D  3  371  ? -157.347 36.088  31.876  1.00 111.47 ?  371  THR C CB    1 
ATOM   4951  O  OG1   . THR D  3  371  ? -158.567 36.396  32.562  1.00 132.93 ?  371  THR C OG1   1 
ATOM   4952  C  CG2   . THR D  3  371  ? -157.656 35.207  30.671  1.00 115.58 ?  371  THR C CG2   1 
ATOM   4953  N  N     . VAL D  3  372  ? -155.231 37.297  33.745  1.00 110.82 ?  372  VAL C N     1 
ATOM   4954  C  CA    . VAL D  3  372  ? -154.678 38.122  34.820  1.00 113.78 ?  372  VAL C CA    1 
ATOM   4955  C  C     . VAL D  3  372  ? -155.791 38.679  35.702  1.00 114.04 ?  372  VAL C C     1 
ATOM   4956  O  O     . VAL D  3  372  ? -155.728 38.606  36.935  1.00 109.02 ?  372  VAL C O     1 
ATOM   4957  C  CB    . VAL D  3  372  ? -153.798 39.245  34.241  1.00 106.50 ?  372  VAL C CB    1 
ATOM   4958  C  CG1   . VAL D  3  372  ? -154.584 40.087  33.246  1.00 108.87 ?  372  VAL C CG1   1 
ATOM   4959  C  CG2   . VAL D  3  372  ? -153.245 40.110  35.363  1.00 101.73 ?  372  VAL C CG2   1 
ATOM   4960  N  N     . GLY D  3  373  ? -156.827 39.247  35.084  1.00 104.55 ?  373  GLY C N     1 
ATOM   4961  C  CA    . GLY D  3  373  ? -157.910 39.818  35.867  1.00 106.18 ?  373  GLY C CA    1 
ATOM   4962  C  C     . GLY D  3  373  ? -158.649 38.779  36.689  1.00 111.81 ?  373  GLY C C     1 
ATOM   4963  O  O     . GLY D  3  373  ? -159.070 39.048  37.817  1.00 109.35 ?  373  GLY C O     1 
ATOM   4964  N  N     . GLU D  3  374  ? -158.807 37.574  36.140  1.00 109.86 ?  374  GLU C N     1 
ATOM   4965  C  CA    . GLU D  3  374  ? -159.592 36.549  36.819  1.00 110.93 ?  374  GLU C CA    1 
ATOM   4966  C  C     . GLU D  3  374  ? -158.870 36.027  38.057  1.00 109.15 ?  374  GLU C C     1 
ATOM   4967  O  O     . GLU D  3  374  ? -159.443 35.995  39.152  1.00 115.45 ?  374  GLU C O     1 
ATOM   4968  C  CB    . GLU D  3  374  ? -159.912 35.413  35.848  1.00 109.88 ?  374  GLU C CB    1 
ATOM   4969  C  CG    . GLU D  3  374  ? -160.805 35.840  34.692  1.00 116.57 ?  374  GLU C CG    1 
ATOM   4970  C  CD    . GLU D  3  374  ? -160.962 34.759  33.644  1.00 131.23 ?  374  GLU C CD    1 
ATOM   4971  O  OE1   . GLU D  3  374  ? -160.774 35.059  32.446  1.00 130.15 ?  374  GLU C OE1   1 
ATOM   4972  O  OE2   . GLU D  3  374  ? -161.268 33.609  34.021  1.00 139.65 ?  374  GLU C OE2   1 
ATOM   4973  N  N     . LEU D  3  375  ? -157.610 35.611  37.907  1.00 112.13 ?  375  LEU C N     1 
ATOM   4974  C  CA    . LEU D  3  375  ? -156.871 35.112  39.062  1.00 122.74 ?  375  LEU C CA    1 
ATOM   4975  C  C     . LEU D  3  375  ? -156.581 36.210  40.076  1.00 117.56 ?  375  LEU C C     1 
ATOM   4976  O  O     . LEU D  3  375  ? -156.232 35.902  41.222  1.00 118.66 ?  375  LEU C O     1 
ATOM   4977  C  CB    . LEU D  3  375  ? -155.571 34.433  38.620  1.00 124.63 ?  375  LEU C CB    1 
ATOM   4978  C  CG    . LEU D  3  375  ? -155.029 34.724  37.220  1.00 111.30 ?  375  LEU C CG    1 
ATOM   4979  C  CD1   . LEU D  3  375  ? -154.380 36.090  37.172  1.00 117.31 ?  375  LEU C CD1   1 
ATOM   4980  C  CD2   . LEU D  3  375  ? -154.048 33.645  36.784  1.00 107.87 ?  375  LEU C CD2   1 
ATOM   4981  N  N     . ILE D  3  376  ? -156.715 37.478  39.686  1.00 114.89 ?  376  ILE C N     1 
ATOM   4982  C  CA    . ILE D  3  376  ? -156.676 38.556  40.668  1.00 120.01 ?  376  ILE C CA    1 
ATOM   4983  C  C     . ILE D  3  376  ? -157.970 38.585  41.469  1.00 118.21 ?  376  ILE C C     1 
ATOM   4984  O  O     . ILE D  3  376  ? -157.955 38.736  42.696  1.00 118.11 ?  376  ILE C O     1 
ATOM   4985  C  CB    . ILE D  3  376  ? -156.410 39.905  39.976  1.00 123.54 ?  376  ILE C CB    1 
ATOM   4986  C  CG1   . ILE D  3  376  ? -154.922 40.056  39.656  1.00 125.35 ?  376  ILE C CG1   1 
ATOM   4987  C  CG2   . ILE D  3  376  ? -156.887 41.054  40.851  1.00 106.47 ?  376  ILE C CG2   1 
ATOM   4988  C  CD1   . ILE D  3  376  ? -154.060 40.219  40.885  1.00 109.68 ?  376  ILE C CD1   1 
ATOM   4989  N  N     . GLN D  3  377  ? -159.108 38.434  40.788  1.00 118.15 ?  377  GLN C N     1 
ATOM   4990  C  CA    . GLN D  3  377  ? -160.392 38.418  41.480  1.00 112.81 ?  377  GLN C CA    1 
ATOM   4991  C  C     . GLN D  3  377  ? -160.446 37.312  42.526  1.00 113.66 ?  377  GLN C C     1 
ATOM   4992  O  O     . GLN D  3  377  ? -160.917 37.532  43.648  1.00 114.01 ?  377  GLN C O     1 
ATOM   4993  C  CB    . GLN D  3  377  ? -161.526 38.251  40.471  1.00 103.65 ?  377  GLN C CB    1 
ATOM   4994  C  CG    . GLN D  3  377  ? -162.762 37.592  41.047  1.00 107.53 ?  377  GLN C CG    1 
ATOM   4995  C  CD    . GLN D  3  377  ? -163.795 37.278  39.987  1.00 124.82 ?  377  GLN C CD    1 
ATOM   4996  O  OE1   . GLN D  3  377  ? -164.488 36.262  40.058  1.00 142.87 ?  377  GLN C OE1   1 
ATOM   4997  N  NE2   . GLN D  3  377  ? -163.907 38.152  38.995  1.00 115.45 ?  377  GLN C NE2   1 
ATOM   4998  N  N     . ASN D  3  378  ? -159.974 36.113  42.175  1.00 119.52 ?  378  ASN C N     1 
ATOM   4999  C  CA    . ASN D  3  378  ? -160.017 34.998  43.117  1.00 123.20 ?  378  ASN C CA    1 
ATOM   5000  C  C     . ASN D  3  378  ? -159.272 35.333  44.403  1.00 123.28 ?  378  ASN C C     1 
ATOM   5001  O  O     . ASN D  3  378  ? -159.697 34.940  45.496  1.00 116.47 ?  378  ASN C O     1 
ATOM   5002  C  CB    . ASN D  3  378  ? -159.440 33.740  42.470  1.00 119.40 ?  378  ASN C CB    1 
ATOM   5003  C  CG    . ASN D  3  378  ? -160.267 33.258  41.294  1.00 127.45 ?  378  ASN C CG    1 
ATOM   5004  O  OD1   . ASN D  3  378  ? -161.097 33.995  40.761  1.00 129.62 ?  378  ASN C OD1   1 
ATOM   5005  N  ND2   . ASN D  3  378  ? -160.044 32.015  40.883  1.00 126.88 ?  378  ASN C ND2   1 
ATOM   5006  N  N     . GLN D  3  379  ? -158.155 36.057  44.295  1.00 121.89 ?  379  GLN C N     1 
ATOM   5007  C  CA    . GLN D  3  379  ? -157.450 36.499  45.493  1.00 116.42 ?  379  GLN C CA    1 
ATOM   5008  C  C     . GLN D  3  379  ? -158.289 37.485  46.294  1.00 119.62 ?  379  GLN C C     1 
ATOM   5009  O  O     . GLN D  3  379  ? -158.168 37.549  47.523  1.00 116.77 ?  379  GLN C O     1 
ATOM   5010  C  CB    . GLN D  3  379  ? -156.108 37.126  45.114  1.00 115.56 ?  379  GLN C CB    1 
ATOM   5011  C  CG    . GLN D  3  379  ? -155.214 37.456  46.301  1.00 119.87 ?  379  GLN C CG    1 
ATOM   5012  C  CD    . GLN D  3  379  ? -154.656 36.216  46.974  1.00 128.39 ?  379  GLN C CD    1 
ATOM   5013  O  OE1   . GLN D  3  379  ? -154.916 35.092  46.543  1.00 124.60 ?  379  GLN C OE1   1 
ATOM   5014  N  NE2   . GLN D  3  379  ? -153.879 36.415  48.035  1.00 117.08 ?  379  GLN C NE2   1 
ATOM   5015  N  N     . ILE D  3  380  ? -159.140 38.260  45.618  1.00 120.44 ?  380  ILE C N     1 
ATOM   5016  C  CA    . ILE D  3  380  ? -160.035 39.174  46.321  1.00 115.52 ?  380  ILE C CA    1 
ATOM   5017  C  C     . ILE D  3  380  ? -161.117 38.398  47.062  1.00 123.57 ?  380  ILE C C     1 
ATOM   5018  O  O     . ILE D  3  380  ? -161.499 38.757  48.183  1.00 110.64 ?  380  ILE C O     1 
ATOM   5019  C  CB    . ILE D  3  380  ? -160.641 40.191  45.337  1.00 103.87 ?  380  ILE C CB    1 
ATOM   5020  C  CG1   . ILE D  3  380  ? -159.627 41.290  45.012  1.00 99.24  ?  380  ILE C CG1   1 
ATOM   5021  C  CG2   . ILE D  3  380  ? -161.924 40.781  45.901  1.00 107.65 ?  380  ILE C CG2   1 
ATOM   5022  C  CD1   . ILE D  3  380  ? -160.184 42.395  44.141  1.00 107.55 ?  380  ILE C CD1   1 
ATOM   5023  N  N     . ARG D  3  381  ? -161.633 37.329  46.449  1.00 127.57 ?  381  ARG C N     1 
ATOM   5024  C  CA    . ARG D  3  381  ? -162.618 36.488  47.120  1.00 112.47 ?  381  ARG C CA    1 
ATOM   5025  C  C     . ARG D  3  381  ? -162.136 36.084  48.508  1.00 111.18 ?  381  ARG C C     1 
ATOM   5026  O  O     . ARG D  3  381  ? -162.873 36.198  49.494  1.00 124.85 ?  381  ARG C O     1 
ATOM   5027  C  CB    . ARG D  3  381  ? -162.918 35.250  46.273  1.00 109.48 ?  381  ARG C CB    1 
ATOM   5028  C  CG    . ARG D  3  381  ? -163.941 35.470  45.170  1.00 114.38 ?  381  ARG C CG    1 
ATOM   5029  C  CD    . ARG D  3  381  ? -164.246 34.163  44.453  1.00 116.69 ?  381  ARG C CD    1 
ATOM   5030  N  NE    . ARG D  3  381  ? -165.556 34.178  43.807  1.00 133.98 ?  381  ARG C NE    1 
ATOM   5031  C  CZ    . ARG D  3  381  ? -165.757 34.447  42.521  1.00 135.26 ?  381  ARG C CZ    1 
ATOM   5032  N  NH1   . ARG D  3  381  ? -164.730 34.726  41.730  1.00 126.56 ?  381  ARG C NH1   1 
ATOM   5033  N  NH2   . ARG D  3  381  ? -166.987 34.435  42.025  1.00 133.50 ?  381  ARG C NH2   1 
ATOM   5034  N  N     . VAL D  3  382  ? -160.892 35.609  48.601  1.00 98.89  ?  382  VAL C N     1 
ATOM   5035  C  CA    . VAL D  3  382  ? -160.332 35.245  49.901  1.00 109.70 ?  382  VAL C CA    1 
ATOM   5036  C  C     . VAL D  3  382  ? -160.336 36.446  50.837  1.00 115.38 ?  382  VAL C C     1 
ATOM   5037  O  O     . VAL D  3  382  ? -160.608 36.317  52.037  1.00 124.61 ?  382  VAL C O     1 
ATOM   5038  C  CB    . VAL D  3  382  ? -158.916 34.666  49.732  1.00 93.22  ?  382  VAL C CB    1 
ATOM   5039  C  CG1   . VAL D  3  382  ? -158.281 34.420  51.093  1.00 91.42  ?  382  VAL C CG1   1 
ATOM   5040  C  CG2   . VAL D  3  382  ? -158.961 33.383  48.919  1.00 98.47  ?  382  VAL C CG2   1 
ATOM   5041  N  N     . GLY D  3  383  ? -160.033 37.632  50.307  1.00 113.02 ?  383  GLY C N     1 
ATOM   5042  C  CA    . GLY D  3  383  ? -160.025 38.819  51.145  1.00 123.17 ?  383  GLY C CA    1 
ATOM   5043  C  C     . GLY D  3  383  ? -161.410 39.188  51.641  1.00 133.20 ?  383  GLY C C     1 
ATOM   5044  O  O     . GLY D  3  383  ? -161.603 39.479  52.825  1.00 140.89 ?  383  GLY C O     1 
ATOM   5045  N  N     . LEU D  3  384  ? -162.397 39.176  50.742  1.00 125.49 ?  384  LEU C N     1 
ATOM   5046  C  CA    . LEU D  3  384  ? -163.759 39.519  51.140  1.00 131.77 ?  384  LEU C CA    1 
ATOM   5047  C  C     . LEU D  3  384  ? -164.336 38.476  52.088  1.00 136.77 ?  384  LEU C C     1 
ATOM   5048  O  O     . LEU D  3  384  ? -164.891 38.817  53.139  1.00 138.43 ?  384  LEU C O     1 
ATOM   5049  C  CB    . LEU D  3  384  ? -164.647 39.671  49.904  1.00 117.72 ?  384  LEU C CB    1 
ATOM   5050  C  CG    . LEU D  3  384  ? -164.344 40.847  48.976  1.00 113.29 ?  384  LEU C CG    1 
ATOM   5051  C  CD1   . LEU D  3  384  ? -165.526 41.113  48.054  1.00 102.50 ?  384  LEU C CD1   1 
ATOM   5052  C  CD2   . LEU D  3  384  ? -163.991 42.087  49.782  1.00 122.74 ?  384  LEU C CD2   1 
ATOM   5053  N  N     . SER D  3  385  ? -164.214 37.196  51.732  1.00 126.56 ?  385  SER C N     1 
ATOM   5054  C  CA    . SER D  3  385  ? -164.820 36.141  52.538  1.00 129.94 ?  385  SER C CA    1 
ATOM   5055  C  C     . SER D  3  385  ? -164.294 36.169  53.968  1.00 136.25 ?  385  SER C C     1 
ATOM   5056  O  O     . SER D  3  385  ? -165.075 36.188  54.928  1.00 156.95 ?  385  SER C O     1 
ATOM   5057  C  CB    . SER D  3  385  ? -164.571 34.779  51.892  1.00 124.35 ?  385  SER C CB    1 
ATOM   5058  O  OG    . SER D  3  385  ? -165.227 34.688  50.639  1.00 107.67 ?  385  SER C OG    1 
ATOM   5059  N  N     . ARG D  3  386  ? -162.970 36.172  54.134  1.00 118.95 ?  386  ARG C N     1 
ATOM   5060  C  CA    . ARG D  3  386  ? -162.406 36.255  55.477  1.00 127.87 ?  386  ARG C CA    1 
ATOM   5061  C  C     . ARG D  3  386  ? -162.705 37.590  56.145  1.00 138.30 ?  386  ARG C C     1 
ATOM   5062  O  O     . ARG D  3  386  ? -162.635 37.680  57.376  1.00 146.43 ?  386  ARG C O     1 
ATOM   5063  C  CB    . ARG D  3  386  ? -160.898 36.005  55.441  1.00 128.82 ?  386  ARG C CB    1 
ATOM   5064  C  CG    . ARG D  3  386  ? -160.529 34.528  55.475  1.00 135.01 ?  386  ARG C CG    1 
ATOM   5065  C  CD    . ARG D  3  386  ? -159.044 34.315  55.728  1.00 131.87 ?  386  ARG C CD    1 
ATOM   5066  N  NE    . ARG D  3  386  ? -158.737 32.910  55.992  1.00 132.75 ?  386  ARG C NE    1 
ATOM   5067  C  CZ    . ARG D  3  386  ? -157.521 32.446  56.264  1.00 114.45 ?  386  ARG C CZ    1 
ATOM   5068  N  NH1   . ARG D  3  386  ? -156.486 33.274  56.310  1.00 98.85  ?  386  ARG C NH1   1 
ATOM   5069  N  NH2   . ARG D  3  386  ? -157.339 31.152  56.492  1.00 99.52  ?  386  ARG C NH2   1 
ATOM   5070  N  N     . MET D  3  387  ? -163.035 38.625  55.369  1.00 134.35 ?  387  MET C N     1 
ATOM   5071  C  CA    . MET D  3  387  ? -163.497 39.870  55.971  1.00 140.02 ?  387  MET C CA    1 
ATOM   5072  C  C     . MET D  3  387  ? -164.879 39.694  56.589  1.00 140.66 ?  387  MET C C     1 
ATOM   5073  O  O     . MET D  3  387  ? -165.163 40.246  57.660  1.00 140.66 ?  387  MET C O     1 
ATOM   5074  C  CB    . MET D  3  387  ? -163.508 40.989  54.931  1.00 125.33 ?  387  MET C CB    1 
ATOM   5075  N  N     . GLU D  3  388  ? -165.750 38.926  55.930  1.00 141.73 ?  388  GLU C N     1 
ATOM   5076  C  CA    . GLU D  3  388  ? -167.062 38.637  56.497  1.00 134.70 ?  388  GLU C CA    1 
ATOM   5077  C  C     . GLU D  3  388  ? -166.958 37.712  57.703  1.00 136.86 ?  388  GLU C C     1 
ATOM   5078  O  O     . GLU D  3  388  ? -167.811 37.763  58.596  1.00 137.30 ?  388  GLU C O     1 
ATOM   5079  C  CB    . GLU D  3  388  ? -167.975 38.026  55.434  1.00 112.97 ?  388  GLU C CB    1 
ATOM   5080  N  N     . ARG D  3  389  ? -165.930 36.861  57.744  1.00 140.47 ?  389  ARG C N     1 
ATOM   5081  C  CA    . ARG D  3  389  ? -165.712 36.028  58.922  1.00 135.51 ?  389  ARG C CA    1 
ATOM   5082  C  C     . ARG D  3  389  ? -165.365 36.871  60.140  1.00 143.27 ?  389  ARG C C     1 
ATOM   5083  O  O     . ARG D  3  389  ? -165.662 36.477  61.274  1.00 149.50 ?  389  ARG C O     1 
ATOM   5084  C  CB    . ARG D  3  389  ? -164.608 35.005  58.647  1.00 117.00 ?  389  ARG C CB    1 
ATOM   5085  N  N     . VAL D  3  390  ? -164.739 38.030  59.929  1.00 144.75 ?  390  VAL C N     1 
ATOM   5086  C  CA    . VAL D  3  390  ? -164.424 38.923  61.039  1.00 151.15 ?  390  VAL C CA    1 
ATOM   5087  C  C     . VAL D  3  390  ? -165.653 39.715  61.465  1.00 149.46 ?  390  VAL C C     1 
ATOM   5088  O  O     . VAL D  3  390  ? -165.854 39.972  62.656  1.00 154.89 ?  390  VAL C O     1 
ATOM   5089  C  CB    . VAL D  3  390  ? -163.258 39.853  60.659  1.00 156.74 ?  390  VAL C CB    1 
ATOM   5090  C  CG1   . VAL D  3  390  ? -163.105 40.958  61.696  1.00 145.83 ?  390  VAL C CG1   1 
ATOM   5091  C  CG2   . VAL D  3  390  ? -161.966 39.058  60.525  1.00 144.64 ?  390  VAL C CG2   1 
ATOM   5092  N  N     . VAL D  3  391  ? -166.490 40.118  60.505  1.00 145.34 ?  391  VAL C N     1 
ATOM   5093  C  CA    . VAL D  3  391  ? -167.678 40.891  60.849  1.00 151.22 ?  391  VAL C CA    1 
ATOM   5094  C  C     . VAL D  3  391  ? -168.676 40.038  61.619  1.00 157.79 ?  391  VAL C C     1 
ATOM   5095  O  O     . VAL D  3  391  ? -169.382 40.544  62.499  1.00 159.99 ?  391  VAL C O     1 
ATOM   5096  C  CB    . VAL D  3  391  ? -168.314 41.497  59.583  1.00 141.40 ?  391  VAL C CB    1 
ATOM   5097  C  CG1   . VAL D  3  391  ? -167.316 42.396  58.869  1.00 138.39 ?  391  VAL C CG1   1 
ATOM   5098  C  CG2   . VAL D  3  391  ? -168.819 40.397  58.657  1.00 124.91 ?  391  VAL C CG2   1 
ATOM   5099  N  N     . ARG D  3  392  ? -168.763 38.744  61.306  1.00 150.34 ?  392  ARG C N     1 
ATOM   5100  C  CA    . ARG D  3  392  ? -169.660 37.866  62.051  1.00 150.03 ?  392  ARG C CA    1 
ATOM   5101  C  C     . ARG D  3  392  ? -169.283 37.829  63.527  1.00 149.22 ?  392  ARG C C     1 
ATOM   5102  O  O     . ARG D  3  392  ? -170.148 37.931  64.405  1.00 146.94 ?  392  ARG C O     1 
ATOM   5103  C  CB    . ARG D  3  392  ? -169.639 36.460  61.450  1.00 134.84 ?  392  ARG C CB    1 
ATOM   5104  N  N     . GLU D  3  393  ? -167.989 37.687  63.819  1.00 144.16 ?  393  GLU C N     1 
ATOM   5105  C  CA    . GLU D  3  393  ? -167.546 37.654  65.208  1.00 145.29 ?  393  GLU C CA    1 
ATOM   5106  C  C     . GLU D  3  393  ? -167.737 39.008  65.880  1.00 146.11 ?  393  GLU C C     1 
ATOM   5107  O  O     . GLU D  3  393  ? -168.099 39.076  67.060  1.00 155.77 ?  393  GLU C O     1 
ATOM   5108  C  CB    . GLU D  3  393  ? -166.081 37.220  65.278  1.00 143.52 ?  393  GLU C CB    1 
ATOM   5109  C  CG    . GLU D  3  393  ? -165.658 36.618  66.613  1.00 139.88 ?  393  GLU C CG    1 
ATOM   5110  C  CD    . GLU D  3  393  ? -165.681 37.620  67.752  1.00 143.74 ?  393  GLU C CD    1 
ATOM   5111  O  OE1   . GLU D  3  393  ? -165.386 38.810  67.511  1.00 145.24 ?  393  GLU C OE1   1 
ATOM   5112  O  OE2   . GLU D  3  393  ? -166.000 37.216  68.889  1.00 142.96 ?  393  GLU C OE2   1 
ATOM   5113  N  N     . ARG D  3  394  ? -167.500 40.095  65.144  1.00 150.09 ?  394  ARG C N     1 
ATOM   5114  C  CA    . ARG D  3  394  ? -167.534 41.422  65.749  1.00 158.80 ?  394  ARG C CA    1 
ATOM   5115  C  C     . ARG D  3  394  ? -168.947 41.820  66.156  1.00 160.57 ?  394  ARG C C     1 
ATOM   5116  O  O     . ARG D  3  394  ? -169.148 42.406  67.226  1.00 157.17 ?  394  ARG C O     1 
ATOM   5117  C  CB    . ARG D  3  394  ? -166.946 42.451  64.784  1.00 156.99 ?  394  ARG C CB    1 
ATOM   5118  N  N     . MET D  3  395  ? -169.940 41.511  65.320  1.00 158.97 ?  395  MET C N     1 
ATOM   5119  C  CA    . MET D  3  395  ? -171.292 41.993  65.581  1.00 158.38 ?  395  MET C CA    1 
ATOM   5120  C  C     . MET D  3  395  ? -171.918 41.316  66.795  1.00 163.61 ?  395  MET C C     1 
ATOM   5121  O  O     . MET D  3  395  ? -172.738 41.932  67.486  1.00 163.72 ?  395  MET C O     1 
ATOM   5122  C  CB    . MET D  3  395  ? -172.162 41.800  64.339  1.00 153.20 ?  395  MET C CB    1 
ATOM   5123  C  CG    . MET D  3  395  ? -172.157 40.389  63.776  1.00 155.52 ?  395  MET C CG    1 
ATOM   5124  S  SD    . MET D  3  395  ? -172.535 40.369  62.012  1.00 153.84 ?  395  MET C SD    1 
ATOM   5125  C  CE    . MET D  3  395  ? -173.959 41.454  61.956  1.00 132.11 ?  395  MET C CE    1 
ATOM   5126  N  N     . THR D  3  396  ? -171.548 40.065  67.079  1.00 165.32 ?  396  THR C N     1 
ATOM   5127  C  CA    . THR D  3  396  ? -172.109 39.379  68.241  1.00 162.63 ?  396  THR C CA    1 
ATOM   5128  C  C     . THR D  3  396  ? -171.638 40.031  69.535  1.00 163.16 ?  396  THR C C     1 
ATOM   5129  O  O     . THR D  3  396  ? -172.450 40.374  70.403  1.00 161.59 ?  396  THR C O     1 
ATOM   5130  C  CB    . THR D  3  396  ? -171.728 37.898  68.220  1.00 143.55 ?  396  THR C CB    1 
ATOM   5131  O  OG1   . THR D  3  396  ? -170.342 37.752  68.553  1.00 140.81 ?  396  THR C OG1   1 
ATOM   5132  C  CG2   . THR D  3  396  ? -171.977 37.303  66.843  1.00 140.11 ?  396  THR C CG2   1 
ATOM   5133  N  N     . THR D  3  397  ? -170.324 40.209  69.681  1.00 159.09 ?  397  THR C N     1 
ATOM   5134  C  CA    . THR D  3  397  ? -169.794 40.817  70.895  1.00 158.79 ?  397  THR C CA    1 
ATOM   5135  C  C     . THR D  3  397  ? -170.146 42.296  70.994  1.00 164.10 ?  397  THR C C     1 
ATOM   5136  O  O     . THR D  3  397  ? -170.353 42.803  72.102  1.00 156.54 ?  397  THR C O     1 
ATOM   5137  C  CB    . THR D  3  397  ? -168.278 40.632  70.961  1.00 157.65 ?  397  THR C CB    1 
ATOM   5138  O  OG1   . THR D  3  397  ? -167.697 40.984  69.698  1.00 163.44 ?  397  THR C OG1   1 
ATOM   5139  C  CG2   . THR D  3  397  ? -167.936 39.188  71.289  1.00 144.25 ?  397  THR C CG2   1 
ATOM   5140  N  N     . GLN D  3  398  ? -170.218 43.000  69.867  1.00 163.71 ?  398  GLN C N     1 
ATOM   5141  C  CA    . GLN D  3  398  ? -170.502 44.426  69.897  1.00 160.61 ?  398  GLN C CA    1 
ATOM   5142  C  C     . GLN D  3  398  ? -171.981 44.674  70.173  1.00 157.82 ?  398  GLN C C     1 
ATOM   5143  O  O     . GLN D  3  398  ? -172.849 43.876  69.809  1.00 155.01 ?  398  GLN C O     1 
ATOM   5144  C  CB    . GLN D  3  398  ? -170.097 45.083  68.579  1.00 152.58 ?  398  GLN C CB    1 
ATOM   5145  N  N     . ASP D  3  399  ? -172.261 45.795  70.833  1.00 151.61 ?  399  ASP C N     1 
ATOM   5146  C  CA    . ASP D  3  399  ? -173.636 46.163  71.132  1.00 150.74 ?  399  ASP C CA    1 
ATOM   5147  C  C     . ASP D  3  399  ? -174.378 46.511  69.849  1.00 153.47 ?  399  ASP C C     1 
ATOM   5148  O  O     . ASP D  3  399  ? -173.813 47.106  68.927  1.00 163.10 ?  399  ASP C O     1 
ATOM   5149  C  CB    . ASP D  3  399  ? -173.669 47.345  72.101  1.00 135.68 ?  399  ASP C CB    1 
ATOM   5150  N  N     . VAL D  3  400  ? -175.655 46.132  69.792  1.00 148.61 ?  400  VAL C N     1 
ATOM   5151  C  CA    . VAL D  3  400  ? -176.457 46.384  68.603  1.00 150.18 ?  400  VAL C CA    1 
ATOM   5152  C  C     . VAL D  3  400  ? -176.798 47.865  68.516  1.00 150.42 ?  400  VAL C C     1 
ATOM   5153  O  O     . VAL D  3  400  ? -177.028 48.534  69.534  1.00 142.34 ?  400  VAL C O     1 
ATOM   5154  C  CB    . VAL D  3  400  ? -177.730 45.522  68.618  1.00 151.98 ?  400  VAL C CB    1 
ATOM   5155  C  CG1   . VAL D  3  400  ? -177.377 44.055  68.807  1.00 137.16 ?  400  VAL C CG1   1 
ATOM   5156  C  CG2   . VAL D  3  400  ? -178.684 45.999  69.703  1.00 157.39 ?  400  VAL C CG2   1 
ATOM   5157  N  N     . GLU D  3  401  ? -176.824 48.388  67.290  1.00 152.22 ?  401  GLU C N     1 
ATOM   5158  C  CA    . GLU D  3  401  ? -177.147 49.788  67.034  1.00 156.44 ?  401  GLU C CA    1 
ATOM   5159  C  C     . GLU D  3  401  ? -175.997 50.699  67.451  1.00 160.50 ?  401  GLU C C     1 
ATOM   5160  O  O     . GLU D  3  401  ? -175.931 51.858  67.028  1.00 162.91 ?  401  GLU C O     1 
ATOM   5161  C  CB    . GLU D  3  401  ? -178.438 50.184  67.753  1.00 160.10 ?  401  GLU C CB    1 
ATOM   5162  C  CG    . GLU D  3  401  ? -179.221 51.284  67.052  1.00 154.02 ?  401  GLU C CG    1 
ATOM   5163  C  CD    . GLU D  3  401  ? -179.476 50.970  65.589  1.00 154.15 ?  401  GLU C CD    1 
ATOM   5164  O  OE1   . GLU D  3  401  ? -178.918 51.675  64.720  1.00 142.67 ?  401  GLU C OE1   1 
ATOM   5165  O  OE2   . GLU D  3  401  ? -180.224 50.010  65.306  1.00 150.92 ?  401  GLU C OE2   1 
ATOM   5166  N  N     . ALA D  3  402  ? -175.092 50.186  68.280  1.00 152.75 ?  402  ALA C N     1 
ATOM   5167  C  CA    . ALA D  3  402  ? -173.879 50.899  68.654  1.00 156.82 ?  402  ALA C CA    1 
ATOM   5168  C  C     . ALA D  3  402  ? -172.717 50.605  67.715  1.00 153.67 ?  402  ALA C C     1 
ATOM   5169  O  O     . ALA D  3  402  ? -171.600 51.069  67.969  1.00 143.62 ?  402  ALA C O     1 
ATOM   5170  C  CB    . ALA D  3  402  ? -173.482 50.551  70.092  1.00 153.95 ?  402  ALA C CB    1 
ATOM   5171  N  N     . ILE D  3  403  ? -172.951 49.850  66.645  1.00 148.86 ?  403  ILE C N     1 
ATOM   5172  C  CA    . ILE D  3  403  ? -171.926 49.505  65.675  1.00 144.82 ?  403  ILE C CA    1 
ATOM   5173  C  C     . ILE D  3  403  ? -172.374 49.921  64.281  1.00 148.33 ?  403  ILE C C     1 
ATOM   5174  O  O     . ILE D  3  403  ? -173.569 49.929  63.970  1.00 142.95 ?  403  ILE C O     1 
ATOM   5175  C  CB    . ILE D  3  403  ? -171.617 48.003  65.699  1.00 139.14 ?  403  ILE C CB    1 
ATOM   5176  N  N     . THR D  3  404  ? -171.404 50.267  63.446  1.00 155.02 ?  404  THR C N     1 
ATOM   5177  C  CA    . THR D  3  404  ? -171.619 50.697  62.073  1.00 147.00 ?  404  THR C CA    1 
ATOM   5178  C  C     . THR D  3  404  ? -170.749 49.862  61.153  1.00 142.57 ?  404  THR C C     1 
ATOM   5179  O  O     . THR D  3  404  ? -169.835 49.165  61.607  1.00 141.85 ?  404  THR C O     1 
ATOM   5180  C  CB    . THR D  3  404  ? -171.285 52.189  61.909  1.00 144.96 ?  404  THR C CB    1 
ATOM   5181  O  OG1   . THR D  3  404  ? -171.920 52.704  60.733  1.00 146.36 ?  404  THR C OG1   1 
ATOM   5182  C  CG2   . THR D  3  404  ? -169.781 52.387  61.789  1.00 139.63 ?  404  THR C CG2   1 
ATOM   5183  N  N     . PRO D  3  405  ? -171.014 49.895  59.844  1.00 136.28 ?  405  PRO C N     1 
ATOM   5184  C  CA    . PRO D  3  405  ? -170.127 49.182  58.910  1.00 136.36 ?  405  PRO C CA    1 
ATOM   5185  C  C     . PRO D  3  405  ? -168.656 49.500  59.116  1.00 145.50 ?  405  PRO C C     1 
ATOM   5186  O  O     . PRO D  3  405  ? -167.810 48.608  58.982  1.00 146.84 ?  405  PRO C O     1 
ATOM   5187  C  CB    . PRO D  3  405  ? -170.631 49.650  57.539  1.00 127.33 ?  405  PRO C CB    1 
ATOM   5188  C  CG    . PRO D  3  405  ? -172.074 49.930  57.760  1.00 129.16 ?  405  PRO C CG    1 
ATOM   5189  C  CD    . PRO D  3  405  ? -172.184 50.475  59.161  1.00 125.02 ?  405  PRO C CD    1 
ATOM   5190  N  N     . GLN D  3  406  ? -168.327 50.751  59.448  1.00 148.31 ?  406  GLN C N     1 
ATOM   5191  C  CA    . GLN D  3  406  ? -166.930 51.113  59.669  1.00 151.42 ?  406  GLN C CA    1 
ATOM   5192  C  C     . GLN D  3  406  ? -166.359 50.404  60.890  1.00 147.88 ?  406  GLN C C     1 
ATOM   5193  O  O     . GLN D  3  406  ? -165.196 49.986  60.884  1.00 140.30 ?  406  GLN C O     1 
ATOM   5194  C  CB    . GLN D  3  406  ? -166.797 52.628  59.815  1.00 138.46 ?  406  GLN C CB    1 
ATOM   5195  N  N     . THR D  3  407  ? -167.160 50.260  61.947  1.00 148.12 ?  407  THR C N     1 
ATOM   5196  C  CA    . THR D  3  407  ? -166.683 49.592  63.151  1.00 146.24 ?  407  THR C CA    1 
ATOM   5197  C  C     . THR D  3  407  ? -166.615 48.080  62.981  1.00 142.56 ?  407  THR C C     1 
ATOM   5198  O  O     . THR D  3  407  ? -165.756 47.432  63.589  1.00 133.48 ?  407  THR C O     1 
ATOM   5199  C  CB    . THR D  3  407  ? -167.582 49.939  64.340  1.00 146.02 ?  407  THR C CB    1 
ATOM   5200  O  OG1   . THR D  3  407  ? -168.889 49.393  64.126  1.00 143.34 ?  407  THR C OG1   1 
ATOM   5201  C  CG2   . THR D  3  407  ? -167.689 51.448  64.501  1.00 133.03 ?  407  THR C CG2   1 
ATOM   5202  N  N     . LEU D  3  408  ? -167.503 47.503  62.169  1.00 143.75 ?  408  LEU C N     1 
ATOM   5203  C  CA    . LEU D  3  408  ? -167.506 46.059  61.971  1.00 144.73 ?  408  LEU C CA    1 
ATOM   5204  C  C     . LEU D  3  408  ? -166.518 45.627  60.899  1.00 144.14 ?  408  LEU C C     1 
ATOM   5205  O  O     . LEU D  3  408  ? -166.037 44.488  60.925  1.00 140.39 ?  408  LEU C O     1 
ATOM   5206  C  CB    . LEU D  3  408  ? -168.906 45.577  61.592  1.00 144.60 ?  408  LEU C CB    1 
ATOM   5207  C  CG    . LEU D  3  408  ? -170.004 45.701  62.647  1.00 145.45 ?  408  LEU C CG    1 
ATOM   5208  C  CD1   . LEU D  3  408  ? -171.329 45.186  62.102  1.00 138.11 ?  408  LEU C CD1   1 
ATOM   5209  C  CD2   . LEU D  3  408  ? -169.615 44.953  63.911  1.00 152.20 ?  408  LEU C CD2   1 
ATOM   5210  N  N     . ILE D  3  409  ? -166.211 46.506  59.955  1.00 142.40 ?  409  ILE C N     1 
ATOM   5211  C  CA    . ILE D  3  409  ? -165.351 46.165  58.832  1.00 137.05 ?  409  ILE C CA    1 
ATOM   5212  C  C     . ILE D  3  409  ? -163.909 46.480  59.200  1.00 138.34 ?  409  ILE C C     1 
ATOM   5213  O  O     . ILE D  3  409  ? -163.554 47.641  59.428  1.00 129.45 ?  409  ILE C O     1 
ATOM   5214  C  CB    . ILE D  3  409  ? -165.770 46.915  57.563  1.00 130.25 ?  409  ILE C CB    1 
ATOM   5215  C  CG1   . ILE D  3  409  ? -167.171 46.479  57.143  1.00 131.82 ?  409  ILE C CG1   1 
ATOM   5216  C  CG2   . ILE D  3  409  ? -164.775 46.662  56.441  1.00 125.11 ?  409  ILE C CG2   1 
ATOM   5217  C  CD1   . ILE D  3  409  ? -167.694 47.200  55.933  1.00 112.12 ?  409  ILE C CD1   1 
ATOM   5218  N  N     . ASN D  3  410  ? -163.075 45.444  59.250  1.00 147.49 ?  410  ASN C N     1 
ATOM   5219  C  CA    . ASN D  3  410  ? -161.622 45.568  59.409  1.00 137.23 ?  410  ASN C CA    1 
ATOM   5220  C  C     . ASN D  3  410  ? -160.975 45.061  58.111  1.00 140.73 ?  410  ASN C C     1 
ATOM   5221  O  O     . ASN D  3  410  ? -160.640 43.876  57.998  1.00 137.36 ?  410  ASN C O     1 
ATOM   5222  C  CB    . ASN D  3  410  ? -161.132 44.789  60.613  1.00 131.98 ?  410  ASN C CB    1 
ATOM   5223  C  CG    . ASN D  3  410  ? -159.904 45.412  61.250  1.00 118.20 ?  410  ASN C CG    1 
ATOM   5224  O  OD1   . ASN D  3  410  ? -160.003 46.409  61.966  1.00 115.01 ?  410  ASN C OD1   1 
ATOM   5225  N  ND2   . ASN D  3  410  ? -158.742 44.808  61.019  1.00 102.79 ?  410  ASN C ND2   1 
ATOM   5226  N  N     . ILE D  3  411  ? -160.789 45.966  57.137  1.00 136.40 ?  411  ILE C N     1 
ATOM   5227  C  CA    . ILE D  3  411  ? -160.339 45.586  55.795  1.00 135.12 ?  411  ILE C CA    1 
ATOM   5228  C  C     . ILE D  3  411  ? -158.898 45.109  55.752  1.00 127.51 ?  411  ILE C C     1 
ATOM   5229  O  O     . ILE D  3  411  ? -158.390 44.798  54.666  1.00 122.64 ?  411  ILE C O     1 
ATOM   5230  C  CB    . ILE D  3  411  ? -160.487 46.751  54.795  1.00 128.13 ?  411  ILE C CB    1 
ATOM   5231  C  CG1   . ILE D  3  411  ? -159.595 47.910  55.238  1.00 137.91 ?  411  ILE C CG1   1 
ATOM   5232  C  CG2   . ILE D  3  411  ? -161.947 47.257  54.719  1.00 120.78 ?  411  ILE C CG2   1 
ATOM   5233  C  CD1   . ILE D  3  411  ? -159.592 49.066  54.311  1.00 135.99 ?  411  ILE C CD1   1 
ATOM   5234  N  N     . ARG D  3  412  ? -158.233 45.004  56.893  1.00 131.95 ?  412  ARG C N     1 
ATOM   5235  C  CA    . ARG D  3  412  ? -156.841 44.563  56.884  1.00 141.12 ?  412  ARG C CA    1 
ATOM   5236  C  C     . ARG D  3  412  ? -156.623 43.294  56.083  1.00 139.74 ?  412  ARG C C     1 
ATOM   5237  O  O     . ARG D  3  412  ? -155.662 43.250  55.298  1.00 134.76 ?  412  ARG C O     1 
ATOM   5238  C  CB    . ARG D  3  412  ? -156.329 44.331  58.310  1.00 130.88 ?  412  ARG C CB    1 
ATOM   5239  N  N     . PRO D  3  413  ? -157.408 42.222  56.267  1.00 135.10 ?  413  PRO C N     1 
ATOM   5240  C  CA    . PRO D  3  413  ? -157.183 41.009  55.456  1.00 131.81 ?  413  PRO C CA    1 
ATOM   5241  C  C     . PRO D  3  413  ? -157.470 41.209  53.979  1.00 125.68 ?  413  PRO C C     1 
ATOM   5242  O  O     . PRO D  3  413  ? -157.021 40.398  53.157  1.00 120.69 ?  413  PRO C O     1 
ATOM   5243  C  CB    . PRO D  3  413  ? -158.147 39.985  56.071  1.00 133.57 ?  413  PRO C CB    1 
ATOM   5244  C  CG    . PRO D  3  413  ? -159.206 40.829  56.723  1.00 130.90 ?  413  PRO C CG    1 
ATOM   5245  C  CD    . PRO D  3  413  ? -158.507 42.042  57.238  1.00 132.34 ?  413  PRO C CD    1 
ATOM   5246  N  N     . VAL D  3  414  ? -158.202 42.259  53.615  1.00 120.49 ?  414  VAL C N     1 
ATOM   5247  C  CA    . VAL D  3  414  ? -158.482 42.524  52.208  1.00 118.73 ?  414  VAL C CA    1 
ATOM   5248  C  C     . VAL D  3  414  ? -157.289 43.194  51.540  1.00 123.79 ?  414  VAL C C     1 
ATOM   5249  O  O     . VAL D  3  414  ? -156.739 42.686  50.556  1.00 112.79 ?  414  VAL C O     1 
ATOM   5250  C  CB    . VAL D  3  414  ? -159.756 43.375  52.062  1.00 104.59 ?  414  VAL C CB    1 
ATOM   5251  C  CG1   . VAL D  3  414  ? -160.016 43.674  50.593  1.00 84.97  ?  414  VAL C CG1   1 
ATOM   5252  C  CG2   . VAL D  3  414  ? -160.945 42.664  52.686  1.00 119.72 ?  414  VAL C CG2   1 
ATOM   5253  N  N     . VAL D  3  415  ? -156.876 44.351  52.063  1.00 126.90 ?  415  VAL C N     1 
ATOM   5254  C  CA    . VAL D  3  415  ? -155.724 45.050  51.500  1.00 119.45 ?  415  VAL C CA    1 
ATOM   5255  C  C     . VAL D  3  415  ? -154.478 44.181  51.593  1.00 117.63 ?  415  VAL C C     1 
ATOM   5256  O  O     . VAL D  3  415  ? -153.654 44.148  50.670  1.00 127.41 ?  415  VAL C O     1 
ATOM   5257  C  CB    . VAL D  3  415  ? -155.525 46.405  52.204  1.00 118.75 ?  415  VAL C CB    1 
ATOM   5258  C  CG1   . VAL D  3  415  ? -155.406 46.206  53.707  1.00 121.45 ?  415  VAL C CG1   1 
ATOM   5259  C  CG2   . VAL D  3  415  ? -154.296 47.117  51.655  1.00 115.12 ?  415  VAL C CG2   1 
ATOM   5260  N  N     . ALA D  3  416  ? -154.320 43.461  52.705  1.00 110.55 ?  416  ALA C N     1 
ATOM   5261  C  CA    . ALA D  3  416  ? -153.165 42.586  52.867  1.00 117.20 ?  416  ALA C CA    1 
ATOM   5262  C  C     . ALA D  3  416  ? -153.214 41.383  51.934  1.00 114.50 ?  416  ALA C C     1 
ATOM   5263  O  O     . ALA D  3  416  ? -152.178 40.753  51.700  1.00 111.66 ?  416  ALA C O     1 
ATOM   5264  C  CB    . ALA D  3  416  ? -153.058 42.124  54.321  1.00 110.76 ?  416  ALA C CB    1 
ATOM   5265  N  N     . ALA D  3  417  ? -154.390 41.057  51.393  1.00 112.02 ?  417  ALA C N     1 
ATOM   5266  C  CA    . ALA D  3  417  ? -154.507 39.940  50.462  1.00 117.34 ?  417  ALA C CA    1 
ATOM   5267  C  C     . ALA D  3  417  ? -153.955 40.296  49.088  1.00 114.56 ?  417  ALA C C     1 
ATOM   5268  O  O     . ALA D  3  417  ? -153.286 39.474  48.451  1.00 120.00 ?  417  ALA C O     1 
ATOM   5269  C  CB    . ALA D  3  417  ? -155.964 39.500  50.349  1.00 126.11 ?  417  ALA C CB    1 
ATOM   5270  N  N     . ILE D  3  418  ? -154.222 41.514  48.618  1.00 108.41 ?  418  ILE C N     1 
ATOM   5271  C  CA    . ILE D  3  418  ? -153.702 41.941  47.324  1.00 105.36 ?  418  ILE C CA    1 
ATOM   5272  C  C     . ILE D  3  418  ? -152.219 42.269  47.419  1.00 102.21 ?  418  ILE C C     1 
ATOM   5273  O  O     . ILE D  3  418  ? -151.436 41.913  46.531  1.00 98.40  ?  418  ILE C O     1 
ATOM   5274  C  CB    . ILE D  3  418  ? -154.520 43.132  46.796  1.00 99.95  ?  418  ILE C CB    1 
ATOM   5275  C  CG1   . ILE D  3  418  ? -154.786 44.131  47.924  1.00 122.38 ?  418  ILE C CG1   1 
ATOM   5276  C  CG2   . ILE D  3  418  ? -155.828 42.652  46.183  1.00 98.88  ?  418  ILE C CG2   1 
ATOM   5277  C  CD1   . ILE D  3  418  ? -155.914 45.100  47.633  1.00 117.44 ?  418  ILE C CD1   1 
ATOM   5278  N  N     . LYS D  3  419  ? -151.805 42.949  48.492  1.00 103.76 ?  419  LYS C N     1 
ATOM   5279  C  CA    . LYS D  3  419  ? -150.381 43.188  48.702  1.00 104.29 ?  419  LYS C CA    1 
ATOM   5280  C  C     . LYS D  3  419  ? -149.617 41.879  48.837  1.00 107.15 ?  419  LYS C C     1 
ATOM   5281  O  O     . LYS D  3  419  ? -148.457 41.789  48.419  1.00 114.73 ?  419  LYS C O     1 
ATOM   5282  C  CB    . LYS D  3  419  ? -150.165 44.057  49.942  1.00 111.04 ?  419  LYS C CB    1 
ATOM   5283  C  CG    . LYS D  3  419  ? -148.700 44.260  50.307  1.00 133.46 ?  419  LYS C CG    1 
ATOM   5284  C  CD    . LYS D  3  419  ? -148.548 45.132  51.545  1.00 142.93 ?  419  LYS C CD    1 
ATOM   5285  C  CE    . LYS D  3  419  ? -147.086 45.295  51.936  1.00 140.78 ?  419  LYS C CE    1 
ATOM   5286  N  NZ    . LYS D  3  419  ? -146.453 43.993  52.295  1.00 124.99 ?  419  LYS C NZ    1 
ATOM   5287  N  N     . GLU D  3  420  ? -150.247 40.857  49.417  1.00 110.65 ?  420  GLU C N     1 
ATOM   5288  C  CA    . GLU D  3  420  ? -149.626 39.544  49.531  1.00 115.67 ?  420  GLU C CA    1 
ATOM   5289  C  C     . GLU D  3  420  ? -149.593 38.796  48.205  1.00 109.68 ?  420  GLU C C     1 
ATOM   5290  O  O     . GLU D  3  420  ? -148.870 37.801  48.094  1.00 112.12 ?  420  GLU C O     1 
ATOM   5291  C  CB    . GLU D  3  420  ? -150.363 38.713  50.584  1.00 128.68 ?  420  GLU C CB    1 
ATOM   5292  C  CG    . GLU D  3  420  ? -149.466 38.076  51.637  1.00 123.59 ?  420  GLU C CG    1 
ATOM   5293  C  CD    . GLU D  3  420  ? -149.150 36.622  51.341  1.00 134.20 ?  420  GLU C CD    1 
ATOM   5294  O  OE1   . GLU D  3  420  ? -149.087 36.252  50.150  1.00 133.40 ?  420  GLU C OE1   1 
ATOM   5295  O  OE2   . GLU D  3  420  ? -148.972 35.846  52.304  1.00 139.38 ?  420  GLU C OE2   1 
ATOM   5296  N  N     . PHE D  3  421  ? -150.352 39.246  47.205  1.00 104.28 ?  421  PHE C N     1 
ATOM   5297  C  CA    . PHE D  3  421  ? -150.353 38.597  45.888  1.00 95.90  ?  421  PHE C CA    1 
ATOM   5298  C  C     . PHE D  3  421  ? -149.276 39.205  44.995  1.00 108.64 ?  421  PHE C C     1 
ATOM   5299  O  O     . PHE D  3  421  ? -148.276 38.552  44.683  1.00 109.02 ?  421  PHE C O     1 
ATOM   5300  C  CB    . PHE D  3  421  ? -151.732 38.705  45.235  1.00 85.84  ?  421  PHE C CB    1 
ATOM   5301  C  CG    . PHE D  3  421  ? -151.783 38.148  43.840  1.00 92.76  ?  421  PHE C CG    1 
ATOM   5302  C  CD1   . PHE D  3  421  ? -152.107 36.820  43.621  1.00 116.04 ?  421  PHE C CD1   1 
ATOM   5303  C  CD2   . PHE D  3  421  ? -151.500 38.951  42.747  1.00 94.44  ?  421  PHE C CD2   1 
ATOM   5304  C  CE1   . PHE D  3  421  ? -152.151 36.304  42.338  1.00 124.35 ?  421  PHE C CE1   1 
ATOM   5305  C  CE2   . PHE D  3  421  ? -151.539 38.439  41.462  1.00 95.88  ?  421  PHE C CE2   1 
ATOM   5306  C  CZ    . PHE D  3  421  ? -151.867 37.116  41.258  1.00 107.43 ?  421  PHE C CZ    1 
ATOM   5307  N  N     . PHE D  3  422  ? -149.470 40.463  44.582  1.00 109.30 ?  422  PHE C N     1 
ATOM   5308  C  CA    . PHE D  3  422  ? -148.531 41.097  43.661  1.00 100.41 ?  422  PHE C CA    1 
ATOM   5309  C  C     . PHE D  3  422  ? -147.086 40.908  44.101  1.00 104.25 ?  422  PHE C C     1 
ATOM   5310  O  O     . PHE D  3  422  ? -146.177 40.894  43.264  1.00 114.68 ?  422  PHE C O     1 
ATOM   5311  C  CB    . PHE D  3  422  ? -148.857 42.584  43.516  1.00 93.38  ?  422  PHE C CB    1 
ATOM   5312  C  CG    . PHE D  3  422  ? -150.037 42.859  42.629  1.00 92.38  ?  422  PHE C CG    1 
ATOM   5313  C  CD1   . PHE D  3  422  ? -149.927 42.735  41.254  1.00 101.86 ?  422  PHE C CD1   1 
ATOM   5314  C  CD2   . PHE D  3  422  ? -151.255 43.240  43.166  1.00 88.71  ?  422  PHE C CD2   1 
ATOM   5315  C  CE1   . PHE D  3  422  ? -151.008 42.985  40.430  1.00 101.71 ?  422  PHE C CE1   1 
ATOM   5316  C  CE2   . PHE D  3  422  ? -152.341 43.493  42.347  1.00 97.53  ?  422  PHE C CE2   1 
ATOM   5317  C  CZ    . PHE D  3  422  ? -152.217 43.364  40.977  1.00 94.20  ?  422  PHE C CZ    1 
ATOM   5318  N  N     . GLY D  3  423  ? -146.854 40.756  45.401  1.00 103.56 ?  423  GLY C N     1 
ATOM   5319  C  CA    . GLY D  3  423  ? -145.555 40.382  45.925  1.00 109.41 ?  423  GLY C CA    1 
ATOM   5320  C  C     . GLY D  3  423  ? -145.592 38.955  46.437  1.00 113.99 ?  423  GLY C C     1 
ATOM   5321  O  O     . GLY D  3  423  ? -146.629 38.476  46.901  1.00 118.60 ?  423  GLY C O     1 
ATOM   5322  N  N     . THR D  3  424  ? -144.453 38.269  46.334  1.00 116.40 ?  424  THR C N     1 
ATOM   5323  C  CA    . THR D  3  424  ? -144.303 36.913  46.853  1.00 123.70 ?  424  THR C CA    1 
ATOM   5324  C  C     . THR D  3  424  ? -144.994 35.877  45.972  1.00 121.82 ?  424  THR C C     1 
ATOM   5325  O  O     . THR D  3  424  ? -144.479 34.767  45.802  1.00 121.43 ?  424  THR C O     1 
ATOM   5326  C  CB    . THR D  3  424  ? -144.838 36.816  48.287  1.00 127.34 ?  424  THR C CB    1 
ATOM   5327  O  OG1   . THR D  3  424  ? -146.265 36.951  48.284  1.00 119.24 ?  424  THR C OG1   1 
ATOM   5328  C  CG2   . THR D  3  424  ? -144.227 37.904  49.161  1.00 118.89 ?  424  THR C CG2   1 
ATOM   5329  N  N     . SER D  3  425  ? -146.157 36.216  45.416  1.00 109.98 ?  425  SER C N     1 
ATOM   5330  C  CA    . SER D  3  425  ? -146.878 35.268  44.575  1.00 113.72 ?  425  SER C CA    1 
ATOM   5331  C  C     . SER D  3  425  ? -145.995 34.787  43.430  1.00 114.78 ?  425  SER C C     1 
ATOM   5332  O  O     . SER D  3  425  ? -145.237 35.560  42.838  1.00 120.49 ?  425  SER C O     1 
ATOM   5333  C  CB    . SER D  3  425  ? -148.155 35.901  44.021  1.00 108.06 ?  425  SER C CB    1 
ATOM   5334  O  OG    . SER D  3  425  ? -148.788 35.041  43.088  1.00 85.05  ?  425  SER C OG    1 
ATOM   5335  N  N     . GLN D  3  426  ? -146.103 33.494  43.118  1.00 103.21 ?  426  GLN C N     1 
ATOM   5336  C  CA    . GLN D  3  426  ? -145.262 32.916  42.076  1.00 105.96 ?  426  GLN C CA    1 
ATOM   5337  C  C     . GLN D  3  426  ? -145.690 33.367  40.685  1.00 101.31 ?  426  GLN C C     1 
ATOM   5338  O  O     . GLN D  3  426  ? -144.863 33.402  39.767  1.00 106.55 ?  426  GLN C O     1 
ATOM   5339  C  CB    . GLN D  3  426  ? -145.281 31.390  42.175  1.00 117.13 ?  426  GLN C CB    1 
ATOM   5340  C  CG    . GLN D  3  426  ? -144.654 30.848  43.452  1.00 118.33 ?  426  GLN C CG    1 
ATOM   5341  C  CD    . GLN D  3  426  ? -144.649 29.333  43.504  1.00 118.38 ?  426  GLN C CD    1 
ATOM   5342  O  OE1   . GLN D  3  426  ? -143.874 28.729  44.247  1.00 122.31 ?  426  GLN C OE1   1 
ATOM   5343  N  NE2   . GLN D  3  426  ? -145.519 28.710  42.716  1.00 97.34  ?  426  GLN C NE2   1 
ATOM   5344  N  N     . LEU D  3  427  ? -146.967 33.714  40.504  1.00 88.29  ?  427  LEU C N     1 
ATOM   5345  C  CA    . LEU D  3  427  ? -147.425 34.208  39.211  1.00 95.03  ?  427  LEU C CA    1 
ATOM   5346  C  C     . LEU D  3  427  ? -147.104 35.680  38.997  1.00 99.12  ?  427  LEU C C     1 
ATOM   5347  O  O     . LEU D  3  427  ? -147.084 36.136  37.848  1.00 87.12  ?  427  LEU C O     1 
ATOM   5348  C  CB    . LEU D  3  427  ? -148.930 33.980  39.058  1.00 92.95  ?  427  LEU C CB    1 
ATOM   5349  C  CG    . LEU D  3  427  ? -149.343 32.583  38.589  1.00 98.29  ?  427  LEU C CG    1 
ATOM   5350  C  CD1   . LEU D  3  427  ? -150.858 32.472  38.501  1.00 108.74 ?  427  LEU C CD1   1 
ATOM   5351  C  CD2   . LEU D  3  427  ? -148.700 32.258  37.249  1.00 93.36  ?  427  LEU C CD2   1 
ATOM   5352  N  N     . SER D  3  428  ? -146.859 36.431  40.067  1.00 96.75  ?  428  SER C N     1 
ATOM   5353  C  CA    . SER D  3  428  ? -146.416 37.815  39.965  1.00 87.03  ?  428  SER C CA    1 
ATOM   5354  C  C     . SER D  3  428  ? -144.897 37.831  39.842  1.00 98.95  ?  428  SER C C     1 
ATOM   5355  O  O     . SER D  3  428  ? -144.193 37.334  40.730  1.00 96.92  ?  428  SER C O     1 
ATOM   5356  C  CB    . SER D  3  428  ? -146.870 38.618  41.182  1.00 98.17  ?  428  SER C CB    1 
ATOM   5357  O  OG    . SER D  3  428  ? -146.303 39.916  41.177  1.00 106.27 ?  428  SER C OG    1 
ATOM   5358  N  N     . GLN D  3  429  ? -144.392 38.397  38.747  1.00 96.52  ?  429  GLN C N     1 
ATOM   5359  C  CA    . GLN D  3  429  ? -142.967 38.355  38.452  1.00 92.46  ?  429  GLN C CA    1 
ATOM   5360  C  C     . GLN D  3  429  ? -142.481 39.724  38.001  1.00 91.71  ?  429  GLN C C     1 
ATOM   5361  O  O     . GLN D  3  429  ? -143.233 40.509  37.415  1.00 88.06  ?  429  GLN C O     1 
ATOM   5362  C  CB    . GLN D  3  429  ? -142.650 37.315  37.369  1.00 84.93  ?  429  GLN C CB    1 
ATOM   5363  C  CG    . GLN D  3  429  ? -143.078 35.901  37.718  1.00 91.10  ?  429  GLN C CG    1 
ATOM   5364  C  CD    . GLN D  3  429  ? -142.861 34.931  36.574  1.00 99.95  ?  429  GLN C CD    1 
ATOM   5365  O  OE1   . GLN D  3  429  ? -142.827 35.325  35.409  1.00 99.46  ?  429  GLN C OE1   1 
ATOM   5366  N  NE2   . GLN D  3  429  ? -142.709 33.653  36.903  1.00 106.28 ?  429  GLN C NE2   1 
ATOM   5367  N  N     . PHE D  3  430  ? -141.209 40.001  38.284  1.00 88.26  ?  430  PHE C N     1 
ATOM   5368  C  CA    . PHE D  3  430  ? -140.566 41.198  37.760  1.00 84.69  ?  430  PHE C CA    1 
ATOM   5369  C  C     . PHE D  3  430  ? -140.462 41.102  36.243  1.00 81.45  ?  430  PHE C C     1 
ATOM   5370  O  O     . PHE D  3  430  ? -139.982 40.098  35.707  1.00 84.48  ?  430  PHE C O     1 
ATOM   5371  C  CB    . PHE D  3  430  ? -139.176 41.373  38.372  1.00 82.53  ?  430  PHE C CB    1 
ATOM   5372  C  CG    . PHE D  3  430  ? -139.188 41.795  39.815  1.00 78.53  ?  430  PHE C CG    1 
ATOM   5373  C  CD1   . PHE D  3  430  ? -138.022 41.775  40.562  1.00 78.05  ?  430  PHE C CD1   1 
ATOM   5374  C  CD2   . PHE D  3  430  ? -140.359 42.216  40.423  1.00 87.50  ?  430  PHE C CD2   1 
ATOM   5375  C  CE1   . PHE D  3  430  ? -138.021 42.162  41.887  1.00 80.09  ?  430  PHE C CE1   1 
ATOM   5376  C  CE2   . PHE D  3  430  ? -140.364 42.606  41.750  1.00 93.27  ?  430  PHE C CE2   1 
ATOM   5377  C  CZ    . PHE D  3  430  ? -139.193 42.578  42.483  1.00 96.41  ?  430  PHE C CZ    1 
ATOM   5378  N  N     . MET D  3  431  ? -140.911 42.144  35.551  1.00 78.36  ?  431  MET C N     1 
ATOM   5379  C  CA    . MET D  3  431  ? -140.903 42.125  34.094  1.00 80.15  ?  431  MET C CA    1 
ATOM   5380  C  C     . MET D  3  431  ? -139.481 41.970  33.571  1.00 89.00  ?  431  MET C C     1 
ATOM   5381  O  O     . MET D  3  431  ? -138.625 42.828  33.808  1.00 105.67 ?  431  MET C O     1 
ATOM   5382  C  CB    . MET D  3  431  ? -141.538 43.401  33.548  1.00 70.36  ?  431  MET C CB    1 
ATOM   5383  C  CG    . MET D  3  431  ? -141.507 43.503  32.033  1.00 60.20  ?  431  MET C CG    1 
ATOM   5384  S  SD    . MET D  3  431  ? -142.262 45.017  31.412  1.00 75.85  ?  431  MET C SD    1 
ATOM   5385  C  CE    . MET D  3  431  ? -141.868 44.909  29.667  1.00 82.85  ?  431  MET C CE    1 
ATOM   5386  N  N     . ASP D  3  432  ? -139.231 40.872  32.862  1.00 83.79  ?  432  ASP C N     1 
ATOM   5387  C  CA    . ASP D  3  432  ? -137.940 40.638  32.218  1.00 85.31  ?  432  ASP C CA    1 
ATOM   5388  C  C     . ASP D  3  432  ? -137.836 41.543  31.000  1.00 84.32  ?  432  ASP C C     1 
ATOM   5389  O  O     . ASP D  3  432  ? -138.458 41.291  29.968  1.00 89.29  ?  432  ASP C O     1 
ATOM   5390  C  CB    . ASP D  3  432  ? -137.799 39.174  31.821  1.00 85.06  ?  432  ASP C CB    1 
ATOM   5391  C  CG    . ASP D  3  432  ? -136.685 38.949  30.818  1.00 94.69  ?  432  ASP C CG    1 
ATOM   5392  O  OD1   . ASP D  3  432  ? -135.638 39.621  30.935  1.00 100.83 ?  432  ASP C OD1   1 
ATOM   5393  O  OD2   . ASP D  3  432  ? -136.859 38.107  29.910  1.00 88.08  ?  432  ASP C OD2   1 
ATOM   5394  N  N     . GLN D  3  433  ? -137.037 42.614  31.108  1.00 80.01  ?  433  GLN C N     1 
ATOM   5395  C  CA    . GLN D  3  433  ? -136.949 43.610  30.039  1.00 78.32  ?  433  GLN C CA    1 
ATOM   5396  C  C     . GLN D  3  433  ? -135.496 44.059  29.872  1.00 83.46  ?  433  GLN C C     1 
ATOM   5397  O  O     . GLN D  3  433  ? -135.076 45.097  30.389  1.00 99.52  ?  433  GLN C O     1 
ATOM   5398  C  CB    . GLN D  3  433  ? -137.875 44.795  30.312  1.00 83.79  ?  433  GLN C CB    1 
ATOM   5399  C  CG    . GLN D  3  433  ? -137.645 45.493  31.645  1.00 75.50  ?  433  GLN C CG    1 
ATOM   5400  C  CD    . GLN D  3  433  ? -138.568 46.683  31.832  1.00 89.06  ?  433  GLN C CD    1 
ATOM   5401  O  OE1   . GLN D  3  433  ? -139.435 46.946  30.998  1.00 112.18 ?  433  GLN C OE1   1 
ATOM   5402  N  NE2   . GLN D  3  433  ? -138.385 47.412  32.926  1.00 66.76  ?  433  GLN C NE2   1 
ATOM   5403  N  N     . ASN D  3  434  ? -134.717 43.259  29.142  1.00 73.30  ?  434  ASN C N     1 
ATOM   5404  C  CA    . ASN D  3  434  ? -133.458 43.728  28.585  1.00 73.66  ?  434  ASN C CA    1 
ATOM   5405  C  C     . ASN D  3  434  ? -133.565 44.027  27.096  1.00 84.04  ?  434  ASN C C     1 
ATOM   5406  O  O     . ASN D  3  434  ? -132.665 44.665  26.539  1.00 96.28  ?  434  ASN C O     1 
ATOM   5407  C  CB    . ASN D  3  434  ? -132.329 42.715  28.834  1.00 61.00  ?  434  ASN C CB    1 
ATOM   5408  C  CG    . ASN D  3  434  ? -132.739 41.291  28.535  1.00 65.16  ?  434  ASN C CG    1 
ATOM   5409  O  OD1   . ASN D  3  434  ? -132.663 40.419  29.400  1.00 88.68  ?  434  ASN C OD1   1 
ATOM   5410  N  ND2   . ASN D  3  434  ? -133.177 41.046  27.308  1.00 72.88  ?  434  ASN C ND2   1 
ATOM   5411  N  N     . ASN D  3  435  ? -134.641 43.583  26.447  1.00 57.30  ?  435  ASN C N     1 
ATOM   5412  C  CA    . ASN D  3  435  ? -134.983 43.978  25.089  1.00 70.41  ?  435  ASN C CA    1 
ATOM   5413  C  C     . ASN D  3  435  ? -136.497 44.006  24.978  1.00 73.87  ?  435  ASN C C     1 
ATOM   5414  O  O     . ASN D  3  435  ? -137.181 43.269  25.698  1.00 83.42  ?  435  ASN C O     1 
ATOM   5415  C  CB    . ASN D  3  435  ? -134.397 43.026  24.038  1.00 66.98  ?  435  ASN C CB    1 
ATOM   5416  C  CG    . ASN D  3  435  ? -134.999 41.641  24.108  1.00 81.09  ?  435  ASN C CG    1 
ATOM   5417  O  OD1   . ASN D  3  435  ? -136.152 41.431  23.728  1.00 81.39  ?  435  ASN C OD1   1 
ATOM   5418  N  ND2   . ASN D  3  435  ? -134.217 40.680  24.586  1.00 88.69  ?  435  ASN C ND2   1 
ATOM   5419  N  N     . PRO D  3  436  ? -137.051 44.837  24.094  1.00 76.96  ?  436  PRO C N     1 
ATOM   5420  C  CA    . PRO D  3  436  ? -138.517 44.921  23.988  1.00 83.75  ?  436  PRO C CA    1 
ATOM   5421  C  C     . PRO D  3  436  ? -139.194 43.576  23.788  1.00 82.76  ?  436  PRO C C     1 
ATOM   5422  O  O     . PRO D  3  436  ? -140.315 43.381  24.275  1.00 84.78  ?  436  PRO C O     1 
ATOM   5423  C  CB    . PRO D  3  436  ? -138.721 45.844  22.780  1.00 84.40  ?  436  PRO C CB    1 
ATOM   5424  C  CG    . PRO D  3  436  ? -137.487 46.682  22.740  1.00 89.60  ?  436  PRO C CG    1 
ATOM   5425  C  CD    . PRO D  3  436  ? -136.373 45.779  23.188  1.00 87.44  ?  436  PRO C CD    1 
ATOM   5426  N  N     . LEU D  3  437  ? -138.548 42.635  23.094  1.00 82.34  ?  437  LEU C N     1 
ATOM   5427  C  CA    . LEU D  3  437  ? -139.179 41.341  22.854  1.00 77.19  ?  437  LEU C CA    1 
ATOM   5428  C  C     . LEU D  3  437  ? -139.249 40.514  24.131  1.00 70.96  ?  437  LEU C C     1 
ATOM   5429  O  O     . LEU D  3  437  ? -140.240 39.812  24.367  1.00 69.53  ?  437  LEU C O     1 
ATOM   5430  C  CB    . LEU D  3  437  ? -138.428 40.579  21.761  1.00 70.14  ?  437  LEU C CB    1 
ATOM   5431  C  CG    . LEU D  3  437  ? -139.134 39.357  21.160  1.00 55.13  ?  437  LEU C CG    1 
ATOM   5432  C  CD1   . LEU D  3  437  ? -138.456 38.931  19.867  1.00 64.65  ?  437  LEU C CD1   1 
ATOM   5433  C  CD2   . LEU D  3  437  ? -139.176 38.195  22.137  1.00 73.78  ?  437  LEU C CD2   1 
ATOM   5434  N  N     . SER D  3  438  ? -138.207 40.574  24.962  1.00 65.57  ?  438  SER C N     1 
ATOM   5435  C  CA    . SER D  3  438  ? -138.215 39.816  26.209  1.00 71.87  ?  438  SER C CA    1 
ATOM   5436  C  C     . SER D  3  438  ? -139.432 40.170  27.053  1.00 77.02  ?  438  SER C C     1 
ATOM   5437  O  O     . SER D  3  438  ? -140.167 39.286  27.509  1.00 88.53  ?  438  SER C O     1 
ATOM   5438  C  CB    . SER D  3  438  ? -136.924 40.069  26.989  1.00 74.68  ?  438  SER C CB    1 
ATOM   5439  O  OG    . SER D  3  438  ? -136.843 41.416  27.418  1.00 90.34  ?  438  SER C OG    1 
ATOM   5440  N  N     . GLY D  3  439  ? -139.665 41.466  27.270  1.00 78.71  ?  439  GLY C N     1 
ATOM   5441  C  CA    . GLY D  3  439  ? -140.836 41.878  28.022  1.00 73.49  ?  439  GLY C CA    1 
ATOM   5442  C  C     . GLY D  3  439  ? -142.137 41.495  27.346  1.00 77.75  ?  439  GLY C C     1 
ATOM   5443  O  O     . GLY D  3  439  ? -143.125 41.189  28.020  1.00 75.45  ?  439  GLY C O     1 
ATOM   5444  N  N     . LEU D  3  440  ? -142.158 41.498  26.011  1.00 75.47  ?  440  LEU C N     1 
ATOM   5445  C  CA    . LEU D  3  440  ? -143.371 41.122  25.294  1.00 71.18  ?  440  LEU C CA    1 
ATOM   5446  C  C     . LEU D  3  440  ? -143.697 39.647  25.493  1.00 80.53  ?  440  LEU C C     1 
ATOM   5447  O  O     . LEU D  3  440  ? -144.861 39.287  25.701  1.00 82.84  ?  440  LEU C O     1 
ATOM   5448  C  CB    . LEU D  3  440  ? -143.224 41.445  23.808  1.00 64.26  ?  440  LEU C CB    1 
ATOM   5449  C  CG    . LEU D  3  440  ? -144.428 41.088  22.937  1.00 58.89  ?  440  LEU C CG    1 
ATOM   5450  C  CD1   . LEU D  3  440  ? -145.674 41.790  23.446  1.00 74.04  ?  440  LEU C CD1   1 
ATOM   5451  C  CD2   . LEU D  3  440  ? -144.166 41.443  21.483  1.00 73.52  ?  440  LEU C CD2   1 
ATOM   5452  N  N     . THR D  3  441  ? -142.686 38.777  25.433  1.00 80.09  ?  441  THR C N     1 
ATOM   5453  C  CA    . THR D  3  441  ? -142.915 37.357  25.667  1.00 71.66  ?  441  THR C CA    1 
ATOM   5454  C  C     . THR D  3  441  ? -143.126 37.030  27.139  1.00 78.23  ?  441  THR C C     1 
ATOM   5455  O  O     . THR D  3  441  ? -143.759 36.013  27.443  1.00 95.96  ?  441  THR C O     1 
ATOM   5456  C  CB    . THR D  3  441  ? -141.751 36.522  25.122  1.00 76.37  ?  441  THR C CB    1 
ATOM   5457  O  OG1   . THR D  3  441  ? -140.508 37.066  25.582  1.00 87.66  ?  441  THR C OG1   1 
ATOM   5458  C  CG2   . THR D  3  441  ? -141.769 36.507  23.598  1.00 84.86  ?  441  THR C CG2   1 
ATOM   5459  N  N     . HIS D  3  442  ? -142.613 37.857  28.056  1.00 80.41  ?  442  HIS C N     1 
ATOM   5460  C  CA    . HIS D  3  442  ? -142.911 37.646  29.470  1.00 77.55  ?  442  HIS C CA    1 
ATOM   5461  C  C     . HIS D  3  442  ? -144.414 37.676  29.705  1.00 70.26  ?  442  HIS C C     1 
ATOM   5462  O  O     . HIS D  3  442  ? -144.985 36.747  30.291  1.00 78.08  ?  442  HIS C O     1 
ATOM   5463  C  CB    . HIS D  3  442  ? -142.205 38.692  30.330  1.00 76.47  ?  442  HIS C CB    1 
ATOM   5464  C  CG    . HIS D  3  442  ? -142.284 38.412  31.797  1.00 64.67  ?  442  HIS C CG    1 
ATOM   5465  N  ND1   . HIS D  3  442  ? -141.688 39.216  32.745  1.00 85.98  ?  442  HIS C ND1   1 
ATOM   5466  C  CD2   . HIS D  3  442  ? -142.886 37.409  32.479  1.00 64.29  ?  442  HIS C CD2   1 
ATOM   5467  C  CE1   . HIS D  3  442  ? -141.922 38.722  33.948  1.00 87.36  ?  442  HIS C CE1   1 
ATOM   5468  N  NE2   . HIS D  3  442  ? -142.646 37.625  33.814  1.00 90.90  ?  442  HIS C NE2   1 
ATOM   5469  N  N     . LYS D  3  443  ? -145.072 38.739  29.255  1.00 86.71  ?  443  LYS C N     1 
ATOM   5470  C  CA    . LYS D  3  443  ? -146.508 38.671  29.065  1.00 84.62  ?  443  LYS C CA    1 
ATOM   5471  C  C     . LYS D  3  443  ? -146.812 37.696  27.930  1.00 87.80  ?  443  LYS C C     1 
ATOM   5472  O  O     . LYS D  3  443  ? -145.950 37.379  27.106  1.00 85.31  ?  443  LYS C O     1 
ATOM   5473  C  CB    . LYS D  3  443  ? -147.087 40.053  28.757  1.00 76.23  ?  443  LYS C CB    1 
ATOM   5474  C  CG    . LYS D  3  443  ? -146.087 41.199  28.861  1.00 68.00  ?  443  LYS C CG    1 
ATOM   5475  C  CD    . LYS D  3  443  ? -146.718 42.516  28.434  1.00 80.00  ?  443  LYS C CD    1 
ATOM   5476  C  CE    . LYS D  3  443  ? -145.675 43.617  28.272  1.00 94.46  ?  443  LYS C CE    1 
ATOM   5477  N  NZ    . LYS D  3  443  ? -145.035 43.994  29.563  1.00 88.93  ?  443  LYS C NZ    1 
ATOM   5478  N  N     . ARG D  3  444  ? -148.051 37.207  27.903  1.00 85.06  ?  444  ARG C N     1 
ATOM   5479  C  CA    . ARG D  3  444  ? -148.460 36.196  26.933  1.00 92.20  ?  444  ARG C CA    1 
ATOM   5480  C  C     . ARG D  3  444  ? -147.986 34.810  27.353  1.00 91.55  ?  444  ARG C C     1 
ATOM   5481  O  O     . ARG D  3  444  ? -148.596 33.801  26.984  1.00 100.47 ?  444  ARG C O     1 
ATOM   5482  C  CB    . ARG D  3  444  ? -147.926 36.514  25.535  1.00 73.11  ?  444  ARG C CB    1 
ATOM   5483  C  CG    . ARG D  3  444  ? -148.255 37.900  25.032  1.00 68.65  ?  444  ARG C CG    1 
ATOM   5484  C  CD    . ARG D  3  444  ? -148.082 37.962  23.527  1.00 71.68  ?  444  ARG C CD    1 
ATOM   5485  N  NE    . ARG D  3  444  ? -148.932 36.981  22.861  1.00 89.46  ?  444  ARG C NE    1 
ATOM   5486  C  CZ    . ARG D  3  444  ? -148.948 36.771  21.549  1.00 104.64 ?  444  ARG C CZ    1 
ATOM   5487  N  NH1   . ARG D  3  444  ? -148.157 37.477  20.754  1.00 94.51  ?  444  ARG C NH1   1 
ATOM   5488  N  NH2   . ARG D  3  444  ? -149.756 35.856  21.033  1.00 112.43 ?  444  ARG C NH2   1 
ATOM   5489  N  N     . ARG D  3  445  ? -146.898 34.746  28.114  1.00 79.46  ?  445  ARG C N     1 
ATOM   5490  C  CA    . ARG D  3  445  ? -146.416 33.465  28.608  1.00 82.52  ?  445  ARG C CA    1 
ATOM   5491  C  C     . ARG D  3  445  ? -147.377 32.911  29.652  1.00 82.32  ?  445  ARG C C     1 
ATOM   5492  O  O     . ARG D  3  445  ? -147.959 33.658  30.443  1.00 82.76  ?  445  ARG C O     1 
ATOM   5493  C  CB    . ARG D  3  445  ? -145.009 33.621  29.189  1.00 83.28  ?  445  ARG C CB    1 
ATOM   5494  C  CG    . ARG D  3  445  ? -144.217 32.321  29.257  1.00 94.51  ?  445  ARG C CG    1 
ATOM   5495  C  CD    . ARG D  3  445  ? -142.788 32.569  29.713  1.00 89.36  ?  445  ARG C CD    1 
ATOM   5496  N  NE    . ARG D  3  445  ? -142.074 33.470  28.813  1.00 82.19  ?  445  ARG C NE    1 
ATOM   5497  C  CZ    . ARG D  3  445  ? -141.375 33.071  27.754  1.00 98.48  ?  445  ARG C CZ    1 
ATOM   5498  N  NH1   . ARG D  3  445  ? -141.296 31.781  27.457  1.00 84.80  ?  445  ARG C NH1   1 
ATOM   5499  N  NH2   . ARG D  3  445  ? -140.756 33.964  26.991  1.00 106.38 ?  445  ARG C NH2   1 
ATOM   5500  N  N     . LEU D  3  446  ? -147.549 31.590  29.649  1.00 91.66  ?  446  LEU C N     1 
ATOM   5501  C  CA    . LEU D  3  446  ? -148.543 30.946  30.494  1.00 85.08  ?  446  LEU C CA    1 
ATOM   5502  C  C     . LEU D  3  446  ? -147.950 29.710  31.156  1.00 72.78  ?  446  LEU C C     1 
ATOM   5503  O  O     . LEU D  3  446  ? -146.960 29.140  30.689  1.00 88.76  ?  446  LEU C O     1 
ATOM   5504  C  CB    . LEU D  3  446  ? -149.785 30.556  29.688  1.00 82.29  ?  446  LEU C CB    1 
ATOM   5505  C  CG    . LEU D  3  446  ? -149.509 29.591  28.534  1.00 78.87  ?  446  LEU C CG    1 
ATOM   5506  C  CD1   . LEU D  3  446  ? -150.298 28.300  28.704  1.00 91.94  ?  446  LEU C CD1   1 
ATOM   5507  C  CD2   . LEU D  3  446  ? -149.817 30.248  27.192  1.00 85.10  ?  446  LEU C CD2   1 
ATOM   5508  N  N     . LEU D  3  447  ? -148.577 29.301  32.254  1.00 67.13  ?  447  LEU C N     1 
ATOM   5509  C  CA    . LEU D  3  447  ? -148.197 28.095  32.974  1.00 88.80  ?  447  LEU C CA    1 
ATOM   5510  C  C     . LEU D  3  447  ? -149.079 26.936  32.527  1.00 108.31 ?  447  LEU C C     1 
ATOM   5511  O  O     . LEU D  3  447  ? -150.277 27.110  32.285  1.00 112.18 ?  447  LEU C O     1 
ATOM   5512  C  CB    . LEU D  3  447  ? -148.315 28.303  34.486  1.00 85.55  ?  447  LEU C CB    1 
ATOM   5513  C  CG    . LEU D  3  447  ? -147.281 27.602  35.372  1.00 100.49 ?  447  LEU C CG    1 
ATOM   5514  C  CD1   . LEU D  3  447  ? -147.527 27.927  36.839  1.00 102.07 ?  447  LEU C CD1   1 
ATOM   5515  C  CD2   . LEU D  3  447  ? -147.281 26.095  35.147  1.00 100.74 ?  447  LEU C CD2   1 
ATOM   5516  N  N     . ALA D  3  448  ? -148.481 25.749  32.423  1.00 110.56 ?  448  ALA C N     1 
ATOM   5517  C  CA    . ALA D  3  448  ? -149.171 24.597  31.856  1.00 104.68 ?  448  ALA C CA    1 
ATOM   5518  C  C     . ALA D  3  448  ? -149.906 23.757  32.892  1.00 113.04 ?  448  ALA C C     1 
ATOM   5519  O  O     . ALA D  3  448  ? -150.963 23.194  32.580  1.00 123.96 ?  448  ALA C O     1 
ATOM   5520  C  CB    . ALA D  3  448  ? -148.180 23.710  31.097  1.00 119.79 ?  448  ALA C CB    1 
ATOM   5521  N  N     . LEU D  3  449  ? -149.380 23.649  34.109  1.00 115.85 ?  449  LEU C N     1 
ATOM   5522  C  CA    . LEU D  3  449  ? -149.980 22.824  35.149  1.00 130.74 ?  449  LEU C CA    1 
ATOM   5523  C  C     . LEU D  3  449  ? -150.444 23.700  36.304  1.00 136.14 ?  449  LEU C C     1 
ATOM   5524  O  O     . LEU D  3  449  ? -149.750 24.642  36.701  1.00 132.79 ?  449  LEU C O     1 
ATOM   5525  C  CB    . LEU D  3  449  ? -148.992 21.762  35.651  1.00 124.06 ?  449  LEU C CB    1 
ATOM   5526  C  CG    . LEU D  3  449  ? -149.539 20.664  36.569  1.00 124.55 ?  449  LEU C CG    1 
ATOM   5527  C  CD1   . LEU D  3  449  ? -149.745 21.173  37.991  1.00 121.31 ?  449  LEU C CD1   1 
ATOM   5528  C  CD2   . LEU D  3  449  ? -150.837 20.097  36.010  1.00 104.60 ?  449  LEU C CD2   1 
ATOM   5529  N  N     . GLY D  3  450  ? -151.618 23.382  36.841  1.00 129.03 ?  450  GLY C N     1 
ATOM   5530  C  CA    . GLY D  3  450  ? -152.176 24.125  37.956  1.00 126.31 ?  450  GLY C CA    1 
ATOM   5531  C  C     . GLY D  3  450  ? -152.145 23.356  39.263  1.00 123.82 ?  450  GLY C C     1 
ATOM   5532  O  O     . GLY D  3  450  ? -152.435 23.906  40.325  1.00 113.74 ?  450  GLY C O     1 
ATOM   5533  N  N     . GLU D  3  462  ? -145.084 13.140  29.396  1.00 95.11  ?  462  GLU C N     1 
ATOM   5534  C  CA    . GLU D  3  462  ? -146.409 13.032  29.998  1.00 104.07 ?  462  GLU C CA    1 
ATOM   5535  C  C     . GLU D  3  462  ? -147.099 14.392  30.040  1.00 105.60 ?  462  GLU C C     1 
ATOM   5536  O  O     . GLU D  3  462  ? -147.656 14.848  29.041  1.00 101.90 ?  462  GLU C O     1 
ATOM   5537  C  CB    . GLU D  3  462  ? -146.309 12.442  31.398  1.00 94.32  ?  462  GLU C CB    1 
ATOM   5538  N  N     . VAL D  3  463  ? -147.059 15.038  31.208  1.00 103.94 ?  463  VAL C N     1 
ATOM   5539  C  CA    . VAL D  3  463  ? -147.658 16.360  31.347  1.00 97.13  ?  463  VAL C CA    1 
ATOM   5540  C  C     . VAL D  3  463  ? -146.876 17.430  30.597  1.00 110.29 ?  463  VAL C C     1 
ATOM   5541  O  O     . VAL D  3  463  ? -147.439 18.484  30.284  1.00 115.54 ?  463  VAL C O     1 
ATOM   5542  C  CB    . VAL D  3  463  ? -147.769 16.736  32.825  1.00 85.90  ?  463  VAL C CB    1 
ATOM   5543  N  N     . ARG D  3  464  ? -145.598 17.182  30.301  1.00 114.09 ?  464  ARG C N     1 
ATOM   5544  C  CA    . ARG D  3  464  ? -144.784 18.163  29.591  1.00 113.29 ?  464  ARG C CA    1 
ATOM   5545  C  C     . ARG D  3  464  ? -144.960 18.074  28.081  1.00 112.92 ?  464  ARG C C     1 
ATOM   5546  O  O     . ARG D  3  464  ? -144.759 19.072  27.379  1.00 116.39 ?  464  ARG C O     1 
ATOM   5547  C  CB    . ARG D  3  464  ? -143.306 17.980  29.942  1.00 104.99 ?  464  ARG C CB    1 
ATOM   5548  C  CG    . ARG D  3  464  ? -142.982 18.121  31.418  1.00 113.50 ?  464  ARG C CG    1 
ATOM   5549  C  CD    . ARG D  3  464  ? -141.515 17.816  31.681  1.00 96.56  ?  464  ARG C CD    1 
ATOM   5550  N  NE    . ARG D  3  464  ? -141.153 18.011  33.081  1.00 118.65 ?  464  ARG C NE    1 
ATOM   5551  C  CZ    . ARG D  3  464  ? -140.662 19.144  33.575  1.00 134.64 ?  464  ARG C CZ    1 
ATOM   5552  N  NH1   . ARG D  3  464  ? -140.472 20.189  32.780  1.00 131.33 ?  464  ARG C NH1   1 
ATOM   5553  N  NH2   . ARG D  3  464  ? -140.359 19.233  34.863  1.00 133.10 ?  464  ARG C NH2   1 
ATOM   5554  N  N     . ASP D  3  465  ? -145.324 16.903  27.565  1.00 119.85 ?  465  ASP C N     1 
ATOM   5555  C  CA    . ASP D  3  465  ? -145.404 16.716  26.124  1.00 123.10 ?  465  ASP C CA    1 
ATOM   5556  C  C     . ASP D  3  465  ? -146.493 17.600  25.528  1.00 125.34 ?  465  ASP C C     1 
ATOM   5557  O  O     . ASP D  3  465  ? -147.520 17.873  26.156  1.00 129.54 ?  465  ASP C O     1 
ATOM   5558  C  CB    . ASP D  3  465  ? -145.675 15.247  25.794  1.00 122.59 ?  465  ASP C CB    1 
ATOM   5559  C  CG    . ASP D  3  465  ? -145.111 14.839  24.447  1.00 135.82 ?  465  ASP C CG    1 
ATOM   5560  O  OD1   . ASP D  3  465  ? -144.900 15.727  23.594  1.00 133.64 ?  465  ASP C OD1   1 
ATOM   5561  O  OD2   . ASP D  3  465  ? -144.875 13.629  24.241  1.00 136.33 ?  465  ASP C OD2   1 
ATOM   5562  N  N     . VAL D  3  466  ? -146.257 18.055  24.294  1.00 116.78 ?  466  VAL C N     1 
ATOM   5563  C  CA    . VAL D  3  466  ? -147.243 18.888  23.619  1.00 125.83 ?  466  VAL C CA    1 
ATOM   5564  C  C     . VAL D  3  466  ? -148.449 18.043  23.218  1.00 136.60 ?  466  VAL C C     1 
ATOM   5565  O  O     . VAL D  3  466  ? -148.381 16.813  23.104  1.00 133.08 ?  466  VAL C O     1 
ATOM   5566  C  CB    . VAL D  3  466  ? -146.628 19.592  22.398  1.00 117.32 ?  466  VAL C CB    1 
ATOM   5567  C  CG1   . VAL D  3  466  ? -145.205 20.037  22.701  1.00 119.61 ?  466  VAL C CG1   1 
ATOM   5568  C  CG2   . VAL D  3  466  ? -146.668 18.684  21.180  1.00 122.58 ?  466  VAL C CG2   1 
ATOM   5569  N  N     . HIS D  3  467  ? -149.574 18.721  23.003  1.00 133.72 ?  467  HIS C N     1 
ATOM   5570  C  CA    . HIS D  3  467  ? -150.806 18.043  22.645  1.00 128.26 ?  467  HIS C CA    1 
ATOM   5571  C  C     . HIS D  3  467  ? -151.351 18.586  21.329  1.00 129.54 ?  467  HIS C C     1 
ATOM   5572  O  O     . HIS D  3  467  ? -151.195 19.775  21.031  1.00 129.83 ?  467  HIS C O     1 
ATOM   5573  C  CB    . HIS D  3  467  ? -151.867 18.209  23.740  1.00 128.28 ?  467  HIS C CB    1 
ATOM   5574  C  CG    . HIS D  3  467  ? -153.066 17.330  23.562  1.00 140.62 ?  467  HIS C CG    1 
ATOM   5575  N  ND1   . HIS D  3  467  ? -153.295 16.216  24.341  1.00 143.62 ?  467  HIS C ND1   1 
ATOM   5576  C  CD2   . HIS D  3  467  ? -154.109 17.406  22.701  1.00 135.77 ?  467  HIS C CD2   1 
ATOM   5577  C  CE1   . HIS D  3  467  ? -154.424 15.643  23.966  1.00 137.49 ?  467  HIS C CE1   1 
ATOM   5578  N  NE2   . HIS D  3  467  ? -154.938 16.345  22.973  1.00 132.24 ?  467  HIS C NE2   1 
ATOM   5579  N  N     . PRO D  3  468  ? -151.980 17.732  20.514  1.00 133.97 ?  468  PRO C N     1 
ATOM   5580  C  CA    . PRO D  3  468  ? -152.606 18.208  19.272  1.00 131.57 ?  468  PRO C CA    1 
ATOM   5581  C  C     . PRO D  3  468  ? -153.417 19.480  19.462  1.00 131.83 ?  468  PRO C C     1 
ATOM   5582  O  O     . PRO D  3  468  ? -153.460 20.337  18.574  1.00 129.84 ?  468  PRO C O     1 
ATOM   5583  C  CB    . PRO D  3  468  ? -153.511 17.037  18.865  1.00 128.33 ?  468  PRO C CB    1 
ATOM   5584  C  CG    . PRO D  3  468  ? -153.004 15.834  19.624  1.00 129.63 ?  468  PRO C CG    1 
ATOM   5585  C  CD    . PRO D  3  468  ? -151.926 16.263  20.579  1.00 132.87 ?  468  PRO C CD    1 
ATOM   5586  N  N     . SER D  3  469  ? -154.070 19.607  20.620  1.00 121.36 ?  469  SER C N     1 
ATOM   5587  C  CA    . SER D  3  469  ? -154.905 20.775  20.878  1.00 113.81 ?  469  SER C CA    1 
ATOM   5588  C  C     . SER D  3  469  ? -154.082 22.056  20.939  1.00 127.19 ?  469  SER C C     1 
ATOM   5589  O  O     . SER D  3  469  ? -154.605 23.143  20.665  1.00 122.72 ?  469  SER C O     1 
ATOM   5590  C  CB    . SER D  3  469  ? -155.684 20.584  22.180  1.00 123.32 ?  469  SER C CB    1 
ATOM   5591  O  OG    . SER D  3  469  ? -156.400 21.757  22.523  1.00 132.26 ?  469  SER C OG    1 
ATOM   5592  N  N     . HIS D  3  470  ? -152.800 21.954  21.291  1.00 130.05 ?  470  HIS C N     1 
ATOM   5593  C  CA    . HIS D  3  470  ? -151.948 23.131  21.410  1.00 116.29 ?  470  HIS C CA    1 
ATOM   5594  C  C     . HIS D  3  470  ? -151.702 23.829  20.078  1.00 113.02 ?  470  HIS C C     1 
ATOM   5595  O  O     . HIS D  3  470  ? -151.051 24.880  20.064  1.00 121.91 ?  470  HIS C O     1 
ATOM   5596  C  CB    . HIS D  3  470  ? -150.612 22.744  22.048  1.00 110.58 ?  470  HIS C CB    1 
ATOM   5597  C  CG    . HIS D  3  470  ? -150.744 22.173  23.426  1.00 131.74 ?  470  HIS C CG    1 
ATOM   5598  N  ND1   . HIS D  3  470  ? -149.659 21.753  24.165  1.00 131.81 ?  470  HIS C ND1   1 
ATOM   5599  C  CD2   . HIS D  3  470  ? -151.833 21.954  24.201  1.00 134.38 ?  470  HIS C CD2   1 
ATOM   5600  C  CE1   . HIS D  3  470  ? -150.074 21.299  25.334  1.00 131.67 ?  470  HIS C CE1   1 
ATOM   5601  N  NE2   . HIS D  3  470  ? -151.389 21.410  25.381  1.00 126.17 ?  470  HIS C NE2   1 
ATOM   5602  N  N     . TYR D  3  471  ? -152.199 23.284  18.969  1.00 118.67 ?  471  TYR C N     1 
ATOM   5603  C  CA    . TYR D  3  471  ? -152.026 23.929  17.675  1.00 123.49 ?  471  TYR C CA    1 
ATOM   5604  C  C     . TYR D  3  471  ? -152.747 25.270  17.655  1.00 122.04 ?  471  TYR C C     1 
ATOM   5605  O  O     . TYR D  3  471  ? -153.940 25.354  17.964  1.00 121.40 ?  471  TYR C O     1 
ATOM   5606  C  CB    . TYR D  3  471  ? -152.552 23.021  16.563  1.00 123.97 ?  471  TYR C CB    1 
ATOM   5607  C  CG    . TYR D  3  471  ? -152.316 23.537  15.159  1.00 115.14 ?  471  TYR C CG    1 
ATOM   5608  C  CD1   . TYR D  3  471  ? -153.201 24.427  14.566  1.00 124.42 ?  471  TYR C CD1   1 
ATOM   5609  C  CD2   . TYR D  3  471  ? -151.215 23.120  14.422  1.00 110.69 ?  471  TYR C CD2   1 
ATOM   5610  C  CE1   . TYR D  3  471  ? -152.992 24.896  13.283  1.00 125.54 ?  471  TYR C CE1   1 
ATOM   5611  C  CE2   . TYR D  3  471  ? -150.998 23.584  13.138  1.00 126.34 ?  471  TYR C CE2   1 
ATOM   5612  C  CZ    . TYR D  3  471  ? -151.890 24.471  12.573  1.00 128.29 ?  471  TYR C CZ    1 
ATOM   5613  O  OH    . TYR D  3  471  ? -151.679 24.936  11.295  1.00 123.71 ?  471  TYR C OH    1 
ATOM   5614  N  N     . GLY D  3  472  ? -152.017 26.324  17.294  1.00 118.23 ?  472  GLY C N     1 
ATOM   5615  C  CA    . GLY D  3  472  ? -152.579 27.656  17.232  1.00 117.05 ?  472  GLY C CA    1 
ATOM   5616  C  C     . GLY D  3  472  ? -152.886 28.298  18.566  1.00 113.41 ?  472  GLY C C     1 
ATOM   5617  O  O     . GLY D  3  472  ? -153.374 29.433  18.587  1.00 111.53 ?  472  GLY C O     1 
ATOM   5618  N  N     . ARG D  3  473  ? -152.619 27.616  19.680  1.00 107.22 ?  473  ARG C N     1 
ATOM   5619  C  CA    . ARG D  3  473  ? -152.874 28.159  21.011  1.00 100.98 ?  473  ARG C CA    1 
ATOM   5620  C  C     . ARG D  3  473  ? -151.564 28.398  21.754  1.00 99.33  ?  473  ARG C C     1 
ATOM   5621  O  O     . ARG D  3  473  ? -151.153 29.548  21.924  1.00 106.58 ?  473  ARG C O     1 
ATOM   5622  C  CB    . ARG D  3  473  ? -153.794 27.226  21.801  1.00 98.79  ?  473  ARG C CB    1 
ATOM   5623  N  N     . MET D  3  474  ? -150.895 27.343  22.207  1.00 90.06  ?  474  MET C N     1 
ATOM   5624  C  CA    . MET D  3  474  ? -149.621 27.456  22.900  1.00 95.12  ?  474  MET C CA    1 
ATOM   5625  C  C     . MET D  3  474  ? -148.491 27.037  21.969  1.00 105.65 ?  474  MET C C     1 
ATOM   5626  O  O     . MET D  3  474  ? -148.597 26.029  21.263  1.00 114.02 ?  474  MET C O     1 
ATOM   5627  C  CB    . MET D  3  474  ? -149.605 26.597  24.167  1.00 83.18  ?  474  MET C CB    1 
ATOM   5628  C  CG    . MET D  3  474  ? -148.364 26.782  25.025  1.00 100.74 ?  474  MET C CG    1 
ATOM   5629  S  SD    . MET D  3  474  ? -148.429 25.828  26.554  1.00 136.47 ?  474  MET C SD    1 
ATOM   5630  C  CE    . MET D  3  474  ? -148.494 24.157  25.912  1.00 120.23 ?  474  MET C CE    1 
ATOM   5631  N  N     . CYS D  3  475  ? -147.414 27.810  21.972  1.00 104.01 ?  475  CYS C N     1 
ATOM   5632  C  CA    . CYS D  3  475  ? -146.282 27.529  21.097  1.00 110.85 ?  475  CYS C CA    1 
ATOM   5633  C  C     . CYS D  3  475  ? -145.475 26.354  21.635  1.00 115.95 ?  475  CYS C C     1 
ATOM   5634  O  O     . CYS D  3  475  ? -144.925 26.445  22.741  1.00 103.59 ?  475  CYS C O     1 
ATOM   5635  C  CB    . CYS D  3  475  ? -145.396 28.763  20.962  1.00 105.20 ?  475  CYS C CB    1 
ATOM   5636  S  SG    . CYS D  3  475  ? -143.952 28.524  19.902  1.00 120.90 ?  475  CYS C SG    1 
ATOM   5637  N  N     . PRO D  3  476  ? -145.381 25.241  20.901  1.00 125.45 ?  476  PRO C N     1 
ATOM   5638  C  CA    . PRO D  3  476  ? -144.561 24.113  21.361  1.00 119.35 ?  476  PRO C CA    1 
ATOM   5639  C  C     . PRO D  3  476  ? -143.069 24.318  21.168  1.00 116.54 ?  476  PRO C C     1 
ATOM   5640  O  O     . PRO D  3  476  ? -142.278 23.565  21.755  1.00 117.88 ?  476  PRO C O     1 
ATOM   5641  C  CB    . PRO D  3  476  ? -145.067 22.953  20.499  1.00 127.04 ?  476  PRO C CB    1 
ATOM   5642  C  CG    . PRO D  3  476  ? -145.491 23.617  19.219  1.00 119.19 ?  476  PRO C CG    1 
ATOM   5643  C  CD    . PRO D  3  476  ? -146.058 24.953  19.623  1.00 126.39 ?  476  PRO C CD    1 
ATOM   5644  N  N     . ILE D  3  477  ? -142.660 25.303  20.361  1.00 113.66 ?  477  ILE C N     1 
ATOM   5645  C  CA    . ILE D  3  477  ? -141.247 25.537  20.087  1.00 113.67 ?  477  ILE C CA    1 
ATOM   5646  C  C     . ILE D  3  477  ? -140.591 26.439  21.121  1.00 113.50 ?  477  ILE C C     1 
ATOM   5647  O  O     . ILE D  3  477  ? -139.379 26.679  21.039  1.00 107.64 ?  477  ILE C O     1 
ATOM   5648  C  CB    . ILE D  3  477  ? -141.051 26.153  18.686  1.00 106.34 ?  477  ILE C CB    1 
ATOM   5649  C  CG1   . ILE D  3  477  ? -141.951 25.458  17.664  1.00 117.56 ?  477  ILE C CG1   1 
ATOM   5650  C  CG2   . ILE D  3  477  ? -139.592 26.063  18.258  1.00 104.76 ?  477  ILE C CG2   1 
ATOM   5651  C  CD1   . ILE D  3  477  ? -141.685 23.980  17.521  1.00 122.10 ?  477  ILE C CD1   1 
ATOM   5652  N  N     . GLU D  3  478  ? -141.348 26.945  22.092  1.00 114.53 ?  478  GLU C N     1 
ATOM   5653  C  CA    . GLU D  3  478  ? -140.847 27.919  23.054  1.00 110.34 ?  478  GLU C CA    1 
ATOM   5654  C  C     . GLU D  3  478  ? -141.059 27.384  24.462  1.00 108.50 ?  478  GLU C C     1 
ATOM   5655  O  O     . GLU D  3  478  ? -142.202 27.199  24.894  1.00 110.13 ?  478  GLU C O     1 
ATOM   5656  C  CB    . GLU D  3  478  ? -141.548 29.267  22.873  1.00 99.12  ?  478  GLU C CB    1 
ATOM   5657  C  CG    . GLU D  3  478  ? -140.790 30.451  23.445  1.00 100.65 ?  478  GLU C CG    1 
ATOM   5658  C  CD    . GLU D  3  478  ? -141.357 31.777  22.974  1.00 114.75 ?  478  GLU C CD    1 
ATOM   5659  O  OE1   . GLU D  3  478  ? -142.483 31.784  22.434  1.00 114.49 ?  478  GLU C OE1   1 
ATOM   5660  O  OE2   . GLU D  3  478  ? -140.678 32.812  23.136  1.00 115.95 ?  478  GLU C OE2   1 
ATOM   5661  N  N     . THR D  3  479  ? -139.960 27.136  25.170  1.00 100.73 ?  479  THR C N     1 
ATOM   5662  C  CA    . THR D  3  479  ? -140.008 26.652  26.543  1.00 103.78 ?  479  THR C CA    1 
ATOM   5663  C  C     . THR D  3  479  ? -138.600 26.632  27.127  1.00 102.49 ?  479  THR C C     1 
ATOM   5664  O  O     . THR D  3  479  ? -137.627 26.412  26.395  1.00 105.74 ?  479  THR C O     1 
ATOM   5665  C  CB    . THR D  3  479  ? -140.639 25.259  26.608  1.00 102.86 ?  479  THR C CB    1 
ATOM   5666  O  OG1   . THR D  3  479  ? -140.713 24.826  27.972  1.00 108.52 ?  479  THR C OG1   1 
ATOM   5667  C  CG2   . THR D  3  479  ? -139.813 24.262  25.810  1.00 105.92 ?  479  THR C CG2   1 
ATOM   5668  N  N     . PRO D  3  480  ? -138.449 26.862  28.430  1.00 86.78  ?  480  PRO C N     1 
ATOM   5669  C  CA    . PRO D  3  480  ? -137.105 26.902  29.018  1.00 104.35 ?  480  PRO C CA    1 
ATOM   5670  C  C     . PRO D  3  480  ? -136.341 25.611  28.770  1.00 114.44 ?  480  PRO C C     1 
ATOM   5671  O  O     . PRO D  3  480  ? -136.920 24.529  28.654  1.00 117.42 ?  480  PRO C O     1 
ATOM   5672  C  CB    . PRO D  3  480  ? -137.379 27.108  30.512  1.00 114.91 ?  480  PRO C CB    1 
ATOM   5673  C  CG    . PRO D  3  480  ? -138.727 27.750  30.561  1.00 104.30 ?  480  PRO C CG    1 
ATOM   5674  C  CD    . PRO D  3  480  ? -139.498 27.156  29.419  1.00 88.49  ?  480  PRO C CD    1 
ATOM   5675  N  N     . GLU D  3  481  ? -135.014 25.739  28.687  1.00 121.03 ?  481  GLU C N     1 
ATOM   5676  C  CA    . GLU D  3  481  ? -134.165 24.566  28.514  1.00 120.80 ?  481  GLU C CA    1 
ATOM   5677  C  C     . GLU D  3  481  ? -133.976 23.804  29.819  1.00 126.47 ?  481  GLU C C     1 
ATOM   5678  O  O     . GLU D  3  481  ? -133.772 22.585  29.795  1.00 132.16 ?  481  GLU C O     1 
ATOM   5679  C  CB    . GLU D  3  481  ? -132.803 24.973  27.949  1.00 113.46 ?  481  GLU C CB    1 
ATOM   5680  C  CG    . GLU D  3  481  ? -132.870 25.753  26.646  1.00 124.29 ?  481  GLU C CG    1 
ATOM   5681  C  CD    . GLU D  3  481  ? -131.496 26.047  26.072  1.00 125.88 ?  481  GLU C CD    1 
ATOM   5682  O  OE1   . GLU D  3  481  ? -130.537 25.328  26.424  1.00 127.44 ?  481  GLU C OE1   1 
ATOM   5683  O  OE2   . GLU D  3  481  ? -131.376 26.998  25.271  1.00 117.84 ?  481  GLU C OE2   1 
ATOM   5684  N  N     . GLY D  3  482  ? -134.040 24.494  30.955  1.00 115.30 ?  482  GLY C N     1 
ATOM   5685  C  CA    . GLY D  3  482  ? -133.861 23.868  32.242  1.00 127.43 ?  482  GLY C CA    1 
ATOM   5686  C  C     . GLY D  3  482  ? -134.924 22.828  32.535  1.00 134.69 ?  482  GLY C C     1 
ATOM   5687  O  O     . GLY D  3  482  ? -135.753 22.493  31.683  1.00 132.91 ?  482  GLY C O     1 
ATOM   5688  N  N     . PRO D  3  483  ? -134.922 22.298  33.760  1.00 130.48 ?  483  PRO C N     1 
ATOM   5689  C  CA    . PRO D  3  483  ? -135.909 21.269  34.120  1.00 135.01 ?  483  PRO C CA    1 
ATOM   5690  C  C     . PRO D  3  483  ? -137.319 21.820  34.288  1.00 136.77 ?  483  PRO C C     1 
ATOM   5691  O  O     . PRO D  3  483  ? -138.061 21.377  35.170  1.00 139.15 ?  483  PRO C O     1 
ATOM   5692  C  CB    . PRO D  3  483  ? -135.362 20.712  35.441  1.00 137.50 ?  483  PRO C CB    1 
ATOM   5693  C  CG    . PRO D  3  483  ? -134.569 21.835  36.019  1.00 132.13 ?  483  PRO C CG    1 
ATOM   5694  C  CD    . PRO D  3  483  ? -133.965 22.560  34.849  1.00 116.54 ?  483  PRO C CD    1 
ATOM   5695  N  N     . ASN D  3  484  ? -137.700 22.787  33.450  1.00 133.50 ?  484  ASN C N     1 
ATOM   5696  C  CA    . ASN D  3  484  ? -139.051 23.337  33.442  1.00 122.58 ?  484  ASN C CA    1 
ATOM   5697  C  C     . ASN D  3  484  ? -139.694 23.220  32.066  1.00 117.95 ?  484  ASN C C     1 
ATOM   5698  O  O     . ASN D  3  484  ? -140.687 23.902  31.786  1.00 110.94 ?  484  ASN C O     1 
ATOM   5699  C  CB    . ASN D  3  484  ? -139.047 24.797  33.895  1.00 108.62 ?  484  ASN C CB    1 
ATOM   5700  C  CG    . ASN D  3  484  ? -138.799 24.946  35.380  1.00 117.85 ?  484  ASN C CG    1 
ATOM   5701  O  OD1   . ASN D  3  484  ? -139.297 24.162  36.188  1.00 124.03 ?  484  ASN C OD1   1 
ATOM   5702  N  ND2   . ASN D  3  484  ? -138.026 25.960  35.750  1.00 130.08 ?  484  ASN C ND2   1 
ATOM   5703  N  N     . ILE D  3  485  ? -139.136 22.373  31.199  1.00 116.17 ?  485  ILE C N     1 
ATOM   5704  C  CA    . ILE D  3  485  ? -139.664 22.228  29.851  1.00 108.93 ?  485  ILE C CA    1 
ATOM   5705  C  C     . ILE D  3  485  ? -141.104 21.757  29.914  1.00 109.37 ?  485  ILE C C     1 
ATOM   5706  O  O     . ILE D  3  485  ? -141.466 20.894  30.726  1.00 122.09 ?  485  ILE C O     1 
ATOM   5707  C  CB    . ILE D  3  485  ? -138.800 21.248  29.041  1.00 116.28 ?  485  ILE C CB    1 
ATOM   5708  C  CG1   . ILE D  3  485  ? -137.326 21.626  29.161  1.00 118.82 ?  485  ILE C CG1   1 
ATOM   5709  C  CG2   . ILE D  3  485  ? -139.248 21.212  27.582  1.00 104.23 ?  485  ILE C CG2   1 
ATOM   5710  C  CD1   . ILE D  3  485  ? -136.388 20.675  28.461  1.00 117.96 ?  485  ILE C CD1   1 
ATOM   5711  N  N     . GLY D  3  486  ? -141.937 22.323  29.048  1.00 105.83 ?  486  GLY C N     1 
ATOM   5712  C  CA    . GLY D  3  486  ? -143.316 21.885  28.976  1.00 116.48 ?  486  GLY C CA    1 
ATOM   5713  C  C     . GLY D  3  486  ? -144.202 22.615  29.962  1.00 110.55 ?  486  GLY C C     1 
ATOM   5714  O  O     . GLY D  3  486  ? -145.326 22.999  29.628  1.00 95.76  ?  486  GLY C O     1 
ATOM   5715  N  N     . LEU D  3  487  ? -143.709 22.803  31.189  1.00 109.13 ?  487  LEU C N     1 
ATOM   5716  C  CA    . LEU D  3  487  ? -144.481 23.524  32.197  1.00 103.34 ?  487  LEU C CA    1 
ATOM   5717  C  C     . LEU D  3  487  ? -144.782 24.951  31.752  1.00 101.54 ?  487  LEU C C     1 
ATOM   5718  O  O     . LEU D  3  487  ? -145.885 25.461  31.981  1.00 107.63 ?  487  LEU C O     1 
ATOM   5719  C  CB    . LEU D  3  487  ? -143.728 23.531  33.527  1.00 106.39 ?  487  LEU C CB    1 
ATOM   5720  C  CG    . LEU D  3  487  ? -142.964 22.254  33.888  1.00 110.75 ?  487  LEU C CG    1 
ATOM   5721  C  CD1   . LEU D  3  487  ? -142.275 22.415  35.234  1.00 108.31 ?  487  LEU C CD1   1 
ATOM   5722  C  CD2   . LEU D  3  487  ? -143.892 21.050  33.892  1.00 111.37 ?  487  LEU C CD2   1 
ATOM   5723  N  N     . ILE D  3  488  ? -143.813 25.614  31.126  1.00 106.61 ?  488  ILE C N     1 
ATOM   5724  C  CA    . ILE D  3  488  ? -143.924 27.017  30.746  1.00 87.58  ?  488  ILE C CA    1 
ATOM   5725  C  C     . ILE D  3  488  ? -143.996 27.107  29.230  1.00 82.74  ?  488  ILE C C     1 
ATOM   5726  O  O     . ILE D  3  488  ? -143.238 26.436  28.521  1.00 93.84  ?  488  ILE C O     1 
ATOM   5727  C  CB    . ILE D  3  488  ? -142.739 27.839  31.287  1.00 83.05  ?  488  ILE C CB    1 
ATOM   5728  C  CG1   . ILE D  3  488  ? -142.627 27.668  32.804  1.00 96.24  ?  488  ILE C CG1   1 
ATOM   5729  C  CG2   . ILE D  3  488  ? -142.889 29.302  30.914  1.00 83.25  ?  488  ILE C CG2   1 
ATOM   5730  C  CD1   . ILE D  3  488  ? -141.379 28.268  33.403  1.00 100.68 ?  488  ILE C CD1   1 
ATOM   5731  N  N     . GLY D  3  489  ? -144.904 27.936  28.738  1.00 78.13  ?  489  GLY C N     1 
ATOM   5732  C  CA    . GLY D  3  489  ? -145.060 28.121  27.305  1.00 90.07  ?  489  GLY C CA    1 
ATOM   5733  C  C     . GLY D  3  489  ? -145.651 29.478  27.006  1.00 82.28  ?  489  GLY C C     1 
ATOM   5734  O  O     . GLY D  3  489  ? -146.457 30.008  27.776  1.00 92.06  ?  489  GLY C O     1 
ATOM   5735  N  N     . SER D  3  490  ? -145.239 30.047  25.878  1.00 74.73  ?  490  SER C N     1 
ATOM   5736  C  CA    . SER D  3  490  ? -145.727 31.349  25.451  1.00 83.16  ?  490  SER C CA    1 
ATOM   5737  C  C     . SER D  3  490  ? -146.921 31.185  24.519  1.00 87.26  ?  490  SER C C     1 
ATOM   5738  O  O     . SER D  3  490  ? -147.026 30.204  23.779  1.00 82.17  ?  490  SER C O     1 
ATOM   5739  C  CB    . SER D  3  490  ? -144.621 32.140  24.751  1.00 104.44 ?  490  SER C CB    1 
ATOM   5740  O  OG    . SER D  3  490  ? -144.131 31.433  23.626  1.00 117.64 ?  490  SER C OG    1 
ATOM   5741  N  N     . LEU D  3  491  ? -147.825 32.160  24.565  1.00 98.07  ?  491  LEU C N     1 
ATOM   5742  C  CA    . LEU D  3  491  ? -149.038 32.096  23.763  1.00 94.06  ?  491  LEU C CA    1 
ATOM   5743  C  C     . LEU D  3  491  ? -148.718 32.247  22.281  1.00 88.92  ?  491  LEU C C     1 
ATOM   5744  O  O     . LEU D  3  491  ? -147.734 32.883  21.894  1.00 91.43  ?  491  LEU C O     1 
ATOM   5745  C  CB    . LEU D  3  491  ? -150.018 33.186  24.193  1.00 96.49  ?  491  LEU C CB    1 
ATOM   5746  C  CG    . LEU D  3  491  ? -151.414 33.101  23.576  1.00 100.75 ?  491  LEU C CG    1 
ATOM   5747  C  CD1   . LEU D  3  491  ? -152.235 32.017  24.261  1.00 98.65  ?  491  LEU C CD1   1 
ATOM   5748  C  CD2   . LEU D  3  491  ? -152.119 34.447  23.639  1.00 100.83 ?  491  LEU C CD2   1 
ATOM   5749  N  N     . SER D  3  492  ? -149.568 31.653  21.447  1.00 95.90  ?  492  SER C N     1 
ATOM   5750  C  CA    . SER D  3  492  ? -149.395 31.748  20.007  1.00 98.60  ?  492  SER C CA    1 
ATOM   5751  C  C     . SER D  3  492  ? -149.741 33.155  19.521  1.00 97.20  ?  492  SER C C     1 
ATOM   5752  O  O     . SER D  3  492  ? -150.334 33.966  20.238  1.00 98.40  ?  492  SER C O     1 
ATOM   5753  C  CB    . SER D  3  492  ? -150.255 30.707  19.294  1.00 101.50 ?  492  SER C CB    1 
ATOM   5754  O  OG    . SER D  3  492  ? -149.838 29.392  19.620  1.00 116.46 ?  492  SER C OG    1 
ATOM   5755  N  N     . VAL D  3  493  ? -149.367 33.435  18.272  1.00 88.72  ?  493  VAL C N     1 
ATOM   5756  C  CA    . VAL D  3  493  ? -149.529 34.780  17.724  1.00 90.66  ?  493  VAL C CA    1 
ATOM   5757  C  C     . VAL D  3  493  ? -150.999 35.185  17.726  1.00 98.41  ?  493  VAL C C     1 
ATOM   5758  O  O     . VAL D  3  493  ? -151.391 36.175  18.356  1.00 101.81 ?  493  VAL C O     1 
ATOM   5759  C  CB    . VAL D  3  493  ? -148.928 34.862  16.310  1.00 83.12  ?  493  VAL C CB    1 
ATOM   5760  C  CG1   . VAL D  3  493  ? -149.168 36.239  15.710  1.00 96.65  ?  493  VAL C CG1   1 
ATOM   5761  C  CG2   . VAL D  3  493  ? -147.442 34.549  16.350  1.00 99.51  ?  493  VAL C CG2   1 
ATOM   5762  N  N     . TYR D  3  494  ? -151.832 34.426  17.020  1.00 94.87  ?  494  TYR C N     1 
ATOM   5763  C  CA    . TYR D  3  494  ? -153.225 34.790  16.800  1.00 93.76  ?  494  TYR C CA    1 
ATOM   5764  C  C     . TYR D  3  494  ? -154.159 34.262  17.883  1.00 96.52  ?  494  TYR C C     1 
ATOM   5765  O  O     . TYR D  3  494  ? -155.378 34.421  17.763  1.00 94.56  ?  494  TYR C O     1 
ATOM   5766  C  CB    . TYR D  3  494  ? -153.681 34.293  15.425  1.00 80.66  ?  494  TYR C CB    1 
ATOM   5767  C  CG    . TYR D  3  494  ? -152.807 34.783  14.295  1.00 76.47  ?  494  TYR C CG    1 
ATOM   5768  C  CD1   . TYR D  3  494  ? -151.603 34.156  14.003  1.00 100.30 ?  494  TYR C CD1   1 
ATOM   5769  C  CD2   . TYR D  3  494  ? -153.179 35.877  13.527  1.00 96.06  ?  494  TYR C CD2   1 
ATOM   5770  C  CE1   . TYR D  3  494  ? -150.796 34.603  12.976  1.00 115.63 ?  494  TYR C CE1   1 
ATOM   5771  C  CE2   . TYR D  3  494  ? -152.379 36.331  12.496  1.00 106.94 ?  494  TYR C CE2   1 
ATOM   5772  C  CZ    . TYR D  3  494  ? -151.188 35.689  12.225  1.00 115.12 ?  494  TYR C CZ    1 
ATOM   5773  O  OH    . TYR D  3  494  ? -150.383 36.134  11.201  1.00 116.97 ?  494  TYR C OH    1 
ATOM   5774  N  N     . ALA D  3  495  ? -153.619 33.651  18.935  1.00 90.60  ?  495  ALA C N     1 
ATOM   5775  C  CA    . ALA D  3  495  ? -154.459 33.105  19.992  1.00 93.70  ?  495  ALA C CA    1 
ATOM   5776  C  C     . ALA D  3  495  ? -155.327 34.196  20.607  1.00 102.14 ?  495  ALA C C     1 
ATOM   5777  O  O     . ALA D  3  495  ? -154.846 35.287  20.923  1.00 123.17 ?  495  ALA C O     1 
ATOM   5778  C  CB    . ALA D  3  495  ? -153.594 32.448  21.066  1.00 92.03  ?  495  ALA C CB    1 
ATOM   5779  N  N     . ARG D  3  496  ? -156.613 33.897  20.768  1.00 109.04 ?  496  ARG C N     1 
ATOM   5780  C  CA    . ARG D  3  496  ? -157.563 34.791  21.414  1.00 101.46 ?  496  ARG C CA    1 
ATOM   5781  C  C     . ARG D  3  496  ? -158.284 34.035  22.518  1.00 104.82 ?  496  ARG C C     1 
ATOM   5782  O  O     . ARG D  3  496  ? -158.643 32.866  22.349  1.00 120.27 ?  496  ARG C O     1 
ATOM   5783  C  CB    . ARG D  3  496  ? -158.575 35.356  20.410  1.00 111.44 ?  496  ARG C CB    1 
ATOM   5784  C  CG    . ARG D  3  496  ? -159.808 35.974  21.049  1.00 108.62 ?  496  ARG C CG    1 
ATOM   5785  C  CD    . ARG D  3  496  ? -160.705 36.622  20.005  1.00 116.25 ?  496  ARG C CD    1 
ATOM   5786  N  NE    . ARG D  3  496  ? -160.860 35.783  18.820  1.00 126.70 ?  496  ARG C NE    1 
ATOM   5787  C  CZ    . ARG D  3  496  ? -161.713 34.769  18.727  1.00 130.25 ?  496  ARG C CZ    1 
ATOM   5788  N  NH1   . ARG D  3  496  ? -162.494 34.460  19.754  1.00 129.93 ?  496  ARG C NH1   1 
ATOM   5789  N  NH2   . ARG D  3  496  ? -161.783 34.061  17.608  1.00 123.59 ?  496  ARG C NH2   1 
ATOM   5790  N  N     . VAL D  3  497  ? -158.492 34.705  23.646  1.00 96.74  ?  497  VAL C N     1 
ATOM   5791  C  CA    . VAL D  3  497  ? -159.105 34.100  24.824  1.00 117.58 ?  497  VAL C CA    1 
ATOM   5792  C  C     . VAL D  3  497  ? -160.574 34.490  24.878  1.00 132.28 ?  497  VAL C C     1 
ATOM   5793  O  O     . VAL D  3  497  ? -160.932 35.650  24.634  1.00 129.46 ?  497  VAL C O     1 
ATOM   5794  C  CB    . VAL D  3  497  ? -158.370 34.528  26.108  1.00 114.83 ?  497  VAL C CB    1 
ATOM   5795  C  CG1   . VAL D  3  497  ? -158.867 33.725  27.302  1.00 122.39 ?  497  VAL C CG1   1 
ATOM   5796  C  CG2   . VAL D  3  497  ? -156.869 34.372  25.934  1.00 100.94 ?  497  VAL C CG2   1 
ATOM   5797  N  N     . ASN D  3  498  ? -161.427 33.523  25.197  1.00 135.47 ?  498  ASN C N     1 
ATOM   5798  C  CA    . ASN D  3  498  ? -162.858 33.763  25.304  1.00 134.11 ?  498  ASN C CA    1 
ATOM   5799  C  C     . ASN D  3  498  ? -163.207 34.286  26.692  1.00 134.77 ?  498  ASN C C     1 
ATOM   5800  O  O     . ASN D  3  498  ? -162.359 34.341  27.585  1.00 137.75 ?  498  ASN C O     1 
ATOM   5801  C  CB    . ASN D  3  498  ? -163.626 32.483  24.989  1.00 130.07 ?  498  ASN C CB    1 
ATOM   5802  C  CG    . ASN D  3  498  ? -163.966 32.358  23.516  1.00 130.42 ?  498  ASN C CG    1 
ATOM   5803  O  OD1   . ASN D  3  498  ? -163.166 32.709  22.648  1.00 118.45 ?  498  ASN C OD1   1 
ATOM   5804  N  ND2   . ASN D  3  498  ? -165.167 31.870  23.227  1.00 130.28 ?  498  ASN C ND2   1 
ATOM   5805  N  N     . PRO D  3  499  ? -164.465 34.687  26.902  1.00 134.30 ?  499  PRO C N     1 
ATOM   5806  C  CA    . PRO D  3  499  ? -164.834 35.307  28.189  1.00 124.27 ?  499  PRO C CA    1 
ATOM   5807  C  C     . PRO D  3  499  ? -164.395 34.520  29.414  1.00 126.50 ?  499  PRO C C     1 
ATOM   5808  O  O     . PRO D  3  499  ? -163.834 35.105  30.349  1.00 131.60 ?  499  PRO C O     1 
ATOM   5809  C  CB    . PRO D  3  499  ? -166.360 35.413  28.084  1.00 118.81 ?  499  PRO C CB    1 
ATOM   5810  C  CG    . PRO D  3  499  ? -166.613 35.556  26.621  1.00 125.80 ?  499  PRO C CG    1 
ATOM   5811  C  CD    . PRO D  3  499  ? -165.584 34.694  25.943  1.00 132.49 ?  499  PRO C CD    1 
ATOM   5812  N  N     . PHE D  3  500  ? -164.639 33.208  29.446  1.00 135.50 ?  500  PHE C N     1 
ATOM   5813  C  CA    . PHE D  3  500  ? -164.220 32.419  30.601  1.00 144.95 ?  500  PHE C CA    1 
ATOM   5814  C  C     . PHE D  3  500  ? -162.703 32.390  30.726  1.00 153.45 ?  500  PHE C C     1 
ATOM   5815  O  O     . PHE D  3  500  ? -162.153 32.630  31.807  1.00 159.99 ?  500  PHE C O     1 
ATOM   5816  C  CB    . PHE D  3  500  ? -164.767 30.995  30.506  1.00 137.01 ?  500  PHE C CB    1 
ATOM   5817  C  CG    . PHE D  3  500  ? -164.023 30.011  31.363  1.00 136.25 ?  500  PHE C CG    1 
ATOM   5818  C  CD1   . PHE D  3  500  ? -163.066 29.175  30.812  1.00 136.95 ?  500  PHE C CD1   1 
ATOM   5819  C  CD2   . PHE D  3  500  ? -164.262 29.940  32.725  1.00 143.73 ?  500  PHE C CD2   1 
ATOM   5820  C  CE1   . PHE D  3  500  ? -162.374 28.276  31.600  1.00 136.77 ?  500  PHE C CE1   1 
ATOM   5821  C  CE2   . PHE D  3  500  ? -163.572 29.043  33.519  1.00 140.80 ?  500  PHE C CE2   1 
ATOM   5822  C  CZ    . PHE D  3  500  ? -162.627 28.210  32.955  1.00 124.83 ?  500  PHE C CZ    1 
ATOM   5823  N  N     . GLY D  3  501  ? -162.011 32.088  29.632  1.00 142.57 ?  501  GLY C N     1 
ATOM   5824  C  CA    . GLY D  3  501  ? -160.570 31.950  29.658  1.00 138.01 ?  501  GLY C CA    1 
ATOM   5825  C  C     . GLY D  3  501  ? -160.100 30.852  28.729  1.00 141.42 ?  501  GLY C C     1 
ATOM   5826  O  O     . GLY D  3  501  ? -158.908 30.750  28.422  1.00 145.48 ?  501  GLY C O     1 
ATOM   5827  N  N     . PHE D  3  502  ? -161.034 30.017  28.280  1.00 140.49 ?  502  PHE C N     1 
ATOM   5828  C  CA    . PHE D  3  502  ? -160.710 28.981  27.311  1.00 139.67 ?  502  PHE C CA    1 
ATOM   5829  C  C     . PHE D  3  502  ? -160.175 29.617  26.035  1.00 129.79 ?  502  PHE C C     1 
ATOM   5830  O  O     . PHE D  3  502  ? -160.881 30.378  25.365  1.00 120.57 ?  502  PHE C O     1 
ATOM   5831  C  CB    . PHE D  3  502  ? -161.944 28.130  27.014  1.00 121.95 ?  502  PHE C CB    1 
ATOM   5832  N  N     . ILE D  3  503  ? -158.920 29.308  25.704  1.00 110.68 ?  503  ILE C N     1 
ATOM   5833  C  CA    . ILE D  3  503  ? -158.289 29.916  24.542  1.00 110.85 ?  503  ILE C CA    1 
ATOM   5834  C  C     . ILE D  3  503  ? -159.049 29.540  23.279  1.00 117.74 ?  503  ILE C C     1 
ATOM   5835  O  O     . ILE D  3  503  ? -159.493 28.397  23.108  1.00 134.93 ?  503  ILE C O     1 
ATOM   5836  C  CB    . ILE D  3  503  ? -156.815 29.490  24.445  1.00 121.32 ?  503  ILE C CB    1 
ATOM   5837  C  CG1   . ILE D  3  503  ? -156.051 29.919  25.699  1.00 119.74 ?  503  ILE C CG1   1 
ATOM   5838  C  CG2   . ILE D  3  503  ? -156.173 30.073  23.193  1.00 106.19 ?  503  ILE C CG2   1 
ATOM   5839  C  CD1   . ILE D  3  503  ? -154.591 29.528  25.685  1.00 123.09 ?  503  ILE C CD1   1 
ATOM   5840  N  N     . GLU D  3  504  ? -159.206 30.512  22.386  1.00 114.17 ?  504  GLU C N     1 
ATOM   5841  C  CA    . GLU D  3  504  ? -159.801 30.296  21.078  1.00 119.77 ?  504  GLU C CA    1 
ATOM   5842  C  C     . GLU D  3  504  ? -158.756 30.556  20.002  1.00 109.20 ?  504  GLU C C     1 
ATOM   5843  O  O     . GLU D  3  504  ? -157.821 31.337  20.199  1.00 113.00 ?  504  GLU C O     1 
ATOM   5844  C  CB    . GLU D  3  504  ? -161.020 31.201  20.856  1.00 125.76 ?  504  GLU C CB    1 
ATOM   5845  N  N     . THR D  3  505  ? -158.916 29.889  18.863  1.00 107.91 ?  505  THR C N     1 
ATOM   5846  C  CA    . THR D  3  505  ? -157.981 30.068  17.772  1.00 115.45 ?  505  THR C CA    1 
ATOM   5847  C  C     . THR D  3  505  ? -158.711 30.552  16.526  1.00 121.52 ?  505  THR C C     1 
ATOM   5848  O  O     . THR D  3  505  ? -159.825 30.096  16.245  1.00 131.01 ?  505  THR C O     1 
ATOM   5849  C  CB    . THR D  3  505  ? -157.239 28.761  17.453  1.00 137.51 ?  505  THR C CB    1 
ATOM   5850  O  OG1   . THR D  3  505  ? -156.688 28.216  18.659  1.00 137.74 ?  505  THR C OG1   1 
ATOM   5851  C  CG2   . THR D  3  505  ? -156.114 29.015  16.459  1.00 132.52 ?  505  THR C CG2   1 
ATOM   5852  N  N     . PRO D  3  506  ? -158.119 31.472  15.767  1.00 117.50 ?  506  PRO C N     1 
ATOM   5853  C  CA    . PRO D  3  506  ? -158.784 31.961  14.552  1.00 130.68 ?  506  PRO C CA    1 
ATOM   5854  C  C     . PRO D  3  506  ? -158.870 30.864  13.502  1.00 136.02 ?  506  PRO C C     1 
ATOM   5855  O  O     . PRO D  3  506  ? -157.871 30.218  13.175  1.00 133.35 ?  506  PRO C O     1 
ATOM   5856  C  CB    . PRO D  3  506  ? -157.883 33.114  14.094  1.00 124.03 ?  506  PRO C CB    1 
ATOM   5857  C  CG    . PRO D  3  506  ? -156.539 32.773  14.650  1.00 125.19 ?  506  PRO C CG    1 
ATOM   5858  C  CD    . PRO D  3  506  ? -156.803 32.100  15.971  1.00 119.79 ?  506  PRO C CD    1 
ATOM   5859  N  N     . TYR D  3  507  ? -160.075 30.658  12.974  1.00 139.83 ?  507  TYR C N     1 
ATOM   5860  C  CA    . TYR D  3  507  ? -160.304 29.676  11.925  1.00 137.96 ?  507  TYR C CA    1 
ATOM   5861  C  C     . TYR D  3  507  ? -161.218 30.266  10.864  1.00 142.98 ?  507  TYR C C     1 
ATOM   5862  O  O     . TYR D  3  507  ? -162.194 30.951  11.182  1.00 138.31 ?  507  TYR C O     1 
ATOM   5863  C  CB    . TYR D  3  507  ? -160.920 28.385  12.478  1.00 134.33 ?  507  TYR C CB    1 
ATOM   5864  C  CG    . TYR D  3  507  ? -159.966 27.567  13.312  1.00 126.17 ?  507  TYR C CG    1 
ATOM   5865  C  CD1   . TYR D  3  507  ? -160.138 27.450  14.685  1.00 131.86 ?  507  TYR C CD1   1 
ATOM   5866  C  CD2   . TYR D  3  507  ? -158.887 26.920  12.728  1.00 124.92 ?  507  TYR C CD2   1 
ATOM   5867  C  CE1   . TYR D  3  507  ? -159.265 26.704  15.451  1.00 133.06 ?  507  TYR C CE1   1 
ATOM   5868  C  CE2   . TYR D  3  507  ? -158.008 26.174  13.485  1.00 137.85 ?  507  TYR C CE2   1 
ATOM   5869  C  CZ    . TYR D  3  507  ? -158.201 26.069  14.846  1.00 139.18 ?  507  TYR C CZ    1 
ATOM   5870  O  OH    . TYR D  3  507  ? -157.327 25.326  15.602  1.00 140.51 ?  507  TYR C OH    1 
ATOM   5871  N  N     . ARG D  3  508  ? -160.890 29.996  9.603   1.00 144.93 ?  508  ARG C N     1 
ATOM   5872  C  CA    . ARG D  3  508  ? -161.710 30.384  8.461   1.00 151.47 ?  508  ARG C CA    1 
ATOM   5873  C  C     . ARG D  3  508  ? -162.378 29.126  7.918   1.00 155.84 ?  508  ARG C C     1 
ATOM   5874  O  O     . ARG D  3  508  ? -161.720 28.290  7.289   1.00 161.00 ?  508  ARG C O     1 
ATOM   5875  C  CB    . ARG D  3  508  ? -160.868 31.075  7.390   1.00 136.17 ?  508  ARG C CB    1 
ATOM   5876  C  CG    . ARG D  3  508  ? -159.473 30.491  7.233   1.00 134.84 ?  508  ARG C CG    1 
ATOM   5877  C  CD    . ARG D  3  508  ? -158.939 30.667  5.819   1.00 139.01 ?  508  ARG C CD    1 
ATOM   5878  N  NE    . ARG D  3  508  ? -158.793 32.068  5.436   1.00 129.51 ?  508  ARG C NE    1 
ATOM   5879  C  CZ    . ARG D  3  508  ? -158.342 32.471  4.253   1.00 117.98 ?  508  ARG C CZ    1 
ATOM   5880  N  NH1   . ARG D  3  508  ? -157.992 31.579  3.337   1.00 121.05 ?  508  ARG C NH1   1 
ATOM   5881  N  NH2   . ARG D  3  508  ? -158.241 33.766  3.985   1.00 108.67 ?  508  ARG C NH2   1 
ATOM   5882  N  N     . LYS D  3  509  ? -163.678 28.990  8.169   1.00 143.74 ?  509  LYS C N     1 
ATOM   5883  C  CA    . LYS D  3  509  ? -164.406 27.807  7.728   1.00 144.37 ?  509  LYS C CA    1 
ATOM   5884  C  C     . LYS D  3  509  ? -164.328 27.663  6.214   1.00 153.39 ?  509  LYS C C     1 
ATOM   5885  O  O     . LYS D  3  509  ? -164.596 28.613  5.471   1.00 150.31 ?  509  LYS C O     1 
ATOM   5886  C  CB    . LYS D  3  509  ? -165.864 27.886  8.180   1.00 138.83 ?  509  LYS C CB    1 
ATOM   5887  N  N     . VAL D  3  510  ? -163.958 26.470  5.757   1.00 157.20 ?  510  VAL C N     1 
ATOM   5888  C  CA    . VAL D  3  510  ? -163.844 26.169  4.336   1.00 154.16 ?  510  VAL C CA    1 
ATOM   5889  C  C     . VAL D  3  510  ? -165.058 25.357  3.902   1.00 153.95 ?  510  VAL C C     1 
ATOM   5890  O  O     . VAL D  3  510  ? -165.318 24.280  4.451   1.00 153.20 ?  510  VAL C O     1 
ATOM   5891  C  CB    . VAL D  3  510  ? -162.551 25.411  4.038   1.00 143.74 ?  510  VAL C CB    1 
ATOM   5892  N  N     . GLU D  3  511  ? -165.795 25.873  2.920   1.00 152.57 ?  511  GLU C N     1 
ATOM   5893  C  CA    . GLU D  3  511  ? -167.011 25.237  2.432   1.00 161.58 ?  511  GLU C CA    1 
ATOM   5894  C  C     . GLU D  3  511  ? -166.908 25.038  0.927   1.00 162.44 ?  511  GLU C C     1 
ATOM   5895  O  O     . GLU D  3  511  ? -166.614 25.986  0.192   1.00 159.62 ?  511  GLU C O     1 
ATOM   5896  C  CB    . GLU D  3  511  ? -168.249 26.079  2.771   1.00 155.96 ?  511  GLU C CB    1 
ATOM   5897  C  CG    . GLU D  3  511  ? -169.322 25.338  3.555   1.00 147.42 ?  511  GLU C CG    1 
ATOM   5898  C  CD    . GLU D  3  511  ? -169.993 24.243  2.748   1.00 153.82 ?  511  GLU C CD    1 
ATOM   5899  O  OE1   . GLU D  3  511  ? -169.516 23.941  1.633   1.00 158.78 ?  511  GLU C OE1   1 
ATOM   5900  O  OE2   . GLU D  3  511  ? -171.001 23.685  3.229   1.00 147.24 ?  511  GLU C OE2   1 
ATOM   5901  N  N     . ASN D  3  512  ? -167.153 23.807  0.476   1.00 161.33 ?  512  ASN C N     1 
ATOM   5902  C  CA    . ASN D  3  512  ? -167.158 23.477  -0.949  1.00 165.03 ?  512  ASN C CA    1 
ATOM   5903  C  C     . ASN D  3  512  ? -165.778 23.658  -1.577  1.00 167.71 ?  512  ASN C C     1 
ATOM   5904  O  O     . ASN D  3  512  ? -165.662 23.951  -2.769  1.00 168.76 ?  512  ASN C O     1 
ATOM   5905  C  CB    . ASN D  3  512  ? -168.198 24.308  -1.706  1.00 168.68 ?  512  ASN C CB    1 
ATOM   5906  C  CG    . ASN D  3  512  ? -168.616 23.670  -3.020  1.00 171.20 ?  512  ASN C CG    1 
ATOM   5907  O  OD1   . ASN D  3  512  ? -169.680 23.975  -3.558  1.00 175.16 ?  512  ASN C OD1   1 
ATOM   5908  N  ND2   . ASN D  3  512  ? -167.785 22.770  -3.536  1.00 167.13 ?  512  ASN C ND2   1 
ATOM   5909  N  N     . GLY D  3  513  ? -164.724 23.484  -0.785  1.00 164.11 ?  513  GLY C N     1 
ATOM   5910  C  CA    . GLY D  3  513  ? -163.380 23.633  -1.307  1.00 164.31 ?  513  GLY C CA    1 
ATOM   5911  C  C     . GLY D  3  513  ? -162.980 25.051  -1.638  1.00 163.36 ?  513  GLY C C     1 
ATOM   5912  O  O     . GLY D  3  513  ? -162.042 25.255  -2.413  1.00 159.64 ?  513  GLY C O     1 
ATOM   5913  N  N     . VAL D  3  514  ? -163.668 26.042  -1.076  1.00 158.75 ?  514  VAL C N     1 
ATOM   5914  C  CA    . VAL D  3  514  ? -163.345 27.446  -1.291  1.00 155.68 ?  514  VAL C CA    1 
ATOM   5915  C  C     . VAL D  3  514  ? -163.184 28.126  0.059   1.00 163.32 ?  514  VAL C C     1 
ATOM   5916  O  O     . VAL D  3  514  ? -164.061 28.016  0.922   1.00 166.16 ?  514  VAL C O     1 
ATOM   5917  C  CB    . VAL D  3  514  ? -164.427 28.148  -2.119  1.00 148.94 ?  514  VAL C CB    1 
ATOM   5918  N  N     . VAL D  3  515  ? -162.066 28.825  0.239   1.00 164.27 ?  515  VAL C N     1 
ATOM   5919  C  CA    . VAL D  3  515  ? -161.785 29.480  1.509   1.00 154.59 ?  515  VAL C CA    1 
ATOM   5920  C  C     . VAL D  3  515  ? -162.787 30.600  1.765   1.00 152.83 ?  515  VAL C C     1 
ATOM   5921  O  O     . VAL D  3  515  ? -162.946 31.507  0.942   1.00 142.06 ?  515  VAL C O     1 
ATOM   5922  C  CB    . VAL D  3  515  ? -160.361 30.032  1.517   1.00 137.99 ?  515  VAL C CB    1 
ATOM   5923  N  N     . THR D  3  516  ? -163.460 30.535  2.910   1.00 153.70 ?  516  THR C N     1 
ATOM   5924  C  CA    . THR D  3  516  ? -164.424 31.549  3.314   1.00 156.33 ?  516  THR C CA    1 
ATOM   5925  C  C     . THR D  3  516  ? -163.747 32.551  4.240   1.00 155.66 ?  516  THR C C     1 
ATOM   5926  O  O     . THR D  3  516  ? -163.148 32.164  5.249   1.00 152.51 ?  516  THR C O     1 
ATOM   5927  C  CB    . THR D  3  516  ? -165.629 30.914  4.009   1.00 149.03 ?  516  THR C CB    1 
ATOM   5928  N  N     . ASP D  3  517  ? -163.848 33.836  3.896   1.00 151.82 ?  517  ASP C N     1 
ATOM   5929  C  CA    . ASP D  3  517  ? -163.217 34.881  4.692   1.00 138.29 ?  517  ASP C CA    1 
ATOM   5930  C  C     . ASP D  3  517  ? -163.808 35.000  6.091   1.00 141.56 ?  517  ASP C C     1 
ATOM   5931  O  O     . ASP D  3  517  ? -163.255 35.738  6.914   1.00 134.85 ?  517  ASP C O     1 
ATOM   5932  C  CB    . ASP D  3  517  ? -163.323 36.226  3.972   1.00 139.60 ?  517  ASP C CB    1 
ATOM   5933  C  CG    . ASP D  3  517  ? -162.596 36.233  2.641   1.00 146.63 ?  517  ASP C CG    1 
ATOM   5934  O  OD1   . ASP D  3  517  ? -163.255 36.026  1.600   1.00 150.00 ?  517  ASP C OD1   1 
ATOM   5935  O  OD2   . ASP D  3  517  ? -161.364 36.443  2.637   1.00 137.96 ?  517  ASP C OD2   1 
ATOM   5936  N  N     . GLN D  3  518  ? -164.905 34.305  6.379   1.00 145.11 ?  518  GLN C N     1 
ATOM   5937  C  CA    . GLN D  3  518  ? -165.505 34.342  7.708   1.00 141.16 ?  518  GLN C CA    1 
ATOM   5938  C  C     . GLN D  3  518  ? -164.601 33.610  8.692   1.00 139.65 ?  518  GLN C C     1 
ATOM   5939  O  O     . GLN D  3  518  ? -164.495 32.380  8.654   1.00 139.50 ?  518  GLN C O     1 
ATOM   5940  C  CB    . GLN D  3  518  ? -166.897 33.720  7.677   1.00 140.76 ?  518  GLN C CB    1 
ATOM   5941  N  N     . ILE D  3  519  ? -163.943 34.361  9.571   1.00 139.38 ?  519  ILE C N     1 
ATOM   5942  C  CA    . ILE D  3  519  ? -163.078 33.798  10.599  1.00 129.10 ?  519  ILE C CA    1 
ATOM   5943  C  C     . ILE D  3  519  ? -163.859 33.714  11.905  1.00 140.71 ?  519  ILE C C     1 
ATOM   5944  O  O     . ILE D  3  519  ? -164.348 34.733  12.406  1.00 149.88 ?  519  ILE C O     1 
ATOM   5945  C  CB    . ILE D  3  519  ? -161.815 34.640  10.774  1.00 108.87 ?  519  ILE C CB    1 
ATOM   5946  N  N     . ASP D  3  520  ? -163.975 32.506  12.450  1.00 132.93 ?  520  ASP C N     1 
ATOM   5947  C  CA    . ASP D  3  520  ? -164.747 32.264  13.658  1.00 144.15 ?  520  ASP C CA    1 
ATOM   5948  C  C     . ASP D  3  520  ? -163.855 31.688  14.751  1.00 143.76 ?  520  ASP C C     1 
ATOM   5949  O  O     . ASP D  3  520  ? -162.785 31.132  14.487  1.00 128.33 ?  520  ASP C O     1 
ATOM   5950  C  CB    . ASP D  3  520  ? -165.923 31.314  13.387  1.00 142.47 ?  520  ASP C CB    1 
ATOM   5951  N  N     . TYR D  3  521  ? -164.316 31.833  15.992  1.00 150.24 ?  521  TYR C N     1 
ATOM   5952  C  CA    . TYR D  3  521  ? -163.607 31.296  17.146  1.00 146.08 ?  521  TYR C CA    1 
ATOM   5953  C  C     . TYR D  3  521  ? -163.998 29.838  17.349  1.00 143.90 ?  521  TYR C C     1 
ATOM   5954  O  O     . TYR D  3  521  ? -165.185 29.519  17.477  1.00 133.59 ?  521  TYR C O     1 
ATOM   5955  C  CB    . TYR D  3  521  ? -163.920 32.116  18.395  1.00 139.91 ?  521  TYR C CB    1 
ATOM   5956  N  N     . LEU D  3  522  ? -163.003 28.954  17.373  1.00 138.49 ?  522  LEU C N     1 
ATOM   5957  C  CA    . LEU D  3  522  ? -163.217 27.529  17.613  1.00 142.29 ?  522  LEU C CA    1 
ATOM   5958  C  C     . LEU D  3  522  ? -162.313 27.107  18.766  1.00 137.16 ?  522  LEU C C     1 
ATOM   5959  O  O     . LEU D  3  522  ? -161.097 26.979  18.595  1.00 142.13 ?  522  LEU C O     1 
ATOM   5960  C  CB    . LEU D  3  522  ? -162.939 26.706  16.358  1.00 138.31 ?  522  LEU C CB    1 
ATOM   5961  C  CG    . LEU D  3  522  ? -163.877 26.935  15.171  1.00 137.33 ?  522  LEU C CG    1 
ATOM   5962  C  CD1   . LEU D  3  522  ? -163.578 25.947  14.053  1.00 128.69 ?  522  LEU C CD1   1 
ATOM   5963  C  CD2   . LEU D  3  522  ? -165.333 26.835  15.603  1.00 136.76 ?  522  LEU C CD2   1 
ATOM   5964  N  N     . THR D  3  523  ? -162.908 26.899  19.940  1.00 131.77 ?  523  THR C N     1 
ATOM   5965  C  CA    . THR D  3  523  ? -162.162 26.426  21.099  1.00 137.70 ?  523  THR C CA    1 
ATOM   5966  C  C     . THR D  3  523  ? -161.601 25.035  20.831  1.00 140.63 ?  523  THR C C     1 
ATOM   5967  O  O     . THR D  3  523  ? -161.833 24.462  19.761  1.00 142.62 ?  523  THR C O     1 
ATOM   5968  C  CB    . THR D  3  523  ? -163.050 26.416  22.345  1.00 133.33 ?  523  THR C CB    1 
ATOM   5969  O  OG1   . THR D  3  523  ? -162.295 25.952  23.470  1.00 136.98 ?  523  THR C OG1   1 
ATOM   5970  C  CG2   . THR D  3  523  ? -164.252 25.506  22.135  1.00 128.11 ?  523  THR C CG2   1 
ATOM   5971  N  N     . ALA D  3  524  ? -160.860 24.485  21.795  1.00 130.60 ?  524  ALA C N     1 
ATOM   5972  C  CA    . ALA D  3  524  ? -160.284 23.156  21.616  1.00 128.72 ?  524  ALA C CA    1 
ATOM   5973  C  C     . ALA D  3  524  ? -161.363 22.131  21.290  1.00 137.81 ?  524  ALA C C     1 
ATOM   5974  O  O     . ALA D  3  524  ? -161.219 21.335  20.355  1.00 134.10 ?  524  ALA C O     1 
ATOM   5975  C  CB    . ALA D  3  524  ? -159.508 22.748  22.868  1.00 129.54 ?  524  ALA C CB    1 
ATOM   5976  N  N     . ASP D  3  525  ? -162.459 22.141  22.052  1.00 141.67 ?  525  ASP C N     1 
ATOM   5977  C  CA    . ASP D  3  525  ? -163.536 21.185  21.816  1.00 136.92 ?  525  ASP C CA    1 
ATOM   5978  C  C     . ASP D  3  525  ? -164.214 21.440  20.475  1.00 139.94 ?  525  ASP C C     1 
ATOM   5979  O  O     . ASP D  3  525  ? -164.393 20.516  19.672  1.00 132.02 ?  525  ASP C O     1 
ATOM   5980  C  CB    . ASP D  3  525  ? -164.551 21.246  22.957  1.00 127.05 ?  525  ASP C CB    1 
ATOM   5981  N  N     . GLU D  3  526  ? -164.595 22.692  20.211  1.00 143.59 ?  526  GLU C N     1 
ATOM   5982  C  CA    . GLU D  3  526  ? -165.228 23.033  18.942  1.00 141.39 ?  526  GLU C CA    1 
ATOM   5983  C  C     . GLU D  3  526  ? -164.336 22.746  17.743  1.00 146.63 ?  526  GLU C C     1 
ATOM   5984  O  O     . GLU D  3  526  ? -164.823 22.785  16.607  1.00 148.41 ?  526  GLU C O     1 
ATOM   5985  C  CB    . GLU D  3  526  ? -165.635 24.509  18.937  1.00 120.58 ?  526  GLU C CB    1 
ATOM   5986  N  N     . GLU D  3  527  ? -163.052 22.462  17.961  1.00 144.61 ?  527  GLU C N     1 
ATOM   5987  C  CA    . GLU D  3  527  ? -162.153 22.212  16.840  1.00 144.54 ?  527  GLU C CA    1 
ATOM   5988  C  C     . GLU D  3  527  ? -162.439 20.865  16.187  1.00 150.90 ?  527  GLU C C     1 
ATOM   5989  O  O     . GLU D  3  527  ? -162.341 20.730  14.962  1.00 150.73 ?  527  GLU C O     1 
ATOM   5990  C  CB    . GLU D  3  527  ? -160.702 22.283  17.314  1.00 141.77 ?  527  GLU C CB    1 
ATOM   5991  C  CG    . GLU D  3  527  ? -159.673 22.221  16.203  1.00 145.21 ?  527  GLU C CG    1 
ATOM   5992  C  CD    . GLU D  3  527  ? -158.371 22.864  16.610  1.00 146.22 ?  527  GLU C CD    1 
ATOM   5993  O  OE1   . GLU D  3  527  ? -157.326 22.184  16.592  1.00 136.03 ?  527  GLU C OE1   1 
ATOM   5994  O  OE2   . GLU D  3  527  ? -158.398 24.061  16.959  1.00 143.16 ?  527  GLU C OE2   1 
ATOM   5995  N  N     . ASP D  3  528  ? -162.793 19.857  16.987  1.00 150.94 ?  528  ASP C N     1 
ATOM   5996  C  CA    . ASP D  3  528  ? -163.035 18.529  16.433  1.00 148.27 ?  528  ASP C CA    1 
ATOM   5997  C  C     . ASP D  3  528  ? -164.313 18.483  15.605  1.00 150.66 ?  528  ASP C C     1 
ATOM   5998  O  O     . ASP D  3  528  ? -164.431 17.649  14.700  1.00 141.40 ?  528  ASP C O     1 
ATOM   5999  C  CB    . ASP D  3  528  ? -163.094 17.496  17.557  1.00 134.69 ?  528  ASP C CB    1 
ATOM   6000  N  N     . ARG D  3  529  ? -165.275 19.364  15.893  1.00 154.18 ?  529  ARG C N     1 
ATOM   6001  C  CA    . ARG D  3  529  ? -166.557 19.317  15.195  1.00 145.23 ?  529  ARG C CA    1 
ATOM   6002  C  C     . ARG D  3  529  ? -166.376 19.454  13.688  1.00 144.88 ?  529  ARG C C     1 
ATOM   6003  O  O     . ARG D  3  529  ? -167.012 18.732  12.910  1.00 155.36 ?  529  ARG C O     1 
ATOM   6004  C  CB    . ARG D  3  529  ? -167.484 20.409  15.727  1.00 120.29 ?  529  ARG C CB    1 
ATOM   6005  N  N     . HIS D  3  530  ? -165.514 20.371  13.256  1.00 135.98 ?  530  HIS C N     1 
ATOM   6006  C  CA    . HIS D  3  530  ? -165.264 20.622  11.843  1.00 139.88 ?  530  HIS C CA    1 
ATOM   6007  C  C     . HIS D  3  530  ? -163.816 20.289  11.518  1.00 144.31 ?  530  HIS C C     1 
ATOM   6008  O  O     . HIS D  3  530  ? -162.902 20.717  12.232  1.00 151.81 ?  530  HIS C O     1 
ATOM   6009  C  CB    . HIS D  3  530  ? -165.566 22.079  11.479  1.00 134.02 ?  530  HIS C CB    1 
ATOM   6010  N  N     . VAL D  3  531  ? -163.611 19.525  10.443  1.00 137.50 ?  531  VAL C N     1 
ATOM   6011  C  CA    . VAL D  3  531  ? -162.257 19.178  10.033  1.00 138.83 ?  531  VAL C CA    1 
ATOM   6012  C  C     . VAL D  3  531  ? -161.488 20.452  9.710   1.00 147.88 ?  531  VAL C C     1 
ATOM   6013  O  O     . VAL D  3  531  ? -162.002 21.365  9.049   1.00 146.12 ?  531  VAL C O     1 
ATOM   6014  C  CB    . VAL D  3  531  ? -162.282 18.215  8.834   1.00 127.68 ?  531  VAL C CB    1 
ATOM   6015  C  CG1   . VAL D  3  531  ? -162.045 18.972  7.530   1.00 126.70 ?  531  VAL C CG1   1 
ATOM   6016  C  CG2   . VAL D  3  531  ? -161.252 17.112  9.018   1.00 114.22 ?  531  VAL C CG2   1 
ATOM   6017  N  N     . VAL D  3  532  ? -160.249 20.520  10.188  1.00 153.27 ?  532  VAL C N     1 
ATOM   6018  C  CA    . VAL D  3  532  ? -159.396 21.694  10.033  1.00 153.17 ?  532  VAL C CA    1 
ATOM   6019  C  C     . VAL D  3  532  ? -158.408 21.433  8.905   1.00 153.30 ?  532  VAL C C     1 
ATOM   6020  O  O     . VAL D  3  532  ? -157.757 20.381  8.870   1.00 145.41 ?  532  VAL C O     1 
ATOM   6021  C  CB    . VAL D  3  532  ? -158.661 22.022  11.344  1.00 148.56 ?  532  VAL C CB    1 
ATOM   6022  C  CG1   . VAL D  3  532  ? -157.863 23.312  11.206  1.00 146.68 ?  532  VAL C CG1   1 
ATOM   6023  C  CG2   . VAL D  3  532  ? -159.650 22.112  12.494  1.00 137.96 ?  532  VAL C CG2   1 
ATOM   6024  N  N     . ALA D  3  533  ? -158.290 22.390  7.990   1.00 155.75 ?  533  ALA C N     1 
ATOM   6025  C  CA    . ALA D  3  533  ? -157.407 22.274  6.839   1.00 156.43 ?  533  ALA C CA    1 
ATOM   6026  C  C     . ALA D  3  533  ? -156.035 22.870  7.144   1.00 159.68 ?  533  ALA C C     1 
ATOM   6027  O  O     . ALA D  3  533  ? -155.859 23.647  8.085   1.00 169.53 ?  533  ALA C O     1 
ATOM   6028  C  CB    . ALA D  3  533  ? -158.018 22.966  5.620   1.00 164.58 ?  533  ALA C CB    1 
ATOM   6029  N  N     . GLN D  3  534  ? -155.058 22.498  6.320   1.00 158.28 ?  534  GLN C N     1 
ATOM   6030  C  CA    . GLN D  3  534  ? -153.680 22.934  6.495   1.00 155.95 ?  534  GLN C CA    1 
ATOM   6031  C  C     . GLN D  3  534  ? -153.459 24.296  5.851   1.00 164.74 ?  534  GLN C C     1 
ATOM   6032  O  O     . GLN D  3  534  ? -154.043 24.607  4.808   1.00 175.21 ?  534  GLN C O     1 
ATOM   6033  C  CB    . GLN D  3  534  ? -152.713 21.911  5.897   1.00 139.69 ?  534  GLN C CB    1 
ATOM   6034  N  N     . ALA D  3  535  ? -152.604 25.103  6.477   1.00 162.47 ?  535  ALA C N     1 
ATOM   6035  C  CA    . ALA D  3  535  ? -152.302 26.440  5.979   1.00 160.15 ?  535  ALA C CA    1 
ATOM   6036  C  C     . ALA D  3  535  ? -151.751 26.384  4.559   1.00 153.57 ?  535  ALA C C     1 
ATOM   6037  O  O     . ALA D  3  535  ? -152.387 26.872  3.620   1.00 147.75 ?  535  ALA C O     1 
ATOM   6038  C  CB    . ALA D  3  535  ? -151.311 27.146  6.906   1.00 146.10 ?  535  ALA C CB    1 
ATOM   6039  N  N     . ASN D  3  536  ? -150.569 25.796  4.395   1.00 151.27 ?  536  ASN C N     1 
ATOM   6040  C  CA    . ASN D  3  536  ? -149.950 25.661  3.079   1.00 152.88 ?  536  ASN C CA    1 
ATOM   6041  C  C     . ASN D  3  536  ? -150.800 24.724  2.232   1.00 157.58 ?  536  ASN C C     1 
ATOM   6042  O  O     . ASN D  3  536  ? -150.693 23.500  2.338   1.00 158.77 ?  536  ASN C O     1 
ATOM   6043  C  CB    . ASN D  3  536  ? -148.520 25.148  3.211   1.00 128.75 ?  536  ASN C CB    1 
ATOM   6044  N  N     . SER D  3  537  ? -151.652 25.296  1.387   1.00 158.24 ?  537  SER C N     1 
ATOM   6045  C  CA    . SER D  3  537  ? -152.557 24.527  0.550   1.00 161.58 ?  537  SER C CA    1 
ATOM   6046  C  C     . SER D  3  537  ? -152.508 25.033  -0.883  1.00 164.33 ?  537  SER C C     1 
ATOM   6047  O  O     . SER D  3  537  ? -152.335 26.233  -1.119  1.00 160.41 ?  537  SER C O     1 
ATOM   6048  C  CB    . SER D  3  537  ? -153.999 24.610  1.072   1.00 153.79 ?  537  SER C CB    1 
ATOM   6049  O  OG    . SER D  3  537  ? -154.080 24.169  2.415   1.00 148.36 ?  537  SER C OG    1 
ATOM   6050  N  N     . PRO D  3  538  ? -152.659 24.137  -1.862  1.00 171.52 ?  538  PRO C N     1 
ATOM   6051  C  CA    . PRO D  3  538  ? -152.620 24.564  -3.267  1.00 175.38 ?  538  PRO C CA    1 
ATOM   6052  C  C     . PRO D  3  538  ? -153.916 25.216  -3.724  1.00 171.79 ?  538  PRO C C     1 
ATOM   6053  O  O     . PRO D  3  538  ? -154.865 24.527  -4.111  1.00 162.59 ?  538  PRO C O     1 
ATOM   6054  C  CB    . PRO D  3  538  ? -152.356 23.254  -4.019  1.00 169.16 ?  538  PRO C CB    1 
ATOM   6055  C  CG    . PRO D  3  538  ? -152.972 22.208  -3.150  1.00 158.47 ?  538  PRO C CG    1 
ATOM   6056  C  CD    . PRO D  3  538  ? -152.776 22.673  -1.728  1.00 164.32 ?  538  PRO C CD    1 
ATOM   6057  N  N     . THR D  3  539  ? -153.963 26.546  -3.686  1.00 166.26 ?  539  THR C N     1 
ATOM   6058  C  CA    . THR D  3  539  ? -155.111 27.316  -4.147  1.00 152.00 ?  539  THR C CA    1 
ATOM   6059  C  C     . THR D  3  539  ? -154.748 27.985  -5.466  1.00 149.10 ?  539  THR C C     1 
ATOM   6060  O  O     . THR D  3  539  ? -153.804 28.781  -5.523  1.00 143.28 ?  539  THR C O     1 
ATOM   6061  C  CB    . THR D  3  539  ? -155.529 28.356  -3.108  1.00 124.99 ?  539  THR C CB    1 
ATOM   6062  N  N     . ASP D  3  540  ? -155.494 27.662  -6.519  1.00 148.08 ?  540  ASP C N     1 
ATOM   6063  C  CA    . ASP D  3  540  ? -155.212 28.149  -7.864  1.00 143.52 ?  540  ASP C CA    1 
ATOM   6064  C  C     . ASP D  3  540  ? -156.038 29.400  -8.138  1.00 147.55 ?  540  ASP C C     1 
ATOM   6065  O  O     . ASP D  3  540  ? -157.272 29.358  -8.081  1.00 146.53 ?  540  ASP C O     1 
ATOM   6066  C  CB    . ASP D  3  540  ? -155.508 27.071  -8.906  1.00 121.83 ?  540  ASP C CB    1 
ATOM   6067  N  N     . GLU D  3  541  ? -155.354 30.505  -8.440  1.00 142.88 ?  541  GLU C N     1 
ATOM   6068  C  CA    . GLU D  3  541  ? -156.009 31.763  -8.778  1.00 140.42 ?  541  GLU C CA    1 
ATOM   6069  C  C     . GLU D  3  541  ? -157.097 32.111  -7.771  1.00 146.56 ?  541  GLU C C     1 
ATOM   6070  O  O     . GLU D  3  541  ? -156.904 31.959  -6.561  1.00 150.13 ?  541  GLU C O     1 
ATOM   6071  C  CB    . GLU D  3  541  ? -156.595 31.696  -10.190 1.00 136.66 ?  541  GLU C CB    1 
ATOM   6072  N  N     . ASN D  3  542  ? -158.242 32.578  -8.262  1.00 142.23 ?  542  ASN C N     1 
ATOM   6073  C  CA    . ASN D  3  542  ? -159.358 32.893  -7.382  1.00 137.69 ?  542  ASN C CA    1 
ATOM   6074  C  C     . ASN D  3  542  ? -159.895 31.619  -6.745  1.00 145.90 ?  542  ASN C C     1 
ATOM   6075  O  O     . ASN D  3  542  ? -160.245 30.662  -7.442  1.00 151.51 ?  542  ASN C O     1 
ATOM   6076  C  CB    . ASN D  3  542  ? -160.463 33.608  -8.157  1.00 128.50 ?  542  ASN C CB    1 
ATOM   6077  N  N     . GLY D  3  543  ? -159.958 31.607  -5.417  1.00 147.79 ?  543  GLY C N     1 
ATOM   6078  C  CA    . GLY D  3  543  ? -160.429 30.412  -4.760  1.00 141.53 ?  543  GLY C CA    1 
ATOM   6079  C  C     . GLY D  3  543  ? -159.454 29.258  -4.942  1.00 147.70 ?  543  GLY C C     1 
ATOM   6080  O  O     . GLY D  3  543  ? -158.272 29.433  -5.250  1.00 137.34 ?  543  GLY C O     1 
ATOM   6081  N  N     . ARG D  3  544  ? -159.980 28.054  -4.742  1.00 147.93 ?  544  ARG C N     1 
ATOM   6082  C  CA    . ARG D  3  544  ? -159.192 26.839  -4.893  1.00 146.32 ?  544  ARG C CA    1 
ATOM   6083  C  C     . ARG D  3  544  ? -159.361 26.260  -6.294  1.00 152.02 ?  544  ARG C C     1 
ATOM   6084  O  O     . ARG D  3  544  ? -158.904 26.846  -7.276  1.00 147.47 ?  544  ARG C O     1 
ATOM   6085  C  CB    . ARG D  3  544  ? -159.587 25.815  -3.842  1.00 124.80 ?  544  ARG C CB    1 
ATOM   6086  N  N     . MET D  3  551  ? -154.285 16.810  3.513   1.00 126.23 ?  551  MET C N     1 
ATOM   6087  C  CA    . MET D  3  551  ? -153.623 16.992  4.799   1.00 128.69 ?  551  MET C CA    1 
ATOM   6088  C  C     . MET D  3  551  ? -154.426 17.925  5.698   1.00 133.10 ?  551  MET C C     1 
ATOM   6089  O  O     . MET D  3  551  ? -154.329 19.147  5.585   1.00 139.55 ?  551  MET C O     1 
ATOM   6090  C  CB    . MET D  3  551  ? -152.214 17.528  4.600   1.00 118.92 ?  551  MET C CB    1 
ATOM   6091  N  N     . VAL D  3  552  ? -155.219 17.339  6.593   1.00 134.87 ?  552  VAL C N     1 
ATOM   6092  C  CA    . VAL D  3  552  ? -156.061 18.092  7.514   1.00 132.45 ?  552  VAL C CA    1 
ATOM   6093  C  C     . VAL D  3  552  ? -156.094 17.365  8.851   1.00 131.06 ?  552  VAL C C     1 
ATOM   6094  O  O     . VAL D  3  552  ? -155.902 16.147  8.922   1.00 128.52 ?  552  VAL C O     1 
ATOM   6095  C  CB    . VAL D  3  552  ? -157.489 18.287  6.960   1.00 132.26 ?  552  VAL C CB    1 
ATOM   6096  C  CG1   . VAL D  3  552  ? -157.469 19.231  5.769   1.00 131.44 ?  552  VAL C CG1   1 
ATOM   6097  C  CG2   . VAL D  3  552  ? -158.095 16.948  6.570   1.00 130.32 ?  552  VAL C CG2   1 
ATOM   6098  N  N     . ARG D  3  553  ? -156.340 18.122  9.917   1.00 138.34 ?  553  ARG C N     1 
ATOM   6099  C  CA    . ARG D  3  553  ? -156.346 17.561  11.262  1.00 137.35 ?  553  ARG C CA    1 
ATOM   6100  C  C     . ARG D  3  553  ? -157.705 16.945  11.567  1.00 136.22 ?  553  ARG C C     1 
ATOM   6101  O  O     . ARG D  3  553  ? -158.734 17.628  11.505  1.00 127.55 ?  553  ARG C O     1 
ATOM   6102  C  CB    . ARG D  3  553  ? -156.002 18.634  12.292  1.00 134.14 ?  553  ARG C CB    1 
ATOM   6103  C  CG    . ARG D  3  553  ? -154.533 19.019  12.322  1.00 132.39 ?  553  ARG C CG    1 
ATOM   6104  C  CD    . ARG D  3  553  ? -154.183 19.680  13.642  1.00 126.00 ?  553  ARG C CD    1 
ATOM   6105  N  NE    . ARG D  3  553  ? -154.872 20.955  13.811  1.00 131.44 ?  553  ARG C NE    1 
ATOM   6106  C  CZ    . ARG D  3  553  ? -155.089 21.537  14.985  1.00 132.10 ?  553  ARG C CZ    1 
ATOM   6107  N  NH1   . ARG D  3  553  ? -154.682 20.951  16.103  1.00 128.38 ?  553  ARG C NH1   1 
ATOM   6108  N  NH2   . ARG D  3  553  ? -155.725 22.699  15.044  1.00 131.80 ?  553  ARG C NH2   1 
ATOM   6109  N  N     . LYS D  3  554  ? -157.708 15.656  11.899  1.00 137.79 ?  554  LYS C N     1 
ATOM   6110  C  CA    . LYS D  3  554  ? -158.934 14.984  12.288  1.00 128.49 ?  554  LYS C CA    1 
ATOM   6111  C  C     . LYS D  3  554  ? -159.388 15.468  13.664  1.00 138.43 ?  554  LYS C C     1 
ATOM   6112  O  O     . LYS D  3  554  ? -158.652 16.138  14.395  1.00 140.68 ?  554  LYS C O     1 
ATOM   6113  C  CB    . LYS D  3  554  ? -158.739 13.469  12.291  1.00 124.13 ?  554  LYS C CB    1 
ATOM   6114  N  N     . LYS D  3  555  ? -160.626 15.114  14.016  1.00 142.77 ?  555  LYS C N     1 
ATOM   6115  C  CA    . LYS D  3  555  ? -161.189 15.566  15.284  1.00 138.48 ?  555  LYS C CA    1 
ATOM   6116  C  C     . LYS D  3  555  ? -160.318 15.144  16.462  1.00 132.38 ?  555  LYS C C     1 
ATOM   6117  O  O     . LYS D  3  555  ? -160.108 15.923  17.398  1.00 128.64 ?  555  LYS C O     1 
ATOM   6118  C  CB    . LYS D  3  555  ? -162.611 15.032  15.447  1.00 138.08 ?  555  LYS C CB    1 
ATOM   6119  N  N     . GLY D  3  556  ? -159.800 13.919  16.432  1.00 125.57 ?  556  GLY C N     1 
ATOM   6120  C  CA    . GLY D  3  556  ? -158.983 13.436  17.527  1.00 133.98 ?  556  GLY C CA    1 
ATOM   6121  C  C     . GLY D  3  556  ? -157.582 13.035  17.115  1.00 142.78 ?  556  GLY C C     1 
ATOM   6122  O  O     . GLY D  3  556  ? -156.701 12.876  17.966  1.00 144.28 ?  556  GLY C O     1 
ATOM   6123  N  N     . GLY D  3  557  ? -157.362 12.871  15.813  1.00 141.97 ?  557  GLY C N     1 
ATOM   6124  C  CA    . GLY D  3  557  ? -156.079 12.412  15.317  1.00 142.85 ?  557  GLY C CA    1 
ATOM   6125  C  C     . GLY D  3  557  ? -155.348 13.429  14.466  1.00 138.03 ?  557  GLY C C     1 
ATOM   6126  O  O     . GLY D  3  557  ? -155.504 14.639  14.659  1.00 135.90 ?  557  GLY C O     1 
ATOM   6127  N  N     . GLU D  3  558  ? -154.548 12.947  13.517  1.00 130.05 ?  558  GLU C N     1 
ATOM   6128  C  CA    . GLU D  3  558  ? -153.741 13.799  12.658  1.00 137.12 ?  558  GLU C CA    1 
ATOM   6129  C  C     . GLU D  3  558  ? -153.914 13.385  11.203  1.00 138.06 ?  558  GLU C C     1 
ATOM   6130  O  O     . GLU D  3  558  ? -154.198 12.223  10.900  1.00 144.30 ?  558  GLU C O     1 
ATOM   6131  C  CB    . GLU D  3  558  ? -152.256 13.739  13.042  1.00 137.68 ?  558  GLU C CB    1 
ATOM   6132  N  N     . VAL D  3  559  ? -153.734 14.353  10.308  1.00 129.17 ?  559  VAL C N     1 
ATOM   6133  C  CA    . VAL D  3  559  ? -153.810 14.118  8.869   1.00 129.31 ?  559  VAL C CA    1 
ATOM   6134  C  C     . VAL D  3  559  ? -155.092 13.376  8.502   1.00 127.01 ?  559  VAL C C     1 
ATOM   6135  O  O     . VAL D  3  559  ? -155.277 12.963  7.356   1.00 115.78 ?  559  VAL C O     1 
ATOM   6136  C  CB    . VAL D  3  559  ? -152.577 13.345  8.366   1.00 121.78 ?  559  VAL C CB    1 
ATOM   6137  C  CG1   . VAL D  3  559  ? -152.479 13.426  6.848   1.00 113.78 ?  559  VAL C CG1   1 
ATOM   6138  C  CG2   . VAL D  3  559  ? -151.312 13.877  9.021   1.00 121.03 ?  559  VAL C CG2   1 
ATOM   6139  N  N     . ASP D  3  568  ? -163.692 21.313  6.394   1.00 125.81 ?  568  ASP C N     1 
ATOM   6140  C  CA    . ASP D  3  568  ? -164.702 22.055  7.139   1.00 138.67 ?  568  ASP C CA    1 
ATOM   6141  C  C     . ASP D  3  568  ? -164.222 23.470  7.444   1.00 149.96 ?  568  ASP C C     1 
ATOM   6142  O  O     . ASP D  3  568  ? -164.882 24.448  7.092   1.00 156.41 ?  568  ASP C O     1 
ATOM   6143  C  CB    . ASP D  3  568  ? -165.058 21.326  8.425   1.00 133.41 ?  568  ASP C CB    1 
ATOM   6144  N  N     . TYR D  3  569  ? -163.066 23.571  8.096   1.00 154.39 ?  569  TYR C N     1 
ATOM   6145  C  CA    . TYR D  3  569  ? -162.476 24.853  8.448   1.00 155.01 ?  569  TYR C CA    1 
ATOM   6146  C  C     . TYR D  3  569  ? -161.032 24.905  7.970   1.00 151.86 ?  569  TYR C C     1 
ATOM   6147  O  O     . TYR D  3  569  ? -160.326 23.893  7.962   1.00 148.50 ?  569  TYR C O     1 
ATOM   6148  C  CB    . TYR D  3  569  ? -162.536 25.105  9.961   1.00 147.39 ?  569  TYR C CB    1 
ATOM   6149  N  N     . MET D  3  570  ? -160.601 26.098  7.571   1.00 157.26 ?  570  MET C N     1 
ATOM   6150  C  CA    . MET D  3  570  ? -159.248 26.338  7.093   1.00 162.90 ?  570  MET C CA    1 
ATOM   6151  C  C     . MET D  3  570  ? -158.499 27.238  8.067   1.00 160.67 ?  570  MET C C     1 
ATOM   6152  O  O     . MET D  3  570  ? -159.092 28.094  8.730   1.00 152.64 ?  570  MET C O     1 
ATOM   6153  C  CB    . MET D  3  570  ? -159.266 26.973  5.697   1.00 166.34 ?  570  MET C CB    1 
ATOM   6154  C  CG    . MET D  3  570  ? -158.002 27.741  5.335   1.00 169.08 ?  570  MET C CG    1 
ATOM   6155  S  SD    . MET D  3  570  ? -156.499 26.751  5.428   1.00 328.73 ?  570  MET C SD    1 
ATOM   6156  C  CE    . MET D  3  570  ? -156.827 25.528  4.163   1.00 171.60 ?  570  MET C CE    1 
ATOM   6157  N  N     . ASP D  3  571  ? -157.187 27.031  8.156   1.00 161.49 ?  571  ASP C N     1 
ATOM   6158  C  CA    . ASP D  3  571  ? -156.362 27.853  9.029   1.00 151.43 ?  571  ASP C CA    1 
ATOM   6159  C  C     . ASP D  3  571  ? -156.297 29.287  8.518   1.00 154.05 ?  571  ASP C C     1 
ATOM   6160  O  O     . ASP D  3  571  ? -156.295 29.544  7.311   1.00 157.72 ?  571  ASP C O     1 
ATOM   6161  C  CB    . ASP D  3  571  ? -154.951 27.276  9.138   1.00 147.01 ?  571  ASP C CB    1 
ATOM   6162  C  CG    . ASP D  3  571  ? -154.844 26.198  10.196  1.00 147.05 ?  571  ASP C CG    1 
ATOM   6163  O  OD1   . ASP D  3  571  ? -155.751 26.113  11.052  1.00 145.45 ?  571  ASP C OD1   1 
ATOM   6164  O  OD2   . ASP D  3  571  ? -153.849 25.442  10.180  1.00 136.52 ?  571  ASP C OD2   1 
ATOM   6165  N  N     . VAL D  3  572  ? -156.241 30.230  9.462   1.00 145.01 ?  572  VAL C N     1 
ATOM   6166  C  CA    . VAL D  3  572  ? -156.169 31.639  9.100   1.00 138.01 ?  572  VAL C CA    1 
ATOM   6167  C  C     . VAL D  3  572  ? -154.850 31.983  8.426   1.00 137.99 ?  572  VAL C C     1 
ATOM   6168  O  O     . VAL D  3  572  ? -154.773 32.978  7.697   1.00 130.22 ?  572  VAL C O     1 
ATOM   6169  C  CB    . VAL D  3  572  ? -156.381 32.525  10.340  1.00 130.70 ?  572  VAL C CB    1 
ATOM   6170  C  CG1   . VAL D  3  572  ? -157.736 32.246  10.963  1.00 125.33 ?  572  VAL C CG1   1 
ATOM   6171  C  CG2   . VAL D  3  572  ? -155.266 32.296  11.346  1.00 130.29 ?  572  VAL C CG2   1 
ATOM   6172  N  N     . SER D  3  573  ? -153.807 31.186  8.652   1.00 141.85 ?  573  SER C N     1 
ATOM   6173  C  CA    . SER D  3  573  ? -152.493 31.429  8.073   1.00 144.13 ?  573  SER C CA    1 
ATOM   6174  C  C     . SER D  3  573  ? -151.475 30.483  8.696   1.00 139.73 ?  573  SER C C     1 
ATOM   6175  O  O     . SER D  3  573  ? -151.809 29.734  9.623   1.00 143.23 ?  573  SER C O     1 
ATOM   6176  C  CB    . SER D  3  573  ? -152.061 32.881  8.288   1.00 138.35 ?  573  SER C CB    1 
ATOM   6177  O  OG    . SER D  3  573  ? -151.913 33.167  9.668   1.00 127.44 ?  573  SER C OG    1 
ATOM   6178  N  N     . PRO D  3  574  ? -150.231 30.480  8.218   1.00 133.27 ?  574  PRO C N     1 
ATOM   6179  C  CA    . PRO D  3  574  ? -149.188 29.712  8.909   1.00 124.02 ?  574  PRO C CA    1 
ATOM   6180  C  C     . PRO D  3  574  ? -148.853 30.336  10.252  1.00 127.59 ?  574  PRO C C     1 
ATOM   6181  O  O     . PRO D  3  574  ? -149.470 31.329  10.652  1.00 125.69 ?  574  PRO C O     1 
ATOM   6182  C  CB    . PRO D  3  574  ? -148.002 29.777  7.939   1.00 114.44 ?  574  PRO C CB    1 
ATOM   6183  C  CG    . PRO D  3  574  ? -148.218 31.041  7.178   1.00 119.67 ?  574  PRO C CG    1 
ATOM   6184  C  CD    . PRO D  3  574  ? -149.711 31.174  7.027   1.00 131.55 ?  574  PRO C CD    1 
ATOM   6185  N  N     . ARG D  3  575  ? -147.889 29.757  10.960  1.00 122.20 ?  575  ARG C N     1 
ATOM   6186  C  CA    . ARG D  3  575  ? -147.362 30.284  12.215  1.00 124.70 ?  575  ARG C CA    1 
ATOM   6187  C  C     . ARG D  3  575  ? -148.433 30.475  13.285  1.00 119.20 ?  575  ARG C C     1 
ATOM   6188  O  O     . ARG D  3  575  ? -148.165 31.111  14.311  1.00 123.85 ?  575  ARG C O     1 
ATOM   6189  C  CB    . ARG D  3  575  ? -146.612 31.605  11.991  1.00 111.61 ?  575  ARG C CB    1 
ATOM   6190  C  CG    . ARG D  3  575  ? -147.503 32.833  11.928  1.00 113.69 ?  575  ARG C CG    1 
ATOM   6191  C  CD    . ARG D  3  575  ? -146.860 33.935  11.104  1.00 123.93 ?  575  ARG C CD    1 
ATOM   6192  N  NE    . ARG D  3  575  ? -147.600 35.190  11.193  1.00 118.93 ?  575  ARG C NE    1 
ATOM   6193  C  CZ    . ARG D  3  575  ? -147.379 36.244  10.414  1.00 120.43 ?  575  ARG C CZ    1 
ATOM   6194  N  NH1   . ARG D  3  575  ? -146.441 36.193  9.476   1.00 120.51 ?  575  ARG C NH1   1 
ATOM   6195  N  NH2   . ARG D  3  575  ? -148.098 37.347  10.567  1.00 117.87 ?  575  ARG C NH2   1 
ATOM   6196  N  N     . GLN D  3  576  ? -149.644 29.950  13.078  1.00 112.87 ?  576  GLN C N     1 
ATOM   6197  C  CA    . GLN D  3  576  ? -150.635 29.965  14.149  1.00 109.17 ?  576  GLN C CA    1 
ATOM   6198  C  C     . GLN D  3  576  ? -150.089 29.277  15.392  1.00 118.38 ?  576  GLN C C     1 
ATOM   6199  O  O     . GLN D  3  576  ? -150.233 29.780  16.512  1.00 119.74 ?  576  GLN C O     1 
ATOM   6200  C  CB    . GLN D  3  576  ? -151.930 29.292  13.690  1.00 118.50 ?  576  GLN C CB    1 
ATOM   6201  C  CG    . GLN D  3  576  ? -152.854 30.181  12.877  1.00 118.09 ?  576  GLN C CG    1 
ATOM   6202  C  CD    . GLN D  3  576  ? -154.277 29.655  12.845  1.00 132.57 ?  576  GLN C CD    1 
ATOM   6203  O  OE1   . GLN D  3  576  ? -155.070 29.919  13.751  1.00 124.74 ?  576  GLN C OE1   1 
ATOM   6204  N  NE2   . GLN D  3  576  ? -154.608 28.904  11.801  1.00 140.64 ?  576  GLN C NE2   1 
ATOM   6205  N  N     . MET D  3  577  ? -149.455 28.117  15.208  1.00 111.73 ?  577  MET C N     1 
ATOM   6206  C  CA    . MET D  3  577  ? -148.823 27.420  16.321  1.00 113.93 ?  577  MET C CA    1 
ATOM   6207  C  C     . MET D  3  577  ? -147.620 28.185  16.857  1.00 122.97 ?  577  MET C C     1 
ATOM   6208  O  O     . MET D  3  577  ? -147.264 28.035  18.032  1.00 128.97 ?  577  MET C O     1 
ATOM   6209  C  CB    . MET D  3  577  ? -148.397 26.022  15.878  1.00 111.97 ?  577  MET C CB    1 
ATOM   6210  C  CG    . MET D  3  577  ? -147.710 26.011  14.520  1.00 114.11 ?  577  MET C CG    1 
ATOM   6211  S  SD    . MET D  3  577  ? -146.888 24.454  14.140  1.00 140.79 ?  577  MET C SD    1 
ATOM   6212  C  CE    . MET D  3  577  ? -145.595 24.454  15.379  1.00 125.82 ?  577  MET C CE    1 
ATOM   6213  N  N     . VAL D  3  578  ? -146.990 29.003  16.021  1.00 110.39 ?  578  VAL C N     1 
ATOM   6214  C  CA    . VAL D  3  578  ? -145.763 29.697  16.395  1.00 102.66 ?  578  VAL C CA    1 
ATOM   6215  C  C     . VAL D  3  578  ? -146.093 30.934  17.220  1.00 100.64 ?  578  VAL C C     1 
ATOM   6216  O  O     . VAL D  3  578  ? -147.161 31.542  17.079  1.00 96.77  ?  578  VAL C O     1 
ATOM   6217  C  CB    . VAL D  3  578  ? -144.951 30.059  15.135  1.00 98.46  ?  578  VAL C CB    1 
ATOM   6218  C  CG1   . VAL D  3  578  ? -143.731 30.880  15.504  1.00 106.33 ?  578  VAL C CG1   1 
ATOM   6219  C  CG2   . VAL D  3  578  ? -144.544 28.798  14.390  1.00 106.43 ?  578  VAL C CG2   1 
ATOM   6220  N  N     . SER D  3  579  ? -145.164 31.307  18.099  1.00 101.15 ?  579  SER C N     1 
ATOM   6221  C  CA    . SER D  3  579  ? -145.292 32.508  18.905  1.00 103.97 ?  579  SER C CA    1 
ATOM   6222  C  C     . SER D  3  579  ? -144.569 33.671  18.226  1.00 100.07 ?  579  SER C C     1 
ATOM   6223  O  O     . SER D  3  579  ? -144.035 33.545  17.121  1.00 97.03  ?  579  SER C O     1 
ATOM   6224  C  CB    . SER D  3  579  ? -144.744 32.269  20.312  1.00 103.43 ?  579  SER C CB    1 
ATOM   6225  O  OG    . SER D  3  579  ? -143.343 32.056  20.282  1.00 100.35 ?  579  SER C OG    1 
ATOM   6226  N  N     . VAL D  3  580  ? -144.548 34.823  18.897  1.00 97.53  ?  580  VAL C N     1 
ATOM   6227  C  CA    . VAL D  3  580  ? -143.890 35.996  18.330  1.00 93.80  ?  580  VAL C CA    1 
ATOM   6228  C  C     . VAL D  3  580  ? -142.390 35.759  18.210  1.00 95.42  ?  580  VAL C C     1 
ATOM   6229  O  O     . VAL D  3  580  ? -141.804 35.913  17.132  1.00 90.41  ?  580  VAL C O     1 
ATOM   6230  C  CB    . VAL D  3  580  ? -144.197 37.248  19.171  1.00 86.08  ?  580  VAL C CB    1 
ATOM   6231  C  CG1   . VAL D  3  580  ? -143.421 38.443  18.639  1.00 79.63  ?  580  VAL C CG1   1 
ATOM   6232  C  CG2   . VAL D  3  580  ? -145.684 37.534  19.161  1.00 99.88  ?  580  VAL C CG2   1 
ATOM   6233  N  N     . ALA D  3  581  ? -141.745 35.386  19.318  1.00 97.76  ?  581  ALA C N     1 
ATOM   6234  C  CA    . ALA D  3  581  ? -140.307 35.140  19.284  1.00 86.23  ?  581  ALA C CA    1 
ATOM   6235  C  C     . ALA D  3  581  ? -139.956 34.075  18.255  1.00 91.62  ?  581  ALA C C     1 
ATOM   6236  O  O     . ALA D  3  581  ? -138.986 34.222  17.503  1.00 90.27  ?  581  ALA C O     1 
ATOM   6237  C  CB    . ALA D  3  581  ? -139.810 34.732  20.671  1.00 86.47  ?  581  ALA C CB    1 
ATOM   6238  N  N     . THR D  3  582  ? -140.739 32.995  18.203  1.00 94.82  ?  582  THR C N     1 
ATOM   6239  C  CA    . THR D  3  582  ? -140.468 31.933  17.240  1.00 93.36  ?  582  THR C CA    1 
ATOM   6240  C  C     . THR D  3  582  ? -140.729 32.402  15.814  1.00 87.29  ?  582  THR C C     1 
ATOM   6241  O  O     . THR D  3  582  ? -140.002 32.026  14.887  1.00 86.04  ?  582  THR C O     1 
ATOM   6242  C  CB    . THR D  3  582  ? -141.313 30.700  17.564  1.00 91.01  ?  582  THR C CB    1 
ATOM   6243  O  OG1   . THR D  3  582  ? -141.074 30.295  18.918  1.00 91.26  ?  582  THR C OG1   1 
ATOM   6244  C  CG2   . THR D  3  582  ? -140.958 29.552  16.629  1.00 95.48  ?  582  THR C CG2   1 
ATOM   6245  N  N     . ALA D  3  583  ? -141.757 33.229  15.620  1.00 88.58  ?  583  ALA C N     1 
ATOM   6246  C  CA    . ALA D  3  583  ? -142.115 33.708  14.290  1.00 82.66  ?  583  ALA C CA    1 
ATOM   6247  C  C     . ALA D  3  583  ? -141.135 34.731  13.736  1.00 83.31  ?  583  ALA C C     1 
ATOM   6248  O  O     . ALA D  3  583  ? -141.344 35.215  12.618  1.00 86.66  ?  583  ALA C O     1 
ATOM   6249  C  CB    . ALA D  3  583  ? -143.524 34.305  14.310  1.00 84.02  ?  583  ALA C CB    1 
ATOM   6250  N  N     . MET D  3  584  ? -140.083 35.076  14.475  1.00 83.65  ?  584  MET C N     1 
ATOM   6251  C  CA    . MET D  3  584  ? -139.086 36.028  14.008  1.00 86.31  ?  584  MET C CA    1 
ATOM   6252  C  C     . MET D  3  584  ? -137.800 35.359  13.543  1.00 87.41  ?  584  MET C C     1 
ATOM   6253  O  O     . MET D  3  584  ? -136.837 36.060  13.213  1.00 81.61  ?  584  MET C O     1 
ATOM   6254  C  CB    . MET D  3  584  ? -138.771 37.046  15.109  1.00 85.40  ?  584  MET C CB    1 
ATOM   6255  C  CG    . MET D  3  584  ? -139.930 37.972  15.444  1.00 82.39  ?  584  MET C CG    1 
ATOM   6256  S  SD    . MET D  3  584  ? -139.486 39.217  16.669  1.00 85.20  ?  584  MET C SD    1 
ATOM   6257  C  CE    . MET D  3  584  ? -138.056 39.959  15.888  1.00 73.98  ?  584  MET C CE    1 
ATOM   6258  N  N     . ILE D  3  585  ? -137.761 34.030  13.504  1.00 89.20  ?  585  ILE C N     1 
ATOM   6259  C  CA    . ILE D  3  585  ? -136.577 33.290  13.071  1.00 78.28  ?  585  ILE C CA    1 
ATOM   6260  C  C     . ILE D  3  585  ? -136.716 33.023  11.578  1.00 72.36  ?  585  ILE C C     1 
ATOM   6261  O  O     . ILE D  3  585  ? -137.549 32.189  11.184  1.00 83.42  ?  585  ILE C O     1 
ATOM   6262  C  CB    . ILE D  3  585  ? -136.418 31.979  13.851  1.00 71.68  ?  585  ILE C CB    1 
ATOM   6263  C  CG1   . ILE D  3  585  ? -136.259 32.260  15.346  1.00 83.80  ?  585  ILE C CG1   1 
ATOM   6264  C  CG2   . ILE D  3  585  ? -135.230 31.194  13.321  1.00 78.55  ?  585  ILE C CG2   1 
ATOM   6265  C  CD1   . ILE D  3  585  ? -136.133 31.011  16.190  1.00 78.62  ?  585  ILE C CD1   1 
ATOM   6266  N  N     . PRO D  3  586  ? -135.943 33.687  10.719  1.00 72.41  ?  586  PRO C N     1 
ATOM   6267  C  CA    . PRO D  3  586  ? -136.022 33.392  9.285   1.00 82.98  ?  586  PRO C CA    1 
ATOM   6268  C  C     . PRO D  3  586  ? -135.635 31.947  9.006   1.00 93.40  ?  586  PRO C C     1 
ATOM   6269  O  O     . PRO D  3  586  ? -134.727 31.396  9.630   1.00 96.34  ?  586  PRO C O     1 
ATOM   6270  C  CB    . PRO D  3  586  ? -135.027 34.378  8.661   1.00 74.38  ?  586  PRO C CB    1 
ATOM   6271  C  CG    . PRO D  3  586  ? -134.098 34.743  9.775   1.00 74.71  ?  586  PRO C CG    1 
ATOM   6272  C  CD    . PRO D  3  586  ? -134.932 34.716  11.022  1.00 73.80  ?  586  PRO C CD    1 
ATOM   6273  N  N     . PHE D  3  587  ? -136.345 31.331  8.061   1.00 94.14  ?  587  PHE C N     1 
ATOM   6274  C  CA    . PHE D  3  587  ? -136.105 29.935  7.693   1.00 93.80  ?  587  PHE C CA    1 
ATOM   6275  C  C     . PHE D  3  587  ? -136.354 28.999  8.875   1.00 92.45  ?  587  PHE C C     1 
ATOM   6276  O  O     . PHE D  3  587  ? -135.603 28.048  9.106   1.00 97.73  ?  587  PHE C O     1 
ATOM   6277  C  CB    . PHE D  3  587  ? -134.689 29.741  7.143   1.00 68.50  ?  587  PHE C CB    1 
ATOM   6278  C  CG    . PHE D  3  587  ? -134.364 30.624  5.974   1.00 69.01  ?  587  PHE C CG    1 
ATOM   6279  C  CD1   . PHE D  3  587  ? -135.080 30.525  4.794   1.00 81.23  ?  587  PHE C CD1   1 
ATOM   6280  C  CD2   . PHE D  3  587  ? -133.330 31.543  6.048   1.00 79.49  ?  587  PHE C CD2   1 
ATOM   6281  C  CE1   . PHE D  3  587  ? -134.781 31.335  3.714   1.00 80.44  ?  587  PHE C CE1   1 
ATOM   6282  C  CE2   . PHE D  3  587  ? -133.023 32.353  4.970   1.00 76.93  ?  587  PHE C CE2   1 
ATOM   6283  C  CZ    . PHE D  3  587  ? -133.751 32.249  3.803   1.00 75.03  ?  587  PHE C CZ    1 
ATOM   6284  N  N     . LEU D  3  588  ? -137.420 29.267  9.633   1.00 84.13  ?  588  LEU C N     1 
ATOM   6285  C  CA    . LEU D  3  588  ? -137.730 28.424  10.783  1.00 86.67  ?  588  LEU C CA    1 
ATOM   6286  C  C     . LEU D  3  588  ? -138.011 26.986  10.369  1.00 105.36 ?  588  LEU C C     1 
ATOM   6287  O  O     . LEU D  3  588  ? -137.705 26.052  11.120  1.00 115.13 ?  588  LEU C O     1 
ATOM   6288  C  CB    . LEU D  3  588  ? -138.923 28.992  11.552  1.00 78.40  ?  588  LEU C CB    1 
ATOM   6289  C  CG    . LEU D  3  588  ? -139.439 28.111  12.693  1.00 72.99  ?  588  LEU C CG    1 
ATOM   6290  C  CD1   . LEU D  3  588  ? -138.366 27.912  13.752  1.00 69.73  ?  588  LEU C CD1   1 
ATOM   6291  C  CD2   . LEU D  3  588  ? -140.704 28.693  13.307  1.00 82.56  ?  588  LEU C CD2   1 
ATOM   6292  N  N     . GLU D  3  589  ? -138.586 26.786  9.182   1.00 106.87 ?  589  GLU C N     1 
ATOM   6293  C  CA    . GLU D  3  589  ? -138.955 25.449  8.732   1.00 100.30 ?  589  GLU C CA    1 
ATOM   6294  C  C     . GLU D  3  589  ? -137.753 24.540  8.509   1.00 102.13 ?  589  GLU C C     1 
ATOM   6295  O  O     . GLU D  3  589  ? -137.941 23.331  8.341   1.00 115.98 ?  589  GLU C O     1 
ATOM   6296  C  CB    . GLU D  3  589  ? -139.779 25.538  7.444   1.00 108.99 ?  589  GLU C CB    1 
ATOM   6297  C  CG    . GLU D  3  589  ? -139.052 26.166  6.258   1.00 112.05 ?  589  GLU C CG    1 
ATOM   6298  C  CD    . GLU D  3  589  ? -138.958 27.680  6.352   1.00 110.04 ?  589  GLU C CD    1 
ATOM   6299  O  OE1   . GLU D  3  589  ? -138.964 28.209  7.484   1.00 99.40  ?  589  GLU C OE1   1 
ATOM   6300  O  OE2   . GLU D  3  589  ? -138.885 28.342  5.294   1.00 99.78  ?  589  GLU C OE2   1 
ATOM   6301  N  N     . HIS D  3  590  ? -136.536 25.080  8.506   1.00 91.06  ?  590  HIS C N     1 
ATOM   6302  C  CA    . HIS D  3  590  ? -135.345 24.278  8.260   1.00 97.28  ?  590  HIS C CA    1 
ATOM   6303  C  C     . HIS D  3  590  ? -134.613 23.871  9.530   1.00 109.21 ?  590  HIS C C     1 
ATOM   6304  O  O     . HIS D  3  590  ? -133.993 22.803  9.554   1.00 128.99 ?  590  HIS C O     1 
ATOM   6305  C  CB    . HIS D  3  590  ? -134.374 25.033  7.348   1.00 99.33  ?  590  HIS C CB    1 
ATOM   6306  C  CG    . HIS D  3  590  ? -134.937 25.347  5.997   1.00 109.72 ?  590  HIS C CG    1 
ATOM   6307  N  ND1   . HIS D  3  590  ? -134.818 24.491  4.924   1.00 118.31 ?  590  HIS C ND1   1 
ATOM   6308  C  CD2   . HIS D  3  590  ? -135.623 26.423  5.546   1.00 114.17 ?  590  HIS C CD2   1 
ATOM   6309  C  CE1   . HIS D  3  590  ? -135.407 25.026  3.870   1.00 121.12 ?  590  HIS C CE1   1 
ATOM   6310  N  NE2   . HIS D  3  590  ? -135.903 26.199  4.220   1.00 111.77 ?  590  HIS C NE2   1 
ATOM   6311  N  N     . ASP D  3  591  ? -134.668 24.683  10.580  1.00 98.33  ?  591  ASP C N     1 
ATOM   6312  C  CA    . ASP D  3  591  ? -133.949 24.372  11.805  1.00 104.30 ?  591  ASP C CA    1 
ATOM   6313  C  C     . ASP D  3  591  ? -134.720 23.364  12.648  1.00 104.57 ?  591  ASP C C     1 
ATOM   6314  O  O     . ASP D  3  591  ? -135.952 23.294  12.603  1.00 94.32  ?  591  ASP C O     1 
ATOM   6315  C  CB    . ASP D  3  591  ? -133.694 25.642  12.617  1.00 104.41 ?  591  ASP C CB    1 
ATOM   6316  C  CG    . ASP D  3  591  ? -132.807 26.630  11.887  1.00 109.91 ?  591  ASP C CG    1 
ATOM   6317  O  OD1   . ASP D  3  591  ? -131.976 26.186  11.064  1.00 111.12 ?  591  ASP C OD1   1 
ATOM   6318  O  OD2   . ASP D  3  591  ? -132.941 27.847  12.134  1.00 98.57  ?  591  ASP C OD2   1 
ATOM   6319  N  N     . ASP D  3  592  ? -133.976 22.578  13.420  1.00 111.81 ?  592  ASP C N     1 
ATOM   6320  C  CA    . ASP D  3  592  ? -134.586 21.613  14.322  1.00 110.05 ?  592  ASP C CA    1 
ATOM   6321  C  C     . ASP D  3  592  ? -135.243 22.330  15.497  1.00 104.77 ?  592  ASP C C     1 
ATOM   6322  O  O     . ASP D  3  592  ? -134.841 23.430  15.886  1.00 113.26 ?  592  ASP C O     1 
ATOM   6323  C  CB    . ASP D  3  592  ? -133.539 20.619  14.826  1.00 109.25 ?  592  ASP C CB    1 
ATOM   6324  C  CG    . ASP D  3  592  ? -134.156 19.428  15.535  1.00 132.93 ?  592  ASP C CG    1 
ATOM   6325  O  OD1   . ASP D  3  592  ? -135.314 19.079  15.219  1.00 144.95 ?  592  ASP C OD1   1 
ATOM   6326  O  OD2   . ASP D  3  592  ? -133.482 18.838  16.405  1.00 135.25 ?  592  ASP C OD2   1 
ATOM   6327  N  N     . ALA D  3  593  ? -136.271 21.692  16.063  1.00 101.89 ?  593  ALA C N     1 
ATOM   6328  C  CA    . ALA D  3  593  ? -136.998 22.300  17.174  1.00 99.40  ?  593  ALA C CA    1 
ATOM   6329  C  C     . ALA D  3  593  ? -136.057 22.703  18.301  1.00 94.81  ?  593  ALA C C     1 
ATOM   6330  O  O     . ALA D  3  593  ? -136.262 23.732  18.955  1.00 93.83  ?  593  ALA C O     1 
ATOM   6331  C  CB    . ALA D  3  593  ? -138.070 21.339  17.689  1.00 106.22 ?  593  ALA C CB    1 
ATOM   6332  N  N     . ASN D  3  594  ? -135.018 21.903  18.545  1.00 97.28  ?  594  ASN C N     1 
ATOM   6333  C  CA    . ASN D  3  594  ? -134.055 22.237  19.590  1.00 94.14  ?  594  ASN C CA    1 
ATOM   6334  C  C     . ASN D  3  594  ? -133.409 23.591  19.323  1.00 101.63 ?  594  ASN C C     1 
ATOM   6335  O  O     . ASN D  3  594  ? -133.429 24.482  20.180  1.00 108.63 ?  594  ASN C O     1 
ATOM   6336  C  CB    . ASN D  3  594  ? -132.993 21.142  19.692  1.00 120.72 ?  594  ASN C CB    1 
ATOM   6337  C  CG    . ASN D  3  594  ? -133.582 19.787  20.031  1.00 133.09 ?  594  ASN C CG    1 
ATOM   6338  O  OD1   . ASN D  3  594  ? -134.789 19.575  19.913  1.00 134.90 ?  594  ASN C OD1   1 
ATOM   6339  N  ND2   . ASN D  3  594  ? -132.728 18.859  20.450  1.00 125.34 ?  594  ASN C ND2   1 
ATOM   6340  N  N     . ARG D  3  595  ? -132.828 23.764  18.133  1.00 99.33  ?  595  ARG C N     1 
ATOM   6341  C  CA    . ARG D  3  595  ? -132.175 25.028  17.811  1.00 87.38  ?  595  ARG C CA    1 
ATOM   6342  C  C     . ARG D  3  595  ? -133.190 26.160  17.704  1.00 95.22  ?  595  ARG C C     1 
ATOM   6343  O  O     . ARG D  3  595  ? -132.904 27.297  18.099  1.00 98.59  ?  595  ARG C O     1 
ATOM   6344  C  CB    . ARG D  3  595  ? -131.379 24.893  16.513  1.00 102.94 ?  595  ARG C CB    1 
ATOM   6345  C  CG    . ARG D  3  595  ? -130.656 23.559  16.354  1.00 127.41 ?  595  ARG C CG    1 
ATOM   6346  C  CD    . ARG D  3  595  ? -129.665 23.293  17.482  1.00 125.69 ?  595  ARG C CD    1 
ATOM   6347  N  NE    . ARG D  3  595  ? -128.490 24.159  17.411  1.00 120.58 ?  595  ARG C NE    1 
ATOM   6348  C  CZ    . ARG D  3  595  ? -127.376 23.967  18.111  1.00 123.33 ?  595  ARG C CZ    1 
ATOM   6349  N  NH1   . ARG D  3  595  ? -127.276 22.932  18.936  1.00 116.12 ?  595  ARG C NH1   1 
ATOM   6350  N  NH2   . ARG D  3  595  ? -126.358 24.806  17.982  1.00 116.11 ?  595  ARG C NH2   1 
ATOM   6351  N  N     . ALA D  3  596  ? -134.380 25.871  17.173  1.00 97.26  ?  596  ALA C N     1 
ATOM   6352  C  CA    . ALA D  3  596  ? -135.424 26.889  17.101  1.00 84.00  ?  596  ALA C CA    1 
ATOM   6353  C  C     . ALA D  3  596  ? -135.803 27.378  18.492  1.00 77.05  ?  596  ALA C C     1 
ATOM   6354  O  O     . ALA D  3  596  ? -135.864 28.587  18.744  1.00 83.71  ?  596  ALA C O     1 
ATOM   6355  C  CB    . ALA D  3  596  ? -136.647 26.338  16.368  1.00 87.09  ?  596  ALA C CB    1 
ATOM   6356  N  N     . LEU D  3  597  ? -136.068 26.449  19.412  1.00 90.08  ?  597  LEU C N     1 
ATOM   6357  C  CA    . LEU D  3  597  ? -136.301 26.831  20.800  1.00 80.95  ?  597  LEU C CA    1 
ATOM   6358  C  C     . LEU D  3  597  ? -135.111 27.608  21.346  1.00 86.75  ?  597  LEU C C     1 
ATOM   6359  O  O     . LEU D  3  597  ? -135.275 28.659  21.977  1.00 85.27  ?  597  LEU C O     1 
ATOM   6360  C  CB    . LEU D  3  597  ? -136.568 25.587  21.648  1.00 83.38  ?  597  LEU C CB    1 
ATOM   6361  C  CG    . LEU D  3  597  ? -137.362 25.751  22.948  1.00 96.74  ?  597  LEU C CG    1 
ATOM   6362  C  CD1   . LEU D  3  597  ? -137.216 24.513  23.823  1.00 96.78  ?  597  LEU C CD1   1 
ATOM   6363  C  CD2   . LEU D  3  597  ? -136.952 27.003  23.706  1.00 101.42 ?  597  LEU C CD2   1 
ATOM   6364  N  N     . MET D  3  598  ? -133.898 27.099  21.114  1.00 87.67  ?  598  MET C N     1 
ATOM   6365  C  CA    . MET D  3  598  ? -132.699 27.826  21.514  1.00 81.77  ?  598  MET C CA    1 
ATOM   6366  C  C     . MET D  3  598  ? -132.675 29.217  20.893  1.00 77.93  ?  598  MET C C     1 
ATOM   6367  O  O     . MET D  3  598  ? -132.380 30.208  21.570  1.00 84.08  ?  598  MET C O     1 
ATOM   6368  C  CB    . MET D  3  598  ? -131.451 27.037  21.118  1.00 89.01  ?  598  MET C CB    1 
ATOM   6369  C  CG    . MET D  3  598  ? -130.720 26.376  22.276  1.00 110.25 ?  598  MET C CG    1 
ATOM   6370  S  SD    . MET D  3  598  ? -129.255 25.471  21.727  1.00 124.44 ?  598  MET C SD    1 
ATOM   6371  C  CE    . MET D  3  598  ? -128.476 25.087  23.294  1.00 110.03 ?  598  MET C CE    1 
ATOM   6372  N  N     . GLY D  3  599  ? -132.993 29.310  19.601  1.00 81.44  ?  599  GLY C N     1 
ATOM   6373  C  CA    . GLY D  3  599  ? -132.967 30.604  18.936  1.00 75.34  ?  599  GLY C CA    1 
ATOM   6374  C  C     . GLY D  3  599  ? -133.924 31.599  19.562  1.00 79.61  ?  599  GLY C C     1 
ATOM   6375  O  O     . GLY D  3  599  ? -133.571 32.756  19.804  1.00 92.66  ?  599  GLY C O     1 
ATOM   6376  N  N     . ALA D  3  600  ? -135.156 31.162  19.827  1.00 79.79  ?  600  ALA C N     1 
ATOM   6377  C  CA    . ALA D  3  600  ? -136.140 32.054  20.430  1.00 66.86  ?  600  ALA C CA    1 
ATOM   6378  C  C     . ALA D  3  600  ? -135.669 32.544  21.792  1.00 71.86  ?  600  ALA C C     1 
ATOM   6379  O  O     . ALA D  3  600  ? -135.740 33.740  22.094  1.00 92.59  ?  600  ALA C O     1 
ATOM   6380  C  CB    . ALA D  3  600  ? -137.490 31.347  20.547  1.00 73.44  ?  600  ALA C CB    1 
ATOM   6381  N  N     . ASN D  3  601  ? -135.177 31.628  22.630  1.00 70.18  ?  601  ASN C N     1 
ATOM   6382  C  CA    . ASN D  3  601  ? -134.706 32.019  23.954  1.00 63.46  ?  601  ASN C CA    1 
ATOM   6383  C  C     . ASN D  3  601  ? -133.581 33.040  23.862  1.00 70.60  ?  601  ASN C C     1 
ATOM   6384  O  O     . ASN D  3  601  ? -133.550 34.014  24.624  1.00 92.01  ?  601  ASN C O     1 
ATOM   6385  C  CB    . ASN D  3  601  ? -134.249 30.786  24.734  1.00 80.22  ?  601  ASN C CB    1 
ATOM   6386  C  CG    . ASN D  3  601  ? -135.402 29.882  25.127  1.00 98.59  ?  601  ASN C CG    1 
ATOM   6387  O  OD1   . ASN D  3  601  ? -136.521 30.030  24.631  1.00 90.26  ?  601  ASN C OD1   1 
ATOM   6388  N  ND2   . ASN D  3  601  ? -135.134 28.939  26.024  1.00 103.90 ?  601  ASN C ND2   1 
ATOM   6389  N  N     . MET D  3  602  ? -132.649 32.842  22.930  1.00 67.75  ?  602  MET C N     1 
ATOM   6390  C  CA    . MET D  3  602  ? -131.515 33.750  22.824  1.00 76.66  ?  602  MET C CA    1 
ATOM   6391  C  C     . MET D  3  602  ? -131.902 35.085  22.203  1.00 81.04  ?  602  MET C C     1 
ATOM   6392  O  O     . MET D  3  602  ? -131.216 36.085  22.440  1.00 91.50  ?  602  MET C O     1 
ATOM   6393  C  CB    . MET D  3  602  ? -130.392 33.092  22.021  1.00 72.80  ?  602  MET C CB    1 
ATOM   6394  C  CG    . MET D  3  602  ? -130.117 31.660  22.444  1.00 63.96  ?  602  MET C CG    1 
ATOM   6395  S  SD    . MET D  3  602  ? -128.598 30.977  21.771  1.00 103.86 ?  602  MET C SD    1 
ATOM   6396  C  CE    . MET D  3  602  ? -127.418 31.498  23.012  1.00 80.22  ?  602  MET C CE    1 
ATOM   6397  N  N     . GLN D  3  603  ? -132.982 35.128  21.419  1.00 80.29  ?  603  GLN C N     1 
ATOM   6398  C  CA    . GLN D  3  603  ? -133.457 36.408  20.904  1.00 71.96  ?  603  GLN C CA    1 
ATOM   6399  C  C     . GLN D  3  603  ? -133.851 37.342  22.039  1.00 62.53  ?  603  GLN C C     1 
ATOM   6400  O  O     . GLN D  3  603  ? -133.540 38.538  22.006  1.00 74.34  ?  603  GLN C O     1 
ATOM   6401  C  CB    . GLN D  3  603  ? -134.633 36.198  19.951  1.00 73.87  ?  603  GLN C CB    1 
ATOM   6402  C  CG    . GLN D  3  603  ? -134.224 35.922  18.514  1.00 77.21  ?  603  GLN C CG    1 
ATOM   6403  C  CD    . GLN D  3  603  ? -135.405 35.937  17.562  1.00 86.37  ?  603  GLN C CD    1 
ATOM   6404  O  OE1   . GLN D  3  603  ? -136.352 35.166  17.716  1.00 102.46 ?  603  GLN C OE1   1 
ATOM   6405  N  NE2   . GLN D  3  603  ? -135.358 36.826  16.576  1.00 82.87  ?  603  GLN C NE2   1 
ATOM   6406  N  N     . ARG D  3  604  ? -134.532 36.816  23.056  1.00 65.25  ?  604  ARG C N     1 
ATOM   6407  C  CA    . ARG D  3  604  ? -134.891 37.621  24.215  1.00 70.31  ?  604  ARG C CA    1 
ATOM   6408  C  C     . ARG D  3  604  ? -133.731 37.802  25.185  1.00 74.56  ?  604  ARG C C     1 
ATOM   6409  O  O     . ARG D  3  604  ? -133.899 38.479  26.205  1.00 69.66  ?  604  ARG C O     1 
ATOM   6410  C  CB    . ARG D  3  604  ? -136.084 37.001  24.947  1.00 61.78  ?  604  ARG C CB    1 
ATOM   6411  C  CG    . ARG D  3  604  ? -135.725 35.853  25.873  1.00 86.40  ?  604  ARG C CG    1 
ATOM   6412  C  CD    . ARG D  3  604  ? -136.964 35.319  26.572  1.00 90.00  ?  604  ARG C CD    1 
ATOM   6413  N  NE    . ARG D  3  604  ? -137.975 34.901  25.608  1.00 89.33  ?  604  ARG C NE    1 
ATOM   6414  C  CZ    . ARG D  3  604  ? -138.071 33.671  25.115  1.00 95.94  ?  604  ARG C CZ    1 
ATOM   6415  N  NH1   . ARG D  3  604  ? -137.221 32.730  25.501  1.00 92.92  ?  604  ARG C NH1   1 
ATOM   6416  N  NH2   . ARG D  3  604  ? -139.020 33.381  24.238  1.00 100.64 ?  604  ARG C NH2   1 
ATOM   6417  N  N     . GLN D  3  605  ? -132.569 37.217  24.898  1.00 65.79  ?  605  GLN C N     1 
ATOM   6418  C  CA    . GLN D  3  605  ? -131.380 37.433  25.708  1.00 61.13  ?  605  GLN C CA    1 
ATOM   6419  C  C     . GLN D  3  605  ? -130.476 38.523  25.150  1.00 69.63  ?  605  GLN C C     1 
ATOM   6420  O  O     . GLN D  3  605  ? -129.486 38.880  25.799  1.00 77.93  ?  605  GLN C O     1 
ATOM   6421  C  CB    . GLN D  3  605  ? -130.588 36.128  25.845  1.00 55.79  ?  605  GLN C CB    1 
ATOM   6422  C  CG    . GLN D  3  605  ? -131.345 35.016  26.557  1.00 69.89  ?  605  GLN C CG    1 
ATOM   6423  C  CD    . GLN D  3  605  ? -130.480 33.797  26.831  1.00 79.68  ?  605  GLN C CD    1 
ATOM   6424  O  OE1   . GLN D  3  605  ? -129.292 33.776  26.505  1.00 86.54  ?  605  GLN C OE1   1 
ATOM   6425  N  NE2   . GLN D  3  605  ? -131.075 32.775  27.437  1.00 80.51  ?  605  GLN C NE2   1 
ATOM   6426  N  N     . ALA D  3  606  ? -130.792 39.060  23.974  1.00 64.92  ?  606  ALA C N     1 
ATOM   6427  C  CA    . ALA D  3  606  ? -129.973 40.104  23.380  1.00 66.36  ?  606  ALA C CA    1 
ATOM   6428  C  C     . ALA D  3  606  ? -130.004 41.364  24.239  1.00 66.29  ?  606  ALA C C     1 
ATOM   6429  O  O     . ALA D  3  606  ? -130.867 41.543  25.101  1.00 85.12  ?  606  ALA C O     1 
ATOM   6430  C  CB    . ALA D  3  606  ? -130.455 40.425  21.966  1.00 70.38  ?  606  ALA C CB    1 
ATOM   6431  N  N     . VAL D  3  607  ? -129.040 42.245  23.991  1.00 55.73  ?  607  VAL C N     1 
ATOM   6432  C  CA    . VAL D  3  607  ? -128.930 43.495  24.737  1.00 59.71  ?  607  VAL C CA    1 
ATOM   6433  C  C     . VAL D  3  607  ? -129.084 44.660  23.767  1.00 68.61  ?  607  VAL C C     1 
ATOM   6434  O  O     . VAL D  3  607  ? -128.700 44.548  22.594  1.00 78.08  ?  607  VAL C O     1 
ATOM   6435  C  CB    . VAL D  3  607  ? -127.598 43.581  25.499  1.00 48.55  ?  607  VAL C CB    1 
ATOM   6436  C  CG1   . VAL D  3  607  ? -127.349 42.303  26.279  1.00 56.12  ?  607  VAL C CG1   1 
ATOM   6437  C  CG2   . VAL D  3  607  ? -126.455 43.864  24.545  1.00 62.17  ?  607  VAL C CG2   1 
ATOM   6438  N  N     . PRO D  3  608  ? -129.644 45.787  24.204  1.00 73.30  ?  608  PRO C N     1 
ATOM   6439  C  CA    . PRO D  3  608  ? -129.799 46.932  23.298  1.00 72.44  ?  608  PRO C CA    1 
ATOM   6440  C  C     . PRO D  3  608  ? -128.452 47.563  22.976  1.00 71.44  ?  608  PRO C C     1 
ATOM   6441  O  O     . PRO D  3  608  ? -127.696 47.941  23.873  1.00 73.55  ?  608  PRO C O     1 
ATOM   6442  C  CB    . PRO D  3  608  ? -130.699 47.892  24.087  1.00 70.44  ?  608  PRO C CB    1 
ATOM   6443  C  CG    . PRO D  3  608  ? -131.330 47.046  25.158  1.00 65.11  ?  608  PRO C CG    1 
ATOM   6444  C  CD    . PRO D  3  608  ? -130.306 46.013  25.497  1.00 70.85  ?  608  PRO C CD    1 
ATOM   6445  N  N     . LEU D  3  609  ? -128.158 47.674  21.686  1.00 67.23  ?  609  LEU C N     1 
ATOM   6446  C  CA    . LEU D  3  609  ? -126.931 48.303  21.228  1.00 65.20  ?  609  LEU C CA    1 
ATOM   6447  C  C     . LEU D  3  609  ? -127.138 49.805  21.061  1.00 75.14  ?  609  LEU C C     1 
ATOM   6448  O  O     . LEU D  3  609  ? -128.260 50.288  20.888  1.00 95.73  ?  609  LEU C O     1 
ATOM   6449  C  CB    . LEU D  3  609  ? -126.468 47.681  19.910  1.00 66.04  ?  609  LEU C CB    1 
ATOM   6450  C  CG    . LEU D  3  609  ? -126.289 46.162  19.923  1.00 53.63  ?  609  LEU C CG    1 
ATOM   6451  C  CD1   . LEU D  3  609  ? -125.783 45.666  18.576  1.00 56.21  ?  609  LEU C CD1   1 
ATOM   6452  C  CD2   . LEU D  3  609  ? -125.350 45.744  21.039  1.00 59.39  ?  609  LEU C CD2   1 
ATOM   6453  N  N     . VAL D  3  610  ? -126.030 50.547  21.117  1.00 68.97  ?  610  VAL C N     1 
ATOM   6454  C  CA    . VAL D  3  610  ? -126.108 52.002  21.016  1.00 58.34  ?  610  VAL C CA    1 
ATOM   6455  C  C     . VAL D  3  610  ? -126.652 52.417  19.655  1.00 67.46  ?  610  VAL C C     1 
ATOM   6456  O  O     . VAL D  3  610  ? -127.409 53.389  19.544  1.00 74.96  ?  610  VAL C O     1 
ATOM   6457  C  CB    . VAL D  3  610  ? -124.732 52.635  21.294  1.00 46.23  ?  610  VAL C CB    1 
ATOM   6458  C  CG1   . VAL D  3  610  ? -124.363 52.477  22.755  1.00 50.26  ?  610  VAL C CG1   1 
ATOM   6459  C  CG2   . VAL D  3  610  ? -123.672 51.999  20.412  1.00 76.81  ?  610  VAL C CG2   1 
ATOM   6460  N  N     . ARG D  3  611  ? -126.278 51.693  18.600  1.00 76.73  ?  611  ARG C N     1 
ATOM   6461  C  CA    . ARG D  3  611  ? -126.718 52.044  17.255  1.00 86.37  ?  611  ARG C CA    1 
ATOM   6462  C  C     . ARG D  3  611  ? -128.031 51.372  16.875  1.00 76.66  ?  611  ARG C C     1 
ATOM   6463  O  O     . ARG D  3  611  ? -128.897 52.008  16.267  1.00 97.02  ?  611  ARG C O     1 
ATOM   6464  C  CB    . ARG D  3  611  ? -125.635 51.685  16.233  1.00 117.33 ?  611  ARG C CB    1 
ATOM   6465  C  CG    . ARG D  3  611  ? -124.901 52.891  15.664  1.00 117.79 ?  611  ARG C CG    1 
ATOM   6466  C  CD    . ARG D  3  611  ? -125.872 53.857  15.001  1.00 105.61 ?  611  ARG C CD    1 
ATOM   6467  N  NE    . ARG D  3  611  ? -125.190 55.015  14.431  1.00 128.77 ?  611  ARG C NE    1 
ATOM   6468  C  CZ    . ARG D  3  611  ? -124.933 56.135  15.100  1.00 125.28 ?  611  ARG C CZ    1 
ATOM   6469  N  NH1   . ARG D  3  611  ? -125.301 56.251  16.368  1.00 118.01 ?  611  ARG C NH1   1 
ATOM   6470  N  NH2   . ARG D  3  611  ? -124.308 57.140  14.501  1.00 116.03 ?  611  ARG C NH2   1 
ATOM   6471  N  N     . SER D  3  612  ? -128.197 50.097  17.217  1.00 65.77  ?  612  SER C N     1 
ATOM   6472  C  CA    . SER D  3  612  ? -129.448 49.404  16.937  1.00 78.57  ?  612  SER C CA    1 
ATOM   6473  C  C     . SER D  3  612  ? -129.730 49.377  15.439  1.00 80.26  ?  612  SER C C     1 
ATOM   6474  O  O     . SER D  3  612  ? -130.480 50.214  14.927  1.00 79.41  ?  612  SER C O     1 
ATOM   6475  C  CB    . SER D  3  612  ? -130.603 50.071  17.691  1.00 78.86  ?  612  SER C CB    1 
ATOM   6476  O  OG    . SER D  3  612  ? -131.818 49.368  17.502  1.00 83.91  ?  612  SER C OG    1 
ATOM   6477  N  N     . GLU D  3  613  ? -129.130 48.423  14.733  1.00 93.61  ?  613  GLU C N     1 
ATOM   6478  C  CA    . GLU D  3  613  ? -129.331 48.246  13.302  1.00 78.55  ?  613  GLU C CA    1 
ATOM   6479  C  C     . GLU D  3  613  ? -130.379 47.168  13.059  1.00 64.88  ?  613  GLU C C     1 
ATOM   6480  O  O     . GLU D  3  613  ? -130.383 46.131  13.727  1.00 68.45  ?  613  GLU C O     1 
ATOM   6481  C  CB    . GLU D  3  613  ? -128.021 47.867  12.609  1.00 75.70  ?  613  GLU C CB    1 
ATOM   6482  C  CG    . GLU D  3  613  ? -128.138 47.660  11.108  1.00 89.98  ?  613  GLU C CG    1 
ATOM   6483  C  CD    . GLU D  3  613  ? -126.817 47.257  10.469  1.00 94.70  ?  613  GLU C CD    1 
ATOM   6484  O  OE1   . GLU D  3  613  ? -125.805 47.161  11.198  1.00 77.33  ?  613  GLU C OE1   1 
ATOM   6485  O  OE2   . GLU D  3  613  ? -126.790 47.035  9.239   1.00 97.40  ?  613  GLU C OE2   1 
ATOM   6486  N  N     . ALA D  3  614  ? -131.273 47.422  12.105  1.00 77.43  ?  614  ALA C N     1 
ATOM   6487  C  CA    . ALA D  3  614  ? -132.327 46.462  11.829  1.00 80.70  ?  614  ALA C CA    1 
ATOM   6488  C  C     . ALA D  3  614  ? -131.775 45.266  11.059  1.00 76.65  ?  614  ALA C C     1 
ATOM   6489  O  O     . ALA D  3  614  ? -130.787 45.389  10.331  1.00 81.68  ?  614  ALA C O     1 
ATOM   6490  C  CB    . ALA D  3  614  ? -133.453 47.111  11.035  1.00 74.84  ?  614  ALA C CB    1 
ATOM   6491  N  N     . PRO D  3  615  ? -132.391 44.096  11.211  1.00 71.11  ?  615  PRO C N     1 
ATOM   6492  C  CA    . PRO D  3  615  ? -131.891 42.906  10.512  1.00 67.03  ?  615  PRO C CA    1 
ATOM   6493  C  C     . PRO D  3  615  ? -132.053 43.040  9.006   1.00 69.14  ?  615  PRO C C     1 
ATOM   6494  O  O     . PRO D  3  615  ? -133.103 43.453  8.509   1.00 70.08  ?  615  PRO C O     1 
ATOM   6495  C  CB    . PRO D  3  615  ? -132.761 41.777  11.072  1.00 62.03  ?  615  PRO C CB    1 
ATOM   6496  C  CG    . PRO D  3  615  ? -134.016 42.456  11.499  1.00 81.71  ?  615  PRO C CG    1 
ATOM   6497  C  CD    . PRO D  3  615  ? -133.608 43.815  11.990  1.00 87.77  ?  615  PRO C CD    1 
ATOM   6498  N  N     . LEU D  3  616  ? -130.995 42.670  8.280   1.00 82.75  ?  616  LEU C N     1 
ATOM   6499  C  CA    . LEU D  3  616  ? -131.017 42.778  6.824   1.00 79.12  ?  616  LEU C CA    1 
ATOM   6500  C  C     . LEU D  3  616  ? -131.935 41.729  6.204   1.00 78.93  ?  616  LEU C C     1 
ATOM   6501  O  O     . LEU D  3  616  ? -132.650 42.015  5.237   1.00 83.80  ?  616  LEU C O     1 
ATOM   6502  C  CB    . LEU D  3  616  ? -129.598 42.652  6.273   1.00 58.51  ?  616  LEU C CB    1 
ATOM   6503  C  CG    . LEU D  3  616  ? -129.401 43.067  4.816   1.00 71.74  ?  616  LEU C CG    1 
ATOM   6504  C  CD1   . LEU D  3  616  ? -129.961 44.457  4.571   1.00 63.64  ?  616  LEU C CD1   1 
ATOM   6505  C  CD2   . LEU D  3  616  ? -127.927 43.014  4.455   1.00 85.69  ?  616  LEU C CD2   1 
ATOM   6506  N  N     . VAL D  3  617  ? -131.930 40.515  6.746   1.00 78.17  ?  617  VAL C N     1 
ATOM   6507  C  CA    . VAL D  3  617  ? -132.813 39.442  6.306   1.00 76.68  ?  617  VAL C CA    1 
ATOM   6508  C  C     . VAL D  3  617  ? -133.708 39.085  7.476   1.00 81.54  ?  617  VAL C C     1 
ATOM   6509  O  O     . VAL D  3  617  ? -133.259 38.469  8.451   1.00 90.08  ?  617  VAL C O     1 
ATOM   6510  C  CB    . VAL D  3  617  ? -132.042 38.215  5.810   1.00 92.12  ?  617  VAL C CB    1 
ATOM   6511  C  CG1   . VAL D  3  617  ? -130.957 37.848  6.790   1.00 99.50  ?  617  VAL C CG1   1 
ATOM   6512  C  CG2   . VAL D  3  617  ? -133.006 37.052  5.609   1.00 76.27  ?  617  VAL C CG2   1 
ATOM   6513  N  N     . GLY D  3  618  ? -134.971 39.471  7.389   1.00 75.81  ?  618  GLY C N     1 
ATOM   6514  C  CA    . GLY D  3  618  ? -135.868 39.195  8.491   1.00 74.19  ?  618  GLY C CA    1 
ATOM   6515  C  C     . GLY D  3  618  ? -137.174 38.560  8.068   1.00 75.70  ?  618  GLY C C     1 
ATOM   6516  O  O     . GLY D  3  618  ? -137.335 38.150  6.909   1.00 87.29  ?  618  GLY C O     1 
ATOM   6517  N  N     . THR D  3  619  ? -138.094 38.427  9.021   1.00 79.10  ?  619  THR C N     1 
ATOM   6518  C  CA    . THR D  3  619  ? -139.413 37.913  8.698   1.00 76.07  ?  619  THR C CA    1 
ATOM   6519  C  C     . THR D  3  619  ? -140.431 39.048  8.607   1.00 91.84  ?  619  THR C C     1 
ATOM   6520  O  O     . THR D  3  619  ? -140.202 40.070  7.946   1.00 99.11  ?  619  THR C O     1 
ATOM   6521  C  CB    . THR D  3  619  ? -139.911 36.920  9.737   1.00 78.47  ?  619  THR C CB    1 
ATOM   6522  O  OG1   . THR D  3  619  ? -141.284 36.634  9.477   1.00 100.92 ?  619  THR C OG1   1 
ATOM   6523  C  CG2   . THR D  3  619  ? -139.805 37.481  11.113  1.00 83.27  ?  619  THR C CG2   1 
ATOM   6524  N  N     . GLY D  3  620  ? -141.558 38.894  9.308   1.00 101.03 ?  620  GLY C N     1 
ATOM   6525  C  CA    . GLY D  3  620  ? -142.645 39.843  9.208   1.00 89.04  ?  620  GLY C CA    1 
ATOM   6526  C  C     . GLY D  3  620  ? -142.996 40.450  10.549  1.00 91.51  ?  620  GLY C C     1 
ATOM   6527  O  O     . GLY D  3  620  ? -143.530 41.561  10.637  1.00 91.77  ?  620  GLY C O     1 
ATOM   6528  N  N     . MET D  3  621  ? -142.675 39.720  11.615  1.00 88.56  ?  621  MET C N     1 
ATOM   6529  C  CA    . MET D  3  621  ? -143.109 40.116  12.949  1.00 85.54  ?  621  MET C CA    1 
ATOM   6530  C  C     . MET D  3  621  ? -142.350 41.322  13.490  1.00 88.82  ?  621  MET C C     1 
ATOM   6531  O  O     . MET D  3  621  ? -142.824 41.961  14.438  1.00 90.12  ?  621  MET C O     1 
ATOM   6532  C  CB    . MET D  3  621  ? -142.958 38.946  13.916  1.00 82.96  ?  621  MET C CB    1 
ATOM   6533  C  CG    . MET D  3  621  ? -143.954 37.837  13.702  1.00 90.10  ?  621  MET C CG    1 
ATOM   6534  S  SD    . MET D  3  621  ? -145.611 38.390  14.113  1.00 111.66 ?  621  MET C SD    1 
ATOM   6535  C  CE    . MET D  3  621  ? -145.340 38.961  15.786  1.00 98.11  ?  621  MET C CE    1 
ATOM   6536  N  N     . GLU D  3  622  ? -141.180 41.634  12.927  1.00 85.76  ?  622  GLU C N     1 
ATOM   6537  C  CA    . GLU D  3  622  ? -140.357 42.717  13.459  1.00 82.02  ?  622  GLU C CA    1 
ATOM   6538  C  C     . GLU D  3  622  ? -141.176 43.983  13.682  1.00 88.06  ?  622  GLU C C     1 
ATOM   6539  O  O     . GLU D  3  622  ? -141.201 44.536  14.787  1.00 83.06  ?  622  GLU C O     1 
ATOM   6540  C  CB    . GLU D  3  622  ? -139.183 43.000  12.516  1.00 86.27  ?  622  GLU C CB    1 
ATOM   6541  C  CG    . GLU D  3  622  ? -138.229 41.826  12.320  1.00 79.45  ?  622  GLU C CG    1 
ATOM   6542  C  CD    . GLU D  3  622  ? -138.717 40.841  11.275  1.00 90.75  ?  622  GLU C CD    1 
ATOM   6543  O  OE1   . GLU D  3  622  ? -139.897 40.936  10.870  1.00 95.23  ?  622  GLU C OE1   1 
ATOM   6544  O  OE2   . GLU D  3  622  ? -137.917 39.978  10.854  1.00 92.85  ?  622  GLU C OE2   1 
ATOM   6545  N  N     . LEU D  3  623  ? -141.852 44.460  12.635  1.00 97.12  ?  623  LEU C N     1 
ATOM   6546  C  CA    . LEU D  3  623  ? -142.622 45.694  12.746  1.00 83.40  ?  623  LEU C CA    1 
ATOM   6547  C  C     . LEU D  3  623  ? -143.732 45.557  13.781  1.00 82.21  ?  623  LEU C C     1 
ATOM   6548  O  O     . LEU D  3  623  ? -143.854 46.382  14.693  1.00 87.37  ?  623  LEU C O     1 
ATOM   6549  C  CB    . LEU D  3  623  ? -143.198 46.069  11.382  1.00 85.61  ?  623  LEU C CB    1 
ATOM   6550  C  CG    . LEU D  3  623  ? -143.729 47.492  11.235  1.00 84.62  ?  623  LEU C CG    1 
ATOM   6551  C  CD1   . LEU D  3  623  ? -142.590 48.496  11.337  1.00 86.18  ?  623  LEU C CD1   1 
ATOM   6552  C  CD2   . LEU D  3  623  ? -144.472 47.649  9.919   1.00 99.94  ?  623  LEU C CD2   1 
ATOM   6553  N  N     . ARG D  3  624  ? -144.552 44.511  13.656  1.00 77.28  ?  624  ARG C N     1 
ATOM   6554  C  CA    . ARG D  3  624  ? -145.666 44.330  14.581  1.00 82.00  ?  624  ARG C CA    1 
ATOM   6555  C  C     . ARG D  3  624  ? -145.178 44.103  16.007  1.00 87.02  ?  624  ARG C C     1 
ATOM   6556  O  O     . ARG D  3  624  ? -145.749 44.645  16.960  1.00 88.29  ?  624  ARG C O     1 
ATOM   6557  C  CB    . ARG D  3  624  ? -146.542 43.165  14.121  1.00 93.21  ?  624  ARG C CB    1 
ATOM   6558  C  CG    . ARG D  3  624  ? -147.594 43.555  13.098  1.00 101.97 ?  624  ARG C CG    1 
ATOM   6559  C  CD    . ARG D  3  624  ? -148.646 44.446  13.733  1.00 86.67  ?  624  ARG C CD    1 
ATOM   6560  N  NE    . ARG D  3  624  ? -149.392 43.739  14.770  1.00 96.95  ?  624  ARG C NE    1 
ATOM   6561  C  CZ    . ARG D  3  624  ? -150.116 44.336  15.710  1.00 95.04  ?  624  ARG C CZ    1 
ATOM   6562  N  NH1   . ARG D  3  624  ? -150.185 45.660  15.752  1.00 97.26  ?  624  ARG C NH1   1 
ATOM   6563  N  NH2   . ARG D  3  624  ? -150.764 43.610  16.614  1.00 90.62  ?  624  ARG C NH2   1 
ATOM   6564  N  N     . ALA D  3  625  ? -144.125 43.301  16.174  1.00 85.11  ?  625  ALA C N     1 
ATOM   6565  C  CA    . ALA D  3  625  ? -143.648 42.987  17.516  1.00 78.36  ?  625  ALA C CA    1 
ATOM   6566  C  C     . ALA D  3  625  ? -143.121 44.227  18.224  1.00 78.02  ?  625  ALA C C     1 
ATOM   6567  O  O     . ALA D  3  625  ? -143.344 44.403  19.427  1.00 82.72  ?  625  ALA C O     1 
ATOM   6568  C  CB    . ALA D  3  625  ? -142.569 41.908  17.451  1.00 96.30  ?  625  ALA C CB    1 
ATOM   6569  N  N     . ALA D  3  626  ? -142.424 45.100  17.495  1.00 84.92  ?  626  ALA C N     1 
ATOM   6570  C  CA    . ALA D  3  626  ? -141.840 46.282  18.120  1.00 81.31  ?  626  ALA C CA    1 
ATOM   6571  C  C     . ALA D  3  626  ? -142.921 47.217  18.651  1.00 86.67  ?  626  ALA C C     1 
ATOM   6572  O  O     . ALA D  3  626  ? -142.930 47.562  19.838  1.00 93.99  ?  626  ALA C O     1 
ATOM   6573  C  CB    . ALA D  3  626  ? -140.937 47.008  17.123  1.00 80.97  ?  626  ALA C CB    1 
ATOM   6574  N  N     . ILE D  3  627  ? -143.848 47.635  17.785  1.00 78.77  ?  627  ILE C N     1 
ATOM   6575  C  CA    . ILE D  3  627  ? -144.841 48.624  18.193  1.00 79.64  ?  627  ILE C CA    1 
ATOM   6576  C  C     . ILE D  3  627  ? -145.762 48.069  19.272  1.00 75.92  ?  627  ILE C C     1 
ATOM   6577  O  O     . ILE D  3  627  ? -146.273 48.825  20.107  1.00 88.96  ?  627  ILE C O     1 
ATOM   6578  C  CB    . ILE D  3  627  ? -145.645 49.120  16.977  1.00 67.18  ?  627  ILE C CB    1 
ATOM   6579  C  CG1   . ILE D  3  627  ? -146.612 48.037  16.499  1.00 78.03  ?  627  ILE C CG1   1 
ATOM   6580  C  CG2   . ILE D  3  627  ? -144.709 49.540  15.854  1.00 77.94  ?  627  ILE C CG2   1 
ATOM   6581  C  CD1   . ILE D  3  627  ? -147.442 48.448  15.302  1.00 100.62 ?  627  ILE C CD1   1 
ATOM   6582  N  N     . ASP D  3  628  ? -145.995 46.755  19.281  1.00 77.33  ?  628  ASP C N     1 
ATOM   6583  C  CA    . ASP D  3  628  ? -146.867 46.165  20.289  1.00 79.04  ?  628  ASP C CA    1 
ATOM   6584  C  C     . ASP D  3  628  ? -146.171 45.964  21.627  1.00 77.53  ?  628  ASP C C     1 
ATOM   6585  O  O     . ASP D  3  628  ? -146.851 45.860  22.653  1.00 78.40  ?  628  ASP C O     1 
ATOM   6586  C  CB    . ASP D  3  628  ? -147.427 44.829  19.797  1.00 68.77  ?  628  ASP C CB    1 
ATOM   6587  C  CG    . ASP D  3  628  ? -148.552 45.003  18.793  1.00 86.63  ?  628  ASP C CG    1 
ATOM   6588  O  OD1   . ASP D  3  628  ? -148.479 45.944  17.975  1.00 91.07  ?  628  ASP C OD1   1 
ATOM   6589  O  OD2   . ASP D  3  628  ? -149.512 44.202  18.826  1.00 90.53  ?  628  ASP C OD2   1 
ATOM   6590  N  N     . ALA D  3  629  ? -144.837 45.912  21.642  1.00 76.11  ?  629  ALA C N     1 
ATOM   6591  C  CA    . ALA D  3  629  ? -144.126 45.739  22.903  1.00 88.54  ?  629  ALA C CA    1 
ATOM   6592  C  C     . ALA D  3  629  ? -144.380 46.901  23.852  1.00 86.77  ?  629  ALA C C     1 
ATOM   6593  O  O     . ALA D  3  629  ? -144.384 46.715  25.074  1.00 96.36  ?  629  ALA C O     1 
ATOM   6594  C  CB    . ALA D  3  629  ? -142.627 45.584  22.644  1.00 94.54  ?  629  ALA C CB    1 
ATOM   6595  N  N     . GLY D  3  630  ? -144.599 48.098  23.314  1.00 87.73  ?  630  GLY C N     1 
ATOM   6596  C  CA    . GLY D  3  630  ? -144.784 49.285  24.120  1.00 104.97 ?  630  GLY C CA    1 
ATOM   6597  C  C     . GLY D  3  630  ? -143.539 50.119  24.318  1.00 102.33 ?  630  GLY C C     1 
ATOM   6598  O  O     . GLY D  3  630  ? -143.622 51.182  24.945  1.00 111.19 ?  630  GLY C O     1 
ATOM   6599  N  N     . ASP D  3  631  ? -142.394 49.674  23.807  1.00 94.86  ?  631  ASP C N     1 
ATOM   6600  C  CA    . ASP D  3  631  ? -141.138 50.397  23.939  1.00 97.55  ?  631  ASP C CA    1 
ATOM   6601  C  C     . ASP D  3  631  ? -140.855 51.308  22.751  1.00 88.30  ?  631  ASP C C     1 
ATOM   6602  O  O     . ASP D  3  631  ? -139.717 51.758  22.588  1.00 82.52  ?  631  ASP C O     1 
ATOM   6603  C  CB    . ASP D  3  631  ? -139.983 49.409  24.127  1.00 102.16 ?  631  ASP C CB    1 
ATOM   6604  C  CG    . ASP D  3  631  ? -140.124 48.582  25.393  1.00 119.32 ?  631  ASP C CG    1 
ATOM   6605  O  OD1   . ASP D  3  631  ? -141.258 48.466  25.908  1.00 112.34 ?  631  ASP C OD1   1 
ATOM   6606  O  OD2   . ASP D  3  631  ? -139.103 48.046  25.874  1.00 127.03 ?  631  ASP C OD2   1 
ATOM   6607  N  N     . VAL D  3  632  ? -141.860 51.591  21.926  1.00 90.51  ?  632  VAL C N     1 
ATOM   6608  C  CA    . VAL D  3  632  ? -141.721 52.472  20.774  1.00 77.36  ?  632  VAL C CA    1 
ATOM   6609  C  C     . VAL D  3  632  ? -142.823 53.520  20.832  1.00 89.97  ?  632  VAL C C     1 
ATOM   6610  O  O     . VAL D  3  632  ? -143.959 53.219  21.216  1.00 102.45 ?  632  VAL C O     1 
ATOM   6611  C  CB    . VAL D  3  632  ? -141.782 51.688  19.448  1.00 78.29  ?  632  VAL C CB    1 
ATOM   6612  C  CG1   . VAL D  3  632  ? -141.828 52.640  18.265  1.00 74.15  ?  632  VAL C CG1   1 
ATOM   6613  C  CG2   . VAL D  3  632  ? -140.588 50.752  19.333  1.00 101.00 ?  632  VAL C CG2   1 
ATOM   6614  N  N     . VAL D  3  633  ? -142.489 54.749  20.450  1.00 91.48  ?  633  VAL C N     1 
ATOM   6615  C  CA    . VAL D  3  633  ? -143.439 55.857  20.507  1.00 87.79  ?  633  VAL C CA    1 
ATOM   6616  C  C     . VAL D  3  633  ? -144.318 55.824  19.262  1.00 87.78  ?  633  VAL C C     1 
ATOM   6617  O  O     . VAL D  3  633  ? -143.817 55.852  18.134  1.00 79.15  ?  633  VAL C O     1 
ATOM   6618  C  CB    . VAL D  3  633  ? -142.712 57.203  20.631  1.00 78.49  ?  633  VAL C CB    1 
ATOM   6619  C  CG1   . VAL D  3  633  ? -143.718 58.320  20.860  1.00 86.52  ?  633  VAL C CG1   1 
ATOM   6620  C  CG2   . VAL D  3  633  ? -141.698 57.155  21.767  1.00 83.85  ?  633  VAL C CG2   1 
ATOM   6621  N  N     . VAL D  3  634  ? -145.631 55.777  19.465  1.00 89.01  ?  634  VAL C N     1 
ATOM   6622  C  CA    . VAL D  3  634  ? -146.599 55.716  18.378  1.00 89.25  ?  634  VAL C CA    1 
ATOM   6623  C  C     . VAL D  3  634  ? -147.444 56.982  18.404  1.00 101.93 ?  634  VAL C C     1 
ATOM   6624  O  O     . VAL D  3  634  ? -147.788 57.488  19.478  1.00 100.93 ?  634  VAL C O     1 
ATOM   6625  C  CB    . VAL D  3  634  ? -147.494 54.464  18.488  1.00 99.71  ?  634  VAL C CB    1 
ATOM   6626  C  CG1   . VAL D  3  634  ? -148.328 54.298  17.230  1.00 97.40  ?  634  VAL C CG1   1 
ATOM   6627  C  CG2   . VAL D  3  634  ? -146.645 53.227  18.750  1.00 100.72 ?  634  VAL C CG2   1 
ATOM   6628  N  N     . ALA D  3  635  ? -147.776 57.492  17.219  1.00 95.28  ?  635  ALA C N     1 
ATOM   6629  C  CA    . ALA D  3  635  ? -148.617 58.677  17.101  1.00 78.15  ?  635  ALA C CA    1 
ATOM   6630  C  C     . ALA D  3  635  ? -150.084 58.275  17.201  1.00 101.30 ?  635  ALA C C     1 
ATOM   6631  O  O     . ALA D  3  635  ? -150.572 57.472  16.398  1.00 111.16 ?  635  ALA C O     1 
ATOM   6632  C  CB    . ALA D  3  635  ? -148.342 59.395  15.784  1.00 76.47  ?  635  ALA C CB    1 
ATOM   6633  N  N     . ASP D  3  636  ? -150.789 58.844  18.182  1.00 102.67 ?  636  ASP C N     1 
ATOM   6634  C  CA    . ASP D  3  636  ? -152.182 58.479  18.418  1.00 106.90 ?  636  ASP C CA    1 
ATOM   6635  C  C     . ASP D  3  636  ? -153.120 59.071  17.377  1.00 105.80 ?  636  ASP C C     1 
ATOM   6636  O  O     . ASP D  3  636  ? -154.143 58.458  17.057  1.00 110.68 ?  636  ASP C O     1 
ATOM   6637  C  CB    . ASP D  3  636  ? -152.619 58.931  19.810  1.00 108.61 ?  636  ASP C CB    1 
ATOM   6638  C  CG    . ASP D  3  636  ? -151.589 58.618  20.875  1.00 109.98 ?  636  ASP C CG    1 
ATOM   6639  O  OD1   . ASP D  3  636  ? -150.383 58.811  20.608  1.00 108.98 ?  636  ASP C OD1   1 
ATOM   6640  O  OD2   . ASP D  3  636  ? -151.983 58.180  21.977  1.00 121.24 ?  636  ASP C OD2   1 
ATOM   6641  N  N     . LYS D  3  637  ? -152.798 60.244  16.841  1.00 97.30  ?  637  LYS C N     1 
ATOM   6642  C  CA    . LYS D  3  637  ? -153.705 60.944  15.943  1.00 108.67 ?  637  LYS C CA    1 
ATOM   6643  C  C     . LYS D  3  637  ? -152.930 61.507  14.762  1.00 90.86  ?  637  LYS C C     1 
ATOM   6644  O  O     . LYS D  3  637  ? -151.866 62.107  14.942  1.00 77.44  ?  637  LYS C O     1 
ATOM   6645  C  CB    . LYS D  3  637  ? -154.444 62.065  16.685  1.00 110.93 ?  637  LYS C CB    1 
ATOM   6646  C  CG    . LYS D  3  637  ? -155.083 61.608  17.991  1.00 112.96 ?  637  LYS C CG    1 
ATOM   6647  C  CD    . LYS D  3  637  ? -155.799 62.737  18.714  1.00 106.31 ?  637  LYS C CD    1 
ATOM   6648  C  CE    . LYS D  3  637  ? -156.418 62.235  20.013  1.00 115.02 ?  637  LYS C CE    1 
ATOM   6649  N  NZ    . LYS D  3  637  ? -157.190 63.296  20.715  1.00 117.39 ?  637  LYS C NZ    1 
ATOM   6650  N  N     . THR D  3  638  ? -153.469 61.317  13.559  1.00 82.86  ?  638  THR C N     1 
ATOM   6651  C  CA    . THR D  3  638  ? -152.816 61.818  12.358  1.00 84.43  ?  638  THR C CA    1 
ATOM   6652  C  C     . THR D  3  638  ? -152.628 63.328  12.442  1.00 90.09  ?  638  THR C C     1 
ATOM   6653  O  O     . THR D  3  638  ? -153.451 64.050  13.013  1.00 109.27 ?  638  THR C O     1 
ATOM   6654  C  CB    . THR D  3  638  ? -153.636 61.466  11.114  1.00 90.43  ?  638  THR C CB    1 
ATOM   6655  O  OG1   . THR D  3  638  ? -153.805 60.045  11.031  1.00 105.20 ?  638  THR C OG1   1 
ATOM   6656  C  CG2   . THR D  3  638  ? -152.935 61.962  9.853   1.00 78.25  ?  638  THR C CG2   1 
ATOM   6657  N  N     . GLY D  3  639  ? -151.530 63.806  11.864  1.00 72.67  ?  639  GLY C N     1 
ATOM   6658  C  CA    . GLY D  3  639  ? -151.248 65.227  11.867  1.00 87.64  ?  639  GLY C CA    1 
ATOM   6659  C  C     . GLY D  3  639  ? -149.856 65.585  11.392  1.00 93.79  ?  639  GLY C C     1 
ATOM   6660  O  O     . GLY D  3  639  ? -149.328 64.970  10.460  1.00 103.38 ?  639  GLY C O     1 
ATOM   6661  N  N     . VAL D  3  640  ? -149.251 66.587  12.027  1.00 82.16  ?  640  VAL C N     1 
ATOM   6662  C  CA    . VAL D  3  640  ? -147.925 67.066  11.663  1.00 74.62  ?  640  VAL C CA    1 
ATOM   6663  C  C     . VAL D  3  640  ? -147.163 67.413  12.935  1.00 83.49  ?  640  VAL C C     1 
ATOM   6664  O  O     . VAL D  3  640  ? -147.750 67.807  13.947  1.00 88.95  ?  640  VAL C O     1 
ATOM   6665  C  CB    . VAL D  3  640  ? -147.998 68.285  10.718  1.00 94.27  ?  640  VAL C CB    1 
ATOM   6666  C  CG1   . VAL D  3  640  ? -148.872 69.374  11.325  1.00 94.57  ?  640  VAL C CG1   1 
ATOM   6667  C  CG2   . VAL D  3  640  ? -146.601 68.814  10.416  1.00 99.19  ?  640  VAL C CG2   1 
ATOM   6668  N  N     . ILE D  3  641  ? -145.845 67.259  12.876  1.00 86.03  ?  641  ILE C N     1 
ATOM   6669  C  CA    . ILE D  3  641  ? -144.987 67.540  14.021  1.00 96.23  ?  641  ILE C CA    1 
ATOM   6670  C  C     . ILE D  3  641  ? -144.803 69.044  14.163  1.00 97.43  ?  641  ILE C C     1 
ATOM   6671  O  O     . ILE D  3  641  ? -144.600 69.759  13.174  1.00 97.67  ?  641  ILE C O     1 
ATOM   6672  C  CB    . ILE D  3  641  ? -143.631 66.826  13.867  1.00 95.56  ?  641  ILE C CB    1 
ATOM   6673  C  CG1   . ILE D  3  641  ? -143.732 65.367  14.321  1.00 85.44  ?  641  ILE C CG1   1 
ATOM   6674  C  CG2   . ILE D  3  641  ? -142.549 67.562  14.643  1.00 92.79  ?  641  ILE C CG2   1 
ATOM   6675  C  CD1   . ILE D  3  641  ? -144.715 64.537  13.524  1.00 89.13  ?  641  ILE C CD1   1 
ATOM   6676  N  N     . GLU D  3  642  ? -144.877 69.530  15.401  1.00 94.45  ?  642  GLU C N     1 
ATOM   6677  C  CA    . GLU D  3  642  ? -144.623 70.932  15.710  1.00 102.77 ?  642  GLU C CA    1 
ATOM   6678  C  C     . GLU D  3  642  ? -143.210 71.173  16.220  1.00 96.25  ?  642  GLU C C     1 
ATOM   6679  O  O     . GLU D  3  642  ? -142.584 72.172  15.852  1.00 93.40  ?  642  GLU C O     1 
ATOM   6680  C  CB    . GLU D  3  642  ? -145.633 71.440  16.746  1.00 102.22 ?  642  GLU C CB    1 
ATOM   6681  C  CG    . GLU D  3  642  ? -145.376 72.866  17.211  1.00 109.18 ?  642  GLU C CG    1 
ATOM   6682  C  CD    . GLU D  3  642  ? -146.390 73.341  18.235  1.00 117.57 ?  642  GLU C CD    1 
ATOM   6683  O  OE1   . GLU D  3  642  ? -147.528 72.823  18.235  1.00 109.65 ?  642  GLU C OE1   1 
ATOM   6684  O  OE2   . GLU D  3  642  ? -146.047 74.230  19.043  1.00 129.20 ?  642  GLU C OE2   1 
ATOM   6685  N  N     . GLU D  3  643  ? -142.694 70.280  17.062  1.00 89.32  ?  643  GLU C N     1 
ATOM   6686  C  CA    . GLU D  3  643  ? -141.329 70.367  17.556  1.00 97.56  ?  643  GLU C CA    1 
ATOM   6687  C  C     . GLU D  3  643  ? -140.753 68.965  17.672  1.00 94.45  ?  643  GLU C C     1 
ATOM   6688  O  O     . GLU D  3  643  ? -141.462 68.011  18.004  1.00 100.00 ?  643  GLU C O     1 
ATOM   6689  C  CB    . GLU D  3  643  ? -141.246 71.072  18.918  1.00 102.17 ?  643  GLU C CB    1 
ATOM   6690  C  CG    . GLU D  3  643  ? -141.704 72.522  18.912  1.00 118.90 ?  643  GLU C CG    1 
ATOM   6691  C  CD    . GLU D  3  643  ? -141.361 73.241  20.206  1.00 130.59 ?  643  GLU C CD    1 
ATOM   6692  O  OE1   . GLU D  3  643  ? -140.298 72.939  20.791  1.00 122.78 ?  643  GLU C OE1   1 
ATOM   6693  O  OE2   . GLU D  3  643  ? -142.157 74.101  20.641  1.00 134.53 ?  643  GLU C OE2   1 
ATOM   6694  N  N     . VAL D  3  644  ? -139.458 68.850  17.390  1.00 82.94  ?  644  VAL C N     1 
ATOM   6695  C  CA    . VAL D  3  644  ? -138.727 67.592  17.497  1.00 82.08  ?  644  VAL C CA    1 
ATOM   6696  C  C     . VAL D  3  644  ? -137.439 67.876  18.258  1.00 82.47  ?  644  VAL C C     1 
ATOM   6697  O  O     . VAL D  3  644  ? -136.528 68.524  17.728  1.00 89.32  ?  644  VAL C O     1 
ATOM   6698  C  CB    . VAL D  3  644  ? -138.427 66.970  16.126  1.00 89.45  ?  644  VAL C CB    1 
ATOM   6699  C  CG1   . VAL D  3  644  ? -139.690 66.361  15.537  1.00 99.37  ?  644  VAL C CG1   1 
ATOM   6700  C  CG2   . VAL D  3  644  ? -137.843 68.013  15.185  1.00 93.26  ?  644  VAL C CG2   1 
ATOM   6701  N  N     . SER D  3  645  ? -137.365 67.398  19.498  1.00 76.56  ?  645  SER C N     1 
ATOM   6702  C  CA    . SER D  3  645  ? -136.198 67.576  20.345  1.00 76.11  ?  645  SER C CA    1 
ATOM   6703  C  C     . SER D  3  645  ? -135.845 66.254  21.007  1.00 81.90  ?  645  SER C C     1 
ATOM   6704  O  O     . SER D  3  645  ? -136.703 65.388  21.200  1.00 84.01  ?  645  SER C O     1 
ATOM   6705  C  CB    . SER D  3  645  ? -136.439 68.648  21.420  1.00 90.72  ?  645  SER C CB    1 
ATOM   6706  O  OG    . SER D  3  645  ? -135.315 68.781  22.273  1.00 99.86  ?  645  SER C OG    1 
ATOM   6707  N  N     . ALA D  3  646  ? -134.568 66.108  21.360  1.00 80.26  ?  646  ALA C N     1 
ATOM   6708  C  CA    . ALA D  3  646  ? -134.129 64.897  22.042  1.00 78.48  ?  646  ALA C CA    1 
ATOM   6709  C  C     . ALA D  3  646  ? -134.932 64.625  23.307  1.00 81.86  ?  646  ALA C C     1 
ATOM   6710  O  O     . ALA D  3  646  ? -134.949 63.485  23.783  1.00 90.55  ?  646  ALA C O     1 
ATOM   6711  C  CB    . ALA D  3  646  ? -132.642 64.992  22.381  1.00 84.69  ?  646  ALA C CB    1 
ATOM   6712  N  N     . ASP D  3  647  ? -135.599 65.641  23.858  1.00 79.26  ?  647  ASP C N     1 
ATOM   6713  C  CA    . ASP D  3  647  ? -136.351 65.494  25.098  1.00 73.15  ?  647  ASP C CA    1 
ATOM   6714  C  C     . ASP D  3  647  ? -137.792 65.055  24.851  1.00 80.59  ?  647  ASP C C     1 
ATOM   6715  O  O     . ASP D  3  647  ? -138.297 64.164  25.541  1.00 87.42  ?  647  ASP C O     1 
ATOM   6716  C  CB    . ASP D  3  647  ? -136.330 66.809  25.884  1.00 91.46  ?  647  ASP C CB    1 
ATOM   6717  C  CG    . ASP D  3  647  ? -134.941 67.415  25.975  1.00 98.09  ?  647  ASP C CG    1 
ATOM   6718  O  OD1   . ASP D  3  647  ? -134.153 66.974  26.838  1.00 97.15  ?  647  ASP C OD1   1 
ATOM   6719  O  OD2   . ASP D  3  647  ? -134.641 68.336  25.186  1.00 95.73  ?  647  ASP C OD2   1 
ATOM   6720  N  N     . TYR D  3  648  ? -138.466 65.669  23.879  1.00 80.00  ?  648  TYR C N     1 
ATOM   6721  C  CA    . TYR D  3  648  ? -139.866 65.362  23.620  1.00 78.23  ?  648  TYR C CA    1 
ATOM   6722  C  C     . TYR D  3  648  ? -140.187 65.638  22.157  1.00 72.51  ?  648  TYR C C     1 
ATOM   6723  O  O     . TYR D  3  648  ? -139.391 66.224  21.421  1.00 69.47  ?  648  TYR C O     1 
ATOM   6724  C  CB    . TYR D  3  648  ? -140.798 66.166  24.536  1.00 83.96  ?  648  TYR C CB    1 
ATOM   6725  C  CG    . TYR D  3  648  ? -140.813 67.658  24.268  1.00 87.36  ?  648  TYR C CG    1 
ATOM   6726  C  CD1   . TYR D  3  648  ? -139.990 68.521  24.979  1.00 92.13  ?  648  TYR C CD1   1 
ATOM   6727  C  CD2   . TYR D  3  648  ? -141.660 68.204  23.311  1.00 90.37  ?  648  TYR C CD2   1 
ATOM   6728  C  CE1   . TYR D  3  648  ? -140.004 69.885  24.739  1.00 99.50  ?  648  TYR C CE1   1 
ATOM   6729  C  CE2   . TYR D  3  648  ? -141.680 69.565  23.063  1.00 90.16  ?  648  TYR C CE2   1 
ATOM   6730  C  CZ    . TYR D  3  648  ? -140.851 70.401  23.780  1.00 98.27  ?  648  TYR C CZ    1 
ATOM   6731  O  OH    . TYR D  3  648  ? -140.866 71.757  23.539  1.00 103.36 ?  648  TYR C OH    1 
ATOM   6732  N  N     . ILE D  3  649  ? -141.380 65.206  21.749  1.00 75.67  ?  649  ILE C N     1 
ATOM   6733  C  CA    . ILE D  3  649  ? -141.891 65.422  20.400  1.00 78.40  ?  649  ILE C CA    1 
ATOM   6734  C  C     . ILE D  3  649  ? -143.357 65.821  20.498  1.00 95.30  ?  649  ILE C C     1 
ATOM   6735  O  O     . ILE D  3  649  ? -144.127 65.212  21.248  1.00 96.72  ?  649  ILE C O     1 
ATOM   6736  C  CB    . ILE D  3  649  ? -141.729 64.168  19.516  1.00 74.49  ?  649  ILE C CB    1 
ATOM   6737  C  CG1   . ILE D  3  649  ? -140.251 63.802  19.373  1.00 89.89  ?  649  ILE C CG1   1 
ATOM   6738  C  CG2   . ILE D  3  649  ? -142.361 64.392  18.151  1.00 72.04  ?  649  ILE C CG2   1 
ATOM   6739  C  CD1   . ILE D  3  649  ? -140.010 62.572  18.525  1.00 87.08  ?  649  ILE C CD1   1 
ATOM   6740  N  N     . THR D  3  650  ? -143.743 66.843  19.736  1.00 92.14  ?  650  THR C N     1 
ATOM   6741  C  CA    . THR D  3  650  ? -145.106 67.358  19.733  1.00 89.34  ?  650  THR C CA    1 
ATOM   6742  C  C     . THR D  3  650  ? -145.682 67.280  18.326  1.00 87.77  ?  650  THR C C     1 
ATOM   6743  O  O     . THR D  3  650  ? -144.991 67.571  17.345  1.00 88.34  ?  650  THR C O     1 
ATOM   6744  C  CB    . THR D  3  650  ? -145.157 68.805  20.229  1.00 91.89  ?  650  THR C CB    1 
ATOM   6745  O  OG1   . THR D  3  650  ? -144.445 69.648  19.315  1.00 107.49 ?  650  THR C OG1   1 
ATOM   6746  C  CG2   . THR D  3  650  ? -144.522 68.916  21.606  1.00 84.99  ?  650  THR C CG2   1 
ATOM   6747  N  N     . VAL D  3  651  ? -146.952 66.894  18.235  1.00 82.44  ?  651  VAL C N     1 
ATOM   6748  C  CA    . VAL D  3  651  ? -147.640 66.715  16.962  1.00 85.01  ?  651  VAL C CA    1 
ATOM   6749  C  C     . VAL D  3  651  ? -148.889 67.584  16.959  1.00 99.09  ?  651  VAL C C     1 
ATOM   6750  O  O     . VAL D  3  651  ? -149.684 67.541  17.905  1.00 104.03 ?  651  VAL C O     1 
ATOM   6751  C  CB    . VAL D  3  651  ? -148.003 65.240  16.715  1.00 88.68  ?  651  VAL C CB    1 
ATOM   6752  C  CG1   . VAL D  3  651  ? -146.748 64.381  16.712  1.00 94.18  ?  651  VAL C CG1   1 
ATOM   6753  C  CG2   . VAL D  3  651  ? -148.990 64.752  17.766  1.00 95.72  ?  651  VAL C CG2   1 
ATOM   6754  N  N     . MET D  3  652  ? -149.058 68.370  15.898  1.00 102.19 ?  652  MET C N     1 
ATOM   6755  C  CA    . MET D  3  652  ? -150.221 69.241  15.731  1.00 96.86  ?  652  MET C CA    1 
ATOM   6756  C  C     . MET D  3  652  ? -151.214 68.518  14.828  1.00 92.44  ?  652  MET C C     1 
ATOM   6757  O  O     . MET D  3  652  ? -151.157 68.619  13.601  1.00 90.79  ?  652  MET C O     1 
ATOM   6758  C  CB    . MET D  3  652  ? -149.814 70.593  15.157  1.00 112.88 ?  652  MET C CB    1 
ATOM   6759  C  CG    . MET D  3  652  ? -150.989 71.488  14.793  1.00 115.43 ?  652  MET C CG    1 
ATOM   6760  S  SD    . MET D  3  652  ? -152.057 71.843  16.201  1.00 116.74 ?  652  MET C SD    1 
ATOM   6761  C  CE    . MET D  3  652  ? -150.933 72.759  17.253  1.00 117.74 ?  652  MET C CE    1 
ATOM   6762  N  N     . ALA D  3  653  ? -152.132 67.779  15.445  1.00 92.78  ?  653  ALA C N     1 
ATOM   6763  C  CA    . ALA D  3  653  ? -153.125 67.031  14.690  1.00 94.68  ?  653  ALA C CA    1 
ATOM   6764  C  C     . ALA D  3  653  ? -154.063 67.974  13.942  1.00 107.99 ?  653  ALA C C     1 
ATOM   6765  O  O     . ALA D  3  653  ? -154.381 69.072  14.408  1.00 119.95 ?  653  ALA C O     1 
ATOM   6766  C  CB    . ALA D  3  653  ? -153.930 66.126  15.621  1.00 90.88  ?  653  ALA C CB    1 
ATOM   6767  N  N     . ASP D  3  654  ? -154.508 67.529  12.763  1.00 99.69  ?  654  ASP C N     1 
ATOM   6768  C  CA    . ASP D  3  654  ? -155.491 68.298  12.006  1.00 110.79 ?  654  ASP C CA    1 
ATOM   6769  C  C     . ASP D  3  654  ? -156.737 68.570  12.833  1.00 112.22 ?  654  ASP C C     1 
ATOM   6770  O  O     . ASP D  3  654  ? -157.360 69.628  12.689  1.00 121.71 ?  654  ASP C O     1 
ATOM   6771  C  CB    . ASP D  3  654  ? -155.862 67.566  10.720  1.00 109.30 ?  654  ASP C CB    1 
ATOM   6772  C  CG    . ASP D  3  654  ? -154.663 67.330  9.817   1.00 115.09 ?  654  ASP C CG    1 
ATOM   6773  O  OD1   . ASP D  3  654  ? -153.717 68.148  9.846   1.00 110.01 ?  654  ASP C OD1   1 
ATOM   6774  O  OD2   . ASP D  3  654  ? -154.675 66.330  9.066   1.00 115.85 ?  654  ASP C OD2   1 
ATOM   6775  N  N     . ASP D  3  655  ? -157.112 67.629  13.704  1.00 101.48 ?  655  ASP C N     1 
ATOM   6776  C  CA    . ASP D  3  655  ? -158.244 67.840  14.597  1.00 102.93 ?  655  ASP C CA    1 
ATOM   6777  C  C     . ASP D  3  655  ? -158.098 69.127  15.392  1.00 105.35 ?  655  ASP C C     1 
ATOM   6778  O  O     . ASP D  3  655  ? -159.099 69.719  15.806  1.00 113.47 ?  655  ASP C O     1 
ATOM   6779  C  CB    . ASP D  3  655  ? -158.386 66.644  15.542  1.00 109.94 ?  655  ASP C CB    1 
ATOM   6780  C  CG    . ASP D  3  655  ? -159.281 66.937  16.737  1.00 125.73 ?  655  ASP C CG    1 
ATOM   6781  O  OD1   . ASP D  3  655  ? -160.328 67.594  16.564  1.00 133.80 ?  655  ASP C OD1   1 
ATOM   6782  O  OD2   . ASP D  3  655  ? -158.931 66.505  17.855  1.00 122.58 ?  655  ASP C OD2   1 
ATOM   6783  N  N     . GLY D  3  656  ? -156.865 69.580  15.607  1.00 102.85 ?  656  GLY C N     1 
ATOM   6784  C  CA    . GLY D  3  656  ? -156.583 70.742  16.418  1.00 108.95 ?  656  GLY C CA    1 
ATOM   6785  C  C     . GLY D  3  656  ? -155.995 70.414  17.772  1.00 109.37 ?  656  GLY C C     1 
ATOM   6786  O  O     . GLY D  3  656  ? -155.329 71.271  18.369  1.00 118.63 ?  656  GLY C O     1 
ATOM   6787  N  N     . THR D  3  657  ? -156.220 69.202  18.271  1.00 102.34 ?  657  THR C N     1 
ATOM   6788  C  CA    . THR D  3  657  ? -155.610 68.781  19.519  1.00 105.53 ?  657  THR C CA    1 
ATOM   6789  C  C     . THR D  3  657  ? -154.087 68.850  19.409  1.00 110.96 ?  657  THR C C     1 
ATOM   6790  O  O     . THR D  3  657  ? -153.515 69.020  18.329  1.00 103.94 ?  657  THR C O     1 
ATOM   6791  C  CB    . THR D  3  657  ? -156.062 67.369  19.884  1.00 113.24 ?  657  THR C CB    1 
ATOM   6792  O  OG1   . THR D  3  657  ? -155.974 66.523  18.730  1.00 114.28 ?  657  THR C OG1   1 
ATOM   6793  C  CG2   . THR D  3  657  ? -157.497 67.384  20.393  1.00 114.84 ?  657  THR C CG2   1 
ATOM   6794  N  N     . ARG D  3  658  ? -153.426 68.710  20.557  1.00 111.12 ?  658  ARG C N     1 
ATOM   6795  C  CA    . ARG D  3  658  ? -151.982 68.922  20.656  1.00 95.50  ?  658  ARG C CA    1 
ATOM   6796  C  C     . ARG D  3  658  ? -151.421 67.884  21.622  1.00 95.81  ?  658  ARG C C     1 
ATOM   6797  O  O     . ARG D  3  658  ? -151.580 68.011  22.840  1.00 93.84  ?  658  ARG C O     1 
ATOM   6798  C  CB    . ARG D  3  658  ? -151.686 70.343  21.118  1.00 114.19 ?  658  ARG C CB    1 
ATOM   6799  C  CG    . ARG D  3  658  ? -150.252 70.812  20.957  1.00 92.92  ?  658  ARG C CG    1 
ATOM   6800  C  CD    . ARG D  3  658  ? -150.203 72.318  21.171  1.00 103.03 ?  658  ARG C CD    1 
ATOM   6801  N  NE    . ARG D  3  658  ? -148.862 72.825  21.439  1.00 112.34 ?  658  ARG C NE    1 
ATOM   6802  C  CZ    . ARG D  3  658  ? -148.607 74.075  21.815  1.00 119.88 ?  658  ARG C CZ    1 
ATOM   6803  N  NH1   . ARG D  3  658  ? -149.604 74.936  21.967  1.00 119.25 ?  658  ARG C NH1   1 
ATOM   6804  N  NH2   . ARG D  3  658  ? -147.361 74.464  22.044  1.00 110.66 ?  658  ARG C NH2   1 
ATOM   6805  N  N     . GLN D  3  659  ? -150.771 66.860  21.076  1.00 98.62  ?  659  GLN C N     1 
ATOM   6806  C  CA    . GLN D  3  659  ? -150.208 65.772  21.862  1.00 94.06  ?  659  GLN C CA    1 
ATOM   6807  C  C     . GLN D  3  659  ? -148.688 65.868  21.873  1.00 87.38  ?  659  GLN C C     1 
ATOM   6808  O  O     . GLN D  3  659  ? -148.073 66.271  20.880  1.00 83.61  ?  659  GLN C O     1 
ATOM   6809  C  CB    . GLN D  3  659  ? -150.639 64.409  21.312  1.00 83.67  ?  659  GLN C CB    1 
ATOM   6810  C  CG    . GLN D  3  659  ? -152.128 64.123  21.428  1.00 103.87 ?  659  GLN C CG    1 
ATOM   6811  C  CD    . GLN D  3  659  ? -152.958 64.929  20.449  1.00 119.55 ?  659  GLN C CD    1 
ATOM   6812  O  OE1   . GLN D  3  659  ? -152.421 65.582  19.553  1.00 117.47 ?  659  GLN C OE1   1 
ATOM   6813  N  NE2   . GLN D  3  659  ? -154.276 64.888  20.615  1.00 121.17 ?  659  GLN C NE2   1 
ATOM   6814  N  N     . SER D  3  660  ? -148.089 65.498  23.003  1.00 75.98  ?  660  SER C N     1 
ATOM   6815  C  CA    . SER D  3  660  ? -146.644 65.488  23.161  1.00 75.15  ?  660  SER C CA    1 
ATOM   6816  C  C     . SER D  3  660  ? -146.212 64.173  23.791  1.00 83.37  ?  660  SER C C     1 
ATOM   6817  O  O     . SER D  3  660  ? -146.983 63.522  24.502  1.00 80.81  ?  660  SER C O     1 
ATOM   6818  C  CB    . SER D  3  660  ? -146.160 66.662  24.018  1.00 79.62  ?  660  SER C CB    1 
ATOM   6819  O  OG    . SER D  3  660  ? -146.444 67.896  23.389  1.00 93.05  ?  660  SER C OG    1 
ATOM   6820  N  N     . TYR D  3  661  ? -144.966 63.787  23.525  1.00 81.48  ?  661  TYR C N     1 
ATOM   6821  C  CA    . TYR D  3  661  ? -144.433 62.510  23.990  1.00 77.15  ?  661  TYR C CA    1 
ATOM   6822  C  C     . TYR D  3  661  ? -143.041 62.744  24.558  1.00 74.28  ?  661  TYR C C     1 
ATOM   6823  O  O     . TYR D  3  661  ? -142.125 63.126  23.822  1.00 75.73  ?  661  TYR C O     1 
ATOM   6824  C  CB    . TYR D  3  661  ? -144.396 61.486  22.855  1.00 75.70  ?  661  TYR C CB    1 
ATOM   6825  C  CG    . TYR D  3  661  ? -145.684 61.400  22.064  1.00 77.32  ?  661  TYR C CG    1 
ATOM   6826  C  CD1   . TYR D  3  661  ? -146.694 60.522  22.435  1.00 82.64  ?  661  TYR C CD1   1 
ATOM   6827  C  CD2   . TYR D  3  661  ? -145.889 62.198  20.947  1.00 71.56  ?  661  TYR C CD2   1 
ATOM   6828  C  CE1   . TYR D  3  661  ? -147.871 60.442  21.715  1.00 82.05  ?  661  TYR C CE1   1 
ATOM   6829  C  CE2   . TYR D  3  661  ? -147.062 62.124  20.220  1.00 66.92  ?  661  TYR C CE2   1 
ATOM   6830  C  CZ    . TYR D  3  661  ? -148.049 61.244  20.609  1.00 84.89  ?  661  TYR C CZ    1 
ATOM   6831  O  OH    . TYR D  3  661  ? -149.219 61.166  19.889  1.00 108.83 ?  661  TYR C OH    1 
ATOM   6832  N  N     . ARG D  3  662  ? -142.883 62.523  25.862  1.00 71.42  ?  662  ARG C N     1 
ATOM   6833  C  CA    . ARG D  3  662  ? -141.573 62.602  26.493  1.00 71.19  ?  662  ARG C CA    1 
ATOM   6834  C  C     . ARG D  3  662  ? -140.821 61.297  26.267  1.00 78.06  ?  662  ARG C C     1 
ATOM   6835  O  O     . ARG D  3  662  ? -141.374 60.210  26.462  1.00 88.36  ?  662  ARG C O     1 
ATOM   6836  C  CB    . ARG D  3  662  ? -141.712 62.888  27.987  1.00 76.47  ?  662  ARG C CB    1 
ATOM   6837  C  CG    . ARG D  3  662  ? -142.301 64.253  28.308  1.00 67.81  ?  662  ARG C CG    1 
ATOM   6838  C  CD    . ARG D  3  662  ? -142.514 64.411  29.804  1.00 68.58  ?  662  ARG C CD    1 
ATOM   6839  N  NE    . ARG D  3  662  ? -141.270 64.247  30.550  1.00 61.53  ?  662  ARG C NE    1 
ATOM   6840  C  CZ    . ARG D  3  662  ? -141.211 64.049  31.863  1.00 88.28  ?  662  ARG C CZ    1 
ATOM   6841  N  NH1   . ARG D  3  662  ? -142.329 63.984  32.576  1.00 77.65  ?  662  ARG C NH1   1 
ATOM   6842  N  NH2   . ARG D  3  662  ? -140.036 63.910  32.461  1.00 94.93  ?  662  ARG C NH2   1 
ATOM   6843  N  N     . LEU D  3  663  ? -139.560 61.405  25.862  1.00 67.36  ?  663  LEU C N     1 
ATOM   6844  C  CA    . LEU D  3  663  ? -138.766 60.256  25.449  1.00 77.11  ?  663  LEU C CA    1 
ATOM   6845  C  C     . LEU D  3  663  ? -137.926 59.740  26.610  1.00 82.93  ?  663  LEU C C     1 
ATOM   6846  O  O     . LEU D  3  663  ? -137.259 60.522  27.296  1.00 83.18  ?  663  LEU C O     1 
ATOM   6847  C  CB    . LEU D  3  663  ? -137.861 60.622  24.272  1.00 61.95  ?  663  LEU C CB    1 
ATOM   6848  C  CG    . LEU D  3  663  ? -138.560 61.215  23.047  1.00 62.07  ?  663  LEU C CG    1 
ATOM   6849  C  CD1   . LEU D  3  663  ? -137.562 61.489  21.936  1.00 64.19  ?  663  LEU C CD1   1 
ATOM   6850  C  CD2   . LEU D  3  663  ? -139.664 60.289  22.564  1.00 71.81  ?  663  LEU C CD2   1 
ATOM   6851  N  N     . ARG D  3  664  ? -137.965 58.426  26.827  1.00 72.52  ?  664  ARG C N     1 
ATOM   6852  C  CA    . ARG D  3  664  ? -137.046 57.796  27.764  1.00 66.07  ?  664  ARG C CA    1 
ATOM   6853  C  C     . ARG D  3  664  ? -135.617 57.968  27.272  1.00 75.30  ?  664  ARG C C     1 
ATOM   6854  O  O     . ARG D  3  664  ? -135.265 57.495  26.187  1.00 84.00  ?  664  ARG C O     1 
ATOM   6855  C  CB    . ARG D  3  664  ? -137.372 56.311  27.917  1.00 69.80  ?  664  ARG C CB    1 
ATOM   6856  C  CG    . ARG D  3  664  ? -138.465 55.984  28.919  1.00 92.12  ?  664  ARG C CG    1 
ATOM   6857  C  CD    . ARG D  3  664  ? -138.495 54.486  29.187  1.00 90.45  ?  664  ARG C CD    1 
ATOM   6858  N  NE    . ARG D  3  664  ? -139.779 53.882  28.840  1.00 115.57 ?  664  ARG C NE    1 
ATOM   6859  C  CZ    . ARG D  3  664  ? -139.964 52.578  28.659  1.00 129.10 ?  664  ARG C CZ    1 
ATOM   6860  N  NH1   . ARG D  3  664  ? -138.943 51.739  28.780  1.00 109.27 ?  664  ARG C NH1   1 
ATOM   6861  N  NH2   . ARG D  3  664  ? -141.168 52.114  28.349  1.00 126.73 ?  664  ARG C NH2   1 
ATOM   6862  N  N     . LYS D  3  665  ? -134.791 58.642  28.068  1.00 68.84  ?  665  LYS C N     1 
ATOM   6863  C  CA    . LYS D  3  665  ? -133.398 58.897  27.717  1.00 75.61  ?  665  LYS C CA    1 
ATOM   6864  C  C     . LYS D  3  665  ? -132.504 58.235  28.757  1.00 74.24  ?  665  LYS C C     1 
ATOM   6865  O  O     . LYS D  3  665  ? -132.514 58.624  29.930  1.00 76.07  ?  665  LYS C O     1 
ATOM   6866  C  CB    . LYS D  3  665  ? -133.121 60.397  27.624  1.00 61.38  ?  665  LYS C CB    1 
ATOM   6867  C  CG    . LYS D  3  665  ? -133.973 61.119  26.593  1.00 61.10  ?  665  LYS C CG    1 
ATOM   6868  C  CD    . LYS D  3  665  ? -133.813 60.512  25.211  1.00 61.73  ?  665  LYS C CD    1 
ATOM   6869  C  CE    . LYS D  3  665  ? -132.388 60.650  24.706  1.00 79.86  ?  665  LYS C CE    1 
ATOM   6870  N  NZ    . LYS D  3  665  ? -132.232 60.087  23.335  1.00 79.83  ?  665  LYS C NZ    1 
ATOM   6871  N  N     . PHE D  3  666  ? -131.737 57.235  28.326  1.00 75.28  ?  666  PHE C N     1 
ATOM   6872  C  CA    . PHE D  3  666  ? -130.788 56.539  29.190  1.00 69.43  ?  666  PHE C CA    1 
ATOM   6873  C  C     . PHE D  3  666  ? -131.452 56.092  30.489  1.00 67.21  ?  666  PHE C C     1 
ATOM   6874  O  O     . PHE D  3  666  ? -130.937 56.307  31.589  1.00 77.62  ?  666  PHE C O     1 
ATOM   6875  C  CB    . PHE D  3  666  ? -129.566 57.414  29.471  1.00 65.84  ?  666  PHE C CB    1 
ATOM   6876  C  CG    . PHE D  3  666  ? -128.859 57.885  28.230  1.00 79.70  ?  666  PHE C CG    1 
ATOM   6877  C  CD1   . PHE D  3  666  ? -128.019 57.033  27.532  1.00 71.80  ?  666  PHE C CD1   1 
ATOM   6878  C  CD2   . PHE D  3  666  ? -129.032 59.179  27.764  1.00 80.10  ?  666  PHE C CD2   1 
ATOM   6879  C  CE1   . PHE D  3  666  ? -127.367 57.461  26.391  1.00 88.33  ?  666  PHE C CE1   1 
ATOM   6880  C  CE2   . PHE D  3  666  ? -128.381 59.613  26.623  1.00 84.55  ?  666  PHE C CE2   1 
ATOM   6881  C  CZ    . PHE D  3  666  ? -127.548 58.753  25.937  1.00 92.72  ?  666  PHE C CZ    1 
ATOM   6882  N  N     . ALA D  3  667  ? -132.615 55.461  30.354  1.00 70.25  ?  667  ALA C N     1 
ATOM   6883  C  CA    . ALA D  3  667  ? -133.351 54.936  31.496  1.00 67.39  ?  667  ALA C CA    1 
ATOM   6884  C  C     . ALA D  3  667  ? -132.893 53.509  31.770  1.00 71.23  ?  667  ALA C C     1 
ATOM   6885  O  O     . ALA D  3  667  ? -132.944 52.654  30.879  1.00 80.92  ?  667  ALA C O     1 
ATOM   6886  C  CB    . ALA D  3  667  ? -134.857 54.980  31.240  1.00 71.51  ?  667  ALA C CB    1 
ATOM   6887  N  N     . ARG D  3  668  ? -132.445 53.256  32.997  1.00 63.77  ?  668  ARG C N     1 
ATOM   6888  C  CA    . ARG D  3  668  ? -131.991 51.921  33.360  1.00 57.39  ?  668  ARG C CA    1 
ATOM   6889  C  C     . ARG D  3  668  ? -133.167 50.955  33.406  1.00 57.49  ?  668  ARG C C     1 
ATOM   6890  O  O     . ARG D  3  668  ? -134.201 51.246  34.015  1.00 82.20  ?  668  ARG C O     1 
ATOM   6891  C  CB    . ARG D  3  668  ? -131.282 51.946  34.712  1.00 64.36  ?  668  ARG C CB    1 
ATOM   6892  C  CG    . ARG D  3  668  ? -130.874 50.568  35.206  1.00 75.68  ?  668  ARG C CG    1 
ATOM   6893  C  CD    . ARG D  3  668  ? -130.191 50.636  36.560  1.00 85.69  ?  668  ARG C CD    1 
ATOM   6894  N  NE    . ARG D  3  668  ? -129.838 49.306  37.047  1.00 83.18  ?  668  ARG C NE    1 
ATOM   6895  C  CZ    . ARG D  3  668  ? -130.663 48.520  37.730  1.00 78.42  ?  668  ARG C CZ    1 
ATOM   6896  N  NH1   . ARG D  3  668  ? -131.892 48.930  38.009  1.00 87.33  ?  668  ARG C NH1   1 
ATOM   6897  N  NH2   . ARG D  3  668  ? -130.259 47.323  38.133  1.00 95.67  ?  668  ARG C NH2   1 
ATOM   6898  N  N     . SER D  3  669  ? -133.008 49.803  32.763  1.00 66.03  ?  669  SER C N     1 
ATOM   6899  C  CA    . SER D  3  669  ? -134.032 48.768  32.786  1.00 72.24  ?  669  SER C CA    1 
ATOM   6900  C  C     . SER D  3  669  ? -133.877 47.933  34.057  1.00 85.32  ?  669  SER C C     1 
ATOM   6901  O  O     . SER D  3  669  ? -133.114 48.275  34.966  1.00 86.91  ?  669  SER C O     1 
ATOM   6902  C  CB    . SER D  3  669  ? -133.954 47.920  31.521  1.00 77.74  ?  669  SER C CB    1 
ATOM   6903  O  OG    . SER D  3  669  ? -135.014 46.981  31.480  1.00 98.47  ?  669  SER C OG    1 
ATOM   6904  N  N     . ASN D  3  670  ? -134.599 46.812  34.129  1.00 86.85  ?  670  ASN C N     1 
ATOM   6905  C  CA    . ASN D  3  670  ? -134.619 46.007  35.346  1.00 85.27  ?  670  ASN C CA    1 
ATOM   6906  C  C     . ASN D  3  670  ? -133.314 45.261  35.586  1.00 92.61  ?  670  ASN C C     1 
ATOM   6907  O  O     . ASN D  3  670  ? -133.016 44.919  36.735  1.00 100.70 ?  670  ASN C O     1 
ATOM   6908  C  CB    . ASN D  3  670  ? -135.780 45.013  35.300  1.00 86.39  ?  670  ASN C CB    1 
ATOM   6909  C  CG    . ASN D  3  670  ? -137.120 45.695  35.119  1.00 95.41  ?  670  ASN C CG    1 
ATOM   6910  O  OD1   . ASN D  3  670  ? -137.209 46.760  34.508  1.00 92.66  ?  670  ASN C OD1   1 
ATOM   6911  N  ND2   . ASN D  3  670  ? -138.173 45.088  35.658  1.00 88.20  ?  670  ASN C ND2   1 
ATOM   6912  N  N     . HIS D  3  671  ? -132.534 44.993  34.539  1.00 92.99  ?  671  HIS C N     1 
ATOM   6913  C  CA    . HIS D  3  671  ? -131.261 44.296  34.681  1.00 97.07  ?  671  HIS C CA    1 
ATOM   6914  C  C     . HIS D  3  671  ? -130.104 45.119  34.125  1.00 88.42  ?  671  HIS C C     1 
ATOM   6915  O  O     . HIS D  3  671  ? -129.145 44.568  33.582  1.00 88.98  ?  671  HIS C O     1 
ATOM   6916  C  CB    . HIS D  3  671  ? -131.315 42.921  34.017  1.00 105.44 ?  671  HIS C CB    1 
ATOM   6917  C  CG    . HIS D  3  671  ? -131.674 41.813  34.959  1.00 118.53 ?  671  HIS C CG    1 
ATOM   6918  N  ND1   . HIS D  3  671  ? -130.895 41.482  36.047  1.00 106.68 ?  671  HIS C ND1   1 
ATOM   6919  C  CD2   . HIS D  3  671  ? -132.727 40.961  34.978  1.00 130.50 ?  671  HIS C CD2   1 
ATOM   6920  C  CE1   . HIS D  3  671  ? -131.451 40.474  36.695  1.00 111.79 ?  671  HIS C CE1   1 
ATOM   6921  N  NE2   . HIS D  3  671  ? -132.564 40.139  36.067  1.00 130.31 ?  671  HIS C NE2   1 
ATOM   6922  N  N     . GLY D  3  672  ? -130.183 46.440  34.259  1.00 94.53  ?  672  GLY C N     1 
ATOM   6923  C  CA    . GLY D  3  672  ? -129.091 47.314  33.890  1.00 92.61  ?  672  GLY C CA    1 
ATOM   6924  C  C     . GLY D  3  672  ? -128.970 47.631  32.417  1.00 73.50  ?  672  GLY C C     1 
ATOM   6925  O  O     . GLY D  3  672  ? -128.000 48.295  32.026  1.00 80.18  ?  672  GLY C O     1 
ATOM   6926  N  N     . THR D  3  673  ? -129.909 47.188  31.586  1.00 67.66  ?  673  THR C N     1 
ATOM   6927  C  CA    . THR D  3  673  ? -129.849 47.478  30.160  1.00 77.50  ?  673  THR C CA    1 
ATOM   6928  C  C     . THR D  3  673  ? -130.424 48.862  29.884  1.00 64.41  ?  673  THR C C     1 
ATOM   6929  O  O     . THR D  3  673  ? -131.539 49.179  30.309  1.00 88.63  ?  673  THR C O     1 
ATOM   6930  C  CB    . THR D  3  673  ? -130.603 46.416  29.358  1.00 76.96  ?  673  THR C CB    1 
ATOM   6931  O  OG1   . THR D  3  673  ? -131.877 46.166  29.965  1.00 70.02  ?  673  THR C OG1   1 
ATOM   6932  C  CG2   . THR D  3  673  ? -129.802 45.121  29.302  1.00 64.77  ?  673  THR C CG2   1 
ATOM   6933  N  N     . CYS D  3  674  ? -129.657 49.684  29.172  1.00 56.95  ?  674  CYS C N     1 
ATOM   6934  C  CA    . CYS D  3  674  ? -130.079 51.048  28.890  1.00 60.67  ?  674  CYS C CA    1 
ATOM   6935  C  C     . CYS D  3  674  ? -131.180 51.062  27.838  1.00 66.72  ?  674  CYS C C     1 
ATOM   6936  O  O     . CYS D  3  674  ? -131.061 50.423  26.788  1.00 68.79  ?  674  CYS C O     1 
ATOM   6937  C  CB    . CYS D  3  674  ? -128.890 51.884  28.421  1.00 61.63  ?  674  CYS C CB    1 
ATOM   6938  S  SG    . CYS D  3  674  ? -129.337 53.502  27.766  1.00 82.31  ?  674  CYS C SG    1 
ATOM   6939  N  N     . ALA D  3  675  ? -132.251 51.794  28.123  1.00 79.08  ?  675  ALA C N     1 
ATOM   6940  C  CA    . ALA D  3  675  ? -133.368 51.971  27.200  1.00 77.36  ?  675  ALA C CA    1 
ATOM   6941  C  C     . ALA D  3  675  ? -133.395 53.441  26.798  1.00 78.47  ?  675  ALA C C     1 
ATOM   6942  O  O     . ALA D  3  675  ? -133.804 54.301  27.584  1.00 80.32  ?  675  ALA C O     1 
ATOM   6943  C  CB    . ALA D  3  675  ? -134.682 51.536  27.840  1.00 65.36  ?  675  ALA C CB    1 
ATOM   6944  N  N     . ASN D  3  676  ? -132.949 53.726  25.578  1.00 72.96  ?  676  ASN C N     1 
ATOM   6945  C  CA    . ASN D  3  676  ? -132.868 55.084  25.060  1.00 61.46  ?  676  ASN C CA    1 
ATOM   6946  C  C     . ASN D  3  676  ? -133.705 55.182  23.793  1.00 78.43  ?  676  ASN C C     1 
ATOM   6947  O  O     . ASN D  3  676  ? -133.513 54.401  22.855  1.00 89.42  ?  676  ASN C O     1 
ATOM   6948  C  CB    . ASN D  3  676  ? -131.416 55.476  24.773  1.00 61.49  ?  676  ASN C CB    1 
ATOM   6949  C  CG    . ASN D  3  676  ? -131.263 56.946  24.433  1.00 88.13  ?  676  ASN C CG    1 
ATOM   6950  O  OD1   . ASN D  3  676  ? -132.167 57.566  23.872  1.00 102.74 ?  676  ASN C OD1   1 
ATOM   6951  N  ND2   . ASN D  3  676  ? -130.111 57.513  24.773  1.00 87.19  ?  676  ASN C ND2   1 
ATOM   6952  N  N     . GLN D  3  677  ? -134.629 56.138  23.770  1.00 71.09  ?  677  GLN C N     1 
ATOM   6953  C  CA    . GLN D  3  677  ? -135.503 56.338  22.624  1.00 59.54  ?  677  GLN C CA    1 
ATOM   6954  C  C     . GLN D  3  677  ? -134.933 57.405  21.698  1.00 73.43  ?  677  GLN C C     1 
ATOM   6955  O  O     . GLN D  3  677  ? -134.424 58.435  22.151  1.00 70.24  ?  677  GLN C O     1 
ATOM   6956  C  CB    . GLN D  3  677  ? -136.909 56.729  23.082  1.00 62.13  ?  677  GLN C CB    1 
ATOM   6957  C  CG    . GLN D  3  677  ? -137.654 55.614  23.801  1.00 69.65  ?  677  GLN C CG    1 
ATOM   6958  C  CD    . GLN D  3  677  ? -139.049 56.022  24.234  1.00 70.07  ?  677  GLN C CD    1 
ATOM   6959  O  OE1   . GLN D  3  677  ? -139.252 57.110  24.774  1.00 80.12  ?  677  GLN C OE1   1 
ATOM   6960  N  NE2   . GLN D  3  677  ? -140.021 55.148  23.996  1.00 64.18  ?  677  GLN C NE2   1 
ATOM   6961  N  N     . ARG D  3  678  ? -135.021 57.146  20.396  1.00 75.25  ?  678  ARG C N     1 
ATOM   6962  C  CA    . ARG D  3  678  ? -134.504 58.032  19.371  1.00 74.24  ?  678  ARG C CA    1 
ATOM   6963  C  C     . ARG D  3  678  ? -135.650 58.550  18.513  1.00 76.25  ?  678  ARG C C     1 
ATOM   6964  O  O     . ARG D  3  678  ? -136.468 57.751  18.035  1.00 83.52  ?  678  ARG C O     1 
ATOM   6965  C  CB    . ARG D  3  678  ? -133.481 57.298  18.482  1.00 87.61  ?  678  ARG C CB    1 
ATOM   6966  C  CG    . ARG D  3  678  ? -132.093 57.916  18.454  1.00 75.53  ?  678  ARG C CG    1 
ATOM   6967  C  CD    . ARG D  3  678  ? -131.167 57.121  17.542  1.00 82.94  ?  678  ARG C CD    1 
ATOM   6968  N  NE    . ARG D  3  678  ? -131.432 57.367  16.125  1.00 82.46  ?  678  ARG C NE    1 
ATOM   6969  C  CZ    . ARG D  3  678  ? -130.580 57.971  15.301  1.00 108.02 ?  678  ARG C CZ    1 
ATOM   6970  N  NH1   . ARG D  3  678  ? -129.400 58.382  15.746  1.00 116.19 ?  678  ARG C NH1   1 
ATOM   6971  N  NH2   . ARG D  3  678  ? -130.903 58.155  14.028  1.00 107.07 ?  678  ARG C NH2   1 
ATOM   6972  N  N     . PRO D  3  679  ? -135.753 59.861  18.295  1.00 78.54  ?  679  PRO C N     1 
ATOM   6973  C  CA    . PRO D  3  679  ? -136.774 60.380  17.373  1.00 80.67  ?  679  PRO C CA    1 
ATOM   6974  C  C     . PRO D  3  679  ? -136.367 60.125  15.927  1.00 86.74  ?  679  PRO C C     1 
ATOM   6975  O  O     . PRO D  3  679  ? -135.230 60.395  15.532  1.00 97.96  ?  679  PRO C O     1 
ATOM   6976  C  CB    . PRO D  3  679  ? -136.811 61.879  17.690  1.00 67.21  ?  679  PRO C CB    1 
ATOM   6977  C  CG    . PRO D  3  679  ? -135.438 62.176  18.198  1.00 68.48  ?  679  PRO C CG    1 
ATOM   6978  C  CD    . PRO D  3  679  ? -134.984 60.941  18.939  1.00 76.80  ?  679  PRO C CD    1 
ATOM   6979  N  N     . ILE D  3  680  ? -137.305 59.600  15.139  1.00 76.75  ?  680  ILE C N     1 
ATOM   6980  C  CA    . ILE D  3  680  ? -137.065 59.281  13.735  1.00 73.01  ?  680  ILE C CA    1 
ATOM   6981  C  C     . ILE D  3  680  ? -137.754 60.249  12.793  1.00 83.30  ?  680  ILE C C     1 
ATOM   6982  O  O     . ILE D  3  680  ? -137.657 60.079  11.568  1.00 90.28  ?  680  ILE C O     1 
ATOM   6983  C  CB    . ILE D  3  680  ? -137.488 57.837  13.409  1.00 65.99  ?  680  ILE C CB    1 
ATOM   6984  C  CG1   . ILE D  3  680  ? -139.014 57.723  13.398  1.00 82.47  ?  680  ILE C CG1   1 
ATOM   6985  C  CG2   . ILE D  3  680  ? -136.888 56.869  14.414  1.00 77.73  ?  680  ILE C CG2   1 
ATOM   6986  C  CD1   . ILE D  3  680  ? -139.524 56.343  13.045  1.00 90.58  ?  680  ILE C CD1   1 
ATOM   6987  N  N     . VAL D  3  681  ? -138.443 61.259  13.314  1.00 85.26  ?  681  VAL C N     1 
ATOM   6988  C  CA    . VAL D  3  681  ? -139.197 62.195  12.495  1.00 85.93  ?  681  VAL C CA    1 
ATOM   6989  C  C     . VAL D  3  681  ? -138.529 63.566  12.553  1.00 85.81  ?  681  VAL C C     1 
ATOM   6990  O  O     . VAL D  3  681  ? -137.641 63.821  13.366  1.00 90.47  ?  681  VAL C O     1 
ATOM   6991  C  CB    . VAL D  3  681  ? -140.673 62.278  12.927  1.00 79.29  ?  681  VAL C CB    1 
ATOM   6992  C  CG1   . VAL D  3  681  ? -141.355 60.933  12.742  1.00 87.72  ?  681  VAL C CG1   1 
ATOM   6993  C  CG2   . VAL D  3  681  ? -140.771 62.733  14.371  1.00 85.38  ?  681  VAL C CG2   1 
ATOM   6994  N  N     . ASP D  3  682  ? -138.970 64.454  11.671  1.00 92.67  ?  682  ASP C N     1 
ATOM   6995  C  CA    . ASP D  3  682  ? -138.460 65.815  11.582  1.00 103.29 ?  682  ASP C CA    1 
ATOM   6996  C  C     . ASP D  3  682  ? -139.593 66.809  11.827  1.00 106.88 ?  682  ASP C C     1 
ATOM   6997  O  O     . ASP D  3  682  ? -140.726 66.436  12.143  1.00 100.37 ?  682  ASP C O     1 
ATOM   6998  C  CB    . ASP D  3  682  ? -137.796 66.063  10.224  1.00 103.33 ?  682  ASP C CB    1 
ATOM   6999  C  CG    . ASP D  3  682  ? -136.395 65.492  10.149  1.00 110.93 ?  682  ASP C CG    1 
ATOM   7000  O  OD1   . ASP D  3  682  ? -135.640 65.642  11.134  1.00 112.52 ?  682  ASP C OD1   1 
ATOM   7001  O  OD2   . ASP D  3  682  ? -136.049 64.893  9.110   1.00 123.81 ?  682  ASP C OD2   1 
ATOM   7002  N  N     . ALA D  3  683  ? -139.268 68.091  11.667  1.00 92.62  ?  683  ALA C N     1 
ATOM   7003  C  CA    . ALA D  3  683  ? -140.200 69.171  11.966  1.00 80.86  ?  683  ALA C CA    1 
ATOM   7004  C  C     . ALA D  3  683  ? -141.481 69.068  11.146  1.00 103.83 ?  683  ALA C C     1 
ATOM   7005  O  O     . ALA D  3  683  ? -142.544 68.734  11.682  1.00 112.09 ?  683  ALA C O     1 
ATOM   7006  C  CB    . ALA D  3  683  ? -139.531 70.524  11.725  1.00 67.79  ?  683  ALA C CB    1 
ATOM   7007  N  N     . GLY D  3  684  ? -141.392 69.352  9.849   1.00 99.17  ?  684  GLY C N     1 
ATOM   7008  C  CA    . GLY D  3  684  ? -142.564 69.425  9.000   1.00 96.44  ?  684  GLY C CA    1 
ATOM   7009  C  C     . GLY D  3  684  ? -143.188 68.111  8.595   1.00 97.60  ?  684  GLY C C     1 
ATOM   7010  O  O     . GLY D  3  684  ? -144.164 68.118  7.840   1.00 101.12 ?  684  GLY C O     1 
ATOM   7011  N  N     . GLN D  3  685  ? -142.667 66.982  9.069   1.00 99.63  ?  685  GLN C N     1 
ATOM   7012  C  CA    . GLN D  3  685  ? -143.204 65.690  8.662   1.00 99.10  ?  685  GLN C CA    1 
ATOM   7013  C  C     . GLN D  3  685  ? -144.681 65.577  9.016   1.00 96.11  ?  685  GLN C C     1 
ATOM   7014  O  O     . GLN D  3  685  ? -145.108 65.949  10.113  1.00 104.64 ?  685  GLN C O     1 
ATOM   7015  C  CB    . GLN D  3  685  ? -142.425 64.554  9.325   1.00 97.59  ?  685  GLN C CB    1 
ATOM   7016  C  CG    . GLN D  3  685  ? -141.038 64.331  8.758   1.00 95.83  ?  685  GLN C CG    1 
ATOM   7017  C  CD    . GLN D  3  685  ? -140.395 63.072  9.299   1.00 99.25  ?  685  GLN C CD    1 
ATOM   7018  O  OE1   . GLN D  3  685  ? -141.027 62.305  10.029  1.00 90.37  ?  685  GLN C OE1   1 
ATOM   7019  N  NE2   . GLN D  3  685  ? -139.132 62.851  8.944   1.00 96.05  ?  685  GLN C NE2   1 
ATOM   7020  N  N     . ARG D  3  686  ? -145.463 65.057  8.075   1.00 83.90  ?  686  ARG C N     1 
ATOM   7021  C  CA    . ARG D  3  686  ? -146.876 64.774  8.291   1.00 96.09  ?  686  ARG C CA    1 
ATOM   7022  C  C     . ARG D  3  686  ? -147.026 63.289  8.592   1.00 90.13  ?  686  ARG C C     1 
ATOM   7023  O  O     . ARG D  3  686  ? -146.730 62.446  7.738   1.00 101.18 ?  686  ARG C O     1 
ATOM   7024  C  CB    . ARG D  3  686  ? -147.707 65.174  7.072   1.00 99.69  ?  686  ARG C CB    1 
ATOM   7025  C  CG    . ARG D  3  686  ? -149.198 64.911  7.219   1.00 104.86 ?  686  ARG C CG    1 
ATOM   7026  C  CD    . ARG D  3  686  ? -150.013 66.108  6.754   1.00 104.24 ?  686  ARG C CD    1 
ATOM   7027  N  NE    . ARG D  3  686  ? -151.425 65.780  6.580   1.00 116.16 ?  686  ARG C NE    1 
ATOM   7028  C  CZ    . ARG D  3  686  ? -152.314 65.749  7.567   1.00 112.69 ?  686  ARG C CZ    1 
ATOM   7029  N  NH1   . ARG D  3  686  ? -151.941 66.024  8.810   1.00 111.38 ?  686  ARG C NH1   1 
ATOM   7030  N  NH2   . ARG D  3  686  ? -153.579 65.441  7.312   1.00 104.25 ?  686  ARG C NH2   1 
ATOM   7031  N  N     . VAL D  3  687  ? -147.477 62.973  9.802   1.00 76.20  ?  687  VAL C N     1 
ATOM   7032  C  CA    . VAL D  3  687  ? -147.517 61.605  10.300  1.00 82.26  ?  687  VAL C CA    1 
ATOM   7033  C  C     . VAL D  3  687  ? -148.965 61.157  10.423  1.00 85.17  ?  687  VAL C C     1 
ATOM   7034  O  O     . VAL D  3  687  ? -149.842 61.942  10.804  1.00 94.83  ?  687  VAL C O     1 
ATOM   7035  C  CB    . VAL D  3  687  ? -146.791 61.483  11.654  1.00 85.93  ?  687  VAL C CB    1 
ATOM   7036  C  CG1   . VAL D  3  687  ? -145.349 61.950  11.523  1.00 83.11  ?  687  VAL C CG1   1 
ATOM   7037  C  CG2   . VAL D  3  687  ? -147.522 62.280  12.721  1.00 76.32  ?  687  VAL C CG2   1 
ATOM   7038  N  N     . GLU D  3  688  ? -149.211 59.891  10.103  1.00 83.50  ?  688  GLU C N     1 
ATOM   7039  C  CA    . GLU D  3  688  ? -150.529 59.292  10.230  1.00 81.45  ?  688  GLU C CA    1 
ATOM   7040  C  C     . GLU D  3  688  ? -150.668 58.594  11.578  1.00 81.14  ?  688  GLU C C     1 
ATOM   7041  O  O     . GLU D  3  688  ? -149.682 58.287  12.253  1.00 80.10  ?  688  GLU C O     1 
ATOM   7042  C  CB    . GLU D  3  688  ? -150.780 58.300  9.092   1.00 99.62  ?  688  GLU C CB    1 
ATOM   7043  C  CG    . GLU D  3  688  ? -151.778 58.786  8.053   1.00 116.84 ?  688  GLU C CG    1 
ATOM   7044  C  CD    . GLU D  3  688  ? -151.519 58.202  6.676   1.00 124.10 ?  688  GLU C CD    1 
ATOM   7045  O  OE1   . GLU D  3  688  ? -150.336 58.110  6.282   1.00 107.32 ?  688  GLU C OE1   1 
ATOM   7046  O  OE2   . GLU D  3  688  ? -152.497 57.835  5.989   1.00 127.05 ?  688  GLU C OE2   1 
ATOM   7047  N  N     . ALA D  3  689  ? -151.917 58.351  11.969  1.00 90.46  ?  689  ALA C N     1 
ATOM   7048  C  CA    . ALA D  3  689  ? -152.180 57.694  13.241  1.00 94.54  ?  689  ALA C CA    1 
ATOM   7049  C  C     . ALA D  3  689  ? -151.570 56.297  13.257  1.00 93.43  ?  689  ALA C C     1 
ATOM   7050  O  O     . ALA D  3  689  ? -151.458 55.630  12.225  1.00 95.83  ?  689  ALA C O     1 
ATOM   7051  C  CB    . ALA D  3  689  ? -153.685 57.616  13.503  1.00 94.63  ?  689  ALA C CB    1 
ATOM   7052  N  N     . GLY D  3  690  ? -151.173 55.856  14.449  1.00 86.07  ?  690  GLY C N     1 
ATOM   7053  C  CA    . GLY D  3  690  ? -150.535 54.567  14.608  1.00 97.50  ?  690  GLY C CA    1 
ATOM   7054  C  C     . GLY D  3  690  ? -149.132 54.468  14.055  1.00 96.39  ?  690  GLY C C     1 
ATOM   7055  O  O     . GLY D  3  690  ? -148.549 53.378  14.086  1.00 96.49  ?  690  GLY C O     1 
ATOM   7056  N  N     . GLN D  3  691  ? -148.569 55.563  13.552  1.00 90.28  ?  691  GLN C N     1 
ATOM   7057  C  CA    . GLN D  3  691  ? -147.229 55.551  12.990  1.00 87.54  ?  691  GLN C CA    1 
ATOM   7058  C  C     . GLN D  3  691  ? -146.184 55.586  14.105  1.00 89.81  ?  691  GLN C C     1 
ATOM   7059  O  O     . GLN D  3  691  ? -146.479 55.871  15.268  1.00 92.43  ?  691  GLN C O     1 
ATOM   7060  C  CB    . GLN D  3  691  ? -147.044 56.732  12.036  1.00 80.28  ?  691  GLN C CB    1 
ATOM   7061  C  CG    . GLN D  3  691  ? -145.709 56.761  11.313  1.00 79.09  ?  691  GLN C CG    1 
ATOM   7062  C  CD    . GLN D  3  691  ? -145.652 57.836  10.246  1.00 91.75  ?  691  GLN C CD    1 
ATOM   7063  O  OE1   . GLN D  3  691  ? -146.683 58.357  9.818   1.00 102.24 ?  691  GLN C OE1   1 
ATOM   7064  N  NE2   . GLN D  3  691  ? -144.444 58.175  9.811   1.00 90.63  ?  691  GLN C NE2   1 
ATOM   7065  N  N     . VAL D  3  692  ? -144.945 55.281  13.736  1.00 90.16  ?  692  VAL C N     1 
ATOM   7066  C  CA    . VAL D  3  692  ? -143.832 55.273  14.678  1.00 89.63  ?  692  VAL C CA    1 
ATOM   7067  C  C     . VAL D  3  692  ? -143.139 56.626  14.633  1.00 86.33  ?  692  VAL C C     1 
ATOM   7068  O  O     . VAL D  3  692  ? -142.736 57.096  13.562  1.00 74.38  ?  692  VAL C O     1 
ATOM   7069  C  CB    . VAL D  3  692  ? -142.848 54.136  14.359  1.00 82.19  ?  692  VAL C CB    1 
ATOM   7070  C  CG1   . VAL D  3  692  ? -141.615 54.244  15.241  1.00 75.72  ?  692  VAL C CG1   1 
ATOM   7071  C  CG2   . VAL D  3  692  ? -143.524 52.788  14.546  1.00 60.80  ?  692  VAL C CG2   1 
ATOM   7072  N  N     . ILE D  3  693  ? -142.995 57.250  15.798  1.00 90.05  ?  693  ILE C N     1 
ATOM   7073  C  CA    . ILE D  3  693  ? -142.385 58.567  15.909  1.00 81.26  ?  693  ILE C CA    1 
ATOM   7074  C  C     . ILE D  3  693  ? -140.941 58.479  16.384  1.00 82.70  ?  693  ILE C C     1 
ATOM   7075  O  O     . ILE D  3  693  ? -140.081 59.216  15.899  1.00 82.97  ?  693  ILE C O     1 
ATOM   7076  C  CB    . ILE D  3  693  ? -143.223 59.460  16.848  1.00 85.99  ?  693  ILE C CB    1 
ATOM   7077  C  CG1   . ILE D  3  693  ? -144.711 59.325  16.520  1.00 93.71  ?  693  ILE C CG1   1 
ATOM   7078  C  CG2   . ILE D  3  693  ? -142.785 60.910  16.735  1.00 93.20  ?  693  ILE C CG2   1 
ATOM   7079  C  CD1   . ILE D  3  693  ? -145.616 60.076  17.468  1.00 96.89  ?  693  ILE C CD1   1 
ATOM   7080  N  N     . ALA D  3  694  ? -140.659 57.585  17.330  1.00 85.14  ?  694  ALA C N     1 
ATOM   7081  C  CA    . ALA D  3  694  ? -139.322 57.434  17.886  1.00 83.49  ?  694  ALA C CA    1 
ATOM   7082  C  C     . ALA D  3  694  ? -139.004 55.958  18.066  1.00 83.46  ?  694  ALA C C     1 
ATOM   7083  O  O     . ALA D  3  694  ? -139.881 55.164  18.418  1.00 88.06  ?  694  ALA C O     1 
ATOM   7084  C  CB    . ALA D  3  694  ? -139.189 58.167  19.227  1.00 78.93  ?  694  ALA C CB    1 
ATOM   7085  N  N     . ASP D  3  695  ? -137.746 55.598  17.824  1.00 78.29  ?  695  ASP C N     1 
ATOM   7086  C  CA    . ASP D  3  695  ? -137.308 54.216  17.965  1.00 80.68  ?  695  ASP C CA    1 
ATOM   7087  C  C     . ASP D  3  695  ? -137.002 53.892  19.421  1.00 74.99  ?  695  ASP C C     1 
ATOM   7088  O  O     . ASP D  3  695  ? -136.465 54.721  20.161  1.00 70.49  ?  695  ASP C O     1 
ATOM   7089  C  CB    . ASP D  3  695  ? -136.069 53.955  17.106  1.00 86.17  ?  695  ASP C CB    1 
ATOM   7090  C  CG    . ASP D  3  695  ? -136.404 53.747  15.641  1.00 89.80  ?  695  ASP C CG    1 
ATOM   7091  O  OD1   . ASP D  3  695  ? -137.467 53.156  15.350  1.00 82.09  ?  695  ASP C OD1   1 
ATOM   7092  O  OD2   . ASP D  3  695  ? -135.603 54.171  14.780  1.00 89.27  ?  695  ASP C OD2   1 
ATOM   7093  N  N     . GLY D  3  696  ? -137.345 52.672  19.827  1.00 82.57  ?  696  GLY C N     1 
ATOM   7094  C  CA    . GLY D  3  696  ? -137.060 52.203  21.162  1.00 80.88  ?  696  GLY C CA    1 
ATOM   7095  C  C     . GLY D  3  696  ? -135.612 51.790  21.321  1.00 73.42  ?  696  GLY C C     1 
ATOM   7096  O  O     . GLY D  3  696  ? -134.729 52.240  20.584  1.00 89.96  ?  696  GLY C O     1 
ATOM   7097  N  N     . PRO D  3  697  ? -135.337 50.922  22.293  1.00 66.61  ?  697  PRO C N     1 
ATOM   7098  C  CA    . PRO D  3  697  ? -133.954 50.479  22.516  1.00 87.92  ?  697  PRO C CA    1 
ATOM   7099  C  C     . PRO D  3  697  ? -133.446 49.579  21.400  1.00 101.58 ?  697  PRO C C     1 
ATOM   7100  O  O     . PRO D  3  697  ? -132.422 49.869  20.772  1.00 90.71  ?  697  PRO C O     1 
ATOM   7101  C  CB    . PRO D  3  697  ? -134.033 49.726  23.852  1.00 82.70  ?  697  PRO C CB    1 
ATOM   7102  C  CG    . PRO D  3  697  ? -135.339 50.142  24.468  1.00 88.06  ?  697  PRO C CG    1 
ATOM   7103  C  CD    . PRO D  3  697  ? -136.255 50.394  23.314  1.00 87.96  ?  697  PRO C CD    1 
ATOM   7104  N  N     . CYS D  3  698  ? -134.157 48.479  21.150  1.00 90.57  ?  698  CYS C N     1 
ATOM   7105  C  CA    . CYS D  3  698  ? -133.749 47.526  20.125  1.00 84.22  ?  698  CYS C CA    1 
ATOM   7106  C  C     . CYS D  3  698  ? -134.670 47.603  18.915  1.00 81.29  ?  698  CYS C C     1 
ATOM   7107  O  O     . CYS D  3  698  ? -135.190 46.580  18.457  1.00 83.50  ?  698  CYS C O     1 
ATOM   7108  C  CB    . CYS D  3  698  ? -133.733 46.103  20.688  1.00 75.71  ?  698  CYS C CB    1 
ATOM   7109  S  SG    . CYS D  3  698  ? -132.553 45.841  22.032  1.00 96.35  ?  698  CYS C SG    1 
ATOM   7110  N  N     . THR D  3  699  ? -134.877 48.808  18.391  1.00 76.95  ?  699  THR C N     1 
ATOM   7111  C  CA    . THR D  3  699  ? -135.741 49.008  17.238  1.00 78.45  ?  699  THR C CA    1 
ATOM   7112  C  C     . THR D  3  699  ? -135.105 50.023  16.301  1.00 63.63  ?  699  THR C C     1 
ATOM   7113  O  O     . THR D  3  699  ? -134.355 50.902  16.730  1.00 74.15  ?  699  THR C O     1 
ATOM   7114  C  CB    . THR D  3  699  ? -137.140 49.487  17.652  1.00 84.83  ?  699  THR C CB    1 
ATOM   7115  O  OG1   . THR D  3  699  ? -137.036 50.751  18.320  1.00 84.11  ?  699  THR C OG1   1 
ATOM   7116  C  CG2   . THR D  3  699  ? -137.795 48.481  18.585  1.00 81.82  ?  699  THR C CG2   1 
ATOM   7117  N  N     . GLN D  3  700  ? -135.411 49.889  15.012  1.00 62.12  ?  700  GLN C N     1 
ATOM   7118  C  CA    . GLN D  3  700  ? -134.968 50.847  14.005  1.00 78.04  ?  700  GLN C CA    1 
ATOM   7119  C  C     . GLN D  3  700  ? -136.087 51.031  12.993  1.00 86.28  ?  700  GLN C C     1 
ATOM   7120  O  O     . GLN D  3  700  ? -136.492 50.069  12.334  1.00 89.95  ?  700  GLN C O     1 
ATOM   7121  C  CB    . GLN D  3  700  ? -133.688 50.382  13.307  1.00 68.93  ?  700  GLN C CB    1 
ATOM   7122  C  CG    . GLN D  3  700  ? -133.132 51.401  12.326  1.00 69.68  ?  700  GLN C CG    1 
ATOM   7123  C  CD    . GLN D  3  700  ? -132.138 50.797  11.355  1.00 79.62  ?  700  GLN C CD    1 
ATOM   7124  O  OE1   . GLN D  3  700  ? -130.939 51.066  11.425  1.00 86.24  ?  700  GLN C OE1   1 
ATOM   7125  N  NE2   . GLN D  3  700  ? -132.636 49.982  10.433  1.00 81.65  ?  700  GLN C NE2   1 
ATOM   7126  N  N     . ASN D  3  701  ? -136.586 52.260  12.878  1.00 85.40  ?  701  ASN C N     1 
ATOM   7127  C  CA    . ASN D  3  701  ? -137.652 52.607  11.943  1.00 79.96  ?  701  ASN C CA    1 
ATOM   7128  C  C     . ASN D  3  701  ? -138.937 51.826  12.204  1.00 81.01  ?  701  ASN C C     1 
ATOM   7129  O  O     . ASN D  3  701  ? -139.781 51.698  11.311  1.00 88.82  ?  701  ASN C O     1 
ATOM   7130  C  CB    . ASN D  3  701  ? -137.199 52.411  10.491  1.00 87.61  ?  701  ASN C CB    1 
ATOM   7131  C  CG    . ASN D  3  701  ? -136.107 53.383  10.088  1.00 99.04  ?  701  ASN C CG    1 
ATOM   7132  O  OD1   . ASN D  3  701  ? -136.010 54.484  10.628  1.00 93.24  ?  701  ASN C OD1   1 
ATOM   7133  N  ND2   . ASN D  3  701  ? -135.276 52.979  9.135   1.00 105.13 ?  701  ASN C ND2   1 
ATOM   7134  N  N     . GLY D  3  702  ? -139.105 51.291  13.412  1.00 70.67  ?  702  GLY C N     1 
ATOM   7135  C  CA    . GLY D  3  702  ? -140.340 50.662  13.827  1.00 73.50  ?  702  GLY C CA    1 
ATOM   7136  C  C     . GLY D  3  702  ? -140.259 49.165  14.039  1.00 85.16  ?  702  GLY C C     1 
ATOM   7137  O  O     . GLY D  3  702  ? -141.155 48.599  14.681  1.00 96.05  ?  702  GLY C O     1 
ATOM   7138  N  N     . GLU D  3  703  ? -139.229 48.501  13.522  1.00 76.92  ?  703  GLU C N     1 
ATOM   7139  C  CA    . GLU D  3  703  ? -139.112 47.054  13.633  1.00 82.02  ?  703  GLU C CA    1 
ATOM   7140  C  C     . GLU D  3  703  ? -137.965 46.675  14.562  1.00 78.83  ?  703  GLU C C     1 
ATOM   7141  O  O     . GLU D  3  703  ? -136.945 47.366  14.636  1.00 67.13  ?  703  GLU C O     1 
ATOM   7142  C  CB    . GLU D  3  703  ? -138.912 46.407  12.258  1.00 80.03  ?  703  GLU C CB    1 
ATOM   7143  C  CG    . GLU D  3  703  ? -137.875 47.085  11.389  1.00 76.42  ?  703  GLU C CG    1 
ATOM   7144  C  CD    . GLU D  3  703  ? -137.980 46.671  9.932   1.00 82.46  ?  703  GLU C CD    1 
ATOM   7145  O  OE1   . GLU D  3  703  ? -138.814 45.792  9.621   1.00 77.08  ?  703  GLU C OE1   1 
ATOM   7146  O  OE2   . GLU D  3  703  ? -137.237 47.228  9.097   1.00 86.56  ?  703  GLU C OE2   1 
ATOM   7147  N  N     . MET D  3  704  ? -138.152 45.564  15.275  1.00 70.73  ?  704  MET C N     1 
ATOM   7148  C  CA    . MET D  3  704  ? -137.157 45.089  16.229  1.00 63.81  ?  704  MET C CA    1 
ATOM   7149  C  C     . MET D  3  704  ? -135.790 44.959  15.572  1.00 75.55  ?  704  MET C C     1 
ATOM   7150  O  O     . MET D  3  704  ? -135.662 44.413  14.473  1.00 74.06  ?  704  MET C O     1 
ATOM   7151  C  CB    . MET D  3  704  ? -137.590 43.739  16.805  1.00 68.32  ?  704  MET C CB    1 
ATOM   7152  C  CG    . MET D  3  704  ? -138.871 43.782  17.618  1.00 85.48  ?  704  MET C CG    1 
ATOM   7153  S  SD    . MET D  3  704  ? -138.626 44.513  19.246  1.00 102.77 ?  704  MET C SD    1 
ATOM   7154  C  CE    . MET D  3  704  ? -137.423 43.383  19.935  1.00 76.19  ?  704  MET C CE    1 
ATOM   7155  N  N     . ALA D  3  705  ? -134.763 45.464  16.260  1.00 68.37  ?  705  ALA C N     1 
ATOM   7156  C  CA    . ALA D  3  705  ? -133.368 45.341  15.834  1.00 67.43  ?  705  ALA C CA    1 
ATOM   7157  C  C     . ALA D  3  705  ? -132.574 44.845  17.041  1.00 79.94  ?  705  ALA C C     1 
ATOM   7158  O  O     . ALA D  3  705  ? -131.976 45.633  17.778  1.00 88.09  ?  705  ALA C O     1 
ATOM   7159  C  CB    . ALA D  3  705  ? -132.832 46.665  15.294  1.00 77.64  ?  705  ALA C CB    1 
ATOM   7160  N  N     . LEU D  3  706  ? -132.578 43.526  17.243  1.00 73.66  ?  706  LEU C N     1 
ATOM   7161  C  CA    . LEU D  3  706  ? -131.912 42.924  18.390  1.00 66.27  ?  706  LEU C CA    1 
ATOM   7162  C  C     . LEU D  3  706  ? -130.424 42.684  18.162  1.00 68.51  ?  706  LEU C C     1 
ATOM   7163  O  O     . LEU D  3  706  ? -129.721 42.321  19.111  1.00 72.19  ?  706  LEU C O     1 
ATOM   7164  C  CB    . LEU D  3  706  ? -132.596 41.603  18.755  1.00 54.25  ?  706  LEU C CB    1 
ATOM   7165  C  CG    . LEU D  3  706  ? -134.072 41.683  19.158  1.00 53.46  ?  706  LEU C CG    1 
ATOM   7166  C  CD1   . LEU D  3  706  ? -134.675 40.294  19.284  1.00 52.24  ?  706  LEU C CD1   1 
ATOM   7167  C  CD2   . LEU D  3  706  ? -134.235 42.447  20.462  1.00 63.93  ?  706  LEU C CD2   1 
ATOM   7168  N  N     . GLY D  3  707  ? -129.927 42.880  16.944  1.00 58.01  ?  707  GLY C N     1 
ATOM   7169  C  CA    . GLY D  3  707  ? -128.525 42.644  16.664  1.00 61.72  ?  707  GLY C CA    1 
ATOM   7170  C  C     . GLY D  3  707  ? -127.970 43.515  15.558  1.00 70.56  ?  707  GLY C C     1 
ATOM   7171  O  O     . GLY D  3  707  ? -128.503 44.594  15.278  1.00 83.21  ?  707  GLY C O     1 
ATOM   7172  N  N     . LYS D  3  708  ? -126.894 43.057  14.923  1.00 57.58  ?  708  LYS C N     1 
ATOM   7173  C  CA    . LYS D  3  708  ? -126.256 43.779  13.835  1.00 68.33  ?  708  LYS C CA    1 
ATOM   7174  C  C     . LYS D  3  708  ? -125.984 42.822  12.682  1.00 71.69  ?  708  LYS C C     1 
ATOM   7175  O  O     . LYS D  3  708  ? -125.885 41.607  12.865  1.00 87.30  ?  708  LYS C O     1 
ATOM   7176  C  CB    . LYS D  3  708  ? -124.946 44.444  14.287  1.00 67.01  ?  708  LYS C CB    1 
ATOM   7177  C  CG    . LYS D  3  708  ? -125.122 45.531  15.338  1.00 76.34  ?  708  LYS C CG    1 
ATOM   7178  C  CD    . LYS D  3  708  ? -125.984 46.673  14.819  1.00 74.24  ?  708  LYS C CD    1 
ATOM   7179  C  CE    . LYS D  3  708  ? -126.092 47.802  15.838  1.00 74.92  ?  708  LYS C CE    1 
ATOM   7180  N  NZ    . LYS D  3  708  ? -124.790 48.492  16.068  1.00 62.28  ?  708  LYS C NZ    1 
ATOM   7181  N  N     . ASN D  3  709  ? -125.867 43.390  11.485  1.00 69.92  ?  709  ASN C N     1 
ATOM   7182  C  CA    . ASN D  3  709  ? -125.552 42.623  10.287  1.00 68.98  ?  709  ASN C CA    1 
ATOM   7183  C  C     . ASN D  3  709  ? -124.046 42.657  10.059  1.00 79.78  ?  709  ASN C C     1 
ATOM   7184  O  O     . ASN D  3  709  ? -123.468 43.732  9.860   1.00 80.78  ?  709  ASN C O     1 
ATOM   7185  C  CB    . ASN D  3  709  ? -126.294 43.190  9.077   1.00 74.02  ?  709  ASN C CB    1 
ATOM   7186  C  CG    . ASN D  3  709  ? -127.795 43.208  9.272   1.00 69.11  ?  709  ASN C CG    1 
ATOM   7187  O  OD1   . ASN D  3  709  ? -128.398 42.199  9.637   1.00 70.28  ?  709  ASN C OD1   1 
ATOM   7188  N  ND2   . ASN D  3  709  ? -128.407 44.360  9.036   1.00 69.68  ?  709  ASN C ND2   1 
ATOM   7189  N  N     . LEU D  3  710  ? -123.413 41.487  10.084  1.00 75.52  ?  710  LEU C N     1 
ATOM   7190  C  CA    . LEU D  3  710  ? -121.966 41.386  9.977   1.00 79.34  ?  710  LEU C CA    1 
ATOM   7191  C  C     . LEU D  3  710  ? -121.571 40.510  8.795   1.00 79.58  ?  710  LEU C C     1 
ATOM   7192  O  O     . LEU D  3  710  ? -122.309 39.606  8.391   1.00 80.08  ?  710  LEU C O     1 
ATOM   7193  C  CB    . LEU D  3  710  ? -121.354 40.825  11.267  1.00 72.60  ?  710  LEU C CB    1 
ATOM   7194  C  CG    . LEU D  3  710  ? -121.372 41.756  12.480  1.00 71.96  ?  710  LEU C CG    1 
ATOM   7195  C  CD1   . LEU D  3  710  ? -122.785 41.924  13.013  1.00 88.25  ?  710  LEU C CD1   1 
ATOM   7196  C  CD2   . LEU D  3  710  ? -120.436 41.244  13.564  1.00 75.70  ?  710  LEU C CD2   1 
ATOM   7197  N  N     . LEU D  3  711  ? -120.392 40.793  8.245   1.00 71.06  ?  711  LEU C N     1 
ATOM   7198  C  CA    . LEU D  3  711  ? -119.827 39.988  7.170   1.00 73.98  ?  711  LEU C CA    1 
ATOM   7199  C  C     . LEU D  3  711  ? -119.203 38.732  7.767   1.00 75.78  ?  711  LEU C C     1 
ATOM   7200  O  O     . LEU D  3  711  ? -118.330 38.823  8.637   1.00 80.19  ?  711  LEU C O     1 
ATOM   7201  C  CB    . LEU D  3  711  ? -118.790 40.796  6.394   1.00 72.96  ?  711  LEU C CB    1 
ATOM   7202  C  CG    . LEU D  3  711  ? -118.241 40.171  5.113   1.00 68.61  ?  711  LEU C CG    1 
ATOM   7203  C  CD1   . LEU D  3  711  ? -119.359 39.987  4.098   1.00 70.32  ?  711  LEU C CD1   1 
ATOM   7204  C  CD2   . LEU D  3  711  ? -117.117 41.025  4.541   1.00 61.39  ?  711  LEU C CD2   1 
ATOM   7205  N  N     . VAL D  3  712  ? -119.647 37.565  7.302   1.00 72.61  ?  712  VAL C N     1 
ATOM   7206  C  CA    . VAL D  3  712  ? -119.249 36.290  7.885   1.00 55.95  ?  712  VAL C CA    1 
ATOM   7207  C  C     . VAL D  3  712  ? -118.497 35.467  6.852   1.00 68.07  ?  712  VAL C C     1 
ATOM   7208  O  O     . VAL D  3  712  ? -118.759 35.551  5.648   1.00 82.05  ?  712  VAL C O     1 
ATOM   7209  C  CB    . VAL D  3  712  ? -120.463 35.499  8.412   1.00 62.23  ?  712  VAL C CB    1 
ATOM   7210  C  CG1   . VAL D  3  712  ? -121.383 35.128  7.261   1.00 66.11  ?  712  VAL C CG1   1 
ATOM   7211  C  CG2   . VAL D  3  712  ? -120.000 34.255  9.154   1.00 69.03  ?  712  VAL C CG2   1 
ATOM   7212  N  N     . ALA D  3  713  ? -117.555 34.661  7.339   1.00 87.47  ?  713  ALA C N     1 
ATOM   7213  C  CA    . ALA D  3  713  ? -116.858 33.661  6.541   1.00 69.35  ?  713  ALA C CA    1 
ATOM   7214  C  C     . ALA D  3  713  ? -116.870 32.354  7.317   1.00 64.81  ?  713  ALA C C     1 
ATOM   7215  O  O     . ALA D  3  713  ? -116.504 32.328  8.496   1.00 69.25  ?  713  ALA C O     1 
ATOM   7216  C  CB    . ALA D  3  713  ? -115.421 34.089  6.229   1.00 59.87  ?  713  ALA C CB    1 
ATOM   7217  N  N     . ILE D  3  714  ? -117.296 31.276  6.660   1.00 69.80  ?  714  ILE C N     1 
ATOM   7218  C  CA    . ILE D  3  714  ? -117.528 30.003  7.335   1.00 63.69  ?  714  ILE C CA    1 
ATOM   7219  C  C     . ILE D  3  714  ? -116.335 29.076  7.161   1.00 57.56  ?  714  ILE C C     1 
ATOM   7220  O  O     . ILE D  3  714  ? -116.492 27.910  6.782   1.00 81.15  ?  714  ILE C O     1 
ATOM   7221  C  CB    . ILE D  3  714  ? -118.809 29.329  6.818   1.00 64.23  ?  714  ILE C CB    1 
ATOM   7222  C  CG1   . ILE D  3  714  ? -119.932 30.356  6.684   1.00 75.70  ?  714  ILE C CG1   1 
ATOM   7223  C  CG2   . ILE D  3  714  ? -119.222 28.198  7.746   1.00 70.76  ?  714  ILE C CG2   1 
ATOM   7224  C  CD1   . ILE D  3  714  ? -121.226 29.769  6.170   1.00 75.74  ?  714  ILE C CD1   1 
ATOM   7225  N  N     . MET D  3  715  ? -115.142 29.579  7.449   1.00 53.28  ?  715  MET C N     1 
ATOM   7226  C  CA    . MET D  3  715  ? -113.946 28.766  7.326   1.00 60.55  ?  715  MET C CA    1 
ATOM   7227  C  C     . MET D  3  715  ? -113.240 28.647  8.671   1.00 63.09  ?  715  MET C C     1 
ATOM   7228  O  O     . MET D  3  715  ? -113.213 29.612  9.442   1.00 72.73  ?  715  MET C O     1 
ATOM   7229  C  CB    . MET D  3  715  ? -112.974 29.358  6.295   1.00 64.11  ?  715  MET C CB    1 
ATOM   7230  C  CG    . MET D  3  715  ? -112.849 30.874  6.346   1.00 59.60  ?  715  MET C CG    1 
ATOM   7231  S  SD    . MET D  3  715  ? -111.142 31.450  6.410   1.00 81.82  ?  715  MET C SD    1 
ATOM   7232  C  CE    . MET D  3  715  ? -110.562 30.575  7.861   1.00 65.56  ?  715  MET C CE    1 
ATOM   7233  N  N     . PRO D  3  716  ? -112.677 27.483  8.989   1.00 62.97  ?  716  PRO C N     1 
ATOM   7234  C  CA    . PRO D  3  716  ? -111.890 27.360  10.225  1.00 65.49  ?  716  PRO C CA    1 
ATOM   7235  C  C     . PRO D  3  716  ? -110.580 28.125  10.100  1.00 55.21  ?  716  PRO C C     1 
ATOM   7236  O  O     . PRO D  3  716  ? -109.833 27.943  9.137   1.00 78.62  ?  716  PRO C O     1 
ATOM   7237  C  CB    . PRO D  3  716  ? -111.657 25.851  10.348  1.00 58.61  ?  716  PRO C CB    1 
ATOM   7238  C  CG    . PRO D  3  716  ? -111.731 25.356  8.940   1.00 57.87  ?  716  PRO C CG    1 
ATOM   7239  C  CD    . PRO D  3  716  ? -112.752 26.213  8.248   1.00 64.88  ?  716  PRO C CD    1 
ATOM   7240  N  N     . TRP D  3  717  ? -110.302 28.980  11.085  1.00 45.32  ?  717  TRP C N     1 
ATOM   7241  C  CA    . TRP D  3  717  ? -109.208 29.951  11.011  1.00 51.52  ?  717  TRP C CA    1 
ATOM   7242  C  C     . TRP D  3  717  ? -108.193 29.661  12.117  1.00 59.04  ?  717  TRP C C     1 
ATOM   7243  O  O     . TRP D  3  717  ? -108.272 30.202  13.220  1.00 59.44  ?  717  TRP C O     1 
ATOM   7244  C  CB    . TRP D  3  717  ? -109.731 31.376  11.102  1.00 52.06  ?  717  TRP C CB    1 
ATOM   7245  C  CG    . TRP D  3  717  ? -108.787 32.394  10.540  1.00 54.92  ?  717  TRP C CG    1 
ATOM   7246  C  CD1   . TRP D  3  717  ? -108.719 32.822  9.246   1.00 63.88  ?  717  TRP C CD1   1 
ATOM   7247  C  CD2   . TRP D  3  717  ? -107.792 33.132  11.258  1.00 51.69  ?  717  TRP C CD2   1 
ATOM   7248  N  NE1   . TRP D  3  717  ? -107.740 33.775  9.112   1.00 57.29  ?  717  TRP C NE1   1 
ATOM   7249  C  CE2   . TRP D  3  717  ? -107.156 33.984  10.333  1.00 48.29  ?  717  TRP C CE2   1 
ATOM   7250  C  CE3   . TRP D  3  717  ? -107.376 33.156  12.592  1.00 62.32  ?  717  TRP C CE3   1 
ATOM   7251  C  CZ2   . TRP D  3  717  ? -106.127 34.847  10.697  1.00 67.00  ?  717  TRP C CZ2   1 
ATOM   7252  C  CZ3   . TRP D  3  717  ? -106.355 34.015  12.953  1.00 64.67  ?  717  TRP C CZ3   1 
ATOM   7253  C  CH2   . TRP D  3  717  ? -105.741 34.847  12.009  1.00 70.46  ?  717  TRP C CH2   1 
ATOM   7254  N  N     . GLU D  3  718  ? -107.230 28.799  11.803  1.00 61.70  ?  718  GLU C N     1 
ATOM   7255  C  CA    . GLU D  3  718  ? -106.036 28.600  12.625  1.00 64.45  ?  718  GLU C CA    1 
ATOM   7256  C  C     . GLU D  3  718  ? -106.412 28.345  14.085  1.00 61.00  ?  718  GLU C C     1 
ATOM   7257  O  O     . GLU D  3  718  ? -105.771 28.833  15.022  1.00 67.01  ?  718  GLU C O     1 
ATOM   7258  C  CB    . GLU D  3  718  ? -105.070 29.789  12.497  1.00 59.27  ?  718  GLU C CB    1 
ATOM   7259  C  CG    . GLU D  3  718  ? -104.684 30.072  11.058  1.00 75.00  ?  718  GLU C CG    1 
ATOM   7260  C  CD    . GLU D  3  718  ? -103.374 30.840  10.926  1.00 107.68 ?  718  GLU C CD    1 
ATOM   7261  O  OE1   . GLU D  3  718  ? -102.527 30.707  11.825  1.00 114.36 ?  718  GLU C OE1   1 
ATOM   7262  O  OE2   . GLU D  3  718  ? -103.186 31.576  9.927   1.00 110.89 ?  718  GLU C OE2   1 
ATOM   7263  N  N     . GLY D  3  719  ? -107.468 27.554  14.281  1.00 65.48  ?  719  GLY C N     1 
ATOM   7264  C  CA    . GLY D  3  719  ? -107.862 27.061  15.595  1.00 68.55  ?  719  GLY C CA    1 
ATOM   7265  C  C     . GLY D  3  719  ? -108.433 28.080  16.557  1.00 72.77  ?  719  GLY C C     1 
ATOM   7266  O  O     . GLY D  3  719  ? -108.847 27.699  17.659  1.00 74.76  ?  719  GLY C O     1 
ATOM   7267  N  N     . HIS D  3  720  ? -108.481 29.359  16.191  1.00 71.29  ?  720  HIS C N     1 
ATOM   7268  C  CA    . HIS D  3  720  ? -109.016 30.340  17.122  1.00 65.65  ?  720  HIS C CA    1 
ATOM   7269  C  C     . HIS D  3  720  ? -110.537 30.317  17.168  1.00 70.57  ?  720  HIS C C     1 
ATOM   7270  O  O     . HIS D  3  720  ? -111.120 30.721  18.177  1.00 79.44  ?  720  HIS C O     1 
ATOM   7271  C  CB    . HIS D  3  720  ? -108.514 31.738  16.765  1.00 71.82  ?  720  HIS C CB    1 
ATOM   7272  C  CG    . HIS D  3  720  ? -107.110 32.006  17.215  1.00 63.62  ?  720  HIS C CG    1 
ATOM   7273  N  ND1   . HIS D  3  720  ? -106.787 32.309  18.521  1.00 78.06  ?  720  HIS C ND1   1 
ATOM   7274  C  CD2   . HIS D  3  720  ? -105.943 32.014  16.530  1.00 70.65  ?  720  HIS C CD2   1 
ATOM   7275  C  CE1   . HIS D  3  720  ? -105.482 32.493  18.621  1.00 77.15  ?  720  HIS C CE1   1 
ATOM   7276  N  NE2   . HIS D  3  720  ? -104.947 32.321  17.426  1.00 79.46  ?  720  HIS C NE2   1 
ATOM   7277  N  N     . ASN D  3  721  ? -111.193 29.863  16.103  1.00 66.15  ?  721  ASN C N     1 
ATOM   7278  C  CA    . ASN D  3  721  ? -112.640 29.631  16.102  1.00 61.52  ?  721  ASN C CA    1 
ATOM   7279  C  C     . ASN D  3  721  ? -112.889 28.125  16.152  1.00 77.17  ?  721  ASN C C     1 
ATOM   7280  O  O     . ASN D  3  721  ? -113.319 27.497  15.180  1.00 82.65  ?  721  ASN C O     1 
ATOM   7281  C  CB    . ASN D  3  721  ? -113.297 30.288  14.880  1.00 71.20  ?  721  ASN C CB    1 
ATOM   7282  C  CG    . ASN D  3  721  ? -112.695 29.825  13.566  1.00 69.69  ?  721  ASN C CG    1 
ATOM   7283  O  OD1   . ASN D  3  721  ? -113.352 29.139  12.782  1.00 63.22  ?  721  ASN C OD1   1 
ATOM   7284  N  ND2   . ASN D  3  721  ? -111.443 30.200  13.317  1.00 81.63  ?  721  ASN C ND2   1 
ATOM   7285  N  N     . TYR D  3  722  ? -112.590 27.547  17.313  1.00 80.67  ?  722  TYR C N     1 
ATOM   7286  C  CA    . TYR D  3  722  ? -112.607 26.109  17.531  1.00 63.04  ?  722  TYR C CA    1 
ATOM   7287  C  C     . TYR D  3  722  ? -113.840 25.718  18.335  1.00 63.39  ?  722  TYR C C     1 
ATOM   7288  O  O     . TYR D  3  722  ? -114.208 26.398  19.297  1.00 75.34  ?  722  TYR C O     1 
ATOM   7289  C  CB    . TYR D  3  722  ? -111.332 25.671  18.256  1.00 63.27  ?  722  TYR C CB    1 
ATOM   7290  C  CG    . TYR D  3  722  ? -111.305 24.223  18.682  1.00 76.65  ?  722  TYR C CG    1 
ATOM   7291  C  CD1   . TYR D  3  722  ? -111.296 23.202  17.742  1.00 80.68  ?  722  TYR C CD1   1 
ATOM   7292  C  CD2   . TYR D  3  722  ? -111.262 23.879  20.026  1.00 73.45  ?  722  TYR C CD2   1 
ATOM   7293  C  CE1   . TYR D  3  722  ? -111.262 21.877  18.130  1.00 78.61  ?  722  TYR C CE1   1 
ATOM   7294  C  CE2   . TYR D  3  722  ? -111.227 22.559  20.424  1.00 70.83  ?  722  TYR C CE2   1 
ATOM   7295  C  CZ    . TYR D  3  722  ? -111.226 21.561  19.473  1.00 81.47  ?  722  TYR C CZ    1 
ATOM   7296  O  OH    . TYR D  3  722  ? -111.191 20.243  19.867  1.00 89.21  ?  722  TYR C OH    1 
ATOM   7297  N  N     . GLU D  3  723  ? -114.474 24.615  17.938  1.00 80.44  ?  723  GLU C N     1 
ATOM   7298  C  CA    . GLU D  3  723  ? -115.720 24.179  18.559  1.00 83.26  ?  723  GLU C CA    1 
ATOM   7299  C  C     . GLU D  3  723  ? -116.806 25.231  18.374  1.00 73.42  ?  723  GLU C C     1 
ATOM   7300  O  O     . GLU D  3  723  ? -117.437 25.298  17.315  1.00 84.77  ?  723  GLU C O     1 
ATOM   7301  C  CB    . GLU D  3  723  ? -115.517 23.877  20.047  1.00 76.41  ?  723  GLU C CB    1 
ATOM   7302  C  CG    . GLU D  3  723  ? -114.614 22.684  20.328  1.00 75.14  ?  723  GLU C CG    1 
ATOM   7303  C  CD    . GLU D  3  723  ? -114.878 22.054  21.686  1.00 80.35  ?  723  GLU C CD    1 
ATOM   7304  O  OE1   . GLU D  3  723  ? -115.828 21.250  21.796  1.00 79.97  ?  723  GLU C OE1   1 
ATOM   7305  O  OE2   . GLU D  3  723  ? -114.143 22.369  22.646  1.00 82.72  ?  723  GLU C OE2   1 
ATOM   7306  N  N     . ASP D  3  724  ? -117.033 26.056  19.396  1.00 64.20  ?  724  ASP C N     1 
ATOM   7307  C  CA    . ASP D  3  724  ? -118.051 27.100  19.336  1.00 67.58  ?  724  ASP C CA    1 
ATOM   7308  C  C     . ASP D  3  724  ? -117.478 28.500  19.513  1.00 61.49  ?  724  ASP C C     1 
ATOM   7309  O  O     . ASP D  3  724  ? -118.246 29.449  19.706  1.00 67.81  ?  724  ASP C O     1 
ATOM   7310  C  CB    . ASP D  3  724  ? -119.138 26.849  20.386  1.00 78.77  ?  724  ASP C CB    1 
ATOM   7311  C  CG    . ASP D  3  724  ? -119.970 25.620  20.082  1.00 92.84  ?  724  ASP C CG    1 
ATOM   7312  O  OD1   . ASP D  3  724  ? -119.958 25.171  18.917  1.00 101.06 ?  724  ASP C OD1   1 
ATOM   7313  O  OD2   . ASP D  3  724  ? -120.641 25.107  21.005  1.00 87.66  ?  724  ASP C OD2   1 
ATOM   7314  N  N     . ALA D  3  725  ? -116.159 28.660  19.456  1.00 65.06  ?  725  ALA C N     1 
ATOM   7315  C  CA    . ALA D  3  725  ? -115.556 29.974  19.610  1.00 58.20  ?  725  ALA C CA    1 
ATOM   7316  C  C     . ALA D  3  725  ? -115.723 30.796  18.334  1.00 64.13  ?  725  ALA C C     1 
ATOM   7317  O  O     . ALA D  3  725  ? -115.985 30.267  17.249  1.00 70.26  ?  725  ALA C O     1 
ATOM   7318  C  CB    . ALA D  3  725  ? -114.074 29.850  19.970  1.00 64.33  ?  725  ALA C CB    1 
ATOM   7319  N  N     . ILE D  3  726  ? -115.567 32.112  18.477  1.00 57.19  ?  726  ILE C N     1 
ATOM   7320  C  CA    . ILE D  3  726  ? -115.747 33.050  17.377  1.00 56.29  ?  726  ILE C CA    1 
ATOM   7321  C  C     . ILE D  3  726  ? -114.615 34.067  17.401  1.00 75.21  ?  726  ILE C C     1 
ATOM   7322  O  O     . ILE D  3  726  ? -114.088 34.414  18.462  1.00 75.59  ?  726  ILE C O     1 
ATOM   7323  C  CB    . ILE D  3  726  ? -117.111 33.769  17.447  1.00 54.20  ?  726  ILE C CB    1 
ATOM   7324  C  CG1   . ILE D  3  726  ? -118.249 32.755  17.565  1.00 65.50  ?  726  ILE C CG1   1 
ATOM   7325  C  CG2   . ILE D  3  726  ? -117.309 34.656  16.229  1.00 79.63  ?  726  ILE C CG2   1 
ATOM   7326  C  CD1   . ILE D  3  726  ? -119.615 33.386  17.743  1.00 60.25  ?  726  ILE C CD1   1 
ATOM   7327  N  N     . ILE D  3  727  ? -114.245 34.547  16.215  1.00 61.16  ?  727  ILE C N     1 
ATOM   7328  C  CA    . ILE D  3  727  ? -113.243 35.594  16.061  1.00 68.02  ?  727  ILE C CA    1 
ATOM   7329  C  C     . ILE D  3  727  ? -113.894 36.779  15.366  1.00 64.35  ?  727  ILE C C     1 
ATOM   7330  O  O     . ILE D  3  727  ? -114.653 36.605  14.406  1.00 72.57  ?  727  ILE C O     1 
ATOM   7331  C  CB    . ILE D  3  727  ? -112.009 35.107  15.271  1.00 67.58  ?  727  ILE C CB    1 
ATOM   7332  C  CG1   . ILE D  3  727  ? -112.424 34.115  14.183  1.00 70.64  ?  727  ILE C CG1   1 
ATOM   7333  C  CG2   . ILE D  3  727  ? -110.979 34.491  16.211  1.00 79.85  ?  727  ILE C CG2   1 
ATOM   7334  C  CD1   . ILE D  3  727  ? -111.255 33.432  13.508  1.00 74.55  ?  727  ILE C CD1   1 
ATOM   7335  N  N     . LEU D  3  728  ? -113.600 37.981  15.855  1.00 57.95  ?  728  LEU C N     1 
ATOM   7336  C  CA    . LEU D  3  728  ? -114.184 39.201  15.323  1.00 62.90  ?  728  LEU C CA    1 
ATOM   7337  C  C     . LEU D  3  728  ? -113.090 40.137  14.831  1.00 76.43  ?  728  LEU C C     1 
ATOM   7338  O  O     . LEU D  3  728  ? -111.946 40.095  15.293  1.00 69.99  ?  728  LEU C O     1 
ATOM   7339  C  CB    . LEU D  3  728  ? -115.034 39.927  16.375  1.00 62.98  ?  728  LEU C CB    1 
ATOM   7340  C  CG    . LEU D  3  728  ? -116.021 39.106  17.205  1.00 70.01  ?  728  LEU C CG    1 
ATOM   7341  C  CD1   . LEU D  3  728  ? -116.901 40.025  18.033  1.00 64.78  ?  728  LEU C CD1   1 
ATOM   7342  C  CD2   . LEU D  3  728  ? -116.863 38.205  16.322  1.00 80.70  ?  728  LEU C CD2   1 
ATOM   7343  N  N     . SER D  3  729  ? -113.463 40.989  13.880  1.00 74.62  ?  729  SER C N     1 
ATOM   7344  C  CA    . SER D  3  729  ? -112.586 42.057  13.432  1.00 57.19  ?  729  SER C CA    1 
ATOM   7345  C  C     . SER D  3  729  ? -112.590 43.184  14.454  1.00 56.38  ?  729  SER C C     1 
ATOM   7346  O  O     . SER D  3  729  ? -113.631 43.514  15.028  1.00 75.14  ?  729  SER C O     1 
ATOM   7347  C  CB    . SER D  3  729  ? -113.034 42.586  12.068  1.00 61.13  ?  729  SER C CB    1 
ATOM   7348  O  OG    . SER D  3  729  ? -113.110 41.541  11.113  1.00 92.50  ?  729  SER C OG    1 
ATOM   7349  N  N     . ASN D  3  730  ? -111.418 43.778  14.682  1.00 58.65  ?  730  ASN C N     1 
ATOM   7350  C  CA    . ASN D  3  730  ? -111.342 44.910  15.597  1.00 52.89  ?  730  ASN C CA    1 
ATOM   7351  C  C     . ASN D  3  730  ? -112.253 46.057  15.179  1.00 65.26  ?  730  ASN C C     1 
ATOM   7352  O  O     . ASN D  3  730  ? -112.454 46.986  15.969  1.00 75.56  ?  730  ASN C O     1 
ATOM   7353  C  CB    . ASN D  3  730  ? -109.900 45.408  15.702  1.00 65.39  ?  730  ASN C CB    1 
ATOM   7354  C  CG    . ASN D  3  730  ? -109.668 46.263  16.930  1.00 68.06  ?  730  ASN C CG    1 
ATOM   7355  O  OD1   . ASN D  3  730  ? -110.284 46.049  17.974  1.00 50.60  ?  730  ASN C OD1   1 
ATOM   7356  N  ND2   . ASN D  3  730  ? -108.775 47.240  16.813  1.00 87.98  ?  730  ASN C ND2   1 
ATOM   7357  N  N     . ARG D  3  731  ? -112.799 46.019  13.961  1.00 60.60  ?  731  ARG C N     1 
ATOM   7358  C  CA    . ARG D  3  731  ? -113.720 47.064  13.527  1.00 53.23  ?  731  ARG C CA    1 
ATOM   7359  C  C     . ARG D  3  731  ? -114.934 47.138  14.440  1.00 72.61  ?  731  ARG C C     1 
ATOM   7360  O  O     . ARG D  3  731  ? -115.444 48.229  14.723  1.00 88.04  ?  731  ARG C O     1 
ATOM   7361  C  CB    . ARG D  3  731  ? -114.155 46.813  12.083  1.00 61.58  ?  731  ARG C CB    1 
ATOM   7362  C  CG    . ARG D  3  731  ? -115.026 47.912  11.499  1.00 69.04  ?  731  ARG C CG    1 
ATOM   7363  C  CD    . ARG D  3  731  ? -115.630 47.495  10.167  1.00 79.12  ?  731  ARG C CD    1 
ATOM   7364  N  NE    . ARG D  3  731  ? -116.728 46.548  10.334  1.00 79.68  ?  731  ARG C NE    1 
ATOM   7365  C  CZ    . ARG D  3  731  ? -118.010 46.895  10.410  1.00 77.38  ?  731  ARG C CZ    1 
ATOM   7366  N  NH1   . ARG D  3  731  ? -118.359 48.172  10.331  1.00 81.20  ?  731  ARG C NH1   1 
ATOM   7367  N  NH2   . ARG D  3  731  ? -118.945 45.966  10.559  1.00 73.15  ?  731  ARG C NH2   1 
ATOM   7368  N  N     . LEU D  3  732  ? -115.415 45.986  14.913  1.00 67.14  ?  732  LEU C N     1 
ATOM   7369  C  CA    . LEU D  3  732  ? -116.575 45.975  15.794  1.00 66.33  ?  732  LEU C CA    1 
ATOM   7370  C  C     . LEU D  3  732  ? -116.313 46.717  17.098  1.00 63.92  ?  732  LEU C C     1 
ATOM   7371  O  O     . LEU D  3  732  ? -117.267 47.129  17.767  1.00 72.56  ?  732  LEU C O     1 
ATOM   7372  C  CB    . LEU D  3  732  ? -117.004 44.536  16.075  1.00 53.43  ?  732  LEU C CB    1 
ATOM   7373  C  CG    . LEU D  3  732  ? -117.235 43.681  14.824  1.00 49.41  ?  732  LEU C CG    1 
ATOM   7374  C  CD1   . LEU D  3  732  ? -117.721 42.288  15.195  1.00 72.65  ?  732  LEU C CD1   1 
ATOM   7375  C  CD2   . LEU D  3  732  ? -118.212 44.352  13.877  1.00 55.95  ?  732  LEU C CD2   1 
ATOM   7376  N  N     . VAL D  3  733  ? -115.050 46.896  17.473  1.00 62.41  ?  733  VAL C N     1 
ATOM   7377  C  CA    . VAL D  3  733  ? -114.711 47.719  18.629  1.00 58.48  ?  733  VAL C CA    1 
ATOM   7378  C  C     . VAL D  3  733  ? -114.492 49.171  18.226  1.00 72.01  ?  733  VAL C C     1 
ATOM   7379  O  O     . VAL D  3  733  ? -114.954 50.087  18.911  1.00 79.69  ?  733  VAL C O     1 
ATOM   7380  C  CB    . VAL D  3  733  ? -113.470 47.145  19.343  1.00 52.67  ?  733  VAL C CB    1 
ATOM   7381  C  CG1   . VAL D  3  733  ? -113.119 47.995  20.557  1.00 66.91  ?  733  VAL C CG1   1 
ATOM   7382  C  CG2   . VAL D  3  733  ? -113.703 45.699  19.744  1.00 49.20  ?  733  VAL C CG2   1 
ATOM   7383  N  N     . GLU D  3  734  ? -113.793 49.401  17.112  1.00 68.69  ?  734  GLU C N     1 
ATOM   7384  C  CA    . GLU D  3  734  ? -113.485 50.767  16.699  1.00 69.83  ?  734  GLU C CA    1 
ATOM   7385  C  C     . GLU D  3  734  ? -114.740 51.521  16.276  1.00 63.41  ?  734  GLU C C     1 
ATOM   7386  O  O     . GLU D  3  734  ? -114.878 52.715  16.566  1.00 87.28  ?  734  GLU C O     1 
ATOM   7387  C  CB    . GLU D  3  734  ? -112.462 50.752  15.564  1.00 83.83  ?  734  GLU C CB    1 
ATOM   7388  C  CG    . GLU D  3  734  ? -111.168 50.028  15.898  1.00 89.87  ?  734  GLU C CG    1 
ATOM   7389  C  CD    . GLU D  3  734  ? -110.165 50.067  14.758  1.00 98.01  ?  734  GLU C CD    1 
ATOM   7390  O  OE1   . GLU D  3  734  ? -110.403 50.804  13.777  1.00 95.91  ?  734  GLU C OE1   1 
ATOM   7391  O  OE2   . GLU D  3  734  ? -109.139 49.359  14.843  1.00 106.51 ?  734  GLU C OE2   1 
ATOM   7392  N  N     . GLU D  3  735  ? -115.664 50.847  15.594  1.00 54.80  ?  735  GLU C N     1 
ATOM   7393  C  CA    . GLU D  3  735  ? -116.875 51.479  15.089  1.00 70.74  ?  735  GLU C CA    1 
ATOM   7394  C  C     . GLU D  3  735  ? -118.074 51.306  16.017  1.00 84.69  ?  735  GLU C C     1 
ATOM   7395  O  O     . GLU D  3  735  ? -119.197 51.642  15.626  1.00 83.89  ?  735  GLU C O     1 
ATOM   7396  C  CB    . GLU D  3  735  ? -117.208 50.939  13.698  1.00 59.08  ?  735  GLU C CB    1 
ATOM   7397  C  CG    . GLU D  3  735  ? -116.208 51.342  12.630  1.00 69.89  ?  735  GLU C CG    1 
ATOM   7398  C  CD    . GLU D  3  735  ? -116.655 50.955  11.234  1.00 90.96  ?  735  GLU C CD    1 
ATOM   7399  O  OE1   . GLU D  3  735  ? -117.703 50.286  11.107  1.00 100.81 ?  735  GLU C OE1   1 
ATOM   7400  O  OE2   . GLU D  3  735  ? -115.958 51.322  10.264  1.00 85.63  ?  735  GLU C OE2   1 
ATOM   7401  N  N     . ASP D  3  736  ? -117.864 50.796  17.232  1.00 71.31  ?  736  ASP C N     1 
ATOM   7402  C  CA    . ASP D  3  736  ? -118.926 50.694  18.235  1.00 65.01  ?  736  ASP C CA    1 
ATOM   7403  C  C     . ASP D  3  736  ? -120.190 50.064  17.656  1.00 80.69  ?  736  ASP C C     1 
ATOM   7404  O  O     . ASP D  3  736  ? -121.308 50.524  17.899  1.00 89.38  ?  736  ASP C O     1 
ATOM   7405  C  CB    . ASP D  3  736  ? -119.238 52.063  18.842  1.00 78.50  ?  736  ASP C CB    1 
ATOM   7406  C  CG    . ASP D  3  736  ? -118.277 52.442  19.950  1.00 90.23  ?  736  ASP C CG    1 
ATOM   7407  O  OD1   . ASP D  3  736  ? -117.882 51.544  20.720  1.00 76.61  ?  736  ASP C OD1   1 
ATOM   7408  O  OD2   . ASP D  3  736  ? -117.918 53.636  20.050  1.00 95.19  ?  736  ASP C OD2   1 
ATOM   7409  N  N     . VAL D  3  737  ? -120.014 48.994  16.881  1.00 79.79  ?  737  VAL C N     1 
ATOM   7410  C  CA    . VAL D  3  737  ? -121.170 48.309  16.310  1.00 79.71  ?  737  VAL C CA    1 
ATOM   7411  C  C     . VAL D  3  737  ? -121.809 47.378  17.332  1.00 67.13  ?  737  VAL C C     1 
ATOM   7412  O  O     . VAL D  3  737  ? -123.038 47.277  17.411  1.00 80.91  ?  737  VAL C O     1 
ATOM   7413  C  CB    . VAL D  3  737  ? -120.771 47.555  15.031  1.00 73.25  ?  737  VAL C CB    1 
ATOM   7414  C  CG1   . VAL D  3  737  ? -119.281 47.279  15.023  1.00 67.76  ?  737  VAL C CG1   1 
ATOM   7415  C  CG2   . VAL D  3  737  ? -121.562 46.258  14.922  1.00 59.70  ?  737  VAL C CG2   1 
ATOM   7416  N  N     . LEU D  3  738  ? -120.995 46.678  18.121  1.00 60.71  ?  738  LEU C N     1 
ATOM   7417  C  CA    . LEU D  3  738  ? -121.493 45.810  19.179  1.00 60.72  ?  738  LEU C CA    1 
ATOM   7418  C  C     . LEU D  3  738  ? -121.306 46.418  20.563  1.00 68.84  ?  738  LEU C C     1 
ATOM   7419  O  O     . LEU D  3  738  ? -121.231 45.682  21.552  1.00 74.08  ?  738  LEU C O     1 
ATOM   7420  C  CB    . LEU D  3  738  ? -120.819 44.439  19.109  1.00 55.61  ?  738  LEU C CB    1 
ATOM   7421  C  CG    . LEU D  3  738  ? -121.231 43.539  17.942  1.00 55.73  ?  738  LEU C CG    1 
ATOM   7422  C  CD1   . LEU D  3  738  ? -120.588 42.167  18.062  1.00 45.32  ?  738  LEU C CD1   1 
ATOM   7423  C  CD2   . LEU D  3  738  ? -122.746 43.420  17.857  1.00 47.10  ?  738  LEU C CD2   1 
ATOM   7424  N  N     . THR D  3  739  ? -121.224 47.743  20.653  1.00 68.95  ?  739  THR C N     1 
ATOM   7425  C  CA    . THR D  3  739  ? -121.126 48.424  21.936  1.00 71.24  ?  739  THR C CA    1 
ATOM   7426  C  C     . THR D  3  739  ? -122.523 48.649  22.501  1.00 77.19  ?  739  THR C C     1 
ATOM   7427  O  O     . THR D  3  739  ? -123.424 49.102  21.786  1.00 79.74  ?  739  THR C O     1 
ATOM   7428  C  CB    . THR D  3  739  ? -120.391 49.758  21.793  1.00 70.15  ?  739  THR C CB    1 
ATOM   7429  O  OG1   . THR D  3  739  ? -119.084 49.533  21.251  1.00 79.66  ?  739  THR C OG1   1 
ATOM   7430  C  CG2   . THR D  3  739  ? -120.256 50.436  23.146  1.00 70.67  ?  739  THR C CG2   1 
ATOM   7431  N  N     . SER D  3  740  ? -122.701 48.327  23.780  1.00 70.11  ?  740  SER C N     1 
ATOM   7432  C  CA    . SER D  3  740  ? -123.982 48.478  24.455  1.00 69.76  ?  740  SER C CA    1 
ATOM   7433  C  C     . SER D  3  740  ? -123.770 49.142  25.806  1.00 72.20  ?  740  SER C C     1 
ATOM   7434  O  O     . SER D  3  740  ? -122.817 48.822  26.521  1.00 66.47  ?  740  SER C O     1 
ATOM   7435  C  CB    . SER D  3  740  ? -124.674 47.127  24.646  1.00 74.71  ?  740  SER C CB    1 
ATOM   7436  O  OG    . SER D  3  740  ? -123.932 46.298  25.524  1.00 70.89  ?  740  SER C OG    1 
ATOM   7437  N  N     . ILE D  3  741  ? -124.662 50.066  26.149  1.00 67.91  ?  741  ILE C N     1 
ATOM   7438  C  CA    . ILE D  3  741  ? -124.593 50.780  27.417  1.00 57.68  ?  741  ILE C CA    1 
ATOM   7439  C  C     . ILE D  3  741  ? -125.261 49.938  28.492  1.00 62.55  ?  741  ILE C C     1 
ATOM   7440  O  O     . ILE D  3  741  ? -126.268 49.267  28.239  1.00 64.04  ?  741  ILE C O     1 
ATOM   7441  C  CB    . ILE D  3  741  ? -125.253 52.165  27.306  1.00 59.49  ?  741  ILE C CB    1 
ATOM   7442  C  CG1   . ILE D  3  741  ? -124.627 52.964  26.163  1.00 69.04  ?  741  ILE C CG1   1 
ATOM   7443  C  CG2   . ILE D  3  741  ? -125.118 52.921  28.617  1.00 65.62  ?  741  ILE C CG2   1 
ATOM   7444  C  CD1   . ILE D  3  741  ? -125.281 54.307  25.926  1.00 71.11  ?  741  ILE C CD1   1 
ATOM   7445  N  N     . HIS D  3  742  ? -124.698 49.971  29.698  1.00 62.12  ?  742  HIS C N     1 
ATOM   7446  C  CA    . HIS D  3  742  ? -125.254 49.246  30.832  1.00 61.63  ?  742  HIS C CA    1 
ATOM   7447  C  C     . HIS D  3  742  ? -125.228 50.144  32.057  1.00 73.74  ?  742  HIS C C     1 
ATOM   7448  O  O     . HIS D  3  742  ? -124.174 50.674  32.419  1.00 79.43  ?  742  HIS C O     1 
ATOM   7449  C  CB    . HIS D  3  742  ? -124.479 47.953  31.098  1.00 71.77  ?  742  HIS C CB    1 
ATOM   7450  C  CG    . HIS D  3  742  ? -124.592 46.952  29.992  1.00 82.58  ?  742  HIS C CG    1 
ATOM   7451  N  ND1   . HIS D  3  742  ? -125.707 46.162  29.815  1.00 91.47  ?  742  HIS C ND1   1 
ATOM   7452  C  CD2   . HIS D  3  742  ? -123.734 46.620  28.998  1.00 71.68  ?  742  HIS C CD2   1 
ATOM   7453  C  CE1   . HIS D  3  742  ? -125.530 45.383  28.763  1.00 83.79  ?  742  HIS C CE1   1 
ATOM   7454  N  NE2   . HIS D  3  742  ? -124.341 45.642  28.249  1.00 70.74  ?  742  HIS C NE2   1 
ATOM   7455  N  N     . ILE D  3  743  ? -126.387 50.307  32.688  1.00 70.99  ?  743  ILE C N     1 
ATOM   7456  C  CA    . ILE D  3  743  ? -126.556 51.202  33.826  1.00 73.02  ?  743  ILE C CA    1 
ATOM   7457  C  C     . ILE D  3  743  ? -126.702 50.368  35.090  1.00 77.22  ?  743  ILE C C     1 
ATOM   7458  O  O     . ILE D  3  743  ? -127.360 49.322  35.085  1.00 80.56  ?  743  ILE C O     1 
ATOM   7459  C  CB    . ILE D  3  743  ? -127.774 52.125  33.637  1.00 66.04  ?  743  ILE C CB    1 
ATOM   7460  C  CG1   . ILE D  3  743  ? -127.676 52.862  32.301  1.00 53.67  ?  743  ILE C CG1   1 
ATOM   7461  C  CG2   . ILE D  3  743  ? -127.878 53.107  34.792  1.00 68.94  ?  743  ILE C CG2   1 
ATOM   7462  C  CD1   . ILE D  3  743  ? -128.897 53.688  31.971  1.00 68.27  ?  743  ILE C CD1   1 
ATOM   7463  N  N     . GLU D  3  744  ? -126.090 50.837  36.172  1.00 73.63  ?  744  GLU C N     1 
ATOM   7464  C  CA    . GLU D  3  744  ? -126.144 50.163  37.460  1.00 74.06  ?  744  GLU C CA    1 
ATOM   7465  C  C     . GLU D  3  744  ? -126.674 51.129  38.509  1.00 81.46  ?  744  GLU C C     1 
ATOM   7466  O  O     . GLU D  3  744  ? -126.384 52.329  38.463  1.00 84.88  ?  744  GLU C O     1 
ATOM   7467  C  CB    . GLU D  3  744  ? -124.765 49.639  37.872  1.00 80.89  ?  744  GLU C CB    1 
ATOM   7468  C  CG    . GLU D  3  744  ? -124.816 48.337  38.649  1.00 97.06  ?  744  GLU C CG    1 
ATOM   7469  C  CD    . GLU D  3  744  ? -125.454 47.218  37.849  1.00 108.78 ?  744  GLU C CD    1 
ATOM   7470  O  OE1   . GLU D  3  744  ? -125.311 47.221  36.608  1.00 107.38 ?  744  GLU C OE1   1 
ATOM   7471  O  OE2   . GLU D  3  744  ? -126.105 46.342  38.457  1.00 118.39 ?  744  GLU C OE2   1 
ATOM   7472  N  N     . GLU D  3  745  ? -127.454 50.604  39.449  1.00 80.46  ?  745  GLU C N     1 
ATOM   7473  C  CA    . GLU D  3  745  ? -128.060 51.400  40.506  1.00 78.99  ?  745  GLU C CA    1 
ATOM   7474  C  C     . GLU D  3  745  ? -127.475 50.995  41.850  1.00 77.64  ?  745  GLU C C     1 
ATOM   7475  O  O     . GLU D  3  745  ? -127.438 49.807  42.184  1.00 94.63  ?  745  GLU C O     1 
ATOM   7476  C  CB    . GLU D  3  745  ? -129.582 51.231  40.523  1.00 91.72  ?  745  GLU C CB    1 
ATOM   7477  C  CG    . GLU D  3  745  ? -130.275 51.974  41.658  1.00 89.86  ?  745  GLU C CG    1 
ATOM   7478  C  CD    . GLU D  3  745  ? -131.789 51.881  41.582  1.00 109.28 ?  745  GLU C CD    1 
ATOM   7479  O  OE1   . GLU D  3  745  ? -132.303 51.253  40.632  1.00 118.78 ?  745  GLU C OE1   1 
ATOM   7480  O  OE2   . GLU D  3  745  ? -132.465 52.440  42.471  1.00 118.99 ?  745  GLU C OE2   1 
ATOM   7481  N  N     . HIS D  3  746  ? -127.017 51.983  42.611  1.00 84.19  ?  746  HIS C N     1 
ATOM   7482  C  CA    . HIS D  3  746  ? -126.536 51.778  43.967  1.00 80.19  ?  746  HIS C CA    1 
ATOM   7483  C  C     . HIS D  3  746  ? -127.345 52.650  44.916  1.00 89.70  ?  746  HIS C C     1 
ATOM   7484  O  O     . HIS D  3  746  ? -127.822 53.726  44.542  1.00 92.25  ?  746  HIS C O     1 
ATOM   7485  C  CB    . HIS D  3  746  ? -125.043 52.100  44.084  1.00 77.92  ?  746  HIS C CB    1 
ATOM   7486  C  CG    . HIS D  3  746  ? -124.181 51.308  43.151  1.00 78.93  ?  746  HIS C CG    1 
ATOM   7487  N  ND1   . HIS D  3  746  ? -124.185 51.504  41.787  1.00 87.31  ?  746  HIS C ND1   1 
ATOM   7488  C  CD2   . HIS D  3  746  ? -123.291 50.315  43.386  1.00 91.37  ?  746  HIS C CD2   1 
ATOM   7489  C  CE1   . HIS D  3  746  ? -123.333 50.668  41.222  1.00 90.40  ?  746  HIS C CE1   1 
ATOM   7490  N  NE2   . HIS D  3  746  ? -122.777 49.935  42.170  1.00 100.78 ?  746  HIS C NE2   1 
ATOM   7491  N  N     . GLU D  3  747  ? -127.501 52.177  46.149  1.00 96.86  ?  747  GLU C N     1 
ATOM   7492  C  CA    . GLU D  3  747  ? -128.378 52.832  47.105  1.00 103.23 ?  747  GLU C CA    1 
ATOM   7493  C  C     . GLU D  3  747  ? -127.781 52.741  48.501  1.00 108.62 ?  747  GLU C C     1 
ATOM   7494  O  O     . GLU D  3  747  ? -127.100 51.770  48.843  1.00 98.64  ?  747  GLU C O     1 
ATOM   7495  C  CB    . GLU D  3  747  ? -129.780 52.208  47.083  1.00 103.70 ?  747  GLU C CB    1 
ATOM   7496  C  CG    . GLU D  3  747  ? -130.917 53.212  47.166  1.00 114.94 ?  747  GLU C CG    1 
ATOM   7497  C  CD    . GLU D  3  747  ? -132.255 52.600  46.796  1.00 129.64 ?  747  GLU C CD    1 
ATOM   7498  O  OE1   . GLU D  3  747  ? -133.216 53.363  46.559  1.00 130.14 ?  747  GLU C OE1   1 
ATOM   7499  O  OE2   . GLU D  3  747  ? -132.343 51.355  46.737  1.00 131.11 ?  747  GLU C OE2   1 
ATOM   7500  N  N     . ILE D  3  748  ? -128.039 53.774  49.301  1.00 103.80 ?  748  ILE C N     1 
ATOM   7501  C  CA    . ILE D  3  748  ? -127.616 53.820  50.694  1.00 100.83 ?  748  ILE C CA    1 
ATOM   7502  C  C     . ILE D  3  748  ? -128.685 54.555  51.490  1.00 111.51 ?  748  ILE C C     1 
ATOM   7503  O  O     . ILE D  3  748  ? -129.414 55.398  50.957  1.00 106.21 ?  748  ILE C O     1 
ATOM   7504  C  CB    . ILE D  3  748  ? -126.239 54.498  50.863  1.00 99.00  ?  748  ILE C CB    1 
ATOM   7505  C  CG1   . ILE D  3  748  ? -125.648 54.162  52.233  1.00 101.90 ?  748  ILE C CG1   1 
ATOM   7506  C  CG2   . ILE D  3  748  ? -126.363 56.002  50.683  1.00 94.22  ?  748  ILE C CG2   1 
ATOM   7507  C  CD1   . ILE D  3  748  ? -125.469 52.676  52.469  1.00 107.41 ?  748  ILE C CD1   1 
ATOM   7508  N  N     . ASP D  3  749  ? -128.774 54.232  52.778  1.00 116.31 ?  749  ASP C N     1 
ATOM   7509  C  CA    . ASP D  3  749  ? -129.842 54.735  53.630  1.00 101.42 ?  749  ASP C CA    1 
ATOM   7510  C  C     . ASP D  3  749  ? -129.275 55.204  54.962  1.00 106.35 ?  749  ASP C C     1 
ATOM   7511  O  O     . ASP D  3  749  ? -128.310 54.637  55.482  1.00 105.12 ?  749  ASP C O     1 
ATOM   7512  C  CB    . ASP D  3  749  ? -130.909 53.660  53.865  1.00 116.58 ?  749  ASP C CB    1 
ATOM   7513  C  CG    . ASP D  3  749  ? -130.318 52.266  53.962  1.00 128.59 ?  749  ASP C CG    1 
ATOM   7514  O  OD1   . ASP D  3  749  ? -129.096 52.152  54.199  1.00 118.07 ?  749  ASP C OD1   1 
ATOM   7515  O  OD2   . ASP D  3  749  ? -131.073 51.285  53.799  1.00 126.60 ?  749  ASP C OD2   1 
ATOM   7516  N  N     . ALA D  3  750  ? -129.896 56.247  55.512  1.00 111.56 ?  750  ALA C N     1 
ATOM   7517  C  CA    . ALA D  3  750  ? -129.532 56.799  56.813  1.00 114.03 ?  750  ALA C CA    1 
ATOM   7518  C  C     . ALA D  3  750  ? -130.749 56.713  57.724  1.00 116.46 ?  750  ALA C C     1 
ATOM   7519  O  O     . ALA D  3  750  ? -131.744 57.416  57.509  1.00 113.16 ?  750  ALA C O     1 
ATOM   7520  C  CB    . ALA D  3  750  ? -129.043 58.240  56.684  1.00 101.66 ?  750  ALA C CB    1 
ATOM   7521  N  N     . ARG D  3  751  ? -130.670 55.858  58.738  1.00 119.89 ?  751  ARG C N     1 
ATOM   7522  C  CA    . ARG D  3  751  ? -131.780 55.612  59.646  1.00 123.67 ?  751  ARG C CA    1 
ATOM   7523  C  C     . ARG D  3  751  ? -131.298 55.733  61.084  1.00 134.85 ?  751  ARG C C     1 
ATOM   7524  O  O     . ARG D  3  751  ? -130.112 55.947  61.354  1.00 140.86 ?  751  ARG C O     1 
ATOM   7525  C  CB    . ARG D  3  751  ? -132.394 54.225  59.413  1.00 129.01 ?  751  ARG C CB    1 
ATOM   7526  C  CG    . ARG D  3  751  ? -132.531 53.832  57.952  1.00 129.63 ?  751  ARG C CG    1 
ATOM   7527  C  CD    . ARG D  3  751  ? -133.148 52.446  57.802  1.00 124.76 ?  751  ARG C CD    1 
ATOM   7528  N  NE    . ARG D  3  751  ? -133.195 52.003  56.408  1.00 129.78 ?  751  ARG C NE    1 
ATOM   7529  C  CZ    . ARG D  3  751  ? -133.856 50.927  55.988  1.00 135.26 ?  751  ARG C CZ    1 
ATOM   7530  N  NH1   . ARG D  3  751  ? -134.533 50.186  56.853  1.00 149.48 ?  751  ARG C NH1   1 
ATOM   7531  N  NH2   . ARG D  3  751  ? -133.846 50.593  54.703  1.00 118.20 ?  751  ARG C NH2   1 
ATOM   7532  N  N     . ASP D  3  752  ? -132.233 55.583  62.016  1.00 133.98 ?  752  ASP C N     1 
ATOM   7533  C  CA    . ASP D  3  752  ? -131.883 55.507  63.424  1.00 130.67 ?  752  ASP C CA    1 
ATOM   7534  C  C     . ASP D  3  752  ? -131.482 54.082  63.778  1.00 135.05 ?  752  ASP C C     1 
ATOM   7535  O  O     . ASP D  3  752  ? -132.055 53.115  63.266  1.00 125.77 ?  752  ASP C O     1 
ATOM   7536  C  CB    . ASP D  3  752  ? -133.056 55.959  64.294  1.00 122.38 ?  752  ASP C CB    1 
ATOM   7537  N  N     . THR D  3  753  ? -130.498 53.956  64.659  1.00 139.04 ?  753  THR C N     1 
ATOM   7538  C  CA    . THR D  3  753  ? -129.957 52.663  65.052  1.00 137.74 ?  753  THR C CA    1 
ATOM   7539  C  C     . THR D  3  753  ? -130.077 52.488  66.567  1.00 137.25 ?  753  THR C C     1 
ATOM   7540  O  O     . THR D  3  753  ? -130.655 53.318  67.270  1.00 132.83 ?  753  THR C O     1 
ATOM   7541  C  CB    . THR D  3  753  ? -128.509 52.542  64.568  1.00 133.26 ?  753  THR C CB    1 
ATOM   7542  O  OG1   . THR D  3  753  ? -127.686 53.443  65.308  1.00 126.66 ?  753  THR C OG1   1 
ATOM   7543  C  CG2   . THR D  3  753  ? -128.421 52.856  63.087  1.00 132.65 ?  753  THR C CG2   1 
ATOM   7544  N  N     . LYS D  3  754  ? -129.499 51.397  67.066  1.00 129.99 ?  754  LYS C N     1 
ATOM   7545  C  CA    . LYS D  3  754  ? -129.601 51.073  68.485  1.00 119.45 ?  754  LYS C CA    1 
ATOM   7546  C  C     . LYS D  3  754  ? -129.018 52.177  69.359  1.00 131.60 ?  754  LYS C C     1 
ATOM   7547  O  O     . LYS D  3  754  ? -129.641 52.599  70.338  1.00 129.46 ?  754  LYS C O     1 
ATOM   7548  C  CB    . LYS D  3  754  ? -128.891 49.741  68.751  1.00 117.60 ?  754  LYS C CB    1 
ATOM   7549  C  CG    . LYS D  3  754  ? -127.791 49.425  67.739  1.00 113.50 ?  754  LYS C CG    1 
ATOM   7550  C  CD    . LYS D  3  754  ? -127.009 48.180  68.146  1.00 103.71 ?  754  LYS C CD    1 
ATOM   7551  C  CE    . LYS D  3  754  ? -126.136 47.631  67.024  1.00 113.63 ?  754  LYS C CE    1 
ATOM   7552  N  NZ    . LYS D  3  754  ? -126.960 47.102  65.904  1.00 99.44  ?  754  LYS C NZ    1 
ATOM   7553  N  N     . LEU D  3  755  ? -127.817 52.649  69.026  1.00 140.41 ?  755  LEU C N     1 
ATOM   7554  C  CA    . LEU D  3  755  ? -127.101 53.611  69.852  1.00 132.28 ?  755  LEU C CA    1 
ATOM   7555  C  C     . LEU D  3  755  ? -126.944 54.976  69.197  1.00 131.55 ?  755  LEU C C     1 
ATOM   7556  O  O     . LEU D  3  755  ? -126.316 55.861  69.788  1.00 120.00 ?  755  LEU C O     1 
ATOM   7557  C  CB    . LEU D  3  755  ? -125.724 53.049  70.227  1.00 112.70 ?  755  LEU C CB    1 
ATOM   7558  C  CG    . LEU D  3  755  ? -124.909 52.428  69.089  1.00 115.62 ?  755  LEU C CG    1 
ATOM   7559  C  CD1   . LEU D  3  755  ? -124.335 53.505  68.179  1.00 129.75 ?  755  LEU C CD1   1 
ATOM   7560  C  CD2   . LEU D  3  755  ? -123.810 51.537  69.642  1.00 105.43 ?  755  LEU C CD2   1 
ATOM   7561  N  N     . GLY D  3  756  ? -127.495 55.177  68.007  1.00 132.54 ?  756  GLY C N     1 
ATOM   7562  C  CA    . GLY D  3  756  ? -127.381 56.465  67.348  1.00 126.80 ?  756  GLY C CA    1 
ATOM   7563  C  C     . GLY D  3  756  ? -128.099 56.444  66.018  1.00 131.28 ?  756  GLY C C     1 
ATOM   7564  O  O     . GLY D  3  756  ? -128.647 55.421  65.594  1.00 128.01 ?  756  GLY C O     1 
ATOM   7565  N  N     . ALA D  3  757  ? -128.090 57.599  65.361  1.00 127.53 ?  757  ALA C N     1 
ATOM   7566  C  CA    . ALA D  3  757  ? -128.736 57.777  64.068  1.00 126.79 ?  757  ALA C CA    1 
ATOM   7567  C  C     . ALA D  3  757  ? -127.673 57.967  62.995  1.00 128.34 ?  757  ALA C C     1 
ATOM   7568  O  O     . ALA D  3  757  ? -126.797 58.828  63.127  1.00 124.29 ?  757  ALA C O     1 
ATOM   7569  C  CB    . ALA D  3  757  ? -129.691 58.972  64.091  1.00 121.12 ?  757  ALA C CB    1 
ATOM   7570  N  N     . GLU D  3  758  ? -127.752 57.161  61.938  1.00 128.53 ?  758  GLU C N     1 
ATOM   7571  C  CA    . GLU D  3  758  ? -126.793 57.263  60.849  1.00 128.29 ?  758  GLU C CA    1 
ATOM   7572  C  C     . GLU D  3  758  ? -126.835 58.654  60.227  1.00 118.96 ?  758  GLU C C     1 
ATOM   7573  O  O     . GLU D  3  758  ? -127.893 59.279  60.129  1.00 118.87 ?  758  GLU C O     1 
ATOM   7574  C  CB    . GLU D  3  758  ? -127.078 56.199  59.789  1.00 130.05 ?  758  GLU C CB    1 
ATOM   7575  N  N     . GLU D  3  759  ? -125.668 59.141  59.807  1.00 113.11 ?  759  GLU C N     1 
ATOM   7576  C  CA    . GLU D  3  759  ? -125.546 60.460  59.191  1.00 113.09 ?  759  GLU C CA    1 
ATOM   7577  C  C     . GLU D  3  759  ? -124.655 60.352  57.963  1.00 119.42 ?  759  GLU C C     1 
ATOM   7578  O  O     . GLU D  3  759  ? -123.467 60.036  58.085  1.00 110.97 ?  759  GLU C O     1 
ATOM   7579  C  CB    . GLU D  3  759  ? -124.985 61.484  60.181  1.00 91.06  ?  759  GLU C CB    1 
ATOM   7580  N  N     . ILE D  3  760  ? -125.231 60.599  56.787  1.00 122.73 ?  760  ILE C N     1 
ATOM   7581  C  CA    . ILE D  3  760  ? -124.481 60.572  55.536  1.00 112.94 ?  760  ILE C CA    1 
ATOM   7582  C  C     . ILE D  3  760  ? -123.806 61.925  55.341  1.00 105.10 ?  760  ILE C C     1 
ATOM   7583  O  O     . ILE D  3  760  ? -124.462 62.913  54.996  1.00 101.66 ?  760  ILE C O     1 
ATOM   7584  C  CB    . ILE D  3  760  ? -125.398 60.237  54.364  1.00 95.47  ?  760  ILE C CB    1 
ATOM   7585  N  N     . THR D  3  761  ? -122.493 61.973  55.557  1.00 99.48  ?  761  THR C N     1 
ATOM   7586  C  CA    . THR D  3  761  ? -121.728 63.208  55.473  1.00 105.05 ?  761  THR C CA    1 
ATOM   7587  C  C     . THR D  3  761  ? -120.461 62.979  54.661  1.00 104.82 ?  761  THR C C     1 
ATOM   7588  O  O     . THR D  3  761  ? -120.007 61.846  54.481  1.00 116.40 ?  761  THR C O     1 
ATOM   7589  C  CB    . THR D  3  761  ? -121.367 63.742  56.868  1.00 110.49 ?  761  THR C CB    1 
ATOM   7590  O  OG1   . THR D  3  761  ? -120.350 64.744  56.753  1.00 127.24 ?  761  THR C OG1   1 
ATOM   7591  C  CG2   . THR D  3  761  ? -120.870 62.612  57.761  1.00 98.58  ?  761  THR C CG2   1 
ATOM   7592  N  N     . ARG D  3  762  ? -119.889 64.080  54.170  1.00 92.37  ?  762  ARG C N     1 
ATOM   7593  C  CA    . ARG D  3  762  ? -118.677 63.979  53.363  1.00 97.29  ?  762  ARG C CA    1 
ATOM   7594  C  C     . ARG D  3  762  ? -117.484 63.537  54.200  1.00 112.36 ?  762  ARG C C     1 
ATOM   7595  O  O     . ARG D  3  762  ? -116.682 62.707  53.755  1.00 125.80 ?  762  ARG C O     1 
ATOM   7596  C  CB    . ARG D  3  762  ? -118.378 65.315  52.686  1.00 104.53 ?  762  ARG C CB    1 
ATOM   7597  C  CG    . ARG D  3  762  ? -116.941 65.430  52.203  1.00 105.07 ?  762  ARG C CG    1 
ATOM   7598  C  CD    . ARG D  3  762  ? -116.723 66.668  51.355  1.00 103.36 ?  762  ARG C CD    1 
ATOM   7599  N  NE    . ARG D  3  762  ? -115.327 66.797  50.949  1.00 103.07 ?  762  ARG C NE    1 
ATOM   7600  C  CZ    . ARG D  3  762  ? -114.886 67.673  50.053  1.00 125.51 ?  762  ARG C CZ    1 
ATOM   7601  N  NH1   . ARG D  3  762  ? -115.735 68.501  49.458  1.00 114.28 ?  762  ARG C NH1   1 
ATOM   7602  N  NH2   . ARG D  3  762  ? -113.596 67.718  49.748  1.00 134.48 ?  762  ARG C NH2   1 
ATOM   7603  N  N     . ASP D  3  763  ? -117.347 64.078  55.407  1.00 112.09 ?  763  ASP C N     1 
ATOM   7604  C  CA    . ASP D  3  763  ? -116.164 63.816  56.216  1.00 124.38 ?  763  ASP C CA    1 
ATOM   7605  C  C     . ASP D  3  763  ? -116.068 62.335  56.562  1.00 122.89 ?  763  ASP C C     1 
ATOM   7606  O  O     . ASP D  3  763  ? -116.962 61.778  57.207  1.00 124.27 ?  763  ASP C O     1 
ATOM   7607  C  CB    . ASP D  3  763  ? -116.200 64.663  57.486  1.00 121.69 ?  763  ASP C CB    1 
ATOM   7608  C  CG    . ASP D  3  763  ? -114.835 64.799  58.132  1.00 139.65 ?  763  ASP C CG    1 
ATOM   7609  O  OD1   . ASP D  3  763  ? -114.523 65.898  58.639  1.00 138.20 ?  763  ASP C OD1   1 
ATOM   7610  O  OD2   . ASP D  3  763  ? -114.074 63.808  58.131  1.00 144.68 ?  763  ASP C OD2   1 
ATOM   7611  N  N     . ILE D  3  764  ? -114.981 61.702  56.133  1.00 122.36 ?  764  ILE C N     1 
ATOM   7612  C  CA    . ILE D  3  764  ? -114.731 60.292  56.421  1.00 129.20 ?  764  ILE C CA    1 
ATOM   7613  C  C     . ILE D  3  764  ? -113.611 60.207  57.451  1.00 133.53 ?  764  ILE C C     1 
ATOM   7614  O  O     . ILE D  3  764  ? -112.678 61.024  57.417  1.00 137.54 ?  764  ILE C O     1 
ATOM   7615  C  CB    . ILE D  3  764  ? -114.382 59.514  55.143  1.00 125.64 ?  764  ILE C CB    1 
ATOM   7616  C  CG1   . ILE D  3  764  ? -115.446 59.751  54.069  1.00 122.19 ?  764  ILE C CG1   1 
ATOM   7617  C  CG2   . ILE D  3  764  ? -114.246 58.027  55.439  1.00 112.54 ?  764  ILE C CG2   1 
ATOM   7618  C  CD1   . ILE D  3  764  ? -116.850 59.392  54.508  1.00 116.26 ?  764  ILE C CD1   1 
ATOM   7619  N  N     . PRO D  3  765  ? -113.658 59.249  58.382  1.00 127.03 ?  765  PRO C N     1 
ATOM   7620  C  CA    . PRO D  3  765  ? -112.633 59.183  59.433  1.00 128.19 ?  765  PRO C CA    1 
ATOM   7621  C  C     . PRO D  3  765  ? -111.210 59.223  58.898  1.00 122.33 ?  765  PRO C C     1 
ATOM   7622  O  O     . PRO D  3  765  ? -110.550 60.266  58.950  1.00 133.52 ?  765  PRO C O     1 
ATOM   7623  C  CB    . PRO D  3  765  ? -112.933 57.846  60.122  1.00 120.02 ?  765  PRO C CB    1 
ATOM   7624  C  CG    . PRO D  3  765  ? -114.396 57.655  59.921  1.00 121.48 ?  765  PRO C CG    1 
ATOM   7625  C  CD    . PRO D  3  765  ? -114.699 58.220  58.558  1.00 124.37 ?  765  PRO C CD    1 
ATOM   7626  N  N     . ASN D  3  766  ? -110.726 58.098  58.384  1.00 111.72 ?  766  ASN C N     1 
ATOM   7627  C  CA    . ASN D  3  766  ? -109.341 57.963  57.939  1.00 121.05 ?  766  ASN C CA    1 
ATOM   7628  C  C     . ASN D  3  766  ? -109.323 57.907  56.415  1.00 118.15 ?  766  ASN C C     1 
ATOM   7629  O  O     . ASN D  3  766  ? -109.533 56.845  55.822  1.00 119.77 ?  766  ASN C O     1 
ATOM   7630  C  CB    . ASN D  3  766  ? -108.699 56.721  58.551  1.00 134.91 ?  766  ASN C CB    1 
ATOM   7631  C  CG    . ASN D  3  766  ? -108.845 56.676  60.059  1.00 135.73 ?  766  ASN C CG    1 
ATOM   7632  O  OD1   . ASN D  3  766  ? -109.845 56.184  60.583  1.00 119.00 ?  766  ASN C OD1   1 
ATOM   7633  N  ND2   . ASN D  3  766  ? -107.845 57.193  60.766  1.00 135.29 ?  766  ASN C ND2   1 
ATOM   7634  N  N     . VAL D  3  767  ? -109.063 59.052  55.785  1.00 111.45 ?  767  VAL C N     1 
ATOM   7635  C  CA    . VAL D  3  767  ? -109.021 59.143  54.330  1.00 119.84 ?  767  VAL C CA    1 
ATOM   7636  C  C     . VAL D  3  767  ? -108.151 60.331  53.952  1.00 116.73 ?  767  VAL C C     1 
ATOM   7637  O  O     . VAL D  3  767  ? -107.951 61.253  54.745  1.00 114.50 ?  767  VAL C O     1 
ATOM   7638  C  CB    . VAL D  3  767  ? -110.443 59.277  53.728  1.00 112.47 ?  767  VAL C CB    1 
ATOM   7639  C  CG1   . VAL D  3  767  ? -111.167 57.941  53.759  1.00 109.54 ?  767  VAL C CG1   1 
ATOM   7640  C  CG2   . VAL D  3  767  ? -111.235 60.336  54.477  1.00 115.85 ?  767  VAL C CG2   1 
ATOM   7641  N  N     . SER D  3  768  ? -107.630 60.308  52.731  1.00 119.02 ?  768  SER C N     1 
ATOM   7642  C  CA    . SER D  3  768  ? -106.899 61.435  52.176  1.00 123.30 ?  768  SER C CA    1 
ATOM   7643  C  C     . SER D  3  768  ? -107.851 62.361  51.426  1.00 120.08 ?  768  SER C C     1 
ATOM   7644  O  O     . SER D  3  768  ? -108.964 61.982  51.056  1.00 121.02 ?  768  SER C O     1 
ATOM   7645  C  CB    . SER D  3  768  ? -105.788 60.954  51.241  1.00 124.98 ?  768  SER C CB    1 
ATOM   7646  O  OG    . SER D  3  768  ? -105.151 62.049  50.604  1.00 124.98 ?  768  SER C OG    1 
ATOM   7647  N  N     . ASP D  3  769  ? -107.396 63.595  51.204  1.00 123.30 ?  769  ASP C N     1 
ATOM   7648  C  CA    . ASP D  3  769  ? -108.219 64.560  50.483  1.00 124.50 ?  769  ASP C CA    1 
ATOM   7649  C  C     . ASP D  3  769  ? -108.412 64.180  49.020  1.00 130.15 ?  769  ASP C C     1 
ATOM   7650  O  O     . ASP D  3  769  ? -109.342 64.682  48.380  1.00 123.38 ?  769  ASP C O     1 
ATOM   7651  C  CB    . ASP D  3  769  ? -107.603 65.957  50.585  1.00 124.61 ?  769  ASP C CB    1 
ATOM   7652  C  CG    . ASP D  3  769  ? -107.585 66.483  52.009  1.00 117.76 ?  769  ASP C CG    1 
ATOM   7653  O  OD1   . ASP D  3  769  ? -108.339 65.949  52.850  1.00 104.57 ?  769  ASP C OD1   1 
ATOM   7654  O  OD2   . ASP D  3  769  ? -106.823 67.435  52.284  1.00 116.11 ?  769  ASP C OD2   1 
ATOM   7655  N  N     . GLU D  3  770  ? -107.560 63.306  48.480  1.00 129.51 ?  770  GLU C N     1 
ATOM   7656  C  CA    . GLU D  3  770  ? -107.689 62.891  47.087  1.00 122.80 ?  770  GLU C CA    1 
ATOM   7657  C  C     . GLU D  3  770  ? -108.846 61.920  46.896  1.00 115.32 ?  770  GLU C C     1 
ATOM   7658  O  O     . GLU D  3  770  ? -109.597 62.030  45.919  1.00 120.86 ?  770  GLU C O     1 
ATOM   7659  C  CB    . GLU D  3  770  ? -106.384 62.266  46.603  1.00 115.83 ?  770  GLU C CB    1 
ATOM   7660  N  N     . VAL D  3  771  ? -109.012 60.969  47.820  1.00 103.99 ?  771  VAL C N     1 
ATOM   7661  C  CA    . VAL D  3  771  ? -110.102 60.005  47.698  1.00 108.87 ?  771  VAL C CA    1 
ATOM   7662  C  C     . VAL D  3  771  ? -111.450 60.701  47.806  1.00 116.76 ?  771  VAL C C     1 
ATOM   7663  O  O     . VAL D  3  771  ? -112.434 60.268  47.194  1.00 121.57 ?  771  VAL C O     1 
ATOM   7664  C  CB    . VAL D  3  771  ? -109.958 58.891  48.752  1.00 102.45 ?  771  VAL C CB    1 
ATOM   7665  C  CG1   . VAL D  3  771  ? -108.618 58.187  48.602  1.00 119.06 ?  771  VAL C CG1   1 
ATOM   7666  C  CG2   . VAL D  3  771  ? -110.110 59.458  50.151  1.00 112.75 ?  771  VAL C CG2   1 
ATOM   7667  N  N     . LEU D  3  772  ? -111.523 61.779  48.584  1.00 109.08 ?  772  LEU C N     1 
ATOM   7668  C  CA    . LEU D  3  772  ? -112.729 62.588  48.691  1.00 100.86 ?  772  LEU C CA    1 
ATOM   7669  C  C     . LEU D  3  772  ? -112.774 63.708  47.660  1.00 105.89 ?  772  LEU C C     1 
ATOM   7670  O  O     . LEU D  3  772  ? -113.691 64.535  47.698  1.00 105.49 ?  772  LEU C O     1 
ATOM   7671  C  CB    . LEU D  3  772  ? -112.849 63.176  50.101  1.00 106.37 ?  772  LEU C CB    1 
ATOM   7672  C  CG    . LEU D  3  772  ? -113.426 62.277  51.197  1.00 108.30 ?  772  LEU C CG    1 
ATOM   7673  C  CD1   . LEU D  3  772  ? -112.650 60.978  51.307  1.00 108.81 ?  772  LEU C CD1   1 
ATOM   7674  C  CD2   . LEU D  3  772  ? -113.442 63.005  52.533  1.00 108.69 ?  772  LEU C CD2   1 
ATOM   7675  N  N     . ALA D  3  773  ? -111.807 63.752  46.739  1.00 106.25 ?  773  ALA C N     1 
ATOM   7676  C  CA    . ALA D  3  773  ? -111.743 64.851  45.783  1.00 105.49 ?  773  ALA C CA    1 
ATOM   7677  C  C     . ALA D  3  773  ? -112.977 64.903  44.891  1.00 99.78  ?  773  ALA C C     1 
ATOM   7678  O  O     . ALA D  3  773  ? -113.417 65.993  44.507  1.00 96.68  ?  773  ALA C O     1 
ATOM   7679  C  CB    . ALA D  3  773  ? -110.479 64.733  44.931  1.00 106.14 ?  773  ALA C CB    1 
ATOM   7680  N  N     . ASP D  3  774  ? -113.547 63.750  44.550  1.00 97.79  ?  774  ASP C N     1 
ATOM   7681  C  CA    . ASP D  3  774  ? -114.681 63.691  43.638  1.00 93.40  ?  774  ASP C CA    1 
ATOM   7682  C  C     . ASP D  3  774  ? -116.028 63.692  44.349  1.00 99.32  ?  774  ASP C C     1 
ATOM   7683  O  O     . ASP D  3  774  ? -117.060 63.548  43.684  1.00 102.46 ?  774  ASP C O     1 
ATOM   7684  C  CB    . ASP D  3  774  ? -114.573 62.455  42.740  1.00 97.61  ?  774  ASP C CB    1 
ATOM   7685  C  CG    . ASP D  3  774  ? -113.563 62.634  41.621  1.00 107.20 ?  774  ASP C CG    1 
ATOM   7686  O  OD1   . ASP D  3  774  ? -112.641 63.464  41.776  1.00 110.45 ?  774  ASP C OD1   1 
ATOM   7687  O  OD2   . ASP D  3  774  ? -113.691 61.945  40.586  1.00 94.34  ?  774  ASP C OD2   1 
ATOM   7688  N  N     . LEU D  3  775  ? -116.051 63.846  45.668  1.00 101.75 ?  775  LEU C N     1 
ATOM   7689  C  CA    . LEU D  3  775  ? -117.303 63.959  46.401  1.00 94.98  ?  775  LEU C CA    1 
ATOM   7690  C  C     . LEU D  3  775  ? -117.732 65.419  46.498  1.00 101.17 ?  775  LEU C C     1 
ATOM   7691  O  O     . LEU D  3  775  ? -116.904 66.333  46.480  1.00 116.65 ?  775  LEU C O     1 
ATOM   7692  C  CB    . LEU D  3  775  ? -117.172 63.360  47.802  1.00 90.92  ?  775  LEU C CB    1 
ATOM   7693  C  CG    . LEU D  3  775  ? -117.599 61.898  47.948  1.00 90.17  ?  775  LEU C CG    1 
ATOM   7694  C  CD1   . LEU D  3  775  ? -116.911 61.029  46.908  1.00 100.04 ?  775  LEU C CD1   1 
ATOM   7695  C  CD2   . LEU D  3  775  ? -117.306 61.391  49.352  1.00 84.16  ?  775  LEU C CD2   1 
ATOM   7696  N  N     . ASP D  3  776  ? -119.042 65.629  46.598  1.00 92.54  ?  776  ASP C N     1 
ATOM   7697  C  CA    . ASP D  3  776  ? -119.602 66.968  46.685  1.00 101.33 ?  776  ASP C CA    1 
ATOM   7698  C  C     . ASP D  3  776  ? -119.587 67.433  48.141  1.00 105.54 ?  776  ASP C C     1 
ATOM   7699  O  O     . ASP D  3  776  ? -118.964 66.817  49.009  1.00 101.98 ?  776  ASP C O     1 
ATOM   7700  C  CB    . ASP D  3  776  ? -121.008 66.992  46.090  1.00 97.42  ?  776  ASP C CB    1 
ATOM   7701  C  CG    . ASP D  3  776  ? -122.023 66.286  46.967  1.00 99.44  ?  776  ASP C CG    1 
ATOM   7702  O  OD1   . ASP D  3  776  ? -121.617 65.438  47.789  1.00 103.43 ?  776  ASP C OD1   1 
ATOM   7703  O  OD2   . ASP D  3  776  ? -123.230 66.578  46.834  1.00 102.84 ?  776  ASP C OD2   1 
ATOM   7704  N  N     . GLU D  3  777  ? -120.286 68.535  48.423  1.00 109.56 ?  777  GLU C N     1 
ATOM   7705  C  CA    . GLU D  3  777  ? -120.313 69.070  49.780  1.00 103.14 ?  777  GLU C CA    1 
ATOM   7706  C  C     . GLU D  3  777  ? -121.091 68.170  50.729  1.00 98.89  ?  777  GLU C C     1 
ATOM   7707  O  O     . GLU D  3  777  ? -120.762 68.100  51.919  1.00 96.12  ?  777  GLU C O     1 
ATOM   7708  C  CB    . GLU D  3  777  ? -120.892 70.483  49.782  1.00 96.73  ?  777  GLU C CB    1 
ATOM   7709  C  CG    . GLU D  3  777  ? -121.810 70.796  48.603  1.00 101.04 ?  777  GLU C CG    1 
ATOM   7710  C  CD    . GLU D  3  777  ? -123.249 70.400  48.852  1.00 103.32 ?  777  GLU C CD    1 
ATOM   7711  O  OE1   . GLU D  3  777  ? -123.948 70.065  47.873  1.00 99.52  ?  777  GLU C OE1   1 
ATOM   7712  O  OE2   . GLU D  3  777  ? -123.679 70.421  50.025  1.00 113.09 ?  777  GLU C OE2   1 
ATOM   7713  N  N     . ARG D  3  778  ? -122.108 67.466  50.232  1.00 101.23 ?  778  ARG C N     1 
ATOM   7714  C  CA    . ARG D  3  778  ? -122.882 66.598  51.109  1.00 97.40  ?  778  ARG C CA    1 
ATOM   7715  C  C     . ARG D  3  778  ? -122.176 65.271  51.354  1.00 96.00  ?  778  ARG C C     1 
ATOM   7716  O  O     . ARG D  3  778  ? -122.416 64.623  52.379  1.00 108.65 ?  778  ARG C O     1 
ATOM   7717  C  CB    . ARG D  3  778  ? -124.270 66.343  50.514  1.00 98.07  ?  778  ARG C CB    1 
ATOM   7718  C  CG    . ARG D  3  778  ? -125.061 67.600  50.222  1.00 106.75 ?  778  ARG C CG    1 
ATOM   7719  C  CD    . ARG D  3  778  ? -125.634 67.564  48.814  1.00 95.58  ?  778  ARG C CD    1 
ATOM   7720  N  NE    . ARG D  3  778  ? -126.420 66.358  48.572  1.00 82.35  ?  778  ARG C NE    1 
ATOM   7721  C  CZ    . ARG D  3  778  ? -126.855 65.975  47.376  1.00 100.14 ?  778  ARG C CZ    1 
ATOM   7722  N  NH1   . ARG D  3  778  ? -126.578 66.702  46.302  1.00 97.03  ?  778  ARG C NH1   1 
ATOM   7723  N  NH2   . ARG D  3  778  ? -127.564 64.861  47.253  1.00 114.70 ?  778  ARG C NH2   1 
ATOM   7724  N  N     . GLY D  3  779  ? -121.312 64.849  50.430  1.00 100.80 ?  779  GLY C N     1 
ATOM   7725  C  CA    . GLY D  3  779  ? -120.626 63.572  50.523  1.00 98.32  ?  779  GLY C CA    1 
ATOM   7726  C  C     . GLY D  3  779  ? -121.008 62.573  49.454  1.00 95.39  ?  779  GLY C C     1 
ATOM   7727  O  O     . GLY D  3  779  ? -120.554 61.423  49.513  1.00 94.99  ?  779  GLY C O     1 
ATOM   7728  N  N     . ILE D  3  780  ? -121.833 62.965  48.489  1.00 97.61  ?  780  ILE C N     1 
ATOM   7729  C  CA    . ILE D  3  780  ? -122.240 62.095  47.391  1.00 90.20  ?  780  ILE C CA    1 
ATOM   7730  C  C     . ILE D  3  780  ? -121.392 62.422  46.172  1.00 97.39  ?  780  ILE C C     1 
ATOM   7731  O  O     . ILE D  3  780  ? -121.032 63.585  45.943  1.00 108.57 ?  780  ILE C O     1 
ATOM   7732  C  CB    . ILE D  3  780  ? -123.743 62.246  47.083  1.00 97.74  ?  780  ILE C CB    1 
ATOM   7733  C  CG1   . ILE D  3  780  ? -124.042 63.620  46.475  1.00 102.16 ?  780  ILE C CG1   1 
ATOM   7734  C  CG2   . ILE D  3  780  ? -124.570 62.037  48.337  1.00 96.82  ?  780  ILE C CG2   1 
ATOM   7735  C  CD1   . ILE D  3  780  ? -123.946 63.670  44.962  1.00 96.95  ?  780  ILE C CD1   1 
ATOM   7736  N  N     . VAL D  3  781  ? -121.069 61.395  45.383  1.00 91.21  ?  781  VAL C N     1 
ATOM   7737  C  CA    . VAL D  3  781  ? -120.235 61.600  44.206  1.00 91.33  ?  781  VAL C CA    1 
ATOM   7738  C  C     . VAL D  3  781  ? -120.894 62.604  43.271  1.00 95.59  ?  781  VAL C C     1 
ATOM   7739  O  O     . VAL D  3  781  ? -122.105 62.549  43.016  1.00 90.83  ?  781  VAL C O     1 
ATOM   7740  C  CB    . VAL D  3  781  ? -119.972 60.265  43.490  1.00 88.69  ?  781  VAL C CB    1 
ATOM   7741  C  CG1   . VAL D  3  781  ? -121.284 59.580  43.150  1.00 84.00  ?  781  VAL C CG1   1 
ATOM   7742  C  CG2   . VAL D  3  781  ? -119.143 60.492  42.233  1.00 98.14  ?  781  VAL C CG2   1 
ATOM   7743  N  N     . ARG D  3  782  ? -120.093 63.531  42.753  1.00 86.86  ?  782  ARG C N     1 
ATOM   7744  C  CA    . ARG D  3  782  ? -120.611 64.544  41.847  1.00 88.31  ?  782  ARG C CA    1 
ATOM   7745  C  C     . ARG D  3  782  ? -121.001 63.927  40.509  1.00 80.62  ?  782  ARG C C     1 
ATOM   7746  O  O     . ARG D  3  782  ? -120.414 62.940  40.056  1.00 77.52  ?  782  ARG C O     1 
ATOM   7747  C  CB    . ARG D  3  782  ? -119.575 65.648  41.634  1.00 93.27  ?  782  ARG C CB    1 
ATOM   7748  C  CG    . ARG D  3  782  ? -119.421 66.594  42.816  1.00 94.93  ?  782  ARG C CG    1 
ATOM   7749  C  CD    . ARG D  3  782  ? -118.272 67.563  42.593  1.00 88.39  ?  782  ARG C CD    1 
ATOM   7750  N  NE    . ARG D  3  782  ? -116.980 66.953  42.892  1.00 88.01  ?  782  ARG C NE    1 
ATOM   7751  C  CZ    . ARG D  3  782  ? -115.814 67.446  42.493  1.00 91.67  ?  782  ARG C CZ    1 
ATOM   7752  N  NH1   . ARG D  3  782  ? -115.777 68.553  41.765  1.00 98.63  ?  782  ARG C NH1   1 
ATOM   7753  N  NH2   . ARG D  3  782  ? -114.685 66.829  42.813  1.00 102.70 ?  782  ARG C NH2   1 
ATOM   7754  N  N     . ILE D  3  783  ? -122.010 64.527  39.873  1.00 82.70  ?  783  ILE C N     1 
ATOM   7755  C  CA    . ILE D  3  783  ? -122.487 64.022  38.593  1.00 73.15  ?  783  ILE C CA    1 
ATOM   7756  C  C     . ILE D  3  783  ? -121.367 64.091  37.565  1.00 74.66  ?  783  ILE C C     1 
ATOM   7757  O  O     . ILE D  3  783  ? -120.527 65.000  37.587  1.00 89.32  ?  783  ILE C O     1 
ATOM   7758  C  CB    . ILE D  3  783  ? -123.718 64.816  38.125  1.00 75.09  ?  783  ILE C CB    1 
ATOM   7759  C  CG1   . ILE D  3  783  ? -124.751 64.928  39.250  1.00 96.99  ?  783  ILE C CG1   1 
ATOM   7760  C  CG2   . ILE D  3  783  ? -124.337 64.164  36.900  1.00 76.95  ?  783  ILE C CG2   1 
ATOM   7761  C  CD1   . ILE D  3  783  ? -124.491 66.069  40.219  1.00 114.84 ?  783  ILE C CD1   1 
ATOM   7762  N  N     . GLY D  3  784  ? -121.352 63.122  36.652  1.00 72.93  ?  784  GLY C N     1 
ATOM   7763  C  CA    . GLY D  3  784  ? -120.355 63.079  35.603  1.00 75.74  ?  784  GLY C CA    1 
ATOM   7764  C  C     . GLY D  3  784  ? -118.975 62.640  36.034  1.00 77.80  ?  784  GLY C C     1 
ATOM   7765  O  O     . GLY D  3  784  ? -118.047 62.681  35.218  1.00 75.42  ?  784  GLY C O     1 
ATOM   7766  N  N     . ALA D  3  785  ? -118.805 62.220  37.284  1.00 71.78  ?  785  ALA C N     1 
ATOM   7767  C  CA    . ALA D  3  785  ? -117.497 61.815  37.774  1.00 80.80  ?  785  ALA C CA    1 
ATOM   7768  C  C     . ALA D  3  785  ? -117.200 60.365  37.406  1.00 84.71  ?  785  ALA C C     1 
ATOM   7769  O  O     . ALA D  3  785  ? -118.090 59.510  37.383  1.00 82.29  ?  785  ALA C O     1 
ATOM   7770  C  CB    . ALA D  3  785  ? -117.412 61.996  39.289  1.00 86.36  ?  785  ALA C CB    1 
ATOM   7771  N  N     . GLU D  3  786  ? -115.931 60.097  37.113  1.00 80.28  ?  786  GLU C N     1 
ATOM   7772  C  CA    . GLU D  3  786  ? -115.471 58.751  36.804  1.00 74.56  ?  786  GLU C CA    1 
ATOM   7773  C  C     . GLU D  3  786  ? -115.108 58.035  38.098  1.00 82.75  ?  786  GLU C C     1 
ATOM   7774  O  O     . GLU D  3  786  ? -114.361 58.572  38.923  1.00 102.14 ?  786  GLU C O     1 
ATOM   7775  C  CB    . GLU D  3  786  ? -114.271 58.800  35.857  1.00 98.46  ?  786  GLU C CB    1 
ATOM   7776  C  CG    . GLU D  3  786  ? -113.729 57.440  35.448  1.00 104.11 ?  786  GLU C CG    1 
ATOM   7777  C  CD    . GLU D  3  786  ? -112.677 57.538  34.359  1.00 117.52 ?  786  GLU C CD    1 
ATOM   7778  O  OE1   . GLU D  3  786  ? -112.681 58.543  33.615  1.00 112.00 ?  786  GLU C OE1   1 
ATOM   7779  O  OE2   . GLU D  3  786  ? -111.844 56.613  34.248  1.00 125.68 ?  786  GLU C OE2   1 
ATOM   7780  N  N     . VAL D  3  787  ? -115.639 56.828  38.276  1.00 83.74  ?  787  VAL C N     1 
ATOM   7781  C  CA    . VAL D  3  787  ? -115.479 56.068  39.512  1.00 78.83  ?  787  VAL C CA    1 
ATOM   7782  C  C     . VAL D  3  787  ? -114.810 54.741  39.185  1.00 86.45  ?  787  VAL C C     1 
ATOM   7783  O  O     . VAL D  3  787  ? -115.306 53.977  38.346  1.00 75.55  ?  787  VAL C O     1 
ATOM   7784  C  CB    . VAL D  3  787  ? -116.823 55.844  40.220  1.00 71.17  ?  787  VAL C CB    1 
ATOM   7785  C  CG1   . VAL D  3  787  ? -117.404 57.173  40.677  1.00 78.04  ?  787  VAL C CG1   1 
ATOM   7786  C  CG2   . VAL D  3  787  ? -117.794 55.127  39.298  1.00 77.26  ?  787  VAL C CG2   1 
ATOM   7787  N  N     . ARG D  3  788  ? -113.691 54.469  39.847  1.00 102.23 ?  788  ARG C N     1 
ATOM   7788  C  CA    . ARG D  3  788  ? -112.973 53.211  39.716  1.00 100.75 ?  788  ARG C CA    1 
ATOM   7789  C  C     . ARG D  3  788  ? -113.351 52.270  40.856  1.00 94.24  ?  788  ARG C C     1 
ATOM   7790  O  O     . ARG D  3  788  ? -114.041 52.646  41.806  1.00 92.39  ?  788  ARG C O     1 
ATOM   7791  C  CB    . ARG D  3  788  ? -111.460 53.451  39.702  1.00 122.03 ?  788  ARG C CB    1 
ATOM   7792  C  CG    . ARG D  3  788  ? -110.782 53.106  38.386  1.00 130.59 ?  788  ARG C CG    1 
ATOM   7793  C  CD    . ARG D  3  788  ? -109.270 53.091  38.540  1.00 137.42 ?  788  ARG C CD    1 
ATOM   7794  N  NE    . ARG D  3  788  ? -108.860 52.335  39.721  1.00 142.90 ?  788  ARG C NE    1 
ATOM   7795  C  CZ    . ARG D  3  788  ? -108.845 51.007  39.793  1.00 123.45 ?  788  ARG C CZ    1 
ATOM   7796  N  NH1   . ARG D  3  788  ? -109.220 50.278  38.750  1.00 118.67 ?  788  ARG C NH1   1 
ATOM   7797  N  NH2   . ARG D  3  788  ? -108.458 50.407  40.910  1.00 113.04 ?  788  ARG C NH2   1 
ATOM   7798  N  N     . ASP D  3  789  ? -112.877 51.031  40.753  1.00 103.04 ?  789  ASP C N     1 
ATOM   7799  C  CA    . ASP D  3  789  ? -113.176 50.026  41.766  1.00 101.73 ?  789  ASP C CA    1 
ATOM   7800  C  C     . ASP D  3  789  ? -112.665 50.473  43.129  1.00 99.52  ?  789  ASP C C     1 
ATOM   7801  O  O     . ASP D  3  789  ? -111.461 50.675  43.316  1.00 119.54 ?  789  ASP C O     1 
ATOM   7802  C  CB    . ASP D  3  789  ? -112.557 48.685  41.375  1.00 102.05 ?  789  ASP C CB    1 
ATOM   7803  N  N     . GLY D  3  790  ? -113.581 50.625  44.083  1.00 85.54  ?  790  GLY C N     1 
ATOM   7804  C  CA    . GLY D  3  790  ? -113.239 51.022  45.431  1.00 91.01  ?  790  GLY C CA    1 
ATOM   7805  C  C     . GLY D  3  790  ? -113.488 52.479  45.755  1.00 95.14  ?  790  GLY C C     1 
ATOM   7806  O  O     . GLY D  3  790  ? -113.475 52.842  46.938  1.00 102.51 ?  790  GLY C O     1 
ATOM   7807  N  N     . ASP D  3  791  ? -113.715 53.322  44.751  1.00 89.17  ?  791  ASP C N     1 
ATOM   7808  C  CA    . ASP D  3  791  ? -113.954 54.735  45.003  1.00 91.49  ?  791  ASP C CA    1 
ATOM   7809  C  C     . ASP D  3  791  ? -115.259 54.936  45.768  1.00 89.38  ?  791  ASP C C     1 
ATOM   7810  O  O     . ASP D  3  791  ? -116.178 54.115  45.704  1.00 88.21  ?  791  ASP C O     1 
ATOM   7811  C  CB    . ASP D  3  791  ? -113.986 55.516  43.689  1.00 90.13  ?  791  ASP C CB    1 
ATOM   7812  C  CG    . ASP D  3  791  ? -112.634 55.553  42.998  1.00 93.82  ?  791  ASP C CG    1 
ATOM   7813  O  OD1   . ASP D  3  791  ? -111.614 55.278  43.665  1.00 102.63 ?  791  ASP C OD1   1 
ATOM   7814  O  OD2   . ASP D  3  791  ? -112.590 55.864  41.789  1.00 93.82  -1 791  ASP C OD2   1 
ATOM   7815  N  N     . ILE D  3  792  ? -115.332 56.047  46.496  1.00 90.72  ?  792  ILE C N     1 
ATOM   7816  C  CA    . ILE D  3  792  ? -116.485 56.336  47.343  1.00 82.25  ?  792  ILE C CA    1 
ATOM   7817  C  C     . ILE D  3  792  ? -117.578 56.983  46.504  1.00 80.84  ?  792  ILE C C     1 
ATOM   7818  O  O     . ILE D  3  792  ? -117.324 57.933  45.755  1.00 81.83  ?  792  ILE C O     1 
ATOM   7819  C  CB    . ILE D  3  792  ? -116.088 57.244  48.519  1.00 84.17  ?  792  ILE C CB    1 
ATOM   7820  C  CG1   . ILE D  3  792  ? -114.850 56.704  49.240  1.00 83.92  ?  792  ILE C CG1   1 
ATOM   7821  C  CG2   . ILE D  3  792  ? -117.252 57.397  49.489  1.00 80.59  ?  792  ILE C CG2   1 
ATOM   7822  C  CD1   . ILE D  3  792  ? -113.539 57.123  48.605  1.00 101.97 ?  792  ILE C CD1   1 
ATOM   7823  N  N     . LEU D  3  793  ? -118.800 56.470  46.632  1.00 82.27  ?  793  LEU C N     1 
ATOM   7824  C  CA    . LEU D  3  793  ? -119.972 57.064  46.000  1.00 84.31  ?  793  LEU C CA    1 
ATOM   7825  C  C     . LEU D  3  793  ? -120.754 57.949  46.961  1.00 90.98  ?  793  LEU C C     1 
ATOM   7826  O  O     . LEU D  3  793  ? -121.111 59.079  46.614  1.00 95.54  ?  793  LEU C O     1 
ATOM   7827  C  CB    . LEU D  3  793  ? -120.891 55.969  45.443  1.00 93.45  ?  793  LEU C CB    1 
ATOM   7828  C  CG    . LEU D  3  793  ? -120.350 55.125  44.288  1.00 87.98  ?  793  LEU C CG    1 
ATOM   7829  C  CD1   . LEU D  3  793  ? -121.391 54.110  43.845  1.00 79.47  ?  793  LEU C CD1   1 
ATOM   7830  C  CD2   . LEU D  3  793  ? -119.930 56.010  43.126  1.00 92.55  ?  793  LEU C CD2   1 
ATOM   7831  N  N     . VAL D  3  794  ? -121.026 57.453  48.166  1.00 96.60  ?  794  VAL C N     1 
ATOM   7832  C  CA    . VAL D  3  794  ? -121.736 58.202  49.194  1.00 104.29 ?  794  VAL C CA    1 
ATOM   7833  C  C     . VAL D  3  794  ? -121.011 58.003  50.516  1.00 99.76  ?  794  VAL C C     1 
ATOM   7834  O  O     . VAL D  3  794  ? -120.713 56.866  50.901  1.00 97.00  ?  794  VAL C O     1 
ATOM   7835  C  CB    . VAL D  3  794  ? -123.208 57.762  49.313  1.00 100.34 ?  794  VAL C CB    1 
ATOM   7836  C  CG1   . VAL D  3  794  ? -123.919 58.572  50.386  1.00 90.04  ?  794  VAL C CG1   1 
ATOM   7837  C  CG2   . VAL D  3  794  ? -123.915 57.904  47.975  1.00 100.99 ?  794  VAL C CG2   1 
ATOM   7838  N  N     . GLY D  3  795  ? -120.724 59.104  51.205  1.00 89.76  ?  795  GLY C N     1 
ATOM   7839  C  CA    . GLY D  3  795  ? -120.086 59.035  52.503  1.00 99.22  ?  795  GLY C CA    1 
ATOM   7840  C  C     . GLY D  3  795  ? -121.086 59.006  53.641  1.00 108.71 ?  795  GLY C C     1 
ATOM   7841  O  O     . GLY D  3  795  ? -121.699 60.028  53.966  1.00 110.19 ?  795  GLY C O     1 
ATOM   7842  N  N     . LYS D  3  796  ? -121.270 57.839  54.247  1.00 111.10 ?  796  LYS C N     1 
ATOM   7843  C  CA    . LYS D  3  796  ? -122.172 57.673  55.376  1.00 109.37 ?  796  LYS C CA    1 
ATOM   7844  C  C     . LYS D  3  796  ? -121.367 57.380  56.634  1.00 116.54 ?  796  LYS C C     1 
ATOM   7845  O  O     . LYS D  3  796  ? -120.330 56.712  56.580  1.00 119.44 ?  796  LYS C O     1 
ATOM   7846  C  CB    . LYS D  3  796  ? -123.178 56.547  55.121  1.00 101.40 ?  796  LYS C CB    1 
ATOM   7847  C  CG    . LYS D  3  796  ? -123.997 56.162  56.341  1.00 102.95 ?  796  LYS C CG    1 
ATOM   7848  C  CD    . LYS D  3  796  ? -124.988 55.057  56.022  1.00 104.65 ?  796  LYS C CD    1 
ATOM   7849  C  CE    . LYS D  3  796  ? -125.806 54.685  57.249  1.00 117.90 ?  796  LYS C CE    1 
ATOM   7850  N  NZ    . LYS D  3  796  ? -126.880 53.702  56.932  1.00 106.43 ?  796  LYS C NZ    1 
ATOM   7851  N  N     . VAL D  3  797  ? -121.848 57.888  57.765  1.00 112.04 ?  797  VAL C N     1 
ATOM   7852  C  CA    . VAL D  3  797  ? -121.195 57.700  59.053  1.00 114.41 ?  797  VAL C CA    1 
ATOM   7853  C  C     . VAL D  3  797  ? -122.256 57.321  60.075  1.00 121.93 ?  797  VAL C C     1 
ATOM   7854  O  O     . VAL D  3  797  ? -123.320 57.949  60.135  1.00 114.92 ?  797  VAL C O     1 
ATOM   7855  C  CB    . VAL D  3  797  ? -120.435 58.963  59.498  1.00 108.94 ?  797  VAL C CB    1 
ATOM   7856  C  CG1   . VAL D  3  797  ? -119.555 58.655  60.693  1.00 125.41 ?  797  VAL C CG1   1 
ATOM   7857  C  CG2   . VAL D  3  797  ? -119.607 59.516  58.348  1.00 96.97  ?  797  VAL C CG2   1 
ATOM   7858  N  N     . THR D  3  798  ? -121.972 56.294  60.869  1.00 128.92 ?  798  THR C N     1 
ATOM   7859  C  CA    . THR D  3  798  ? -122.883 55.821  61.897  1.00 134.51 ?  798  THR C CA    1 
ATOM   7860  C  C     . THR D  3  798  ? -122.174 55.785  63.241  1.00 136.48 ?  798  THR C C     1 
ATOM   7861  O  O     . THR D  3  798  ? -120.953 55.606  63.302  1.00 131.12 ?  798  THR C O     1 
ATOM   7862  C  CB    . THR D  3  798  ? -123.426 54.423  61.566  1.00 129.38 ?  798  THR C CB    1 
ATOM   7863  O  OG1   . THR D  3  798  ? -122.335 53.520  61.350  1.00 128.17 ?  798  THR C OG1   1 
ATOM   7864  C  CG2   . THR D  3  798  ? -124.294 54.472  60.317  1.00 119.68 ?  798  THR C CG2   1 
ATOM   7865  N  N     . PRO D  3  799  ? -122.915 55.950  64.335  1.00 136.81 ?  799  PRO C N     1 
ATOM   7866  C  CA    . PRO D  3  799  ? -122.274 56.014  65.653  1.00 140.54 ?  799  PRO C CA    1 
ATOM   7867  C  C     . PRO D  3  799  ? -121.621 54.693  66.030  1.00 145.46 ?  799  PRO C C     1 
ATOM   7868  O  O     . PRO D  3  799  ? -122.171 53.614  65.795  1.00 142.31 ?  799  PRO C O     1 
ATOM   7869  C  CB    . PRO D  3  799  ? -123.434 56.356  66.595  1.00 131.51 ?  799  PRO C CB    1 
ATOM   7870  C  CG    . PRO D  3  799  ? -124.652 55.867  65.882  1.00 120.52 ?  799  PRO C CG    1 
ATOM   7871  C  CD    . PRO D  3  799  ? -124.380 56.084  64.422  1.00 124.44 ?  799  PRO C CD    1 
ATOM   7872  N  N     . LYS D  3  800  ? -120.432 54.791  66.620  1.00 147.66 ?  800  LYS C N     1 
ATOM   7873  C  CA    . LYS D  3  800  ? -119.709 53.643  67.146  1.00 142.57 ?  800  LYS C CA    1 
ATOM   7874  C  C     . LYS D  3  800  ? -119.693 53.710  68.667  1.00 156.20 ?  800  LYS C C     1 
ATOM   7875  O  O     . LYS D  3  800  ? -119.515 54.786  69.248  1.00 156.98 ?  800  LYS C O     1 
ATOM   7876  C  CB    . LYS D  3  800  ? -118.277 53.594  66.605  1.00 114.12 ?  800  LYS C CB    1 
ATOM   7877  N  N     . GLY D  3  801  ? -119.882 52.558  69.307  1.00 142.38 ?  801  GLY C N     1 
ATOM   7878  C  CA    . GLY D  3  801  ? -119.950 52.498  70.755  1.00 139.22 ?  801  GLY C CA    1 
ATOM   7879  C  C     . GLY D  3  801  ? -118.659 52.883  71.446  1.00 148.14 ?  801  GLY C C     1 
ATOM   7880  O  O     . GLY D  3  801  ? -117.852 53.638  70.896  1.00 151.92 ?  801  GLY C O     1 
ATOM   7881  N  N     . GLU D  3  802  ? -118.457 52.375  72.660  1.00 142.30 ?  802  GLU C N     1 
ATOM   7882  C  CA    . GLU D  3  802  ? -117.231 52.646  73.398  1.00 141.40 ?  802  GLU C CA    1 
ATOM   7883  C  C     . GLU D  3  802  ? -116.017 52.292  72.553  1.00 142.03 ?  802  GLU C C     1 
ATOM   7884  O  O     . GLU D  3  802  ? -115.819 51.129  72.189  1.00 134.56 ?  802  GLU C O     1 
ATOM   7885  C  CB    . GLU D  3  802  ? -117.222 51.857  74.709  1.00 144.78 ?  802  GLU C CB    1 
ATOM   7886  N  N     . THR D  3  803  ? -115.208 53.305  72.239  1.00 140.67 ?  803  THR C N     1 
ATOM   7887  C  CA    . THR D  3  803  ? -114.067 53.110  71.352  1.00 131.69 ?  803  THR C CA    1 
ATOM   7888  C  C     . THR D  3  803  ? -113.177 51.971  71.839  1.00 126.89 ?  803  THR C C     1 
ATOM   7889  O  O     . THR D  3  803  ? -112.980 50.972  71.138  1.00 118.68 ?  803  THR C O     1 
ATOM   7890  C  CB    . THR D  3  803  ? -113.266 54.409  71.237  1.00 121.66 ?  803  THR C CB    1 
ATOM   7891  O  OG1   . THR D  3  803  ? -112.555 54.643  72.459  1.00 127.99 ?  803  THR C OG1   1 
ATOM   7892  C  CG2   . THR D  3  803  ? -114.196 55.583  70.969  1.00 101.03 ?  803  THR C CG2   1 
ATOM   7893  N  N     . GLU D  3  804  ? -112.639 52.105  73.050  1.00 125.85 ?  804  GLU C N     1 
ATOM   7894  C  CA    . GLU D  3  804  ? -111.698 51.132  73.602  1.00 126.21 ?  804  GLU C CA    1 
ATOM   7895  C  C     . GLU D  3  804  ? -110.607 50.808  72.583  1.00 125.12 ?  804  GLU C C     1 
ATOM   7896  O  O     . GLU D  3  804  ? -110.325 49.648  72.274  1.00 124.31 ?  804  GLU C O     1 
ATOM   7897  C  CB    . GLU D  3  804  ? -112.423 49.866  74.060  1.00 128.86 ?  804  GLU C CB    1 
ATOM   7898  C  CG    . GLU D  3  804  ? -111.521 48.861  74.757  1.00 139.56 ?  804  GLU C CG    1 
ATOM   7899  C  CD    . GLU D  3  804  ? -110.798 49.460  75.947  1.00 130.88 ?  804  GLU C CD    1 
ATOM   7900  O  OE1   . GLU D  3  804  ? -111.448 50.169  76.743  1.00 118.65 ?  804  GLU C OE1   1 
ATOM   7901  O  OE2   . GLU D  3  804  ? -109.578 49.230  76.081  1.00 145.74 -1 804  GLU C OE2   1 
ATOM   7902  N  N     . LEU D  3  805  ? -109.993 51.862  72.053  1.00 126.06 ?  805  LEU C N     1 
ATOM   7903  C  CA    . LEU D  3  805  ? -109.012 51.716  70.991  1.00 110.95 ?  805  LEU C CA    1 
ATOM   7904  C  C     . LEU D  3  805  ? -107.760 51.006  71.502  1.00 106.61 ?  805  LEU C C     1 
ATOM   7905  O  O     . LEU D  3  805  ? -107.560 50.811  72.705  1.00 98.76  ?  805  LEU C O     1 
ATOM   7906  C  CB    . LEU D  3  805  ? -108.648 53.081  70.410  1.00 102.03 ?  805  LEU C CB    1 
ATOM   7907  C  CG    . LEU D  3  805  ? -109.202 53.385  69.018  1.00 103.48 ?  805  LEU C CG    1 
ATOM   7908  C  CD1   . LEU D  3  805  ? -108.502 52.532  67.968  1.00 92.01  ?  805  LEU C CD1   1 
ATOM   7909  C  CD2   . LEU D  3  805  ? -110.707 53.168  68.984  1.00 123.98 ?  805  LEU C CD2   1 
ATOM   7910  N  N     . THR D  3  806  ? -106.911 50.615  70.554  1.00 104.79 ?  806  THR C N     1 
ATOM   7911  C  CA    . THR D  3  806  ? -105.647 49.969  70.874  1.00 102.81 ?  806  THR C CA    1 
ATOM   7912  C  C     . THR D  3  806  ? -104.606 51.020  71.257  1.00 93.68  ?  806  THR C C     1 
ATOM   7913  O  O     . THR D  3  806  ? -104.513 52.066  70.610  1.00 93.20  ?  806  THR C O     1 
ATOM   7914  C  CB    . THR D  3  806  ? -105.141 49.152  69.687  1.00 98.66  ?  806  THR C CB    1 
ATOM   7915  O  OG1   . THR D  3  806  ? -104.885 50.026  68.579  1.00 92.28  ?  806  THR C OG1   1 
ATOM   7916  C  CG2   . THR D  3  806  ? -106.177 48.118  69.276  1.00 113.39 ?  806  THR C CG2   1 
ATOM   7917  N  N     . PRO D  3  807  ? -103.814 50.767  72.301  1.00 77.55  ?  807  PRO C N     1 
ATOM   7918  C  CA    . PRO D  3  807  ? -102.789 51.754  72.679  1.00 88.42  ?  807  PRO C CA    1 
ATOM   7919  C  C     . PRO D  3  807  ? -101.814 52.055  71.556  1.00 93.32  ?  807  PRO C C     1 
ATOM   7920  O  O     . PRO D  3  807  ? -101.443 53.219  71.357  1.00 87.47  ?  807  PRO C O     1 
ATOM   7921  C  CB    . PRO D  3  807  ? -102.100 51.095  73.884  1.00 82.93  ?  807  PRO C CB    1 
ATOM   7922  C  CG    . PRO D  3  807  ? -102.391 49.637  73.743  1.00 92.55  ?  807  PRO C CG    1 
ATOM   7923  C  CD    . PRO D  3  807  ? -103.758 49.558  73.137  1.00 88.62  ?  807  PRO C CD    1 
ATOM   7924  N  N     . GLU D  3  808  ? -101.391 51.033  70.806  1.00 99.33  ?  808  GLU C N     1 
ATOM   7925  C  CA    . GLU D  3  808  ? -100.483 51.264  69.687  1.00 94.51  ?  808  GLU C CA    1 
ATOM   7926  C  C     . GLU D  3  808  ? -101.070 52.251  68.686  1.00 93.50  ?  808  GLU C C     1 
ATOM   7927  O  O     . GLU D  3  808  ? -100.323 52.918  67.961  1.00 97.88  ?  808  GLU C O     1 
ATOM   7928  C  CB    . GLU D  3  808  ? -100.145 49.942  68.994  1.00 89.19  ?  808  GLU C CB    1 
ATOM   7929  C  CG    . GLU D  3  808  ? -99.373  48.951  69.858  1.00 80.91  ?  808  GLU C CG    1 
ATOM   7930  C  CD    . GLU D  3  808  ? -100.243 48.286  70.910  1.00 102.52 ?  808  GLU C CD    1 
ATOM   7931  O  OE1   . GLU D  3  808  ? -101.478 48.480  70.873  1.00 100.76 ?  808  GLU C OE1   1 
ATOM   7932  O  OE2   . GLU D  3  808  ? -99.693  47.570  71.775  1.00 105.21 -1 808  GLU C OE2   1 
ATOM   7933  N  N     . GLU D  3  809  ? -102.398 52.358  68.629  1.00 89.23  ?  809  GLU C N     1 
ATOM   7934  C  CA    . GLU D  3  809  ? -103.052 53.334  67.767  1.00 94.72  ?  809  GLU C CA    1 
ATOM   7935  C  C     . GLU D  3  809  ? -103.190 54.691  68.442  1.00 103.35 ?  809  GLU C C     1 
ATOM   7936  O  O     . GLU D  3  809  ? -103.077 55.727  67.778  1.00 109.90 ?  809  GLU C O     1 
ATOM   7937  C  CB    . GLU D  3  809  ? -104.431 52.824  67.340  1.00 95.86  ?  809  GLU C CB    1 
ATOM   7938  N  N     . ARG D  3  810  ? -103.432 54.706  69.755  1.00 97.38  ?  810  ARG C N     1 
ATOM   7939  C  CA    . ARG D  3  810  ? -103.550 55.974  70.466  1.00 94.87  ?  810  ARG C CA    1 
ATOM   7940  C  C     . ARG D  3  810  ? -102.236 56.743  70.442  1.00 101.60 ?  810  ARG C C     1 
ATOM   7941  O  O     . ARG D  3  810  ? -102.231 57.975  70.333  1.00 99.36  ?  810  ARG C O     1 
ATOM   7942  C  CB    . ARG D  3  810  ? -104.007 55.730  71.904  1.00 85.95  ?  810  ARG C CB    1 
ATOM   7943  N  N     . LEU D  3  811  ? -101.109 56.034  70.540  1.00 102.11 ?  811  LEU C N     1 
ATOM   7944  C  CA    . LEU D  3  811  ? -99.811  56.703  70.510  1.00 88.72  ?  811  LEU C CA    1 
ATOM   7945  C  C     . LEU D  3  811  ? -99.631  57.487  69.217  1.00 93.68  ?  811  LEU C C     1 
ATOM   7946  O  O     . LEU D  3  811  ? -99.282  58.673  69.240  1.00 100.02 ?  811  LEU C O     1 
ATOM   7947  C  CB    . LEU D  3  811  ? -98.688  55.682  70.687  1.00 95.21  ?  811  LEU C CB    1 
ATOM   7948  C  CG    . LEU D  3  811  ? -97.274  56.260  70.610  1.00 86.79  ?  811  LEU C CG    1 
ATOM   7949  C  CD1   . LEU D  3  811  ? -97.138  57.448  71.544  1.00 82.14  ?  811  LEU C CD1   1 
ATOM   7950  C  CD2   . LEU D  3  811  ? -96.237  55.195  70.940  1.00 85.79  ?  811  LEU C CD2   1 
ATOM   7951  N  N     . LEU D  3  812  ? -99.864  56.839  68.072  1.00 97.87  ?  812  LEU C N     1 
ATOM   7952  C  CA    . LEU D  3  812  ? -99.815  57.559  66.804  1.00 104.03 ?  812  LEU C CA    1 
ATOM   7953  C  C     . LEU D  3  812  ? -100.846 58.679  66.760  1.00 107.72 ?  812  LEU C C     1 
ATOM   7954  O  O     . LEU D  3  812  ? -100.642 59.683  66.068  1.00 111.06 ?  812  LEU C O     1 
ATOM   7955  C  CB    . LEU D  3  812  ? -100.028 56.596  65.635  1.00 95.11  ?  812  LEU C CB    1 
ATOM   7956  C  CG    . LEU D  3  812  ? -98.817  55.778  65.180  1.00 98.55  ?  812  LEU C CG    1 
ATOM   7957  C  CD1   . LEU D  3  812  ? -98.332  54.860  66.293  1.00 96.23  ?  812  LEU C CD1   1 
ATOM   7958  C  CD2   . LEU D  3  812  ? -99.152  54.980  63.929  1.00 109.60 ?  812  LEU C CD2   1 
ATOM   7959  N  N     . ARG D  3  813  ? -101.956 58.526  67.485  1.00 99.86  ?  813  ARG C N     1 
ATOM   7960  C  CA    . ARG D  3  813  ? -102.952 59.591  67.545  1.00 118.66 ?  813  ARG C CA    1 
ATOM   7961  C  C     . ARG D  3  813  ? -102.339 60.882  68.074  1.00 113.80 ?  813  ARG C C     1 
ATOM   7962  O  O     . ARG D  3  813  ? -102.459 61.944  67.451  1.00 104.63 ?  813  ARG C O     1 
ATOM   7963  C  CB    . ARG D  3  813  ? -104.130 59.157  68.419  1.00 110.96 ?  813  ARG C CB    1 
ATOM   7964  C  CG    . ARG D  3  813  ? -104.939 58.006  67.849  1.00 106.69 ?  813  ARG C CG    1 
ATOM   7965  C  CD    . ARG D  3  813  ? -105.575 58.388  66.523  1.00 123.10 ?  813  ARG C CD    1 
ATOM   7966  N  NE    . ARG D  3  813  ? -106.469 57.347  66.024  1.00 140.15 ?  813  ARG C NE    1 
ATOM   7967  C  CZ    . ARG D  3  813  ? -107.158 57.433  64.890  1.00 140.64 ?  813  ARG C CZ    1 
ATOM   7968  N  NH1   . ARG D  3  813  ? -107.058 58.517  64.132  1.00 133.72 1  813  ARG C NH1   1 
ATOM   7969  N  NH2   . ARG D  3  813  ? -107.948 56.436  64.515  1.00 142.22 ?  813  ARG C NH2   1 
ATOM   7970  N  N     . ALA D  3  814  ? -101.672 60.808  69.226  1.00 108.14 ?  814  ALA C N     1 
ATOM   7971  C  CA    . ALA D  3  814  ? -101.058 62.000  69.800  1.00 105.38 ?  814  ALA C CA    1 
ATOM   7972  C  C     . ALA D  3  814  ? -99.859  62.456  68.978  1.00 102.25 ?  814  ALA C C     1 
ATOM   7973  O  O     . ALA D  3  814  ? -99.626  63.661  68.828  1.00 106.13 ?  814  ALA C O     1 
ATOM   7974  C  CB    . ALA D  3  814  ? -100.648 61.733  71.248  1.00 110.44 ?  814  ALA C CB    1 
ATOM   7975  N  N     . ILE D  3  815  ? -99.089  61.510  68.438  1.00 92.83  ?  815  ILE C N     1 
ATOM   7976  C  CA    . ILE D  3  815  ? -97.894  61.863  67.675  1.00 92.27  ?  815  ILE C CA    1 
ATOM   7977  C  C     . ILE D  3  815  ? -98.259  62.783  66.517  1.00 99.02  ?  815  ILE C C     1 
ATOM   7978  O  O     . ILE D  3  815  ? -97.731  63.893  66.388  1.00 109.48 ?  815  ILE C O     1 
ATOM   7979  C  CB    . ILE D  3  815  ? -97.173  60.597  67.180  1.00 99.08  ?  815  ILE C CB    1 
ATOM   7980  C  CG1   . ILE D  3  815  ? -96.625  59.796  68.363  1.00 99.51  ?  815  ILE C CG1   1 
ATOM   7981  C  CG2   . ILE D  3  815  ? -96.056  60.962  66.213  1.00 104.80 ?  815  ILE C CG2   1 
ATOM   7982  C  CD1   . ILE D  3  815  ? -95.864  58.551  67.958  1.00 92.72  ?  815  ILE C CD1   1 
ATOM   7983  N  N     . PHE D  3  816  ? -99.172  62.334  65.660  1.00 103.07 ?  816  PHE C N     1 
ATOM   7984  C  CA    . PHE D  3  816  ? -99.585  63.107  64.497  1.00 114.06 ?  816  PHE C CA    1 
ATOM   7985  C  C     . PHE D  3  816  ? -100.772 64.019  64.779  1.00 117.62 ?  816  PHE C C     1 
ATOM   7986  O  O     . PHE D  3  816  ? -101.266 64.672  63.854  1.00 118.85 ?  816  PHE C O     1 
ATOM   7987  C  CB    . PHE D  3  816  ? -99.910  62.167  63.332  1.00 111.98 ?  816  PHE C CB    1 
ATOM   7988  C  CG    . PHE D  3  816  ? -98.716  61.417  62.814  1.00 125.35 ?  816  PHE C CG    1 
ATOM   7989  C  CD1   . PHE D  3  816  ? -98.385  60.173  63.325  1.00 115.69 ?  816  PHE C CD1   1 
ATOM   7990  C  CD2   . PHE D  3  816  ? -97.916  61.963  61.823  1.00 135.62 ?  816  PHE C CD2   1 
ATOM   7991  C  CE1   . PHE D  3  816  ? -97.283  59.484  62.852  1.00 122.69 ?  816  PHE C CE1   1 
ATOM   7992  C  CE2   . PHE D  3  816  ? -96.813  61.279  61.347  1.00 135.80 ?  816  PHE C CE2   1 
ATOM   7993  C  CZ    . PHE D  3  816  ? -96.497  60.038  61.862  1.00 134.42 ?  816  PHE C CZ    1 
ATOM   7994  N  N     . GLY D  3  817  ? -101.236 64.081  66.024  1.00 113.12 ?  817  GLY C N     1 
ATOM   7995  C  CA    . GLY D  3  817  ? -102.276 65.028  66.388  1.00 114.83 ?  817  GLY C CA    1 
ATOM   7996  C  C     . GLY D  3  817  ? -103.587 64.842  65.659  1.00 118.12 ?  817  GLY C C     1 
ATOM   7997  O  O     . GLY D  3  817  ? -104.282 65.827  65.388  1.00 117.93 ?  817  GLY C O     1 
ATOM   7998  N  N     . GLU D  3  818  ? -103.948 63.603  65.330  1.00 118.59 ?  818  GLU C N     1 
ATOM   7999  C  CA    . GLU D  3  818  ? -105.239 63.295  64.725  1.00 117.29 ?  818  GLU C CA    1 
ATOM   8000  C  C     . GLU D  3  818  ? -106.153 62.732  65.807  1.00 116.00 ?  818  GLU C C     1 
ATOM   8001  O  O     . GLU D  3  818  ? -105.965 61.599  66.261  1.00 114.12 ?  818  GLU C O     1 
ATOM   8002  C  CB    . GLU D  3  818  ? -105.089 62.312  63.566  1.00 118.79 ?  818  GLU C CB    1 
ATOM   8003  C  CG    . GLU D  3  818  ? -104.518 62.924  62.298  1.00 125.86 ?  818  GLU C CG    1 
ATOM   8004  C  CD    . GLU D  3  818  ? -104.637 61.998  61.102  1.00 136.44 ?  818  GLU C CD    1 
ATOM   8005  O  OE1   . GLU D  3  818  ? -105.068 60.840  61.286  1.00 141.77 ?  818  GLU C OE1   1 
ATOM   8006  O  OE2   . GLU D  3  818  ? -104.304 62.430  59.979  1.00 145.00 ?  818  GLU C OE2   1 
ATOM   8007  N  N     . LYS D  3  819  ? -107.138 63.526  66.219  1.00 115.25 ?  819  LYS C N     1 
ATOM   8008  C  CA    . LYS D  3  819  ? -108.055 63.103  67.270  1.00 121.61 ?  819  LYS C CA    1 
ATOM   8009  C  C     . LYS D  3  819  ? -108.861 61.894  66.818  1.00 117.89 ?  819  LYS C C     1 
ATOM   8010  O  O     . LYS D  3  819  ? -109.531 61.935  65.781  1.00 111.33 ?  819  LYS C O     1 
ATOM   8011  C  CB    . LYS D  3  819  ? -108.986 64.253  67.650  1.00 109.02 ?  819  LYS C CB    1 
ATOM   8012  N  N     . ALA D  3  820  ? -108.798 60.817  67.599  1.00 125.70 ?  820  ALA C N     1 
ATOM   8013  C  CA    . ALA D  3  820  ? -109.590 59.627  67.319  1.00 123.58 ?  820  ALA C CA    1 
ATOM   8014  C  C     . ALA D  3  820  ? -111.068 59.985  67.240  1.00 120.31 ?  820  ALA C C     1 
ATOM   8015  O  O     . ALA D  3  820  ? -111.699 60.273  68.263  1.00 114.62 ?  820  ALA C O     1 
ATOM   8016  C  CB    . ALA D  3  820  ? -109.351 58.557  68.386  1.00 109.91 ?  820  ALA C CB    1 
ATOM   8017  N  N     . ARG D  3  821  ? -111.625 59.966  66.032  1.00 120.67 ?  821  ARG C N     1 
ATOM   8018  C  CA    . ARG D  3  821  ? -112.991 60.420  65.835  1.00 123.14 ?  821  ARG C CA    1 
ATOM   8019  C  C     . ARG D  3  821  ? -113.964 59.541  66.620  1.00 125.24 ?  821  ARG C C     1 
ATOM   8020  O  O     . ARG D  3  821  ? -113.623 58.462  67.110  1.00 114.44 ?  821  ARG C O     1 
ATOM   8021  C  CB    . ARG D  3  821  ? -113.346 60.431  64.349  1.00 120.99 ?  821  ARG C CB    1 
ATOM   8022  C  CG    . ARG D  3  821  ? -114.385 61.480  63.989  1.00 124.64 ?  821  ARG C CG    1 
ATOM   8023  C  CD    . ARG D  3  821  ? -114.530 61.641  62.489  1.00 128.43 ?  821  ARG C CD    1 
ATOM   8024  N  NE    . ARG D  3  821  ? -115.317 62.824  62.152  1.00 145.09 ?  821  ARG C NE    1 
ATOM   8025  C  CZ    . ARG D  3  821  ? -115.681 63.152  60.917  1.00 148.23 ?  821  ARG C CZ    1 
ATOM   8026  N  NH1   . ARG D  3  821  ? -115.334 62.382  59.894  1.00 140.11 ?  821  ARG C NH1   1 
ATOM   8027  N  NH2   . ARG D  3  821  ? -116.397 64.249  60.706  1.00 145.42 ?  821  ARG C NH2   1 
ATOM   8028  N  N     . GLU D  3  822  ? -115.203 60.022  66.725  1.00 130.63 ?  822  GLU C N     1 
ATOM   8029  C  CA    . GLU D  3  822  ? -116.158 59.418  67.647  1.00 126.05 ?  822  GLU C CA    1 
ATOM   8030  C  C     . GLU D  3  822  ? -116.748 58.125  67.097  1.00 134.85 ?  822  GLU C C     1 
ATOM   8031  O  O     . GLU D  3  822  ? -116.862 57.130  67.822  1.00 135.92 ?  822  GLU C O     1 
ATOM   8032  C  CB    . GLU D  3  822  ? -117.271 60.422  67.973  1.00 116.60 ?  822  GLU C CB    1 
ATOM   8033  C  CG    . GLU D  3  822  ? -117.687 61.306  66.809  1.00 120.96 ?  822  GLU C CG    1 
ATOM   8034  C  CD    . GLU D  3  822  ? -117.072 62.697  66.879  1.00 132.54 ?  822  GLU C CD    1 
ATOM   8035  O  OE1   . GLU D  3  822  ? -116.573 63.076  67.960  1.00 125.75 ?  822  GLU C OE1   1 
ATOM   8036  O  OE2   . GLU D  3  822  ? -117.090 63.411  65.853  1.00 128.91 ?  822  GLU C OE2   1 
ATOM   8037  N  N     . VAL D  3  823  ? -117.137 58.118  65.824  1.00 144.11 ?  823  VAL C N     1 
ATOM   8038  C  CA    . VAL D  3  823  ? -117.920 57.014  65.283  1.00 130.39 ?  823  VAL C CA    1 
ATOM   8039  C  C     . VAL D  3  823  ? -117.194 56.356  64.119  1.00 132.51 ?  823  VAL C C     1 
ATOM   8040  O  O     . VAL D  3  823  ? -116.113 56.798  63.711  1.00 117.39 ?  823  VAL C O     1 
ATOM   8041  C  CB    . VAL D  3  823  ? -119.319 57.500  64.867  1.00 131.29 ?  823  VAL C CB    1 
ATOM   8042  C  CG1   . VAL D  3  823  ? -120.031 58.095  66.069  1.00 132.18 ?  823  VAL C CG1   1 
ATOM   8043  C  CG2   . VAL D  3  823  ? -119.211 58.528  63.758  1.00 123.03 ?  823  VAL C CG2   1 
ATOM   8044  N  N     . ARG D  3  824  ? -117.792 55.298  63.579  1.00 140.32 ?  824  ARG C N     1 
ATOM   8045  C  CA    . ARG D  3  824  ? -117.159 54.439  62.593  1.00 135.71 ?  824  ARG C CA    1 
ATOM   8046  C  C     . ARG D  3  824  ? -117.446 54.920  61.172  1.00 138.54 ?  824  ARG C C     1 
ATOM   8047  O  O     . ARG D  3  824  ? -118.291 55.785  60.933  1.00 135.35 ?  824  ARG C O     1 
ATOM   8048  C  CB    . ARG D  3  824  ? -117.631 52.996  62.772  1.00 112.33 ?  824  ARG C CB    1 
ATOM   8049  N  N     . ASP D  3  825  ? -116.723 54.333  60.222  1.00 141.36 ?  825  ASP C N     1 
ATOM   8050  C  CA    . ASP D  3  825  ? -116.831 54.669  58.808  1.00 135.44 ?  825  ASP C CA    1 
ATOM   8051  C  C     . ASP D  3  825  ? -117.752 53.680  58.106  1.00 126.38 ?  825  ASP C C     1 
ATOM   8052  O  O     . ASP D  3  825  ? -117.602 52.464  58.265  1.00 120.00 ?  825  ASP C O     1 
ATOM   8053  C  CB    . ASP D  3  825  ? -115.452 54.660  58.146  1.00 127.66 ?  825  ASP C CB    1 
ATOM   8054  C  CG    . ASP D  3  825  ? -115.527 54.441  56.648  1.00 122.53 ?  825  ASP C CG    1 
ATOM   8055  O  OD1   . ASP D  3  825  ? -116.372 55.083  55.990  1.00 119.50 ?  825  ASP C OD1   1 
ATOM   8056  O  OD2   . ASP D  3  825  ? -114.742 53.619  56.127  1.00 119.68 ?  825  ASP C OD2   1 
ATOM   8057  N  N     . THR D  3  826  ? -118.698 54.206  57.316  1.00 119.69 ?  826  THR C N     1 
ATOM   8058  C  CA    . THR D  3  826  ? -119.645 53.370  56.572  1.00 120.41 ?  826  THR C CA    1 
ATOM   8059  C  C     . THR D  3  826  ? -119.962 54.086  55.255  1.00 121.20 ?  826  THR C C     1 
ATOM   8060  O  O     . THR D  3  826  ? -121.009 54.713  55.083  1.00 129.71 ?  826  THR C O     1 
ATOM   8061  C  CB    . THR D  3  826  ? -120.916 53.086  57.373  1.00 121.38 ?  826  THR C CB    1 
ATOM   8062  O  OG1   . THR D  3  826  ? -122.061 53.539  56.639  1.00 102.15 ?  826  THR C OG1   1 
ATOM   8063  C  CG2   . THR D  3  826  ? -120.870 53.797  58.721  1.00 126.25 ?  826  THR C CG2   1 
ATOM   8064  N  N     . SER D  3  827  ? -119.037 53.985  54.307  1.00 115.96 ?  827  SER C N     1 
ATOM   8065  C  CA    . SER D  3  827  ? -119.177 54.626  53.008  1.00 107.99 ?  827  SER C CA    1 
ATOM   8066  C  C     . SER D  3  827  ? -119.554 53.599  51.949  1.00 117.32 ?  827  SER C C     1 
ATOM   8067  O  O     . SER D  3  827  ? -119.207 52.419  52.050  1.00 116.18 ?  827  SER C O     1 
ATOM   8068  C  CB    . SER D  3  827  ? -117.881 55.332  52.604  1.00 109.24 ?  827  SER C CB    1 
ATOM   8069  O  OG    . SER D  3  827  ? -117.528 56.329  53.544  1.00 118.04 ?  827  SER C OG    1 
ATOM   8070  N  N     . LEU D  3  828  ? -120.267 54.059  50.926  1.00 113.39 ?  828  LEU C N     1 
ATOM   8071  C  CA    . LEU D  3  828  ? -120.708 53.186  49.842  1.00 106.20 ?  828  LEU C CA    1 
ATOM   8072  C  C     . LEU D  3  828  ? -119.713 53.312  48.697  1.00 98.91  ?  828  LEU C C     1 
ATOM   8073  O  O     . LEU D  3  828  ? -119.687 54.321  47.988  1.00 107.21 ?  828  LEU C O     1 
ATOM   8074  C  CB    . LEU D  3  828  ? -122.122 53.543  49.400  1.00 102.02 ?  828  LEU C CB    1 
ATOM   8075  C  CG    . LEU D  3  828  ? -122.602 52.840  48.128  1.00 94.39  ?  828  LEU C CG    1 
ATOM   8076  C  CD1   . LEU D  3  828  ? -122.365 51.337  48.220  1.00 96.54  ?  828  LEU C CD1   1 
ATOM   8077  C  CD2   . LEU D  3  828  ? -124.074 53.141  47.874  1.00 95.98  ?  828  LEU C CD2   1 
ATOM   8078  N  N     . LYS D  3  829  ? -118.888 52.289  48.520  1.00 88.35  ?  829  LYS C N     1 
ATOM   8079  C  CA    . LYS D  3  829  ? -117.892 52.252  47.460  1.00 89.44  ?  829  LYS C CA    1 
ATOM   8080  C  C     . LYS D  3  829  ? -118.397 51.410  46.295  1.00 98.06  ?  829  LYS C C     1 
ATOM   8081  O  O     . LYS D  3  829  ? -119.354 50.643  46.420  1.00 116.24 ?  829  LYS C O     1 
ATOM   8082  C  CB    . LYS D  3  829  ? -116.567 51.686  47.984  1.00 99.73  ?  829  LYS C CB    1 
ATOM   8083  C  CG    . LYS D  3  829  ? -116.173 52.221  49.351  1.00 105.62 ?  829  LYS C CG    1 
ATOM   8084  C  CD    . LYS D  3  829  ? -114.955 51.498  49.902  1.00 106.98 ?  829  LYS C CD    1 
ATOM   8085  C  CE    . LYS D  3  829  ? -114.701 51.889  51.350  1.00 116.18 ?  829  LYS C CE    1 
ATOM   8086  N  NZ    . LYS D  3  829  ? -115.861 51.553  52.224  1.00 110.94 ?  829  LYS C NZ    1 
ATOM   8087  N  N     . VAL D  3  830  ? -117.740 51.564  45.152  1.00 91.12  ?  830  VAL C N     1 
ATOM   8088  C  CA    . VAL D  3  830  ? -118.167 50.826  43.958  1.00 97.96  ?  830  VAL C CA    1 
ATOM   8089  C  C     . VAL D  3  830  ? -117.755 49.367  44.098  1.00 101.52 ?  830  VAL C C     1 
ATOM   8090  O  O     . VAL D  3  830  ? -116.660 49.084  44.620  1.00 97.55  ?  830  VAL C O     1 
ATOM   8091  C  CB    . VAL D  3  830  ? -117.564 51.451  42.699  1.00 90.97  ?  830  VAL C CB    1 
ATOM   8092  C  CG1   . VAL D  3  830  ? -117.563 52.972  42.804  1.00 91.57  ?  830  VAL C CG1   1 
ATOM   8093  C  CG2   . VAL D  3  830  ? -116.164 50.911  42.456  1.00 85.62  ?  830  VAL C CG2   1 
ATOM   8094  N  N     . PRO D  3  831  ? -118.578 48.415  43.661  1.00 100.23 ?  831  PRO C N     1 
ATOM   8095  C  CA    . PRO D  3  831  ? -118.201 47.003  43.783  1.00 101.16 ?  831  PRO C CA    1 
ATOM   8096  C  C     . PRO D  3  831  ? -116.938 46.692  42.995  1.00 100.26 ?  831  PRO C C     1 
ATOM   8097  O  O     . PRO D  3  831  ? -116.674 47.274  41.940  1.00 99.95  ?  831  PRO C O     1 
ATOM   8098  C  CB    . PRO D  3  831  ? -119.414 46.260  43.211  1.00 109.31 ?  831  PRO C CB    1 
ATOM   8099  C  CG    . PRO D  3  831  ? -120.546 47.232  43.324  1.00 94.86  ?  831  PRO C CG    1 
ATOM   8100  C  CD    . PRO D  3  831  ? -119.934 48.582  43.112  1.00 100.05 ?  831  PRO C CD    1 
ATOM   8101  N  N     . HIS D  3  832  ? -116.154 45.755  43.524  1.00 107.48 ?  832  HIS C N     1 
ATOM   8102  C  CA    . HIS D  3  832  ? -114.914 45.355  42.874  1.00 116.77 ?  832  HIS C CA    1 
ATOM   8103  C  C     . HIS D  3  832  ? -115.180 44.896  41.445  1.00 107.91 ?  832  HIS C C     1 
ATOM   8104  O  O     . HIS D  3  832  ? -116.135 44.163  41.177  1.00 106.41 ?  832  HIS C O     1 
ATOM   8105  C  CB    . HIS D  3  832  ? -114.238 44.239  43.673  1.00 117.72 ?  832  HIS C CB    1 
ATOM   8106  C  CG    . HIS D  3  832  ? -113.054 43.632  42.986  1.00 126.51 ?  832  HIS C CG    1 
ATOM   8107  N  ND1   . HIS D  3  832  ? -111.932 44.359  42.650  1.00 129.28 ?  832  HIS C ND1   1 
ATOM   8108  C  CD2   . HIS D  3  832  ? -112.817 42.363  42.575  1.00 129.91 ?  832  HIS C CD2   1 
ATOM   8109  C  CE1   . HIS D  3  832  ? -111.056 43.565  42.060  1.00 128.88 ?  832  HIS C CE1   1 
ATOM   8110  N  NE2   . HIS D  3  832  ? -111.568 42.349  42.002  1.00 133.32 ?  832  HIS C NE2   1 
ATOM   8111  N  N     . GLY D  3  833  ? -114.325 45.336  40.524  1.00 106.31 ?  833  GLY C N     1 
ATOM   8112  C  CA    . GLY D  3  833  ? -114.460 44.968  39.131  1.00 105.26 ?  833  GLY C CA    1 
ATOM   8113  C  C     . GLY D  3  833  ? -115.451 45.787  38.337  1.00 109.77 ?  833  GLY C C     1 
ATOM   8114  O  O     . GLY D  3  833  ? -115.744 45.433  37.189  1.00 112.41 ?  833  GLY C O     1 
ATOM   8115  N  N     . GLU D  3  834  ? -115.978 46.868  38.905  1.00 107.02 ?  834  GLU C N     1 
ATOM   8116  C  CA    . GLU D  3  834  ? -116.933 47.732  38.230  1.00 100.73 ?  834  GLU C CA    1 
ATOM   8117  C  C     . GLU D  3  834  ? -116.323 49.114  38.026  1.00 102.27 ?  834  GLU C C     1 
ATOM   8118  O  O     . GLU D  3  834  ? -115.399 49.520  38.736  1.00 113.68 ?  834  GLU C O     1 
ATOM   8119  C  CB    . GLU D  3  834  ? -118.239 47.840  39.027  1.00 95.65  ?  834  GLU C CB    1 
ATOM   8120  C  CG    . GLU D  3  834  ? -119.331 48.648  38.344  1.00 108.89 ?  834  GLU C CG    1 
ATOM   8121  C  CD    . GLU D  3  834  ? -120.643 48.616  39.109  1.00 124.03 ?  834  GLU C CD    1 
ATOM   8122  O  OE1   . GLU D  3  834  ? -120.735 47.866  40.105  1.00 121.99 ?  834  GLU C OE1   1 
ATOM   8123  O  OE2   . GLU D  3  834  ? -121.583 49.341  38.716  1.00 113.10 ?  834  GLU C OE2   1 
ATOM   8124  N  N     . SER D  3  835  ? -116.848 49.835  37.039  1.00 78.97  ?  835  SER C N     1 
ATOM   8125  C  CA    . SER D  3  835  ? -116.343 51.162  36.711  1.00 72.36  ?  835  SER C CA    1 
ATOM   8126  C  C     . SER D  3  835  ? -117.288 51.810  35.711  1.00 95.93  ?  835  SER C C     1 
ATOM   8127  O  O     . SER D  3  835  ? -117.989 51.125  34.959  1.00 98.29  ?  835  SER C O     1 
ATOM   8128  C  CB    . SER D  3  835  ? -114.920 51.100  36.146  1.00 93.95  ?  835  SER C CB    1 
ATOM   8129  O  OG    . SER D  3  835  ? -114.018 50.543  37.086  1.00 105.92 ?  835  SER C OG    1 
ATOM   8130  N  N     . GLY D  3  836  ? -117.296 53.136  35.712  1.00 91.19  ?  836  GLY C N     1 
ATOM   8131  C  CA    . GLY D  3  836  ? -118.143 53.885  34.808  1.00 62.50  ?  836  GLY C CA    1 
ATOM   8132  C  C     . GLY D  3  836  ? -118.295 55.318  35.281  1.00 72.40  ?  836  GLY C C     1 
ATOM   8133  O  O     . GLY D  3  836  ? -117.655 55.749  36.239  1.00 83.63  ?  836  GLY C O     1 
ATOM   8134  N  N     . LYS D  3  837  ? -119.158 56.044  34.576  1.00 71.79  ?  837  LYS C N     1 
ATOM   8135  C  CA    . LYS D  3  837  ? -119.483 57.425  34.899  1.00 71.83  ?  837  LYS C CA    1 
ATOM   8136  C  C     . LYS D  3  837  ? -120.788 57.484  35.685  1.00 78.96  ?  837  LYS C C     1 
ATOM   8137  O  O     . LYS D  3  837  ? -121.658 56.621  35.543  1.00 85.74  ?  837  LYS C O     1 
ATOM   8138  C  CB    . LYS D  3  837  ? -119.607 58.274  33.631  1.00 68.13  ?  837  LYS C CB    1 
ATOM   8139  C  CG    . LYS D  3  837  ? -118.335 58.375  32.800  1.00 85.53  ?  837  LYS C CG    1 
ATOM   8140  C  CD    . LYS D  3  837  ? -117.385 59.427  33.352  1.00 99.90  ?  837  LYS C CD    1 
ATOM   8141  C  CE    . LYS D  3  837  ? -116.181 59.616  32.438  1.00 101.35 ?  837  LYS C CE    1 
ATOM   8142  N  NZ    . LYS D  3  837  ? -115.299 60.727  32.896  1.00 115.74 ?  837  LYS C NZ    1 
ATOM   8143  N  N     . VAL D  3  838  ? -120.918 58.515  36.514  1.00 73.26  ?  838  VAL C N     1 
ATOM   8144  C  CA    . VAL D  3  838  ? -122.124 58.724  37.308  1.00 55.13  ?  838  VAL C CA    1 
ATOM   8145  C  C     . VAL D  3  838  ? -123.113 59.525  36.472  1.00 56.44  ?  838  VAL C C     1 
ATOM   8146  O  O     . VAL D  3  838  ? -122.800 60.629  36.014  1.00 79.68  ?  838  VAL C O     1 
ATOM   8147  C  CB    . VAL D  3  838  ? -121.810 59.438  38.630  1.00 54.58  ?  838  VAL C CB    1 
ATOM   8148  C  CG1   . VAL D  3  838  ? -123.089 59.680  39.413  1.00 68.34  ?  838  VAL C CG1   1 
ATOM   8149  C  CG2   . VAL D  3  838  ? -120.831 58.622  39.457  1.00 61.20  ?  838  VAL C CG2   1 
ATOM   8150  N  N     . ILE D  3  839  ? -124.306 58.968  36.270  1.00 72.91  ?  839  ILE C N     1 
ATOM   8151  C  CA    . ILE D  3  839  ? -125.335 59.606  35.457  1.00 74.64  ?  839  ILE C CA    1 
ATOM   8152  C  C     . ILE D  3  839  ? -126.169 60.543  36.318  1.00 79.32  ?  839  ILE C C     1 
ATOM   8153  O  O     . ILE D  3  839  ? -126.171 61.762  36.109  1.00 102.62 ?  839  ILE C O     1 
ATOM   8154  C  CB    . ILE D  3  839  ? -126.233 58.561  34.770  1.00 74.65  ?  839  ILE C CB    1 
ATOM   8155  C  CG1   . ILE D  3  839  ? -125.503 57.907  33.597  1.00 72.82  ?  839  ILE C CG1   1 
ATOM   8156  C  CG2   . ILE D  3  839  ? -127.534 59.199  34.307  1.00 81.71  ?  839  ILE C CG2   1 
ATOM   8157  C  CD1   . ILE D  3  839  ? -126.385 56.993  32.776  1.00 65.34  ?  839  ILE C CD1   1 
ATOM   8158  N  N     . GLY D  3  840  ? -126.890 59.981  37.287  1.00 70.92  ?  840  GLY C N     1 
ATOM   8159  C  CA    . GLY D  3  840  ? -127.789 60.766  38.105  1.00 81.30  ?  840  GLY C CA    1 
ATOM   8160  C  C     . GLY D  3  840  ? -127.707 60.362  39.563  1.00 74.67  ?  840  GLY C C     1 
ATOM   8161  O  O     . GLY D  3  840  ? -127.187 59.301  39.916  1.00 71.66  ?  840  GLY C O     1 
ATOM   8162  N  N     . ILE D  3  841  ? -128.230 61.245  40.410  1.00 78.15  ?  841  ILE C N     1 
ATOM   8163  C  CA    . ILE D  3  841  ? -128.306 61.029  41.848  1.00 76.62  ?  841  ILE C CA    1 
ATOM   8164  C  C     . ILE D  3  841  ? -129.705 61.408  42.306  1.00 79.02  ?  841  ILE C C     1 
ATOM   8165  O  O     . ILE D  3  841  ? -130.211 62.477  41.947  1.00 83.71  ?  841  ILE C O     1 
ATOM   8166  C  CB    . ILE D  3  841  ? -127.251 61.848  42.617  1.00 81.96  ?  841  ILE C CB    1 
ATOM   8167  C  CG1   . ILE D  3  841  ? -125.837 61.356  42.298  1.00 83.83  ?  841  ILE C CG1   1 
ATOM   8168  C  CG2   . ILE D  3  841  ? -127.521 61.794  44.115  1.00 80.97  ?  841  ILE C CG2   1 
ATOM   8169  C  CD1   . ILE D  3  841  ? -125.294 61.861  40.978  1.00 100.07 ?  841  ILE C CD1   1 
ATOM   8170  N  N     . ARG D  3  842  ? -130.329 60.535  43.092  1.00 85.63  ?  842  ARG C N     1 
ATOM   8171  C  CA    . ARG D  3  842  ? -131.646 60.789  43.661  1.00 93.10  ?  842  ARG C CA    1 
ATOM   8172  C  C     . ARG D  3  842  ? -131.507 60.848  45.174  1.00 99.04  ?  842  ARG C C     1 
ATOM   8173  O  O     . ARG D  3  842  ? -131.097 59.865  45.801  1.00 96.89  ?  842  ARG C O     1 
ATOM   8174  C  CB    . ARG D  3  842  ? -132.647 59.708  43.250  1.00 99.01  ?  842  ARG C CB    1 
ATOM   8175  C  CG    . ARG D  3  842  ? -134.095 60.101  43.476  1.00 95.05  ?  842  ARG C CG    1 
ATOM   8176  C  CD    . ARG D  3  842  ? -134.491 61.255  42.569  1.00 114.67 ?  842  ARG C CD    1 
ATOM   8177  N  NE    . ARG D  3  842  ? -135.752 61.866  42.977  1.00 119.47 ?  842  ARG C NE    1 
ATOM   8178  C  CZ    . ARG D  3  842  ? -135.841 62.928  43.771  1.00 133.06 ?  842  ARG C CZ    1 
ATOM   8179  N  NH1   . ARG D  3  842  ? -134.740 63.500  44.242  1.00 128.67 ?  842  ARG C NH1   1 
ATOM   8180  N  NH2   . ARG D  3  842  ? -137.031 63.418  44.094  1.00 142.68 ?  842  ARG C NH2   1 
ATOM   8181  N  N     . VAL D  3  843  ? -131.842 61.996  45.756  1.00 102.86 ?  843  VAL C N     1 
ATOM   8182  C  CA    . VAL D  3  843  ? -131.691 62.235  47.187  1.00 107.65 ?  843  VAL C CA    1 
ATOM   8183  C  C     . VAL D  3  843  ? -133.076 62.383  47.800  1.00 110.63 ?  843  VAL C C     1 
ATOM   8184  O  O     . VAL D  3  843  ? -133.860 63.246  47.384  1.00 119.37 ?  843  VAL C O     1 
ATOM   8185  C  CB    . VAL D  3  843  ? -130.828 63.475  47.465  1.00 108.45 ?  843  VAL C CB    1 
ATOM   8186  C  CG1   . VAL D  3  843  ? -131.340 64.668  46.667  1.00 105.33 ?  843  VAL C CG1   1 
ATOM   8187  C  CG2   . VAL D  3  843  ? -130.815 63.784  48.955  1.00 103.29 ?  843  VAL C CG2   1 
ATOM   8188  N  N     . PHE D  3  844  ? -133.374 61.544  48.790  1.00 99.40  ?  844  PHE C N     1 
ATOM   8189  C  CA    . PHE D  3  844  ? -134.631 61.591  49.533  1.00 107.54 ?  844  PHE C CA    1 
ATOM   8190  C  C     . PHE D  3  844  ? -134.300 61.861  50.995  1.00 123.88 ?  844  PHE C C     1 
ATOM   8191  O  O     . PHE D  3  844  ? -133.765 60.988  51.686  1.00 119.97 ?  844  PHE C O     1 
ATOM   8192  C  CB    . PHE D  3  844  ? -135.413 60.290  49.373  1.00 107.33 ?  844  PHE C CB    1 
ATOM   8193  C  CG    . PHE D  3  844  ? -135.925 60.059  47.981  1.00 99.06  ?  844  PHE C CG    1 
ATOM   8194  C  CD1   . PHE D  3  844  ? -136.524 61.086  47.272  1.00 106.74 ?  844  PHE C CD1   1 
ATOM   8195  C  CD2   . PHE D  3  844  ? -135.798 58.820  47.379  1.00 89.33  ?  844  PHE C CD2   1 
ATOM   8196  C  CE1   . PHE D  3  844  ? -136.995 60.879  45.991  1.00 106.55 ?  844  PHE C CE1   1 
ATOM   8197  C  CE2   . PHE D  3  844  ? -136.266 58.607  46.096  1.00 97.90  ?  844  PHE C CE2   1 
ATOM   8198  C  CZ    . PHE D  3  844  ? -136.865 59.638  45.402  1.00 105.62 ?  844  PHE C CZ    1 
ATOM   8199  N  N     . SER D  3  845  ? -134.622 63.064  51.462  1.00 135.23 ?  845  SER C N     1 
ATOM   8200  C  CA    . SER D  3  845  ? -134.248 63.516  52.791  1.00 131.63 ?  845  SER C CA    1 
ATOM   8201  C  C     . SER D  3  845  ? -135.434 63.413  53.749  1.00 127.24 ?  845  SER C C     1 
ATOM   8202  O  O     . SER D  3  845  ? -136.553 63.062  53.368  1.00 119.26 ?  845  SER C O     1 
ATOM   8203  C  CB    . SER D  3  845  ? -133.714 64.949  52.728  1.00 121.02 ?  845  SER C CB    1 
ATOM   8204  O  OG    . SER D  3  845  ? -133.405 65.439  54.021  1.00 130.85 ?  845  SER C OG    1 
ATOM   8205  N  N     . ARG D  3  846  ? -135.172 63.719  55.020  1.00 129.04 ?  846  ARG C N     1 
ATOM   8206  C  CA    . ARG D  3  846  ? -136.205 63.781  56.047  1.00 119.32 ?  846  ARG C CA    1 
ATOM   8207  C  C     . ARG D  3  846  ? -136.654 65.210  56.324  1.00 116.77 ?  846  ARG C C     1 
ATOM   8208  O  O     . ARG D  3  846  ? -137.857 65.472  56.415  1.00 114.38 ?  846  ARG C O     1 
ATOM   8209  C  CB    . ARG D  3  846  ? -135.713 63.125  57.342  1.00 119.38 ?  846  ARG C CB    1 
ATOM   8210  C  CG    . ARG D  3  846  ? -136.717 63.202  58.482  1.00 126.24 ?  846  ARG C CG    1 
ATOM   8211  C  CD    . ARG D  3  846  ? -138.076 62.662  58.058  1.00 124.36 ?  846  ARG C CD    1 
ATOM   8212  N  NE    . ARG D  3  846  ? -138.100 61.203  57.991  1.00 127.55 ?  846  ARG C NE    1 
ATOM   8213  C  CZ    . ARG D  3  846  ? -138.594 60.419  58.945  1.00 119.82 ?  846  ARG C CZ    1 
ATOM   8214  N  NH1   . ARG D  3  846  ? -138.578 59.100  58.801  1.00 103.79 ?  846  ARG C NH1   1 
ATOM   8215  N  NH2   . ARG D  3  846  ? -139.111 60.956  60.042  1.00 119.02 ?  846  ARG C NH2   1 
ATOM   8216  N  N     . GLU D  3  847  ? -135.706 66.141  56.471  1.00 111.35 ?  847  GLU C N     1 
ATOM   8217  C  CA    . GLU D  3  847  ? -136.064 67.555  56.530  1.00 113.27 ?  847  GLU C CA    1 
ATOM   8218  C  C     . GLU D  3  847  ? -137.003 67.908  55.385  1.00 125.41 ?  847  GLU C C     1 
ATOM   8219  O  O     . GLU D  3  847  ? -138.094 68.448  55.598  1.00 134.36 ?  847  GLU C O     1 
ATOM   8220  C  CB    . GLU D  3  847  ? -134.804 68.420  56.490  1.00 97.27  ?  847  GLU C CB    1 
ATOM   8221  N  N     . ASP D  3  848  ? -136.588 67.605  54.157  1.00 118.85 ?  848  ASP C N     1 
ATOM   8222  C  CA    . ASP D  3  848  ? -137.525 67.534  53.047  1.00 125.06 ?  848  ASP C CA    1 
ATOM   8223  C  C     . ASP D  3  848  ? -138.471 66.375  53.322  1.00 133.64 ?  848  ASP C C     1 
ATOM   8224  O  O     . ASP D  3  848  ? -138.080 65.211  53.184  1.00 140.76 ?  848  ASP C O     1 
ATOM   8225  C  CB    . ASP D  3  848  ? -136.788 67.340  51.721  1.00 138.94 ?  848  ASP C CB    1 
ATOM   8226  C  CG    . ASP D  3  848  ? -135.431 68.018  51.704  1.00 140.83 ?  848  ASP C CG    1 
ATOM   8227  O  OD1   . ASP D  3  848  ? -134.825 68.158  52.787  1.00 138.13 ?  848  ASP C OD1   1 
ATOM   8228  O  OD2   . ASP D  3  848  ? -134.969 68.405  50.609  1.00 145.36 ?  848  ASP C OD2   1 
ATOM   8229  N  N     . ASP D  3  849  ? -139.704 66.687  53.728  1.00 126.41 ?  849  ASP C N     1 
ATOM   8230  C  CA    . ASP D  3  849  ? -140.657 65.707  54.243  1.00 133.97 ?  849  ASP C CA    1 
ATOM   8231  C  C     . ASP D  3  849  ? -140.499 64.334  53.599  1.00 132.67 ?  849  ASP C C     1 
ATOM   8232  O  O     . ASP D  3  849  ? -140.054 63.387  54.255  1.00 132.66 ?  849  ASP C O     1 
ATOM   8233  C  CB    . ASP D  3  849  ? -142.085 66.221  54.055  1.00 138.10 ?  849  ASP C CB    1 
ATOM   8234  C  CG    . ASP D  3  849  ? -142.295 67.587  54.681  1.00 139.21 ?  849  ASP C CG    1 
ATOM   8235  O  OD1   . ASP D  3  849  ? -141.393 68.443  54.552  1.00 123.36 ?  849  ASP C OD1   1 
ATOM   8236  O  OD2   . ASP D  3  849  ? -143.354 67.803  55.307  1.00 135.01 ?  849  ASP C OD2   1 
ATOM   8237  N  N     . ASP D  3  850  ? -140.851 64.216  52.325  1.00 128.57 ?  850  ASP C N     1 
ATOM   8238  C  CA    . ASP D  3  850  ? -140.671 62.950  51.605  1.00 135.09 ?  850  ASP C CA    1 
ATOM   8239  C  C     . ASP D  3  850  ? -141.509 61.876  52.305  1.00 134.06 ?  850  ASP C C     1 
ATOM   8240  O  O     . ASP D  3  850  ? -142.556 62.174  52.896  1.00 139.32 ?  850  ASP C O     1 
ATOM   8241  C  CB    . ASP D  3  850  ? -139.191 62.628  51.501  1.00 127.42 ?  850  ASP C CB    1 
ATOM   8242  C  CG    . ASP D  3  850  ? -138.420 63.669  50.713  1.00 137.40 ?  850  ASP C CG    1 
ATOM   8243  O  OD1   . ASP D  3  850  ? -138.913 64.810  50.591  1.00 150.57 ?  850  ASP C OD1   1 
ATOM   8244  O  OD2   . ASP D  3  850  ? -137.318 63.346  50.219  1.00 128.56 ?  850  ASP C OD2   1 
ATOM   8245  N  N     . GLU D  3  851  ? -141.057 60.624  52.247  1.00 116.81 ?  851  GLU C N     1 
ATOM   8246  C  CA    . GLU D  3  851  ? -141.760 59.521  52.889  1.00 116.81 ?  851  GLU C CA    1 
ATOM   8247  C  C     . GLU D  3  851  ? -140.886 58.275  52.897  1.00 118.88 ?  851  GLU C C     1 
ATOM   8248  O  O     . GLU D  3  851  ? -140.841 57.532  51.911  1.00 133.37 ?  851  GLU C O     1 
ATOM   8249  C  CB    . GLU D  3  851  ? -143.089 59.241  52.183  1.00 116.12 ?  851  GLU C CB    1 
ATOM   8250  N  N     . LEU D  3  852  ? -140.188 58.038  54.004  1.00 112.30 ?  852  LEU C N     1 
ATOM   8251  C  CA    . LEU D  3  852  ? -139.255 56.932  54.107  1.00 108.87 ?  852  LEU C CA    1 
ATOM   8252  C  C     . LEU D  3  852  ? -139.659 56.004  55.245  1.00 120.09 ?  852  LEU C C     1 
ATOM   8253  O  O     . LEU D  3  852  ? -140.332 56.430  56.189  1.00 124.64 ?  852  LEU C O     1 
ATOM   8254  C  CB    . LEU D  3  852  ? -137.824 57.434  54.343  1.00 104.07 ?  852  LEU C CB    1 
ATOM   8255  C  CG    . LEU D  3  852  ? -137.331 58.579  53.454  1.00 113.02 ?  852  LEU C CG    1 
ATOM   8256  C  CD1   . LEU D  3  852  ? -137.972 59.903  53.855  1.00 114.61 ?  852  LEU C CD1   1 
ATOM   8257  C  CD2   . LEU D  3  852  ? -135.815 58.688  53.516  1.00 125.84 ?  852  LEU C CD2   1 
ATOM   8258  N  N     . PRO D  3  853  ? -139.272 54.730  55.182  1.00 118.72 ?  853  PRO C N     1 
ATOM   8259  C  CA    . PRO D  3  853  ? -139.613 53.801  56.264  1.00 118.95 ?  853  PRO C CA    1 
ATOM   8260  C  C     . PRO D  3  853  ? -139.186 54.349  57.619  1.00 131.42 ?  853  PRO C C     1 
ATOM   8261  O  O     . PRO D  3  853  ? -138.214 55.100  57.730  1.00 136.53 ?  853  PRO C O     1 
ATOM   8262  C  CB    . PRO D  3  853  ? -138.837 52.531  55.897  1.00 118.83 ?  853  PRO C CB    1 
ATOM   8263  C  CG    . PRO D  3  853  ? -138.703 52.603  54.411  1.00 120.08 ?  853  PRO C CG    1 
ATOM   8264  C  CD    . PRO D  3  853  ? -138.544 54.065  54.088  1.00 113.77 ?  853  PRO C CD    1 
ATOM   8265  N  N     . ALA D  3  854  ? -139.931 53.963  58.655  1.00 129.86 ?  854  ALA C N     1 
ATOM   8266  C  CA    . ALA D  3  854  ? -139.694 54.476  59.999  1.00 128.21 ?  854  ALA C CA    1 
ATOM   8267  C  C     . ALA D  3  854  ? -138.226 54.346  60.382  1.00 130.47 ?  854  ALA C C     1 
ATOM   8268  O  O     . ALA D  3  854  ? -137.631 53.271  60.265  1.00 132.24 ?  854  ALA C O     1 
ATOM   8269  C  CB    . ALA D  3  854  ? -140.573 53.732  61.006  1.00 107.60 ?  854  ALA C CB    1 
ATOM   8270  N  N     . GLY D  3  855  ? -137.644 55.455  60.843  1.00 125.90 ?  855  GLY C N     1 
ATOM   8271  C  CA    . GLY D  3  855  ? -136.256 55.523  61.226  1.00 129.60 ?  855  GLY C CA    1 
ATOM   8272  C  C     . GLY D  3  855  ? -135.347 56.093  60.156  1.00 137.94 ?  855  GLY C C     1 
ATOM   8273  O  O     . GLY D  3  855  ? -134.344 56.736  60.485  1.00 148.77 ?  855  GLY C O     1 
ATOM   8274  N  N     . VAL D  3  856  ? -135.679 55.878  58.883  1.00 136.12 ?  856  VAL C N     1 
ATOM   8275  C  CA    . VAL D  3  856  ? -134.854 56.387  57.795  1.00 136.23 ?  856  VAL C CA    1 
ATOM   8276  C  C     . VAL D  3  856  ? -134.940 57.906  57.762  1.00 133.05 ?  856  VAL C C     1 
ATOM   8277  O  O     . VAL D  3  856  ? -136.036 58.483  57.761  1.00 128.82 ?  856  VAL C O     1 
ATOM   8278  C  CB    . VAL D  3  856  ? -135.292 55.778  56.455  1.00 124.72 ?  856  VAL C CB    1 
ATOM   8279  C  CG1   . VAL D  3  856  ? -134.283 56.114  55.367  1.00 116.14 ?  856  VAL C CG1   1 
ATOM   8280  C  CG2   . VAL D  3  856  ? -135.473 54.274  56.586  1.00 126.91 ?  856  VAL C CG2   1 
ATOM   8281  N  N     . ASN D  3  857  ? -133.782 58.562  57.736  1.00 126.08 ?  857  ASN C N     1 
ATOM   8282  C  CA    . ASN D  3  857  ? -133.706 60.013  57.632  1.00 120.29 ?  857  ASN C CA    1 
ATOM   8283  C  C     . ASN D  3  857  ? -133.458 60.479  56.203  1.00 121.25 ?  857  ASN C C     1 
ATOM   8284  O  O     . ASN D  3  857  ? -134.193 61.326  55.688  1.00 118.11 ?  857  ASN C O     1 
ATOM   8285  C  CB    . ASN D  3  857  ? -132.607 60.555  58.553  1.00 127.25 ?  857  ASN C CB    1 
ATOM   8286  C  CG    . ASN D  3  857  ? -132.907 60.319  60.019  1.00 133.59 ?  857  ASN C CG    1 
ATOM   8287  O  OD1   . ASN D  3  857  ? -134.068 60.228  60.421  1.00 127.37 ?  857  ASN C OD1   1 
ATOM   8288  N  ND2   . ASN D  3  857  ? -131.858 60.220  60.830  1.00 137.88 ?  857  ASN C ND2   1 
ATOM   8289  N  N     . GLU D  3  858  ? -132.437 59.934  55.547  1.00 126.96 ?  858  GLU C N     1 
ATOM   8290  C  CA    . GLU D  3  858  ? -132.071 60.337  54.198  1.00 119.46 ?  858  GLU C CA    1 
ATOM   8291  C  C     . GLU D  3  858  ? -131.849 59.101  53.341  1.00 115.87 ?  858  GLU C C     1 
ATOM   8292  O  O     . GLU D  3  858  ? -131.311 58.094  53.814  1.00 111.85 ?  858  GLU C O     1 
ATOM   8293  C  CB    . GLU D  3  858  ? -130.812 61.212  54.210  1.00 109.89 ?  858  GLU C CB    1 
ATOM   8294  C  CG    . GLU D  3  858  ? -130.566 61.972  52.922  1.00 115.16 ?  858  GLU C CG    1 
ATOM   8295  C  CD    . GLU D  3  858  ? -129.521 63.057  53.086  1.00 128.06 ?  858  GLU C CD    1 
ATOM   8296  O  OE1   . GLU D  3  858  ? -128.946 63.164  54.189  1.00 135.76 ?  858  GLU C OE1   1 
ATOM   8297  O  OE2   . GLU D  3  858  ? -129.277 63.804  52.115  1.00 133.51 ?  858  GLU C OE2   1 
ATOM   8298  N  N     . LEU D  3  859  ? -132.269 59.182  52.080  1.00 112.38 ?  859  LEU C N     1 
ATOM   8299  C  CA    . LEU D  3  859  ? -132.146 58.071  51.142  1.00 104.18 ?  859  LEU C CA    1 
ATOM   8300  C  C     . LEU D  3  859  ? -131.660 58.615  49.809  1.00 103.90 ?  859  LEU C C     1 
ATOM   8301  O  O     . LEU D  3  859  ? -132.346 59.428  49.182  1.00 104.60 ?  859  LEU C O     1 
ATOM   8302  C  CB    . LEU D  3  859  ? -133.483 57.340  50.979  1.00 104.47 ?  859  LEU C CB    1 
ATOM   8303  C  CG    . LEU D  3  859  ? -133.538 56.140  50.030  1.00 110.33 ?  859  LEU C CG    1 
ATOM   8304  C  CD1   . LEU D  3  859  ? -133.696 56.593  48.586  1.00 96.22  ?  859  LEU C CD1   1 
ATOM   8305  C  CD2   . LEU D  3  859  ? -132.298 55.270  50.194  1.00 106.81 ?  859  LEU C CD2   1 
ATOM   8306  N  N     . VAL D  3  860  ? -130.482 58.167  49.377  1.00 102.11 ?  860  VAL C N     1 
ATOM   8307  C  CA    . VAL D  3  860  ? -129.878 58.607  48.126  1.00 97.13  ?  860  VAL C CA    1 
ATOM   8308  C  C     . VAL D  3  860  ? -129.465 57.382  47.324  1.00 93.87  ?  860  VAL C C     1 
ATOM   8309  O  O     . VAL D  3  860  ? -128.992 56.388  47.887  1.00 99.44  ?  860  VAL C O     1 
ATOM   8310  C  CB    . VAL D  3  860  ? -128.663 59.527  48.366  1.00 97.55  ?  860  VAL C CB    1 
ATOM   8311  C  CG1   . VAL D  3  860  ? -127.544 58.760  49.055  1.00 95.30  ?  860  VAL C CG1   1 
ATOM   8312  C  CG2   . VAL D  3  860  ? -128.182 60.121  47.052  1.00 99.75  ?  860  VAL C CG2   1 
ATOM   8313  N  N     . ARG D  3  861  ? -129.644 57.455  46.006  1.00 87.61  ?  861  ARG C N     1 
ATOM   8314  C  CA    . ARG D  3  861  ? -129.277 56.378  45.097  1.00 84.94  ?  861  ARG C CA    1 
ATOM   8315  C  C     . ARG D  3  861  ? -128.489 56.961  43.936  1.00 86.34  ?  861  ARG C C     1 
ATOM   8316  O  O     . ARG D  3  861  ? -128.891 57.976  43.357  1.00 84.50  ?  861  ARG C O     1 
ATOM   8317  C  CB    . ARG D  3  861  ? -130.515 55.636  44.582  1.00 84.21  ?  861  ARG C CB    1 
ATOM   8318  N  N     . VAL D  3  862  ? -127.370 56.322  43.600  1.00 86.12  ?  862  VAL C N     1 
ATOM   8319  C  CA    . VAL D  3  862  ? -126.489 56.767  42.526  1.00 78.12  ?  862  VAL C CA    1 
ATOM   8320  C  C     . VAL D  3  862  ? -126.612 55.790  41.366  1.00 74.90  ?  862  VAL C C     1 
ATOM   8321  O  O     . VAL D  3  862  ? -126.582 54.570  41.568  1.00 79.85  ?  862  VAL C O     1 
ATOM   8322  C  CB    . VAL D  3  862  ? -125.029 56.874  42.999  1.00 69.38  ?  862  VAL C CB    1 
ATOM   8323  C  CG1   . VAL D  3  862  ? -124.149 57.405  41.879  1.00 76.95  ?  862  VAL C CG1   1 
ATOM   8324  C  CG2   . VAL D  3  862  ? -124.934 57.767  44.224  1.00 87.12  ?  862  VAL C CG2   1 
ATOM   8325  N  N     . TYR D  3  863  ? -126.747 56.326  40.156  1.00 65.07  ?  863  TYR C N     1 
ATOM   8326  C  CA    . TYR D  3  863  ? -126.848 55.530  38.939  1.00 67.70  ?  863  TYR C CA    1 
ATOM   8327  C  C     . TYR D  3  863  ? -125.557 55.677  38.146  1.00 72.97  ?  863  TYR C C     1 
ATOM   8328  O  O     . TYR D  3  863  ? -125.160 56.796  37.803  1.00 82.56  ?  863  TYR C O     1 
ATOM   8329  C  CB    . TYR D  3  863  ? -128.049 55.963  38.098  1.00 76.39  ?  863  TYR C CB    1 
ATOM   8330  C  CG    . TYR D  3  863  ? -129.388 55.651  38.727  1.00 73.66  ?  863  TYR C CG    1 
ATOM   8331  C  CD1   . TYR D  3  863  ? -129.905 54.364  38.698  1.00 79.26  ?  863  TYR C CD1   1 
ATOM   8332  C  CD2   . TYR D  3  863  ? -130.138 56.643  39.342  1.00 83.11  ?  863  TYR C CD2   1 
ATOM   8333  C  CE1   . TYR D  3  863  ? -131.128 54.073  39.268  1.00 72.55  ?  863  TYR C CE1   1 
ATOM   8334  C  CE2   . TYR D  3  863  ? -131.364 56.361  39.914  1.00 86.94  ?  863  TYR C CE2   1 
ATOM   8335  C  CZ    . TYR D  3  863  ? -131.853 55.074  39.874  1.00 79.66  ?  863  TYR C CZ    1 
ATOM   8336  O  OH    . TYR D  3  863  ? -133.071 54.785  40.443  1.00 104.97 ?  863  TYR C OH    1 
ATOM   8337  N  N     . VAL D  3  864  ? -124.909 54.551  37.854  1.00 75.19  ?  864  VAL C N     1 
ATOM   8338  C  CA    . VAL D  3  864  ? -123.643 54.524  37.131  1.00 60.45  ?  864  VAL C CA    1 
ATOM   8339  C  C     . VAL D  3  864  ? -123.855 53.797  35.809  1.00 73.90  ?  864  VAL C C     1 
ATOM   8340  O  O     . VAL D  3  864  ? -124.474 52.727  35.776  1.00 79.37  ?  864  VAL C O     1 
ATOM   8341  C  CB    . VAL D  3  864  ? -122.534 53.846  37.955  1.00 56.48  ?  864  VAL C CB    1 
ATOM   8342  C  CG1   . VAL D  3  864  ? -121.223 53.858  37.190  1.00 77.11  ?  864  VAL C CG1   1 
ATOM   8343  C  CG2   . VAL D  3  864  ? -122.379 54.535  39.301  1.00 69.96  ?  864  VAL C CG2   1 
ATOM   8344  N  N     . ALA D  3  865  ? -123.339 54.376  34.729  1.00 67.95  ?  865  ALA C N     1 
ATOM   8345  C  CA    . ALA D  3  865  ? -123.459 53.820  33.390  1.00 58.82  ?  865  ALA C CA    1 
ATOM   8346  C  C     . ALA D  3  865  ? -122.096 53.384  32.872  1.00 78.66  ?  865  ALA C C     1 
ATOM   8347  O  O     . ALA D  3  865  ? -121.051 53.884  33.299  1.00 69.52  ?  865  ALA C O     1 
ATOM   8348  C  CB    . ALA D  3  865  ? -124.082 54.834  32.425  1.00 51.42  ?  865  ALA C CB    1 
ATOM   8349  N  N     . GLN D  3  866  ? -122.122 52.440  31.932  1.00 84.34  ?  866  GLN C N     1 
ATOM   8350  C  CA    . GLN D  3  866  ? -120.907 51.871  31.366  1.00 70.65  ?  866  GLN C CA    1 
ATOM   8351  C  C     . GLN D  3  866  ? -121.117 51.639  29.878  1.00 74.77  ?  866  GLN C C     1 
ATOM   8352  O  O     . GLN D  3  866  ? -122.153 51.103  29.472  1.00 78.56  ?  866  GLN C O     1 
ATOM   8353  C  CB    . GLN D  3  866  ? -120.541 50.553  32.054  1.00 71.28  ?  866  GLN C CB    1 
ATOM   8354  C  CG    . GLN D  3  866  ? -120.728 50.572  33.561  1.00 88.13  ?  866  GLN C CG    1 
ATOM   8355  C  CD    . GLN D  3  866  ? -120.661 49.188  34.173  1.00 94.23  ?  866  GLN C CD    1 
ATOM   8356  O  OE1   . GLN D  3  866  ? -121.414 48.868  35.094  1.00 81.14  ?  866  GLN C OE1   1 
ATOM   8357  N  NE2   . GLN D  3  866  ? -119.754 48.359  33.665  1.00 91.02  ?  866  GLN C NE2   1 
ATOM   8358  N  N     . LYS D  3  867  ? -120.139 52.044  29.073  1.00 71.71  ?  867  LYS C N     1 
ATOM   8359  C  CA    . LYS D  3  867  ? -120.158 51.811  27.633  1.00 74.97  ?  867  LYS C CA    1 
ATOM   8360  C  C     . LYS D  3  867  ? -119.297 50.578  27.376  1.00 78.56  ?  867  LYS C C     1 
ATOM   8361  O  O     . LYS D  3  867  ? -118.068 50.650  27.402  1.00 69.82  ?  867  LYS C O     1 
ATOM   8362  C  CB    . LYS D  3  867  ? -119.653 53.034  26.874  1.00 73.48  ?  867  LYS C CB    1 
ATOM   8363  C  CG    . LYS D  3  867  ? -120.044 53.065  25.405  1.00 78.40  ?  867  LYS C CG    1 
ATOM   8364  C  CD    . LYS D  3  867  ? -119.622 54.373  24.743  1.00 101.50 ?  867  LYS C CD    1 
ATOM   8365  C  CE    . LYS D  3  867  ? -120.140 54.469  23.311  1.00 103.69 ?  867  LYS C CE    1 
ATOM   8366  N  NZ    . LYS D  3  867  ? -119.730 55.740  22.645  1.00 95.93  ?  867  LYS C NZ    1 
ATOM   8367  N  N     . ARG D  3  868  ? -119.951 49.446  27.123  1.00 75.72  ?  868  ARG C N     1 
ATOM   8368  C  CA    . ARG D  3  868  ? -119.282 48.152  27.009  1.00 60.25  ?  868  ARG C CA    1 
ATOM   8369  C  C     . ARG D  3  868  ? -118.934 47.887  25.549  1.00 74.92  ?  868  ARG C C     1 
ATOM   8370  O  O     . ARG D  3  868  ? -119.819 47.607  24.732  1.00 75.80  ?  868  ARG C O     1 
ATOM   8371  C  CB    . ARG D  3  868  ? -120.169 47.037  27.559  1.00 52.31  ?  868  ARG C CB    1 
ATOM   8372  C  CG    . ARG D  3  868  ? -120.524 47.172  29.032  1.00 65.14  ?  868  ARG C CG    1 
ATOM   8373  C  CD    . ARG D  3  868  ? -119.612 46.334  29.907  1.00 72.29  ?  868  ARG C CD    1 
ATOM   8374  N  NE    . ARG D  3  868  ? -120.021 46.373  31.308  1.00 84.98  ?  868  ARG C NE    1 
ATOM   8375  C  CZ    . ARG D  3  868  ? -120.983 45.616  31.827  1.00 85.84  ?  868  ARG C CZ    1 
ATOM   8376  N  NH1   . ARG D  3  868  ? -121.645 44.759  31.062  1.00 72.11  ?  868  ARG C NH1   1 
ATOM   8377  N  NH2   . ARG D  3  868  ? -121.287 45.718  33.113  1.00 84.76  ?  868  ARG C NH2   1 
ATOM   8378  N  N     . LYS D  3  869  ? -117.647 47.983  25.221  1.00 82.27  ?  869  LYS C N     1 
ATOM   8379  C  CA    . LYS D  3  869  ? -117.176 47.521  23.924  1.00 68.01  ?  869  LYS C CA    1 
ATOM   8380  C  C     . LYS D  3  869  ? -117.284 46.003  23.853  1.00 70.89  ?  869  LYS C C     1 
ATOM   8381  O  O     . LYS D  3  869  ? -117.081 45.304  24.850  1.00 71.35  ?  869  LYS C O     1 
ATOM   8382  C  CB    . LYS D  3  869  ? -115.732 47.951  23.698  1.00 59.89  ?  869  LYS C CB    1 
ATOM   8383  C  CG    . LYS D  3  869  ? -115.503 49.451  23.638  1.00 66.21  ?  869  LYS C CG    1 
ATOM   8384  C  CD    . LYS D  3  869  ? -115.966 50.031  22.315  1.00 63.00  ?  869  LYS C CD    1 
ATOM   8385  C  CE    . LYS D  3  869  ? -115.454 51.453  22.137  1.00 76.27  ?  869  LYS C CE    1 
ATOM   8386  N  NZ    . LYS D  3  869  ? -113.967 51.511  22.137  1.00 93.69  ?  869  LYS C NZ    1 
ATOM   8387  N  N     . ILE D  3  870  ? -117.595 45.489  22.664  1.00 74.29  ?  870  ILE C N     1 
ATOM   8388  C  CA    . ILE D  3  870  ? -117.673 44.045  22.472  1.00 63.88  ?  870  ILE C CA    1 
ATOM   8389  C  C     . ILE D  3  870  ? -116.300 43.448  22.746  1.00 59.20  ?  870  ILE C C     1 
ATOM   8390  O  O     . ILE D  3  870  ? -115.354 43.659  21.980  1.00 69.08  ?  870  ILE C O     1 
ATOM   8391  C  CB    . ILE D  3  870  ? -118.171 43.684  21.061  1.00 64.03  ?  870  ILE C CB    1 
ATOM   8392  C  CG1   . ILE D  3  870  ? -118.229 42.164  20.896  1.00 71.41  ?  870  ILE C CG1   1 
ATOM   8393  C  CG2   . ILE D  3  870  ? -117.286 44.320  19.998  1.00 80.75  ?  870  ILE C CG2   1 
ATOM   8394  C  CD1   . ILE D  3  870  ? -119.124 41.476  21.908  1.00 67.56  ?  870  ILE C CD1   1 
ATOM   8395  N  N     . SER D  3  871  ? -116.180 42.704  23.842  1.00 63.40  ?  871  SER C N     1 
ATOM   8396  C  CA    . SER D  3  871  ? -114.899 42.217  24.327  1.00 66.03  ?  871  SER C CA    1 
ATOM   8397  C  C     . SER D  3  871  ? -114.795 40.706  24.162  1.00 67.03  ?  871  SER C C     1 
ATOM   8398  O  O     . SER D  3  871  ? -115.792 39.983  24.245  1.00 67.52  ?  871  SER C O     1 
ATOM   8399  C  CB    . SER D  3  871  ? -114.698 42.589  25.801  1.00 80.72  ?  871  SER C CB    1 
ATOM   8400  O  OG    . SER D  3  871  ? -113.451 42.119  26.284  1.00 108.87 ?  871  SER C OG    1 
ATOM   8401  N  N     . ASP D  3  872  ? -113.571 40.236  23.929  1.00 90.22  ?  872  ASP C N     1 
ATOM   8402  C  CA    . ASP D  3  872  ? -113.321 38.802  23.859  1.00 71.26  ?  872  ASP C CA    1 
ATOM   8403  C  C     . ASP D  3  872  ? -113.769 38.132  25.150  1.00 62.12  ?  872  ASP C C     1 
ATOM   8404  O  O     . ASP D  3  872  ? -113.388 38.550  26.248  1.00 67.86  ?  872  ASP C O     1 
ATOM   8405  C  CB    . ASP D  3  872  ? -111.838 38.534  23.598  1.00 73.27  ?  872  ASP C CB    1 
ATOM   8406  C  CG    . ASP D  3  872  ? -110.927 39.500  24.338  1.00 109.27 ?  872  ASP C CG    1 
ATOM   8407  O  OD1   . ASP D  3  872  ? -111.391 40.599  24.712  1.00 115.64 ?  872  ASP C OD1   1 
ATOM   8408  O  OD2   . ASP D  3  872  ? -109.741 39.162  24.538  1.00 116.70 ?  872  ASP C OD2   1 
ATOM   8409  N  N     . GLY D  3  873  ? -114.587 37.086  25.015  1.00 64.74  ?  873  GLY C N     1 
ATOM   8410  C  CA    . GLY D  3  873  ? -115.225 36.423  26.131  1.00 44.86  ?  873  GLY C CA    1 
ATOM   8411  C  C     . GLY D  3  873  ? -116.731 36.601  26.154  1.00 58.60  ?  873  GLY C C     1 
ATOM   8412  O  O     . GLY D  3  873  ? -117.441 35.732  26.674  1.00 67.41  ?  873  GLY C O     1 
ATOM   8413  N  N     . ASP D  3  874  ? -117.230 37.704  25.602  1.00 66.56  ?  874  ASP C N     1 
ATOM   8414  C  CA    . ASP D  3  874  ? -118.667 37.911  25.515  1.00 60.91  ?  874  ASP C CA    1 
ATOM   8415  C  C     . ASP D  3  874  ? -119.310 36.827  24.654  1.00 62.89  ?  874  ASP C C     1 
ATOM   8416  O  O     . ASP D  3  874  ? -118.652 36.150  23.859  1.00 70.08  ?  874  ASP C O     1 
ATOM   8417  C  CB    . ASP D  3  874  ? -118.974 39.297  24.950  1.00 55.10  ?  874  ASP C CB    1 
ATOM   8418  C  CG    . ASP D  3  874  ? -118.571 40.413  25.896  1.00 74.21  ?  874  ASP C CG    1 
ATOM   8419  O  OD1   . ASP D  3  874  ? -118.685 40.219  27.126  1.00 74.63  ?  874  ASP C OD1   1 
ATOM   8420  O  OD2   . ASP D  3  874  ? -118.137 41.480  25.412  1.00 84.05  ?  874  ASP C OD2   1 
ATOM   8421  N  N     . LYS D  3  875  ? -120.619 36.671  24.819  1.00 61.38  ?  875  LYS C N     1 
ATOM   8422  C  CA    . LYS D  3  875  ? -121.374 35.591  24.196  1.00 59.68  ?  875  LYS C CA    1 
ATOM   8423  C  C     . LYS D  3  875  ? -122.263 36.161  23.099  1.00 57.98  ?  875  LYS C C     1 
ATOM   8424  O  O     . LYS D  3  875  ? -123.184 36.935  23.381  1.00 73.57  ?  875  LYS C O     1 
ATOM   8425  C  CB    . LYS D  3  875  ? -122.210 34.848  25.239  1.00 57.81  ?  875  LYS C CB    1 
ATOM   8426  C  CG    . LYS D  3  875  ? -122.993 33.671  24.697  1.00 55.59  ?  875  LYS C CG    1 
ATOM   8427  C  CD    . LYS D  3  875  ? -123.729 32.941  25.812  1.00 68.97  ?  875  LYS C CD    1 
ATOM   8428  C  CE    . LYS D  3  875  ? -124.440 31.696  25.290  1.00 78.60  ?  875  LYS C CE    1 
ATOM   8429  N  NZ    . LYS D  3  875  ? -125.185 30.987  26.368  1.00 92.96  ?  875  LYS C NZ    1 
ATOM   8430  N  N     . LEU D  3  876  ? -121.985 35.781  21.856  1.00 61.12  ?  876  LEU C N     1 
ATOM   8431  C  CA    . LEU D  3  876  ? -122.807 36.138  20.709  1.00 54.76  ?  876  LEU C CA    1 
ATOM   8432  C  C     . LEU D  3  876  ? -123.610 34.926  20.257  1.00 50.18  ?  876  LEU C C     1 
ATOM   8433  O  O     . LEU D  3  876  ? -123.324 33.785  20.629  1.00 59.23  ?  876  LEU C O     1 
ATOM   8434  C  CB    . LEU D  3  876  ? -121.950 36.661  19.551  1.00 44.66  ?  876  LEU C CB    1 
ATOM   8435  C  CG    . LEU D  3  876  ? -121.326 38.050  19.681  1.00 52.27  ?  876  LEU C CG    1 
ATOM   8436  C  CD1   . LEU D  3  876  ? -120.391 38.124  20.878  1.00 78.99  ?  876  LEU C CD1   1 
ATOM   8437  C  CD2   . LEU D  3  876  ? -120.588 38.410  18.403  1.00 44.96  ?  876  LEU C CD2   1 
ATOM   8438  N  N     . ALA D  3  877  ? -124.623 35.187  19.435  1.00 46.34  ?  877  ALA C N     1 
ATOM   8439  C  CA    . ALA D  3  877  ? -125.485 34.118  18.951  1.00 55.54  ?  877  ALA C CA    1 
ATOM   8440  C  C     . ALA D  3  877  ? -126.401 34.666  17.870  1.00 61.23  ?  877  ALA C C     1 
ATOM   8441  O  O     . ALA D  3  877  ? -126.718 35.858  17.856  1.00 76.81  ?  877  ALA C O     1 
ATOM   8442  C  CB    . ALA D  3  877  ? -126.315 33.504  20.086  1.00 51.58  ?  877  ALA C CB    1 
ATOM   8443  N  N     . GLY D  3  878  ? -126.816 33.780  16.965  1.00 68.95  ?  878  GLY C N     1 
ATOM   8444  C  CA    . GLY D  3  878  ? -127.792 34.109  15.952  1.00 65.22  ?  878  GLY C CA    1 
ATOM   8445  C  C     . GLY D  3  878  ? -129.193 33.667  16.353  1.00 70.02  ?  878  GLY C C     1 
ATOM   8446  O  O     . GLY D  3  878  ? -129.440 33.180  17.453  1.00 73.39  ?  878  GLY C O     1 
ATOM   8447  N  N     . ARG D  3  879  ? -130.121 33.845  15.415  1.00 63.75  ?  879  ARG C N     1 
ATOM   8448  C  CA    . ARG D  3  879  ? -131.520 33.515  15.653  1.00 67.22  ?  879  ARG C CA    1 
ATOM   8449  C  C     . ARG D  3  879  ? -131.823 32.030  15.501  1.00 79.45  ?  879  ARG C C     1 
ATOM   8450  O  O     . ARG D  3  879  ? -132.973 31.629  15.711  1.00 79.75  ?  879  ARG C O     1 
ATOM   8451  C  CB    . ARG D  3  879  ? -132.412 34.322  14.707  1.00 72.04  ?  879  ARG C CB    1 
ATOM   8452  C  CG    . ARG D  3  879  ? -132.444 35.810  15.015  1.00 89.84  ?  879  ARG C CG    1 
ATOM   8453  C  CD    . ARG D  3  879  ? -133.038 36.606  13.865  1.00 79.57  ?  879  ARG C CD    1 
ATOM   8454  N  NE    . ARG D  3  879  ? -132.169 36.587  12.693  1.00 79.86  ?  879  ARG C NE    1 
ATOM   8455  C  CZ    . ARG D  3  879  ? -132.434 37.220  11.555  1.00 88.34  ?  879  ARG C CZ    1 
ATOM   8456  N  NH1   . ARG D  3  879  ? -133.549 37.927  11.430  1.00 81.91  ?  879  ARG C NH1   1 
ATOM   8457  N  NH2   . ARG D  3  879  ? -131.583 37.144  10.540  1.00 91.97  ?  879  ARG C NH2   1 
ATOM   8458  N  N     . HIS D  3  880  ? -130.832 31.209  15.152  1.00 85.72  ?  880  HIS C N     1 
ATOM   8459  C  CA    . HIS D  3  880  ? -131.043 29.787  14.913  1.00 73.88  ?  880  HIS C CA    1 
ATOM   8460  C  C     . HIS D  3  880  ? -130.492 28.919  16.039  1.00 74.07  ?  880  HIS C C     1 
ATOM   8461  O  O     . HIS D  3  880  ? -130.269 27.721  15.841  1.00 92.11  ?  880  HIS C O     1 
ATOM   8462  C  CB    . HIS D  3  880  ? -130.419 29.381  13.578  1.00 75.99  ?  880  HIS C CB    1 
ATOM   8463  C  CG    . HIS D  3  880  ? -130.844 30.241  12.429  1.00 77.48  ?  880  HIS C CG    1 
ATOM   8464  N  ND1   . HIS D  3  880  ? -132.022 30.038  11.743  1.00 82.38  ?  880  HIS C ND1   1 
ATOM   8465  C  CD2   . HIS D  3  880  ? -130.248 31.308  11.847  1.00 81.64  ?  880  HIS C CD2   1 
ATOM   8466  C  CE1   . HIS D  3  880  ? -132.132 30.941  10.786  1.00 82.81  ?  880  HIS C CE1   1 
ATOM   8467  N  NE2   . HIS D  3  880  ? -131.069 31.725  10.828  1.00 78.15  ?  880  HIS C NE2   1 
ATOM   8468  N  N     . GLY D  3  881  ? -130.269 29.498  17.218  1.00 74.05  ?  881  GLY C N     1 
ATOM   8469  C  CA    . GLY D  3  881  ? -129.730 28.765  18.340  1.00 81.81  ?  881  GLY C CA    1 
ATOM   8470  C  C     . GLY D  3  881  ? -128.220 28.674  18.381  1.00 81.04  ?  881  GLY C C     1 
ATOM   8471  O  O     . GLY D  3  881  ? -127.670 28.243  19.402  1.00 86.76  ?  881  GLY C O     1 
ATOM   8472  N  N     . ASN D  3  882  ? -127.534 29.059  17.309  1.00 71.14  ?  882  ASN C N     1 
ATOM   8473  C  CA    . ASN D  3  882  ? -126.078 29.028  17.305  1.00 75.96  ?  882  ASN C CA    1 
ATOM   8474  C  C     . ASN D  3  882  ? -125.534 30.059  18.287  1.00 68.87  ?  882  ASN C C     1 
ATOM   8475  O  O     . ASN D  3  882  ? -125.900 31.236  18.234  1.00 84.56  ?  882  ASN C O     1 
ATOM   8476  C  CB    . ASN D  3  882  ? -125.545 29.292  15.898  1.00 84.58  ?  882  ASN C CB    1 
ATOM   8477  C  CG    . ASN D  3  882  ? -126.204 30.491  15.239  1.00 90.61  ?  882  ASN C CG    1 
ATOM   8478  O  OD1   . ASN D  3  882  ? -127.418 30.678  15.333  1.00 86.26  ?  882  ASN C OD1   1 
ATOM   8479  N  ND2   . ASN D  3  882  ? -125.403 31.313  14.571  1.00 87.66  ?  882  ASN C ND2   1 
ATOM   8480  N  N     . LYS D  3  883  ? -124.660 29.613  19.188  1.00 66.96  ?  883  LYS C N     1 
ATOM   8481  C  CA    . LYS D  3  883  ? -124.096 30.476  20.214  1.00 63.70  ?  883  LYS C CA    1 
ATOM   8482  C  C     . LYS D  3  883  ? -122.626 30.138  20.406  1.00 61.55  ?  883  LYS C C     1 
ATOM   8483  O  O     . LYS D  3  883  ? -122.180 29.025  20.119  1.00 78.14  ?  883  LYS C O     1 
ATOM   8484  C  CB    . LYS D  3  883  ? -124.850 30.340  21.544  1.00 56.28  ?  883  LYS C CB    1 
ATOM   8485  N  N     . GLY D  3  884  ? -121.877 31.115  20.902  1.00 53.34  ?  884  GLY C N     1 
ATOM   8486  C  CA    . GLY D  3  884  ? -120.461 30.920  21.144  1.00 59.92  ?  884  GLY C CA    1 
ATOM   8487  C  C     . GLY D  3  884  ? -119.835 32.200  21.652  1.00 55.35  ?  884  GLY C C     1 
ATOM   8488  O  O     . GLY D  3  884  ? -120.332 33.305  21.404  1.00 58.03  ?  884  GLY C O     1 
ATOM   8489  N  N     . VAL D  3  885  ? -118.729 32.027  22.375  1.00 55.86  ?  885  VAL C N     1 
ATOM   8490  C  CA    . VAL D  3  885  ? -118.006 33.151  22.959  1.00 58.69  ?  885  VAL C CA    1 
ATOM   8491  C  C     . VAL D  3  885  ? -117.055 33.726  21.922  1.00 62.20  ?  885  VAL C C     1 
ATOM   8492  O  O     . VAL D  3  885  ? -116.839 33.132  20.859  1.00 71.12  ?  885  VAL C O     1 
ATOM   8493  C  CB    . VAL D  3  885  ? -117.242 32.735  24.230  1.00 66.26  ?  885  VAL C CB    1 
ATOM   8494  C  CG1   . VAL D  3  885  ? -118.194 32.121  25.241  1.00 77.17  ?  885  VAL C CG1   1 
ATOM   8495  C  CG2   . VAL D  3  885  ? -116.122 31.769  23.886  1.00 69.49  ?  885  VAL C CG2   1 
ATOM   8496  N  N     . ILE D  3  886  ? -116.485 34.888  22.224  1.00 61.29  ?  886  ILE C N     1 
ATOM   8497  C  CA    . ILE D  3  886  ? -115.522 35.537  21.345  1.00 55.07  ?  886  ILE C CA    1 
ATOM   8498  C  C     . ILE D  3  886  ? -114.143 35.046  21.773  1.00 68.02  ?  886  ILE C C     1 
ATOM   8499  O  O     . ILE D  3  886  ? -113.607 35.471  22.795  1.00 71.42  ?  886  ILE C O     1 
ATOM   8500  C  CB    . ILE D  3  886  ? -115.641 37.060  21.405  1.00 56.89  ?  886  ILE C CB    1 
ATOM   8501  C  CG1   . ILE D  3  886  ? -117.046 37.494  20.980  1.00 53.03  ?  886  ILE C CG1   1 
ATOM   8502  C  CG2   . ILE D  3  886  ? -114.587 37.722  20.525  1.00 77.60  ?  886  ILE C CG2   1 
ATOM   8503  C  CD1   . ILE D  3  886  ? -117.282 38.978  21.088  1.00 74.75  ?  886  ILE C CD1   1 
ATOM   8504  N  N     . GLY D  3  887  ? -113.578 34.124  20.990  1.00 67.46  ?  887  GLY C N     1 
ATOM   8505  C  CA    . GLY D  3  887  ? -112.277 33.572  21.320  1.00 70.01  ?  887  GLY C CA    1 
ATOM   8506  C  C     . GLY D  3  887  ? -111.129 34.529  21.060  1.00 62.78  ?  887  GLY C C     1 
ATOM   8507  O  O     . GLY D  3  887  ? -110.123 34.499  21.775  1.00 76.96  ?  887  GLY C O     1 
ATOM   8508  N  N     . LYS D  3  888  ? -111.244 35.374  20.036  1.00 49.74  ?  888  LYS C N     1 
ATOM   8509  C  CA    . LYS D  3  888  ? -110.183 36.325  19.737  1.00 61.91  ?  888  LYS C CA    1 
ATOM   8510  C  C     . LYS D  3  888  ? -110.738 37.445  18.872  1.00 65.04  ?  888  LYS C C     1 
ATOM   8511  O  O     . LYS D  3  888  ? -111.791 37.310  18.242  1.00 55.94  ?  888  LYS C O     1 
ATOM   8512  C  CB    . LYS D  3  888  ? -109.002 35.653  19.037  1.00 59.29  ?  888  LYS C CB    1 
ATOM   8513  C  CG    . LYS D  3  888  ? -107.685 36.372  19.246  1.00 63.30  ?  888  LYS C CG    1 
ATOM   8514  C  CD    . LYS D  3  888  ? -106.611 35.796  18.346  1.00 58.12  ?  888  LYS C CD    1 
ATOM   8515  C  CE    . LYS D  3  888  ? -105.223 36.283  18.745  1.00 71.51  ?  888  LYS C CE    1 
ATOM   8516  N  NZ    . LYS D  3  888  ? -104.712 35.634  19.989  1.00 83.39  ?  888  LYS C NZ    1 
ATOM   8517  N  N     . ILE D  3  889  ? -110.009 38.558  18.851  1.00 63.78  ?  889  ILE C N     1 
ATOM   8518  C  CA    . ILE D  3  889  ? -110.371 39.685  17.999  1.00 63.92  ?  889  ILE C CA    1 
ATOM   8519  C  C     . ILE D  3  889  ? -109.155 40.181  17.231  1.00 70.42  ?  889  ILE C C     1 
ATOM   8520  O  O     . ILE D  3  889  ? -108.304 40.876  17.785  1.00 73.07  ?  889  ILE C O     1 
ATOM   8521  C  CB    . ILE D  3  889  ? -110.995 40.824  18.813  1.00 58.65  ?  889  ILE C CB    1 
ATOM   8522  C  CG1   . ILE D  3  889  ? -112.293 40.346  19.451  1.00 64.14  ?  889  ILE C CG1   1 
ATOM   8523  C  CG2   . ILE D  3  889  ? -111.248 42.018  17.920  1.00 68.87  ?  889  ILE C CG2   1 
ATOM   8524  C  CD1   . ILE D  3  889  ? -112.967 41.348  20.343  1.00 60.04  ?  889  ILE C CD1   1 
ATOM   8525  N  N     . LEU D  3  890  ? -109.042 39.805  15.950  1.00 58.93  ?  890  LEU C N     1 
ATOM   8526  C  CA    . LEU D  3  890  ? -107.864 40.199  15.199  1.00 62.79  ?  890  LEU C CA    1 
ATOM   8527  C  C     . LEU D  3  890  ? -107.982 41.643  14.716  1.00 60.52  ?  890  LEU C C     1 
ATOM   8528  O  O     . LEU D  3  890  ? -109.084 42.134  14.461  1.00 70.43  ?  890  LEU C O     1 
ATOM   8529  C  CB    . LEU D  3  890  ? -107.657 39.280  13.996  1.00 70.80  ?  890  LEU C CB    1 
ATOM   8530  C  CG    . LEU D  3  890  ? -107.705 37.768  14.219  1.00 52.63  ?  890  LEU C CG    1 
ATOM   8531  C  CD1   . LEU D  3  890  ? -107.067 37.417  15.554  1.00 64.89  ?  890  LEU C CD1   1 
ATOM   8532  C  CD2   . LEU D  3  890  ? -109.134 37.269  14.152  1.00 60.93  ?  890  LEU C CD2   1 
ATOM   8533  N  N     . PRO D  3  891  ? -106.856 42.345  14.579  1.00 48.82  ?  891  PRO C N     1 
ATOM   8534  C  CA    . PRO D  3  891  ? -106.891 43.641  13.896  1.00 61.93  ?  891  PRO C CA    1 
ATOM   8535  C  C     . PRO D  3  891  ? -107.425 43.467  12.485  1.00 65.31  ?  891  PRO C C     1 
ATOM   8536  O  O     . PRO D  3  891  ? -107.245 42.423  11.854  1.00 64.58  ?  891  PRO C O     1 
ATOM   8537  C  CB    . PRO D  3  891  ? -105.424 44.087  13.895  1.00 70.22  ?  891  PRO C CB    1 
ATOM   8538  C  CG    . PRO D  3  891  ? -104.811 43.366  15.039  1.00 65.56  ?  891  PRO C CG    1 
ATOM   8539  C  CD    . PRO D  3  891  ? -105.514 42.035  15.101  1.00 56.74  ?  891  PRO C CD    1 
ATOM   8540  N  N     . VAL D  3  892  ? -108.098 44.508  11.990  1.00 65.59  ?  892  VAL C N     1 
ATOM   8541  C  CA    . VAL D  3  892  ? -108.708 44.430  10.669  1.00 60.39  ?  892  VAL C CA    1 
ATOM   8542  C  C     . VAL D  3  892  ? -107.683 44.103  9.592   1.00 78.32  ?  892  VAL C C     1 
ATOM   8543  O  O     . VAL D  3  892  ? -108.050 43.626  8.513   1.00 86.40  ?  892  VAL C O     1 
ATOM   8544  C  CB    . VAL D  3  892  ? -109.446 45.743  10.343  1.00 61.90  ?  892  VAL C CB    1 
ATOM   8545  C  CG1   . VAL D  3  892  ? -108.479 46.916  10.382  1.00 78.45  ?  892  VAL C CG1   1 
ATOM   8546  C  CG2   . VAL D  3  892  ? -110.130 45.645  8.985   1.00 70.41  ?  892  VAL C CG2   1 
ATOM   8547  N  N     . GLU D  3  893  ? -106.397 44.340  9.860   1.00 76.29  ?  893  GLU C N     1 
ATOM   8548  C  CA    . GLU D  3  893  ? -105.372 44.082  8.853   1.00 74.85  ?  893  GLU C CA    1 
ATOM   8549  C  C     . GLU D  3  893  ? -105.252 42.590  8.555   1.00 75.60  ?  893  GLU C C     1 
ATOM   8550  O  O     . GLU D  3  893  ? -105.381 42.168  7.400   1.00 81.96  ?  893  GLU C O     1 
ATOM   8551  C  CB    . GLU D  3  893  ? -104.031 44.662  9.309   1.00 61.88  ?  893  GLU C CB    1 
ATOM   8552  C  CG    . GLU D  3  893  ? -103.585 44.211  10.687  1.00 69.79  ?  893  GLU C CG    1 
ATOM   8553  C  CD    . GLU D  3  893  ? -103.034 45.355  11.521  1.00 83.39  ?  893  GLU C CD    1 
ATOM   8554  O  OE1   . GLU D  3  893  ? -103.407 46.518  11.252  1.00 96.82  ?  893  GLU C OE1   1 
ATOM   8555  O  OE2   . GLU D  3  893  ? -102.228 45.093  12.442  1.00 72.02  ?  893  GLU C OE2   1 
ATOM   8556  N  N     . ASP D  3  894  ? -105.017 41.774  9.584   1.00 70.79  ?  894  ASP C N     1 
ATOM   8557  C  CA    . ASP D  3  894  ? -104.826 40.332  9.403   1.00 77.10  ?  894  ASP C CA    1 
ATOM   8558  C  C     . ASP D  3  894  ? -106.167 39.623  9.577   1.00 65.99  ?  894  ASP C C     1 
ATOM   8559  O  O     . ASP D  3  894  ? -106.459 39.003  10.601  1.00 61.60  ?  894  ASP C O     1 
ATOM   8560  C  CB    . ASP D  3  894  ? -103.778 39.803  10.373  1.00 80.04  ?  894  ASP C CB    1 
ATOM   8561  C  CG    . ASP D  3  894  ? -104.150 40.039  11.824  1.00 73.36  ?  894  ASP C CG    1 
ATOM   8562  O  OD1   . ASP D  3  894  ? -104.901 40.999  12.100  1.00 83.88  ?  894  ASP C OD1   1 
ATOM   8563  O  OD2   . ASP D  3  894  ? -103.687 39.266  12.689  1.00 59.94  ?  894  ASP C OD2   1 
ATOM   8564  N  N     . MET D  3  895  ? -106.989 39.705  8.531   1.00 67.67  ?  895  MET C N     1 
ATOM   8565  C  CA    . MET D  3  895  ? -108.323 39.137  8.542   1.00 51.46  ?  895  MET C CA    1 
ATOM   8566  C  C     . MET D  3  895  ? -108.668 38.722  7.121   1.00 61.19  ?  895  MET C C     1 
ATOM   8567  O  O     . MET D  3  895  ? -108.428 39.499  6.186   1.00 73.78  ?  895  MET C O     1 
ATOM   8568  C  CB    . MET D  3  895  ? -109.355 40.144  9.060   1.00 72.01  ?  895  MET C CB    1 
ATOM   8569  C  CG    . MET D  3  895  ? -110.742 39.572  9.318   1.00 81.73  ?  895  MET C CG    1 
ATOM   8570  S  SD    . MET D  3  895  ? -110.948 38.986  11.009  1.00 82.75  ?  895  MET C SD    1 
ATOM   8571  C  CE    . MET D  3  895  ? -110.260 40.365  11.915  1.00 59.30  ?  895  MET C CE    1 
ATOM   8572  N  N     . PRO D  3  896  ? -109.217 37.524  6.921   1.00 63.23  ?  896  PRO C N     1 
ATOM   8573  C  CA    . PRO D  3  896  ? -109.604 37.115  5.564   1.00 75.94  ?  896  PRO C CA    1 
ATOM   8574  C  C     . PRO D  3  896  ? -110.470 38.167  4.891   1.00 75.91  ?  896  PRO C C     1 
ATOM   8575  O  O     . PRO D  3  896  ? -111.572 38.468  5.359   1.00 82.82  ?  896  PRO C O     1 
ATOM   8576  C  CB    . PRO D  3  896  ? -110.370 35.803  5.790   1.00 67.54  ?  896  PRO C CB    1 
ATOM   8577  C  CG    . PRO D  3  896  ? -110.705 35.785  7.254   1.00 64.32  ?  896  PRO C CG    1 
ATOM   8578  C  CD    . PRO D  3  896  ? -109.586 36.516  7.927   1.00 64.34  ?  896  PRO C CD    1 
ATOM   8579  N  N     . PHE D  3  897  ? -109.976 38.743  3.798   1.00 70.05  ?  897  PHE C N     1 
ATOM   8580  C  CA    . PHE D  3  897  ? -110.657 39.831  3.116   1.00 76.02  ?  897  PHE C CA    1 
ATOM   8581  C  C     . PHE D  3  897  ? -110.914 39.472  1.659   1.00 73.51  ?  897  PHE C C     1 
ATOM   8582  O  O     . PHE D  3  897  ? -110.112 38.787  1.017   1.00 77.14  ?  897  PHE C O     1 
ATOM   8583  C  CB    . PHE D  3  897  ? -109.842 41.124  3.191   1.00 81.67  ?  897  PHE C CB    1 
ATOM   8584  C  CG    . PHE D  3  897  ? -108.466 41.010  2.601   1.00 76.76  ?  897  PHE C CG    1 
ATOM   8585  C  CD1   . PHE D  3  897  ? -108.235 41.355  1.282   1.00 76.55  ?  897  PHE C CD1   1 
ATOM   8586  C  CD2   . PHE D  3  897  ? -107.402 40.566  3.369   1.00 87.76  ?  897  PHE C CD2   1 
ATOM   8587  C  CE1   . PHE D  3  897  ? -106.970 41.258  0.737   1.00 73.61  ?  897  PHE C CE1   1 
ATOM   8588  C  CE2   . PHE D  3  897  ? -106.134 40.464  2.828   1.00 90.69  ?  897  PHE C CE2   1 
ATOM   8589  C  CZ    . PHE D  3  897  ? -105.918 40.813  1.511   1.00 74.54  ?  897  PHE C CZ    1 
ATOM   8590  N  N     . LEU D  3  898  ? -112.046 39.952  1.145   1.00 69.55  ?  898  LEU C N     1 
ATOM   8591  C  CA    . LEU D  3  898  ? -112.412 39.738  -0.242  1.00 71.03  ?  898  LEU C CA    1 
ATOM   8592  C  C     . LEU D  3  898  ? -111.417 40.440  -1.161  1.00 77.86  ?  898  LEU C C     1 
ATOM   8593  O  O     . LEU D  3  898  ? -110.568 41.212  -0.709  1.00 76.96  ?  898  LEU C O     1 
ATOM   8594  C  CB    . LEU D  3  898  ? -113.828 40.248  -0.497  1.00 68.70  ?  898  LEU C CB    1 
ATOM   8595  C  CG    . LEU D  3  898  ? -114.941 39.648  0.362   1.00 66.71  ?  898  LEU C CG    1 
ATOM   8596  C  CD1   . LEU D  3  898  ? -116.263 40.353  0.097   1.00 69.65  ?  898  LEU C CD1   1 
ATOM   8597  C  CD2   . LEU D  3  898  ? -115.071 38.161  0.095   1.00 76.00  ?  898  LEU C CD2   1 
ATOM   8598  N  N     . PRO D  3  899  ? -111.496 40.186  -2.469  1.00 72.25  ?  899  PRO C N     1 
ATOM   8599  C  CA    . PRO D  3  899  ? -110.619 40.905  -3.405  1.00 74.09  ?  899  PRO C CA    1 
ATOM   8600  C  C     . PRO D  3  899  ? -110.753 42.416  -3.321  1.00 84.53  ?  899  PRO C C     1 
ATOM   8601  O  O     . PRO D  3  899  ? -109.796 43.124  -3.658  1.00 89.89  ?  899  PRO C O     1 
ATOM   8602  C  CB    . PRO D  3  899  ? -111.063 40.376  -4.775  1.00 89.68  ?  899  PRO C CB    1 
ATOM   8603  C  CG    . PRO D  3  899  ? -111.636 39.030  -4.485  1.00 73.99  ?  899  PRO C CG    1 
ATOM   8604  C  CD    . PRO D  3  899  ? -112.302 39.155  -3.145  1.00 72.09  ?  899  PRO C CD    1 
ATOM   8605  N  N     . ASP D  3  900  ? -111.905 42.934  -2.886  1.00 86.74  ?  900  ASP C N     1 
ATOM   8606  C  CA    . ASP D  3  900  ? -112.066 44.370  -2.690  1.00 66.24  ?  900  ASP C CA    1 
ATOM   8607  C  C     . ASP D  3  900  ? -111.111 44.936  -1.653  1.00 74.00  ?  900  ASP C C     1 
ATOM   8608  O  O     . ASP D  3  900  ? -110.950 46.159  -1.590  1.00 85.16  ?  900  ASP C O     1 
ATOM   8609  C  CB    . ASP D  3  900  ? -113.493 44.699  -2.244  1.00 60.62  ?  900  ASP C CB    1 
ATOM   8610  C  CG    . ASP D  3  900  ? -114.539 44.267  -3.249  1.00 94.04  ?  900  ASP C CG    1 
ATOM   8611  O  OD1   . ASP D  3  900  ? -114.218 44.199  -4.455  1.00 117.12 ?  900  ASP C OD1   1 
ATOM   8612  O  OD2   . ASP D  3  900  ? -115.687 43.995  -2.831  1.00 84.04  ?  900  ASP C OD2   1 
ATOM   8613  N  N     . GLY D  3  901  ? -110.474 44.088  -0.851  1.00 87.52  ?  901  GLY C N     1 
ATOM   8614  C  CA    . GLY D  3  901  ? -109.843 44.532  0.368   1.00 87.91  ?  901  GLY C CA    1 
ATOM   8615  C  C     . GLY D  3  901  ? -110.790 44.644  1.541   1.00 83.11  ?  901  GLY C C     1 
ATOM   8616  O  O     . GLY D  3  901  ? -110.345 44.994  2.642   1.00 79.99  ?  901  GLY C O     1 
ATOM   8617  N  N     . THR D  3  902  ? -112.085 44.360  1.333   1.00 71.59  ?  902  THR C N     1 
ATOM   8618  C  CA    . THR D  3  902  ? -113.133 44.419  2.344   1.00 66.92  ?  902  THR C CA    1 
ATOM   8619  C  C     . THR D  3  902  ? -112.968 43.270  3.327   1.00 67.73  ?  902  THR C C     1 
ATOM   8620  O  O     . THR D  3  902  ? -113.314 42.123  3.014   1.00 83.67  ?  902  THR C O     1 
ATOM   8621  C  CB    . THR D  3  902  ? -114.517 44.353  1.698   1.00 68.91  ?  902  THR C CB    1 
ATOM   8622  O  OG1   . THR D  3  902  ? -114.650 45.395  0.725   1.00 80.40  ?  902  THR C OG1   1 
ATOM   8623  C  CG2   . THR D  3  902  ? -115.614 44.493  2.737   1.00 84.92  ?  902  THR C CG2   1 
ATOM   8624  N  N     . PRO D  3  903  ? -112.449 43.543  4.517   1.00 61.95  ?  903  PRO C N     1 
ATOM   8625  C  CA    . PRO D  3  903  ? -112.273 42.481  5.510   1.00 71.64  ?  903  PRO C CA    1 
ATOM   8626  C  C     . PRO D  3  903  ? -113.610 41.951  6.001   1.00 73.37  ?  903  PRO C C     1 
ATOM   8627  O  O     . PRO D  3  903  ? -114.608 42.672  6.058   1.00 72.46  ?  903  PRO C O     1 
ATOM   8628  C  CB    . PRO D  3  903  ? -111.508 43.177  6.644   1.00 67.27  ?  903  PRO C CB    1 
ATOM   8629  C  CG    . PRO D  3  903  ? -110.960 44.445  6.033   1.00 50.97  ?  903  PRO C CG    1 
ATOM   8630  C  CD    . PRO D  3  903  ? -111.953 44.839  4.995   1.00 64.55  ?  903  PRO C CD    1 
ATOM   8631  N  N     . VAL D  3  904  ? -113.620 40.668  6.360   1.00 67.50  ?  904  VAL C N     1 
ATOM   8632  C  CA    . VAL D  3  904  ? -114.797 40.063  6.967   1.00 66.02  ?  904  VAL C CA    1 
ATOM   8633  C  C     . VAL D  3  904  ? -114.849 40.445  8.439   1.00 76.52  ?  904  VAL C C     1 
ATOM   8634  O  O     . VAL D  3  904  ? -113.821 40.703  9.076   1.00 80.99  ?  904  VAL C O     1 
ATOM   8635  C  CB    . VAL D  3  904  ? -114.784 38.535  6.781   1.00 71.87  ?  904  VAL C CB    1 
ATOM   8636  C  CG1   . VAL D  3  904  ? -114.676 38.185  5.305   1.00 69.86  ?  904  VAL C CG1   1 
ATOM   8637  C  CG2   . VAL D  3  904  ? -113.633 37.926  7.566   1.00 77.04  ?  904  VAL C CG2   1 
ATOM   8638  N  N     . ASP D  3  905  ? -116.063 40.476  8.991   1.00 71.22  ?  905  ASP C N     1 
ATOM   8639  C  CA    . ASP D  3  905  ? -116.278 40.901  10.372  1.00 64.02  ?  905  ASP C CA    1 
ATOM   8640  C  C     . ASP D  3  905  ? -116.095 39.769  11.375  1.00 68.13  ?  905  ASP C C     1 
ATOM   8641  O  O     . ASP D  3  905  ? -115.452 39.963  12.411  1.00 64.36  ?  905  ASP C O     1 
ATOM   8642  C  CB    . ASP D  3  905  ? -117.673 41.503  10.528  1.00 76.37  ?  905  ASP C CB    1 
ATOM   8643  C  CG    . ASP D  3  905  ? -117.837 42.802  9.758   1.00 82.87  ?  905  ASP C CG    1 
ATOM   8644  O  OD1   . ASP D  3  905  ? -116.813 43.486  9.521   1.00 83.81  ?  905  ASP C OD1   1 
ATOM   8645  O  OD2   . ASP D  3  905  ? -118.983 43.143  9.394   1.00 79.60  ?  905  ASP C OD2   1 
ATOM   8646  N  N     . ILE D  3  906  ? -116.642 38.590  11.097  1.00 67.03  ?  906  ILE C N     1 
ATOM   8647  C  CA    . ILE D  3  906  ? -116.537 37.461  12.012  1.00 67.10  ?  906  ILE C CA    1 
ATOM   8648  C  C     . ILE D  3  906  ? -116.267 36.198  11.209  1.00 70.29  ?  906  ILE C C     1 
ATOM   8649  O  O     . ILE D  3  906  ? -116.800 36.022  10.108  1.00 78.84  ?  906  ILE C O     1 
ATOM   8650  C  CB    . ILE D  3  906  ? -117.807 37.294  12.870  1.00 69.41  ?  906  ILE C CB    1 
ATOM   8651  C  CG1   . ILE D  3  906  ? -118.966 36.789  12.012  1.00 66.23  ?  906  ILE C CG1   1 
ATOM   8652  C  CG2   . ILE D  3  906  ? -118.179 38.606  13.540  1.00 94.51  ?  906  ILE C CG2   1 
ATOM   8653  C  CD1   . ILE D  3  906  ? -120.244 36.550  12.796  1.00 75.18  ?  906  ILE C CD1   1 
ATOM   8654  N  N     . ILE D  3  907  ? -115.441 35.314  11.765  1.00 75.40  ?  907  ILE C N     1 
ATOM   8655  C  CA    . ILE D  3  907  ? -115.095 34.041  11.141  1.00 70.03  ?  907  ILE C CA    1 
ATOM   8656  C  C     . ILE D  3  907  ? -115.717 32.931  11.976  1.00 70.89  ?  907  ILE C C     1 
ATOM   8657  O  O     . ILE D  3  907  ? -115.334 32.726  13.135  1.00 82.08  ?  907  ILE C O     1 
ATOM   8658  C  CB    . ILE D  3  907  ? -113.574 33.863  11.028  1.00 66.93  ?  907  ILE C CB    1 
ATOM   8659  C  CG1   . ILE D  3  907  ? -112.943 35.104  10.388  1.00 71.74  ?  907  ILE C CG1   1 
ATOM   8660  C  CG2   . ILE D  3  907  ? -113.244 32.617  10.219  1.00 70.19  ?  907  ILE C CG2   1 
ATOM   8661  C  CD1   . ILE D  3  907  ? -111.428 35.082  10.374  1.00 61.25  ?  907  ILE C CD1   1 
ATOM   8662  N  N     . LEU D  3  908  ? -116.671 32.214  11.391  1.00 65.26  ?  908  LEU C N     1 
ATOM   8663  C  CA    . LEU D  3  908  ? -117.400 31.159  12.084  1.00 62.06  ?  908  LEU C CA    1 
ATOM   8664  C  C     . LEU D  3  908  ? -116.978 29.805  11.532  1.00 65.60  ?  908  LEU C C     1 
ATOM   8665  O  O     . LEU D  3  908  ? -117.072 29.567  10.323  1.00 78.67  ?  908  LEU C O     1 
ATOM   8666  C  CB    . LEU D  3  908  ? -118.909 31.346  11.935  1.00 55.67  ?  908  LEU C CB    1 
ATOM   8667  C  CG    . LEU D  3  908  ? -119.502 32.631  12.512  1.00 56.09  ?  908  LEU C CG    1 
ATOM   8668  C  CD1   . LEU D  3  908  ? -120.972 32.736  12.154  1.00 47.32  ?  908  LEU C CD1   1 
ATOM   8669  C  CD2   . LEU D  3  908  ? -119.309 32.680  14.019  1.00 61.07  ?  908  LEU C CD2   1 
ATOM   8670  N  N     . ASN D  3  909  ? -116.518 28.923  12.414  1.00 66.80  ?  909  ASN C N     1 
ATOM   8671  C  CA    . ASN D  3  909  ? -116.231 27.557  12.010  1.00 73.31  ?  909  ASN C CA    1 
ATOM   8672  C  C     . ASN D  3  909  ? -117.533 26.839  11.651  1.00 73.59  ?  909  ASN C C     1 
ATOM   8673  O  O     . ASN D  3  909  ? -118.638 27.327  11.905  1.00 71.46  ?  909  ASN C O     1 
ATOM   8674  C  CB    . ASN D  3  909  ? -115.488 26.816  13.121  1.00 64.01  ?  909  ASN C CB    1 
ATOM   8675  C  CG    . ASN D  3  909  ? -114.772 25.583  12.621  1.00 54.89  ?  909  ASN C CG    1 
ATOM   8676  O  OD1   . ASN D  3  909  ? -115.153 24.997  11.608  1.00 71.18  ?  909  ASN C OD1   1 
ATOM   8677  N  ND2   . ASN D  3  909  ? -113.723 25.181  13.330  1.00 68.37  ?  909  ASN C ND2   1 
ATOM   8678  N  N     . THR D  3  910  ? -117.393 25.660  11.044  1.00 75.16  ?  910  THR C N     1 
ATOM   8679  C  CA    . THR D  3  910  ? -118.551 24.872  10.619  1.00 84.10  ?  910  THR C CA    1 
ATOM   8680  C  C     . THR D  3  910  ? -119.054 24.067  11.815  1.00 93.68  ?  910  THR C C     1 
ATOM   8681  O  O     . THR D  3  910  ? -118.774 22.877  11.977  1.00 94.25  ?  910  THR C O     1 
ATOM   8682  C  CB    . THR D  3  910  ? -118.192 23.968  9.448   1.00 74.97  ?  910  THR C CB    1 
ATOM   8683  O  OG1   . THR D  3  910  ? -117.402 22.870  9.920   1.00 91.92  ?  910  THR C OG1   1 
ATOM   8684  C  CG2   . THR D  3  910  ? -117.399 24.744  8.411   1.00 67.60  ?  910  THR C CG2   1 
ATOM   8685  N  N     . HIS D  3  911  ? -119.821 24.743  12.670  1.00 104.55 ?  911  HIS C N     1 
ATOM   8686  C  CA    . HIS D  3  911  ? -120.359 24.088  13.857  1.00 111.32 ?  911  HIS C CA    1 
ATOM   8687  C  C     . HIS D  3  911  ? -121.230 22.894  13.482  1.00 115.80 ?  911  HIS C C     1 
ATOM   8688  O  O     . HIS D  3  911  ? -121.111 21.814  14.070  1.00 128.36 ?  911  HIS C O     1 
ATOM   8689  C  CB    . HIS D  3  911  ? -121.158 25.091  14.692  1.00 107.03 ?  911  HIS C CB    1 
ATOM   8690  C  CG    . HIS D  3  911  ? -122.103 24.450  15.661  1.00 123.27 ?  911  HIS C CG    1 
ATOM   8691  N  ND1   . HIS D  3  911  ? -121.692 23.920  16.866  1.00 128.78 ?  911  HIS C ND1   1 
ATOM   8692  C  CD2   . HIS D  3  911  ? -123.440 24.243  15.597  1.00 123.08 ?  911  HIS C CD2   1 
ATOM   8693  C  CE1   . HIS D  3  911  ? -122.737 23.424  17.506  1.00 119.66 ?  911  HIS C CE1   1 
ATOM   8694  N  NE2   . HIS D  3  911  ? -123.809 23.606  16.757  1.00 126.68 ?  911  HIS C NE2   1 
ATOM   8695  N  N     . GLY D  3  912  ? -122.123 23.075  12.511  1.00 97.57  ?  912  GLY C N     1 
ATOM   8696  C  CA    . GLY D  3  912  ? -123.074 22.040  12.156  1.00 121.21 ?  912  GLY C CA    1 
ATOM   8697  C  C     . GLY D  3  912  ? -122.457 20.781  11.583  1.00 126.81 ?  912  GLY C C     1 
ATOM   8698  O  O     . GLY D  3  912  ? -122.180 20.706  10.382  1.00 134.85 ?  912  GLY C O     1 
ATOM   8699  N  N     . VAL D  3  913  ? -122.227 19.786  12.434  1.00 112.82 ?  913  VAL C N     1 
ATOM   8700  C  CA    . VAL D  3  913  ? -121.771 18.478  11.973  1.00 127.82 ?  913  VAL C CA    1 
ATOM   8701  C  C     . VAL D  3  913  ? -122.905 17.837  11.182  1.00 131.49 ?  913  VAL C C     1 
ATOM   8702  O  O     . VAL D  3  913  ? -124.062 18.268  11.305  1.00 129.83 ?  913  VAL C O     1 
ATOM   8703  C  CB    . VAL D  3  913  ? -121.331 17.588  13.146  1.00 135.84 ?  913  VAL C CB    1 
ATOM   8704  C  CG1   . VAL D  3  913  ? -119.975 18.037  13.670  1.00 138.18 ?  913  VAL C CG1   1 
ATOM   8705  C  CG2   . VAL D  3  913  ? -122.374 17.620  14.255  1.00 126.72 ?  913  VAL C CG2   1 
ATOM   8706  N  N     . PRO D  3  914  ? -122.633 16.820  10.365  1.00 129.01 ?  914  PRO C N     1 
ATOM   8707  C  CA    . PRO D  3  914  ? -123.710 16.199  9.586   1.00 108.33 ?  914  PRO C CA    1 
ATOM   8708  C  C     . PRO D  3  914  ? -124.795 15.642  10.494  1.00 112.44 ?  914  PRO C C     1 
ATOM   8709  O  O     . PRO D  3  914  ? -124.533 15.201  11.615  1.00 116.25 ?  914  PRO C O     1 
ATOM   8710  C  CB    . PRO D  3  914  ? -122.994 15.086  8.811   1.00 101.73 ?  914  PRO C CB    1 
ATOM   8711  C  CG    . PRO D  3  914  ? -121.745 14.820  9.588   1.00 117.83 ?  914  PRO C CG    1 
ATOM   8712  C  CD    . PRO D  3  914  ? -121.341 16.142  10.168  1.00 121.48 ?  914  PRO C CD    1 
ATOM   8713  N  N     . ARG D  3  915  ? -126.031 15.676  9.992   1.00 107.99 ?  915  ARG C N     1 
ATOM   8714  C  CA    . ARG D  3  915  ? -127.205 15.277  10.760  1.00 107.62 ?  915  ARG C CA    1 
ATOM   8715  C  C     . ARG D  3  915  ? -127.604 16.377  11.739  1.00 120.12 ?  915  ARG C C     1 
ATOM   8716  O  O     . ARG D  3  915  ? -128.789 16.702  11.865  1.00 117.46 ?  915  ARG C O     1 
ATOM   8717  C  CB    . ARG D  3  915  ? -126.956 13.959  11.498  1.00 88.80  ?  915  ARG C CB    1 
ATOM   8718  N  N     . ARG D  3  916  ? -126.623 16.954  12.439  1.00 123.42 ?  916  ARG C N     1 
ATOM   8719  C  CA    . ARG D  3  916  ? -126.906 18.109  13.287  1.00 114.54 ?  916  ARG C CA    1 
ATOM   8720  C  C     . ARG D  3  916  ? -127.409 19.282  12.455  1.00 121.80 ?  916  ARG C C     1 
ATOM   8721  O  O     . ARG D  3  916  ? -128.352 19.978  12.851  1.00 129.36 ?  916  ARG C O     1 
ATOM   8722  C  CB    . ARG D  3  916  ? -125.659 18.501  14.078  1.00 112.69 ?  916  ARG C CB    1 
ATOM   8723  N  N     . MET D  3  917  ? -126.784 19.520  11.303  1.00 110.91 ?  917  MET C N     1 
ATOM   8724  C  CA    . MET D  3  917  ? -127.312 20.439  10.302  1.00 113.35 ?  917  MET C CA    1 
ATOM   8725  C  C     . MET D  3  917  ? -127.222 21.899  10.726  1.00 111.82 ?  917  MET C C     1 
ATOM   8726  O  O     . MET D  3  917  ? -126.207 22.561  10.488  1.00 114.67 ?  917  MET C O     1 
ATOM   8727  C  CB    . MET D  3  917  ? -128.765 20.084  9.976   1.00 131.30 ?  917  MET C CB    1 
ATOM   8728  N  N     . ASN D  3  918  ? -128.284 22.411  11.349  1.00 111.68 ?  918  ASN C N     1 
ATOM   8729  C  CA    . ASN D  3  918  ? -128.452 23.847  11.559  1.00 125.42 ?  918  ASN C CA    1 
ATOM   8730  C  C     . ASN D  3  918  ? -128.503 24.561  10.206  1.00 108.27 ?  918  ASN C C     1 
ATOM   8731  O  O     . ASN D  3  918  ? -127.730 25.476  9.914   1.00 97.51  ?  918  ASN C O     1 
ATOM   8732  C  CB    . ASN D  3  918  ? -127.345 24.413  12.453  1.00 122.14 ?  918  ASN C CB    1 
ATOM   8733  C  CG    . ASN D  3  918  ? -127.746 25.714  13.123  1.00 111.88 ?  918  ASN C CG    1 
ATOM   8734  O  OD1   . ASN D  3  918  ? -128.656 26.409  12.663  1.00 92.45  ?  918  ASN C OD1   1 
ATOM   8735  N  ND2   . ASN D  3  918  ? -127.070 26.050  14.217  1.00 107.06 ?  918  ASN C ND2   1 
ATOM   8736  N  N     . ILE D  3  919  ? -129.444 24.107  9.377   1.00 101.54 ?  919  ILE C N     1 
ATOM   8737  C  CA    . ILE D  3  919  ? -129.508 24.550  7.988   1.00 94.41  ?  919  ILE C CA    1 
ATOM   8738  C  C     . ILE D  3  919  ? -129.958 26.003  7.897   1.00 97.71  ?  919  ILE C C     1 
ATOM   8739  O  O     . ILE D  3  919  ? -129.453 26.770  7.069   1.00 96.16  ?  919  ILE C O     1 
ATOM   8740  C  CB    . ILE D  3  919  ? -130.432 23.618  7.185   1.00 108.16 ?  919  ILE C CB    1 
ATOM   8741  C  CG1   . ILE D  3  919  ? -130.999 24.344  5.963   1.00 104.54 ?  919  ILE C CG1   1 
ATOM   8742  C  CG2   . ILE D  3  919  ? -131.550 23.086  8.070   1.00 111.54 ?  919  ILE C CG2   1 
ATOM   8743  C  CD1   . ILE D  3  919  ? -129.955 24.734  4.944   1.00 107.57 ?  919  ILE C CD1   1 
ATOM   8744  N  N     . GLY D  3  920  ? -130.916 26.403  8.736   1.00 93.68  ?  920  GLY C N     1 
ATOM   8745  C  CA    . GLY D  3  920  ? -131.455 27.752  8.642   1.00 83.83  ?  920  GLY C CA    1 
ATOM   8746  C  C     . GLY D  3  920  ? -130.382 28.824  8.629   1.00 84.87  ?  920  GLY C C     1 
ATOM   8747  O  O     . GLY D  3  920  ? -130.500 29.826  7.919   1.00 85.93  ?  920  GLY C O     1 
ATOM   8748  N  N     . GLN D  3  921  ? -129.318 28.625  9.409   1.00 86.55  ?  921  GLN C N     1 
ATOM   8749  C  CA    . GLN D  3  921  ? -128.242 29.610  9.468   1.00 70.84  ?  921  GLN C CA    1 
ATOM   8750  C  C     . GLN D  3  921  ? -127.598 29.821  8.103   1.00 78.84  ?  921  GLN C C     1 
ATOM   8751  O  O     . GLN D  3  921  ? -127.317 30.959  7.711   1.00 91.32  ?  921  GLN C O     1 
ATOM   8752  C  CB    . GLN D  3  921  ? -127.192 29.176  10.489  1.00 81.96  ?  921  GLN C CB    1 
ATOM   8753  C  CG    . GLN D  3  921  ? -125.838 29.842  10.314  1.00 76.51  ?  921  GLN C CG    1 
ATOM   8754  C  CD    . GLN D  3  921  ? -124.802 29.294  11.274  1.00 99.43  ?  921  GLN C CD    1 
ATOM   8755  O  OE1   . GLN D  3  921  ? -125.134 28.846  12.372  1.00 95.96  ?  921  GLN C OE1   1 
ATOM   8756  N  NE2   . GLN D  3  921  ? -123.538 29.317  10.860  1.00 94.35  ?  921  GLN C NE2   1 
ATOM   8757  N  N     . ILE D  3  922  ? -127.347 28.738  7.367   1.00 89.21  ?  922  ILE C N     1 
ATOM   8758  C  CA    . ILE D  3  922  ? -126.686 28.864  6.071   1.00 87.23  ?  922  ILE C CA    1 
ATOM   8759  C  C     . ILE D  3  922  ? -127.545 29.669  5.105   1.00 81.53  ?  922  ILE C C     1 
ATOM   8760  O  O     . ILE D  3  922  ? -127.027 30.437  4.286   1.00 84.21  ?  922  ILE C O     1 
ATOM   8761  C  CB    . ILE D  3  922  ? -126.350 27.472  5.506   1.00 88.17  ?  922  ILE C CB    1 
ATOM   8762  C  CG1   . ILE D  3  922  ? -125.275 26.800  6.359   1.00 84.46  ?  922  ILE C CG1   1 
ATOM   8763  C  CG2   . ILE D  3  922  ? -125.898 27.588  4.055   1.00 93.37  ?  922  ILE C CG2   1 
ATOM   8764  C  CD1   . ILE D  3  922  ? -123.977 27.588  6.428   1.00 82.87  ?  922  ILE C CD1   1 
ATOM   8765  N  N     . LEU D  3  923  ? -128.867 29.507  5.186   1.00 81.35  ?  923  LEU C N     1 
ATOM   8766  C  CA    . LEU D  3  923  ? -129.761 30.172  4.245   1.00 80.82  ?  923  LEU C CA    1 
ATOM   8767  C  C     . LEU D  3  923  ? -129.731 31.686  4.425   1.00 84.23  ?  923  LEU C C     1 
ATOM   8768  O  O     . LEU D  3  923  ? -129.512 32.427  3.461   1.00 88.99  ?  923  LEU C O     1 
ATOM   8769  C  CB    . LEU D  3  923  ? -131.177 29.619  4.406   1.00 86.28  ?  923  LEU C CB    1 
ATOM   8770  C  CG    . LEU D  3  923  ? -131.297 28.122  4.102   1.00 80.13  ?  923  LEU C CG    1 
ATOM   8771  C  CD1   . LEU D  3  923  ? -132.720 27.636  4.308   1.00 86.35  ?  923  LEU C CD1   1 
ATOM   8772  C  CD2   . LEU D  3  923  ? -130.828 27.832  2.685   1.00 60.53  ?  923  LEU C CD2   1 
ATOM   8773  N  N     . GLU D  3  924  ? -129.948 32.169  5.652   1.00 69.43  ?  924  GLU C N     1 
ATOM   8774  C  CA    . GLU D  3  924  ? -129.937 33.611  5.872   1.00 78.43  ?  924  GLU C CA    1 
ATOM   8775  C  C     . GLU D  3  924  ? -128.577 34.228  5.573   1.00 80.83  ?  924  GLU C C     1 
ATOM   8776  O  O     . GLU D  3  924  ? -128.507 35.422  5.265   1.00 95.06  ?  924  GLU C O     1 
ATOM   8777  C  CB    . GLU D  3  924  ? -130.351 33.942  7.307   1.00 77.03  ?  924  GLU C CB    1 
ATOM   8778  C  CG    . GLU D  3  924  ? -129.267 33.726  8.347   1.00 82.82  ?  924  GLU C CG    1 
ATOM   8779  C  CD    . GLU D  3  924  ? -129.435 34.635  9.552   1.00 87.70  ?  924  GLU C CD    1 
ATOM   8780  O  OE1   . GLU D  3  924  ? -129.224 35.859  9.411   1.00 86.69  ?  924  GLU C OE1   1 
ATOM   8781  O  OE2   . GLU D  3  924  ? -129.789 34.128  10.638  1.00 83.63  ?  924  GLU C OE2   1 
ATOM   8782  N  N     . THR D  3  925  ? -127.498 33.448  5.656   1.00 71.34  ?  925  THR C N     1 
ATOM   8783  C  CA    . THR D  3  925  ? -126.182 33.978  5.318   1.00 65.33  ?  925  THR C CA    1 
ATOM   8784  C  C     . THR D  3  925  ? -126.103 34.332  3.839   1.00 79.29  ?  925  THR C C     1 
ATOM   8785  O  O     . THR D  3  925  ? -125.613 35.406  3.471   1.00 92.54  ?  925  THR C O     1 
ATOM   8786  C  CB    . THR D  3  925  ? -125.094 32.970  5.691   1.00 57.30  ?  925  THR C CB    1 
ATOM   8787  O  OG1   . THR D  3  925  ? -125.162 32.691  7.094   1.00 75.38  ?  925  THR C OG1   1 
ATOM   8788  C  CG2   . THR D  3  925  ? -123.720 33.528  5.362   1.00 60.29  ?  925  THR C CG2   1 
ATOM   8789  N  N     . HIS D  3  926  ? -126.583 33.437  2.974   1.00 79.99  ?  926  HIS C N     1 
ATOM   8790  C  CA    . HIS D  3  926  ? -126.590 33.726  1.544   1.00 85.98  ?  926  HIS C CA    1 
ATOM   8791  C  C     . HIS D  3  926  ? -127.554 34.861  1.225   1.00 83.63  ?  926  HIS C C     1 
ATOM   8792  O  O     . HIS D  3  926  ? -127.194 35.822  0.535   1.00 88.26  ?  926  HIS C O     1 
ATOM   8793  C  CB    . HIS D  3  926  ? -126.950 32.467  0.756   1.00 83.13  ?  926  HIS C CB    1 
ATOM   8794  C  CG    . HIS D  3  926  ? -125.906 31.397  0.827   1.00 84.56  ?  926  HIS C CG    1 
ATOM   8795  N  ND1   . HIS D  3  926  ? -124.556 31.674  0.818   1.00 93.40  ?  926  HIS C ND1   1 
ATOM   8796  C  CD2   . HIS D  3  926  ? -126.013 30.050  0.916   1.00 77.70  ?  926  HIS C CD2   1 
ATOM   8797  C  CE1   . HIS D  3  926  ? -123.876 30.544  0.894   1.00 85.07  ?  926  HIS C CE1   1 
ATOM   8798  N  NE2   . HIS D  3  926  ? -124.737 29.544  0.955   1.00 92.65  ?  926  HIS C NE2   1 
ATOM   8799  N  N     . LEU D  3  927  ? -128.788 34.768  1.725   1.00 75.92  ?  927  LEU C N     1 
ATOM   8800  C  CA    . LEU D  3  927  ? -129.737 35.859  1.540   1.00 80.27  ?  927  LEU C CA    1 
ATOM   8801  C  C     . LEU D  3  927  ? -129.169 37.170  2.067   1.00 80.35  ?  927  LEU C C     1 
ATOM   8802  O  O     . LEU D  3  927  ? -129.405 38.236  1.486   1.00 84.43  ?  927  LEU C O     1 
ATOM   8803  C  CB    . LEU D  3  927  ? -131.057 35.529  2.233   1.00 76.26  ?  927  LEU C CB    1 
ATOM   8804  C  CG    . LEU D  3  927  ? -132.313 35.751  1.391   1.00 72.85  ?  927  LEU C CG    1 
ATOM   8805  C  CD1   . LEU D  3  927  ? -133.565 35.649  2.253   1.00 76.63  ?  927  LEU C CD1   1 
ATOM   8806  C  CD2   . LEU D  3  927  ? -132.246 37.088  0.675   1.00 87.85  ?  927  LEU C CD2   1 
ATOM   8807  N  N     . GLY D  3  928  ? -128.416 37.110  3.166   1.00 83.17  ?  928  GLY C N     1 
ATOM   8808  C  CA    . GLY D  3  928  ? -127.786 38.312  3.684   1.00 70.95  ?  928  GLY C CA    1 
ATOM   8809  C  C     . GLY D  3  928  ? -126.900 38.990  2.658   1.00 78.35  ?  928  GLY C C     1 
ATOM   8810  O  O     . GLY D  3  928  ? -126.912 40.217  2.527   1.00 93.00  ?  928  GLY C O     1 
ATOM   8811  N  N     . TRP D  3  929  ? -126.123 38.201  1.912   1.00 77.90  ?  929  TRP C N     1 
ATOM   8812  C  CA    . TRP D  3  929  ? -125.293 38.777  0.858   1.00 81.69  ?  929  TRP C CA    1 
ATOM   8813  C  C     . TRP D  3  929  ? -126.145 39.259  -0.309  1.00 91.56  ?  929  TRP C C     1 
ATOM   8814  O  O     . TRP D  3  929  ? -125.845 40.294  -0.918  1.00 94.82  ?  929  TRP C O     1 
ATOM   8815  C  CB    . TRP D  3  929  ? -124.259 37.759  0.382   1.00 77.38  ?  929  TRP C CB    1 
ATOM   8816  C  CG    . TRP D  3  929  ? -123.463 38.234  -0.791  1.00 70.94  ?  929  TRP C CG    1 
ATOM   8817  C  CD1   . TRP D  3  929  ? -123.640 37.884  -2.097  1.00 84.31  ?  929  TRP C CD1   1 
ATOM   8818  C  CD2   . TRP D  3  929  ? -122.369 39.158  -0.767  1.00 65.37  ?  929  TRP C CD2   1 
ATOM   8819  N  NE1   . TRP D  3  929  ? -122.721 38.530  -2.888  1.00 100.89 ?  929  TRP C NE1   1 
ATOM   8820  C  CE2   . TRP D  3  929  ? -121.930 39.319  -2.094  1.00 90.07  ?  929  TRP C CE2   1 
ATOM   8821  C  CE3   . TRP D  3  929  ? -121.718 39.863  0.248   1.00 75.52  ?  929  TRP C CE3   1 
ATOM   8822  C  CZ2   . TRP D  3  929  ? -120.868 40.155  -2.432  1.00 103.13 ?  929  TRP C CZ2   1 
ATOM   8823  C  CZ3   . TRP D  3  929  ? -120.664 40.692  -0.090  1.00 63.39  ?  929  TRP C CZ3   1 
ATOM   8824  C  CH2   . TRP D  3  929  ? -120.251 40.832  -1.417  1.00 85.40  ?  929  TRP C CH2   1 
ATOM   8825  N  N     . VAL D  3  930  ? -127.207 38.522  -0.638  1.00 86.46  ?  930  VAL C N     1 
ATOM   8826  C  CA    . VAL D  3  930  ? -128.120 38.959  -1.691  1.00 85.50  ?  930  VAL C CA    1 
ATOM   8827  C  C     . VAL D  3  930  ? -128.718 40.316  -1.340  1.00 88.02  ?  930  VAL C C     1 
ATOM   8828  O  O     . VAL D  3  930  ? -128.651 41.270  -2.124  1.00 91.50  ?  930  VAL C O     1 
ATOM   8829  C  CB    . VAL D  3  930  ? -129.215 37.902  -1.920  1.00 85.12  ?  930  VAL C CB    1 
ATOM   8830  C  CG1   . VAL D  3  930  ? -130.220 38.391  -2.949  1.00 83.15  ?  930  VAL C CG1   1 
ATOM   8831  C  CG2   . VAL D  3  930  ? -128.596 36.583  -2.355  1.00 98.28  ?  930  VAL C CG2   1 
ATOM   8832  N  N     . ALA D  3  931  ? -129.307 40.422  -0.147  1.00 83.30  ?  931  ALA C N     1 
ATOM   8833  C  CA    . ALA D  3  931  ? -129.938 41.671  0.262   1.00 72.87  ?  931  ALA C CA    1 
ATOM   8834  C  C     . ALA D  3  931  ? -128.932 42.812  0.345   1.00 78.50  ?  931  ALA C C     1 
ATOM   8835  O  O     . ALA D  3  931  ? -129.285 43.970  0.098   1.00 92.88  ?  931  ALA C O     1 
ATOM   8836  C  CB    . ALA D  3  931  ? -130.652 41.478  1.600   1.00 67.47  ?  931  ALA C CB    1 
ATOM   8837  N  N     . LYS D  3  932  ? -127.677 42.507  0.679   1.00 72.02  ?  932  LYS C N     1 
ATOM   8838  C  CA    . LYS D  3  932  ? -126.654 43.541  0.796   1.00 72.75  ?  932  LYS C CA    1 
ATOM   8839  C  C     . LYS D  3  932  ? -126.199 44.070  -0.557  1.00 81.83  ?  932  LYS C C     1 
ATOM   8840  O  O     . LYS D  3  932  ? -125.853 45.251  -0.666  1.00 93.46  ?  932  LYS C O     1 
ATOM   8841  C  CB    . LYS D  3  932  ? -125.448 43.008  1.565   1.00 84.33  ?  932  LYS C CB    1 
ATOM   8842  C  CG    . LYS D  3  932  ? -124.318 44.011  1.725   1.00 94.28  ?  932  LYS C CG    1 
ATOM   8843  C  CD    . LYS D  3  932  ? -124.718 45.152  2.647   1.00 85.60  ?  932  LYS C CD    1 
ATOM   8844  C  CE    . LYS D  3  932  ? -123.554 46.105  2.887   1.00 82.50  ?  932  LYS C CE    1 
ATOM   8845  N  NZ    . LYS D  3  932  ? -123.885 47.173  3.873   1.00 100.40 ?  932  LYS C NZ    1 
ATOM   8846  N  N     . ALA D  3  933  ? -126.191 43.230  -1.589  1.00 87.46  ?  933  ALA C N     1 
ATOM   8847  C  CA    . ALA D  3  933  ? -125.698 43.624  -2.902  1.00 86.88  ?  933  ALA C CA    1 
ATOM   8848  C  C     . ALA D  3  933  ? -126.799 43.782  -3.939  1.00 88.60  ?  933  ALA C C     1 
ATOM   8849  O  O     . ALA D  3  933  ? -126.499 44.121  -5.089  1.00 94.36  ?  933  ALA C O     1 
ATOM   8850  C  CB    . ALA D  3  933  ? -124.667 42.609  -3.406  1.00 90.74  ?  933  ALA C CB    1 
ATOM   8851  N  N     . GLY D  3  934  ? -128.058 43.556  -3.572  1.00 89.98  ?  934  GLY C N     1 
ATOM   8852  C  CA    . GLY D  3  934  ? -129.131 43.633  -4.542  1.00 95.66  ?  934  GLY C CA    1 
ATOM   8853  C  C     . GLY D  3  934  ? -129.057 42.493  -5.546  1.00 96.17  ?  934  GLY C C     1 
ATOM   8854  O  O     . GLY D  3  934  ? -128.313 41.525  -5.389  1.00 102.58 ?  934  GLY C O     1 
ATOM   8855  N  N     . TRP D  3  935  ? -129.852 42.628  -6.603  1.00 97.98  ?  935  TRP C N     1 
ATOM   8856  C  CA    . TRP D  3  935  ? -129.876 41.613  -7.648  1.00 95.45  ?  935  TRP C CA    1 
ATOM   8857  C  C     . TRP D  3  935  ? -130.724 42.107  -8.813  1.00 108.97 ?  935  TRP C C     1 
ATOM   8858  O  O     . TRP D  3  935  ? -131.421 43.121  -8.719  1.00 120.19 ?  935  TRP C O     1 
ATOM   8859  C  CB    . TRP D  3  935  ? -130.408 40.281  -7.117  1.00 88.99  ?  935  TRP C CB    1 
ATOM   8860  C  CG    . TRP D  3  935  ? -131.845 40.329  -6.718  1.00 79.12  ?  935  TRP C CG    1 
ATOM   8861  C  CD1   . TRP D  3  935  ? -132.922 40.052  -7.507  1.00 94.14  ?  935  TRP C CD1   1 
ATOM   8862  C  CD2   . TRP D  3  935  ? -132.368 40.671  -5.429  1.00 89.90  ?  935  TRP C CD2   1 
ATOM   8863  N  NE1   . TRP D  3  935  ? -134.084 40.201  -6.791  1.00 109.92 ?  935  TRP C NE1   1 
ATOM   8864  C  CE2   . TRP D  3  935  ? -133.772 40.580  -5.512  1.00 103.58 ?  935  TRP C CE2   1 
ATOM   8865  C  CE3   . TRP D  3  935  ? -131.787 41.045  -4.214  1.00 90.56  ?  935  TRP C CE3   1 
ATOM   8866  C  CZ2   . TRP D  3  935  ? -134.605 40.848  -4.426  1.00 97.65  ?  935  TRP C CZ2   1 
ATOM   8867  C  CZ3   . TRP D  3  935  ? -132.615 41.311  -3.136  1.00 92.73  ?  935  TRP C CZ3   1 
ATOM   8868  C  CH2   . TRP D  3  935  ? -134.009 41.211  -3.250  1.00 95.30  ?  935  TRP C CH2   1 
ATOM   8869  N  N     . ASN D  3  936  ? -130.650 41.365  -9.916  1.00 116.75 ?  936  ASN C N     1 
ATOM   8870  C  CA    . ASN D  3  936  ? -131.431 41.658  -11.116 1.00 114.25 ?  936  ASN C CA    1 
ATOM   8871  C  C     . ASN D  3  936  ? -131.438 40.388  -11.957 1.00 113.53 ?  936  ASN C C     1 
ATOM   8872  O  O     . ASN D  3  936  ? -130.389 39.984  -12.469 1.00 121.64 ?  936  ASN C O     1 
ATOM   8873  C  CB    . ASN D  3  936  ? -130.834 42.832  -11.884 1.00 118.53 ?  936  ASN C CB    1 
ATOM   8874  C  CG    . ASN D  3  936  ? -131.804 43.430  -12.889 1.00 128.58 ?  936  ASN C CG    1 
ATOM   8875  O  OD1   . ASN D  3  936  ? -131.702 44.606  -13.239 1.00 128.98 ?  936  ASN C OD1   1 
ATOM   8876  N  ND2   . ASN D  3  936  ? -132.757 42.626  -13.348 1.00 124.68 ?  936  ASN C ND2   1 
ATOM   8877  N  N     . ILE D  3  937  ? -132.610 39.766  -12.098 1.00 103.98 ?  937  ILE C N     1 
ATOM   8878  C  CA    . ILE D  3  937  ? -132.709 38.468  -12.751 1.00 113.51 ?  937  ILE C CA    1 
ATOM   8879  C  C     . ILE D  3  937  ? -132.265 38.497  -14.207 1.00 122.91 ?  937  ILE C C     1 
ATOM   8880  O  O     . ILE D  3  937  ? -132.054 37.435  -14.800 1.00 128.62 ?  937  ILE C O     1 
ATOM   8881  C  CB    . ILE D  3  937  ? -134.150 37.920  -12.657 1.00 107.82 ?  937  ILE C CB    1 
ATOM   8882  C  CG1   . ILE D  3  937  ? -134.978 38.734  -11.662 1.00 113.83 ?  937  ILE C CG1   1 
ATOM   8883  C  CG2   . ILE D  3  937  ? -134.137 36.449  -12.270 1.00 112.36 ?  937  ILE C CG2   1 
ATOM   8884  C  CD1   . ILE D  3  937  ? -135.537 40.016  -12.242 1.00 121.40 ?  937  ILE C CD1   1 
ATOM   8885  N  N     . ASP D  3  938  ? -132.117 39.680  -14.799 1.00 127.34 ?  938  ASP C N     1 
ATOM   8886  C  CA    . ASP D  3  938  ? -131.734 39.812  -16.202 1.00 134.93 ?  938  ASP C CA    1 
ATOM   8887  C  C     . ASP D  3  938  ? -132.667 38.990  -17.091 1.00 134.31 ?  938  ASP C C     1 
ATOM   8888  O  O     . ASP D  3  938  ? -132.247 38.132  -17.870 1.00 116.96 ?  938  ASP C O     1 
ATOM   8889  C  CB    . ASP D  3  938  ? -130.273 39.408  -16.412 1.00 122.42 ?  938  ASP C CB    1 
ATOM   8890  N  N     . VAL D  3  939  ? -133.963 39.272  -16.953 1.00 131.27 ?  939  VAL C N     1 
ATOM   8891  C  CA    . VAL D  3  939  ? -134.976 38.507  -17.668 1.00 136.15 ?  939  VAL C CA    1 
ATOM   8892  C  C     . VAL D  3  939  ? -134.810 38.730  -19.165 1.00 137.44 ?  939  VAL C C     1 
ATOM   8893  O  O     . VAL D  3  939  ? -134.867 39.865  -19.652 1.00 128.65 ?  939  VAL C O     1 
ATOM   8894  C  CB    . VAL D  3  939  ? -136.380 38.892  -17.190 1.00 126.07 ?  939  VAL C CB    1 
ATOM   8895  C  CG1   . VAL D  3  939  ? -136.518 38.626  -15.698 1.00 111.44 ?  939  VAL C CG1   1 
ATOM   8896  C  CG2   . VAL D  3  939  ? -136.667 40.352  -17.502 1.00 122.52 ?  939  VAL C CG2   1 
ATOM   8897  N  N     . ALA D  3  940  ? -134.595 37.641  -19.900 1.00 140.69 ?  940  ALA C N     1 
ATOM   8898  C  CA    . ALA D  3  940  ? -134.472 37.685  -21.353 1.00 136.90 ?  940  ALA C CA    1 
ATOM   8899  C  C     . ALA D  3  940  ? -135.226 36.497  -21.925 1.00 138.47 ?  940  ALA C C     1 
ATOM   8900  O  O     . ALA D  3  940  ? -134.889 35.347  -21.627 1.00 130.89 ?  940  ALA C O     1 
ATOM   8901  C  CB    . ALA D  3  940  ? -133.005 37.660  -21.792 1.00 125.65 ?  940  ALA C CB    1 
ATOM   8902  N  N     . ALA D  3  941  ? -136.243 36.773  -22.740 1.00 143.78 ?  941  ALA C N     1 
ATOM   8903  C  CA    . ALA D  3  941  ? -137.116 35.734  -23.281 1.00 147.56 ?  941  ALA C CA    1 
ATOM   8904  C  C     . ALA D  3  941  ? -137.819 34.986  -22.146 1.00 141.31 ?  941  ALA C C     1 
ATOM   8905  O  O     . ALA D  3  941  ? -137.704 33.768  -21.994 1.00 138.18 ?  941  ALA C O     1 
ATOM   8906  C  CB    . ALA D  3  941  ? -136.331 34.773  -24.181 1.00 135.46 ?  941  ALA C CB    1 
ATOM   8907  N  N     . GLY D  3  942  ? -138.550 35.750  -21.343 1.00 139.33 ?  942  GLY C N     1 
ATOM   8908  C  CA    . GLY D  3  942  ? -139.216 35.204  -20.181 1.00 140.14 ?  942  GLY C CA    1 
ATOM   8909  C  C     . GLY D  3  942  ? -138.349 35.267  -18.940 1.00 136.58 ?  942  GLY C C     1 
ATOM   8910  O  O     . GLY D  3  942  ? -137.258 35.844  -18.918 1.00 134.24 ?  942  GLY C O     1 
ATOM   8911  N  N     . VAL D  3  943  ? -138.861 34.654  -17.878 1.00 125.06 ?  943  VAL C N     1 
ATOM   8912  C  CA    . VAL D  3  943  ? -138.146 34.588  -16.607 1.00 126.22 ?  943  VAL C CA    1 
ATOM   8913  C  C     . VAL D  3  943  ? -137.848 33.128  -16.288 1.00 131.50 ?  943  VAL C C     1 
ATOM   8914  O  O     . VAL D  3  943  ? -138.644 32.243  -16.636 1.00 130.00 ?  943  VAL C O     1 
ATOM   8915  C  CB    . VAL D  3  943  ? -138.948 35.255  -15.479 1.00 126.12 ?  943  VAL C CB    1 
ATOM   8916  C  CG1   . VAL D  3  943  ? -139.134 36.737  -15.769 1.00 118.49 ?  943  VAL C CG1   1 
ATOM   8917  C  CG2   . VAL D  3  943  ? -140.292 34.564  -15.304 1.00 112.28 ?  943  VAL C CG2   1 
ATOM   8918  N  N     . PRO D  3  944  ? -136.723 32.829  -15.638 1.00 121.05 ?  944  PRO C N     1 
ATOM   8919  C  CA    . PRO D  3  944  ? -136.384 31.431  -15.350 1.00 116.62 ?  944  PRO C CA    1 
ATOM   8920  C  C     . PRO D  3  944  ? -137.519 30.707  -14.639 1.00 116.17 ?  944  PRO C C     1 
ATOM   8921  O  O     . PRO D  3  944  ? -138.361 31.319  -13.977 1.00 112.61 ?  944  PRO C O     1 
ATOM   8922  C  CB    . PRO D  3  944  ? -135.143 31.547  -14.459 1.00 111.99 ?  944  PRO C CB    1 
ATOM   8923  C  CG    . PRO D  3  944  ? -134.520 32.840  -14.870 1.00 103.75 ?  944  PRO C CG    1 
ATOM   8924  C  CD    . PRO D  3  944  ? -135.666 33.758  -15.200 1.00 109.46 ?  944  PRO C CD    1 
ATOM   8925  N  N     . ASP D  3  945  ? -137.528 29.380  -14.785 1.00 124.12 ?  945  ASP C N     1 
ATOM   8926  C  CA    . ASP D  3  945  ? -138.601 28.567  -14.223 1.00 119.90 ?  945  ASP C CA    1 
ATOM   8927  C  C     . ASP D  3  945  ? -138.672 28.667  -12.706 1.00 126.58 ?  945  ASP C C     1 
ATOM   8928  O  O     . ASP D  3  945  ? -139.744 28.444  -12.133 1.00 130.08 ?  945  ASP C O     1 
ATOM   8929  C  CB    . ASP D  3  945  ? -138.419 27.107  -14.640 1.00 125.87 ?  945  ASP C CB    1 
ATOM   8930  C  CG    . ASP D  3  945  ? -138.029 26.962  -16.100 1.00 143.36 ?  945  ASP C CG    1 
ATOM   8931  O  OD1   . ASP D  3  945  ? -137.472 27.927  -16.665 1.00 145.80 ?  945  ASP C OD1   1 
ATOM   8932  O  OD2   . ASP D  3  945  ? -138.274 25.883  -16.681 1.00 139.71 ?  945  ASP C OD2   1 
ATOM   8933  N  N     . TRP D  3  946  ? -137.560 28.992  -12.041 1.00 127.51 ?  946  TRP C N     1 
ATOM   8934  C  CA    . TRP D  3  946  ? -137.578 29.068  -10.584 1.00 125.22 ?  946  TRP C CA    1 
ATOM   8935  C  C     . TRP D  3  946  ? -138.316 30.307  -10.095 1.00 123.14 ?  946  TRP C C     1 
ATOM   8936  O  O     . TRP D  3  946  ? -138.934 30.278  -9.024  1.00 115.72 ?  946  TRP C O     1 
ATOM   8937  C  CB    . TRP D  3  946  ? -136.150 29.041  -10.031 1.00 112.46 ?  946  TRP C CB    1 
ATOM   8938  C  CG    . TRP D  3  946  ? -135.369 30.315  -10.222 1.00 103.24 ?  946  TRP C CG    1 
ATOM   8939  C  CD1   . TRP D  3  946  ? -135.520 31.484  -9.528  1.00 102.11 ?  946  TRP C CD1   1 
ATOM   8940  C  CD2   . TRP D  3  946  ? -134.295 30.536  -11.145 1.00 98.60  ?  946  TRP C CD2   1 
ATOM   8941  N  NE1   . TRP D  3  946  ? -134.621 32.421  -9.974  1.00 104.07 ?  946  TRP C NE1   1 
ATOM   8942  C  CE2   . TRP D  3  946  ? -133.856 31.864  -10.965 1.00 108.71 ?  946  TRP C CE2   1 
ATOM   8943  C  CE3   . TRP D  3  946  ? -133.668 29.744  -12.111 1.00 100.56 ?  946  TRP C CE3   1 
ATOM   8944  C  CZ2   . TRP D  3  946  ? -132.818 32.416  -11.714 1.00 99.56  ?  946  TRP C CZ2   1 
ATOM   8945  C  CZ3   . TRP D  3  946  ? -132.637 30.294  -12.854 1.00 109.38 ?  946  TRP C CZ3   1 
ATOM   8946  C  CH2   . TRP D  3  946  ? -132.223 31.618  -12.651 1.00 97.56  ?  946  TRP C CH2   1 
ATOM   8947  N  N     . ALA D  3  947  ? -138.266 31.398  -10.858 1.00 117.35 ?  947  ALA C N     1 
ATOM   8948  C  CA    . ALA D  3  947  ? -138.932 32.636  -10.477 1.00 113.75 ?  947  ALA C CA    1 
ATOM   8949  C  C     . ALA D  3  947  ? -140.426 32.628  -10.777 1.00 125.43 ?  947  ALA C C     1 
ATOM   8950  O  O     . ALA D  3  947  ? -141.116 33.592  -10.428 1.00 125.54 ?  947  ALA C O     1 
ATOM   8951  C  CB    . ALA D  3  947  ? -138.269 33.823  -11.181 1.00 101.47 ?  947  ALA C CB    1 
ATOM   8952  N  N     . SER D  3  948  ? -140.939 31.569  -11.409 1.00 126.99 ?  948  SER C N     1 
ATOM   8953  C  CA    . SER D  3  948  ? -142.365 31.507  -11.718 1.00 129.42 ?  948  SER C CA    1 
ATOM   8954  C  C     . SER D  3  948  ? -143.209 31.620  -10.454 1.00 125.65 ?  948  SER C C     1 
ATOM   8955  O  O     . SER D  3  948  ? -144.197 32.366  -10.420 1.00 121.49 ?  948  SER C O     1 
ATOM   8956  C  CB    . SER D  3  948  ? -142.679 30.216  -12.468 1.00 132.25 ?  948  SER C CB    1 
ATOM   8957  O  OG    . SER D  3  948  ? -142.214 29.086  -11.751 1.00 134.69 ?  948  SER C OG    1 
ATOM   8958  N  N     . LYS D  3  949  ? -142.831 30.894  -9.401  1.00 126.47 ?  949  LYS C N     1 
ATOM   8959  C  CA    . LYS D  3  949  ? -143.549 30.960  -8.135  1.00 125.21 ?  949  LYS C CA    1 
ATOM   8960  C  C     . LYS D  3  949  ? -143.382 32.302  -7.434  1.00 123.72 ?  949  LYS C C     1 
ATOM   8961  O  O     . LYS D  3  949  ? -144.120 32.580  -6.483  1.00 119.35 ?  949  LYS C O     1 
ATOM   8962  C  CB    . LYS D  3  949  ? -143.079 29.834  -7.210  1.00 118.47 ?  949  LYS C CB    1 
ATOM   8963  C  CG    . LYS D  3  949  ? -143.948 29.615  -5.979  1.00 116.68 ?  949  LYS C CG    1 
ATOM   8964  C  CD    . LYS D  3  949  ? -145.310 29.045  -6.353  1.00 118.73 ?  949  LYS C CD    1 
ATOM   8965  C  CE    . LYS D  3  949  ? -146.088 28.604  -5.122  1.00 115.42 ?  949  LYS C CE    1 
ATOM   8966  N  NZ    . LYS D  3  949  ? -145.379 27.519  -4.390  1.00 109.17 ?  949  LYS C NZ    1 
ATOM   8967  N  N     . LEU D  3  950  ? -142.441 33.136  -7.882  1.00 122.75 ?  950  LEU C N     1 
ATOM   8968  C  CA    . LEU D  3  950  ? -142.159 34.408  -7.238  1.00 122.46 ?  950  LEU C CA    1 
ATOM   8969  C  C     . LEU D  3  950  ? -143.122 35.495  -7.710  1.00 130.11 ?  950  LEU C C     1 
ATOM   8970  O  O     . LEU D  3  950  ? -143.542 35.505  -8.871  1.00 133.64 ?  950  LEU C O     1 
ATOM   8971  C  CB    . LEU D  3  950