data_6W01
# 
_entry.id   6W01 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6W01         
WWPDB D_1000247386 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6W01 
_pdbx_database_status.recvd_initial_deposition_date   2020-02-28 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Kim, Y.'                                                       1 ? 
'Jedrzejczak, R.'                                               2 ? 
'Maltseva, N.'                                                  3 ? 
'Endres, M.'                                                    4 ? 
'Godzik, A.'                                                    5 ? 
'Michalska, K.'                                                 6 ? 
'Joachimiak, A.'                                                7 ? 
'Center for Structural Genomics of Infectious Diseases (CSGID)' 8 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_id_ASTM           PRCIEI 
_citation.journal_id_CSD            0795 
_citation.journal_id_ISSN           1469-896X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            29 
_citation.language                  ? 
_citation.page_first                1596 
_citation.page_last                 1605 
_citation.title                     'Crystal structure of Nsp15 endoribonuclease NendoU from SARS-CoV-2.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1002/pro.3873 
_citation.pdbx_database_id_PubMed   32304108 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kim, Y.'         1 ? 
primary 'Jedrzejczak, R.' 2 ? 
primary 'Maltseva, N.I.'  3 ? 
primary 'Wilamowski, M.'  4 ? 
primary 'Endres, M.'      5 ? 
primary 'Godzik, A.'      6 ? 
primary 'Michalska, K.'   7 ? 
primary 'Joachimiak, A.'  8 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6W01 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     150.784 
_cell.length_a_esd                 ? 
_cell.length_b                     150.784 
_cell.length_b_esd                 ? 
_cell.length_c                     111.682 
_cell.length_c_esd                 ? 
_cell.volume                       2198995.469 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6W01 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                173 
_symmetry.space_group_name_Hall            'P 6c' 
_symmetry.space_group_name_H-M             'P 63' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Uridylate-specific endoribonuclease' 41657.238 2   3.1.-.- ? ? ? 
2 non-polymer syn 1,2-ETHANEDIOL                        62.068    22  ?       ? ? ? 
3 non-polymer syn 'DI(HYDROXYETHYL)ETHER'               106.120   3   ?       ? ? ? 
4 non-polymer syn 'CITRIC ACID'                         192.124   2   ?       ? ? ? 
5 water       nat water                                 18.015    519 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'NSP15 endoribnuclease' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSNMSLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFE
LWAKRNIKPVPEVKILNNLGVDIAANTVIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRN
ARNGVLITEGSVKGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLEL
AMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVID
LLLDDFVEIIKSQDLSVVSKVVKVTIDYTEISFMLWCKDGHVETFYPKLQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSNMSLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFE
LWAKRNIKPVPEVKILNNLGVDIAANTVIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRN
ARNGVLITEGSVKGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLEL
AMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVID
LLLDDFVEIIKSQDLSVVSKVVKVTIDYTEISFMLWCKDGHVETFYPKLQ
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  ASN n 
1 24  MET n 
1 25  SER n 
1 26  LEU n 
1 27  GLU n 
1 28  ASN n 
1 29  VAL n 
1 30  ALA n 
1 31  PHE n 
1 32  ASN n 
1 33  VAL n 
1 34  VAL n 
1 35  ASN n 
1 36  LYS n 
1 37  GLY n 
1 38  HIS n 
1 39  PHE n 
1 40  ASP n 
1 41  GLY n 
1 42  GLN n 
1 43  GLN n 
1 44  GLY n 
1 45  GLU n 
1 46  VAL n 
1 47  PRO n 
1 48  VAL n 
1 49  SER n 
1 50  ILE n 
1 51  ILE n 
1 52  ASN n 
1 53  ASN n 
1 54  THR n 
1 55  VAL n 
1 56  TYR n 
1 57  THR n 
1 58  LYS n 
1 59  VAL n 
1 60  ASP n 
1 61  GLY n 
1 62  VAL n 
1 63  ASP n 
1 64  VAL n 
1 65  GLU n 
1 66  LEU n 
1 67  PHE n 
1 68  GLU n 
1 69  ASN n 
1 70  LYS n 
1 71  THR n 
1 72  THR n 
1 73  LEU n 
1 74  PRO n 
1 75  VAL n 
1 76  ASN n 
1 77  VAL n 
1 78  ALA n 
1 79  PHE n 
1 80  GLU n 
1 81  LEU n 
1 82  TRP n 
1 83  ALA n 
1 84  LYS n 
1 85  ARG n 
1 86  ASN n 
1 87  ILE n 
1 88  LYS n 
1 89  PRO n 
1 90  VAL n 
1 91  PRO n 
1 92  GLU n 
1 93  VAL n 
1 94  LYS n 
1 95  ILE n 
1 96  LEU n 
1 97  ASN n 
1 98  ASN n 
1 99  LEU n 
1 100 GLY n 
1 101 VAL n 
1 102 ASP n 
1 103 ILE n 
1 104 ALA n 
1 105 ALA n 
1 106 ASN n 
1 107 THR n 
1 108 VAL n 
1 109 ILE n 
1 110 TRP n 
1 111 ASP n 
1 112 TYR n 
1 113 LYS n 
1 114 ARG n 
1 115 ASP n 
1 116 ALA n 
1 117 PRO n 
1 118 ALA n 
1 119 HIS n 
1 120 ILE n 
1 121 SER n 
1 122 THR n 
1 123 ILE n 
1 124 GLY n 
1 125 VAL n 
1 126 CYS n 
1 127 SER n 
1 128 MET n 
1 129 THR n 
1 130 ASP n 
1 131 ILE n 
1 132 ALA n 
1 133 LYS n 
1 134 LYS n 
1 135 PRO n 
1 136 THR n 
1 137 GLU n 
1 138 THR n 
1 139 ILE n 
1 140 CYS n 
1 141 ALA n 
1 142 PRO n 
1 143 LEU n 
1 144 THR n 
1 145 VAL n 
1 146 PHE n 
1 147 PHE n 
1 148 ASP n 
1 149 GLY n 
1 150 ARG n 
1 151 VAL n 
1 152 ASP n 
1 153 GLY n 
1 154 GLN n 
1 155 VAL n 
1 156 ASP n 
1 157 LEU n 
1 158 PHE n 
1 159 ARG n 
1 160 ASN n 
1 161 ALA n 
1 162 ARG n 
1 163 ASN n 
1 164 GLY n 
1 165 VAL n 
1 166 LEU n 
1 167 ILE n 
1 168 THR n 
1 169 GLU n 
1 170 GLY n 
1 171 SER n 
1 172 VAL n 
1 173 LYS n 
1 174 GLY n 
1 175 LEU n 
1 176 GLN n 
1 177 PRO n 
1 178 SER n 
1 179 VAL n 
1 180 GLY n 
1 181 PRO n 
1 182 LYS n 
1 183 GLN n 
1 184 ALA n 
1 185 SER n 
1 186 LEU n 
1 187 ASN n 
1 188 GLY n 
1 189 VAL n 
1 190 THR n 
1 191 LEU n 
1 192 ILE n 
1 193 GLY n 
1 194 GLU n 
1 195 ALA n 
1 196 VAL n 
1 197 LYS n 
1 198 THR n 
1 199 GLN n 
1 200 PHE n 
1 201 ASN n 
1 202 TYR n 
1 203 TYR n 
1 204 LYS n 
1 205 LYS n 
1 206 VAL n 
1 207 ASP n 
1 208 GLY n 
1 209 VAL n 
1 210 VAL n 
1 211 GLN n 
1 212 GLN n 
1 213 LEU n 
1 214 PRO n 
1 215 GLU n 
1 216 THR n 
1 217 TYR n 
1 218 PHE n 
1 219 THR n 
1 220 GLN n 
1 221 SER n 
1 222 ARG n 
1 223 ASN n 
1 224 LEU n 
1 225 GLN n 
1 226 GLU n 
1 227 PHE n 
1 228 LYS n 
1 229 PRO n 
1 230 ARG n 
1 231 SER n 
1 232 GLN n 
1 233 MET n 
1 234 GLU n 
1 235 ILE n 
1 236 ASP n 
1 237 PHE n 
1 238 LEU n 
1 239 GLU n 
1 240 LEU n 
1 241 ALA n 
1 242 MET n 
1 243 ASP n 
1 244 GLU n 
1 245 PHE n 
1 246 ILE n 
1 247 GLU n 
1 248 ARG n 
1 249 TYR n 
1 250 LYS n 
1 251 LEU n 
1 252 GLU n 
1 253 GLY n 
1 254 TYR n 
1 255 ALA n 
1 256 PHE n 
1 257 GLU n 
1 258 HIS n 
1 259 ILE n 
1 260 VAL n 
1 261 TYR n 
1 262 GLY n 
1 263 ASP n 
1 264 PHE n 
1 265 SER n 
1 266 HIS n 
1 267 SER n 
1 268 GLN n 
1 269 LEU n 
1 270 GLY n 
1 271 GLY n 
1 272 LEU n 
1 273 HIS n 
1 274 LEU n 
1 275 LEU n 
1 276 ILE n 
1 277 GLY n 
1 278 LEU n 
1 279 ALA n 
1 280 LYS n 
1 281 ARG n 
1 282 PHE n 
1 283 LYS n 
1 284 GLU n 
1 285 SER n 
1 286 PRO n 
1 287 PHE n 
1 288 GLU n 
1 289 LEU n 
1 290 GLU n 
1 291 ASP n 
1 292 PHE n 
1 293 ILE n 
1 294 PRO n 
1 295 MET n 
1 296 ASP n 
1 297 SER n 
1 298 THR n 
1 299 VAL n 
1 300 LYS n 
1 301 ASN n 
1 302 TYR n 
1 303 PHE n 
1 304 ILE n 
1 305 THR n 
1 306 ASP n 
1 307 ALA n 
1 308 GLN n 
1 309 THR n 
1 310 GLY n 
1 311 SER n 
1 312 SER n 
1 313 LYS n 
1 314 CYS n 
1 315 VAL n 
1 316 CYS n 
1 317 SER n 
1 318 VAL n 
1 319 ILE n 
1 320 ASP n 
1 321 LEU n 
1 322 LEU n 
1 323 LEU n 
1 324 ASP n 
1 325 ASP n 
1 326 PHE n 
1 327 VAL n 
1 328 GLU n 
1 329 ILE n 
1 330 ILE n 
1 331 LYS n 
1 332 SER n 
1 333 GLN n 
1 334 ASP n 
1 335 LEU n 
1 336 SER n 
1 337 VAL n 
1 338 VAL n 
1 339 SER n 
1 340 LYS n 
1 341 VAL n 
1 342 VAL n 
1 343 LYS n 
1 344 VAL n 
1 345 THR n 
1 346 ILE n 
1 347 ASP n 
1 348 TYR n 
1 349 THR n 
1 350 GLU n 
1 351 ILE n 
1 352 SER n 
1 353 PHE n 
1 354 MET n 
1 355 LEU n 
1 356 TRP n 
1 357 CYS n 
1 358 LYS n 
1 359 ASP n 
1 360 GLY n 
1 361 HIS n 
1 362 VAL n 
1 363 GLU n 
1 364 THR n 
1 365 PHE n 
1 366 TYR n 
1 367 PRO n 
1 368 LYS n 
1 369 LEU n 
1 370 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   370 
_entity_src_gen.gene_src_common_name               2019-nCoV 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'rep, 1a-1b' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Severe acute respiratory syndrome coronavirus 2' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2697049 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              Gold 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pMCSG53 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    R1AB_SARS2 
_struct_ref.pdbx_db_accession          P0DTD1 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIA
ANTVIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSVKGLQPSVGPKQA
SLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDF
SHSQLGGLHLLIGLAKRFKESPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVVKV
TIDYTEISFMLWCKDGHVETFYPKLQ
;
_struct_ref.pdbx_align_begin           6453 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6W01 A 25 ? 370 ? P0DTD1 6453 ? 6798 ? 2 347 
2 1 6W01 B 25 ? 370 ? P0DTD1 6453 ? 6798 ? 2 347 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6W01 MET A 1  ? UNP P0DTD1 ? ? 'initiating methionine' -22 1  
1 6W01 HIS A 2  ? UNP P0DTD1 ? ? 'expression tag'        -21 2  
1 6W01 HIS A 3  ? UNP P0DTD1 ? ? 'expression tag'        -20 3  
1 6W01 HIS A 4  ? UNP P0DTD1 ? ? 'expression tag'        -19 4  
1 6W01 HIS A 5  ? UNP P0DTD1 ? ? 'expression tag'        -18 5  
1 6W01 HIS A 6  ? UNP P0DTD1 ? ? 'expression tag'        -17 6  
1 6W01 HIS A 7  ? UNP P0DTD1 ? ? 'expression tag'        -16 7  
1 6W01 SER A 8  ? UNP P0DTD1 ? ? 'expression tag'        -15 8  
1 6W01 SER A 9  ? UNP P0DTD1 ? ? 'expression tag'        -14 9  
1 6W01 GLY A 10 ? UNP P0DTD1 ? ? 'expression tag'        -13 10 
1 6W01 VAL A 11 ? UNP P0DTD1 ? ? 'expression tag'        -12 11 
1 6W01 ASP A 12 ? UNP P0DTD1 ? ? 'expression tag'        -11 12 
1 6W01 LEU A 13 ? UNP P0DTD1 ? ? 'expression tag'        -10 13 
1 6W01 GLY A 14 ? UNP P0DTD1 ? ? 'expression tag'        -9  14 
1 6W01 THR A 15 ? UNP P0DTD1 ? ? 'expression tag'        -8  15 
1 6W01 GLU A 16 ? UNP P0DTD1 ? ? 'expression tag'        -7  16 
1 6W01 ASN A 17 ? UNP P0DTD1 ? ? 'expression tag'        -6  17 
1 6W01 LEU A 18 ? UNP P0DTD1 ? ? 'expression tag'        -5  18 
1 6W01 TYR A 19 ? UNP P0DTD1 ? ? 'expression tag'        -4  19 
1 6W01 PHE A 20 ? UNP P0DTD1 ? ? 'expression tag'        -3  20 
1 6W01 GLN A 21 ? UNP P0DTD1 ? ? 'expression tag'        -2  21 
1 6W01 SER A 22 ? UNP P0DTD1 ? ? 'expression tag'        -1  22 
1 6W01 ASN A 23 ? UNP P0DTD1 ? ? 'expression tag'        0   23 
1 6W01 MET A 24 ? UNP P0DTD1 ? ? 'expression tag'        1   24 
2 6W01 MET B 1  ? UNP P0DTD1 ? ? 'initiating methionine' -22 25 
2 6W01 HIS B 2  ? UNP P0DTD1 ? ? 'expression tag'        -21 26 
2 6W01 HIS B 3  ? UNP P0DTD1 ? ? 'expression tag'        -20 27 
2 6W01 HIS B 4  ? UNP P0DTD1 ? ? 'expression tag'        -19 28 
2 6W01 HIS B 5  ? UNP P0DTD1 ? ? 'expression tag'        -18 29 
2 6W01 HIS B 6  ? UNP P0DTD1 ? ? 'expression tag'        -17 30 
2 6W01 HIS B 7  ? UNP P0DTD1 ? ? 'expression tag'        -16 31 
2 6W01 SER B 8  ? UNP P0DTD1 ? ? 'expression tag'        -15 32 
2 6W01 SER B 9  ? UNP P0DTD1 ? ? 'expression tag'        -14 33 
2 6W01 GLY B 10 ? UNP P0DTD1 ? ? 'expression tag'        -13 34 
2 6W01 VAL B 11 ? UNP P0DTD1 ? ? 'expression tag'        -12 35 
2 6W01 ASP B 12 ? UNP P0DTD1 ? ? 'expression tag'        -11 36 
2 6W01 LEU B 13 ? UNP P0DTD1 ? ? 'expression tag'        -10 37 
2 6W01 GLY B 14 ? UNP P0DTD1 ? ? 'expression tag'        -9  38 
2 6W01 THR B 15 ? UNP P0DTD1 ? ? 'expression tag'        -8  39 
2 6W01 GLU B 16 ? UNP P0DTD1 ? ? 'expression tag'        -7  40 
2 6W01 ASN B 17 ? UNP P0DTD1 ? ? 'expression tag'        -6  41 
2 6W01 LEU B 18 ? UNP P0DTD1 ? ? 'expression tag'        -5  42 
2 6W01 TYR B 19 ? UNP P0DTD1 ? ? 'expression tag'        -4  43 
2 6W01 PHE B 20 ? UNP P0DTD1 ? ? 'expression tag'        -3  44 
2 6W01 GLN B 21 ? UNP P0DTD1 ? ? 'expression tag'        -2  45 
2 6W01 SER B 22 ? UNP P0DTD1 ? ? 'expression tag'        -1  46 
2 6W01 ASN B 23 ? UNP P0DTD1 ? ? 'expression tag'        0   47 
2 6W01 MET B 24 ? UNP P0DTD1 ? ? 'expression tag'        1   48 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                 ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ?                 'C4 H7 N O4'     133.103 
CIT non-polymer         . 'CITRIC ACID'           ?                 'C6 H8 O7'       192.124 
CYS 'L-peptide linking' y CYSTEINE                ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL          'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE               ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE               ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                   ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                 ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE              ?                 'C5 H11 N O2 S'  149.211 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER' ?                 'C4 H10 O3'      106.120 
PHE 'L-peptide linking' y PHENYLALANINE           ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                 ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                  ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE               ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ?                 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6W01 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.40 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         72.03 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M sodium citrate pH 5.6, 10 %(w/v) PEG4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 X 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2020-02-25 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            31.50 
_reflns.entry_id                         6W01 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.9 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       111894 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.3 
_reflns.pdbx_Rmerge_I_obs                0.112 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.11 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.982 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.9 
_reflns_shell.d_res_low                   1.93 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.44 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           5660 
_reflns_shell.percent_possible_all        99.7 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.53 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             5.1 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.586 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               41.15 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6W01 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.90 
_refine.ls_d_res_low                             44.87 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     111305 
_refine.ls_number_reflns_R_free                  5485 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.70 
_refine.ls_percent_reflns_R_free                 4.93 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1617 
_refine.ls_R_factor_R_free                       0.1849 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1605 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.38 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDBID 6VWW' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 18.7626 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1948 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        44.87 
_refine_hist.number_atoms_solvent             519 
_refine_hist.number_atoms_total               6134 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        5537 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         78 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0113  ? 5827 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.9869  ? 7860 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0730  ? 891  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0057  ? 1009 ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 14.6769 ? 3473 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.90 1.93  . . 148 3242 90.59 . . . 0.3105 . 0.2862 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.93 1.95  . . 156 3390 94.41 . . . 0.2748 . 0.2622 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.95 1.97  . . 179 3464 97.64 . . . 0.3074 . 0.2558 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.97 2.00  . . 157 3634 99.48 . . . 0.3202 . 0.2421 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.00 2.02  . . 142 3543 99.70 . . . 0.2435 . 0.2390 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.02 2.05  . . 166 3550 99.65 . . . 0.2567 . 0.2260 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.05 2.08  . . 184 3540 99.55 . . . 0.2476 . 0.2133 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.08 2.11  . . 194 3572 99.87 . . . 0.2418 . 0.2104 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.11 2.14  . . 200 3516 99.79 . . . 0.2412 . 0.2003 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.14 2.18  . . 197 3562 99.71 . . . 0.2247 . 0.1911 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.18 2.22  . . 227 3512 99.55 . . . 0.2274 . 0.1772 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.22 2.26  . . 172 3539 99.52 . . . 0.1962 . 0.1761 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.26 2.30  . . 172 3534 99.49 . . . 0.2026 . 0.1727 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.30 2.35  . . 168 3595 99.26 . . . 0.1769 . 0.1631 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.35 2.40  . . 201 3511 99.52 . . . 0.1860 . 0.1570 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.40 2.45  . . 171 3571 99.73 . . . 0.1771 . 0.1661 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.45 2.52  . . 229 3530 99.39 . . . 0.1950 . 0.1545 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.52 2.58  . . 199 3505 99.60 . . . 0.1908 . 0.1620 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.58 2.66  . . 200 3557 99.50 . . . 0.2129 . 0.1583 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.66 2.74  . . 219 3495 99.17 . . . 0.1978 . 0.1543 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.74 2.84  . . 206 3533 99.13 . . . 0.1858 . 0.1577 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.84 2.96  . . 179 3532 98.88 . . . 0.1900 . 0.1576 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.96 3.09  . . 179 3546 99.04 . . . 0.1882 . 0.1566 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.09 3.25  . . 137 3571 98.85 . . . 0.2025 . 0.1599 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.25 3.46  . . 174 3539 98.65 . . . 0.1862 . 0.1549 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.46 3.73  . . 193 3532 98.96 . . . 0.1666 . 0.1517 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.73 4.10  . . 207 3548 99.13 . . . 0.1524 . 0.1424 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.10 4.69  . . 165 3590 99.02 . . . 0.1438 . 0.1225 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.69 5.91  . . 174 3548 98.21 . . . 0.1420 . 0.1337 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.91 44.87 . . 190 3519 96.01 . . . 0.1694 . 0.1590 . . . . . . . . . . . 
# 
_struct.entry_id                     6W01 
_struct.title                        
'The 1.9 A Crystal Structure of NSP15 Endoribonuclease from SARS CoV-2 in the Complex with a Citrate' 
_struct.pdbx_descriptor              'Uridylate-specific endoribonuclease' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6W01 
_struct_keywords.text            
'SARS Corona virus, endonuclease, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, VIRAL PROTEIN' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 2 ? 
E  N N 2 ? 
F  N N 2 ? 
G  N N 3 ? 
H  N N 3 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 2 ? 
N  N N 4 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 2 ? 
T  N N 2 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 4 ? 
Y  N N 2 ? 
Z  N N 2 ? 
AA N N 3 ? 
BA N N 2 ? 
CA N N 2 ? 
DA N N 5 ? 
EA N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 25  ? GLY A 37  ? SER A 2   GLY A 14  1 ? 13 
HELX_P HELX_P2  AA2 PRO A 74  ? LYS A 84  ? PRO A 51  LYS A 61  1 ? 11 
HELX_P HELX_P3  AA3 GLU A 92  ? LEU A 99  ? GLU A 69  LEU A 76  1 ? 8  
HELX_P HELX_P4  AA4 GLU A 137 ? ALA A 141 ? GLU A 114 ALA A 118 5 ? 5  
HELX_P HELX_P5  AA5 GLY A 153 ? ALA A 161 ? GLY A 130 ALA A 138 1 ? 9  
HELX_P HELX_P6  AA6 SER A 231 ? LEU A 240 ? SER A 208 LEU A 217 1 ? 10 
HELX_P HELX_P7  AA7 ALA A 241 ? TYR A 249 ? ALA A 218 TYR A 226 1 ? 9  
HELX_P HELX_P8  AA8 ALA A 255 ? VAL A 260 ? ALA A 232 VAL A 237 1 ? 6  
HELX_P HELX_P9  AA9 LEU A 274 ? SER A 285 ? LEU A 251 SER A 262 1 ? 12 
HELX_P HELX_P10 AB1 LEU A 322 ? LYS A 331 ? LEU A 299 LYS A 308 1 ? 10 
HELX_P HELX_P11 AB2 SER B 25  ? GLY B 37  ? SER B 2   GLY B 14  1 ? 13 
HELX_P HELX_P12 AB3 PRO B 74  ? LYS B 84  ? PRO B 51  LYS B 61  1 ? 11 
HELX_P HELX_P13 AB4 GLU B 92  ? LEU B 99  ? GLU B 69  LEU B 76  1 ? 8  
HELX_P HELX_P14 AB5 GLU B 137 ? ALA B 141 ? GLU B 114 ALA B 118 5 ? 5  
HELX_P HELX_P15 AB6 GLY B 153 ? ALA B 161 ? GLY B 130 ALA B 138 1 ? 9  
HELX_P HELX_P16 AB7 SER B 231 ? LEU B 240 ? SER B 208 LEU B 217 1 ? 10 
HELX_P HELX_P17 AB8 ALA B 241 ? TYR B 249 ? ALA B 218 TYR B 226 1 ? 9  
HELX_P HELX_P18 AB9 ALA B 255 ? VAL B 260 ? ALA B 232 VAL B 237 1 ? 6  
HELX_P HELX_P19 AC1 LEU B 274 ? SER B 285 ? LEU B 251 SER B 262 1 ? 12 
HELX_P HELX_P20 AC2 LEU B 322 ? SER B 332 ? LEU B 299 SER B 309 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 5 ? 
AA3 ? 5 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 3 ? 
AA8 ? 3 ? 
AA9 ? 3 ? 
AB1 ? 5 ? 
AB2 ? 5 ? 
AB3 ? 2 ? 
AB4 ? 2 ? 
AB5 ? 2 ? 
AB6 ? 3 ? 
AB7 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? parallel      
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? parallel      
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? parallel      
AB1 2 3 ? parallel      
AB1 3 4 ? anti-parallel 
AB1 4 5 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB2 3 4 ? anti-parallel 
AB2 4 5 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? parallel      
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 48  ? ILE A 51  ? VAL A 25  ILE A 28  
AA1 2 THR A 54  ? VAL A 59  ? THR A 31  VAL A 36  
AA1 3 VAL A 62  ? GLU A 68  ? VAL A 39  GLU A 45  
AA2 1 ILE A 103 ? ALA A 104 ? ILE A 80  ALA A 81  
AA2 2 VAL A 145 ? ASP A 148 ? VAL A 122 ASP A 125 
AA2 3 GLY A 164 ? THR A 168 ? GLY A 141 THR A 145 
AA2 4 ASN A 201 ? VAL A 206 ? ASN A 178 VAL A 183 
AA2 5 SER A 178 ? VAL A 179 ? SER A 155 VAL A 156 
AA3 1 ILE A 103 ? ALA A 104 ? ILE A 80  ALA A 81  
AA3 2 VAL A 145 ? ASP A 148 ? VAL A 122 ASP A 125 
AA3 3 GLY A 164 ? THR A 168 ? GLY A 141 THR A 145 
AA3 4 ASN A 201 ? VAL A 206 ? ASN A 178 VAL A 183 
AA3 5 VAL A 209 ? VAL A 210 ? VAL A 186 VAL A 187 
AA4 1 TRP A 110 ? ASP A 111 ? TRP A 87  ASP A 88  
AA4 2 ALA A 116 ? PRO A 117 ? ALA A 93  PRO A 94  
AA5 1 THR A 122 ? ILE A 123 ? THR A 99  ILE A 100 
AA5 2 ASP A 130 ? ALA A 132 ? ASP A 107 ALA A 109 
AA6 1 ALA A 184 ? LEU A 186 ? ALA A 161 LEU A 163 
AA6 2 VAL A 189 ? LEU A 191 ? VAL A 166 LEU A 168 
AA7 1 PHE A 287 ? GLU A 290 ? PHE A 264 GLU A 267 
AA7 2 LYS A 300 ? ASP A 306 ? LYS A 277 ASP A 283 
AA7 3 SER A 312 ? VAL A 318 ? SER A 289 VAL A 295 
AA8 1 SER A 339 ? ILE A 346 ? SER A 316 ILE A 323 
AA8 2 THR A 349 ? LYS A 358 ? THR A 326 LYS A 335 
AA8 3 HIS A 361 ? PRO A 367 ? HIS A 338 PRO A 344 
AA9 1 VAL B 48  ? ILE B 51  ? VAL B 25  ILE B 28  
AA9 2 THR B 54  ? VAL B 59  ? THR B 31  VAL B 36  
AA9 3 VAL B 62  ? GLU B 68  ? VAL B 39  GLU B 45  
AB1 1 ILE B 103 ? ALA B 104 ? ILE B 80  ALA B 81  
AB1 2 VAL B 145 ? ASP B 148 ? VAL B 122 ASP B 125 
AB1 3 GLY B 164 ? THR B 168 ? GLY B 141 THR B 145 
AB1 4 ASN B 201 ? VAL B 206 ? ASN B 178 VAL B 183 
AB1 5 SER B 178 ? VAL B 179 ? SER B 155 VAL B 156 
AB2 1 ILE B 103 ? ALA B 104 ? ILE B 80  ALA B 81  
AB2 2 VAL B 145 ? ASP B 148 ? VAL B 122 ASP B 125 
AB2 3 GLY B 164 ? THR B 168 ? GLY B 141 THR B 145 
AB2 4 ASN B 201 ? VAL B 206 ? ASN B 178 VAL B 183 
AB2 5 VAL B 209 ? GLN B 211 ? VAL B 186 GLN B 188 
AB3 1 TRP B 110 ? ASP B 111 ? TRP B 87  ASP B 88  
AB3 2 ALA B 116 ? PRO B 117 ? ALA B 93  PRO B 94  
AB4 1 THR B 122 ? ILE B 123 ? THR B 99  ILE B 100 
AB4 2 ASP B 130 ? ALA B 132 ? ASP B 107 ALA B 109 
AB5 1 ALA B 184 ? LEU B 186 ? ALA B 161 LEU B 163 
AB5 2 VAL B 189 ? LEU B 191 ? VAL B 166 LEU B 168 
AB6 1 PHE B 287 ? GLU B 290 ? PHE B 264 GLU B 267 
AB6 2 LYS B 300 ? ASP B 306 ? LYS B 277 ASP B 283 
AB6 3 SER B 312 ? VAL B 318 ? SER B 289 VAL B 295 
AB7 1 SER B 339 ? ILE B 346 ? SER B 316 ILE B 323 
AB7 2 THR B 349 ? LYS B 358 ? THR B 326 LYS B 335 
AB7 3 HIS B 361 ? PRO B 367 ? HIS B 338 PRO B 344 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 49  ? N SER A 26  O TYR A 56  ? O TYR A 33  
AA1 2 3 N VAL A 59  ? N VAL A 36  O VAL A 62  ? O VAL A 39  
AA2 1 2 N ILE A 103 ? N ILE A 80  O PHE A 146 ? O PHE A 123 
AA2 2 3 N PHE A 147 ? N PHE A 124 O VAL A 165 ? O VAL A 142 
AA2 3 4 N GLY A 164 ? N GLY A 141 O LYS A 205 ? O LYS A 182 
AA2 4 5 O TYR A 202 ? O TYR A 179 N SER A 178 ? N SER A 155 
AA3 1 2 N ILE A 103 ? N ILE A 80  O PHE A 146 ? O PHE A 123 
AA3 2 3 N PHE A 147 ? N PHE A 124 O VAL A 165 ? O VAL A 142 
AA3 3 4 N GLY A 164 ? N GLY A 141 O LYS A 205 ? O LYS A 182 
AA3 4 5 N VAL A 206 ? N VAL A 183 O VAL A 209 ? O VAL A 186 
AA4 1 2 N ASP A 111 ? N ASP A 88  O ALA A 116 ? O ALA A 93  
AA5 1 2 N THR A 122 ? N THR A 99  O ILE A 131 ? O ILE A 108 
AA6 1 2 N LEU A 186 ? N LEU A 163 O VAL A 189 ? O VAL A 166 
AA7 1 2 N GLU A 288 ? N GLU A 265 O THR A 305 ? O THR A 282 
AA7 2 3 N LYS A 300 ? N LYS A 277 O VAL A 318 ? O VAL A 295 
AA8 1 2 N VAL A 342 ? N VAL A 319 O PHE A 353 ? O PHE A 330 
AA8 2 3 N TRP A 356 ? N TRP A 333 O GLU A 363 ? O GLU A 340 
AA9 1 2 N SER B 49  ? N SER B 26  O TYR B 56  ? O TYR B 33  
AA9 2 3 N VAL B 59  ? N VAL B 36  O VAL B 62  ? O VAL B 39  
AB1 1 2 N ILE B 103 ? N ILE B 80  O PHE B 146 ? O PHE B 123 
AB1 2 3 N PHE B 147 ? N PHE B 124 O VAL B 165 ? O VAL B 142 
AB1 3 4 N GLY B 164 ? N GLY B 141 O LYS B 205 ? O LYS B 182 
AB1 4 5 O TYR B 202 ? O TYR B 179 N SER B 178 ? N SER B 155 
AB2 1 2 N ILE B 103 ? N ILE B 80  O PHE B 146 ? O PHE B 123 
AB2 2 3 N PHE B 147 ? N PHE B 124 O VAL B 165 ? O VAL B 142 
AB2 3 4 N GLY B 164 ? N GLY B 141 O LYS B 205 ? O LYS B 182 
AB2 4 5 N LYS B 204 ? N LYS B 181 O GLN B 211 ? O GLN B 188 
AB3 1 2 N ASP B 111 ? N ASP B 88  O ALA B 116 ? O ALA B 93  
AB4 1 2 N THR B 122 ? N THR B 99  O ILE B 131 ? O ILE B 108 
AB5 1 2 N LEU B 186 ? N LEU B 163 O VAL B 189 ? O VAL B 166 
AB6 1 2 N GLU B 288 ? N GLU B 265 O THR B 305 ? O THR B 282 
AB6 2 3 N LYS B 300 ? N LYS B 277 O VAL B 318 ? O VAL B 295 
AB7 1 2 N VAL B 342 ? N VAL B 319 O PHE B 353 ? O PHE B 330 
AB7 2 3 N TRP B 356 ? N TRP B 333 O GLU B 363 ? O GLU B 340 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A EDO 401 ? 6  'binding site for residue EDO A 401' 
AC2 Software A EDO 402 ? 8  'binding site for residue EDO A 402' 
AC3 Software A EDO 403 ? 2  'binding site for residue EDO A 403' 
AC4 Software A EDO 404 ? 7  'binding site for residue EDO A 404' 
AC5 Software A PEG 405 ? 6  'binding site for residue PEG A 405' 
AC6 Software A PEG 406 ? 6  'binding site for residue PEG A 406' 
AC7 Software A EDO 407 ? 6  'binding site for residue EDO A 407' 
AC8 Software A EDO 408 ? 6  'binding site for residue EDO A 408' 
AC9 Software A EDO 409 ? 4  'binding site for residue EDO A 409' 
AD1 Software A EDO 410 ? 2  'binding site for residue EDO A 410' 
AD2 Software A EDO 411 ? 3  'binding site for residue EDO A 411' 
AD3 Software A CIT 412 ? 12 'binding site for residue CIT A 412' 
AD4 Software A EDO 413 ? 4  'binding site for residue EDO A 413' 
AD5 Software A EDO 414 ? 5  'binding site for residue EDO A 414' 
AD6 Software B EDO 401 ? 5  'binding site for residue EDO B 401' 
AD7 Software B EDO 402 ? 8  'binding site for residue EDO B 402' 
AD8 Software B EDO 403 ? 5  'binding site for residue EDO B 403' 
AD9 Software B EDO 404 ? 5  'binding site for residue EDO B 404' 
AE1 Software B EDO 405 ? 4  'binding site for residue EDO B 405' 
AE2 Software B EDO 406 ? 5  'binding site for residue EDO B 406' 
AE3 Software B EDO 407 ? 3  'binding site for residue EDO B 407' 
AE4 Software B CIT 408 ? 10 'binding site for residue CIT B 408' 
AE5 Software B EDO 409 ? 9  'binding site for residue EDO B 409' 
AE6 Software B EDO 410 ? 5  'binding site for residue EDO B 410' 
AE7 Software B PEG 411 ? 4  'binding site for residue PEG B 411' 
AE8 Software B EDO 412 ? 4  'binding site for residue EDO B 412' 
AE9 Software B EDO 413 ? 7  'binding site for residue EDO B 413' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  LEU A  66  ? LEU A 43  . ? 1_555 ? 
2   AC1 6  PHE A  67  ? PHE A 44  . ? 1_555 ? 
3   AC1 6  GLU A  68  ? GLU A 45  . ? 1_555 ? 
4   AC1 6  TRP A  82  ? TRP A 59  . ? 1_555 ? 
5   AC1 6  HOH DA .   ? HOH A 506 . ? 3_455 ? 
6   AC1 6  HOH DA .   ? HOH A 573 . ? 1_555 ? 
7   AC2 8  GLU A  27  ? GLU A 4   . ? 1_555 ? 
8   AC2 8  PRO A  47  ? PRO A 24  . ? 1_555 ? 
9   AC2 8  VAL A  48  ? VAL A 25  . ? 1_555 ? 
10  AC2 8  ASN B  76  ? ASN B 53  . ? 3_455 ? 
11  AC2 8  GLU B  80  ? GLU B 57  . ? 3_455 ? 
12  AC2 8  CYS B  126 ? CYS B 103 . ? 3_455 ? 
13  AC2 8  SER B  127 ? SER B 104 . ? 3_455 ? 
14  AC2 8  MET B  128 ? MET B 105 . ? 3_455 ? 
15  AC3 2  ILE A  192 ? ILE A 169 . ? 1_555 ? 
16  AC3 2  GLY A  193 ? GLY A 170 . ? 1_555 ? 
17  AC4 7  LEU A  335 ? LEU A 312 . ? 1_555 ? 
18  AC4 7  SER A  336 ? SER A 313 . ? 1_555 ? 
19  AC4 7  VAL A  337 ? VAL A 314 . ? 1_555 ? 
20  AC4 7  CYS A  357 ? CYS A 334 . ? 1_555 ? 
21  AC4 7  LYS A  358 ? LYS A 335 . ? 1_555 ? 
22  AC4 7  ASP A  359 ? ASP A 336 . ? 1_555 ? 
23  AC4 7  GLY A  360 ? GLY A 337 . ? 1_555 ? 
24  AC5 6  HIS A  273 ? HIS A 250 . ? 1_555 ? 
25  AC5 6  ASN A  301 ? ASN A 278 . ? 1_555 ? 
26  AC5 6  VAL A  315 ? VAL A 292 . ? 1_555 ? 
27  AC5 6  CYS A  316 ? CYS A 293 . ? 1_555 ? 
28  AC5 6  SER A  317 ? SER A 294 . ? 1_555 ? 
29  AC5 6  CIT N  .   ? CIT A 412 . ? 1_555 ? 
30  AC6 6  ASN A  98  ? ASN A 75  . ? 1_555 ? 
31  AC6 6  LEU A  99  ? LEU A 76  . ? 1_555 ? 
32  AC6 6  GLY A  100 ? GLY A 77  . ? 1_555 ? 
33  AC6 6  LYS A  204 ? LYS A 181 . ? 1_555 ? 
34  AC6 6  PRO A  214 ? PRO A 191 . ? 1_555 ? 
35  AC6 6  TYR A  348 ? TYR A 325 . ? 1_555 ? 
36  AC7 6  ASN A  97  ? ASN A 74  . ? 1_555 ? 
37  AC7 6  GLY A  100 ? GLY A 77  . ? 1_555 ? 
38  AC7 6  VAL A  101 ? VAL A 78  . ? 1_555 ? 
39  AC7 6  ASP A  102 ? ASP A 79  . ? 1_555 ? 
40  AC7 6  HOH DA .   ? HOH A 564 . ? 1_555 ? 
41  AC7 6  HOH DA .   ? HOH A 588 . ? 1_555 ? 
42  AC8 6  GLU A  252 ? GLU A 229 . ? 1_555 ? 
43  AC8 6  GLY A  253 ? GLY A 230 . ? 1_555 ? 
44  AC8 6  TYR A  254 ? TYR A 231 . ? 1_555 ? 
45  AC8 6  GLY A  360 ? GLY A 337 . ? 1_555 ? 
46  AC8 6  HIS A  361 ? HIS A 338 . ? 1_555 ? 
47  AC8 6  HOH DA .   ? HOH A 747 . ? 1_555 ? 
48  AC9 4  ARG A  222 ? ARG A 199 . ? 1_555 ? 
49  AC9 4  ASN A  223 ? ASN A 200 . ? 1_555 ? 
50  AC9 4  LEU A  224 ? LEU A 201 . ? 1_555 ? 
51  AC9 4  HOH DA .   ? HOH A 670 . ? 1_555 ? 
52  AD1 2  TYR A  249 ? TYR A 226 . ? 1_555 ? 
53  AD1 2  LYS A  331 ? LYS A 308 . ? 1_555 ? 
54  AD2 3  GLU A  328 ? GLU A 305 . ? 1_555 ? 
55  AD2 3  HOH DA .   ? HOH A 592 . ? 1_555 ? 
56  AD2 3  ARG B  159 ? ARG B 136 . ? 4_565 ? 
57  AD3 12 HIS A  258 ? HIS A 235 . ? 1_555 ? 
58  AD3 12 GLN A  268 ? GLN A 245 . ? 1_555 ? 
59  AD3 12 LEU A  269 ? LEU A 246 . ? 1_555 ? 
60  AD3 12 GLY A  270 ? GLY A 247 . ? 1_555 ? 
61  AD3 12 GLY A  271 ? GLY A 248 . ? 1_555 ? 
62  AD3 12 HIS A  273 ? HIS A 250 . ? 1_555 ? 
63  AD3 12 LYS A  313 ? LYS A 290 . ? 1_555 ? 
64  AD3 12 THR A  364 ? THR A 341 . ? 1_555 ? 
65  AD3 12 TYR A  366 ? TYR A 343 . ? 1_555 ? 
66  AD3 12 PEG G  .   ? PEG A 405 . ? 1_555 ? 
67  AD3 12 HOH DA .   ? HOH A 627 . ? 1_555 ? 
68  AD3 12 HOH DA .   ? HOH A 700 . ? 1_555 ? 
69  AD4 4  PRO A  181 ? PRO A 158 . ? 1_555 ? 
70  AD4 4  LYS A  182 ? LYS A 159 . ? 1_555 ? 
71  AD4 4  GLN A  183 ? GLN A 160 . ? 1_555 ? 
72  AD4 4  GLN A  220 ? GLN A 197 . ? 1_555 ? 
73  AD5 5  VAL A  179 ? VAL A 156 . ? 1_555 ? 
74  AD5 5  GLU A  215 ? GLU A 192 . ? 1_555 ? 
75  AD5 5  THR A  216 ? THR A 193 . ? 1_555 ? 
76  AD5 5  PHE A  218 ? PHE A 195 . ? 1_555 ? 
77  AD5 5  HOH DA .   ? HOH A 678 . ? 1_555 ? 
78  AD6 5  PHE B  67  ? PHE B 44  . ? 1_555 ? 
79  AD6 5  TRP B  82  ? TRP B 59  . ? 1_555 ? 
80  AD6 5  HOH EA .   ? HOH B 502 . ? 1_555 ? 
81  AD6 5  HOH EA .   ? HOH B 516 . ? 1_555 ? 
82  AD6 5  HOH EA .   ? HOH B 561 . ? 1_555 ? 
83  AD7 8  ASN A  76  ? ASN A 53  . ? 2_565 ? 
84  AD7 8  GLU A  80  ? GLU A 57  . ? 2_565 ? 
85  AD7 8  CYS A  126 ? CYS A 103 . ? 2_565 ? 
86  AD7 8  SER A  127 ? SER A 104 . ? 2_565 ? 
87  AD7 8  MET A  128 ? MET A 105 . ? 2_565 ? 
88  AD7 8  GLU B  27  ? GLU B 4   . ? 1_555 ? 
89  AD7 8  PRO B  47  ? PRO B 24  . ? 1_555 ? 
90  AD7 8  VAL B  48  ? VAL B 25  . ? 1_555 ? 
91  AD8 5  SER B  297 ? SER B 274 . ? 1_555 ? 
92  AD8 5  THR B  298 ? THR B 275 . ? 1_555 ? 
93  AD8 5  VAL B  299 ? VAL B 276 . ? 1_555 ? 
94  AD8 5  ILE B  351 ? ILE B 328 . ? 1_555 ? 
95  AD8 5  HOH EA .   ? HOH B 605 . ? 1_555 ? 
96  AD9 5  ASN B  97  ? ASN B 74  . ? 1_555 ? 
97  AD9 5  GLY B  100 ? GLY B 77  . ? 1_555 ? 
98  AD9 5  VAL B  101 ? VAL B 78  . ? 1_555 ? 
99  AD9 5  ASP B  102 ? ASP B 79  . ? 1_555 ? 
100 AD9 5  HOH EA .   ? HOH B 674 . ? 1_555 ? 
101 AE1 4  PRO A  214 ? PRO A 191 . ? 4_564 ? 
102 AE1 4  GLU A  350 ? GLU A 327 . ? 4_564 ? 
103 AE1 4  SER B  171 ? SER B 148 . ? 1_555 ? 
104 AE1 4  HOH EA .   ? HOH B 679 . ? 1_555 ? 
105 AE2 5  GLU B  169 ? GLU B 146 . ? 1_555 ? 
106 AE2 5  VAL B  179 ? VAL B 156 . ? 1_555 ? 
107 AE2 5  LYS B  197 ? LYS B 174 . ? 1_555 ? 
108 AE2 5  GLN B  199 ? GLN B 176 . ? 1_555 ? 
109 AE2 5  ASN B  201 ? ASN B 178 . ? 1_555 ? 
110 AE3 3  LYS B  182 ? LYS B 159 . ? 1_555 ? 
111 AE3 3  GLN B  183 ? GLN B 160 . ? 1_555 ? 
112 AE3 3  GLN B  220 ? GLN B 197 . ? 1_555 ? 
113 AE4 10 HIS B  258 ? HIS B 235 . ? 1_555 ? 
114 AE4 10 GLN B  268 ? GLN B 245 . ? 1_555 ? 
115 AE4 10 LEU B  269 ? LEU B 246 . ? 1_555 ? 
116 AE4 10 GLY B  270 ? GLY B 247 . ? 1_555 ? 
117 AE4 10 GLY B  271 ? GLY B 248 . ? 1_555 ? 
118 AE4 10 HIS B  273 ? HIS B 250 . ? 1_555 ? 
119 AE4 10 LYS B  313 ? LYS B 290 . ? 1_555 ? 
120 AE4 10 THR B  364 ? THR B 341 . ? 1_555 ? 
121 AE4 10 TYR B  366 ? TYR B 343 . ? 1_555 ? 
122 AE4 10 HOH EA .   ? HOH B 670 . ? 1_555 ? 
123 AE5 9  LYS A  343 ? LYS A 320 . ? 4_564 ? 
124 AE5 9  VAL A  344 ? VAL A 321 . ? 4_564 ? 
125 AE5 9  THR A  345 ? THR A 322 . ? 4_564 ? 
126 AE5 9  GLU A  350 ? GLU A 327 . ? 4_564 ? 
127 AE5 9  VAL B  172 ? VAL B 149 . ? 1_555 ? 
128 AE5 9  LYS B  173 ? LYS B 150 . ? 1_555 ? 
129 AE5 9  GLY B  174 ? GLY B 151 . ? 1_555 ? 
130 AE5 9  LEU B  175 ? LEU B 152 . ? 1_555 ? 
131 AE5 9  HOH EA .   ? HOH B 591 . ? 1_555 ? 
132 AE6 5  SER B  178 ? SER B 155 . ? 1_555 ? 
133 AE6 5  VAL B  179 ? VAL B 156 . ? 1_555 ? 
134 AE6 5  GLU B  215 ? GLU B 192 . ? 1_555 ? 
135 AE6 5  THR B  216 ? THR B 193 . ? 1_555 ? 
136 AE6 5  PHE B  218 ? PHE B 195 . ? 1_555 ? 
137 AE7 4  ASN B  98  ? ASN B 75  . ? 1_555 ? 
138 AE7 4  LEU B  99  ? LEU B 76  . ? 1_555 ? 
139 AE7 4  GLY B  100 ? GLY B 77  . ? 1_555 ? 
140 AE7 4  LYS B  204 ? LYS B 181 . ? 1_555 ? 
141 AE8 4  GLU B  215 ? GLU B 192 . ? 1_555 ? 
142 AE8 4  VAL B  344 ? VAL B 321 . ? 1_555 ? 
143 AE8 4  THR B  345 ? THR B 322 . ? 1_555 ? 
144 AE8 4  HOH EA .   ? HOH B 515 . ? 1_555 ? 
145 AE9 7  GLU A  215 ? GLU A 192 . ? 4_564 ? 
146 AE9 7  THR B  168 ? THR B 145 . ? 1_555 ? 
147 AE9 7  GLY B  170 ? GLY B 147 . ? 1_555 ? 
148 AE9 7  SER B  171 ? SER B 148 . ? 1_555 ? 
149 AE9 7  HOH EA .   ? HOH B 517 . ? 1_555 ? 
150 AE9 7  HOH EA .   ? HOH B 611 . ? 1_555 ? 
151 AE9 7  HOH EA .   ? HOH B 689 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6W01 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.006632 
_atom_sites.fract_transf_matrix[1][2]   0.003829 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007658 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008954 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C ? ? 3.54356 2.42580 25.62398 1.50364  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N ? ? 4.01032 2.96436 19.97189 1.75589  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O ? ? 4.49882 3.47563 15.80542 1.70748  0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S ? ? 9.55732 6.39887 1.23737  29.19336 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   A ASN A  1 23  ? -50.25826 25.03588 1.10611   0.471 57.94988  ? 0   ASN A N   1 
ATOM   2    N N   B ASN A  1 23  ? -48.88002 29.67884 1.02257   0.529 62.34848  ? 0   ASN A N   1 
ATOM   3    C CA  A ASN A  1 23  ? -51.64294 24.58551 1.13333   0.471 57.12233  ? 0   ASN A CA  1 
ATOM   4    C CA  B ASN A  1 23  ? -49.86572 28.69815 1.45800   0.529 57.24624  ? 0   ASN A CA  1 
ATOM   5    C C   A ASN A  1 23  ? -52.52966 25.54513 1.92655   0.471 52.30272  ? 0   ASN A C   1 
ATOM   6    C C   B ASN A  1 23  ? -51.19021 29.40424 1.73978   0.529 54.37452  ? 0   ASN A C   1 
ATOM   7    O O   A ASN A  1 23  ? -53.41900 25.11396 2.66206   0.471 47.15567  ? 0   ASN A O   1 
ATOM   8    O O   B ASN A  1 23  ? -51.24828 30.31819 2.56725   0.529 53.70363  ? 0   ASN A O   1 
ATOM   9    C CB  A ASN A  1 23  ? -51.73120 23.18288 1.71666   0.471 58.47378  ? 0   ASN A CB  1 
ATOM   10   C CB  B ASN A  1 23  ? -49.37686 27.95106 2.69142   0.529 56.96317  ? 0   ASN A CB  1 
ATOM   11   N N   A MET A  1 24  ? -52.26882 26.84467 1.79091   0.471 51.15982  ? 1   MET A N   1 
ATOM   12   N N   B MET A  1 24  ? -52.24938 28.99484 1.04124   0.529 45.98657  ? 1   MET A N   1 
ATOM   13   C CA  A MET A  1 24  ? -53.14919 27.84614 2.37482   0.471 45.22507  ? 1   MET A CA  1 
ATOM   14   C CA  B MET A  1 24  ? -53.55920 29.60758 1.21939   0.529 42.88103  ? 1   MET A CA  1 
ATOM   15   C C   A MET A  1 24  ? -54.48404 27.84479 1.64999   0.471 39.58766  ? 1   MET A C   1 
ATOM   16   C C   B MET A  1 24  ? -54.62523 28.53736 1.07069   0.529 37.59141  ? 1   MET A C   1 
ATOM   17   O O   A MET A  1 24  ? -54.53660 27.77204 0.42029   0.471 38.95424  ? 1   MET A O   1 
ATOM   18   O O   B MET A  1 24  ? -54.43512 27.56171 0.33828   0.529 40.00684  ? 1   MET A O   1 
ATOM   19   C CB  A MET A  1 24  ? -52.54508 29.24586 2.28021   0.471 49.21506  ? 1   MET A CB  1 
ATOM   20   C CB  B MET A  1 24  ? -53.78686 30.74135 0.21342   0.529 41.76517  ? 1   MET A CB  1 
ATOM   21   C CG  A MET A  1 24  ? -51.81285 29.73740 3.51181   0.471 52.69863  ? 1   MET A CG  1 
ATOM   22   C CG  B MET A  1 24  ? -53.22953 30.47212 -1.17265  0.529 36.92619  ? 1   MET A CG  1 
ATOM   23   S SD  A MET A  1 24  ? -52.68300 29.53141 5.07497   0.471 42.95687  ? 1   MET A SD  1 
ATOM   24   S SD  B MET A  1 24  ? -53.01532 32.05319 -2.05442  0.529 38.44520  ? 1   MET A SD  1 
ATOM   25   C CE  A MET A  1 24  ? -54.26677 30.23226 4.66956   0.471 39.25905  ? 1   MET A CE  1 
ATOM   26   C CE  B MET A  1 24  ? -51.57596 31.71003 -3.06724  0.529 35.63098  ? 1   MET A CE  1 
ATOM   27   N N   A SER A  1 25  ? -55.56359 27.96628 2.41124   0.471 34.16709  ? 2   SER A N   1 
ATOM   28   N N   B SER A  1 25  ? -55.73067 28.71053 1.79777   0.529 33.77617  ? 2   SER A N   1 
ATOM   29   C CA  A SER A  1 25  ? -56.87589 27.88729 1.79156   0.471 31.23348  ? 2   SER A CA  1 
ATOM   30   C CA  B SER A  1 25  ? -56.88277 27.80947 1.72651   0.529 31.03335  ? 2   SER A CA  1 
ATOM   31   C C   A SER A  1 25  ? -57.91022 28.38463 2.77024   0.471 29.06238  ? 2   SER A C   1 
ATOM   32   C C   B SER A  1 25  ? -57.94456 28.24559 2.72161   0.529 29.08069  ? 2   SER A C   1 
ATOM   33   O O   A SER A  1 25  ? -57.71576 28.32320 3.98646   0.471 30.33310  ? 2   SER A O   1 
ATOM   34   O O   B SER A  1 25  ? -57.79116 28.02511 3.92795   0.529 29.22376  ? 2   SER A O   1 
ATOM   35   C CB  A SER A  1 25  ? -57.21158 26.45719 1.36783   0.471 33.39537  ? 2   SER A CB  1 
ATOM   36   C CB  B SER A  1 25  ? -56.48755 26.34634 2.00447   0.529 34.69067  ? 2   SER A CB  1 
ATOM   37   O OG  A SER A  1 25  ? -58.02357 25.77258 2.31731   0.471 30.24182  ? 2   SER A OG  1 
ATOM   38   O OG  B SER A  1 25  ? -57.64472 25.50881 2.08929   0.529 33.22546  ? 2   SER A OG  1 
ATOM   39   N N   . LEU A  1 26  ? -59.02102 28.86076 2.22233   1.000 28.28978  ? 3   LEU A N   1 
ATOM   40   C CA  . LEU A  1 26  ? -60.13696 29.25447 3.06860   1.000 27.36116  ? 3   LEU A CA  1 
ATOM   41   C C   . LEU A  1 26  ? -60.60019 28.09093 3.93871   1.000 25.88370  ? 3   LEU A C   1 
ATOM   42   O O   . LEU A  1 26  ? -60.80910 28.24689 5.15200   1.000 25.56806  ? 3   LEU A O   1 
ATOM   43   C CB  . LEU A  1 26  ? -61.29847 29.73487 2.18313   1.000 25.31662  ? 3   LEU A CB  1 
ATOM   44   C CG  . LEU A  1 26  ? -62.65264 30.00209 2.84139   1.000 28.84736  ? 3   LEU A CG  1 
ATOM   45   C CD1 . LEU A  1 26  ? -62.51592 31.13250 3.86689   1.000 28.31264  ? 3   LEU A CD1 1 
ATOM   46   C CD2 . LEU A  1 26  ? -63.70633 30.37253 1.75743   1.000 30.65048  ? 3   LEU A CD2 1 
ATOM   47   N N   . GLU A  1 27  ? -60.82822 26.92987 3.30943   1.000 24.99203  ? 4   GLU A N   1 
ATOM   48   C CA  . GLU A  1 27  ? -61.33415 25.74820 4.01529   1.000 26.74973  ? 4   GLU A CA  1 
ATOM   49   C C   . GLU A  1 27  ? -60.35247 25.25700 5.07690   1.000 27.45644  ? 4   GLU A C   1 
ATOM   50   O O   . GLU A  1 27  ? -60.77518 24.72288 6.10949   1.000 26.55561  ? 4   GLU A O   1 
ATOM   51   C CB  . GLU A  1 27  ? -61.62932 24.62707 3.00547   1.000 26.43068  ? 4   GLU A CB  1 
ATOM   52   C CG  . GLU A  1 27  ? -62.95107 24.86636 2.19486   1.000 29.55930  ? 4   GLU A CG  1 
ATOM   53   C CD  . GLU A  1 27  ? -62.79281 25.84464 0.99294   1.000 35.91429  ? 4   GLU A CD  1 
ATOM   54   O OE1 . GLU A  1 27  ? -61.71243 26.46235 0.80422   1.000 30.73112  ? 4   GLU A OE1 1 
ATOM   55   O OE2 . GLU A  1 27  ? -63.76065 25.99721 0.20609   1.000 37.94717  ? 4   GLU A OE2 1 
ATOM   56   N N   . ASN A  1 28  ? -59.03568 25.40685 4.84644   1.000 24.64898  ? 5   ASN A N   1 
ATOM   57   C CA  . ASN A  1 28  ? -58.08658 25.02243 5.89126   1.000 24.96663  ? 5   ASN A CA  1 
ATOM   58   C C   . ASN A  1 28  ? -58.05857 26.03224 7.04278   1.000 24.95557  ? 5   ASN A C   1 
ATOM   59   O O   . ASN A  1 28  ? -57.93033 25.62925 8.20985   1.000 29.03719  ? 5   ASN A O   1 
ATOM   60   C CB  . ASN A  1 28  ? -56.68727 24.82992 5.29319   1.000 27.64030  ? 5   ASN A CB  1 
ATOM   61   C CG  . ASN A  1 28  ? -55.62104 24.56785 6.35447   1.000 31.85839  ? 5   ASN A CG  1 
ATOM   62   O OD1 . ASN A  1 28  ? -54.82833 25.46010 6.68507   1.000 32.49648  ? 5   ASN A OD1 1 
ATOM   63   N ND2 . ASN A  1 28  ? -55.61384 23.36208 6.91336   1.000 28.46936  ? 5   ASN A ND2 1 
ATOM   64   N N   . VAL A  1 29  ? -58.16887 27.33749 6.75079   1.000 23.06926  ? 6   VAL A N   1 
ATOM   65   C CA  . VAL A  1 29  ? -58.31332 28.32867 7.82394   1.000 24.65952  ? 6   VAL A CA  1 
ATOM   66   C C   . VAL A  1 29  ? -59.51932 27.99501 8.69613   1.000 26.51870  ? 6   VAL A C   1 
ATOM   67   O O   . VAL A  1 29  ? -59.44339 27.99562 9.93262   1.000 26.67664  ? 6   VAL A O   1 
ATOM   68   C CB  . VAL A  1 29  ? -58.41863 29.74944 7.24131   1.000 26.68286  ? 6   VAL A CB  1 
ATOM   69   C CG1 . VAL A  1 29  ? -58.71661 30.78101 8.36202   1.000 25.22845  ? 6   VAL A CG1 1 
ATOM   70   C CG2 . VAL A  1 29  ? -57.10632 30.11174 6.51665   1.000 28.00779  ? 6   VAL A CG2 1 
ATOM   71   N N   . ALA A  1 30  ? -60.65263 27.69211 8.06515   1.000 25.08560  ? 7   ALA A N   1 
ATOM   72   C CA  . ALA A  1 30  ? -61.85861 27.34654 8.82014   1.000 24.97834  ? 7   ALA A CA  1 
ATOM   73   C C   . ALA A  1 30  ? -61.67826 26.05901 9.62229   1.000 22.35480  ? 7   ALA A C   1 
ATOM   74   O O   . ALA A  1 30  ? -62.16889 25.95454 10.75380  1.000 26.77320  ? 7   ALA A O   1 
ATOM   75   C CB  . ALA A  1 30  ? -63.04413 27.19775 7.86144   1.000 26.70491  ? 7   ALA A CB  1 
ATOM   76   N N   . PHE A  1 31  ? -60.99221 25.06244 9.06011   1.000 24.16287  ? 8   PHE A N   1 
ATOM   77   C CA  . PHE A  1 31  ? -60.73480 23.84306 9.83055   1.000 26.87094  ? 8   PHE A CA  1 
ATOM   78   C C   . PHE A  1 31  ? -59.96947 24.16167 11.11680  1.000 29.35540  ? 8   PHE A C   1 
ATOM   79   O O   . PHE A  1 31  ? -60.26713 23.61098 12.18779  1.000 27.29719  ? 8   PHE A O   1 
ATOM   80   C CB  . PHE A  1 31  ? -59.95592 22.82518 8.98244   1.000 28.85900  ? 8   PHE A CB  1 
ATOM   81   C CG  . PHE A  1 31  ? -59.46304 21.62035 9.76464   1.000 29.26579  ? 8   PHE A CG  1 
ATOM   82   C CD1 . PHE A  1 31  ? -58.25686 21.66616 10.45368  1.000 32.69679  ? 8   PHE A CD1 1 
ATOM   83   C CD2 . PHE A  1 31  ? -60.21118 20.44715 9.80751   1.000 30.50433  ? 8   PHE A CD2 1 
ATOM   84   C CE1 . PHE A  1 31  ? -57.80013 20.57448 11.18374  1.000 37.30291  ? 8   PHE A CE1 1 
ATOM   85   C CE2 . PHE A  1 31  ? -59.76922 19.34084 10.53361  1.000 37.81921  ? 8   PHE A CE2 1 
ATOM   86   C CZ  . PHE A  1 31  ? -58.55963 19.40306 11.22673  1.000 39.35169  ? 8   PHE A CZ  1 
ATOM   87   N N   . ASN A  1 32  ? -58.95319 25.02556 11.02073  1.000 24.05699  ? 9   ASN A N   1 
ATOM   88   C CA  . ASN A  1 32  ? -58.19008 25.39211 12.20730  1.000 28.02222  ? 9   ASN A CA  1 
ATOM   89   C C   . ASN A  1 32  ? -59.04942 26.13383 13.21380  1.000 27.65261  ? 9   ASN A C   1 
ATOM   90   O O   . ASN A  1 32  ? -58.95129 25.86753 14.41658  1.000 29.81773  ? 9   ASN A O   1 
ATOM   91   C CB  . ASN A  1 32  ? -56.97287 26.24402 11.81954  1.000 27.68152  ? 9   ASN A CB  1 
ATOM   92   C CG  . ASN A  1 32  ? -55.79284 25.38525 11.38011  1.000 32.12103  ? 9   ASN A CG  1 
ATOM   93   O OD1 . ASN A  1 32  ? -54.85575 25.15798 12.15122  1.000 33.12326  ? 9   ASN A OD1 1 
ATOM   94   N ND2 . ASN A  1 32  ? -55.85919 24.86353 10.14226  1.000 27.34941  ? 9   ASN A ND2 1 
ATOM   95   N N   . VAL A  1 33  ? -59.87689 27.08951 12.75161  1.000 26.32401  ? 10  VAL A N   1 
ATOM   96   C CA  . VAL A  1 33  ? -60.75186 27.80955 13.68360  1.000 27.68868  ? 10  VAL A CA  1 
ATOM   97   C C   . VAL A  1 33  ? -61.64380 26.80463 14.42234  1.000 29.66727  ? 10  VAL A C   1 
ATOM   98   O O   . VAL A  1 33  ? -61.71564 26.79916 15.65584  1.000 31.37554  ? 10  VAL A O   1 
ATOM   99   C CB  . VAL A  1 33  ? -61.56780 28.88596 12.94091  1.000 27.91159  ? 10  VAL A CB  1 
ATOM   100  C CG1 . VAL A  1 33  ? -62.69231 29.51926 13.85294  1.000 26.28871  ? 10  VAL A CG1 1 
ATOM   101  C CG2 . VAL A  1 33  ? -60.61905 30.00975 12.43275  1.000 23.98527  ? 10  VAL A CG2 1 
ATOM   102  N N   . VAL A  1 34  ? -62.26998 25.88993 13.67480  1.000 27.40006  ? 11  VAL A N   1 
ATOM   103  C CA  . VAL A  1 34  ? -63.19720 24.91918 14.27621  1.000 29.29691  ? 11  VAL A CA  1 
ATOM   104  C C   . VAL A  1 34  ? -62.48472 24.02341 15.27042  1.000 31.50901  ? 11  VAL A C   1 
ATOM   105  O O   . VAL A  1 34  ? -63.02171 23.71714 16.33667  1.000 35.74267  ? 11  VAL A O   1 
ATOM   106  C CB  . VAL A  1 34  ? -63.89347 24.07185 13.19081  1.000 30.04427  ? 11  VAL A CB  1 
ATOM   107  C CG1 . VAL A  1 34  ? -64.59567 22.84767 13.81762  1.000 34.88215  ? 11  VAL A CG1 1 
ATOM   108  C CG2 . VAL A  1 34  ? -64.89971 24.93755 12.39885  1.000 28.90543  ? 11  VAL A CG2 1 
ATOM   109  N N   . ASN A  1 35  ? -61.28533 23.54582 14.92906  1.000 29.39354  ? 12  ASN A N   1 
ATOM   110  C CA  . ASN A  1 35  ? -60.66675 22.50899 15.73705  1.000 29.38705  ? 12  ASN A CA  1 
ATOM   111  C C   . ASN A  1 35  ? -59.67827 23.03048 16.75772  1.000 34.62860  ? 12  ASN A C   1 
ATOM   112  O O   . ASN A  1 35  ? -59.46071 22.37165 17.77627  1.000 34.71613  ? 12  ASN A O   1 
ATOM   113  C CB  . ASN A  1 35  ? -59.96730 21.48832 14.83604  1.000 33.45131  ? 12  ASN A CB  1 
ATOM   114  C CG  . ASN A  1 35  ? -60.96777 20.59211 14.14354  1.000 41.29367  ? 12  ASN A CG  1 
ATOM   115  O OD1 . ASN A  1 35  ? -61.43165 19.64821 14.74266  1.000 46.21178  ? 12  ASN A OD1 1 
ATOM   116  N ND2 . ASN A  1 35  ? -61.37845 20.94726 12.91519  1.000 34.14440  ? 12  ASN A ND2 1 
ATOM   117  N N   . LYS A  1 36  ? -59.05809 24.17742 16.51359  1.000 30.13708  ? 13  LYS A N   1 
ATOM   118  C CA  . LYS A  1 36  ? -57.99712 24.66673 17.38099  1.000 28.53202  ? 13  LYS A CA  1 
ATOM   119  C C   . LYS A  1 36  ? -58.31188 26.03835 17.97345  1.000 32.93611  ? 13  LYS A C   1 
ATOM   120  O O   . LYS A  1 36  ? -57.54295 26.53397 18.81322  1.000 29.87718  ? 13  LYS A O   1 
ATOM   121  C CB  . LYS A  1 36  ? -56.67875 24.72950 16.59964  1.000 29.41251  ? 13  LYS A CB  1 
ATOM   122  C CG  . LYS A  1 36  ? -56.17245 23.34664 16.16410  1.000 37.70306  ? 13  LYS A CG  1 
ATOM   123  C CD  . LYS A  1 36  ? -55.66497 22.60357 17.39051  1.000 44.21385  ? 13  LYS A CD  1 
ATOM   124  C CE  . LYS A  1 36  ? -54.87920 21.36975 17.03059  1.000 57.16962  ? 13  LYS A CE  1 
ATOM   125  N NZ  . LYS A  1 36  ? -54.51842 20.60862 18.26632  1.000 59.28860  ? 13  LYS A NZ  1 
ATOM   126  N N   . GLY A  1 37  ? -59.43085 26.64808 17.59309  1.000 30.07455  ? 14  GLY A N   1 
ATOM   127  C CA  . GLY A  1 37  ? -59.79449 27.95074 18.11684  1.000 30.21717  ? 14  GLY A CA  1 
ATOM   128  C C   . GLY A  1 37  ? -59.14636 29.14529 17.44218  1.000 33.83565  ? 14  GLY A C   1 
ATOM   129  O O   . GLY A  1 37  ? -59.48176 30.28088 17.79128  1.000 32.16828  ? 14  GLY A O   1 
ATOM   130  N N   . HIS A  1 38  ? -58.25452 28.93651 16.47698  1.000 30.93147  ? 15  HIS A N   1 
ATOM   131  C CA  . HIS A  1 38  ? -57.51141 29.99334 15.78584  1.000 27.82648  ? 15  HIS A CA  1 
ATOM   132  C C   . HIS A  1 38  ? -56.63309 29.25458 14.78080  1.000 31.26396  ? 15  HIS A C   1 
ATOM   133  O O   . HIS A  1 38  ? -56.58309 28.02159 14.78388  1.000 31.77493  ? 15  HIS A O   1 
ATOM   134  C CB  . HIS A  1 38  ? -56.64308 30.86052 16.72571  1.000 26.89642  ? 15  HIS A CB  1 
ATOM   135  C CG  . HIS A  1 38  ? -55.44675 30.14066 17.29742  1.000 28.73644  ? 15  HIS A CG  1 
ATOM   136  N ND1 . HIS A  1 38  ? -54.15678 30.59033 17.13479  1.000 31.86104  ? 15  HIS A ND1 1 
ATOM   137  C CD2 . HIS A  1 38  ? -55.34803 28.96987 17.98229  1.000 32.81077  ? 15  HIS A CD2 1 
ATOM   138  C CE1 . HIS A  1 38  ? -53.31322 29.75499 17.71791  1.000 31.45192  ? 15  HIS A CE1 1 
ATOM   139  N NE2 . HIS A  1 38  ? -54.01068 28.76074 18.24126  1.000 33.70317  ? 15  HIS A NE2 1 
ATOM   140  N N   . PHE A  1 39  ? -55.93560 30.00625 13.92316  1.000 27.51152  ? 16  PHE A N   1 
ATOM   141  C CA  . PHE A  1 39  ? -55.06456 29.33084 12.96951  1.000 28.95930  ? 16  PHE A CA  1 
ATOM   142  C C   . PHE A  1 39  ? -53.87625 28.75352 13.70457  1.000 31.76417  ? 16  PHE A C   1 
ATOM   143  O O   . PHE A  1 39  ? -53.16943 29.47642 14.41282  1.000 33.05775  ? 16  PHE A O   1 
ATOM   144  C CB  . PHE A  1 39  ? -54.56802 30.25781 11.85956  1.000 25.00729  ? 16  PHE A CB  1 
ATOM   145  C CG  . PHE A  1 39  ? -53.84468 29.49619 10.77338  1.000 27.11785  ? 16  PHE A CG  1 
ATOM   146  C CD1 . PHE A  1 39  ? -54.57788 28.75017 9.84790   1.000 29.93882  ? 16  PHE A CD1 1 
ATOM   147  C CD2 . PHE A  1 39  ? -52.43727 29.46406 10.72435  1.000 27.28087  ? 16  PHE A CD2 1 
ATOM   148  C CE1 . PHE A  1 39  ? -53.91880 28.01311 8.85064   1.000 32.63887  ? 16  PHE A CE1 1 
ATOM   149  C CE2 . PHE A  1 39  ? -51.78848 28.75163 9.75808   1.000 33.65809  ? 16  PHE A CE2 1 
ATOM   150  C CZ  . PHE A  1 39  ? -52.53328 28.01491 8.80907   1.000 34.42865  ? 16  PHE A CZ  1 
ATOM   151  N N   . ASP A  1 40  ? -53.64004 27.44836 13.51967  1.000 31.98899  ? 17  ASP A N   1 
ATOM   152  C CA  . ASP A  1 40  ? -52.56680 26.76276 14.22763  1.000 37.23550  ? 17  ASP A CA  1 
ATOM   153  C C   . ASP A  1 40  ? -51.71994 25.92490 13.27232  1.000 37.27072  ? 17  ASP A C   1 
ATOM   154  O O   . ASP A  1 40  ? -51.00222 25.03393 13.71315  1.000 39.01184  ? 17  ASP A O   1 
ATOM   155  C CB  . ASP A  1 40  ? -53.16563 25.89970 15.34399  1.000 40.87555  ? 17  ASP A CB  1 
ATOM   156  C CG  . ASP A  1 40  ? -52.13088 25.40141 16.33960  1.000 55.55456  ? 17  ASP A CG  1 
ATOM   157  O OD1 . ASP A  1 40  ? -51.26485 26.19624 16.77259  1.000 57.39851  ? 17  ASP A OD1 1 
ATOM   158  O OD2 . ASP A  1 40  ? -52.21188 24.20727 16.69240  1.000 55.00029  ? 17  ASP A OD2 1 
ATOM   159  N N   . GLY A  1 41  ? -51.82820 26.15389 11.96440  1.000 36.66839  ? 18  GLY A N   1 
ATOM   160  C CA  . GLY A  1 41  ? -50.98744 25.41032 11.04428  1.000 36.49695  ? 18  GLY A CA  1 
ATOM   161  C C   . GLY A  1 41  ? -51.34206 23.94482 10.86445  1.000 39.24151  ? 18  GLY A C   1 
ATOM   162  O O   . GLY A  1 41  ? -50.52344 23.18222 10.34262  1.000 39.47994  ? 18  GLY A O   1 
ATOM   163  N N   . GLN A  1 42  ? -52.53927 23.51765 11.26662  1.000 31.26604  ? 19  GLN A N   1 
ATOM   164  C CA  . GLN A  1 42  ? -52.90176 22.10992 11.12600  1.000 34.52933  ? 19  GLN A CA  1 
ATOM   165  C C   . GLN A  1 42  ? -53.43628 21.82423 9.72287   1.000 35.98380  ? 19  GLN A C   1 
ATOM   166  O O   . GLN A  1 42  ? -54.04271 22.68916 9.08057   1.000 37.22091  ? 19  GLN A O   1 
ATOM   167  C CB  . GLN A  1 42  ? -53.95881 21.72357 12.16469  1.000 36.07168  ? 19  GLN A CB  1 
ATOM   168  C CG  . GLN A  1 42  ? -53.55551 22.03523 13.60675  1.000 40.19923  ? 19  GLN A CG  1 
ATOM   169  C CD  . GLN A  1 42  ? -52.32947 21.24555 14.05539  1.000 51.20373  ? 19  GLN A CD  1 
ATOM   170  O OE1 . GLN A  1 42  ? -52.09722 20.13052 13.59480  1.000 56.20521  ? 19  GLN A OE1 1 
ATOM   171  N NE2 . GLN A  1 42  ? -51.53673 21.83003 14.94872  1.000 54.21829  ? 19  GLN A NE2 1 
ATOM   172  N N   . GLN A  1 43  ? -53.23599 20.58607 9.25947   1.000 32.08551  ? 20  GLN A N   1 
ATOM   173  C CA  . GLN A  1 43  ? -53.83871 20.14197 8.00879   1.000 33.92837  ? 20  GLN A CA  1 
ATOM   174  C C   . GLN A  1 43  ? -55.29620 19.74415 8.22479   1.000 38.72721  ? 20  GLN A C   1 
ATOM   175  O O   . GLN A  1 43  ? -55.65104 19.17399 9.26344   1.000 36.48556  ? 20  GLN A O   1 
ATOM   176  C CB  . GLN A  1 43  ? -53.06422 18.95464 7.42374   1.000 38.60293  ? 20  GLN A CB  1 
ATOM   177  C CG  . GLN A  1 43  ? -51.70578 19.32725 6.87606   1.000 49.45976  ? 20  GLN A CG  1 
ATOM   178  C CD  . GLN A  1 43  ? -51.04301 18.16324 6.14628   1.000 67.61913  ? 20  GLN A CD  1 
ATOM   179  O OE1 . GLN A  1 43  ? -51.36568 16.99186 6.38234   1.000 69.65408  ? 20  GLN A OE1 1 
ATOM   180  N NE2 . GLN A  1 43  ? -50.11830 18.48551 5.24536   1.000 73.54042  ? 20  GLN A NE2 1 
ATOM   181  N N   . GLY A  1 44  ? -56.12629 20.01862 7.22802   1.000 34.35981  ? 21  GLY A N   1 
ATOM   182  C CA  . GLY A  1 44  ? -57.52462 19.62059 7.25334   1.000 32.31079  ? 21  GLY A CA  1 
ATOM   183  C C   . GLY A  1 44  ? -58.36688 20.63233 6.50260   1.000 32.76255  ? 21  GLY A C   1 
ATOM   184  O O   . GLY A  1 44  ? -57.90113 21.70154 6.12318   1.000 31.11763  ? 21  GLY A O   1 
ATOM   185  N N   . GLU A  1 45  ? -59.63683 20.28111 6.28485   1.000 29.41168  ? 22  GLU A N   1 
ATOM   186  C CA  . GLU A  1 45  ? -60.56140 21.19188 5.60477   1.000 29.46034  ? 22  GLU A CA  1 
ATOM   187  C C   . GLU A  1 45  ? -61.96236 20.96114 6.15334   1.000 33.27774  ? 22  GLU A C   1 
ATOM   188  O O   . GLU A  1 45  ? -62.29426 19.84135 6.53599   1.000 30.39352  ? 22  GLU A O   1 
ATOM   189  C CB  . GLU A  1 45  ? -60.56033 20.96036 4.08635   1.000 33.16263  ? 22  GLU A CB  1 
ATOM   190  C CG  . GLU A  1 45  ? -59.36651 21.54946 3.34350   1.000 49.22029  ? 22  GLU A CG  1 
ATOM   191  C CD  . GLU A  1 45  ? -58.16541 20.58479 3.25423   1.000 63.81537  ? 22  GLU A CD  1 
ATOM   192  O OE1 . GLU A  1 45  ? -58.32842 19.38185 3.56791   1.000 66.75044  ? 22  GLU A OE1 1 
ATOM   193  O OE2 . GLU A  1 45  ? -57.05401 21.03915 2.87764   1.000 65.52581  ? 22  GLU A OE2 1 
ATOM   194  N N   . VAL A  1 46  ? -62.77154 22.01917 6.21004   1.000 29.79821  ? 23  VAL A N   1 
ATOM   195  C CA  . VAL A  1 46  ? -64.21113 21.86999 6.45667   1.000 32.41163  ? 23  VAL A CA  1 
ATOM   196  C C   . VAL A  1 46  ? -64.97355 22.61578 5.36319   1.000 28.98208  ? 23  VAL A C   1 
ATOM   197  O O   . VAL A  1 46  ? -64.42770 23.53230 4.72503   1.000 31.54093  ? 23  VAL A O   1 
ATOM   198  C CB  . VAL A  1 46  ? -64.61971 22.40431 7.85248   1.000 26.43661  ? 23  VAL A CB  1 
ATOM   199  C CG1 . VAL A  1 46  ? -63.99250 21.53821 8.97923   1.000 29.49569  ? 23  VAL A CG1 1 
ATOM   200  C CG2 . VAL A  1 46  ? -64.26363 23.90746 7.99337   1.000 25.38453  ? 23  VAL A CG2 1 
ATOM   201  N N   . PRO A  1 47  ? -66.24926 22.26454 5.14413   1.000 28.39684  ? 24  PRO A N   1 
ATOM   202  C CA  . PRO A  1 47  ? -67.03647 22.97631 4.12978   1.000 26.85529  ? 24  PRO A CA  1 
ATOM   203  C C   . PRO A  1 47  ? -67.37198 24.37548 4.61451   1.000 28.27203  ? 24  PRO A C   1 
ATOM   204  O O   . PRO A  1 47  ? -67.72109 24.56596 5.78487   1.000 27.42095  ? 24  PRO A O   1 
ATOM   205  C CB  . PRO A  1 47  ? -68.31462 22.12548 4.00047   1.000 27.45464  ? 24  PRO A CB  1 
ATOM   206  C CG  . PRO A  1 47  ? -67.98593 20.77398 4.71727   1.000 29.95568  ? 24  PRO A CG  1 
ATOM   207  C CD  . PRO A  1 47  ? -67.00836 21.15032 5.76439   1.000 28.39302  ? 24  PRO A CD  1 
ATOM   208  N N   . VAL A  1 48  ? -67.27294 25.35478 3.71106   1.000 23.91195  ? 25  VAL A N   1 
ATOM   209  C CA  . VAL A  1 48  ? -67.46148 26.76718 4.04909   1.000 21.83705  ? 25  VAL A CA  1 
ATOM   210  C C   . VAL A  1 48  ? -68.47009 27.39654 3.09615   1.000 24.21910  ? 25  VAL A C   1 
ATOM   211  O O   . VAL A  1 48  ? -68.43886 27.13237 1.89001   1.000 24.53428  ? 25  VAL A O   1 
ATOM   212  C CB  . VAL A  1 48  ? -66.10540 27.52203 3.97419   1.000 27.82851  ? 25  VAL A CB  1 
ATOM   213  C CG1 . VAL A  1 48  ? -66.32243 29.02671 4.07441   1.000 26.94251  ? 25  VAL A CG1 1 
ATOM   214  C CG2 . VAL A  1 48  ? -65.17563 27.02576 5.08453   1.000 25.73548  ? 25  VAL A CG2 1 
ATOM   215  N N   . SER A  1 49  ? -69.34510 28.25753 3.62712   1.000 20.90929  ? 26  SER A N   1 
ATOM   216  C CA  . SER A  1 49  ? -70.20625 29.14746 2.85341   1.000 23.34610  ? 26  SER A CA  1 
ATOM   217  C C   . SER A  1 49  ? -69.85952 30.57630 3.18560   1.000 24.37740  ? 26  SER A C   1 
ATOM   218  O O   . SER A  1 49  ? -69.69899 30.91329 4.36060   1.000 25.92657  ? 26  SER A O   1 
ATOM   219  C CB  . SER A  1 49  ? -71.73132 29.00963 3.18986   1.000 26.22227  ? 26  SER A CB  1 
ATOM   220  O OG  . SER A  1 49  ? -72.16778 27.73697 2.89387   1.000 38.68861  ? 26  SER A OG  1 
ATOM   221  N N   . ILE A  1 50  ? -69.82154 31.42547 2.16734   1.000 22.57253  ? 27  ILE A N   1 
ATOM   222  C CA  . ILE A  1 50  ? -69.69598 32.87296 2.35837   1.000 19.71397  ? 27  ILE A CA  1 
ATOM   223  C C   . ILE A  1 50  ? -70.98514 33.53775 1.89551   1.000 22.94908  ? 27  ILE A C   1 
ATOM   224  O O   . ILE A  1 50  ? -71.39658 33.38164 0.74294   1.000 25.74428  ? 27  ILE A O   1 
ATOM   225  C CB  . ILE A  1 50  ? -68.46917 33.42013 1.61125   1.000 24.76296  ? 27  ILE A CB  1 
ATOM   226  C CG1 . ILE A  1 50  ? -67.20988 32.73685 2.26459   1.000 29.16247  ? 27  ILE A CG1 1 
ATOM   227  C CG2 . ILE A  1 50  ? -68.42641 34.95098 1.66123   1.000 23.31925  ? 27  ILE A CG2 1 
ATOM   228  C CD1 . ILE A  1 50  ? -65.95462 33.23527 1.85298   1.000 40.09436  ? 27  ILE A CD1 1 
ATOM   229  N N   A ILE A  1 51  ? -71.65079 34.26397 2.77890   0.484 23.96314  ? 28  ILE A N   1 
ATOM   230  N N   B ILE A  1 51  ? -71.61262 34.28087 2.80715   0.516 23.18468  ? 28  ILE A N   1 
ATOM   231  C CA  A ILE A  1 51  ? -72.87600 34.95071 2.37474   0.484 24.92708  ? 28  ILE A CA  1 
ATOM   232  C CA  B ILE A  1 51  ? -72.81741 35.06182 2.52148   0.516 24.96316  ? 28  ILE A CA  1 
ATOM   233  C C   A ILE A  1 51  ? -72.82064 36.34052 2.95421   0.484 25.45545  ? 28  ILE A C   1 
ATOM   234  C C   B ILE A  1 51  ? -72.81078 36.26244 3.44011   0.516 25.67249  ? 28  ILE A C   1 
ATOM   235  O O   A ILE A  1 51  ? -72.63575 36.49124 4.16451   0.484 27.20064  ? 28  ILE A O   1 
ATOM   236  O O   B ILE A  1 51  ? -72.49282 36.13338 4.62069   0.516 25.21861  ? 28  ILE A O   1 
ATOM   237  C CB  A ILE A  1 51  ? -74.16886 34.24724 2.84210   0.484 27.28319  ? 28  ILE A CB  1 
ATOM   238  C CB  B ILE A  1 51  ? -74.14541 34.29913 2.76363   0.516 27.62681  ? 28  ILE A CB  1 
ATOM   239  C CG1 A ILE A  1 51  ? -74.15101 32.77433 2.49242   0.484 31.75941  ? 28  ILE A CG1 1 
ATOM   240  C CG1 B ILE A  1 51  ? -74.08107 32.83840 2.37280   0.516 30.99060  ? 28  ILE A CG1 1 
ATOM   241  C CG2 A ILE A  1 51  ? -75.38217 34.90740 2.17235   0.484 30.72992  ? 28  ILE A CG2 1 
ATOM   242  C CG2 B ILE A  1 51  ? -75.30818 35.01241 2.03357   0.516 29.79436  ? 28  ILE A CG2 1 
ATOM   243  C CD1 A ILE A  1 51  ? -75.47389 32.07862 2.81814   0.484 37.75354  ? 28  ILE A CD1 1 
ATOM   244  C CD1 B ILE A  1 51  ? -75.33780 32.08318 2.81082   0.516 38.65157  ? 28  ILE A CD1 1 
ATOM   245  N N   A ASN A  1 52  ? -72.96821 37.34786 2.09599   0.484 29.75726  ? 29  ASN A N   1 
ATOM   246  N N   B ASN A  1 52  ? -73.20055 37.41321 2.89483   0.516 29.90548  ? 29  ASN A N   1 
ATOM   247  C CA  A ASN A  1 52  ? -72.74930 38.73380 2.50313   0.484 34.80636  ? 29  ASN A CA  1 
ATOM   248  C CA  B ASN A  1 52  ? -73.43704 38.68045 3.61086   0.516 34.79376  ? 29  ASN A CA  1 
ATOM   249  C C   A ASN A  1 52  ? -71.35086 38.85608 3.09601   0.484 30.13092  ? 29  ASN A C   1 
ATOM   250  C C   B ASN A  1 52  ? -72.38528 39.00531 4.67072   0.516 30.28607  ? 29  ASN A C   1 
ATOM   251  O O   A ASN A  1 52  ? -70.34774 38.51160 2.45074   0.484 29.59313  ? 29  ASN A O   1 
ATOM   252  O O   B ASN A  1 52  ? -72.67720 39.23674 5.86541   0.516 21.72330  ? 29  ASN A O   1 
ATOM   253  C CB  A ASN A  1 52  ? -73.82158 39.17029 3.51101   0.484 36.75912  ? 29  ASN A CB  1 
ATOM   254  C CB  B ASN A  1 52  ? -74.83512 38.68155 4.18560   0.516 45.00783  ? 29  ASN A CB  1 
ATOM   255  C CG  A ASN A  1 52  ? -75.24115 39.00220 2.96756   0.484 46.14318  ? 29  ASN A CG  1 
ATOM   256  C CG  B ASN A  1 52  ? -75.86280 38.72279 3.08913   0.516 46.64172  ? 29  ASN A CG  1 
ATOM   257  O OD1 A ASN A  1 52  ? -75.57378 39.58943 1.93627   0.484 51.18109  ? 29  ASN A OD1 1 
ATOM   258  O OD1 B ASN A  1 52  ? -75.64038 39.36129 2.04338   0.516 50.77709  ? 29  ASN A OD1 1 
ATOM   259  N ND2 A ASN A  1 52  ? -76.07785 38.17894 3.64753   0.484 45.33211  ? 29  ASN A ND2 1 
ATOM   260  N ND2 B ASN A  1 52  ? -76.93969 37.98949 3.26943   0.516 40.58028  ? 29  ASN A ND2 1 
ATOM   261  N N   A ASN A  1 53  ? -71.29456 39.26548 4.35588   0.484 26.34810  ? 30  ASN A N   1 
ATOM   262  N N   B ASN A  1 53  ? -71.14944 39.07290 4.17625   0.516 27.79103  ? 30  ASN A N   1 
ATOM   263  C CA  A ASN A  1 53  ? -70.04987 39.48721 5.07995   0.484 29.54997  ? 30  ASN A CA  1 
ATOM   264  C CA  B ASN A  1 53  ? -69.97810 39.40605 4.97250   0.516 29.35259  ? 30  ASN A CA  1 
ATOM   265  C C   A ASN A  1 53  ? -69.80995 38.45693 6.17782   0.484 29.48392  ? 30  ASN A C   1 
ATOM   266  C C   B ASN A  1 53  ? -69.78488 38.44920 6.13351   0.516 29.44074  ? 30  ASN A C   1 
ATOM   267  O O   A ASN A  1 53  ? -69.13472 38.75312 7.16311   0.484 30.63029  ? 30  ASN A O   1 
ATOM   268  O O   B ASN A  1 53  ? -69.13652 38.79561 7.11883   0.516 30.71380  ? 30  ASN A O   1 
ATOM   269  C CB  A ASN A  1 53  ? -70.04954 40.89266 5.67720   0.484 33.12568  ? 30  ASN A CB  1 
ATOM   270  C CB  B ASN A  1 53  ? -70.06054 40.85451 5.47194   0.516 33.39172  ? 30  ASN A CB  1 
ATOM   271  C CG  A ASN A  1 53  ? -68.96100 41.77815 5.08057   0.484 30.57582  ? 30  ASN A CG  1 
ATOM   272  C CG  B ASN A  1 53  ? -68.88104 41.70377 4.99392   0.516 30.59553  ? 30  ASN A CG  1 
ATOM   273  O OD1 A ASN A  1 53  ? -67.98000 41.28944 4.50948   0.484 28.93708  ? 30  ASN A OD1 1 
ATOM   274  O OD1 B ASN A  1 53  ? -67.93055 41.19636 4.38861   0.516 28.17723  ? 30  ASN A OD1 1 
ATOM   275  N ND2 A ASN A  1 53  ? -69.13572 43.07298 5.20810   0.484 31.19728  ? 30  ASN A ND2 1 
ATOM   276  N ND2 B ASN A  1 53  ? -68.93974 42.98562 5.27457   0.516 30.26428  ? 30  ASN A ND2 1 
ATOM   277  N N   . THR A  1 54  ? -70.34401 37.23416 6.03070   1.000 25.03804  ? 31  THR A N   1 
ATOM   278  C CA  . THR A  1 54  ? -70.26446 36.24391 7.09119   1.000 24.68284  ? 31  THR A CA  1 
ATOM   279  C C   . THR A  1 54  ? -69.70562 34.93954 6.53198   1.000 27.21215  ? 31  THR A C   1 
ATOM   280  O O   . THR A  1 54  ? -70.01787 34.54728 5.40072   1.000 25.46937  ? 31  THR A O   1 
ATOM   281  C CB  . THR A  1 54  ? -71.65239 36.04516 7.72430   1.000 32.12672  ? 31  THR A CB  1 
ATOM   282  O OG1 . THR A  1 54  ? -72.10791 37.32008 8.19418   1.000 35.10855  ? 31  THR A OG1 1 
ATOM   283  C CG2 . THR A  1 54  ? -71.62967 35.04822 8.90757   1.000 29.64327  ? 31  THR A CG2 1 
ATOM   284  N N   . VAL A  1 55  ? -68.85678 34.29465 7.30810   1.000 23.93439  ? 32  VAL A N   1 
ATOM   285  C CA  . VAL A  1 55  ? -68.31870 32.96128 6.97724   1.000 21.76991  ? 32  VAL A CA  1 
ATOM   286  C C   . VAL A  1 55  ? -69.06479 31.93089 7.81123   1.000 25.48250  ? 32  VAL A C   1 
ATOM   287  O O   . VAL A  1 55  ? -69.14547 32.07524 9.03755   1.000 23.77707  ? 32  VAL A O   1 
ATOM   288  C CB  . VAL A  1 55  ? -66.81244 32.89536 7.27681   1.000 24.23700  ? 32  VAL A CB  1 
ATOM   289  C CG1 . VAL A  1 55  ? -66.25237 31.51735 6.88906   1.000 23.88961  ? 32  VAL A CG1 1 
ATOM   290  C CG2 . VAL A  1 55  ? -66.11509 34.03972 6.52905   1.000 23.73468  ? 32  VAL A CG2 1 
ATOM   291  N N   . TYR A  1 56  ? -69.57499 30.87667 7.16530   1.000 20.08640  ? 33  TYR A N   1 
ATOM   292  C CA  . TYR A  1 56  ? -70.25118 29.77826 7.83518   1.000 20.39472  ? 33  TYR A CA  1 
ATOM   293  C C   . TYR A  1 56  ? -69.51676 28.49337 7.53930   1.000 25.60118  ? 33  TYR A C   1 
ATOM   294  O O   . TYR A  1 56  ? -68.83535 28.37062 6.50882   1.000 26.10177  ? 33  TYR A O   1 
ATOM   295  C CB  . TYR A  1 56  ? -71.71066 29.57694 7.34250   1.000 24.93968  ? 33  TYR A CB  1 
ATOM   296  C CG  . TYR A  1 56  ? -72.59301 30.77632 7.52816   1.000 30.12490  ? 33  TYR A CG  1 
ATOM   297  C CD1 . TYR A  1 56  ? -72.60319 31.80832 6.58719   1.000 29.17609  ? 33  TYR A CD1 1 
ATOM   298  C CD2 . TYR A  1 56  ? -73.43107 30.87650 8.63903   1.000 28.53933  ? 33  TYR A CD2 1 
ATOM   299  C CE1 . TYR A  1 56  ? -73.41547 32.91703 6.75496   1.000 28.93908  ? 33  TYR A CE1 1 
ATOM   300  C CE2 . TYR A  1 56  ? -74.23627 31.98438 8.82752   1.000 32.73885  ? 33  TYR A CE2 1 
ATOM   301  C CZ  . TYR A  1 56  ? -74.23270 32.99432 7.88103   1.000 39.23764  ? 33  TYR A CZ  1 
ATOM   302  O OH  . TYR A  1 56  ? -75.04107 34.08135 8.07261   1.000 43.24987  ? 33  TYR A OH  1 
ATOM   303  N N   . THR A  1 57  ? -69.71259 27.51011 8.41435   1.000 23.46974  ? 34  THR A N   1 
ATOM   304  C CA  . THR A  1 57  ? -69.27428 26.15521 8.10641   1.000 21.28668  ? 34  THR A CA  1 
ATOM   305  C C   . THR A  1 57  ? -70.41990 25.18845 8.37088   1.000 28.16852  ? 34  THR A C   1 
ATOM   306  O O   . THR A  1 57  ? -71.30673 25.45150 9.18865   1.000 25.45096  ? 34  THR A O   1 
ATOM   307  C CB  . THR A  1 57  ? -68.00071 25.76545 8.91133   1.000 27.09010  ? 34  THR A CB  1 
ATOM   308  O OG1 . THR A  1 57  ? -67.46622 24.53320 8.39543   1.000 27.36683  ? 34  THR A OG1 1 
ATOM   309  C CG2 . THR A  1 57  ? -68.29512 25.61024 10.39810  1.000 26.34074  ? 34  THR A CG2 1 
ATOM   310  N N   . LYS A  1 58  ? -70.40781 24.06452 7.66628   1.000 27.25827  ? 35  LYS A N   1 
ATOM   311  C CA  . LYS A  1 58  ? -71.50259 23.11673 7.76137   1.000 28.67813  ? 35  LYS A CA  1 
ATOM   312  C C   . LYS A  1 58  ? -71.15326 22.11742 8.85531   1.000 35.44837  ? 35  LYS A C   1 
ATOM   313  O O   . LYS A  1 58  ? -70.06541 21.51906 8.82555   1.000 32.57097  ? 35  LYS A O   1 
ATOM   314  C CB  . LYS A  1 58  ? -71.74353 22.41110 6.42547   1.000 33.61959  ? 35  LYS A CB  1 
ATOM   315  C CG  . LYS A  1 58  ? -72.91590 21.40997 6.45774   1.000 41.61533  ? 35  LYS A CG  1 
ATOM   316  C CD  . LYS A  1 58  ? -72.86733 20.42097 5.27364   1.000 50.19817  ? 35  LYS A CD  1 
ATOM   317  C CE  . LYS A  1 58  ? -73.00046 21.15420 3.94624   1.000 51.74840  ? 35  LYS A CE  1 
ATOM   318  N NZ  . LYS A  1 58  ? -74.40072 21.29682 3.49086   1.000 55.29383  ? 35  LYS A NZ  1 
ATOM   319  N N   . VAL A  1 59  ? -72.04280 21.97901 9.84411   1.000 31.55019  ? 36  VAL A N   1 
ATOM   320  C CA  . VAL A  1 59  ? -71.86962 21.03158 10.94615  1.000 32.84994  ? 36  VAL A CA  1 
ATOM   321  C C   . VAL A  1 59  ? -73.10199 20.15118 10.96459  1.000 43.25979  ? 36  VAL A C   1 
ATOM   322  O O   . VAL A  1 59  ? -74.21434 20.62770 11.25069  1.000 35.95226  ? 36  VAL A O   1 
ATOM   323  C CB  . VAL A  1 59  ? -71.66558 21.71822 12.30027  1.000 35.23867  ? 36  VAL A CB  1 
ATOM   324  C CG1 . VAL A  1 59  ? -71.45482 20.67069 13.38556  1.000 39.52347  ? 36  VAL A CG1 1 
ATOM   325  C CG2 . VAL A  1 59  ? -70.48032 22.66654 12.24179  1.000 31.29100  ? 36  VAL A CG2 1 
ATOM   326  N N   . ASP A  1 60  ? -72.91283 18.87628 10.61491  1.000 42.37557  ? 37  ASP A N   1 
ATOM   327  C CA  . ASP A  1 60  ? -73.99194 17.89811 10.59031  1.000 41.14423  ? 37  ASP A CA  1 
ATOM   328  C C   . ASP A  1 60  ? -75.20652 18.42477 9.83914   1.000 40.74072  ? 37  ASP A C   1 
ATOM   329  O O   . ASP A  1 60  ? -76.34143 18.37878 10.31515  1.000 40.07560  ? 37  ASP A O   1 
ATOM   330  C CB  . ASP A  1 60  ? -74.34783 17.47324 12.00933  1.000 49.63885  ? 37  ASP A CB  1 
ATOM   331  C CG  . ASP A  1 60  ? -73.27544 16.58997 12.61665  1.000 62.64664  ? 37  ASP A CG  1 
ATOM   332  O OD1 . ASP A  1 60  ? -72.78384 15.70656 11.88216  1.000 68.39682  ? 37  ASP A OD1 1 
ATOM   333  O OD2 . ASP A  1 60  ? -72.90744 16.78724 13.79474  1.000 65.86767  ? 37  ASP A OD2 1 
ATOM   334  N N   . GLY A  1 61  ? -74.96520 18.93521 8.64559   1.000 36.70811  ? 38  GLY A N   1 
ATOM   335  C CA  . GLY A  1 61  ? -76.07487 19.28482 7.80159   1.000 34.92887  ? 38  GLY A CA  1 
ATOM   336  C C   . GLY A  1 61  ? -76.62921 20.69149 7.97214   1.000 34.22606  ? 38  GLY A C   1 
ATOM   337  O O   . GLY A  1 61  ? -77.51895 21.06431 7.21430   1.000 38.70030  ? 38  GLY A O   1 
ATOM   338  N N   . VAL A  1 62  ? -76.14571 21.49351 8.92951   1.000 30.43036  ? 39  VAL A N   1 
ATOM   339  C CA  . VAL A  1 62  ? -76.64001 22.86281 9.03633   1.000 31.41714  ? 39  VAL A CA  1 
ATOM   340  C C   . VAL A  1 62  ? -75.46513 23.81449 9.12988   1.000 30.01278  ? 39  VAL A C   1 
ATOM   341  O O   . VAL A  1 62  ? -74.35804 23.43484 9.51594   1.000 28.42698  ? 39  VAL A O   1 
ATOM   342  C CB  . VAL A  1 62  ? -77.60159 23.07072 10.22824  1.000 36.17257  ? 39  VAL A CB  1 
ATOM   343  C CG1 . VAL A  1 62  ? -78.80431 22.11221 10.09214  1.000 38.71503  ? 39  VAL A CG1 1 
ATOM   344  C CG2 . VAL A  1 62  ? -76.87617 22.93732 11.57218  1.000 31.64439  ? 39  VAL A CG2 1 
ATOM   345  N N   . ASP A  1 63  ? -75.72999 25.08214 8.79755   1.000 29.25749  ? 40  ASP A N   1 
ATOM   346  C CA  . ASP A  1 63  ? -74.69103 26.10552 8.76607   1.000 24.83775  ? 40  ASP A CA  1 
ATOM   347  C C   . ASP A  1 63  ? -74.51761 26.78300 10.11654  1.000 25.89947  ? 40  ASP A C   1 
ATOM   348  O O   . ASP A  1 63  ? -75.48359 27.15868 10.77856  1.000 28.92212  ? 40  ASP A O   1 
ATOM   349  C CB  . ASP A  1 63  ? -75.01449 27.14632 7.69087   1.000 26.27728  ? 40  ASP A CB  1 
ATOM   350  C CG  . ASP A  1 63  ? -74.93206 26.55055 6.27318   1.000 36.12709  ? 40  ASP A CG  1 
ATOM   351  O OD1 . ASP A  1 63  ? -74.03404 25.71114 6.02960   1.000 34.12341  ? 40  ASP A OD1 1 
ATOM   352  O OD2 . ASP A  1 63  ? -75.77115 26.90294 5.40406   1.000 39.06027  ? 40  ASP A OD2 1 
ATOM   353  N N   . VAL A  1 64  ? -73.27242 26.98584 10.49638  1.000 22.84873  ? 41  VAL A N   1 
ATOM   354  C CA  . VAL A  1 64  ? -72.92454 27.59748 11.77267  1.000 24.18021  ? 41  VAL A CA  1 
ATOM   355  C C   . VAL A  1 64  ? -71.99950 28.76040 11.47582  1.000 24.80595  ? 41  VAL A C   1 
ATOM   356  O O   . VAL A  1 64  ? -71.05987 28.61866 10.69053  1.000 24.11142  ? 41  VAL A O   1 
ATOM   357  C CB  . VAL A  1 64  ? -72.23503 26.59972 12.72618  1.000 28.01200  ? 41  VAL A CB  1 
ATOM   358  C CG1 . VAL A  1 64  ? -71.83574 27.33265 14.02617  1.000 32.89411  ? 41  VAL A CG1 1 
ATOM   359  C CG2 . VAL A  1 64  ? -73.18313 25.41997 13.00106  1.000 30.81587  ? 41  VAL A CG2 1 
ATOM   360  N N   . GLU A  1 65  ? -72.27296 29.90450 12.08663  1.000 22.47378  ? 42  GLU A N   1 
ATOM   361  C CA  . GLU A  1 65  ? -71.48764 31.09689 11.81679  1.000 24.93334  ? 42  GLU A CA  1 
ATOM   362  C C   . GLU A  1 65  ? -70.11701 31.03512 12.49116  1.000 30.55142  ? 42  GLU A C   1 
ATOM   363  O O   . GLU A  1 65  ? -70.01743 30.77843 13.69094  1.000 30.21861  ? 42  GLU A O   1 
ATOM   364  C CB  . GLU A  1 65  ? -72.26350 32.34265 12.27932  1.000 25.06212  ? 42  GLU A CB  1 
ATOM   365  C CG  . GLU A  1 65  ? -71.37883 33.57766 12.30640  1.000 26.54750  ? 42  GLU A CG  1 
ATOM   366  C CD  . GLU A  1 65  ? -72.15355 34.84619 12.73123  1.000 38.42518  ? 42  GLU A CD  1 
ATOM   367  O OE1 . GLU A  1 65  ? -73.37343 34.91945 12.51915  1.000 38.93012  ? 42  GLU A OE1 1 
ATOM   368  O OE2 . GLU A  1 65  ? -71.52103 35.73656 13.29101  1.000 43.01070  ? 42  GLU A OE2 1 
ATOM   369  N N   . LEU A  1 66  ? -69.05290 31.28349 11.71880  1.000 24.65130  ? 43  LEU A N   1 
ATOM   370  C CA  . LEU A  1 66  ? -67.69771 31.34591 12.27192  1.000 27.27505  ? 43  LEU A CA  1 
ATOM   371  C C   . LEU A  1 66  ? -67.14755 32.76322 12.41180  1.000 29.72069  ? 43  LEU A C   1 
ATOM   372  O O   . LEU A  1 66  ? -66.26809 32.99470 13.25133  1.000 30.36299  ? 43  LEU A O   1 
ATOM   373  C CB  . LEU A  1 66  ? -66.71156 30.56956 11.39558  1.000 26.79803  ? 43  LEU A CB  1 
ATOM   374  C CG  . LEU A  1 66  ? -66.91345 29.07653 11.29489  1.000 28.82395  ? 43  LEU A CG  1 
ATOM   375  C CD1 . LEU A  1 66  ? -65.74226 28.47885 10.50801  1.000 29.78240  ? 43  LEU A CD1 1 
ATOM   376  C CD2 . LEU A  1 66  ? -67.02349 28.49024 12.70485  1.000 31.21687  ? 43  LEU A CD2 1 
ATOM   377  N N   . PHE A  1 67  ? -67.58834 33.70199 11.57692  1.000 26.10367  ? 44  PHE A N   1 
ATOM   378  C CA  . PHE A  1 67  ? -66.94808 35.01459 11.53045  1.000 24.75071  ? 44  PHE A CA  1 
ATOM   379  C C   . PHE A  1 67  ? -67.88345 35.97662 10.83915  1.000 30.26217  ? 44  PHE A C   1 
ATOM   380  O O   . PHE A  1 67  ? -68.38340 35.67026 9.75687   1.000 30.28478  ? 44  PHE A O   1 
ATOM   381  C CB  . PHE A  1 67  ? -65.62393 34.93260 10.74965  1.000 25.14739  ? 44  PHE A CB  1 
ATOM   382  C CG  . PHE A  1 67  ? -64.91746 36.26449 10.60476  1.000 26.36391  ? 44  PHE A CG  1 
ATOM   383  C CD1 . PHE A  1 67  ? -64.20659 36.80150 11.68355  1.000 26.28754  ? 44  PHE A CD1 1 
ATOM   384  C CD2 . PHE A  1 67  ? -64.92789 36.95553 9.38561   1.000 21.77172  ? 44  PHE A CD2 1 
ATOM   385  C CE1 . PHE A  1 67  ? -63.53322 38.03827 11.55286  1.000 25.17547  ? 44  PHE A CE1 1 
ATOM   386  C CE2 . PHE A  1 67  ? -64.25413 38.19899 9.24500   1.000 21.04316  ? 44  PHE A CE2 1 
ATOM   387  C CZ  . PHE A  1 67  ? -63.58663 38.73703 10.32409  1.000 22.39390  ? 44  PHE A CZ  1 
ATOM   388  N N   . GLU A  1 68  ? -68.11013 37.13645 11.44463  1.000 25.33447  ? 45  GLU A N   1 
ATOM   389  C CA  . GLU A  1 68  ? -68.81148 38.22142 10.78876  1.000 26.71988  ? 45  GLU A CA  1 
ATOM   390  C C   . GLU A  1 68  ? -67.80662 39.33665 10.54705  1.000 27.90352  ? 45  GLU A C   1 
ATOM   391  O O   . GLU A  1 68  ? -67.23312 39.88106 11.50025  1.000 28.69303  ? 45  GLU A O   1 
ATOM   392  C CB  . GLU A  1 68  ? -69.97822 38.74737 11.63140  1.000 27.26139  ? 45  GLU A CB  1 
ATOM   393  C CG  . GLU A  1 68  ? -70.56917 39.99768 11.00119  1.000 37.64478  ? 45  GLU A CG  1 
ATOM   394  C CD  . GLU A  1 68  ? -71.76436 40.58346 11.76921  1.000 47.88538  ? 45  GLU A CD  1 
ATOM   395  O OE1 . GLU A  1 68  ? -71.93905 40.26554 12.96553  1.000 46.03938  ? 45  GLU A OE1 1 
ATOM   396  O OE2 . GLU A  1 68  ? -72.52190 41.35904 11.15075  1.000 50.26698  ? 45  GLU A OE2 1 
ATOM   397  N N   . ASN A  1 69  ? -67.64570 39.71441 9.29207   1.000 23.42595  ? 46  ASN A N   1 
ATOM   398  C CA  . ASN A  1 69  ? -66.65723 40.71846 8.92321   1.000 26.00353  ? 46  ASN A CA  1 
ATOM   399  C C   . ASN A  1 69  ? -67.14769 42.12072 9.28761   1.000 25.81690  ? 46  ASN A C   1 
ATOM   400  O O   . ASN A  1 69  ? -68.15744 42.57916 8.75158   1.000 25.04639  ? 46  ASN A O   1 
ATOM   401  C CB  . ASN A  1 69  ? -66.39717 40.61110 7.41978   1.000 26.80720  ? 46  ASN A CB  1 
ATOM   402  C CG  . ASN A  1 69  ? -65.34761 41.57501 6.94231   1.000 27.17277  ? 46  ASN A CG  1 
ATOM   403  O OD1 . ASN A  1 69  ? -64.47457 41.98351 7.72185   1.000 22.29748  ? 46  ASN A OD1 1 
ATOM   404  N ND2 . ASN A  1 69  ? -65.40785 41.94416 5.64221   1.000 21.65791  ? 46  ASN A ND2 1 
ATOM   405  N N   . LYS A  1 70  ? -66.41592 42.82282 10.15981  1.000 27.82033  ? 47  LYS A N   1 
ATOM   406  C CA  . LYS A  1 70  ? -66.67143 44.23119 10.46522  1.000 29.58844  ? 47  LYS A CA  1 
ATOM   407  C C   . LYS A  1 70  ? -65.59357 45.16004 9.88569   1.000 32.46568  ? 47  LYS A C   1 
ATOM   408  O O   . LYS A  1 70  ? -65.60048 46.36287 10.16845  1.000 29.85505  ? 47  LYS A O   1 
ATOM   409  C CB  . LYS A  1 70  ? -66.75955 44.44663 11.98127  1.000 33.71614  ? 47  LYS A CB  1 
ATOM   410  C CG  . LYS A  1 70  ? -67.75303 43.54414 12.70777  1.000 37.13599  ? 47  LYS A CG  1 
ATOM   411  C CD  . LYS A  1 70  ? -69.18147 43.82741 12.29505  1.000 45.37204  ? 47  LYS A CD  1 
ATOM   412  C CE  . LYS A  1 70  ? -69.60045 45.28385 12.55079  1.000 64.94156  ? 47  LYS A CE  1 
ATOM   413  N NZ  . LYS A  1 70  ? -70.41847 45.53163 13.79695  1.000 72.94376  ? 47  LYS A NZ  1 
ATOM   414  N N   . THR A  1 71  ? -64.69430 44.63640 9.05449   1.000 25.04967  ? 48  THR A N   1 
ATOM   415  C CA  . THR A  1 71  ? -63.56839 45.39074 8.52416   1.000 24.23644  ? 48  THR A CA  1 
ATOM   416  C C   . THR A  1 71  ? -63.94345 45.93590 7.15795   1.000 27.14367  ? 48  THR A C   1 
ATOM   417  O O   . THR A  1 71  ? -64.99209 45.60401 6.59737   1.000 26.60207  ? 48  THR A O   1 
ATOM   418  C CB  . THR A  1 71  ? -62.31303 44.51283 8.37872   1.000 26.02660  ? 48  THR A CB  1 
ATOM   419  O OG1 . THR A  1 71  ? -62.40826 43.71690 7.17734   1.000 25.64052  ? 48  THR A OG1 1 
ATOM   420  C CG2 . THR A  1 71  ? -62.12752 43.58406 9.57205   1.000 24.76027  ? 48  THR A CG2 1 
ATOM   421  N N   . THR A  1 72  ? -63.05915 46.74324 6.58216   1.000 22.42476  ? 49  THR A N   1 
ATOM   422  C CA  . THR A  1 72  ? -63.21979 47.18338 5.20257   1.000 28.41602  ? 49  THR A CA  1 
ATOM   423  C C   . THR A  1 72  ? -62.44869 46.29909 4.19939   1.000 27.93799  ? 49  THR A C   1 
ATOM   424  O O   . THR A  1 72  ? -62.30822 46.67569 3.02355   1.000 29.02099  ? 49  THR A O   1 
ATOM   425  C CB  . THR A  1 72  ? -62.79058 48.63873 5.09181   1.000 29.71072  ? 49  THR A CB  1 
ATOM   426  O OG1 . THR A  1 72  ? -61.41158 48.76579 5.49657   1.000 29.73947  ? 49  THR A OG1 1 
ATOM   427  C CG2 . THR A  1 72  ? -63.63582 49.45940 6.08392   1.000 27.93155  ? 49  THR A CG2 1 
ATOM   428  N N   . LEU A  1 73  ? -61.96458 45.13994 4.63621   1.000 21.56015  ? 50  LEU A N   1 
ATOM   429  C CA  . LEU A  1 73  ? -61.32119 44.16279 3.76616   1.000 23.65390  ? 50  LEU A CA  1 
ATOM   430  C C   . LEU A  1 73  ? -62.36683 43.17322 3.25803   1.000 26.84031  ? 50  LEU A C   1 
ATOM   431  O O   . LEU A  1 73  ? -63.44348 43.05145 3.85710   1.000 23.13341  ? 50  LEU A O   1 
ATOM   432  C CB  . LEU A  1 73  ? -60.25642 43.39322 4.54803   1.000 23.42441  ? 50  LEU A CB  1 
ATOM   433  C CG  . LEU A  1 73  ? -59.03455 44.21724 5.02322   1.000 28.80094  ? 50  LEU A CG  1 
ATOM   434  C CD1 . LEU A  1 73  ? -58.24729 43.41737 6.04987   1.000 31.79048  ? 50  LEU A CD1 1 
ATOM   435  C CD2 . LEU A  1 73  ? -58.15731 44.56467 3.84904   1.000 32.62157  ? 50  LEU A CD2 1 
ATOM   436  N N   . PRO A  1 74  ? -62.05666 42.43309 2.18349   1.000 22.19844  ? 51  PRO A N   1 
ATOM   437  C CA  . PRO A  1 74  ? -62.93930 41.32775 1.75453   1.000 24.41318  ? 51  PRO A CA  1 
ATOM   438  C C   . PRO A  1 74  ? -63.13762 40.32067 2.87277   1.000 23.13975  ? 51  PRO A C   1 
ATOM   439  O O   . PRO A  1 74  ? -62.20932 40.02050 3.63494   1.000 24.15345  ? 51  PRO A O   1 
ATOM   440  C CB  . PRO A  1 74  ? -62.19711 40.69626 0.56613   1.000 22.19995  ? 51  PRO A CB  1 
ATOM   441  C CG  . PRO A  1 74  ? -61.23475 41.86073 0.05576   1.000 23.42828  ? 51  PRO A CG  1 
ATOM   442  C CD  . PRO A  1 74  ? -60.87139 42.62184 1.31257   1.000 24.11439  ? 51  PRO A CD  1 
ATOM   443  N N   . VAL A  1 75  ? -64.36677 39.78169 2.95257   1.000 20.78421  ? 52  VAL A N   1 
ATOM   444  C CA  . VAL A  1 75  ? -64.74613 38.89314 4.05837   1.000 21.06870  ? 52  VAL A CA  1 
ATOM   445  C C   . VAL A  1 75  ? -63.77423 37.72225 4.21955   1.000 22.74189  ? 52  VAL A C   1 
ATOM   446  O O   . VAL A  1 75  ? -63.39855 37.37441 5.33741   1.000 21.41744  ? 52  VAL A O   1 
ATOM   447  C CB  . VAL A  1 75  ? -66.19961 38.39437 3.87119   1.000 25.74600  ? 52  VAL A CB  1 
ATOM   448  C CG1 . VAL A  1 75  ? -66.36092 37.72322 2.52791   1.000 24.61793  ? 52  VAL A CG1 1 
ATOM   449  C CG2 . VAL A  1 75  ? -66.62249 37.41364 5.02701   1.000 24.45762  ? 52  VAL A CG2 1 
ATOM   450  N N   . ASN A  1 76  ? -63.35143 37.07395 3.12306   1.000 22.60895  ? 53  ASN A N   1 
ATOM   451  C CA  . ASN A  1 76  ? -62.51266 35.89582 3.31691   1.000 21.17712  ? 53  ASN A CA  1 
ATOM   452  C C   . ASN A  1 76  ? -61.09627 36.27689 3.76787   1.000 26.77928  ? 53  ASN A C   1 
ATOM   453  O O   . ASN A  1 76  ? -60.42498 35.47992 4.43874   1.000 23.80384  ? 53  ASN A O   1 
ATOM   454  C CB  . ASN A  1 76  ? -62.41617 35.05690 2.02831   1.000 22.77977  ? 53  ASN A CB  1 
ATOM   455  C CG  . ASN A  1 76  ? -61.81521 35.85522 0.88846   1.000 24.71246  ? 53  ASN A CG  1 
ATOM   456  O OD1 . ASN A  1 76  ? -62.27883 36.97196 0.58099   1.000 24.50414  ? 53  ASN A OD1 1 
ATOM   457  N ND2 . ASN A  1 76  ? -60.76154 35.32114 0.28012   1.000 24.11553  ? 53  ASN A ND2 1 
ATOM   458  N N   . VAL A  1 77  ? -60.63340 37.46438 3.38647   1.000 25.40878  ? 54  VAL A N   1 
ATOM   459  C CA  . VAL A  1 77  ? -59.31446 37.96658 3.79818   1.000 25.12704  ? 54  VAL A CA  1 
ATOM   460  C C   . VAL A  1 77  ? -59.32729 38.34958 5.27949   1.000 25.30835  ? 54  VAL A C   1 
ATOM   461  O O   . VAL A  1 77  ? -58.42796 37.98005 6.04952   1.000 24.86728  ? 54  VAL A O   1 
ATOM   462  C CB  . VAL A  1 77  ? -58.92744 39.17529 2.91424   1.000 24.30806  ? 54  VAL A CB  1 
ATOM   463  C CG1 . VAL A  1 77  ? -57.59984 39.82582 3.39238   1.000 22.99816  ? 54  VAL A CG1 1 
ATOM   464  C CG2 . VAL A  1 77  ? -58.81426 38.74490 1.44184   1.000 25.14988  ? 54  VAL A CG2 1 
ATOM   465  N N   . ALA A  1 78  ? -60.32592 39.12572 5.68752   1.000 23.06969  ? 55  ALA A N   1 
ATOM   466  C CA  . ALA A  1 78  ? -60.48088 39.48950 7.09692   1.000 23.64459  ? 55  ALA A CA  1 
ATOM   467  C C   . ALA A  1 78  ? -60.58765 38.25713 7.98263   1.000 26.03509  ? 55  ALA A C   1 
ATOM   468  O O   . ALA A  1 78  ? -60.02712 38.22954 9.08547   1.000 26.24802  ? 55  ALA A O   1 
ATOM   469  C CB  . ALA A  1 78  ? -61.73340 40.35351 7.28359   1.000 20.36331  ? 55  ALA A CB  1 
ATOM   470  N N   . PHE A  1 79  ? -61.34745 37.24195 7.53443   1.000 20.16368  ? 56  PHE A N   1 
ATOM   471  C CA  . PHE A  1 79  ? -61.43172 35.97379 8.25921   1.000 22.80870  ? 56  PHE A CA  1 
ATOM   472  C C   . PHE A  1 79  ? -60.05005 35.36444 8.49010   1.000 25.23769  ? 56  PHE A C   1 
ATOM   473  O O   . PHE A  1 79  ? -59.73771 34.92361 9.59270   1.000 23.68274  ? 56  PHE A O   1 
ATOM   474  C CB  . PHE A  1 79  ? -62.29780 34.98773 7.46501   1.000 24.34639  ? 56  PHE A CB  1 
ATOM   475  C CG  . PHE A  1 79  ? -62.41968 33.61765 8.08902   1.000 22.64931  ? 56  PHE A CG  1 
ATOM   476  C CD1 . PHE A  1 79  ? -62.90801 33.45249 9.38309   1.000 21.73185  ? 56  PHE A CD1 1 
ATOM   477  C CD2 . PHE A  1 79  ? -62.13231 32.47983 7.34049   1.000 22.97104  ? 56  PHE A CD2 1 
ATOM   478  C CE1 . PHE A  1 79  ? -63.09875 32.15328 9.93645   1.000 23.05425  ? 56  PHE A CE1 1 
ATOM   479  C CE2 . PHE A  1 79  ? -62.30962 31.17212 7.88158   1.000 23.38517  ? 56  PHE A CE2 1 
ATOM   480  C CZ  . PHE A  1 79  ? -62.79250 31.01978 9.17663   1.000 23.66241  ? 56  PHE A CZ  1 
ATOM   481  N N   . GLU A  1 80  ? -59.21030 35.32465 7.45107   1.000 23.18726  ? 57  GLU A N   1 
ATOM   482  C CA  . GLU A  1 80  ? -57.89171 34.71237 7.60524   1.000 23.78241  ? 57  GLU A CA  1 
ATOM   483  C C   . GLU A  1 80  ? -56.99088 35.52568 8.54218   1.000 26.37975  ? 57  GLU A C   1 
ATOM   484  O O   . GLU A  1 80  ? -56.24666 34.95337 9.35713   1.000 25.83401  ? 57  GLU A O   1 
ATOM   485  C CB  . GLU A  1 80  ? -57.23357 34.55559 6.23162   1.000 23.65431  ? 57  GLU A CB  1 
ATOM   486  C CG  . GLU A  1 80  ? -55.82160 34.03241 6.29847   1.000 29.07513  ? 57  GLU A CG  1 
ATOM   487  C CD  . GLU A  1 80  ? -55.28905 33.63206 4.91763   1.000 41.62689  ? 57  GLU A CD  1 
ATOM   488  O OE1 . GLU A  1 80  ? -56.11089 33.50093 3.98089   1.000 40.55906  ? 57  GLU A OE1 1 
ATOM   489  O OE2 . GLU A  1 80  ? -54.05880 33.44203 4.76673   1.000 39.33380  ? 57  GLU A OE2 1 
ATOM   490  N N   . LEU A  1 81  ? -57.03509 36.85570 8.44509   1.000 25.70350  ? 58  LEU A N   1 
ATOM   491  C CA  . LEU A  1 81  ? -56.18626 37.67087 9.32027   1.000 24.58628  ? 58  LEU A CA  1 
ATOM   492  C C   . LEU A  1 81  ? -56.62346 37.53681 10.77492  1.000 23.09133  ? 58  LEU A C   1 
ATOM   493  O O   . LEU A  1 81  ? -55.78575 37.47369 11.67491  1.000 26.36001  ? 58  LEU A O   1 
ATOM   494  C CB  . LEU A  1 81  ? -56.22178 39.14078 8.89030   1.000 23.04665  ? 58  LEU A CB  1 
ATOM   495  C CG  . LEU A  1 81  ? -55.65785 39.46046 7.49221   1.000 28.89938  ? 58  LEU A CG  1 
ATOM   496  C CD1 . LEU A  1 81  ? -55.74420 40.97270 7.15269   1.000 32.64638  ? 58  LEU A CD1 1 
ATOM   497  C CD2 . LEU A  1 81  ? -54.25864 38.98580 7.34730   1.000 30.74010  ? 58  LEU A CD2 1 
ATOM   498  N N   . TRP A  1 82  ? -57.93949 37.51099 11.01940  1.000 21.84586  ? 59  TRP A N   1 
ATOM   499  C CA  . TRP A  1 82  ? -58.45146 37.27618 12.37059  1.000 26.87689  ? 59  TRP A CA  1 
ATOM   500  C C   . TRP A  1 82  ? -58.02136 35.91149 12.90421  1.000 28.70675  ? 59  TRP A C   1 
ATOM   501  O O   . TRP A  1 82  ? -57.56611 35.80200 14.05089  1.000 26.31982  ? 59  TRP A O   1 
ATOM   502  C CB  . TRP A  1 82  ? -59.98434 37.40535 12.40034  1.000 24.23518  ? 59  TRP A CB  1 
ATOM   503  C CG  . TRP A  1 82  ? -60.59299 36.91772 13.70739  1.000 28.07851  ? 59  TRP A CG  1 
ATOM   504  C CD1 . TRP A  1 82  ? -60.53701 37.54751 14.95006  1.000 28.51917  ? 59  TRP A CD1 1 
ATOM   505  C CD2 . TRP A  1 82  ? -61.32615 35.71273 13.90153  1.000 28.69093  ? 59  TRP A CD2 1 
ATOM   506  N NE1 . TRP A  1 82  ? -61.20617 36.77960 15.88398  1.000 30.27436  ? 59  TRP A NE1 1 
ATOM   507  C CE2 . TRP A  1 82  ? -61.69836 35.65712 15.26829  1.000 28.45874  ? 59  TRP A CE2 1 
ATOM   508  C CE3 . TRP A  1 82  ? -61.70772 34.66642 13.05316  1.000 24.43180  ? 59  TRP A CE3 1 
ATOM   509  C CZ2 . TRP A  1 82  ? -62.43720 34.61553 15.78893  1.000 35.07609  ? 59  TRP A CZ2 1 
ATOM   510  C CZ3 . TRP A  1 82  ? -62.46918 33.62993 13.57546  1.000 33.05862  ? 59  TRP A CZ3 1 
ATOM   511  C CH2 . TRP A  1 82  ? -62.82037 33.60749 14.93510  1.000 38.83871  ? 59  TRP A CH2 1 
ATOM   512  N N   . ALA A  1 83  ? -58.14946 34.85026 12.08575  1.000 24.71231  ? 60  ALA A N   1 
ATOM   513  C CA  . ALA A  1 83  ? -57.70608 33.52946 12.53894  1.000 25.87452  ? 60  ALA A CA  1 
ATOM   514  C C   . ALA A  1 83  ? -56.21788 33.52586 12.88671  1.000 24.85505  ? 60  ALA A C   1 
ATOM   515  O O   . ALA A  1 83  ? -55.79870 32.79967 13.79581  1.000 27.12917  ? 60  ALA A O   1 
ATOM   516  C CB  . ALA A  1 83  ? -57.98041 32.46367 11.46879  1.000 23.41347  ? 60  ALA A CB  1 
ATOM   517  N N   . LYS A  1 84  ? -55.40708 34.30782 12.15975  1.000 24.27118  ? 61  LYS A N   1 
ATOM   518  C CA  . LYS A  1 84  ? -53.95594 34.36629 12.33960  1.000 25.86268  ? 61  LYS A CA  1 
ATOM   519  C C   . LYS A  1 84  ? -53.51737 35.45611 13.33517  1.000 28.04827  ? 61  LYS A C   1 
ATOM   520  O O   . LYS A  1 84  ? -52.32722 35.77930 13.39561  1.000 25.70796  ? 61  LYS A O   1 
ATOM   521  C CB  . LYS A  1 84  ? -53.26358 34.56178 10.98186  1.000 27.57169  ? 61  LYS A CB  1 
ATOM   522  C CG  . LYS A  1 84  ? -53.38035 33.28468 10.09079  1.000 29.31814  ? 61  LYS A CG  1 
ATOM   523  C CD  . LYS A  1 84  ? -52.80369 33.45562 8.68378   1.000 31.80774  ? 61  LYS A CD  1 
ATOM   524  C CE  . LYS A  1 84  ? -52.84716 32.09302 7.93956   1.000 28.61758  ? 61  LYS A CE  1 
ATOM   525  N NZ  . LYS A  1 84  ? -52.35750 32.23798 6.54663   1.000 29.56121  ? 61  LYS A NZ  1 
ATOM   526  N N   . ARG A  1 85  ? -54.43728 35.97398 14.14212  1.000 25.71964  ? 62  ARG A N   1 
ATOM   527  C CA  . ARG A  1 85  ? -54.10615 37.02174 15.10560  1.000 30.67188  ? 62  ARG A CA  1 
ATOM   528  C C   . ARG A  1 85  ? -53.12205 36.50308 16.14760  1.000 30.95576  ? 62  ARG A C   1 
ATOM   529  O O   . ARG A  1 85  ? -53.06791 35.30978 16.45245  1.000 27.18471  ? 62  ARG A O   1 
ATOM   530  C CB  . ARG A  1 85  ? -55.36832 37.51615 15.82188  1.000 26.71181  ? 62  ARG A CB  1 
ATOM   531  C CG  . ARG A  1 85  ? -56.00357 36.43733 16.72604  1.000 27.54400  ? 62  ARG A CG  1 
ATOM   532  C CD  . ARG A  1 85  ? -57.44761 36.79224 17.08669  1.000 28.43481  ? 62  ARG A CD  1 
ATOM   533  N NE  . ARG A  1 85  ? -58.04362 35.81033 17.99320  1.000 31.88144  ? 62  ARG A NE  1 
ATOM   534  C CZ  . ARG A  1 85  ? -58.61893 34.67632 17.60519  1.000 36.85954  ? 62  ARG A CZ  1 
ATOM   535  N NH1 . ARG A  1 85  ? -58.66988 34.36266 16.31137  1.000 32.77910  ? 62  ARG A NH1 1 
ATOM   536  N NH2 . ARG A  1 85  ? -59.13987 33.83716 18.50384  1.000 38.92514  ? 62  ARG A NH2 1 
ATOM   537  N N   . ASN A  1 86  ? -52.34729 37.42014 16.71699  1.000 26.12973  ? 63  ASN A N   1 
ATOM   538  C CA  . ASN A  1 86  ? -51.44314 37.03811 17.79250  1.000 27.36613  ? 63  ASN A CA  1 
ATOM   539  C C   . ASN A  1 86  ? -52.27388 36.74877 19.05321  1.000 26.81111  ? 63  ASN A C   1 
ATOM   540  O O   . ASN A  1 86  ? -53.07956 37.58422 19.47284  1.000 29.21053  ? 63  ASN A O   1 
ATOM   541  C CB  . ASN A  1 86  ? -50.41969 38.16861 18.03113  1.000 27.18914  ? 63  ASN A CB  1 
ATOM   542  C CG  . ASN A  1 86  ? -49.25870 37.71151 18.87893  1.000 33.03701  ? 63  ASN A CG  1 
ATOM   543  O OD1 . ASN A  1 86  ? -49.45801 37.08830 19.92043  1.000 35.76552  ? 63  ASN A OD1 1 
ATOM   544  N ND2 . ASN A  1 86  ? -48.03514 37.99040 18.43278  1.000 35.32934  ? 63  ASN A ND2 1 
ATOM   545  N N   . ILE A  1 87  ? -52.09251 35.56900 19.65992  1.000 24.72985  ? 64  ILE A N   1 
ATOM   546  C CA  . ILE A  1 87  ? -52.86259 35.18756 20.85594  1.000 29.22379  ? 64  ILE A CA  1 
ATOM   547  C C   . ILE A  1 87  ? -52.00340 35.22074 22.11959  1.000 31.93885  ? 64  ILE A C   1 
ATOM   548  O O   . ILE A  1 87  ? -52.39945 34.66150 23.14289  1.000 35.26498  ? 64  ILE A O   1 
ATOM   549  C CB  . ILE A  1 87  ? -53.52616 33.79020 20.69454  1.000 29.89190  ? 64  ILE A CB  1 
ATOM   550  C CG1 . ILE A  1 87  ? -52.44340 32.73208 20.46076  1.000 31.53542  ? 64  ILE A CG1 1 
ATOM   551  C CG2 . ILE A  1 87  ? -54.57932 33.80334 19.56622  1.000 27.39297  ? 64  ILE A CG2 1 
ATOM   552  C CD1 . ILE A  1 87  ? -52.83847 31.28081 20.81686  1.000 34.43575  ? 64  ILE A CD1 1 
ATOM   553  N N   . LYS A  1 88  ? -50.80426 35.79072 22.05757  1.000 27.61660  ? 65  LYS A N   1 
ATOM   554  C CA  . LYS A  1 88  ? -50.01240 36.08806 23.25009  1.000 27.44033  ? 65  LYS A CA  1 
ATOM   555  C C   . LYS A  1 88  ? -50.32790 37.49756 23.72238  1.000 28.67782  ? 65  LYS A C   1 
ATOM   556  O O   . LYS A  1 88  ? -50.95355 38.27849 23.00602  1.000 28.75785  ? 65  LYS A O   1 
ATOM   557  C CB  . LYS A  1 88  ? -48.52056 35.95010 22.93000  1.000 32.47240  ? 65  LYS A CB  1 
ATOM   558  C CG  . LYS A  1 88  ? -48.13525 34.50868 22.61294  1.000 45.72320  ? 65  LYS A CG  1 
ATOM   559  C CD  . LYS A  1 88  ? -46.71825 34.41580 22.02875  1.000 63.67806  ? 65  LYS A CD  1 
ATOM   560  C CE  . LYS A  1 88  ? -46.74372 34.77598 20.53891  1.000 72.91763  ? 65  LYS A CE  1 
ATOM   561  N NZ  . LYS A  1 88  ? -45.48891 34.40183 19.82798  1.000 75.87339  ? 65  LYS A NZ  1 
ATOM   562  N N   . PRO A  1 89  ? -49.97118 37.86376 24.94862  1.000 31.70685  ? 66  PRO A N   1 
ATOM   563  C CA  . PRO A  1 89  ? -50.11932 39.27965 25.33010  1.000 32.90316  ? 66  PRO A CA  1 
ATOM   564  C C   . PRO A  1 89  ? -49.31722 40.13153 24.35944  1.000 29.09639  ? 66  PRO A C   1 
ATOM   565  O O   . PRO A  1 89  ? -48.15758 39.82435 24.06886  1.000 32.76219  ? 66  PRO A O   1 
ATOM   566  C CB  . PRO A  1 89  ? -49.52766 39.34290 26.74758  1.000 29.64469  ? 66  PRO A CB  1 
ATOM   567  C CG  . PRO A  1 89  ? -49.60038 37.90185 27.24284  1.000 32.42394  ? 66  PRO A CG  1 
ATOM   568  C CD  . PRO A  1 89  ? -49.37642 37.04822 26.02546  1.000 29.08038  ? 66  PRO A CD  1 
ATOM   569  N N   . VAL A  1 90  ? -49.93839 41.19250 23.85029  1.000 29.75250  ? 67  VAL A N   1 
ATOM   570  C CA  . VAL A  1 90  ? -49.24016 42.12104 22.95613  1.000 28.51090  ? 67  VAL A CA  1 
ATOM   571  C C   . VAL A  1 90  ? -49.51477 43.54786 23.40984  1.000 26.28419  ? 67  VAL A C   1 
ATOM   572  O O   . VAL A  1 90  ? -50.50652 43.82101 24.10964  1.000 29.60340  ? 67  VAL A O   1 
ATOM   573  C CB  . VAL A  1 90  ? -49.66685 41.92211 21.47818  1.000 25.73469  ? 67  VAL A CB  1 
ATOM   574  C CG1 . VAL A  1 90  ? -49.09611 40.58373 20.92419  1.000 27.71630  ? 67  VAL A CG1 1 
ATOM   575  C CG2 . VAL A  1 90  ? -51.18825 41.93086 21.35668  1.000 27.86485  ? 67  VAL A CG2 1 
ATOM   576  N N   . PRO A  1 91  ? -48.67658 44.49663 22.98151  1.000 27.87813  ? 68  PRO A N   1 
ATOM   577  C CA  . PRO A  1 91  ? -48.91458 45.90070 23.33473  1.000 28.72698  ? 68  PRO A CA  1 
ATOM   578  C C   . PRO A  1 91  ? -50.29964 46.33174 22.88515  1.000 27.29434  ? 68  PRO A C   1 
ATOM   579  O O   . PRO A  1 91  ? -50.77609 45.92520 21.82260  1.000 27.63980  ? 68  PRO A O   1 
ATOM   580  C CB  . PRO A  1 91  ? -47.81357 46.64312 22.55840  1.000 26.45515  ? 68  PRO A CB  1 
ATOM   581  C CG  . PRO A  1 91  ? -46.68151 45.63962 22.50673  1.000 27.77193  ? 68  PRO A CG  1 
ATOM   582  C CD  . PRO A  1 91  ? -47.41665 44.33318 22.22663  1.000 30.78634  ? 68  PRO A CD  1 
ATOM   583  N N   . GLU A  1 92  ? -50.96122 47.15192 23.69887  1.000 26.68518  ? 69  GLU A N   1 
ATOM   584  C CA  . GLU A  1 92  ? -52.20270 47.73930 23.22508  1.000 28.88946  ? 69  GLU A CA  1 
ATOM   585  C C   . GLU A  1 92  ? -51.95539 48.54754 21.95948  1.000 30.16747  ? 69  GLU A C   1 
ATOM   586  O O   . GLU A  1 92  ? -50.88072 49.12619 21.76689  1.000 27.03510  ? 69  GLU A O   1 
ATOM   587  C CB  . GLU A  1 92  ? -52.82837 48.61414 24.31234  1.000 32.19215  ? 69  GLU A CB  1 
ATOM   588  C CG  . GLU A  1 92  ? -53.35156 47.77059 25.47348  1.000 32.71048  ? 69  GLU A CG  1 
ATOM   589  C CD  . GLU A  1 92  ? -54.20688 48.55747 26.43660  1.000 33.42548  ? 69  GLU A CD  1 
ATOM   590  O OE1 . GLU A  1 92  ? -53.62323 49.18084 27.34340  1.000 33.34034  ? 69  GLU A OE1 1 
ATOM   591  O OE2 . GLU A  1 92  ? -55.45983 48.55078 26.28903  1.000 34.18975  ? 69  GLU A OE2 1 
ATOM   592  N N   . VAL A  1 93  ? -52.99334 48.63776 21.11728  1.000 26.49110  ? 70  VAL A N   1 
ATOM   593  C CA  . VAL A  1 93  ? -52.84894 49.29997 19.81837  1.000 26.72249  ? 70  VAL A CA  1 
ATOM   594  C C   . VAL A  1 93  ? -52.49327 50.78578 19.98448  1.000 27.75759  ? 70  VAL A C   1 
ATOM   595  O O   . VAL A  1 93  ? -51.69149 51.32709 19.21733  1.000 26.18556  ? 70  VAL A O   1 
ATOM   596  C CB  . VAL A  1 93  ? -54.12890 49.09217 18.97855  1.000 27.61178  ? 70  VAL A CB  1 
ATOM   597  C CG1 . VAL A  1 93  ? -54.13774 49.99999 17.74077  1.000 29.25088  ? 70  VAL A CG1 1 
ATOM   598  C CG2 . VAL A  1 93  ? -54.25936 47.59958 18.52810  1.000 26.14828  ? 70  VAL A CG2 1 
ATOM   599  N N   . LYS A  1 94  ? -53.06310 51.46641 20.98614  1.000 24.01965  ? 71  LYS A N   1 
ATOM   600  C CA  . LYS A  1 94  ? -52.69268 52.87854 21.19640  1.000 26.27500  ? 71  LYS A CA  1 
ATOM   601  C C   . LYS A  1 94  ? -51.18274 53.05264 21.38959  1.000 29.17813  ? 71  LYS A C   1 
ATOM   602  O O   . LYS A  1 94  ? -50.60616 54.05259 20.94256  1.000 27.65842  ? 71  LYS A O   1 
ATOM   603  C CB  . LYS A  1 94  ? -53.45154 53.47101 22.39631  1.000 26.99951  ? 71  LYS A CB  1 
ATOM   604  C CG  . LYS A  1 94  ? -53.14336 52.84288 23.78924  1.000 28.81742  ? 71  LYS A CG  1 
ATOM   605  C CD  . LYS A  1 94  ? -54.14197 53.36776 24.88681  1.000 27.39850  ? 71  LYS A CD  1 
ATOM   606  C CE  . LYS A  1 94  ? -54.05309 52.50584 26.17161  1.000 29.57783  ? 71  LYS A CE  1 
ATOM   607  N NZ  . LYS A  1 94  ? -54.97602 53.03228 27.24208  1.000 30.04995  ? 71  LYS A NZ  1 
ATOM   608  N N   . ILE A  1 95  ? -50.51776 52.08750 22.03341  1.000 27.97821  ? 72  ILE A N   1 
ATOM   609  C CA  . ILE A  1 95  ? -49.06652 52.20277 22.23388  1.000 26.51045  ? 72  ILE A CA  1 
ATOM   610  C C   . ILE A  1 95  ? -48.32922 52.04964 20.90136  1.000 27.43265  ? 72  ILE A C   1 
ATOM   611  O O   . ILE A  1 95  ? -47.40326 52.80625 20.58612  1.000 29.17250  ? 72  ILE A O   1 
ATOM   612  C CB  . ILE A  1 95  ? -48.57346 51.15088 23.25098  1.000 26.02636  ? 72  ILE A CB  1 
ATOM   613  C CG1 . ILE A  1 95  ? -49.17807 51.35018 24.64464  1.000 32.35402  ? 72  ILE A CG1 1 
ATOM   614  C CG2 . ILE A  1 95  ? -47.05125 51.15096 23.28755  1.000 27.89333  ? 72  ILE A CG2 1 
ATOM   615  C CD1 . ILE A  1 95  ? -48.67886 52.62406 25.35187  1.000 31.85563  ? 72  ILE A CD1 1 
ATOM   616  N N   . LEU A  1 96  ? -48.71148 51.04793 20.10947  1.000 30.19842  ? 73  LEU A N   1 
ATOM   617  C CA  . LEU A  1 96  ? -48.05829 50.82870 18.81732  1.000 27.62652  ? 73  LEU A CA  1 
ATOM   618  C C   . LEU A  1 96  ? -48.26422 52.01920 17.89228  1.000 27.99747  ? 73  LEU A C   1 
ATOM   619  O O   . LEU A  1 96  ? -47.33068 52.45474 17.20365  1.000 31.15555  ? 73  LEU A O   1 
ATOM   620  C CB  . LEU A  1 96  ? -48.62668 49.55376 18.16260  1.000 26.92249  ? 73  LEU A CB  1 
ATOM   621  C CG  . LEU A  1 96  ? -48.46769 48.28100 18.98893  1.000 28.16681  ? 73  LEU A CG  1 
ATOM   622  C CD1 . LEU A  1 96  ? -49.24815 47.13716 18.33409  1.000 31.41905  ? 73  LEU A CD1 1 
ATOM   623  C CD2 . LEU A  1 96  ? -46.96471 47.90511 19.14509  1.000 35.28424  ? 73  LEU A CD2 1 
ATOM   624  N N   . ASN A  1 97  ? -49.49570 52.53947 17.84670  1.000 25.93886  ? 74  ASN A N   1 
ATOM   625  C CA  . ASN A  1 97  ? -49.77804 53.73927 17.07124  1.000 25.19291  ? 74  ASN A CA  1 
ATOM   626  C C   . ASN A  1 97  ? -48.92019 54.91023 17.52923  1.000 25.91952  ? 74  ASN A C   1 
ATOM   627  O O   . ASN A  1 97  ? -48.38162 55.65998 16.70454  1.000 30.49952  ? 74  ASN A O   1 
ATOM   628  C CB  . ASN A  1 97  ? -51.25894 54.12517 17.21879  1.000 25.57954  ? 74  ASN A CB  1 
ATOM   629  C CG  . ASN A  1 97  ? -52.21479 53.16577 16.49654  1.000 31.83765  ? 74  ASN A CG  1 
ATOM   630  O OD1 . ASN A  1 97  ? -51.79317 52.31462 15.72986  1.000 30.78764  ? 74  ASN A OD1 1 
ATOM   631  N ND2 . ASN A  1 97  ? -53.51974 53.33494 16.74115  1.000 28.16407  ? 74  ASN A ND2 1 
ATOM   632  N N   . ASN A  1 98  ? -48.86478 55.15128 18.84796  1.000 28.02773  ? 75  ASN A N   1 
ATOM   633  C CA  . ASN A  1 98  ? -48.08607 56.29518 19.32354  1.000 29.22450  ? 75  ASN A CA  1 
ATOM   634  C C   . ASN A  1 98  ? -46.60906 56.13281 18.99934  1.000 33.52061  ? 75  ASN A C   1 
ATOM   635  O O   . ASN A  1 98  ? -45.89067 57.13021 18.88759  1.000 32.42581  ? 75  ASN A O   1 
ATOM   636  C CB  . ASN A  1 98  ? -48.23496 56.47674 20.82553  1.000 31.62952  ? 75  ASN A CB  1 
ATOM   637  C CG  . ASN A  1 98  ? -49.65461 56.90722 21.23541  1.000 31.15065  ? 75  ASN A CG  1 
ATOM   638  O OD1 . ASN A  1 98  ? -50.48808 57.23852 20.40098  1.000 27.60591  ? 75  ASN A OD1 1 
ATOM   639  N ND2 . ASN A  1 98  ? -49.89935 56.93517 22.52315  1.000 28.96487  ? 75  ASN A ND2 1 
ATOM   640  N N   . LEU A  1 99  ? -46.12017 54.90046 18.91448  1.000 30.02132  ? 76  LEU A N   1 
ATOM   641  C CA  . LEU A  1 99  ? -44.72057 54.69663 18.55752  1.000 34.60253  ? 76  LEU A CA  1 
ATOM   642  C C   . LEU A  1 99  ? -44.52280 54.66699 17.04916  1.000 39.25840  ? 76  LEU A C   1 
ATOM   643  O O   . LEU A  1 99  ? -43.39891 54.42724 16.59482  1.000 37.52101  ? 76  LEU A O   1 
ATOM   644  C CB  . LEU A  1 99  ? -44.17016 53.39094 19.17736  1.000 32.53200  ? 76  LEU A CB  1 
ATOM   645  C CG  . LEU A  1 99  ? -43.98609 53.40060 20.69655  1.000 34.80516  ? 76  LEU A CG  1 
ATOM   646  C CD1 . LEU A  1 99  ? -43.74410 51.98114 21.26985  1.000 33.80833  ? 76  LEU A CD1 1 
ATOM   647  C CD2 . LEU A  1 99  ? -42.84368 54.35447 21.10469  1.000 35.64460  ? 76  LEU A CD2 1 
ATOM   648  N N   . GLY A  1 100 ? -45.58921 54.86374 16.26525  1.000 32.54689  ? 77  GLY A N   1 
ATOM   649  C CA  . GLY A  1 100 ? -45.42905 54.95692 14.82714  1.000 37.42438  ? 77  GLY A CA  1 
ATOM   650  C C   . GLY A  1 100 ? -45.32536 53.62059 14.10921  1.000 37.00379  ? 77  GLY A C   1 
ATOM   651  O O   . GLY A  1 100 ? -44.84910 53.57724 12.97528  1.000 35.83312  ? 77  GLY A O   1 
ATOM   652  N N   . VAL A  1 101 ? -45.76017 52.52812 14.73136  1.000 33.38708  ? 78  VAL A N   1 
ATOM   653  C CA  . VAL A  1 101 ? -45.67951 51.21765 14.08777  1.000 34.11249  ? 78  VAL A CA  1 
ATOM   654  C C   . VAL A  1 101 ? -46.59806 51.18400 12.86795  1.000 35.44881  ? 78  VAL A C   1 
ATOM   655  O O   . VAL A  1 101 ? -47.78636 51.51263 12.96312  1.000 33.18609  ? 78  VAL A O   1 
ATOM   656  C CB  . VAL A  1 101 ? -46.04774 50.11521 15.09225  1.000 29.61539  ? 78  VAL A CB  1 
ATOM   657  C CG1 . VAL A  1 101 ? -46.31087 48.79699 14.36594  1.000 28.72305  ? 78  VAL A CG1 1 
ATOM   658  C CG2 . VAL A  1 101 ? -44.93699 49.96864 16.11902  1.000 30.29039  ? 78  VAL A CG2 1 
ATOM   659  N N   . ASP A  1 102 ? -46.04005 50.79436 11.71249  1.000 34.77999  ? 79  ASP A N   1 
ATOM   660  C CA  . ASP A  1 102 ? -46.76419 50.63810 10.44541  1.000 33.31581  ? 79  ASP A CA  1 
ATOM   661  C C   . ASP A  1 102 ? -47.25389 49.21044 10.15788  1.000 36.15099  ? 79  ASP A C   1 
ATOM   662  O O   . ASP A  1 102 ? -48.22981 49.03141 9.40345   1.000 32.79237  ? 79  ASP A O   1 
ATOM   663  C CB  . ASP A  1 102 ? -45.84263 51.05268 9.28778   1.000 33.14181  ? 79  ASP A CB  1 
ATOM   664  C CG  . ASP A  1 102 ? -45.49423 52.52855 9.33415   1.000 40.04836  ? 79  ASP A CG  1 
ATOM   665  O OD1 . ASP A  1 102 ? -46.42498 53.33017 9.54757   1.000 41.32727  ? 79  ASP A OD1 1 
ATOM   666  O OD2 . ASP A  1 102 ? -44.30908 52.86658 9.19858   1.000 40.78934  ? 79  ASP A OD2 1 
ATOM   667  N N   . ILE A  1 103 ? -46.56928 48.19297 10.67220  1.000 32.77549  ? 80  ILE A N   1 
ATOM   668  C CA  . ILE A  1 103 ? -46.73996 46.82005 10.19115  1.000 31.86003  ? 80  ILE A CA  1 
ATOM   669  C C   . ILE A  1 103 ? -46.02841 45.91467 11.18275  1.000 35.32507  ? 80  ILE A C   1 
ATOM   670  O O   . ILE A  1 103 ? -45.11547 46.35286 11.88662  1.000 34.15032  ? 80  ILE A O   1 
ATOM   671  C CB  . ILE A  1 103 ? -46.16035 46.68958 8.75444   1.000 33.97910  ? 80  ILE A CB  1 
ATOM   672  C CG1 . ILE A  1 103 ? -46.59816 45.37834 8.06543   1.000 36.18163  ? 80  ILE A CG1 1 
ATOM   673  C CG2 . ILE A  1 103 ? -44.64439 46.80147 8.77171   1.000 30.77876  ? 80  ILE A CG2 1 
ATOM   674  C CD1 . ILE A  1 103 ? -46.32309 45.36469 6.54482   1.000 31.47785  ? 80  ILE A CD1 1 
ATOM   675  N N   . ALA A  1 104 ? -46.44632 44.65231 11.25323  1.000 35.03898  ? 81  ALA A N   1 
ATOM   676  C CA  . ALA A  1 104 ? -45.86956 43.70472 12.20312  1.000 32.35922  ? 81  ALA A CA  1 
ATOM   677  C C   . ALA A  1 104 ? -45.09671 42.62916 11.44864  1.000 35.54939  ? 81  ALA A C   1 
ATOM   678  O O   . ALA A  1 104 ? -45.51536 42.20568 10.36508  1.000 35.14627  ? 81  ALA A O   1 
ATOM   679  C CB  . ALA A  1 104 ? -46.96822 43.06094 13.06450  1.000 31.97541  ? 81  ALA A CB  1 
ATOM   680  N N   . ALA A  1 105 ? -43.97059 42.18584 12.01950  1.000 32.75025  ? 82  ALA A N   1 
ATOM   681  C CA  . ALA A  1 105 ? -43.19045 41.08783 11.44123  1.000 35.84420  ? 82  ALA A CA  1 
ATOM   682  C C   . ALA A  1 105 ? -43.88254 39.74236 11.70038  1.000 38.99402  ? 82  ALA A C   1 
ATOM   683  O O   . ALA A  1 105 ? -43.86648 39.21841 12.82352  1.000 39.78955  ? 82  ALA A O   1 
ATOM   684  C CB  . ALA A  1 105 ? -41.77586 41.09173 12.01695  1.000 37.26901  ? 82  ALA A CB  1 
ATOM   685  N N   . ASN A  1 106 ? -44.50696 39.17784 10.67029  1.000 38.02997  ? 83  ASN A N   1 
ATOM   686  C CA  . ASN A  1 106 ? -44.88840 37.76471 10.68529  1.000 40.96345  ? 83  ASN A CA  1 
ATOM   687  C C   . ASN A  1 106 ? -45.94041 37.44940 11.73761  1.000 37.08394  ? 83  ASN A C   1 
ATOM   688  O O   . ASN A  1 106 ? -45.97035 36.35398 12.28965  1.000 38.24004  ? 83  ASN A O   1 
ATOM   689  C CB  . ASN A  1 106 ? -43.66064 36.87276 10.87415  1.000 43.90599  ? 83  ASN A CB  1 
ATOM   690  C CG  . ASN A  1 106 ? -42.69782 36.99806 9.72037   1.000 46.15297  ? 83  ASN A CG  1 
ATOM   691  O OD1 . ASN A  1 106 ? -41.92772 37.94926 9.64036   1.000 48.17438  ? 83  ASN A OD1 1 
ATOM   692  N ND2 . ASN A  1 106 ? -42.76844 36.06280 8.79562   1.000 51.48377  ? 83  ASN A ND2 1 
ATOM   693  N N   . THR A  1 107 ? -46.82198 38.39917 12.01307  1.000 30.45592  ? 84  THR A N   1 
ATOM   694  C CA  . THR A  1 107 ? -47.95786 38.16866 12.89035  1.000 34.40546  ? 84  THR A CA  1 
ATOM   695  C C   . THR A  1 107 ? -48.99728 39.20867 12.50692  1.000 32.36460  ? 84  THR A C   1 
ATOM   696  O O   . THR A  1 107 ? -48.72104 40.10339 11.70226  1.000 32.18907  ? 84  THR A O   1 
ATOM   697  C CB  . THR A  1 107 ? -47.55117 38.25681 14.37170  1.000 37.83291  ? 84  THR A CB  1 
ATOM   698  O OG1 . THR A  1 107 ? -48.67197 37.93054 15.20643  1.000 40.20396  ? 84  THR A OG1 1 
ATOM   699  C CG2 . THR A  1 107 ? -47.03896 39.65575 14.71977  1.000 32.91372  ? 84  THR A CG2 1 
ATOM   700  N N   . VAL A  1 108 ? -50.19702 39.06951 13.07017  1.000 27.42622  ? 85  VAL A N   1 
ATOM   701  C CA  . VAL A  1 108 ? -51.27414 40.04948 12.94257  1.000 27.52200  ? 85  VAL A CA  1 
ATOM   702  C C   . VAL A  1 108 ? -51.60912 40.54101 14.34899  1.000 29.69656  ? 85  VAL A C   1 
ATOM   703  O O   . VAL A  1 108 ? -51.96157 39.73946 15.22272  1.000 29.05318  ? 85  VAL A O   1 
ATOM   704  C CB  . VAL A  1 108 ? -52.52388 39.44366 12.26876  1.000 28.72960  ? 85  VAL A CB  1 
ATOM   705  C CG1 . VAL A  1 108 ? -53.69961 40.41624 12.28234  1.000 26.29714  ? 85  VAL A CG1 1 
ATOM   706  C CG2 . VAL A  1 108 ? -52.22305 38.99974 10.84590  1.000 32.50058  ? 85  VAL A CG2 1 
ATOM   707  N N   . ILE A  1 109 ? -51.50517 41.84838 14.57275  1.000 27.84039  ? 86  ILE A N   1 
ATOM   708  C CA  . ILE A  1 109 ? -52.04925 42.46230 15.78243  1.000 24.79637  ? 86  ILE A CA  1 
ATOM   709  C C   . ILE A  1 109 ? -53.51222 42.78466 15.49202  1.000 23.73341  ? 86  ILE A C   1 
ATOM   710  O O   . ILE A  1 109 ? -53.81121 43.70704 14.72507  1.000 27.07711  ? 86  ILE A O   1 
ATOM   711  C CB  . ILE A  1 109 ? -51.27235 43.72398 16.18146  1.000 28.03332  ? 86  ILE A CB  1 
ATOM   712  C CG1 . ILE A  1 109 ? -49.76717 43.44735 16.25330  1.000 30.04077  ? 86  ILE A CG1 1 
ATOM   713  C CG2 . ILE A  1 109 ? -51.84501 44.30965 17.50068  1.000 25.08871  ? 86  ILE A CG2 1 
ATOM   714  C CD1 . ILE A  1 109 ? -49.37796 42.37476 17.28089  1.000 27.84694  ? 86  ILE A CD1 1 
ATOM   715  N N   . TRP A  1 110 ? -54.43636 42.01730 16.08692  1.000 21.97429  ? 87  TRP A N   1 
ATOM   716  C CA  . TRP A  1 110 ? -55.86055 42.27098 15.88958  1.000 24.29467  ? 87  TRP A CA  1 
ATOM   717  C C   . TRP A  1 110 ? -56.31653 43.42430 16.78552  1.000 27.30114  ? 87  TRP A C   1 
ATOM   718  O O   . TRP A  1 110 ? -56.06255 43.41284 17.98895  1.000 27.99334  ? 87  TRP A O   1 
ATOM   719  C CB  . TRP A  1 110 ? -56.68330 41.00448 16.21457  1.000 23.64329  ? 87  TRP A CB  1 
ATOM   720  C CG  . TRP A  1 110 ? -58.11821 41.14430 15.78528  1.000 25.78087  ? 87  TRP A CG  1 
ATOM   721  C CD1 . TRP A  1 110 ? -59.21136 41.37643 16.59133  1.000 25.87638  ? 87  TRP A CD1 1 
ATOM   722  C CD2 . TRP A  1 110 ? -58.61427 41.08150 14.43879  1.000 25.30374  ? 87  TRP A CD2 1 
ATOM   723  N NE1 . TRP A  1 110 ? -60.34979 41.47173 15.81387  1.000 24.74758  ? 87  TRP A NE1 1 
ATOM   724  C CE2 . TRP A  1 110 ? -60.00935 41.27733 14.49764  1.000 26.31740  ? 87  TRP A CE2 1 
ATOM   725  C CE3 . TRP A  1 110 ? -58.00836 40.84620 13.18898  1.000 26.90560  ? 87  TRP A CE3 1 
ATOM   726  C CZ2 . TRP A  1 110 ? -60.81481 41.26985 13.36054  1.000 28.21329  ? 87  TRP A CZ2 1 
ATOM   727  C CZ3 . TRP A  1 110 ? -58.81941 40.83171 12.04993  1.000 25.21429  ? 87  TRP A CZ3 1 
ATOM   728  C CH2 . TRP A  1 110 ? -60.19907 41.03923 12.15091  1.000 26.38039  ? 87  TRP A CH2 1 
ATOM   729  N N   . ASP A  1 111 ? -57.03864 44.38835 16.21512  1.000 23.18349  ? 88  ASP A N   1 
ATOM   730  C CA  . ASP A  1 111 ? -57.49778 45.56231 16.96204  1.000 24.83349  ? 88  ASP A CA  1 
ATOM   731  C C   . ASP A  1 111 ? -58.91583 45.27695 17.44860  1.000 28.33067  ? 88  ASP A C   1 
ATOM   732  O O   . ASP A  1 111 ? -59.88488 45.38636 16.69320  1.000 26.70245  ? 88  ASP A O   1 
ATOM   733  C CB  . ASP A  1 111 ? -57.42893 46.80416 16.07349  1.000 26.33204  ? 88  ASP A CB  1 
ATOM   734  C CG  . ASP A  1 111 ? -57.78605 48.10797 16.82441  1.000 30.82693  ? 88  ASP A CG  1 
ATOM   735  O OD1 . ASP A  1 111 ? -58.48810 48.04498 17.85285  1.000 32.32889  ? 88  ASP A OD1 1 
ATOM   736  O OD2 . ASP A  1 111 ? -57.37936 49.18538 16.34557  1.000 33.21957  ? 88  ASP A OD2 1 
ATOM   737  N N   . TYR A  1 112 ? -59.04865 44.90114 18.71522  1.000 23.59914  ? 89  TYR A N   1 
ATOM   738  C CA  . TYR A  1 112 ? -60.37055 44.52610 19.21008  1.000 28.22223  ? 89  TYR A CA  1 
ATOM   739  C C   . TYR A  1 112 ? -61.27275 45.74506 19.46276  1.000 33.32788  ? 89  TYR A C   1 
ATOM   740  O O   . TYR A  1 112 ? -62.48176 45.58098 19.62662  1.000 32.99783  ? 89  TYR A O   1 
ATOM   741  C CB  . TYR A  1 112 ? -60.22968 43.70275 20.50074  1.000 25.66466  ? 89  TYR A CB  1 
ATOM   742  C CG  . TYR A  1 112 ? -59.78805 42.26167 20.28869  1.000 26.65331  ? 89  TYR A CG  1 
ATOM   743  C CD1 . TYR A  1 112 ? -58.41811 41.90497 20.23933  1.000 28.37698  ? 89  TYR A CD1 1 
ATOM   744  C CD2 . TYR A  1 112 ? -60.73190 41.25536 20.16020  1.000 28.12303  ? 89  TYR A CD2 1 
ATOM   745  C CE1 . TYR A  1 112 ? -58.03121 40.56341 20.05625  1.000 28.48957  ? 89  TYR A CE1 1 
ATOM   746  C CE2 . TYR A  1 112 ? -60.35678 39.92009 19.98152  1.000 29.74845  ? 89  TYR A CE2 1 
ATOM   747  C CZ  . TYR A  1 112 ? -59.02413 39.58788 19.91915  1.000 26.71831  ? 89  TYR A CZ  1 
ATOM   748  O OH  . TYR A  1 112 ? -58.67518 38.27558 19.74933  1.000 30.66070  ? 89  TYR A OH  1 
ATOM   749  N N   . LYS A  1 113 ? -60.72376 46.95801 19.51126  1.000 29.08225  ? 90  LYS A N   1 
ATOM   750  C CA  . LYS A  1 113 ? -61.60183 48.11850 19.62722  1.000 33.11173  ? 90  LYS A CA  1 
ATOM   751  C C   . LYS A  1 113 ? -62.29208 48.42178 18.30128  1.000 35.76340  ? 90  LYS A C   1 
ATOM   752  O O   . LYS A  1 113 ? -63.39282 48.97074 18.29592  1.000 31.68191  ? 90  LYS A O   1 
ATOM   753  C CB  . LYS A  1 113 ? -60.82043 49.35799 20.09276  1.000 35.80657  ? 90  LYS A CB  1 
ATOM   754  C CG  . LYS A  1 113 ? -60.06156 49.22413 21.44494  1.000 44.71793  ? 90  LYS A CG  1 
ATOM   755  C CD  . LYS A  1 113 ? -60.97980 49.30432 22.63831  1.000 48.33854  ? 90  LYS A CD  1 
ATOM   756  C CE  . LYS A  1 113 ? -60.19104 49.46711 23.95744  1.000 44.43189  ? 90  LYS A CE  1 
ATOM   757  N NZ  . LYS A  1 113 ? -59.17591 48.37330 24.15477  1.000 41.47364  ? 90  LYS A NZ  1 
ATOM   758  N N   . ARG A  1 114 ? -61.63156 48.13449 17.17823  1.000 28.90000  ? 91  ARG A N   1 
ATOM   759  C CA  . ARG A  1 114 ? -62.18441 48.33210 15.84467  1.000 32.21405  ? 91  ARG A CA  1 
ATOM   760  C C   . ARG A  1 114 ? -62.69069 47.03432 15.20431  1.000 30.20909  ? 91  ARG A C   1 
ATOM   761  O O   . ARG A  1 114 ? -63.30235 47.10122 14.14080  1.000 33.21414  ? 91  ARG A O   1 
ATOM   762  C CB  . ARG A  1 114 ? -61.11074 48.97204 14.92455  1.000 28.71744  ? 91  ARG A CB  1 
ATOM   763  C CG  . ARG A  1 114 ? -60.75864 50.47200 15.19787  1.000 29.45420  ? 91  ARG A CG  1 
ATOM   764  C CD  . ARG A  1 114 ? -59.40178 50.87826 14.48176  1.000 34.14377  ? 91  ARG A CD  1 
ATOM   765  N NE  . ARG A  1 114 ? -59.51415 50.59418 13.06060  1.000 36.84688  ? 91  ARG A NE  1 
ATOM   766  C CZ  . ARG A  1 114 ? -58.85568 49.65055 12.41031  1.000 31.55665  ? 91  ARG A CZ  1 
ATOM   767  N NH1 . ARG A  1 114 ? -59.13074 49.43497 11.12399  1.000 32.03340  ? 91  ARG A NH1 1 
ATOM   768  N NH2 . ARG A  1 114 ? -57.92889 48.92826 13.03169  1.000 28.90119  ? 91  ARG A NH2 1 
ATOM   769  N N   A ASP A  1 115 ? -62.47873 45.87330 15.83787  0.733 27.35232  ? 92  ASP A N   1 
ATOM   770  N N   B ASP A  1 115 ? -62.42321 45.87629 15.81043  0.267 28.06068  ? 92  ASP A N   1 
ATOM   771  C CA  A ASP A  1 115 ? -62.74191 44.54312 15.24260  0.733 27.72600  ? 92  ASP A CA  1 
ATOM   772  C CA  B ASP A  1 115 ? -62.76667 44.57792 15.22372  0.267 29.17007  ? 92  ASP A CA  1 
ATOM   773  C C   A ASP A  1 115 ? -62.13978 44.43747 13.84692  0.733 29.32424  ? 92  ASP A C   1 
ATOM   774  C C   B ASP A  1 115 ? -62.13876 44.42531 13.84050  0.267 28.35313  ? 92  ASP A C   1 
ATOM   775  O O   A ASP A  1 115 ? -62.82066 44.09512 12.86936  0.733 27.48031  ? 92  ASP A O   1 
ATOM   776  O O   B ASP A  1 115 ? -62.79824 44.05252 12.86566  0.267 28.07915  ? 92  ASP A O   1 
ATOM   777  C CB  A ASP A  1 115 ? -64.24836 44.20904 15.19014  0.733 34.11661  ? 92  ASP A CB  1 
ATOM   778  C CB  B ASP A  1 115 ? -64.28862 44.39149 15.16076  0.267 34.59423  ? 92  ASP A CB  1 
ATOM   779  C CG  A ASP A  1 115 ? -64.88543 44.09960 16.57134  0.733 41.45978  ? 92  ASP A CG  1 
ATOM   780  C CG  B ASP A  1 115 ? -64.80745 43.45674 16.23005  0.267 40.95751  ? 92  ASP A CG  1 
ATOM   781  O OD1 A ASP A  1 115 ? -64.39058 43.30008 17.41549  0.733 43.64352  ? 92  ASP A OD1 1 
ATOM   782  O OD1 B ASP A  1 115 ? -65.15790 42.31122 15.88426  0.267 44.47560  ? 92  ASP A OD1 1 
ATOM   783  O OD2 A ASP A  1 115 ? -65.87926 44.81374 16.80805  0.733 43.45370  ? 92  ASP A OD2 1 
ATOM   784  O OD2 B ASP A  1 115 ? -64.84039 43.85601 17.41965  0.267 42.23626  ? 92  ASP A OD2 1 
ATOM   785  N N   . ALA A  1 116 ? -60.84289 44.71753 13.75662  1.000 24.51614  ? 93  ALA A N   1 
ATOM   786  C CA  . ALA A  1 116 ? -60.16746 44.78301 12.46850  1.000 24.06353  ? 93  ALA A CA  1 
ATOM   787  C C   . ALA A  1 116 ? -58.66726 44.67147 12.69745  1.000 23.93243  ? 93  ALA A C   1 
ATOM   788  O O   . ALA A  1 116 ? -58.19382 44.87334 13.82603  1.000 24.49638  ? 93  ALA A O   1 
ATOM   789  C CB  . ALA A  1 116 ? -60.51046 46.10210 11.74280  1.000 23.58120  ? 93  ALA A CB  1 
ATOM   790  N N   . PRO A  1 117 ? -57.89427 44.32328 11.66529  1.000 27.13240  ? 94  PRO A N   1 
ATOM   791  C CA  . PRO A  1 117 ? -56.42785 44.33790 11.81590  1.000 24.90448  ? 94  PRO A CA  1 
ATOM   792  C C   . PRO A  1 117 ? -55.97176 45.72213 12.23510  1.000 27.05058  ? 94  PRO A C   1 
ATOM   793  O O   . PRO A  1 117 ? -56.50283 46.73298 11.75461  1.000 25.36503  ? 94  PRO A O   1 
ATOM   794  C CB  . PRO A  1 117 ? -55.90194 43.99981 10.40959  1.000 23.90096  ? 94  PRO A CB  1 
ATOM   795  C CG  . PRO A  1 117 ? -57.05414 43.23249 9.75053   1.000 28.70882  ? 94  PRO A CG  1 
ATOM   796  C CD  . PRO A  1 117 ? -58.30783 43.94221 10.29855  1.000 28.92119  ? 94  PRO A CD  1 
ATOM   797  N N   . ALA A  1 118 ? -54.97104 45.75986 13.12730  1.000 25.24549  ? 95  ALA A N   1 
ATOM   798  C CA  . ALA A  1 118 ? -54.37765 47.04797 13.50186  1.000 27.83635  ? 95  ALA A CA  1 
ATOM   799  C C   . ALA A  1 118 ? -53.63090 47.68490 12.34075  1.000 30.74042  ? 95  ALA A C   1 
ATOM   800  O O   . ALA A  1 118 ? -53.49365 48.90664 12.30256  1.000 27.15425  ? 95  ALA A O   1 
ATOM   801  C CB  . ALA A  1 118 ? -53.42515 46.87994 14.69701  1.000 24.64130  ? 95  ALA A CB  1 
ATOM   802  N N   . HIS A  1 119 ? -53.15563 46.89079 11.38162  1.000 27.10717  ? 96  HIS A N   1 
ATOM   803  C CA  . HIS A  1 119 ? -52.33165 47.38923 10.29405  1.000 31.09069  ? 96  HIS A CA  1 
ATOM   804  C C   . HIS A  1 119 ? -52.88659 46.90948 8.95806   1.000 33.51528  ? 96  HIS A C   1 
ATOM   805  O O   . HIS A  1 119 ? -53.42110 45.81199 8.86076   1.000 34.83867  ? 96  HIS A O   1 
ATOM   806  C CB  . HIS A  1 119 ? -50.87541 46.92251 10.50539  1.000 28.92330  ? 96  HIS A CB  1 
ATOM   807  C CG  . HIS A  1 119 ? -50.35141 47.32460 11.85088  1.000 30.29994  ? 96  HIS A CG  1 
ATOM   808  N ND1 . HIS A  1 119 ? -50.08291 46.41149 12.85074  1.000 30.86286  ? 96  HIS A ND1 1 
ATOM   809  C CD2 . HIS A  1 119 ? -50.17501 48.54892 12.40090  1.000 27.39301  ? 96  HIS A CD2 1 
ATOM   810  C CE1 . HIS A  1 119 ? -49.69999 47.05958 13.94240  1.000 32.55923  ? 96  HIS A CE1 1 
ATOM   811  N NE2 . HIS A  1 119 ? -49.75880 48.35690 13.69828  1.000 28.92384  ? 96  HIS A NE2 1 
ATOM   812  N N   . ILE A  1 120 ? -52.66122 47.70568 7.91436   1.000 39.22294  ? 97  ILE A N   1 
ATOM   813  C CA  . ILE A  1 120 ? -53.28912 47.44856 6.61580   1.000 45.21940  ? 97  ILE A CA  1 
ATOM   814  C C   . ILE A  1 120 ? -52.66681 46.23981 5.92472   1.000 37.97738  ? 97  ILE A C   1 
ATOM   815  O O   . ILE A  1 120 ? -53.36591 45.42561 5.29697   1.000 37.74343  ? 97  ILE A O   1 
ATOM   816  C CB  . ILE A  1 120 ? -53.16893 48.70379 5.72931   1.000 50.70974  ? 97  ILE A CB  1 
ATOM   817  C CG1 . ILE A  1 120 ? -53.87109 49.88722 6.39503   1.000 56.41677  ? 97  ILE A CG1 1 
ATOM   818  C CG2 . ILE A  1 120 ? -53.74145 48.42676 4.33362   1.000 49.12276  ? 97  ILE A CG2 1 
ATOM   819  C CD1 . ILE A  1 120 ? -55.34939 49.63901 6.62724   1.000 61.70614  ? 97  ILE A CD1 1 
ATOM   820  N N   . SER A  1 121 ? -51.34403 46.12773 5.98688   1.000 32.60518  ? 98  SER A N   1 
ATOM   821  C CA  . SER A  1 121 ? -50.59215 45.11317 5.25211   1.000 32.54211  ? 98  SER A CA  1 
ATOM   822  C C   . SER A  1 121 ? -49.93828 44.16317 6.23122   1.000 31.18348  ? 98  SER A C   1 
ATOM   823  O O   . SER A  1 121 ? -49.92220 44.40631 7.44442   1.000 30.70881  ? 98  SER A O   1 
ATOM   824  C CB  . SER A  1 121 ? -49.52385 45.76468 4.36437   1.000 33.25895  ? 98  SER A CB  1 
ATOM   825  O OG  . SER A  1 121 ? -50.14823 46.62153 3.44113   1.000 33.56488  ? 98  SER A OG  1 
ATOM   826  N N   . THR A  1 122 ? -49.37415 43.07775 5.68524   1.000 29.65587  ? 99  THR A N   1 
ATOM   827  C CA  . THR A  1 122 ? -48.74693 42.05756 6.50431   1.000 29.77252  ? 99  THR A CA  1 
ATOM   828  C C   . THR A  1 122 ? -47.41016 41.66151 5.89187   1.000 33.07558  ? 99  THR A C   1 
ATOM   829  O O   . THR A  1 122 ? -47.06779 42.03166 4.75586   1.000 35.00212  ? 99  THR A O   1 
ATOM   830  C CB  . THR A  1 122 ? -49.66945 40.82146 6.65816   1.000 33.62511  ? 99  THR A CB  1 
ATOM   831  O OG1 . THR A  1 122 ? -50.07935 40.37026 5.35656   1.000 33.64753  ? 99  THR A OG1 1 
ATOM   832  C CG2 . THR A  1 122 ? -50.89489 41.16902 7.46726   1.000 30.63140  ? 99  THR A CG2 1 
ATOM   833  N N   . ILE A  1 123 ? -46.63625 40.92438 6.68136   1.000 34.75906  ? 100 ILE A N   1 
ATOM   834  C CA  . ILE A  1 123 ? -45.35241 40.35594 6.26091   1.000 33.23299  ? 100 ILE A CA  1 
ATOM   835  C C   . ILE A  1 123 ? -45.43018 38.88367 6.59542   1.000 38.23392  ? 100 ILE A C   1 
ATOM   836  O O   . ILE A  1 123 ? -45.49422 38.52415 7.78245   1.000 33.65175  ? 100 ILE A O   1 
ATOM   837  C CB  . ILE A  1 123 ? -44.15958 40.99617 6.97533   1.000 35.50509  ? 100 ILE A CB  1 
ATOM   838  C CG1 . ILE A  1 123 ? -44.07573 42.49588 6.66729   1.000 35.65277  ? 100 ILE A CG1 1 
ATOM   839  C CG2 . ILE A  1 123 ? -42.82153 40.29128 6.58032   1.000 38.35729  ? 100 ILE A CG2 1 
ATOM   840  C CD1 . ILE A  1 123 ? -43.05383 43.24432 7.54491   1.000 35.27796  ? 100 ILE A CD1 1 
ATOM   841  N N   . GLY A  1 124 ? -45.43529 38.03161 5.56708   1.000 38.20665  ? 101 GLY A N   1 
ATOM   842  C CA  . GLY A  1 124 ? -45.41382 36.59360 5.80474   1.000 39.48606  ? 101 GLY A CA  1 
ATOM   843  C C   . GLY A  1 124 ? -46.64109 36.01840 6.49518   1.000 44.46406  ? 101 GLY A C   1 
ATOM   844  O O   . GLY A  1 124 ? -46.51670 35.01831 7.21274   1.000 41.19771  ? 101 GLY A O   1 
ATOM   845  N N   . VAL A  1 125 ? -47.82621 36.61598 6.31074   1.000 34.53661  ? 102 VAL A N   1 
ATOM   846  C CA  . VAL A  1 125 ? -49.05170 36.13813 6.94132   1.000 33.95002  ? 102 VAL A CA  1 
ATOM   847  C C   . VAL A  1 125 ? -50.06610 35.61901 5.91811   1.000 39.61788  ? 102 VAL A C   1 
ATOM   848  O O   . VAL A  1 125 ? -50.63089 34.53889 6.09335   1.000 38.97159  ? 102 VAL A O   1 
ATOM   849  C CB  . VAL A  1 125 ? -49.69614 37.23398 7.82520   1.000 37.13821  ? 102 VAL A CB  1 
ATOM   850  C CG1 . VAL A  1 125 ? -50.98377 36.68944 8.41431   1.000 32.84166  ? 102 VAL A CG1 1 
ATOM   851  C CG2 . VAL A  1 125 ? -48.74483 37.69543 8.94756   1.000 35.11082  ? 102 VAL A CG2 1 
ATOM   852  N N   . CYS A  1 126 ? -50.34468 36.40001 4.87007   1.000 35.15550  ? 103 CYS A N   1 
ATOM   853  C CA  . CYS A  1 126 ? -51.54411 36.22265 4.05769   1.000 38.17699  ? 103 CYS A CA  1 
ATOM   854  C C   . CYS A  1 126 ? -51.26249 36.67420 2.63159   1.000 37.93861  ? 103 CYS A C   1 
ATOM   855  O O   . CYS A  1 126 ? -50.78530 37.79211 2.42450   1.000 37.27745  ? 103 CYS A O   1 
ATOM   856  C CB  . CYS A  1 126 ? -52.71088 37.02681 4.63886   1.000 37.89086  ? 103 CYS A CB  1 
ATOM   857  S SG  . CYS A  1 126 ? -54.18841 37.09167 3.58674   1.000 40.28086  ? 103 CYS A SG  1 
ATOM   858  N N   . SER A  1 127 ? -51.56563 35.82029 1.64819   1.000 33.08937  ? 104 SER A N   1 
ATOM   859  C CA  . SER A  1 127 ? -51.13087 36.13805 0.29008   1.000 39.72185  ? 104 SER A CA  1 
ATOM   860  C C   . SER A  1 127 ? -51.86583 37.34779 -0.27410  1.000 38.97641  ? 104 SER A C   1 
ATOM   861  O O   . SER A  1 127 ? -51.31881 38.04168 -1.14045  1.000 38.96369  ? 104 SER A O   1 
ATOM   862  C CB  . SER A  1 127 ? -51.32269 34.94043 -0.64099  1.000 47.50957  ? 104 SER A CB  1 
ATOM   863  O OG  . SER A  1 127 ? -52.72012 34.72132 -0.83380  1.000 54.78256  ? 104 SER A OG  1 
ATOM   864  N N   . MET A  1 128 ? -53.09795 37.61727 0.18232   1.000 32.07810  ? 105 MET A N   1 
ATOM   865  C CA  . MET A  1 128 ? -53.80092 38.79851 -0.31996  1.000 37.10781  ? 105 MET A CA  1 
ATOM   866  C C   . MET A  1 128 ? -53.25006 40.09140 0.27581   1.000 36.70384  ? 105 MET A C   1 
ATOM   867  O O   . MET A  1 128 ? -53.34203 41.13328 -0.37413  1.000 36.24541  ? 105 MET A O   1 
ATOM   868  C CB  . MET A  1 128 ? -55.32217 38.70363 -0.06378  1.000 34.61855  ? 105 MET A CB  1 
ATOM   869  C CG  . MET A  1 128 ? -56.14204 37.97772 -1.20832  1.000 36.09888  ? 105 MET A CG  1 
ATOM   870  S SD  . MET A  1 128 ? -56.08490 38.87347 -2.78745  1.000 42.83061  ? 105 MET A SD  1 
ATOM   871  C CE  . MET A  1 128 ? -56.43544 40.52206 -2.20274  1.000 49.11332  ? 105 MET A CE  1 
ATOM   872  N N   . THR A  1 129 ? -52.72253 40.06774 1.51339   1.000 32.87310  ? 106 THR A N   1 
ATOM   873  C CA  . THR A  1 129 ? -52.29529 41.30584 2.17951   1.000 36.30372  ? 106 THR A CA  1 
ATOM   874  C C   . THR A  1 129 ? -50.78047 41.45840 2.33319   1.000 37.04332  ? 106 THR A C   1 
ATOM   875  O O   . THR A  1 129 ? -50.32351 42.56974 2.65109   1.000 35.43265  ? 106 THR A O   1 
ATOM   876  C CB  . THR A  1 129 ? -52.92430 41.43611 3.58231   1.000 32.70707  ? 106 THR A CB  1 
ATOM   877  O OG1 . THR A  1 129 ? -52.56385 40.30222 4.37247   1.000 32.38548  ? 106 THR A OG1 1 
ATOM   878  C CG2 . THR A  1 129 ? -54.47286 41.53519 3.51628   1.000 31.35244  ? 106 THR A CG2 1 
ATOM   879  N N   . ASP A  1 130 ? -50.00127 40.38860 2.15927   1.000 31.34222  ? 107 ASP A N   1 
ATOM   880  C CA  . ASP A  1 130 ? -48.55579 40.47654 2.33353   1.000 35.30581  ? 107 ASP A CA  1 
ATOM   881  C C   . ASP A  1 130 ? -47.97583 41.47717 1.35072   1.000 40.66652  ? 107 ASP A C   1 
ATOM   882  O O   . ASP A  1 130 ? -48.29262 41.44959 0.15670   1.000 39.48656  ? 107 ASP A O   1 
ATOM   883  C CB  . ASP A  1 130 ? -47.88489 39.12064 2.08697   1.000 34.69774  ? 107 ASP A CB  1 
ATOM   884  C CG  . ASP A  1 130 ? -47.89672 38.19614 3.30592   1.000 39.21320  ? 107 ASP A CG  1 
ATOM   885  O OD1 . ASP A  1 130 ? -48.39718 38.56309 4.41026   1.000 34.37386  ? 107 ASP A OD1 1 
ATOM   886  O OD2 . ASP A  1 130 ? -47.39198 37.06464 3.13640   1.000 39.39007  ? 107 ASP A OD2 1 
ATOM   887  N N   . ILE A  1 131 ? -47.08741 42.33954 1.84136   1.000 33.10283  ? 108 ILE A N   1 
ATOM   888  C CA  . ILE A  1 131 ? -46.18271 43.03835 0.94332   1.000 36.39676  ? 108 ILE A CA  1 
ATOM   889  C C   . ILE A  1 131 ? -44.83150 42.36558 0.86802   1.000 39.38855  ? 108 ILE A C   1 
ATOM   890  O O   . ILE A  1 131 ? -44.00434 42.75303 0.02321   1.000 40.56911  ? 108 ILE A O   1 
ATOM   891  C CB  . ILE A  1 131 ? -45.99027 44.50533 1.37475   1.000 40.00343  ? 108 ILE A CB  1 
ATOM   892  C CG1 . ILE A  1 131 ? -45.29342 44.54643 2.74316   1.000 41.03779  ? 108 ILE A CG1 1 
ATOM   893  C CG2 . ILE A  1 131 ? -47.33332 45.18063 1.45347   1.000 37.14950  ? 108 ILE A CG2 1 
ATOM   894  C CD1 . ILE A  1 131 ? -44.92317 45.94415 3.20754   1.000 44.92963  ? 108 ILE A CD1 1 
ATOM   895  N N   . ALA A  1 132 ? -44.56883 41.38664 1.72881   1.000 40.54324  ? 109 ALA A N   1 
ATOM   896  C CA  . ALA A  1 132 ? -43.28494 40.69365 1.74714   1.000 42.17260  ? 109 ALA A CA  1 
ATOM   897  C C   . ALA A  1 132 ? -43.48127 39.40971 2.53432   1.000 42.04171  ? 109 ALA A C   1 
ATOM   898  O O   . ALA A  1 132 ? -44.47008 39.25443 3.25545   1.000 38.64723  ? 109 ALA A O   1 
ATOM   899  C CB  . ALA A  1 132 ? -42.18138 41.56805 2.37246   1.000 42.18827  ? 109 ALA A CB  1 
ATOM   900  N N   . LYS A  1 133 ? -42.52326 38.49355 2.38755   1.000 43.28895  ? 110 LYS A N   1 
ATOM   901  C CA  . LYS A  1 133 ? -42.45390 37.28868 3.20726   1.000 45.55802  ? 110 LYS A CA  1 
ATOM   902  C C   . LYS A  1 133 ? -41.64532 37.49625 4.48831   1.000 44.00594  ? 110 LYS A C   1 
ATOM   903  O O   . LYS A  1 133 ? -42.00221 36.94101 5.53121   1.000 42.41359  ? 110 LYS A O   1 
ATOM   904  C CB  . LYS A  1 133 ? -41.85076 36.12605 2.40237   1.000 49.90976  ? 110 LYS A CB  1 
ATOM   905  C CG  . LYS A  1 133 ? -42.82786 35.43637 1.47677   1.000 55.38545  ? 110 LYS A CG  1 
ATOM   906  C CD  . LYS A  1 133 ? -44.11993 35.05745 2.23816   1.000 67.37031  ? 110 LYS A CD  1 
ATOM   907  C CE  . LYS A  1 133 ? -44.86304 33.84866 1.63494   1.000 71.16649  ? 110 LYS A CE  1 
ATOM   908  N NZ  . LYS A  1 133 ? -45.07435 33.94033 0.15378   1.000 73.15728  ? 110 LYS A NZ  1 
ATOM   909  N N   . LYS A  1 134 ? -40.55917 38.26755 4.43108   1.000 43.07367  ? 111 LYS A N   1 
ATOM   910  C CA  . LYS A  1 134 ? -39.68557 38.52845 5.56856   1.000 46.37474  ? 111 LYS A CA  1 
ATOM   911  C C   . LYS A  1 134 ? -39.46034 40.02733 5.72488   1.000 44.28152  ? 111 LYS A C   1 
ATOM   912  O O   . LYS A  1 134 ? -39.49385 40.76329 4.73630   1.000 42.47790  ? 111 LYS A O   1 
ATOM   913  C CB  . LYS A  1 134 ? -38.32675 37.81799 5.39081   1.000 46.26225  ? 111 LYS A CB  1 
ATOM   914  C CG  . LYS A  1 134 ? -38.44342 36.28450 5.31113   1.000 51.61534  ? 111 LYS A CG  1 
ATOM   915  C CD  . LYS A  1 134 ? -37.07481 35.62394 5.10824   1.000 57.26283  ? 111 LYS A CD  1 
ATOM   916  C CE  . LYS A  1 134 ? -37.20733 34.30449 4.35620   1.000 60.18793  ? 111 LYS A CE  1 
ATOM   917  N NZ  . LYS A  1 134 ? -35.86369 33.71549 4.00837   1.000 69.34261  ? 111 LYS A NZ  1 
ATOM   918  N N   . PRO A  1 135 ? -39.22391 40.51279 6.95204   1.000 45.76637  ? 112 PRO A N   1 
ATOM   919  C CA  . PRO A  1 135 ? -39.02033 41.96591 7.13178   1.000 49.70356  ? 112 PRO A CA  1 
ATOM   920  C C   . PRO A  1 135 ? -37.73957 42.47708 6.49509   1.000 56.04213  ? 112 PRO A C   1 
ATOM   921  O O   . PRO A  1 135 ? -37.60616 43.68608 6.28304   1.000 55.66388  ? 112 PRO A O   1 
ATOM   922  C CB  . PRO A  1 135 ? -38.97289 42.14685 8.65666   1.000 48.94327  ? 112 PRO A CB  1 
ATOM   923  C CG  . PRO A  1 135 ? -39.37436 40.84924 9.24705   1.000 51.27022  ? 112 PRO A CG  1 
ATOM   924  C CD  . PRO A  1 135 ? -39.15089 39.77702 8.22365   1.000 47.21339  ? 112 PRO A CD  1 
ATOM   925  N N   . THR A  1 136 ? -36.79926 41.59592 6.18709   1.000 57.09557  ? 113 THR A N   1 
ATOM   926  C CA  . THR A  1 136 ? -35.54773 42.00444 5.56613   1.000 62.19627  ? 113 THR A CA  1 
ATOM   927  C C   . THR A  1 136 ? -35.71765 42.41728 4.11117   1.000 57.93294  ? 113 THR A C   1 
ATOM   928  O O   . THR A  1 136 ? -34.78267 42.97786 3.54821   1.000 57.24422  ? 113 THR A O   1 
ATOM   929  C CB  . THR A  1 136 ? -34.52399 40.87049 5.67318   1.000 60.84155  ? 113 THR A CB  1 
ATOM   930  O OG1 . THR A  1 136 ? -35.13223 39.63055 5.27644   1.000 58.37877  ? 113 THR A OG1 1 
ATOM   931  C CG2 . THR A  1 136 ? -34.03061 40.75312 7.11445   1.000 56.86530  ? 113 THR A CG2 1 
ATOM   932  N N   . GLU A  1 137 ? -36.87950 42.18047 3.49522   1.000 57.94133  ? 114 GLU A N   1 
ATOM   933  C CA  . GLU A  1 137 ? -37.05182 42.58445 2.10495   1.000 51.76202  ? 114 GLU A CA  1 
ATOM   934  C C   . GLU A  1 137 ? -37.07146 44.10831 2.01450   1.000 55.81834  ? 114 GLU A C   1 
ATOM   935  O O   . GLU A  1 137 ? -37.49802 44.79748 2.94515   1.000 55.52812  ? 114 GLU A O   1 
ATOM   936  C CB  . GLU A  1 137 ? -38.32530 41.98153 1.51589   1.000 47.88966  ? 114 GLU A CB  1 
ATOM   937  C CG  . GLU A  1 137 ? -38.24028 40.47238 1.24309   1.000 50.95765  ? 114 GLU A CG  1 
ATOM   938  C CD  . GLU A  1 137 ? -39.59767 39.86646 0.88265   1.000 57.76819  ? 114 GLU A CD  1 
ATOM   939  O OE1 . GLU A  1 137 ? -40.00509 38.86950 1.53056   1.000 59.48010  ? 114 GLU A OE1 1 
ATOM   940  O OE2 . GLU A  1 137 ? -40.27460 40.41063 -0.02545  1.000 59.43825  ? 114 GLU A OE2 1 
ATOM   941  N N   . THR A  1 138 ? -36.57242 44.62485 0.88391   1.000 56.20149  ? 115 THR A N   1 
ATOM   942  C CA  . THR A  1 138 ? -36.35719 46.05980 0.70384   1.000 54.47802  ? 115 THR A CA  1 
ATOM   943  C C   . THR A  1 138 ? -37.62351 46.86747 0.91539   1.000 55.38037  ? 115 THR A C   1 
ATOM   944  O O   . THR A  1 138 ? -37.56451 47.99457 1.42861   1.000 51.73194  ? 115 THR A O   1 
ATOM   945  C CB  . THR A  1 138 ? -35.82402 46.32987 -0.69870  1.000 61.38279  ? 115 THR A CB  1 
ATOM   946  O OG1 . THR A  1 138 ? -34.53567 45.73141 -0.82917  1.000 66.58994  ? 115 THR A OG1 1 
ATOM   947  C CG2 . THR A  1 138 ? -35.70130 47.82734 -0.95413  1.000 58.72966  ? 115 THR A CG2 1 
ATOM   948  N N   . ILE A  1 139 ? -38.77796 46.31487 0.52811   1.000 53.68215  ? 116 ILE A N   1 
ATOM   949  C CA  . ILE A  1 139 ? -40.01525 47.07172 0.60508   1.000 50.53013  ? 116 ILE A CA  1 
ATOM   950  C C   . ILE A  1 139 ? -40.35495 47.44194 2.04288   1.000 47.91084  ? 116 ILE A C   1 
ATOM   951  O O   . ILE A  1 139 ? -41.13713 48.36917 2.26935   1.000 52.57827  ? 116 ILE A O   1 
ATOM   952  C CB  . ILE A  1 139 ? -41.15006 46.27310 -0.06525  1.000 54.87575  ? 116 ILE A CB  1 
ATOM   953  C CG1 . ILE A  1 139 ? -42.28782 47.20849 -0.47071  1.000 55.72784  ? 116 ILE A CG1 1 
ATOM   954  C CG2 . ILE A  1 139 ? -41.62851 45.12992 0.85076   1.000 47.94716  ? 116 ILE A CG2 1 
ATOM   955  C CD1 . ILE A  1 139 ? -43.48003 46.48011 -0.99835  1.000 62.18595  ? 116 ILE A CD1 1 
ATOM   956  N N   . CYS A  1 140 ? -39.77629 46.74245 3.03101   1.000 50.73752  ? 117 CYS A N   1 
ATOM   957  C CA  . CYS A  1 140 ? -40.04456 46.99977 4.44744   1.000 49.18203  ? 117 CYS A CA  1 
ATOM   958  C C   . CYS A  1 140 ? -39.08439 47.99955 5.09214   1.000 52.72973  ? 117 CYS A C   1 
ATOM   959  O O   . CYS A  1 140 ? -39.37314 48.48300 6.19627   1.000 49.59826  ? 117 CYS A O   1 
ATOM   960  C CB  . CYS A  1 140 ? -39.97513 45.69450 5.24705   1.000 51.12387  ? 117 CYS A CB  1 
ATOM   961  S SG  . CYS A  1 140 ? -41.11114 44.40805 4.69510   1.000 51.44357  ? 117 CYS A SG  1 
ATOM   962  N N   . ALA A  1 141 ? -37.94911 48.31104 4.45115   1.000 51.87970  ? 118 ALA A N   1 
ATOM   963  C CA  . ALA A  1 141 ? -36.94895 49.16606 5.09239   1.000 54.51009  ? 118 ALA A CA  1 
ATOM   964  C C   . ALA A  1 141 ? -37.50469 50.51605 5.55471   1.000 55.77442  ? 118 ALA A C   1 
ATOM   965  O O   . ALA A  1 141 ? -37.18597 50.92429 6.68526   1.000 55.02972  ? 118 ALA A O   1 
ATOM   966  C CB  . ALA A  1 141 ? -35.74071 49.33405 4.15973   1.000 51.12928  ? 118 ALA A CB  1 
ATOM   967  N N   . PRO A  1 142 ? -38.32137 51.24881 4.77689   1.000 51.92018  ? 119 PRO A N   1 
ATOM   968  C CA  . PRO A  1 142 ? -38.85796 52.52893 5.28090   1.000 50.70909  ? 119 PRO A CA  1 
ATOM   969  C C   . PRO A  1 142 ? -40.00399 52.39835 6.27833   1.000 50.33803  ? 119 PRO A C   1 
ATOM   970  O O   . PRO A  1 142 ? -40.37332 53.39968 6.91172   1.000 48.12155  ? 119 PRO A O   1 
ATOM   971  C CB  . PRO A  1 142 ? -39.34631 53.23156 4.00184   1.000 51.16592  ? 119 PRO A CB  1 
ATOM   972  C CG  . PRO A  1 142 ? -39.68558 52.12905 3.08666   1.000 54.27607  ? 119 PRO A CG  1 
ATOM   973  C CD  . PRO A  1 142 ? -38.66826 51.04906 3.35355   1.000 54.44675  ? 119 PRO A CD  1 
ATOM   974  N N   . LEU A  1 143 ? -40.60222 51.22198 6.42211   1.000 47.45537  ? 120 LEU A N   1 
ATOM   975  C CA  . LEU A  1 143 ? -41.72897 51.05548 7.32261   1.000 41.78260  ? 120 LEU A CA  1 
ATOM   976  C C   . LEU A  1 143 ? -41.21563 50.79645 8.72760   1.000 42.43915  ? 120 LEU A C   1 
ATOM   977  O O   . LEU A  1 143 ? -40.19920 50.12231 8.92211   1.000 43.95953  ? 120 LEU A O   1 
ATOM   978  C CB  . LEU A  1 143 ? -42.61750 49.88832 6.86826   1.000 39.13046  ? 120 LEU A CB  1 
ATOM   979  C CG  . LEU A  1 143 ? -43.24550 50.01614 5.47886   1.000 40.98519  ? 120 LEU A CG  1 
ATOM   980  C CD1 . LEU A  1 143 ? -44.02279 48.74103 5.14091   1.000 42.26502  ? 120 LEU A CD1 1 
ATOM   981  C CD2 . LEU A  1 143 ? -44.18434 51.20377 5.49268   1.000 45.90168  ? 120 LEU A CD2 1 
ATOM   982  N N   . THR A  1 144 ? -41.93634 51.31265 9.71410   1.000 35.43654  ? 121 THR A N   1 
ATOM   983  C CA  . THR A  1 144 ? -41.62102 50.99090 11.09919  1.000 35.25176  ? 121 THR A CA  1 
ATOM   984  C C   . THR A  1 144 ? -42.24140 49.63196 11.43633  1.000 37.85306  ? 121 THR A C   1 
ATOM   985  O O   . THR A  1 144 ? -43.46635 49.49507 11.62656  1.000 38.41307  ? 121 THR A O   1 
ATOM   986  C CB  . THR A  1 144 ? -42.06875 52.12419 12.01857  1.000 36.28537  ? 121 THR A CB  1 
ATOM   987  O OG1 . THR A  1 144 ? -41.25520 53.27941 11.73638  1.000 39.72694  ? 121 THR A OG1 1 
ATOM   988  C CG2 . THR A  1 144 ? -41.85953 51.73974 13.46925  1.000 37.77875  ? 121 THR A CG2 1 
ATOM   989  N N   . VAL A  1 145 ? -41.37865 48.59418 11.48196  1.000 38.61721  ? 122 VAL A N   1 
ATOM   990  C CA  . VAL A  1 145 ? -41.83159 47.21785 11.65156  1.000 36.91492  ? 122 VAL A CA  1 
ATOM   991  C C   . VAL A  1 145 ? -41.83207 46.88278 13.13075  1.000 38.49675  ? 122 VAL A C   1 
ATOM   992  O O   . VAL A  1 145 ? -40.86662 47.17871 13.84546  1.000 39.74775  ? 122 VAL A O   1 
ATOM   993  C CB  . VAL A  1 145 ? -40.92842 46.23166 10.88093  1.000 36.97772  ? 122 VAL A CB  1 
ATOM   994  C CG1 . VAL A  1 145 ? -41.35894 44.79873 11.15451  1.000 33.94860  ? 122 VAL A CG1 1 
ATOM   995  C CG2 . VAL A  1 145 ? -40.92689 46.53459 9.37246   1.000 36.77543  ? 122 VAL A CG2 1 
ATOM   996  N N   . PHE A  1 146 ? -42.89057 46.22097 13.58701  1.000 34.23770  ? 123 PHE A N   1 
ATOM   997  C CA  . PHE A  1 146 ? -42.95798 45.75765 14.96598  1.000 34.26971  ? 123 PHE A CA  1 
ATOM   998  C C   . PHE A  1 146 ? -42.32272 44.37418 15.06953  1.000 36.60671  ? 123 PHE A C   1 
ATOM   999  O O   . PHE A  1 146 ? -42.72828 43.45071 14.36266  1.000 38.86489  ? 123 PHE A O   1 
ATOM   1000 C CB  . PHE A  1 146 ? -44.40305 45.72008 15.43957  1.000 31.21446  ? 123 PHE A CB  1 
ATOM   1001 C CG  . PHE A  1 146 ? -44.59049 45.03308 16.75680  1.000 33.19969  ? 123 PHE A CG  1 
ATOM   1002 C CD1 . PHE A  1 146 ? -44.16489 45.64543 17.93877  1.000 39.23318  ? 123 PHE A CD1 1 
ATOM   1003 C CD2 . PHE A  1 146 ? -45.17130 43.76432 16.81934  1.000 38.16723  ? 123 PHE A CD2 1 
ATOM   1004 C CE1 . PHE A  1 146 ? -44.33870 45.00600 19.17378  1.000 42.22452  ? 123 PHE A CE1 1 
ATOM   1005 C CE2 . PHE A  1 146 ? -45.33411 43.10375 18.04627  1.000 38.90168  ? 123 PHE A CE2 1 
ATOM   1006 C CZ  . PHE A  1 146 ? -44.93332 43.73965 19.22686  1.000 42.45464  ? 123 PHE A CZ  1 
ATOM   1007 N N   . PHE A  1 147 ? -41.34296 44.23890 15.95542  1.000 33.89780  ? 124 PHE A N   1 
ATOM   1008 C CA  . PHE A  1 147 ? -40.62877 42.99264 16.21224  1.000 37.50910  ? 124 PHE A CA  1 
ATOM   1009 C C   . PHE A  1 147 ? -40.86461 42.52909 17.64954  1.000 43.08572  ? 124 PHE A C   1 
ATOM   1010 O O   . PHE A  1 147 ? -40.92495 43.33999 18.58072  1.000 40.46312  ? 124 PHE A O   1 
ATOM   1011 C CB  . PHE A  1 147 ? -39.12475 43.16716 15.99028  1.000 35.61908  ? 124 PHE A CB  1 
ATOM   1012 C CG  . PHE A  1 147 ? -38.74027 43.53291 14.58357  1.000 39.71561  ? 124 PHE A CG  1 
ATOM   1013 C CD1 . PHE A  1 147 ? -38.53053 42.53552 13.61932  1.000 43.93118  ? 124 PHE A CD1 1 
ATOM   1014 C CD2 . PHE A  1 147 ? -38.49716 44.86792 14.23870  1.000 38.50355  ? 124 PHE A CD2 1 
ATOM   1015 C CE1 . PHE A  1 147 ? -38.11710 42.86939 12.32011  1.000 41.63159  ? 124 PHE A CE1 1 
ATOM   1016 C CE2 . PHE A  1 147 ? -38.07638 45.21456 12.94899  1.000 42.78731  ? 124 PHE A CE2 1 
ATOM   1017 C CZ  . PHE A  1 147 ? -37.88928 44.20396 11.98271  1.000 45.55363  ? 124 PHE A CZ  1 
ATOM   1018 N N   . ASP A  1 148 ? -40.95664 41.21958 17.84366  1.000 44.66447  ? 125 ASP A N   1 
ATOM   1019 C CA  . ASP A  1 148 ? -41.34054 40.64640 19.13197  1.000 41.27168  ? 125 ASP A CA  1 
ATOM   1020 C C   . ASP A  1 148 ? -40.20356 39.74496 19.60894  1.000 43.66580  ? 125 ASP A C   1 
ATOM   1021 O O   . ASP A  1 148 ? -40.01537 38.63326 19.09168  1.000 42.35505  ? 125 ASP A O   1 
ATOM   1022 C CB  . ASP A  1 148 ? -42.67512 39.90428 18.98116  1.000 39.17751  ? 125 ASP A CB  1 
ATOM   1023 C CG  . ASP A  1 148 ? -43.16989 39.28185 20.27795  1.000 42.39383  ? 125 ASP A CG  1 
ATOM   1024 O OD1 . ASP A  1 148 ? -42.41967 39.21961 21.26914  1.000 44.74642  ? 125 ASP A OD1 1 
ATOM   1025 O OD2 . ASP A  1 148 ? -44.34202 38.86304 20.30645  1.000 45.40287  ? 125 ASP A OD2 1 
ATOM   1026 N N   . GLY A  1 149 ? -39.44626 40.23031 20.59816  1.000 45.95649  ? 126 GLY A N   1 
ATOM   1027 C CA  . GLY A  1 149 ? -38.28247 39.51623 21.09638  1.000 46.15986  ? 126 GLY A CA  1 
ATOM   1028 C C   . GLY A  1 149 ? -38.58859 38.15070 21.66698  1.000 45.87106  ? 126 GLY A C   1 
ATOM   1029 O O   . GLY A  1 149 ? -37.67460 37.34892 21.84727  1.000 50.24465  ? 126 GLY A O   1 
ATOM   1030 N N   . ARG A  1 150 ? -39.85251 37.85650 21.94746  1.000 42.69167  ? 127 ARG A N   1 
ATOM   1031 C CA  . ARG A  1 150 ? -40.21589 36.51752 22.40235  1.000 47.56280  ? 127 ARG A CA  1 
ATOM   1032 C C   . ARG A  1 150 ? -40.16932 35.47688 21.28348  1.000 50.93040  ? 127 ARG A C   1 
ATOM   1033 O O   . ARG A  1 150 ? -40.24949 34.28188 21.57418  1.000 58.45410  ? 127 ARG A O   1 
ATOM   1034 C CB  . ARG A  1 150 ? -41.61991 36.55489 23.03716  1.000 41.69798  ? 127 ARG A CB  1 
ATOM   1035 C CG  . ARG A  1 150 ? -41.68390 37.44611 24.28578  1.000 43.45831  ? 127 ARG A CG  1 
ATOM   1036 C CD  . ARG A  1 150 ? -43.12846 37.73597 24.70513  1.000 45.65385  ? 127 ARG A CD  1 
ATOM   1037 N NE  . ARG A  1 150 ? -43.90356 38.34622 23.62775  1.000 41.47192  ? 127 ARG A NE  1 
ATOM   1038 C CZ  . ARG A  1 150 ? -45.17914 38.68515 23.73640  1.000 40.47103  ? 127 ARG A CZ  1 
ATOM   1039 N NH1 . ARG A  1 150 ? -45.82726 38.48476 24.89056  1.000 34.32954  ? 127 ARG A NH1 1 
ATOM   1040 N NH2 . ARG A  1 150 ? -45.80068 39.22052 22.69578  1.000 39.51821  ? 127 ARG A NH2 1 
ATOM   1041 N N   . VAL A  1 151 ? -40.07367 35.89911 20.02382  1.000 47.57966  ? 128 VAL A N   1 
ATOM   1042 C CA  . VAL A  1 151 ? -39.98602 35.00396 18.87413  1.000 51.17396  ? 128 VAL A CA  1 
ATOM   1043 C C   . VAL A  1 151 ? -38.51842 34.89813 18.46346  1.000 52.88941  ? 128 VAL A C   1 
ATOM   1044 O O   . VAL A  1 151 ? -37.81643 35.91692 18.35276  1.000 47.03255  ? 128 VAL A O   1 
ATOM   1045 C CB  . VAL A  1 151 ? -40.86115 35.51197 17.71077  1.000 50.68764  ? 128 VAL A CB  1 
ATOM   1046 C CG1 . VAL A  1 151 ? -40.74706 34.60183 16.49221  1.000 46.54266  ? 128 VAL A CG1 1 
ATOM   1047 C CG2 . VAL A  1 151 ? -42.33298 35.64838 18.14939  1.000 47.21597  ? 128 VAL A CG2 1 
ATOM   1048 N N   . ASP A  1 152 ? -38.03853 33.66835 18.25833  1.000 47.77505  ? 129 ASP A N   1 
ATOM   1049 C CA  . ASP A  1 152 ? -36.64277 33.48336 17.88459  1.000 53.41902  ? 129 ASP A CA  1 
ATOM   1050 C C   . ASP A  1 152 ? -36.31092 34.26460 16.61890  1.000 44.76981  ? 129 ASP A C   1 
ATOM   1051 O O   . ASP A  1 152 ? -37.09540 34.31047 15.66900  1.000 48.29314  ? 129 ASP A O   1 
ATOM   1052 C CB  . ASP A  1 152 ? -36.32412 31.99916 17.67281  1.000 65.66300  ? 129 ASP A CB  1 
ATOM   1053 C CG  . ASP A  1 152 ? -36.46449 31.18230 18.94259  1.000 79.43923  ? 129 ASP A CG  1 
ATOM   1054 O OD1 . ASP A  1 152 ? -36.91190 30.01504 18.84909  1.000 85.14365  ? 129 ASP A OD1 1 
ATOM   1055 O OD2 . ASP A  1 152 ? -36.14994 31.71597 20.03380  1.000 83.02678  ? 129 ASP A OD2 1 
ATOM   1056 N N   . GLY A  1 153 ? -35.14024 34.89054 16.61732  1.000 48.53129  ? 130 GLY A N   1 
ATOM   1057 C CA  . GLY A  1 153 ? -34.65555 35.62887 15.47906  1.000 51.97982  ? 130 GLY A CA  1 
ATOM   1058 C C   . GLY A  1 153 ? -35.10878 37.07375 15.40715  1.000 49.63469  ? 130 GLY A C   1 
ATOM   1059 O O   . GLY A  1 153 ? -34.46560 37.87112 14.72026  1.000 49.13583  ? 130 GLY A O   1 
ATOM   1060 N N   . GLN A  1 154 ? -36.17225 37.45325 16.11553  1.000 49.78752  ? 131 GLN A N   1 
ATOM   1061 C CA  . GLN A  1 154 ? -36.71114 38.79067 15.87193  1.000 46.13787  ? 131 GLN A CA  1 
ATOM   1062 C C   . GLN A  1 154 ? -35.86152 39.89529 16.49598  1.000 46.62220  ? 131 GLN A C   1 
ATOM   1063 O O   . GLN A  1 154 ? -35.77798 40.98341 15.91665  1.000 46.83305  ? 131 GLN A O   1 
ATOM   1064 C CB  . GLN A  1 154 ? -38.17495 38.86511 16.32431  1.000 42.41987  ? 131 GLN A CB  1 
ATOM   1065 C CG  . GLN A  1 154 ? -39.09283 37.99986 15.42880  1.000 43.37489  ? 131 GLN A CG  1 
ATOM   1066 C CD  . GLN A  1 154 ? -40.41452 38.66505 15.02876  1.000 57.54601  ? 131 GLN A CD  1 
ATOM   1067 O OE1 . GLN A  1 154 ? -40.90805 39.60503 15.67713  1.000 56.98900  ? 131 GLN A OE1 1 
ATOM   1068 N NE2 . GLN A  1 154 ? -41.00784 38.15737 13.95306  1.000 59.30150  ? 131 GLN A NE2 1 
ATOM   1069 N N   . VAL A  1 155 ? -35.18065 39.65287 17.62506  1.000 48.10995  ? 132 VAL A N   1 
ATOM   1070 C CA  . VAL A  1 155 ? -34.26659 40.67862 18.13613  1.000 46.28322  ? 132 VAL A CA  1 
ATOM   1071 C C   . VAL A  1 155 ? -33.19630 40.99239 17.09502  1.000 53.31416  ? 132 VAL A C   1 
ATOM   1072 O O   . VAL A  1 155 ? -32.89379 42.15939 16.81420  1.000 49.23967  ? 132 VAL A O   1 
ATOM   1073 C CB  . VAL A  1 155 ? -33.63721 40.25222 19.47634  1.000 46.64684  ? 132 VAL A CB  1 
ATOM   1074 C CG1 . VAL A  1 155 ? -32.51133 41.21305 19.85345  1.000 49.47845  ? 132 VAL A CG1 1 
ATOM   1075 C CG2 . VAL A  1 155 ? -34.67549 40.22995 20.58076  1.000 47.14578  ? 132 VAL A CG2 1 
ATOM   1076 N N   . ASP A  1 156 ? -32.61929 39.94932 16.49282  1.000 54.83197  ? 133 ASP A N   1 
ATOM   1077 C CA  . ASP A  1 156 ? -31.60422 40.14478 15.46312  1.000 54.69033  ? 133 ASP A CA  1 
ATOM   1078 C C   . ASP A  1 156 ? -32.16764 40.79159 14.20339  1.000 48.50250  ? 133 ASP A C   1 
ATOM   1079 O O   . ASP A  1 156 ? -31.46350 41.56295 13.54640  1.000 50.94947  ? 133 ASP A O   1 
ATOM   1080 C CB  . ASP A  1 156 ? -30.94181 38.81052 15.12597  1.000 62.79825  ? 133 ASP A CB  1 
ATOM   1081 C CG  . ASP A  1 156 ? -30.06142 38.29433 16.26447  1.000 75.02149  ? 133 ASP A CG  1 
ATOM   1082 O OD1 . ASP A  1 156 ? -30.02655 37.06717 16.48403  1.000 82.01702  ? 133 ASP A OD1 1 
ATOM   1083 O OD2 . ASP A  1 156 ? -29.43401 39.12141 16.96228  1.000 79.21746  ? 133 ASP A OD2 1 
ATOM   1084 N N   . LEU A  1 157 ? -33.40891 40.47332 13.83318  1.000 46.10369  ? 134 LEU A N   1 
ATOM   1085 C CA  . LEU A  1 157 ? -34.05933 41.18495 12.73103  1.000 52.89089  ? 134 LEU A CA  1 
ATOM   1086 C C   . LEU A  1 157 ? -34.18333 42.68131 13.03808  1.000 54.24088  ? 134 LEU A C   1 
ATOM   1087 O O   . LEU A  1 157 ? -33.92240 43.53108 12.17205  1.000 53.85746  ? 134 LEU A O   1 
ATOM   1088 C CB  . LEU A  1 157 ? -35.43426 40.56933 12.44495  1.000 46.88737  ? 134 LEU A CB  1 
ATOM   1089 C CG  . LEU A  1 157 ? -35.41769 39.19599 11.75017  1.000 51.92117  ? 134 LEU A CG  1 
ATOM   1090 C CD1 . LEU A  1 157 ? -36.83511 38.60521 11.55994  1.000 50.20987  ? 134 LEU A CD1 1 
ATOM   1091 C CD2 . LEU A  1 157 ? -34.70058 39.29757 10.41642  1.000 52.75795  ? 134 LEU A CD2 1 
ATOM   1092 N N   . PHE A  1 158 ? -34.55882 43.02092 14.27429  1.000 49.72203  ? 135 PHE A N   1 
ATOM   1093 C CA  . PHE A  1 158 ? -34.57052 44.42126 14.69076  1.000 47.92500  ? 135 PHE A CA  1 
ATOM   1094 C C   . PHE A  1 158 ? -33.17768 45.04674 14.58501  1.000 52.74880  ? 135 PHE A C   1 
ATOM   1095 O O   . PHE A  1 158 ? -33.02985 46.16731 14.08152  1.000 51.28836  ? 135 PHE A O   1 
ATOM   1096 C CB  . PHE A  1 158 ? -35.10986 44.53154 16.11830  1.000 44.82480  ? 135 PHE A CB  1 
ATOM   1097 C CG  . PHE A  1 158 ? -35.03160 45.92926 16.70748  1.000 44.89681  ? 135 PHE A CG  1 
ATOM   1098 C CD1 . PHE A  1 158 ? -36.01823 46.86605 16.43862  1.000 45.39397  ? 135 PHE A CD1 1 
ATOM   1099 C CD2 . PHE A  1 158 ? -33.97212 46.29111 17.54238  1.000 45.88088  ? 135 PHE A CD2 1 
ATOM   1100 C CE1 . PHE A  1 158 ? -35.95609 48.14875 16.98483  1.000 43.53654  ? 135 PHE A CE1 1 
ATOM   1101 C CE2 . PHE A  1 158 ? -33.90341 47.55613 18.08726  1.000 44.37517  ? 135 PHE A CE2 1 
ATOM   1102 C CZ  . PHE A  1 158 ? -34.90682 48.48984 17.80507  1.000 44.77694  ? 135 PHE A CZ  1 
ATOM   1103 N N   . ARG A  1 159 ? -32.14081 44.33505 15.05053  1.000 53.55338  ? 136 ARG A N   1 
ATOM   1104 C CA  . ARG A  1 159 ? -30.78499 44.88506 14.99610  1.000 56.47588  ? 136 ARG A CA  1 
ATOM   1105 C C   . ARG A  1 159 ? -30.37722 45.25246 13.57343  1.000 56.66226  ? 136 ARG A C   1 
ATOM   1106 O O   . ARG A  1 159 ? -29.56855 46.16245 13.38072  1.000 60.06859  ? 136 ARG A O   1 
ATOM   1107 C CB  . ARG A  1 159 ? -29.77273 43.88961 15.57754  1.000 59.80122  ? 136 ARG A CB  1 
ATOM   1108 C CG  . ARG A  1 159 ? -29.85391 43.65102 17.08492  1.000 58.09374  ? 136 ARG A CG  1 
ATOM   1109 C CD  . ARG A  1 159 ? -28.75963 42.67559 17.49721  1.000 61.46407  ? 136 ARG A CD  1 
ATOM   1110 N NE  . ARG A  1 159 ? -28.69071 42.37757 18.92731  1.000 60.40735  ? 136 ARG A NE  1 
ATOM   1111 C CZ  . ARG A  1 159 ? -28.28636 43.23533 19.86412  1.000 67.87951  ? 136 ARG A CZ  1 
ATOM   1112 N NH1 . ARG A  1 159 ? -27.94632 44.49018 19.55469  1.000 65.18861  ? 136 ARG A NH1 1 
ATOM   1113 N NH2 . ARG A  1 159 ? -28.23260 42.83932 21.12941  1.000 73.85505  ? 136 ARG A NH2 1 
ATOM   1114 N N   . ASN A  1 160 ? -30.91212 44.55407 12.57392  1.000 58.69720  ? 137 ASN A N   1 
ATOM   1115 C CA  . ASN A  1 160 ? -30.61922 44.80186 11.16775  1.000 66.75026  ? 137 ASN A CA  1 
ATOM   1116 C C   . ASN A  1 160 ? -31.66315 45.65581 10.44967  1.000 63.98265  ? 137 ASN A C   1 
ATOM   1117 O O   . ASN A  1 160 ? -31.41745 46.08078 9.31431   1.000 62.79513  ? 137 ASN A O   1 
ATOM   1118 C CB  . ASN A  1 160 ? -30.46430 43.46232 10.43569  1.000 71.54069  ? 137 ASN A CB  1 
ATOM   1119 C CG  . ASN A  1 160 ? -29.15253 42.76650 10.78447  1.000 76.16905  ? 137 ASN A CG  1 
ATOM   1120 O OD1 . ASN A  1 160 ? -29.13798 41.69481 11.38892  1.000 78.61291  ? 137 ASN A OD1 1 
ATOM   1121 N ND2 . ASN A  1 160 ? -28.04885 43.39400 10.42725  1.000 77.55834  ? 137 ASN A ND2 1 
ATOM   1122 N N   . ALA A  1 161 ? -32.81358 45.91307 11.06498  1.000 57.66017  ? 138 ALA A N   1 
ATOM   1123 C CA  . ALA A  1 161 ? -33.84104 46.71724 10.42088  1.000 54.18101  ? 138 ALA A CA  1 
ATOM   1124 C C   . ALA A  1 161 ? -33.51038 48.20535 10.47984  1.000 55.95408  ? 138 ALA A C   1 
ATOM   1125 O O   . ALA A  1 161 ? -32.93835 48.70366 11.45756  1.000 56.27785  ? 138 ALA A O   1 
ATOM   1126 C CB  . ALA A  1 161 ? -35.20410 46.46125 11.06707  1.000 51.27630  ? 138 ALA A CB  1 
ATOM   1127 N N   . ARG A  1 162 ? -33.89351 48.91814 9.42079   1.000 54.79032  ? 139 ARG A N   1 
ATOM   1128 C CA  . ARG A  1 162 ? -33.70570 50.36457 9.38445   1.000 58.23357  ? 139 ARG A CA  1 
ATOM   1129 C C   . ARG A  1 162 ? -34.67125 51.07780 10.33737  1.000 53.56389  ? 139 ARG A C   1 
ATOM   1130 O O   . ARG A  1 162 ? -34.28645 52.03035 11.03438  1.000 49.18013  ? 139 ARG A O   1 
ATOM   1131 C CB  . ARG A  1 162 ? -33.89683 50.85443 7.94815   1.000 65.37081  ? 139 ARG A CB  1 
ATOM   1132 C CG  . ARG A  1 162 ? -33.65751 52.33177 7.73810   1.000 73.38666  ? 139 ARG A CG  1 
ATOM   1133 C CD  . ARG A  1 162 ? -33.42674 52.65524 6.26821   1.000 80.55975  ? 139 ARG A CD  1 
ATOM   1134 N NE  . ARG A  1 162 ? -32.93390 54.02370 6.10492   1.000 87.23750  ? 139 ARG A NE  1 
ATOM   1135 C CZ  . ARG A  1 162 ? -31.66099 54.39472 6.24818   1.000 88.24955  ? 139 ARG A CZ  1 
ATOM   1136 N NH1 . ARG A  1 162 ? -31.32372 55.66477 6.08634   1.000 86.69098  ? 139 ARG A NH1 1 
ATOM   1137 N NH2 . ARG A  1 162 ? -30.72581 53.50261 6.55430   1.000 89.21470  ? 139 ARG A NH2 1 
ATOM   1138 N N   . ASN A  1 163 ? -35.92965 50.63279 10.37077  1.000 46.74415  ? 140 ASN A N   1 
ATOM   1139 C CA  . ASN A  1 163 ? -36.98853 51.26877 11.14765  1.000 46.63955  ? 140 ASN A CA  1 
ATOM   1140 C C   . ASN A  1 163 ? -37.75071 50.18646 11.88626  1.000 45.47387  ? 140 ASN A C   1 
ATOM   1141 O O   . ASN A  1 163 ? -38.15746 49.19676 11.27532  1.000 43.38708  ? 140 ASN A O   1 
ATOM   1142 C CB  . ASN A  1 163 ? -37.93662 52.04810 10.23935  1.000 39.27373  ? 140 ASN A CB  1 
ATOM   1143 C CG  . ASN A  1 163 ? -37.26463 53.24913 9.62895   1.000 47.73003  ? 140 ASN A CG  1 
ATOM   1144 O OD1 . ASN A  1 163 ? -36.99954 54.21349 10.32377  1.000 48.14823  ? 140 ASN A OD1 1 
ATOM   1145 N ND2 . ASN A  1 163 ? -36.97489 53.19327 8.32852   1.000 46.61695  ? 140 ASN A ND2 1 
ATOM   1146 N N   . GLY A  1 164 ? -37.95010 50.35429 13.18238  1.000 40.55532  ? 141 GLY A N   1 
ATOM   1147 C CA  . GLY A  1 164 ? -38.62480 49.30224 13.90475  1.000 38.12982  ? 141 GLY A CA  1 
ATOM   1148 C C   . GLY A  1 164 ? -38.91441 49.66465 15.34059  1.000 41.22242  ? 141 GLY A C   1 
ATOM   1149 O O   . GLY A  1 164 ? -38.32253 50.59177 15.91226  1.000 42.57264  ? 141 GLY A O   1 
ATOM   1150 N N   . VAL A  1 165 ? -39.82699 48.88838 15.91741  1.000 37.75409  ? 142 VAL A N   1 
ATOM   1151 C CA  . VAL A  1 165 ? -40.09297 48.87279 17.34817  1.000 41.00576  ? 142 VAL A CA  1 
ATOM   1152 C C   . VAL A  1 165 ? -39.96399 47.43116 17.82041  1.000 41.61961  ? 142 VAL A C   1 
ATOM   1153 O O   . VAL A  1 165 ? -40.52143 46.52111 17.19927  1.000 38.46760  ? 142 VAL A O   1 
ATOM   1154 C CB  . VAL A  1 165 ? -41.48895 49.44009 17.66565  1.000 35.20832  ? 142 VAL A CB  1 
ATOM   1155 C CG1 . VAL A  1 165 ? -41.88331 49.10609 19.08171  1.000 33.56839  ? 142 VAL A CG1 1 
ATOM   1156 C CG2 . VAL A  1 165 ? -41.47660 50.94425 17.42682  1.000 35.52071  ? 142 VAL A CG2 1 
ATOM   1157 N N   . LEU A  1 166 ? -39.21721 47.22438 18.90274  1.000 35.64725  ? 143 LEU A N   1 
ATOM   1158 C CA  . LEU A  1 166 ? -38.94834 45.89874 19.44926  1.000 38.23704  ? 143 LEU A CA  1 
ATOM   1159 C C   . LEU A  1 166 ? -39.49262 45.83060 20.87230  1.000 41.04701  ? 143 LEU A C   1 
ATOM   1160 O O   . LEU A  1 166 ? -39.27374 46.76219 21.65856  1.000 39.48430  ? 143 LEU A O   1 
ATOM   1161 C CB  . LEU A  1 166 ? -37.42406 45.62991 19.44448  1.000 37.07305  ? 143 LEU A CB  1 
ATOM   1162 C CG  . LEU A  1 166 ? -36.91471 44.43289 20.25397  1.000 43.15839  ? 143 LEU A CG  1 
ATOM   1163 C CD1 . LEU A  1 166 ? -37.44257 43.11049 19.68307  1.000 42.30398  ? 143 LEU A CD1 1 
ATOM   1164 C CD2 . LEU A  1 166 ? -35.40268 44.40226 20.34721  1.000 44.86312  ? 143 LEU A CD2 1 
ATOM   1165 N N   . ILE A  1 167 ? -40.20762 44.74533 21.21729  1.000 36.75962  ? 144 ILE A N   1 
ATOM   1166 C CA  . ILE A  1 167 ? -40.46984 44.46688 22.63045  1.000 33.81467  ? 144 ILE A CA  1 
ATOM   1167 C C   . ILE A  1 167 ? -39.66763 43.24679 23.08779  1.000 40.28939  ? 144 ILE A C   1 
ATOM   1168 O O   . ILE A  1 167 ? -39.40779 42.31674 22.31701  1.000 40.49729  ? 144 ILE A O   1 
ATOM   1169 C CB  . ILE A  1 167 ? -41.97100 44.30326 22.93800  1.000 30.34320  ? 144 ILE A CB  1 
ATOM   1170 C CG1 . ILE A  1 167 ? -42.61220 43.18352 22.10412  1.000 33.13404  ? 144 ILE A CG1 1 
ATOM   1171 C CG2 . ILE A  1 167 ? -42.73138 45.64792 22.67916  1.000 30.34158  ? 144 ILE A CG2 1 
ATOM   1172 C CD1 . ILE A  1 167 ? -43.94796 42.74209 22.64968  1.000 32.37172  ? 144 ILE A CD1 1 
ATOM   1173 N N   . THR A  1 168 ? -39.25934 43.25629 24.35728  1.000 38.28335  ? 145 THR A N   1 
ATOM   1174 C CA  . THR A  1 168 ? -38.65920 42.06825 24.95842  1.000 42.92513  ? 145 THR A CA  1 
ATOM   1175 C C   . THR A  1 168 ? -39.18615 41.89415 26.37380  1.000 47.70477  ? 145 THR A C   1 
ATOM   1176 O O   . THR A  1 168 ? -39.75469 42.81072 26.97382  1.000 42.53065  ? 145 THR A O   1 
ATOM   1177 C CB  . THR A  1 168 ? -37.11784 42.12934 25.03095  1.000 45.45345  ? 145 THR A CB  1 
ATOM   1178 O OG1 . THR A  1 168 ? -36.72243 43.22288 25.87289  1.000 44.46413  ? 145 THR A OG1 1 
ATOM   1179 C CG2 . THR A  1 168 ? -36.50139 42.30295 23.65389  1.000 45.55666  ? 145 THR A CG2 1 
ATOM   1180 N N   . GLU A  1 169 ? -38.94401 40.70943 26.92439  1.000 48.73907  ? 146 GLU A N   1 
ATOM   1181 C CA  . GLU A  1 169 ? -39.22114 40.47307 28.32779  1.000 49.90699  ? 146 GLU A CA  1 
ATOM   1182 C C   . GLU A  1 169 ? -38.01184 40.72556 29.21174  1.000 49.84711  ? 146 GLU A C   1 
ATOM   1183 O O   . GLU A  1 169 ? -38.14404 40.68199 30.43880  1.000 55.09639  ? 146 GLU A O   1 
ATOM   1184 C CB  . GLU A  1 169 ? -39.71304 39.04120 28.53005  1.000 49.35637  ? 146 GLU A CB  1 
ATOM   1185 C CG  . GLU A  1 169 ? -41.06534 38.75638 27.87085  1.000 44.45291  ? 146 GLU A CG  1 
ATOM   1186 C CD  . GLU A  1 169 ? -41.45198 37.27828 28.00419  1.000 49.95585  ? 146 GLU A CD  1 
ATOM   1187 O OE1 . GLU A  1 169 ? -40.53820 36.42237 28.04886  1.000 54.73100  ? 146 GLU A OE1 1 
ATOM   1188 O OE2 . GLU A  1 169 ? -42.65413 36.97678 28.10308  1.000 46.17808  ? 146 GLU A OE2 1 
ATOM   1189 N N   . GLY A  1 170 ? -36.85667 41.01255 28.62541  1.000 48.27438  ? 147 GLY A N   1 
ATOM   1190 C CA  . GLY A  1 170 ? -35.63479 41.12054 29.39475  1.000 53.36484  ? 147 GLY A CA  1 
ATOM   1191 C C   . GLY A  1 170 ? -34.59501 41.95403 28.67482  1.000 55.43178  ? 147 GLY A C   1 
ATOM   1192 O O   . GLY A  1 170 ? -34.89273 42.63840 27.69152  1.000 51.49612  ? 147 GLY A O   1 
ATOM   1193 N N   . SER A  1 171 ? -33.36111 41.88794 29.18913  1.000 56.27741  ? 148 SER A N   1 
ATOM   1194 C CA  . SER A  1 171 ? -32.26629 42.70504 28.67835  1.000 57.21719  ? 148 SER A CA  1 
ATOM   1195 C C   . SER A  1 171 ? -31.88731 42.32038 27.25613  1.000 58.96351  ? 148 SER A C   1 
ATOM   1196 O O   . SER A  1 171 ? -31.91195 41.14682 26.88104  1.000 58.61752  ? 148 SER A O   1 
ATOM   1197 C CB  . SER A  1 171 ? -31.03164 42.56611 29.57096  1.000 60.67836  ? 148 SER A CB  1 
ATOM   1198 O OG  . SER A  1 171 ? -31.22525 43.27374 30.77420  1.000 64.99438  ? 148 SER A OG  1 
ATOM   1199 N N   . VAL A  1 172 ? -31.51618 43.32432 26.47121  1.000 54.78138  ? 149 VAL A N   1 
ATOM   1200 C CA  . VAL A  1 172 ? -30.90116 43.13374 25.16548  1.000 55.13311  ? 149 VAL A CA  1 
ATOM   1201 C C   . VAL A  1 172 ? -29.48756 43.68061 25.25487  1.000 57.38872  ? 149 VAL A C   1 
ATOM   1202 O O   . VAL A  1 172 ? -29.29254 44.81401 25.70515  1.000 56.86099  ? 149 VAL A O   1 
ATOM   1203 C CB  . VAL A  1 172 ? -31.68376 43.86171 24.06169  1.000 55.14037  ? 149 VAL A CB  1 
ATOM   1204 C CG1 . VAL A  1 172 ? -30.99726 43.66875 22.72278  1.000 55.29202  ? 149 VAL A CG1 1 
ATOM   1205 C CG2 . VAL A  1 172 ? -33.12209 43.37627 24.01773  1.000 54.68651  ? 149 VAL A CG2 1 
ATOM   1206 N N   . LYS A  1 173 ? -28.50710 42.89302 24.82967  1.000 59.00934  ? 150 LYS A N   1 
ATOM   1207 C CA  . LYS A  1 173 ? -27.12249 43.32432 24.97224  1.000 60.81792  ? 150 LYS A CA  1 
ATOM   1208 C C   . LYS A  1 173 ? -26.86193 44.54950 24.09916  1.000 56.89718  ? 150 LYS A C   1 
ATOM   1209 O O   . LYS A  1 173 ? -27.20539 44.56742 22.91170  1.000 63.25599  ? 150 LYS A O   1 
ATOM   1210 C CB  . LYS A  1 173 ? -26.16166 42.18706 24.61289  1.000 67.71012  ? 150 LYS A CB  1 
ATOM   1211 C CG  . LYS A  1 173 ? -24.88569 42.21010 25.43313  1.000 74.48963  ? 150 LYS A CG  1 
ATOM   1212 C CD  . LYS A  1 173 ? -23.86993 41.18120 24.96394  1.000 82.81816  ? 150 LYS A CD  1 
ATOM   1213 C CE  . LYS A  1 173 ? -23.25961 41.56808 23.61751  1.000 86.61895  ? 150 LYS A CE  1 
ATOM   1214 N NZ  . LYS A  1 173 ? -22.12594 40.67903 23.20693  1.000 89.19614  ? 150 LYS A NZ  1 
ATOM   1215 N N   . GLY A  1 174 ? -26.29560 45.58811 24.70387  1.000 56.86289  ? 151 GLY A N   1 
ATOM   1216 C CA  . GLY A  1 174 ? -25.95031 46.80491 24.00086  1.000 64.89332  ? 151 GLY A CA  1 
ATOM   1217 C C   . GLY A  1 174 ? -27.06841 47.80844 23.79575  1.000 67.09000  ? 151 GLY A C   1 
ATOM   1218 O O   . GLY A  1 174 ? -26.81569 48.86110 23.19935  1.000 72.74426  ? 151 GLY A O   1 
ATOM   1219 N N   . LEU A  1 175 ? -28.29118 47.53558 24.26023  1.000 60.15367  ? 152 LEU A N   1 
ATOM   1220 C CA  . LEU A  1 175 ? -29.42009 48.44619 24.07171  1.000 55.28581  ? 152 LEU A CA  1 
ATOM   1221 C C   . LEU A  1 175 ? -30.02640 48.82367 25.41298  1.000 55.34334  ? 152 LEU A C   1 
ATOM   1222 O O   . LEU A  1 175 ? -30.32525 47.94826 26.22780  1.000 61.20312  ? 152 LEU A O   1 
ATOM   1223 C CB  . LEU A  1 175 ? -30.49733 47.82298 23.18847  1.000 52.03376  ? 152 LEU A CB  1 
ATOM   1224 C CG  . LEU A  1 175 ? -30.10611 47.58546 21.73223  1.000 57.92015  ? 152 LEU A CG  1 
ATOM   1225 C CD1 . LEU A  1 175 ? -31.25556 46.96691 20.97724  1.000 58.03993  ? 152 LEU A CD1 1 
ATOM   1226 C CD2 . LEU A  1 175 ? -29.66620 48.88659 21.08607  1.000 65.12260  ? 152 LEU A CD2 1 
ATOM   1227 N N   . GLN A  1 176 ? -30.22449 50.11726 25.63011  1.000 53.17701  ? 153 GLN A N   1 
ATOM   1228 C CA  . GLN A  1 176 ? -30.87134 50.58347 26.85175  1.000 51.45194  ? 153 GLN A CA  1 
ATOM   1229 C C   . GLN A  1 176 ? -32.38290 50.52292 26.68553  1.000 49.69288  ? 153 GLN A C   1 
ATOM   1230 O O   . GLN A  1 176 ? -32.90883 51.06718 25.71253  1.000 40.28045  ? 153 GLN A O   1 
ATOM   1231 C CB  . GLN A  1 176 ? -30.44552 52.00489 27.17350  1.000 52.63372  ? 153 GLN A CB  1 
ATOM   1232 C CG  . GLN A  1 176 ? -28.92942 52.19491 27.09876  1.000 69.85573  ? 153 GLN A CG  1 
ATOM   1233 C CD  . GLN A  1 176 ? -28.15282 51.05751 27.78315  1.000 82.02990  ? 153 GLN A CD  1 
ATOM   1234 O OE1 . GLN A  1 176 ? -28.52277 50.60700 28.87466  1.000 85.16686  ? 153 GLN A OE1 1 
ATOM   1235 N NE2 . GLN A  1 176 ? -27.07949 50.58507 27.13412  1.000 79.01893  ? 153 GLN A NE2 1 
ATOM   1236 N N   . PRO A  1 177 ? -33.10321 49.89624 27.60965  1.000 48.88432  ? 154 PRO A N   1 
ATOM   1237 C CA  . PRO A  1 177 ? -34.54816 49.72347 27.45217  1.000 44.98716  ? 154 PRO A CA  1 
ATOM   1238 C C   . PRO A  1 177 ? -35.34760 50.90770 27.98641  1.000 45.52260  ? 154 PRO A C   1 
ATOM   1239 O O   . PRO A  1 177 ? -34.89093 51.68868 28.82091  1.000 45.34737  ? 154 PRO A O   1 
ATOM   1240 C CB  . PRO A  1 177 ? -34.82335 48.46882 28.28956  1.000 46.38254  ? 154 PRO A CB  1 
ATOM   1241 C CG  . PRO A  1 177 ? -33.79922 48.55281 29.39332  1.000 48.91742  ? 154 PRO A CG  1 
ATOM   1242 C CD  . PRO A  1 177 ? -32.59432 49.27053 28.84376  1.000 48.13008  ? 154 PRO A CD  1 
ATOM   1243 N N   . SER A  1 178 ? -36.56301 51.02574 27.47802  1.000 45.91193  ? 155 SER A N   1 
ATOM   1244 C CA  . SER A  1 178 ? -37.60484 51.83283 28.09709  1.000 43.72431  ? 155 SER A CA  1 
ATOM   1245 C C   . SER A  1 178 ? -38.63872 50.87560 28.67209  1.000 40.94340  ? 155 SER A C   1 
ATOM   1246 O O   . SER A  1 178 ? -39.14541 50.01306 27.94853  1.000 37.85730  ? 155 SER A O   1 
ATOM   1247 C CB  . SER A  1 178 ? -38.24804 52.77785 27.08112  1.000 40.30580  ? 155 SER A CB  1 
ATOM   1248 O OG  . SER A  1 178 ? -39.52169 53.23758 27.52963  1.000 40.45358  ? 155 SER A OG  1 
ATOM   1249 N N   . VAL A  1 179 ? -38.94151 51.01815 29.96177  1.000 34.57227  ? 156 VAL A N   1 
ATOM   1250 C CA  . VAL A  1 179 ? -39.90008 50.12233 30.61264  1.000 42.34457  ? 156 VAL A CA  1 
ATOM   1251 C C   . VAL A  1 179 ? -41.30281 50.53139 30.19056  1.000 41.78039  ? 156 VAL A C   1 
ATOM   1252 O O   . VAL A  1 179 ? -41.70032 51.68376 30.38491  1.000 40.74593  ? 156 VAL A O   1 
ATOM   1253 C CB  . VAL A  1 179 ? -39.75570 50.16660 32.14322  1.000 47.57486  ? 156 VAL A CB  1 
ATOM   1254 C CG1 . VAL A  1 179 ? -40.87109 49.33049 32.78316  1.000 45.50737  ? 156 VAL A CG1 1 
ATOM   1255 C CG2 . VAL A  1 179 ? -38.35734 49.65102 32.57592  1.000 47.71898  ? 156 VAL A CG2 1 
ATOM   1256 N N   . GLY A  1 180 ? -42.06338 49.59303 29.60911  1.000 35.74021  ? 157 GLY A N   1 
ATOM   1257 C CA  . GLY A  1 180 ? -43.37912 49.92445 29.09164  1.000 31.88593  ? 157 GLY A CA  1 
ATOM   1258 C C   . GLY A  1 180 ? -44.45561 49.86611 30.15940  1.000 31.18187  ? 157 GLY A C   1 
ATOM   1259 O O   . GLY A  1 180 ? -44.16027 49.74935 31.35533  1.000 33.24780  ? 157 GLY A O   1 
ATOM   1260 N N   . PRO A  1 181 ? -45.72628 49.94743 29.75270  1.000 32.66166  ? 158 PRO A N   1 
ATOM   1261 C CA  . PRO A  1 181 ? -46.81952 49.84234 30.72394  1.000 33.23680  ? 158 PRO A CA  1 
ATOM   1262 C C   . PRO A  1 181 ? -46.86992 48.46519 31.36873  1.000 35.57292  ? 158 PRO A C   1 
ATOM   1263 O O   . PRO A  1 181 ? -46.31733 47.47792 30.86116  1.000 33.23233  ? 158 PRO A O   1 
ATOM   1264 C CB  . PRO A  1 181 ? -48.07944 50.10585 29.88889  1.000 41.93835  ? 158 PRO A CB  1 
ATOM   1265 C CG  . PRO A  1 181 ? -47.68637 49.86020 28.47675  1.000 40.35820  ? 158 PRO A CG  1 
ATOM   1266 C CD  . PRO A  1 181 ? -46.21046 50.16719 28.37668  1.000 33.81563  ? 158 PRO A CD  1 
ATOM   1267 N N   . LYS A  1 182 ? -47.52880 48.41702 32.52991  1.000 31.67913  ? 159 LYS A N   1 
ATOM   1268 C CA  . LYS A  1 182 ? -47.68681 47.13538 33.21710  1.000 36.88209  ? 159 LYS A CA  1 
ATOM   1269 C C   . LYS A  1 182 ? -48.59507 46.19280 32.45373  1.000 35.33208  ? 159 LYS A C   1 
ATOM   1270 O O   . LYS A  1 182 ? -48.42714 44.96778 32.55540  1.000 35.53480  ? 159 LYS A O   1 
ATOM   1271 C CB  . LYS A  1 182 ? -48.24192 47.33523 34.62681  1.000 33.81408  ? 159 LYS A CB  1 
ATOM   1272 C CG  . LYS A  1 182 ? -47.20409 47.84921 35.61716  1.000 42.44805  ? 159 LYS A CG  1 
ATOM   1273 C CD  . LYS A  1 182 ? -47.77686 47.93963 37.01956  1.000 47.31748  ? 159 LYS A CD  1 
ATOM   1274 C CE  . LYS A  1 182 ? -46.73253 48.49196 37.97943  1.000 57.79763  ? 159 LYS A CE  1 
ATOM   1275 N NZ  . LYS A  1 182 ? -47.31652 48.82418 39.29982  1.000 64.62054  ? 159 LYS A NZ  1 
ATOM   1276 N N   . GLN A  1 183 ? -49.56997 46.73434 31.71296  1.000 32.37794  ? 160 GLN A N   1 
ATOM   1277 C CA  . GLN A  1 183 ? -50.64898 45.94983 31.12407  1.000 33.05820  ? 160 GLN A CA  1 
ATOM   1278 C C   . GLN A  1 183 ? -50.37223 45.68614 29.65093  1.000 32.52038  ? 160 GLN A C   1 
ATOM   1279 O O   . GLN A  1 183 ? -49.63133 46.42037 28.99029  1.000 34.33570  ? 160 GLN A O   1 
ATOM   1280 C CB  . GLN A  1 183 ? -52.01320 46.65787 31.26611  1.000 31.34281  ? 160 GLN A CB  1 
ATOM   1281 C CG  . GLN A  1 183 ? -52.22590 47.90533 30.36529  1.000 31.10062  ? 160 GLN A CG  1 
ATOM   1282 C CD  . GLN A  1 183 ? -51.75694 49.23039 31.04992  1.000 35.63091  ? 160 GLN A CD  1 
ATOM   1283 O OE1 . GLN A  1 183 ? -50.87085 49.22031 31.88940  1.000 34.47956  ? 160 GLN A OE1 1 
ATOM   1284 N NE2 . GLN A  1 183 ? -52.37680 50.34387 30.68804  1.000 33.42750  ? 160 GLN A NE2 1 
ATOM   1285 N N   . ALA A  1 184 ? -50.99541 44.63049 29.13665  1.000 27.97863  ? 161 ALA A N   1 
ATOM   1286 C CA  . ALA A  1 184 ? -50.97538 44.34400 27.71136  1.000 27.98839  ? 161 ALA A CA  1 
ATOM   1287 C C   . ALA A  1 184 ? -52.30806 43.71694 27.35250  1.000 30.96721  ? 161 ALA A C   1 
ATOM   1288 O O   . ALA A  1 184 ? -53.14985 43.46776 28.22129  1.000 30.45274  ? 161 ALA A O   1 
ATOM   1289 C CB  . ALA A  1 184 ? -49.81120 43.43029 27.33361  1.000 29.99893  ? 161 ALA A CB  1 
ATOM   1290 N N   . SER A  1 185 ? -52.49244 43.44037 26.06516  1.000 28.41123  ? 162 SER A N   1 
ATOM   1291 C CA  . SER A  1 185 ? -53.75049 42.89005 25.56433  1.000 27.92966  ? 162 SER A CA  1 
ATOM   1292 C C   . SER A  1 185 ? -53.58354 41.42030 25.23380  1.000 28.84106  ? 162 SER A C   1 
ATOM   1293 O O   . SER A  1 185 ? -52.70202 41.05949 24.45184  1.000 30.77231  ? 162 SER A O   1 
ATOM   1294 C CB  . SER A  1 185 ? -54.22011 43.63656 24.30945  1.000 27.56754  ? 162 SER A CB  1 
ATOM   1295 O OG  . SER A  1 185 ? -55.43639 43.07395 23.86264  1.000 28.63078  ? 162 SER A OG  1 
ATOM   1296 N N   . LEU A  1 186 ? -54.46318 40.57783 25.78109  1.000 27.47750  ? 163 LEU A N   1 
ATOM   1297 C CA  . LEU A  1 186 ? -54.41986 39.13787 25.54823  1.000 27.33758  ? 163 LEU A CA  1 
ATOM   1298 C C   . LEU A  1 186 ? -55.80381 38.73881 25.03690  1.000 30.76663  ? 163 LEU A C   1 
ATOM   1299 O O   . LEU A  1 186 ? -56.78215 38.79968 25.78824  1.000 29.39149  ? 163 LEU A O   1 
ATOM   1300 C CB  . LEU A  1 186 ? -54.05013 38.38343 26.83018  1.000 27.50439  ? 163 LEU A CB  1 
ATOM   1301 C CG  . LEU A  1 186 ? -54.08627 36.84802 26.72652  1.000 33.71164  ? 163 LEU A CG  1 
ATOM   1302 C CD1 . LEU A  1 186 ? -53.22262 36.36532 25.57076  1.000 32.46125  ? 163 LEU A CD1 1 
ATOM   1303 C CD2 . LEU A  1 186 ? -53.64768 36.13436 28.04211  1.000 30.56844  ? 163 LEU A CD2 1 
ATOM   1304 N N   . ASN A  1 187 ? -55.89526 38.41503 23.74753  1.000 27.55370  ? 164 ASN A N   1 
ATOM   1305 C CA  . ASN A  1 187 ? -57.18112 38.11104 23.09396  1.000 32.93404  ? 164 ASN A CA  1 
ATOM   1306 C C   . ASN A  1 187 ? -58.23136 39.17447 23.37508  1.000 32.39854  ? 164 ASN A C   1 
ATOM   1307 O O   . ASN A  1 187 ? -59.39154 38.87109 23.64177  1.000 31.01775  ? 164 ASN A O   1 
ATOM   1308 C CB  . ASN A  1 187 ? -57.67603 36.74638 23.52693  1.000 30.58186  ? 164 ASN A CB  1 
ATOM   1309 C CG  . ASN A  1 187 ? -56.61545 35.74521 23.39722  1.000 34.06440  ? 164 ASN A CG  1 
ATOM   1310 O OD1 . ASN A  1 187 ? -55.96679 35.69096 22.35173  1.000 36.81562  ? 164 ASN A OD1 1 
ATOM   1311 N ND2 . ASN A  1 187 ? -56.35131 34.98363 24.46692  1.000 39.03611  ? 164 ASN A ND2 1 
ATOM   1312 N N   . GLY A  1 188 ? -57.81300 40.42668 23.32822  1.000 31.89134  ? 165 GLY A N   1 
ATOM   1313 C CA  . GLY A  1 188 ? -58.71599 41.54411 23.52020  1.000 34.46393  ? 165 GLY A CA  1 
ATOM   1314 C C   . GLY A  1 188 ? -59.00609 41.89716 24.95609  1.000 34.61693  ? 165 GLY A C   1 
ATOM   1315 O O   . GLY A  1 188 ? -59.75638 42.84084 25.19980  1.000 36.74663  ? 165 GLY A O   1 
ATOM   1316 N N   . VAL A  1 189 ? -58.44296 41.17297 25.91369  1.000 31.30573  ? 166 VAL A N   1 
ATOM   1317 C CA  . VAL A  1 189 ? -58.59003 41.48058 27.33326  1.000 25.75003  ? 166 VAL A CA  1 
ATOM   1318 C C   . VAL A  1 189 ? -57.33415 42.21177 27.77869  1.000 29.28522  ? 166 VAL A C   1 
ATOM   1319 O O   . VAL A  1 189 ? -56.23153 41.63291 27.75567  1.000 28.12099  ? 166 VAL A O   1 
ATOM   1320 C CB  . VAL A  1 189 ? -58.76733 40.19650 28.16795  1.000 29.09680  ? 166 VAL A CB  1 
ATOM   1321 C CG1 . VAL A  1 189 ? -59.02520 40.56514 29.65037  1.000 29.59997  ? 166 VAL A CG1 1 
ATOM   1322 C CG2 . VAL A  1 189 ? -59.83256 39.28558 27.56939  1.000 31.14373  ? 166 VAL A CG2 1 
ATOM   1323 N N   . THR A  1 190 ? -57.48696 43.44859 28.24838  1.000 30.40160  ? 167 THR A N   1 
ATOM   1324 C CA  . THR A  1 190 ? -56.33208 44.16856 28.76373  1.000 33.93181  ? 167 THR A CA  1 
ATOM   1325 C C   . THR A  1 190 ? -56.13056 43.79236 30.21872  1.000 35.37278  ? 167 THR A C   1 
ATOM   1326 O O   . THR A  1 190 ? -57.08314 43.82392 31.00767  1.000 36.86921  ? 167 THR A O   1 
ATOM   1327 C CB  . THR A  1 190 ? -56.52669 45.68008 28.62740  1.000 38.48952  ? 167 THR A CB  1 
ATOM   1328 O OG1 . THR A  1 190 ? -56.54934 46.01037 27.23999  1.000 35.66574  ? 167 THR A OG1 1 
ATOM   1329 C CG2 . THR A  1 190 ? -55.34817 46.42329 29.29787  1.000 29.71151  ? 167 THR A CG2 1 
ATOM   1330 N N   . LEU A  1 191 ? -54.90291 43.40874 30.57553  1.000 31.29434  ? 168 LEU A N   1 
ATOM   1331 C CA  . LEU A  1 191 ? -54.69831 42.86928 31.91455  1.000 29.62748  ? 168 LEU A CA  1 
ATOM   1332 C C   . LEU A  1 191 ? -53.23360 43.02109 32.29602  1.000 31.84043  ? 168 LEU A C   1 
ATOM   1333 O O   . LEU A  1 191 ? -52.36480 43.19165 31.43890  1.000 30.42404  ? 168 LEU A O   1 
ATOM   1334 C CB  . LEU A  1 191 ? -55.14866 41.40652 31.96951  1.000 28.13474  ? 168 LEU A CB  1 
ATOM   1335 C CG  . LEU A  1 191 ? -54.45505 40.37635 31.06374  1.000 31.94073  ? 168 LEU A CG  1 
ATOM   1336 C CD1 . LEU A  1 191 ? -53.21554 39.80925 31.73285  1.000 32.75853  ? 168 LEU A CD1 1 
ATOM   1337 C CD2 . LEU A  1 191 ? -55.40281 39.18948 30.68487  1.000 32.94392  ? 168 LEU A CD2 1 
ATOM   1338 N N   . ILE A  1 192 ? -52.98907 43.00386 33.59943  1.000 35.19357  ? 169 ILE A N   1 
ATOM   1339 C CA  . ILE A  1 192 ? -51.65393 42.96417 34.17450  1.000 36.09296  ? 169 ILE A CA  1 
ATOM   1340 C C   . ILE A  1 192 ? -51.37578 41.50157 34.50791  1.000 40.09404  ? 169 ILE A C   1 
ATOM   1341 O O   . ILE A  1 192 ? -52.02505 40.92169 35.38835  1.000 36.48482  ? 169 ILE A O   1 
ATOM   1342 C CB  . ILE A  1 192 ? -51.55416 43.88354 35.39911  1.000 30.31703  ? 169 ILE A CB  1 
ATOM   1343 C CG1 . ILE A  1 192 ? -51.76903 45.35923 34.93159  1.000 33.89568  ? 169 ILE A CG1 1 
ATOM   1344 C CG2 . ILE A  1 192 ? -50.19794 43.72347 36.10774  1.000 31.27926  ? 169 ILE A CG2 1 
ATOM   1345 C CD1 . ILE A  1 192 ? -51.85194 46.40151 36.08260  1.000 36.59535  ? 169 ILE A CD1 1 
ATOM   1346 N N   . GLY A  1 193 ? -50.44579 40.89107 33.77536  1.000 35.10183  ? 170 GLY A N   1 
ATOM   1347 C CA  . GLY A  1 193 ? -50.31383 39.44264 33.82451  1.000 31.43696  ? 170 GLY A CA  1 
ATOM   1348 C C   . GLY A  1 193 ? -49.75414 38.98823 35.15579  1.000 35.80775  ? 170 GLY A C   1 
ATOM   1349 O O   . GLY A  1 193 ? -48.87888 39.62639 35.73527  1.000 36.28789  ? 170 GLY A O   1 
ATOM   1350 N N   . GLU A  1 194 ? -50.28730 37.88004 35.66174  1.000 35.22953  ? 171 GLU A N   1 
ATOM   1351 C CA  . GLU A  1 194 ? -49.71126 37.22111 36.81899  1.000 39.99371  ? 171 GLU A CA  1 
ATOM   1352 C C   . GLU A  1 194 ? -49.19666 35.84123 36.48603  1.000 41.49221  ? 171 GLU A C   1 
ATOM   1353 O O   . GLU A  1 194 ? -48.18139 35.43521 37.03112  1.000 38.42701  ? 171 GLU A O   1 
ATOM   1354 C CB  . GLU A  1 194 ? -50.73332 37.11649 37.95879  1.000 44.44504  ? 171 GLU A CB  1 
ATOM   1355 C CG  . GLU A  1 194 ? -51.58586 38.36328 38.14197  1.000 44.25461  ? 171 GLU A CG  1 
ATOM   1356 C CD  . GLU A  1 194 ? -52.48698 38.29817 39.37426  1.000 53.44843  ? 171 GLU A CD  1 
ATOM   1357 O OE1 . GLU A  1 194 ? -52.74357 37.18934 39.90166  1.000 53.28011  ? 171 GLU A OE1 1 
ATOM   1358 O OE2 . GLU A  1 194 ? -52.94698 39.37000 39.81733  1.000 54.47560  ? 171 GLU A OE2 1 
ATOM   1359 N N   . ALA A  1 195 ? -49.87640 35.11629 35.60101  1.000 36.69063  ? 172 ALA A N   1 
ATOM   1360 C CA  . ALA A  1 195 ? -49.40884 33.84292 35.08002  1.000 41.07833  ? 172 ALA A CA  1 
ATOM   1361 C C   . ALA A  1 195 ? -48.61287 34.01807 33.79866  1.000 43.77418  ? 172 ALA A C   1 
ATOM   1362 O O   . ALA A  1 195 ? -48.01805 33.05118 33.31598  1.000 40.93151  ? 172 ALA A O   1 
ATOM   1363 C CB  . ALA A  1 195 ? -50.59958 32.90680 34.80452  1.000 38.64557  ? 172 ALA A CB  1 
ATOM   1364 N N   . VAL A  1 196 ? -48.61194 35.22882 33.23652  1.000 36.94971  ? 173 VAL A N   1 
ATOM   1365 C CA  . VAL A  1 196 ? -47.89748 35.54927 32.01413  1.000 40.35292  ? 173 VAL A CA  1 
ATOM   1366 C C   . VAL A  1 196 ? -47.34037 36.96697 32.16184  1.000 43.01161  ? 173 VAL A C   1 
ATOM   1367 O O   . VAL A  1 196 ? -47.87150 37.78535 32.91887  1.000 39.15117  ? 173 VAL A O   1 
ATOM   1368 C CB  . VAL A  1 196 ? -48.82804 35.40736 30.78868  1.000 43.55269  ? 173 VAL A CB  1 
ATOM   1369 C CG1 . VAL A  1 196 ? -49.92746 36.47363 30.81399  1.000 34.20917  ? 173 VAL A CG1 1 
ATOM   1370 C CG2 . VAL A  1 196 ? -48.03052 35.41913 29.49556  1.000 51.88057  ? 173 VAL A CG2 1 
ATOM   1371 N N   . LYS A  1 197 ? -46.23626 37.23843 31.46602  1.000 37.43379  ? 174 LYS A N   1 
ATOM   1372 C CA  . LYS A  1 197 ? -45.58608 38.54308 31.52740  1.000 41.38635  ? 174 LYS A CA  1 
ATOM   1373 C C   . LYS A  1 197 ? -46.26887 39.51132 30.56381  1.000 38.09670  ? 174 LYS A C   1 
ATOM   1374 O O   . LYS A  1 197 ? -46.43560 39.20325 29.37974  1.000 33.14329  ? 174 LYS A O   1 
ATOM   1375 C CB  . LYS A  1 197 ? -44.10806 38.38269 31.18072  1.000 52.44475  ? 174 LYS A CB  1 
ATOM   1376 C CG  . LYS A  1 197 ? -43.20369 39.46973 31.70043  1.000 67.96575  ? 174 LYS A CG  1 
ATOM   1377 C CD  . LYS A  1 197 ? -41.76960 38.97337 31.87210  1.000 69.34658  ? 174 LYS A CD  1 
ATOM   1378 C CE  . LYS A  1 197 ? -40.89925 40.07422 32.48334  1.000 73.68943  ? 174 LYS A CE  1 
ATOM   1379 N NZ  . LYS A  1 197 ? -41.13468 41.39932 31.81479  1.000 73.45561  ? 174 LYS A NZ  1 
ATOM   1380 N N   . THR A  1 198 ? -46.67920 40.68593 31.06730  1.000 35.04909  ? 175 THR A N   1 
ATOM   1381 C CA  . THR A  1 198 ? -47.28138 41.70894 30.20839  1.000 31.54458  ? 175 THR A CA  1 
ATOM   1382 C C   . THR A  1 198 ? -46.48844 43.02796 30.16124  1.000 34.62238  ? 175 THR A C   1 
ATOM   1383 O O   . THR A  1 198 ? -46.83353 43.90241 29.35703  1.000 31.99169  ? 175 THR A O   1 
ATOM   1384 C CB  . THR A  1 198 ? -48.73312 42.01567 30.64617  1.000 30.12603  ? 175 THR A CB  1 
ATOM   1385 O OG1 . THR A  1 198 ? -48.73725 42.36438 32.03996  1.000 31.41102  ? 175 THR A OG1 1 
ATOM   1386 C CG2 . THR A  1 198 ? -49.66845 40.77350 30.41784  1.000 28.79737  ? 175 THR A CG2 1 
ATOM   1387 N N   . GLN A  1 199 ? -45.45748 43.20373 30.98192  1.000 36.37930  ? 176 GLN A N   1 
ATOM   1388 C CA  . GLN A  1 199 ? -44.66222 44.43739 30.97979  1.000 39.49742  ? 176 GLN A CA  1 
ATOM   1389 C C   . GLN A  1 199 ? -43.42752 44.20496 30.12159  1.000 41.63680  ? 176 GLN A C   1 
ATOM   1390 O O   . GLN A  1 199 ? -42.61624 43.32774 30.42524  1.000 41.65049  ? 176 GLN A O   1 
ATOM   1391 C CB  . GLN A  1 199 ? -44.25592 44.85973 32.39284  1.000 42.80264  ? 176 GLN A CB  1 
ATOM   1392 C CG  . GLN A  1 199 ? -43.53663 46.27883 32.48816  1.000 37.21630  ? 176 GLN A CG  1 
ATOM   1393 C CD  . GLN A  1 199 ? -43.63209 46.82926 33.86198  1.000 40.70274  ? 176 GLN A CD  1 
ATOM   1394 O OE1 . GLN A  1 199 ? -43.35778 46.12658 34.83172  1.000 44.83745  ? 176 GLN A OE1 1 
ATOM   1395 N NE2 . GLN A  1 199 ? -44.03457 48.09755 33.98179  1.000 49.83762  ? 176 GLN A NE2 1 
ATOM   1396 N N   . PHE A  1 200 ? -43.31112 44.94925 29.02888  1.000 37.73589  ? 177 PHE A N   1 
ATOM   1397 C CA  . PHE A  1 200 ? -42.21311 44.75510 28.09237  1.000 33.04719  ? 177 PHE A CA  1 
ATOM   1398 C C   . PHE A  1 200 ? -41.20349 45.87777 28.23291  1.000 36.91249  ? 177 PHE A C   1 
ATOM   1399 O O   . PHE A  1 200 ? -41.54405 46.96707 28.70066  1.000 35.24486  ? 177 PHE A O   1 
ATOM   1400 C CB  . PHE A  1 200 ? -42.74270 44.71426 26.66304  1.000 33.95752  ? 177 PHE A CB  1 
ATOM   1401 C CG  . PHE A  1 200 ? -43.86251 43.71774 26.47488  1.000 33.01299  ? 177 PHE A CG  1 
ATOM   1402 C CD1 . PHE A  1 200 ? -43.64805 42.37217 26.76733  1.000 38.86817  ? 177 PHE A CD1 1 
ATOM   1403 C CD2 . PHE A  1 200 ? -45.12078 44.13256 26.03732  1.000 29.73538  ? 177 PHE A CD2 1 
ATOM   1404 C CE1 . PHE A  1 200 ? -44.68094 41.42739 26.60050  1.000 38.42228  ? 177 PHE A CE1 1 
ATOM   1405 C CE2 . PHE A  1 200 ? -46.17410 43.20845 25.86785  1.000 36.19736  ? 177 PHE A CE2 1 
ATOM   1406 C CZ  . PHE A  1 200 ? -45.94117 41.85430 26.14622  1.000 38.07680  ? 177 PHE A CZ  1 
ATOM   1407 N N   . ASN A  1 201 ? -39.94610 45.56255 27.88925  1.000 37.70755  ? 178 ASN A N   1 
ATOM   1408 C CA  . ASN A  1 201 ? -38.98464 46.56244 27.45708  1.000 39.97799  ? 178 ASN A CA  1 
ATOM   1409 C C   . ASN A  1 201 ? -39.27915 46.95842 26.01685  1.000 36.87776  ? 178 ASN A C   1 
ATOM   1410 O O   . ASN A  1 201 ? -39.58912 46.10240 25.18193  1.000 36.80042  ? 178 ASN A O   1 
ATOM   1411 C CB  . ASN A  1 201 ? -37.55170 46.02647 27.53750  1.000 37.12716  ? 178 ASN A CB  1 
ATOM   1412 C CG  . ASN A  1 201 ? -37.05631 45.92099 28.94370  1.000 40.44929  ? 178 ASN A CG  1 
ATOM   1413 O OD1 . ASN A  1 201 ? -37.50877 46.64212 29.81733  1.000 44.20311  ? 178 ASN A OD1 1 
ATOM   1414 N ND2 . ASN A  1 201 ? -36.10722 45.02691 29.17613  1.000 46.72776  ? 178 ASN A ND2 1 
ATOM   1415 N N   . TYR A  1 202 ? -39.13596 48.25458 25.72802  1.000 37.55738  ? 179 TYR A N   1 
ATOM   1416 C CA  . TYR A  1 202 ? -39.36676 48.84367 24.41418  1.000 34.92142  ? 179 TYR A CA  1 
ATOM   1417 C C   . TYR A  1 202 ? -38.08932 49.44000 23.86243  1.000 36.91713  ? 179 TYR A C   1 
ATOM   1418 O O   . TYR A  1 202 ? -37.30469 50.04683 24.60075  1.000 39.45740  ? 179 TYR A O   1 
ATOM   1419 C CB  . TYR A  1 202 ? -40.40755 49.95443 24.47466  1.000 31.99083  ? 179 TYR A CB  1 
ATOM   1420 C CG  . TYR A  1 202 ? -41.81580 49.43137 24.43537  1.000 33.29134  ? 179 TYR A CG  1 
ATOM   1421 C CD1 . TYR A  1 202 ? -42.44574 48.98417 25.58746  1.000 34.86911  ? 179 TYR A CD1 1 
ATOM   1422 C CD2 . TYR A  1 202 ? -42.52602 49.40745 23.24505  1.000 32.36017  ? 179 TYR A CD2 1 
ATOM   1423 C CE1 . TYR A  1 202 ? -43.75457 48.50828 25.54851  1.000 31.55800  ? 179 TYR A CE1 1 
ATOM   1424 C CE2 . TYR A  1 202 ? -43.80859 48.94082 23.20218  1.000 27.68000  ? 179 TYR A CE2 1 
ATOM   1425 C CZ  . TYR A  1 202 ? -44.41049 48.49025 24.35808  1.000 30.33466  ? 179 TYR A CZ  1 
ATOM   1426 O OH  . TYR A  1 202 ? -45.69618 48.03675 24.30260  1.000 35.57908  ? 179 TYR A OH  1 
ATOM   1427 N N   . TYR A  1 203 ? -37.90556 49.28819 22.55449  1.000 39.91623  ? 180 TYR A N   1 
ATOM   1428 C CA  . TYR A  1 203 ? -36.76114 49.82533 21.82565  1.000 42.62600  ? 180 TYR A CA  1 
ATOM   1429 C C   . TYR A  1 203 ? -37.29099 50.31888 20.49279  1.000 41.89802  ? 180 TYR A C   1 
ATOM   1430 O O   . TYR A  1 203 ? -38.25882 49.76421 19.96844  1.000 39.80105  ? 180 TYR A O   1 
ATOM   1431 C CB  . TYR A  1 203 ? -35.67259 48.76508 21.58867  1.000 39.96337  ? 180 TYR A CB  1 
ATOM   1432 C CG  . TYR A  1 203 ? -35.30176 47.96103 22.82020  1.000 41.65950  ? 180 TYR A CG  1 
ATOM   1433 C CD1 . TYR A  1 203 ? -36.08776 46.87675 23.23394  1.000 42.15856  ? 180 TYR A CD1 1 
ATOM   1434 C CD2 . TYR A  1 203 ? -34.17152 48.28599 23.56943  1.000 40.57235  ? 180 TYR A CD2 1 
ATOM   1435 C CE1 . TYR A  1 203 ? -35.76738 46.15318 24.36400  1.000 44.03860  ? 180 TYR A CE1 1 
ATOM   1436 C CE2 . TYR A  1 203 ? -33.82844 47.55010 24.70114  1.000 45.63115  ? 180 TYR A CE2 1 
ATOM   1437 C CZ  . TYR A  1 203 ? -34.63689 46.48153 25.09032  1.000 47.78082  ? 180 TYR A CZ  1 
ATOM   1438 O OH  . TYR A  1 203 ? -34.32020 45.73563 26.20513  1.000 45.34324  ? 180 TYR A OH  1 
ATOM   1439 N N   . LYS A  1 204 ? -36.64620 51.33737 19.93717  1.000 38.64492  ? 181 LYS A N   1 
ATOM   1440 C CA  . LYS A  1 204 ? -37.10526 51.91426 18.68180  1.000 41.73902  ? 181 LYS A CA  1 
ATOM   1441 C C   . LYS A  1 204 ? -35.91456 52.40503 17.86774  1.000 43.87898  ? 181 LYS A C   1 
ATOM   1442 O O   . LYS A  1 204 ? -34.98834 53.02387 18.40849  1.000 46.62545  ? 181 LYS A O   1 
ATOM   1443 C CB  . LYS A  1 204 ? -38.07012 53.08281 18.91038  1.000 41.04346  ? 181 LYS A CB  1 
ATOM   1444 C CG  . LYS A  1 204 ? -38.61612 53.64617 17.61899  1.000 37.92531  ? 181 LYS A CG  1 
ATOM   1445 C CD  . LYS A  1 204 ? -39.60991 54.78330 17.83585  1.000 39.90346  ? 181 LYS A CD  1 
ATOM   1446 C CE  . LYS A  1 204 ? -40.25203 55.08951 16.50115  1.000 44.98834  ? 181 LYS A CE  1 
ATOM   1447 N NZ  . LYS A  1 204 ? -40.88650 56.39023 16.52062  1.000 54.32640  ? 181 LYS A NZ  1 
ATOM   1448 N N   . LYS A  1 205 ? -35.96959 52.15808 16.56103  1.000 44.66065  ? 182 LYS A N   1 
ATOM   1449 C CA  . LYS A  1 205 ? -34.94761 52.58934 15.61349  1.000 49.48778  ? 182 LYS A CA  1 
ATOM   1450 C C   . LYS A  1 205 ? -35.60034 53.41964 14.52274  1.000 43.55631  ? 182 LYS A C   1 
ATOM   1451 O O   . LYS A  1 205 ? -36.68455 53.08124 14.05159  1.000 41.89089  ? 182 LYS A O   1 
ATOM   1452 C CB  . LYS A  1 205 ? -34.24014 51.39943 14.96490  1.000 49.60879  ? 182 LYS A CB  1 
ATOM   1453 C CG  . LYS A  1 205 ? -33.19002 50.74094 15.81827  1.000 56.65198  ? 182 LYS A CG  1 
ATOM   1454 C CD  . LYS A  1 205 ? -32.65178 49.46563 15.12550  1.000 56.41940  ? 182 LYS A CD  1 
ATOM   1455 C CE  . LYS A  1 205 ? -31.63996 49.78758 14.05430  1.000 55.15284  ? 182 LYS A CE  1 
ATOM   1456 N NZ  . LYS A  1 205 ? -31.19545 48.53915 13.37086  1.000 54.47332  ? 182 LYS A NZ  1 
ATOM   1457 N N   . VAL A  1 206 ? -34.92402 54.48761 14.11424  1.000 46.75720  ? 183 VAL A N   1 
ATOM   1458 C CA  . VAL A  1 206 ? -35.36481 55.35272 13.02344  1.000 51.59052  ? 183 VAL A CA  1 
ATOM   1459 C C   . VAL A  1 206 ? -34.15260 55.56395 12.12520  1.000 50.93533  ? 183 VAL A C   1 
ATOM   1460 O O   . VAL A  1 206 ? -33.09267 55.97134 12.60989  1.000 48.39170  ? 183 VAL A O   1 
ATOM   1461 C CB  . VAL A  1 206 ? -35.91075 56.70289 13.54006  1.000 52.85718  ? 183 VAL A CB  1 
ATOM   1462 C CG1 . VAL A  1 206 ? -36.25636 57.66128 12.38765  1.000 50.60465  ? 183 VAL A CG1 1 
ATOM   1463 C CG2 . VAL A  1 206 ? -37.12475 56.47945 14.43226  1.000 49.44649  ? 183 VAL A CG2 1 
ATOM   1464 N N   . ASP A  1 207 ? -34.29914 55.26013 10.83348  1.000 54.11233  ? 184 ASP A N   1 
ATOM   1465 C CA  . ASP A  1 207 ? -33.20362 55.33410 9.84812   1.000 56.46065  ? 184 ASP A CA  1 
ATOM   1466 C C   . ASP A  1 207 ? -31.90301 54.72444 10.37893  1.000 57.37052  ? 184 ASP A C   1 
ATOM   1467 O O   . ASP A  1 207 ? -30.82203 55.30565 10.27213  1.000 54.32145  ? 184 ASP A O   1 
ATOM   1468 C CB  . ASP A  1 207 ? -32.96375 56.77372 9.37764   1.000 63.75770  ? 184 ASP A CB  1 
ATOM   1469 C CG  . ASP A  1 207 ? -34.23710 57.45604 8.90877   1.000 71.39942  ? 184 ASP A CG  1 
ATOM   1470 O OD1 . ASP A  1 207 ? -34.51014 58.57575 9.37565   1.000 77.15773  ? 184 ASP A OD1 1 
ATOM   1471 O OD2 . ASP A  1 207 ? -34.97690 56.86649 8.09323   1.000 76.06797  ? 184 ASP A OD2 1 
ATOM   1472 N N   . GLY A  1 208 ? -32.00585 53.52439 10.94082  1.000 58.95485  ? 185 GLY A N   1 
ATOM   1473 C CA  . GLY A  1 208 ? -30.83086 52.79403 11.36771  1.000 57.71869  ? 185 GLY A CA  1 
ATOM   1474 C C   . GLY A  1 208 ? -30.27195 53.17958 12.72093  1.000 58.11273  ? 185 GLY A C   1 
ATOM   1475 O O   . GLY A  1 208 ? -29.30346 52.54904 13.16740  1.000 59.40148  ? 185 GLY A O   1 
ATOM   1476 N N   . VAL A  1 209 ? -30.85364 54.17185 13.39800  1.000 55.60476  ? 186 VAL A N   1 
ATOM   1477 C CA  . VAL A  1 209 ? -30.29049 54.74057 14.61963  1.000 52.62151  ? 186 VAL A CA  1 
ATOM   1478 C C   . VAL A  1 209 ? -31.21827 54.42600 15.78472  1.000 50.56559  ? 186 VAL A C   1 
ATOM   1479 O O   . VAL A  1 209 ? -32.41875 54.72903 15.73477  1.000 48.29902  ? 186 VAL A O   1 
ATOM   1480 C CB  . VAL A  1 209 ? -30.06171 56.25826 14.47394  1.000 52.86835  ? 186 VAL A CB  1 
ATOM   1481 C CG1 . VAL A  1 209 ? -29.66512 56.89405 15.81731  1.000 51.64379  ? 186 VAL A CG1 1 
ATOM   1482 C CG2 . VAL A  1 209 ? -28.99863 56.53065 13.40189  1.000 60.09705  ? 186 VAL A CG2 1 
ATOM   1483 N N   . VAL A  1 210 ? -30.66640 53.81047 16.83166  1.000 49.04848  ? 187 VAL A N   1 
ATOM   1484 C CA  . VAL A  1 210 ? -31.45479 53.50964 18.02134  1.000 54.87371  ? 187 VAL A CA  1 
ATOM   1485 C C   . VAL A  1 210 ? -31.85340 54.81360 18.70385  1.000 48.81125  ? 187 VAL A C   1 
ATOM   1486 O O   . VAL A  1 210 ? -31.01664 55.69002 18.92878  1.000 47.95687  ? 187 VAL A O   1 
ATOM   1487 C CB  . VAL A  1 210 ? -30.66242 52.59845 18.96844  1.000 56.52161  ? 187 VAL A CB  1 
ATOM   1488 C CG1 . VAL A  1 210 ? -31.46947 52.35933 20.25715  1.000 57.93945  ? 187 VAL A CG1 1 
ATOM   1489 C CG2 . VAL A  1 210 ? -30.34906 51.27549 18.25940  1.000 55.45641  ? 187 VAL A CG2 1 
ATOM   1490 N N   . GLN A  1 211 ? -33.13084 54.95614 19.01498  1.000 48.36957  ? 188 GLN A N   1 
ATOM   1491 C CA  . GLN A  1 211 ? -33.66208 56.15823 19.65218  1.000 46.90596  ? 188 GLN A CA  1 
ATOM   1492 C C   . GLN A  1 211 ? -33.61511 56.04022 21.16684  1.000 50.13046  ? 188 GLN A C   1 
ATOM   1493 O O   . GLN A  1 211 ? -33.67029 54.93949 21.72206  1.000 53.07870  ? 188 GLN A O   1 
ATOM   1494 C CB  . GLN A  1 211 ? -35.10734 56.38448 19.23119  1.000 50.50710  ? 188 GLN A CB  1 
ATOM   1495 C CG  . GLN A  1 211 ? -35.27717 56.38753 17.74585  1.000 56.18512  ? 188 GLN A CG  1 
ATOM   1496 C CD  . GLN A  1 211 ? -34.56296 57.54151 17.12170  1.000 56.98190  ? 188 GLN A CD  1 
ATOM   1497 O OE1 . GLN A  1 211 ? -33.47369 57.38630 16.56582  1.000 58.38913  ? 188 GLN A OE1 1 
ATOM   1498 N NE2 . GLN A  1 211 ? -35.16958 58.72730 17.21467  1.000 59.82381  ? 188 GLN A NE2 1 
ATOM   1499 N N   . GLN A  1 212 ? -33.51548 57.18573 21.84054  1.000 45.72349  ? 189 GLN A N   1 
ATOM   1500 C CA  . GLN A  1 212 ? -33.83054 57.25561 23.26294  1.000 45.13501  ? 189 GLN A CA  1 
ATOM   1501 C C   . GLN A  1 212 ? -35.30320 57.59382 23.36046  1.000 44.65319  ? 189 GLN A C   1 
ATOM   1502 O O   . GLN A  1 212 ? -35.72139 58.67793 22.95273  1.000 48.58343  ? 189 GLN A O   1 
ATOM   1503 C CB  . GLN A  1 212 ? -33.00302 58.29912 24.00657  1.000 50.02940  ? 189 GLN A CB  1 
ATOM   1504 C CG  . GLN A  1 212 ? -31.56749 57.89913 24.28183  1.000 64.09593  ? 189 GLN A CG  1 
ATOM   1505 C CD  . GLN A  1 212 ? -30.84854 58.92485 25.15963  1.000 76.22599  ? 189 GLN A CD  1 
ATOM   1506 O OE1 . GLN A  1 212 ? -29.65423 59.17498 24.98921  1.000 80.19293  ? 189 GLN A OE1 1 
ATOM   1507 N NE2 . GLN A  1 212 ? -31.58422 59.52196 26.10343  1.000 76.60300  ? 189 GLN A NE2 1 
ATOM   1508 N N   . LEU A  1 213 ? -36.09209 56.66218 23.87451  1.000 36.67197  ? 190 LEU A N   1 
ATOM   1509 C CA  . LEU A  1 213 ? -37.49770 56.93850 24.05786  1.000 36.95641  ? 190 LEU A CA  1 
ATOM   1510 C C   . LEU A  1 213 ? -37.66944 57.88739 25.24237  1.000 36.70195  ? 190 LEU A C   1 
ATOM   1511 O O   . LEU A  1 213 ? -36.92425 57.80399 26.21737  1.000 37.47019  ? 190 LEU A O   1 
ATOM   1512 C CB  . LEU A  1 213 ? -38.26026 55.63021 24.29416  1.000 36.57408  ? 190 LEU A CB  1 
ATOM   1513 C CG  . LEU A  1 213 ? -38.26300 54.73757 23.04997  1.000 42.20048  ? 190 LEU A CG  1 
ATOM   1514 C CD1 . LEU A  1 213 ? -38.72661 53.31094 23.40935  1.000 40.26931  ? 190 LEU A CD1 1 
ATOM   1515 C CD2 . LEU A  1 213 ? -39.20796 55.38447 21.99496  1.000 39.66587  ? 190 LEU A CD2 1 
ATOM   1516 N N   . PRO A  1 214 ? -38.64859 58.78195 25.17802  1.000 35.44090  ? 191 PRO A N   1 
ATOM   1517 C CA  . PRO A  1 214 ? -38.84059 59.76889 26.24843  1.000 38.24781  ? 191 PRO A CA  1 
ATOM   1518 C C   . PRO A  1 214 ? -39.41052 59.15058 27.51927  1.000 43.28117  ? 191 PRO A C   1 
ATOM   1519 O O   . PRO A  1 214 ? -40.14105 58.15024 27.48687  1.000 38.08268  ? 191 PRO A O   1 
ATOM   1520 C CB  . PRO A  1 214 ? -39.85283 60.74357 25.63413  1.000 37.71682  ? 191 PRO A CB  1 
ATOM   1521 C CG  . PRO A  1 214 ? -40.71023 59.82079 24.71630  1.000 36.01398  ? 191 PRO A CG  1 
ATOM   1522 C CD  . PRO A  1 214 ? -39.68592 58.87310 24.13088  1.000 32.52115  ? 191 PRO A CD  1 
ATOM   1523 N N   . GLU A  1 215 ? -39.05964 59.76732 28.65126  1.000 42.36411  ? 192 GLU A N   1 
ATOM   1524 C CA  . GLU A  1 215 ? -39.84060 59.63784 29.87986  1.000 37.05918  ? 192 GLU A CA  1 
ATOM   1525 C C   . GLU A  1 215 ? -41.31104 59.81752 29.56773  1.000 37.38055  ? 192 GLU A C   1 
ATOM   1526 O O   . GLU A  1 215 ? -41.68558 60.77350 28.87942  1.000 33.24457  ? 192 GLU A O   1 
ATOM   1527 C CB  . GLU A  1 215 ? -39.44219 60.72613 30.87842  1.000 44.21075  ? 192 GLU A CB  1 
ATOM   1528 C CG  . GLU A  1 215 ? -38.30402 60.42422 31.73609  1.000 52.40807  ? 192 GLU A CG  1 
ATOM   1529 C CD  . GLU A  1 215 ? -38.14550 61.44161 32.85009  1.000 47.62987  ? 192 GLU A CD  1 
ATOM   1530 O OE1 . GLU A  1 215 ? -39.05342 62.27280 33.11735  1.000 42.56127  ? 192 GLU A OE1 1 
ATOM   1531 O OE2 . GLU A  1 215 ? -37.09157 61.39994 33.46928  1.000 52.55362  ? 192 GLU A OE2 1 
ATOM   1532 N N   . THR A  1 216 ? -42.15551 58.93476 30.10859  1.000 33.93771  ? 193 THR A N   1 
ATOM   1533 C CA  . THR A  1 216 ? -43.56256 59.03466 29.77806  1.000 29.06340  ? 193 THR A CA  1 
ATOM   1534 C C   . THR A  1 216 ? -44.40393 58.54772 30.95598  1.000 32.04957  ? 193 THR A C   1 
ATOM   1535 O O   . THR A  1 216 ? -43.97809 57.68143 31.72471  1.000 31.55537  ? 193 THR A O   1 
ATOM   1536 C CB  . THR A  1 216 ? -43.87901 58.22333 28.50153  1.000 33.94528  ? 193 THR A CB  1 
ATOM   1537 O OG1 . THR A  1 216 ? -45.26147 58.39272 28.13201  1.000 31.10905  ? 193 THR A OG1 1 
ATOM   1538 C CG2 . THR A  1 216 ? -43.58492 56.71567 28.71140  1.000 31.83911  ? 193 THR A CG2 1 
ATOM   1539 N N   . TYR A  1 217 ? -45.58034 59.15000 31.11913  1.000 29.62354  ? 194 TYR A N   1 
ATOM   1540 C CA  . TYR A  1 217 ? -46.63867 58.52696 31.89945  1.000 29.65419  ? 194 TYR A CA  1 
ATOM   1541 C C   . TYR A  1 217 ? -47.31289 57.47146 31.03158  1.000 31.18396  ? 194 TYR A C   1 
ATOM   1542 O O   . TYR A  1 217 ? -47.15625 57.46733 29.81107  1.000 26.09034  ? 194 TYR A O   1 
ATOM   1543 C CB  . TYR A  1 217 ? -47.68729 59.54517 32.35085  1.000 25.52070  ? 194 TYR A CB  1 
ATOM   1544 C CG  . TYR A  1 217 ? -47.17665 60.58589 33.32856  1.000 28.04217  ? 194 TYR A CG  1 
ATOM   1545 C CD1 . TYR A  1 217 ? -47.05679 60.29256 34.69452  1.000 28.02912  ? 194 TYR A CD1 1 
ATOM   1546 C CD2 . TYR A  1 217 ? -46.77379 61.85805 32.88177  1.000 28.05163  ? 194 TYR A CD2 1 
ATOM   1547 C CE1 . TYR A  1 217 ? -46.57199 61.25462 35.59781  1.000 30.82689  ? 194 TYR A CE1 1 
ATOM   1548 C CE2 . TYR A  1 217 ? -46.27050 62.82811 33.78562  1.000 33.04816  ? 194 TYR A CE2 1 
ATOM   1549 C CZ  . TYR A  1 217 ? -46.18182 62.52288 35.12949  1.000 33.77577  ? 194 TYR A CZ  1 
ATOM   1550 O OH  . TYR A  1 217 ? -45.71923 63.49222 36.00958  1.000 34.91212  ? 194 TYR A OH  1 
ATOM   1551 N N   . PHE A  1 218 ? -48.08515 56.59513 31.66573  1.000 26.27495  ? 195 PHE A N   1 
ATOM   1552 C CA  . PHE A  1 218 ? -48.90189 55.61863 30.94703  1.000 29.40198  ? 195 PHE A CA  1 
ATOM   1553 C C   . PHE A  1 218 ? -50.34120 55.69839 31.41578  1.000 30.63703  ? 195 PHE A C   1 
ATOM   1554 O O   . PHE A  1 218 ? -50.59562 55.82589 32.61596  1.000 33.48948  ? 195 PHE A O   1 
ATOM   1555 C CB  . PHE A  1 218 ? -48.37898 54.18165 31.16201  1.000 30.93321  ? 195 PHE A CB  1 
ATOM   1556 C CG  . PHE A  1 218 ? -47.04243 53.93377 30.52867  1.000 31.36722  ? 195 PHE A CG  1 
ATOM   1557 C CD1 . PHE A  1 218 ? -46.90533 53.96183 29.14311  1.000 28.71055  ? 195 PHE A CD1 1 
ATOM   1558 C CD2 . PHE A  1 218 ? -45.92936 53.65899 31.30564  1.000 30.84922  ? 195 PHE A CD2 1 
ATOM   1559 C CE1 . PHE A  1 218 ? -45.66750 53.70615 28.54784  1.000 29.61222  ? 195 PHE A CE1 1 
ATOM   1560 C CE2 . PHE A  1 218 ? -44.69121 53.39558 30.71400  1.000 32.61242  ? 195 PHE A CE2 1 
ATOM   1561 C CZ  . PHE A  1 218 ? -44.56442 53.43533 29.33975  1.000 30.92786  ? 195 PHE A CZ  1 
ATOM   1562 N N   . THR A  1 219 ? -51.28541 55.61256 30.47536  1.000 28.26313  ? 196 THR A N   1 
ATOM   1563 C CA  . THR A  1 219 ? -52.66888 55.43025 30.88087  1.000 24.80566  ? 196 THR A CA  1 
ATOM   1564 C C   . THR A  1 219 ? -52.86234 54.01724 31.40692  1.000 29.05366  ? 196 THR A C   1 
ATOM   1565 O O   . THR A  1 219 ? -52.07124 53.10277 31.12798  1.000 29.59325  ? 196 THR A O   1 
ATOM   1566 C CB  . THR A  1 219 ? -53.63274 55.70259 29.72053  1.000 28.66535  ? 196 THR A CB  1 
ATOM   1567 O OG1 . THR A  1 219 ? -53.23901 54.91353 28.58494  1.000 24.90101  ? 196 THR A OG1 1 
ATOM   1568 C CG2 . THR A  1 219 ? -53.59145 57.19390 29.35041  1.000 26.81054  ? 196 THR A CG2 1 
ATOM   1569 N N   . GLN A  1 220 ? -53.95897 53.83843 32.14640  1.000 27.88663  ? 197 GLN A N   1 
ATOM   1570 C CA  . GLN A  1 220 ? -54.17907 52.64046 32.93160  1.000 28.21873  ? 197 GLN A CA  1 
ATOM   1571 C C   . GLN A  1 220 ? -55.14157 51.66454 32.27209  1.000 28.95319  ? 197 GLN A C   1 
ATOM   1572 O O   . GLN A  1 220 ? -55.27287 50.53777 32.76066  1.000 30.54300  ? 197 GLN A O   1 
ATOM   1573 C CB  . GLN A  1 220 ? -54.67995 53.02828 34.33500  1.000 29.37203  ? 197 GLN A CB  1 
ATOM   1574 C CG  . GLN A  1 220 ? -53.64749 53.89948 35.13617  1.000 28.92176  ? 197 GLN A CG  1 
ATOM   1575 C CD  . GLN A  1 220 ? -52.46369 53.08201 35.61959  1.000 38.65740  ? 197 GLN A CD  1 
ATOM   1576 O OE1 . GLN A  1 220 ? -52.62475 51.94643 36.04255  1.000 39.59582  ? 197 GLN A OE1 1 
ATOM   1577 N NE2 . GLN A  1 220 ? -51.26583 53.65590 35.55133  1.000 36.97209  ? 197 GLN A NE2 1 
ATOM   1578 N N   . SER A  1 221 ? -55.81734 52.06985 31.19517  1.000 26.28646  ? 198 SER A N   1 
ATOM   1579 C CA  . SER A  1 221 ? -56.63436 51.15040 30.38065  1.000 29.87113  ? 198 SER A CA  1 
ATOM   1580 C C   . SER A  1 221 ? -57.73519 50.46175 31.18745  1.000 32.39060  ? 198 SER A C   1 
ATOM   1581 O O   . SER A  1 221 ? -58.08350 49.30831 30.92876  1.000 30.21395  ? 198 SER A O   1 
ATOM   1582 C CB  . SER A  1 221 ? -55.75031 50.10421 29.69169  1.000 28.18091  ? 198 SER A CB  1 
ATOM   1583 O OG  . SER A  1 221 ? -54.78058 50.73591 28.86430  1.000 30.73246  ? 198 SER A OG  1 
ATOM   1584 N N   . ARG A  1 222 ? -58.32538 51.16277 32.14630  1.000 31.11844  ? 199 ARG A N   1 
ATOM   1585 C CA  . ARG A  1 222 ? -59.41066 50.55122 32.90019  1.000 33.30234  ? 199 ARG A CA  1 
ATOM   1586 C C   . ARG A  1 222 ? -60.74906 50.86566 32.22975  1.000 35.78108  ? 199 ARG A C   1 
ATOM   1587 O O   . ARG A  1 222 ? -60.83075 51.66862 31.29823  1.000 32.59763  ? 199 ARG A O   1 
ATOM   1588 C CB  . ARG A  1 222 ? -59.38511 51.03746 34.34972  1.000 33.80948  ? 199 ARG A CB  1 
ATOM   1589 C CG  . ARG A  1 222 ? -58.16918 50.54144 35.10882  1.000 36.56136  ? 199 ARG A CG  1 
ATOM   1590 C CD  . ARG A  1 222 ? -57.97520 51.24131 36.44922  1.000 34.49785  ? 199 ARG A CD  1 
ATOM   1591 N NE  . ARG A  1 222 ? -57.53009 52.63660 36.31548  1.000 32.66780  ? 199 ARG A NE  1 
ATOM   1592 C CZ  . ARG A  1 222 ? -57.02255 53.33276 37.33468  1.000 35.55885  ? 199 ARG A CZ  1 
ATOM   1593 N NH1 . ARG A  1 222 ? -56.90277 52.73190 38.52546  1.000 34.95639  ? 199 ARG A NH1 1 
ATOM   1594 N NH2 . ARG A  1 222 ? -56.62784 54.60575 37.18027  1.000 31.05636  ? 199 ARG A NH2 1 
ATOM   1595 N N   . ASN A  1 223 ? -61.80746 50.20713 32.68643  1.000 36.83876  ? 200 ASN A N   1 
ATOM   1596 C CA  . ASN A  1 223 ? -63.13328 50.53875 32.18167  1.000 40.25203  ? 200 ASN A CA  1 
ATOM   1597 C C   . ASN A  1 223 ? -64.06532 50.89095 33.33909  1.000 42.42416  ? 200 ASN A C   1 
ATOM   1598 O O   . ASN A  1 223 ? -63.79225 50.57686 34.50242  1.000 43.14813  ? 200 ASN A O   1 
ATOM   1599 C CB  . ASN A  1 223 ? -63.70580 49.40924 31.31511  1.000 45.20345  ? 200 ASN A CB  1 
ATOM   1600 C CG  . ASN A  1 223 ? -63.84414 48.11993 32.06368  1.000 52.16772  ? 200 ASN A CG  1 
ATOM   1601 O OD1 . ASN A  1 223 ? -64.78233 47.95087 32.84001  1.000 55.93047  ? 200 ASN A OD1 1 
ATOM   1602 N ND2 . ASN A  1 223 ? -62.91835 47.18827 31.83187  1.000 57.41642  ? 200 ASN A ND2 1 
ATOM   1603 N N   . LEU A  1 224 ? -65.15025 51.59905 33.00708  1.000 48.61422  ? 201 LEU A N   1 
ATOM   1604 C CA  . LEU A  1 224 ? -66.08690 52.07956 34.02485  1.000 54.56891  ? 201 LEU A CA  1 
ATOM   1605 C C   . LEU A  1 224 ? -66.59232 50.95160 34.91291  1.000 58.73732  ? 201 LEU A C   1 
ATOM   1606 O O   . LEU A  1 224 ? -66.51800 51.03294 36.14458  1.000 69.82409  ? 201 LEU A O   1 
ATOM   1607 C CB  . LEU A  1 224 ? -67.27698 52.77069 33.36373  1.000 56.29475  ? 201 LEU A CB  1 
ATOM   1608 C CG  . LEU A  1 224 ? -67.16573 54.24319 33.03577  1.000 53.85116  ? 201 LEU A CG  1 
ATOM   1609 C CD1 . LEU A  1 224 ? -68.54560 54.75084 32.73113  1.000 56.26417  ? 201 LEU A CD1 1 
ATOM   1610 C CD2 . LEU A  1 224 ? -66.58207 54.94412 34.22231  1.000 51.60758  ? 201 LEU A CD2 1 
ATOM   1611 N N   . GLN A  1 225 ? -67.09810 49.88365 34.29627  1.000 53.69208  ? 202 GLN A N   1 
ATOM   1612 C CA  . GLN A  1 225 ? -67.88518 48.89390 35.02069  1.000 70.93382  ? 202 GLN A CA  1 
ATOM   1613 C C   . GLN A  1 225 ? -67.07481 48.22900 36.12433  1.000 74.31489  ? 202 GLN A C   1 
ATOM   1614 O O   . GLN A  1 225 ? -67.57321 48.02448 37.23711  1.000 78.19561  ? 202 GLN A O   1 
ATOM   1615 C CB  . GLN A  1 225 ? -68.41192 47.84110 34.04930  1.000 84.50392  ? 202 GLN A CB  1 
ATOM   1616 C CG  . GLN A  1 225 ? -69.27928 48.39051 32.93484  1.000 97.15412  ? 202 GLN A CG  1 
ATOM   1617 C CD  . GLN A  1 225 ? -69.70105 47.30393 31.95997  1.000 108.32948 ? 202 GLN A CD  1 
ATOM   1618 O OE1 . GLN A  1 225 ? -68.93624 46.37471 31.67874  1.000 111.48480 ? 202 GLN A OE1 1 
ATOM   1619 N NE2 . GLN A  1 225 ? -70.92619 47.40696 31.44759  1.000 111.78853 ? 202 GLN A NE2 1 
ATOM   1620 N N   . GLU A  1 226 ? -65.82775 47.86322 35.83321  1.000 64.32391  ? 203 GLU A N   1 
ATOM   1621 C CA  . GLU A  1 226 ? -65.05034 47.14245 36.82937  1.000 63.79258  ? 203 GLU A CA  1 
ATOM   1622 C C   . GLU A  1 226 ? -63.78173 47.90857 37.18496  1.000 47.69405  ? 203 GLU A C   1 
ATOM   1623 O O   . GLU A  1 226 ? -62.70245 47.32143 37.30614  1.000 44.18419  ? 203 GLU A O   1 
ATOM   1624 C CB  . GLU A  1 226 ? -64.73251 45.73338 36.32853  1.000 75.87870  ? 203 GLU A CB  1 
ATOM   1625 C CG  . GLU A  1 226 ? -64.13501 45.69171 34.93454  1.000 81.36674  ? 203 GLU A CG  1 
ATOM   1626 C CD  . GLU A  1 226 ? -64.47652 44.41159 34.20189  1.000 85.83018  ? 203 GLU A CD  1 
ATOM   1627 O OE1 . GLU A  1 226 ? -65.30318 43.63372 34.72553  1.000 91.02089  ? 203 GLU A OE1 1 
ATOM   1628 O OE2 . GLU A  1 226 ? -63.91423 44.18374 33.10781  1.000 87.29128  ? 203 GLU A OE2 1 
ATOM   1629 N N   . PHE A  1 227 ? -63.92436 49.21341 37.39133  1.000 43.63469  ? 204 PHE A N   1 
ATOM   1630 C CA  . PHE A  1 227 ? -62.79878 50.04816 37.78126  1.000 40.01772  ? 204 PHE A CA  1 
ATOM   1631 C C   . PHE A  1 227 ? -62.25027 49.60864 39.13343  1.000 40.88389  ? 204 PHE A C   1 
ATOM   1632 O O   . PHE A  1 227 ? -63.00185 49.44240 40.09379  1.000 48.76202  ? 204 PHE A O   1 
ATOM   1633 C CB  . PHE A  1 227 ? -63.23866 51.50950 37.84735  1.000 36.37532  ? 204 PHE A CB  1 
ATOM   1634 C CG  . PHE A  1 227 ? -62.10210 52.46435 38.02383  1.000 36.51633  ? 204 PHE A CG  1 
ATOM   1635 C CD1 . PHE A  1 227 ? -61.54791 52.68354 39.27945  1.000 35.46976  ? 204 PHE A CD1 1 
ATOM   1636 C CD2 . PHE A  1 227 ? -61.58571 53.14081 36.93839  1.000 35.50456  ? 204 PHE A CD2 1 
ATOM   1637 C CE1 . PHE A  1 227 ? -60.50218 53.55816 39.45231  1.000 40.60156  ? 204 PHE A CE1 1 
ATOM   1638 C CE2 . PHE A  1 227 ? -60.52204 54.02705 37.10327  1.000 33.65953  ? 204 PHE A CE2 1 
ATOM   1639 C CZ  . PHE A  1 227 ? -59.98143 54.22656 38.36091  1.000 38.41804  ? 204 PHE A CZ  1 
ATOM   1640 N N   . LYS A  1 228 ? -60.93696 49.43899 39.21500  1.000 35.26580  ? 205 LYS A N   1 
ATOM   1641 C CA  . LYS A  1 228 ? -60.30919 49.08685 40.48305  1.000 46.41282  ? 205 LYS A CA  1 
ATOM   1642 C C   . LYS A  1 228 ? -59.22215 50.10066 40.80860  1.000 45.15778  ? 205 LYS A C   1 
ATOM   1643 O O   . LYS A  1 228 ? -58.41959 50.43978 39.92801  1.000 38.73864  ? 205 LYS A O   1 
ATOM   1644 C CB  . LYS A  1 228 ? -59.70427 47.66939 40.44608  1.000 48.23292  ? 205 LYS A CB  1 
ATOM   1645 C CG  . LYS A  1 228 ? -60.73653 46.53654 40.64061  1.000 51.50410  ? 205 LYS A CG  1 
ATOM   1646 C CD  . LYS A  1 228 ? -60.05715 45.18021 40.53103  1.000 58.75534  ? 205 LYS A CD  1 
ATOM   1647 C CE  . LYS A  1 228 ? -60.90455 44.06807 41.13964  1.000 69.83276  ? 205 LYS A CE  1 
ATOM   1648 N NZ  . LYS A  1 228 ? -62.37159 44.35880 41.03549  1.000 71.20138  ? 205 LYS A NZ  1 
ATOM   1649 N N   . PRO A  1 229 ? -59.17222 50.61120 42.03912  1.000 47.05203  ? 206 PRO A N   1 
ATOM   1650 C CA  . PRO A  1 229 ? -58.12852 51.58083 42.40111  1.000 39.67004  ? 206 PRO A CA  1 
ATOM   1651 C C   . PRO A  1 229 ? -56.74910 50.93817 42.43559  1.000 42.36095  ? 206 PRO A C   1 
ATOM   1652 O O   . PRO A  1 229 ? -56.59174 49.76981 42.79857  1.000 45.58785  ? 206 PRO A O   1 
ATOM   1653 C CB  . PRO A  1 229 ? -58.56154 52.05591 43.79177  1.000 37.12802  ? 206 PRO A CB  1 
ATOM   1654 C CG  . PRO A  1 229 ? -59.31339 50.86811 44.36317  1.000 41.88399  ? 206 PRO A CG  1 
ATOM   1655 C CD  . PRO A  1 229 ? -60.06709 50.30051 43.17233  1.000 45.55182  ? 206 PRO A CD  1 
ATOM   1656 N N   . ARG A  1 230 ? -55.72956 51.71328 42.04983  1.000 38.27028  ? 207 ARG A N   1 
ATOM   1657 C CA  . ARG A  1 230 ? -54.37690 51.16930 42.00031  1.000 41.08066  ? 207 ARG A CA  1 
ATOM   1658 C C   . ARG A  1 230 ? -53.40368 51.91660 42.91071  1.000 42.35797  ? 207 ARG A C   1 
ATOM   1659 O O   . ARG A  1 230 ? -52.18550 51.77482 42.76093  1.000 39.77589  ? 207 ARG A O   1 
ATOM   1660 C CB  . ARG A  1 230 ? -53.87730 51.14486 40.55470  1.000 39.07415  ? 207 ARG A CB  1 
ATOM   1661 C CG  . ARG A  1 230 ? -54.59839 50.07023 39.72183  1.000 45.55509  ? 207 ARG A CG  1 
ATOM   1662 C CD  . ARG A  1 230 ? -54.11497 49.96963 38.27334  1.000 41.35461  ? 207 ARG A CD  1 
ATOM   1663 N NE  . ARG A  1 230 ? -54.87412 48.93209 37.55944  1.000 44.16258  ? 207 ARG A NE  1 
ATOM   1664 C CZ  . ARG A  1 230 ? -54.87368 48.78025 36.23726  1.000 44.71952  ? 207 ARG A CZ  1 
ATOM   1665 N NH1 . ARG A  1 230 ? -54.14537 49.60231 35.47451  1.000 38.91401  ? 207 ARG A NH1 1 
ATOM   1666 N NH2 . ARG A  1 230 ? -55.58571 47.80233 35.67669  1.000 37.81299  ? 207 ARG A NH2 1 
ATOM   1667 N N   . SER A  1 231 ? -53.91067 52.69556 43.86162  1.000 39.18418  ? 208 SER A N   1 
ATOM   1668 C CA  . SER A  1 231 ? -53.05857 53.39004 44.82006  1.000 41.62249  ? 208 SER A CA  1 
ATOM   1669 C C   . SER A  1 231 ? -53.93507 53.77672 45.99938  1.000 40.91681  ? 208 SER A C   1 
ATOM   1670 O O   . SER A  1 231 ? -55.16094 53.73501 45.91134  1.000 38.92585  ? 208 SER A O   1 
ATOM   1671 C CB  . SER A  1 231 ? -52.41259 54.63327 44.20889  1.000 38.54661  ? 208 SER A CB  1 
ATOM   1672 O OG  . SER A  1 231 ? -53.37906 55.67139 44.16820  1.000 37.77006  ? 208 SER A OG  1 
ATOM   1673 N N   . GLN A  1 232 ? -53.29657 54.15341 47.11074  1.000 40.38113  ? 209 GLN A N   1 
ATOM   1674 C CA  . GLN A  1 232 ? -54.07907 54.55589 48.27502  1.000 40.92266  ? 209 GLN A CA  1 
ATOM   1675 C C   . GLN A  1 232 ? -54.84592 55.84552 48.00321  1.000 46.02234  ? 209 GLN A C   1 
ATOM   1676 O O   . GLN A  1 232 ? -55.97359 56.01763 48.48760  1.000 46.57224  ? 209 GLN A O   1 
ATOM   1677 C CB  . GLN A  1 232 ? -53.17521 54.70634 49.50622  1.000 41.59899  ? 209 GLN A CB  1 
ATOM   1678 C CG  . GLN A  1 232 ? -53.94212 55.04327 50.78416  1.000 45.29394  ? 209 GLN A CG  1 
ATOM   1679 C CD  . GLN A  1 232 ? -54.88079 53.91498 51.21699  1.000 52.48964  ? 209 GLN A CD  1 
ATOM   1680 O OE1 . GLN A  1 232 ? -54.47314 52.76095 51.31196  1.000 55.99746  ? 209 GLN A OE1 1 
ATOM   1681 N NE2 . GLN A  1 232 ? -56.14222 54.24855 51.47083  1.000 49.72117  ? 209 GLN A NE2 1 
ATOM   1682 N N   . MET A  1 233 ? -54.27400 56.75402 47.21205  1.000 42.21493  ? 210 MET A N   1 
ATOM   1683 C CA  . MET A  1 233 ? -55.01158 57.96187 46.86888  1.000 41.69651  ? 210 MET A CA  1 
ATOM   1684 C C   . MET A  1 233 ? -56.29734 57.62688 46.11181  1.000 40.11192  ? 210 MET A C   1 
ATOM   1685 O O   . MET A  1 233 ? -57.36337 58.20056 46.40024  1.000 38.29947  ? 210 MET A O   1 
ATOM   1686 C CB  . MET A  1 233 ? -54.12005 58.91628 46.06358  1.000 37.03286  ? 210 MET A CB  1 
ATOM   1687 C CG  . MET A  1 233 ? -54.85284 60.17476 45.62310  1.000 36.88074  ? 210 MET A CG  1 
ATOM   1688 S SD  . MET A  1 233 ? -53.88480 61.22622 44.51488  1.000 40.52244  ? 210 MET A SD  1 
ATOM   1689 C CE  . MET A  1 233 ? -52.45239 61.66480 45.50844  1.000 40.06596  ? 210 MET A CE  1 
ATOM   1690 N N   . GLU A  1 234 ? -56.23256 56.66911 45.16886  1.000 38.04239  ? 211 GLU A N   1 
ATOM   1691 C CA  . GLU A  1 234 ? -57.43659 56.27817 44.42857  1.000 37.08112  ? 211 GLU A CA  1 
ATOM   1692 C C   . GLU A  1 234 ? -58.44826 55.58342 45.32978  1.000 40.57363  ? 211 GLU A C   1 
ATOM   1693 O O   . GLU A  1 234 ? -59.66556 55.75366 45.15415  1.000 41.62182  ? 211 GLU A O   1 
ATOM   1694 C CB  . GLU A  1 234 ? -57.07606 55.37606 43.24620  1.000 33.99303  ? 211 GLU A CB  1 
ATOM   1695 C CG  . GLU A  1 234 ? -56.30547 56.10987 42.14134  1.000 36.62013  ? 211 GLU A CG  1 
ATOM   1696 C CD  . GLU A  1 234 ? -56.28329 55.34191 40.84153  1.000 42.43462  ? 211 GLU A CD  1 
ATOM   1697 O OE1 . GLU A  1 234 ? -56.39562 54.08360 40.88915  1.000 40.05606  ? 211 GLU A OE1 1 
ATOM   1698 O OE2 . GLU A  1 234 ? -56.16353 56.00171 39.77295  1.000 37.61754  ? 211 GLU A OE2 1 
ATOM   1699 N N   . ILE A  1 235 ? -57.97398 54.76098 46.26885  1.000 41.29724  ? 212 ILE A N   1 
ATOM   1700 C CA  . ILE A  1 235 ? -58.88780 54.17394 47.24502  1.000 43.40852  ? 212 ILE A CA  1 
ATOM   1701 C C   . ILE A  1 235 ? -59.61517 55.28628 47.98580  1.000 46.72461  ? 212 ILE A C   1 
ATOM   1702 O O   . ILE A  1 235 ? -60.84719 55.31090 48.04764  1.000 49.28450  ? 212 ILE A O   1 
ATOM   1703 C CB  . ILE A  1 235 ? -58.12738 53.25297 48.21620  1.000 47.01660  ? 212 ILE A CB  1 
ATOM   1704 C CG1 . ILE A  1 235 ? -57.50959 52.06148 47.48080  1.000 41.73669  ? 212 ILE A CG1 1 
ATOM   1705 C CG2 . ILE A  1 235 ? -59.03920 52.78700 49.37171  1.000 48.42314  ? 212 ILE A CG2 1 
ATOM   1706 C CD1 . ILE A  1 235 ? -56.76828 51.10378 48.44656  1.000 44.16688  ? 212 ILE A CD1 1 
ATOM   1707 N N   . ASP A  1 236 ? -58.85396 56.25473 48.50805  1.000 44.72767  ? 213 ASP A N   1 
ATOM   1708 C CA  . ASP A  1 236 ? -59.43987 57.38173 49.23032  1.000 44.17400  ? 213 ASP A CA  1 
ATOM   1709 C C   . ASP A  1 236 ? -60.41803 58.16271 48.35925  1.000 41.69477  ? 213 ASP A C   1 
ATOM   1710 O O   . ASP A  1 236 ? -61.48101 58.58272 48.83294  1.000 46.26369  ? 213 ASP A O   1 
ATOM   1711 C CB  . ASP A  1 236 ? -58.33373 58.31151 49.73793  1.000 42.23270  ? 213 ASP A CB  1 
ATOM   1712 C CG  . ASP A  1 236 ? -57.47309 57.67608 50.81278  1.000 49.43678  ? 213 ASP A CG  1 
ATOM   1713 O OD1 . ASP A  1 236 ? -57.85440 56.61220 51.32621  1.000 52.03184  ? 213 ASP A OD1 1 
ATOM   1714 O OD2 . ASP A  1 236 ? -56.39886 58.23923 51.13952  1.000 54.49781  ? 213 ASP A OD2 1 
ATOM   1715 N N   . PHE A  1 237 ? -60.07288 58.37435 47.08595  1.000 37.57660  ? 214 PHE A N   1 
ATOM   1716 C CA  . PHE A  1 237 ? -60.95855 59.11868 46.18890  1.000 41.75137  ? 214 PHE A CA  1 
ATOM   1717 C C   . PHE A  1 237 ? -62.30724 58.42659 46.03029  1.000 39.51982  ? 214 PHE A C   1 
ATOM   1718 O O   . PHE A  1 237 ? -63.35702 59.08243 45.96524  1.000 39.74479  ? 214 PHE A O   1 
ATOM   1719 C CB  . PHE A  1 237 ? -60.31322 59.28603 44.81301  1.000 36.04704  ? 214 PHE A CB  1 
ATOM   1720 C CG  . PHE A  1 237 ? -61.20585 60.00137 43.82225  1.000 35.97035  ? 214 PHE A CG  1 
ATOM   1721 C CD1 . PHE A  1 237 ? -61.22678 61.39293 43.77474  1.000 33.69438  ? 214 PHE A CD1 1 
ATOM   1722 C CD2 . PHE A  1 237 ? -62.04944 59.28279 42.96767  1.000 35.12466  ? 214 PHE A CD2 1 
ATOM   1723 C CE1 . PHE A  1 237 ? -62.04733 62.07086 42.86965  1.000 33.53899  ? 214 PHE A CE1 1 
ATOM   1724 C CE2 . PHE A  1 237 ? -62.87131 59.94983 42.05585  1.000 32.82177  ? 214 PHE A CE2 1 
ATOM   1725 C CZ  . PHE A  1 237 ? -62.88187 61.34198 42.01248  1.000 34.89966  ? 214 PHE A CZ  1 
ATOM   1726 N N   . LEU A  1 238 ? -62.29717 57.10500 45.94212  1.000 40.02087  ? 215 LEU A N   1 
ATOM   1727 C CA  . LEU A  1 238 ? -63.54277 56.37490 45.77499  1.000 43.07762  ? 215 LEU A CA  1 
ATOM   1728 C C   . LEU A  1 238 ? -64.34982 56.33767 47.06337  1.000 43.92557  ? 215 LEU A C   1 
ATOM   1729 O O   . LEU A  1 238 ? -65.57956 56.38664 47.00979  1.000 46.46537  ? 215 LEU A O   1 
ATOM   1730 C CB  . LEU A  1 238 ? -63.24703 54.96082 45.27406  1.000 42.53252  ? 215 LEU A CB  1 
ATOM   1731 C CG  . LEU A  1 238 ? -62.71735 54.89558 43.83060  1.000 43.56546  ? 215 LEU A CG  1 
ATOM   1732 C CD1 . LEU A  1 238 ? -62.40955 53.44614 43.46375  1.000 39.76079  ? 215 LEU A CD1 1 
ATOM   1733 C CD2 . LEU A  1 238 ? -63.68937 55.52172 42.84836  1.000 39.25190  ? 215 LEU A CD2 1 
ATOM   1734 N N   . GLU A  1 239 ? -63.68847 56.28698 48.21999  1.000 47.09600  ? 216 GLU A N   1 
ATOM   1735 C CA  . GLU A  1 239 ? -64.38622 56.08628 49.48529  1.000 53.80065  ? 216 GLU A CA  1 
ATOM   1736 C C   . GLU A  1 239 ? -64.76817 57.38197 50.18853  1.000 54.62662  ? 216 GLU A C   1 
ATOM   1737 O O   . GLU A  1 239 ? -65.75791 57.39907 50.92843  1.000 58.85739  ? 216 GLU A O   1 
ATOM   1738 C CB  . GLU A  1 239 ? -63.53088 55.24327 50.43823  1.000 61.65663  ? 216 GLU A CB  1 
ATOM   1739 C CG  . GLU A  1 239 ? -63.16838 53.85988 49.88608  1.000 77.95846  ? 216 GLU A CG  1 
ATOM   1740 C CD  . GLU A  1 239 ? -62.36776 52.99765 50.87642  1.000 90.73734  ? 216 GLU A CD  1 
ATOM   1741 O OE1 . GLU A  1 239 ? -61.87020 53.53696 51.89552  1.000 94.09751  ? 216 GLU A OE1 1 
ATOM   1742 O OE2 . GLU A  1 239 ? -62.23389 51.77522 50.63011  1.000 91.79472  ? 216 GLU A OE2 1 
ATOM   1743 N N   . LEU A  1 240 ? -64.00959 58.45740 50.00826  1.000 47.17353  ? 217 LEU A N   1 
ATOM   1744 C CA  . LEU A  1 240 ? -64.26270 59.68366 50.75489  1.000 52.08062  ? 217 LEU A CA  1 
ATOM   1745 C C   . LEU A  1 240 ? -65.24364 60.58143 50.00714  1.000 53.82862  ? 217 LEU A C   1 
ATOM   1746 O O   . LEU A  1 240 ? -65.43496 60.46144 48.79352  1.000 47.33055  ? 217 LEU A O   1 
ATOM   1747 C CB  . LEU A  1 240 ? -62.96081 60.45189 51.01402  1.000 43.77041  ? 217 LEU A CB  1 
ATOM   1748 C CG  . LEU A  1 240 ? -61.86345 59.84704 51.89634  1.000 45.40172  ? 217 LEU A CG  1 
ATOM   1749 C CD1 . LEU A  1 240 ? -60.68775 60.81894 51.97739  1.000 42.99129  ? 217 LEU A CD1 1 
ATOM   1750 C CD2 . LEU A  1 240 ? -62.35727 59.54664 53.29163  1.000 49.81968  ? 217 LEU A CD2 1 
ATOM   1751 N N   . ALA A  1 241 ? -65.87139 61.48778 50.75578  1.000 50.52743  ? 218 ALA A N   1 
ATOM   1752 C CA  . ALA A  1 241 ? -66.63485 62.55824 50.13311  1.000 50.25025  ? 218 ALA A CA  1 
ATOM   1753 C C   . ALA A  1 241 ? -65.68245 63.58600 49.52891  1.000 54.96622  ? 218 ALA A C   1 
ATOM   1754 O O   . ALA A  1 241 ? -64.54065 63.73977 49.97445  1.000 51.99186  ? 218 ALA A O   1 
ATOM   1755 C CB  . ALA A  1 241 ? -67.56164 63.22439 51.14756  1.000 53.56071  ? 218 ALA A CB  1 
ATOM   1756 N N   . MET A  1 242 ? -66.16806 64.29336 48.50283  1.000 53.69309  ? 219 MET A N   1 
ATOM   1757 C CA  . MET A  1 242 ? -65.32076 65.21096 47.73834  1.000 50.03403  ? 219 MET A CA  1 
ATOM   1758 C C   . MET A  1 242 ? -64.53405 66.16013 48.64546  1.000 52.12531  ? 219 MET A C   1 
ATOM   1759 O O   . MET A  1 242 ? -63.29809 66.25044 48.56096  1.000 49.16925  ? 219 MET A O   1 
ATOM   1760 C CB  . MET A  1 242 ? -66.18775 65.99962 46.75522  1.000 49.69526  ? 219 MET A CB  1 
ATOM   1761 C CG  . MET A  1 242 ? -65.46182 67.14430 46.00724  1.000 48.89664  ? 219 MET A CG  1 
ATOM   1762 S SD  . MET A  1 242 ? -66.52136 67.89046 44.73425  1.000 46.34351  ? 219 MET A SD  1 
ATOM   1763 C CE  . MET A  1 242 ? -67.60632 68.91334 45.77309  1.000 43.91499  ? 219 MET A CE  1 
ATOM   1764 N N   . ASP A  1 243 ? -65.23232 66.86509 49.53772  1.000 48.84822  ? 220 ASP A N   1 
ATOM   1765 C CA  . ASP A  1 243 ? -64.55690 67.85258 50.37283  1.000 53.98044  ? 220 ASP A CA  1 
ATOM   1766 C C   . ASP A  1 243 ? -63.52105 67.21043 51.28463  1.000 55.36388  ? 220 ASP A C   1 
ATOM   1767 O O   . ASP A  1 243 ? -62.46221 67.79864 51.54002  1.000 58.61413  ? 220 ASP A O   1 
ATOM   1768 C CB  . ASP A  1 243 ? -65.58009 68.63283 51.18860  1.000 67.51687  ? 220 ASP A CB  1 
ATOM   1769 C CG  . ASP A  1 243 ? -66.44426 69.52206 50.32225  1.000 76.80420  ? 220 ASP A CG  1 
ATOM   1770 O OD1 . ASP A  1 243 ? -66.00181 69.86947 49.19808  1.000 74.80089  ? 220 ASP A OD1 1 
ATOM   1771 O OD2 . ASP A  1 243 ? -67.56055 69.87120 50.76592  1.000 82.56691  ? 220 ASP A OD2 1 
ATOM   1772 N N   . GLU A  1 244 ? -63.80046 66.00535 51.78755  1.000 58.90485  ? 221 GLU A N   1 
ATOM   1773 C CA  . GLU A  1 244 ? -62.83191 65.32944 52.65000  1.000 60.63039  ? 221 GLU A CA  1 
ATOM   1774 C C   . GLU A  1 244 ? -61.58812 64.93696 51.86449  1.000 49.33722  ? 221 GLU A C   1 
ATOM   1775 O O   . GLU A  1 244 ? -60.46183 65.10723 52.34396  1.000 49.02504  ? 221 GLU A O   1 
ATOM   1776 C CB  . GLU A  1 244 ? -63.45549 64.09062 53.29547  1.000 72.23146  ? 221 GLU A CB  1 
ATOM   1777 C CG  . GLU A  1 244 ? -64.76664 64.32559 54.01633  1.000 84.74990  ? 221 GLU A CG  1 
ATOM   1778 C CD  . GLU A  1 244 ? -65.32904 63.05012 54.63494  1.000 96.46373  ? 221 GLU A CD  1 
ATOM   1779 O OE1 . GLU A  1 244 ? -65.67688 63.07495 55.84211  1.000 101.17449 ? 221 GLU A OE1 1 
ATOM   1780 O OE2 . GLU A  1 244 ? -65.42347 62.02587 53.91212  1.000 95.44440  ? 221 GLU A OE2 1 
ATOM   1781 N N   . PHE A  1 245 ? -61.77517 64.38958 50.65731  1.000 43.35053  ? 222 PHE A N   1 
ATOM   1782 C CA  . PHE A  1 245 ? -60.62665 64.00625 49.83825  1.000 44.23047  ? 222 PHE A CA  1 
ATOM   1783 C C   . PHE A  1 245 ? -59.76338 65.21511 49.50712  1.000 46.48668  ? 222 PHE A C   1 
ATOM   1784 O O   . PHE A  1 245 ? -58.53371 65.17352 49.63749  1.000 44.63732  ? 222 PHE A O   1 
ATOM   1785 C CB  . PHE A  1 245 ? -61.08921 63.32791 48.54609  1.000 39.28446  ? 222 PHE A CB  1 
ATOM   1786 C CG  . PHE A  1 245 ? -59.95468 62.94431 47.64569  1.000 41.45206  ? 222 PHE A CG  1 
ATOM   1787 C CD1 . PHE A  1 245 ? -59.31486 61.72456 47.81039  1.000 39.33717  ? 222 PHE A CD1 1 
ATOM   1788 C CD2 . PHE A  1 245 ? -59.49381 63.82368 46.66715  1.000 37.20603  ? 222 PHE A CD2 1 
ATOM   1789 C CE1 . PHE A  1 245 ? -58.25297 61.36744 46.99464  1.000 38.63769  ? 222 PHE A CE1 1 
ATOM   1790 C CE2 . PHE A  1 245 ? -58.42918 63.48912 45.85816  1.000 36.95892  ? 222 PHE A CE2 1 
ATOM   1791 C CZ  . PHE A  1 245 ? -57.80930 62.25023 46.02084  1.000 42.87198  ? 222 PHE A CZ  1 
ATOM   1792 N N   . ILE A  1 246 ? -60.39513 66.28935 49.03214  1.000 46.45648  ? 223 ILE A N   1 
ATOM   1793 C CA  . ILE A  1 246 ? -59.65278 67.46880 48.60524  1.000 44.75305  ? 223 ILE A CA  1 
ATOM   1794 C C   . ILE A  1 246 ? -58.86435 68.05449 49.77079  1.000 48.65186  ? 223 ILE A C   1 
ATOM   1795 O O   . ILE A  1 246 ? -57.69655 68.43486 49.61884  1.000 45.95148  ? 223 ILE A O   1 
ATOM   1796 C CB  . ILE A  1 246 ? -60.61601 68.49150 47.97454  1.000 39.37978  ? 223 ILE A CB  1 
ATOM   1797 C CG1 . ILE A  1 246 ? -61.03411 67.98739 46.59278  1.000 38.27068  ? 223 ILE A CG1 1 
ATOM   1798 C CG2 . ILE A  1 246 ? -59.96427 69.87077 47.89255  1.000 38.99725  ? 223 ILE A CG2 1 
ATOM   1799 C CD1 . ILE A  1 246 ? -62.17327 68.75960 45.95609  1.000 42.65828  ? 223 ILE A CD1 1 
ATOM   1800 N N   . GLU A  1 247 ? -59.46793 68.08978 50.96040  1.000 51.26224  ? 224 GLU A N   1 
ATOM   1801 C CA  . GLU A  1 247 ? -58.74509 68.56414 52.13763  1.000 50.68670  ? 224 GLU A CA  1 
ATOM   1802 C C   . GLU A  1 247 ? -57.56494 67.65666 52.46700  1.000 57.53518  ? 224 GLU A C   1 
ATOM   1803 O O   . GLU A  1 247 ? -56.45148 68.13647 52.70199  1.000 56.78621  ? 224 GLU A O   1 
ATOM   1804 C CB  . GLU A  1 247 ? -59.67385 68.66233 53.35115  1.000 52.28868  ? 224 GLU A CB  1 
ATOM   1805 C CG  . GLU A  1 247 ? -58.89107 69.01301 54.61647  1.000 64.39422  ? 224 GLU A CG  1 
ATOM   1806 C CD  . GLU A  1 247 ? -59.56797 68.56901 55.91288  1.000 79.97721  ? 224 GLU A CD  1 
ATOM   1807 O OE1 . GLU A  1 247 ? -60.80084 68.32753 55.90515  1.000 84.14090  ? 224 GLU A OE1 1 
ATOM   1808 O OE2 . GLU A  1 247 ? -58.85712 68.46449 56.94331  1.000 84.18890  ? 224 GLU A OE2 1 
ATOM   1809 N N   . ARG A  1 248 ? -57.78949 66.33748 52.48839  1.000 60.81502  ? 225 ARG A N   1 
ATOM   1810 C CA  . ARG A  1 248 ? -56.73993 65.41019 52.91527  1.000 59.79207  ? 225 ARG A CA  1 
ATOM   1811 C C   . ARG A  1 248 ? -55.50713 65.48064 52.01119  1.000 56.56116  ? 225 ARG A C   1 
ATOM   1812 O O   . ARG A  1 248 ? -54.37377 65.37019 52.48833  1.000 54.12999  ? 225 ARG A O   1 
ATOM   1813 C CB  . ARG A  1 248 ? -57.29276 63.98149 52.96041  1.000 59.57197  ? 225 ARG A CB  1 
ATOM   1814 C CG  . ARG A  1 248 ? -56.21359 62.90892 53.14911  1.000 60.90170  ? 225 ARG A CG  1 
ATOM   1815 C CD  . ARG A  1 248 ? -56.81136 61.52268 53.29296  1.000 59.26758  ? 225 ARG A CD  1 
ATOM   1816 N NE  . ARG A  1 248 ? -57.66151 61.41203 54.47679  1.000 65.36798  ? 225 ARG A NE  1 
ATOM   1817 C CZ  . ARG A  1 248 ? -58.29543 60.29858 54.82373  1.000 65.52921  ? 225 ARG A CZ  1 
ATOM   1818 N NH1 . ARG A  1 248 ? -58.16319 59.21421 54.07095  1.000 71.19172  ? 225 ARG A NH1 1 
ATOM   1819 N NH2 . ARG A  1 248 ? -59.06320 60.26901 55.90371  1.000 62.71967  ? 225 ARG A NH2 1 
ATOM   1820 N N   . TYR A  1 249 ? -55.69780 65.64910 50.70412  1.000 55.20788  ? 226 TYR A N   1 
ATOM   1821 C CA  . TYR A  1 249 ? -54.57126 65.71993 49.77948  1.000 53.30982  ? 226 TYR A CA  1 
ATOM   1822 C C   . TYR A  1 249 ? -54.21178 67.15150 49.40488  1.000 50.10406  ? 226 TYR A C   1 
ATOM   1823 O O   . TYR A  1 249 ? -53.40478 67.36155 48.49317  1.000 46.99150  ? 226 TYR A O   1 
ATOM   1824 C CB  . TYR A  1 249 ? -54.85518 64.86655 48.52975  1.000 47.47653  ? 226 TYR A CB  1 
ATOM   1825 C CG  . TYR A  1 249 ? -54.80868 63.38805 48.87693  1.000 45.97204  ? 226 TYR A CG  1 
ATOM   1826 C CD1 . TYR A  1 249 ? -55.96585 62.69183 49.19040  1.000 43.21910  ? 226 TYR A CD1 1 
ATOM   1827 C CD2 . TYR A  1 249 ? -53.58850 62.71190 48.96974  1.000 47.32140  ? 226 TYR A CD2 1 
ATOM   1828 C CE1 . TYR A  1 249 ? -55.92119 61.35814 49.55458  1.000 47.16882  ? 226 TYR A CE1 1 
ATOM   1829 C CE2 . TYR A  1 249 ? -53.53474 61.37107 49.32802  1.000 43.53500  ? 226 TYR A CE2 1 
ATOM   1830 C CZ  . TYR A  1 249 ? -54.70469 60.70230 49.61822  1.000 44.27457  ? 226 TYR A CZ  1 
ATOM   1831 O OH  . TYR A  1 249 ? -54.66684 59.37948 49.98018  1.000 43.08158  ? 226 TYR A OH  1 
ATOM   1832 N N   . LYS A  1 250 ? -54.79579 68.13657 50.09103  1.000 52.52570  ? 227 LYS A N   1 
ATOM   1833 C CA  . LYS A  1 250 ? -54.40737 69.54086 49.95125  1.000 54.84508  ? 227 LYS A CA  1 
ATOM   1834 C C   . LYS A  1 250 ? -54.56369 70.01298 48.50610  1.000 48.97509  ? 227 LYS A C   1 
ATOM   1835 O O   . LYS A  1 250 ? -53.64173 70.55527 47.89575  1.000 47.55770  ? 227 LYS A O   1 
ATOM   1836 C CB  . LYS A  1 250 ? -52.97597 69.75160 50.45044  1.000 57.20663  ? 227 LYS A CB  1 
ATOM   1837 C CG  . LYS A  1 250 ? -52.66902 69.01825 51.74828  1.000 63.43213  ? 227 LYS A CG  1 
ATOM   1838 C CD  . LYS A  1 250 ? -53.35062 69.67688 52.93448  1.000 71.73500  ? 227 LYS A CD  1 
ATOM   1839 C CE  . LYS A  1 250 ? -52.33297 70.03625 54.01615  1.000 77.81989  ? 227 LYS A CE  1 
ATOM   1840 N NZ  . LYS A  1 250 ? -52.94699 70.81179 55.13349  1.000 83.09506  ? 227 LYS A NZ  1 
ATOM   1841 N N   . LEU A  1 251 ? -55.75389 69.79973 47.95148  1.000 47.56712  ? 228 LEU A N   1 
ATOM   1842 C CA  . LEU A  1 251 ? -55.99293 70.09631 46.55201  1.000 42.29941  ? 228 LEU A CA  1 
ATOM   1843 C C   . LEU A  1 251 ? -56.83055 71.35695 46.34981  1.000 47.33769  ? 228 LEU A C   1 
ATOM   1844 O O   . LEU A  1 251 ? -57.26897 71.61703 45.22621  1.000 38.88122  ? 228 LEU A O   1 
ATOM   1845 C CB  . LEU A  1 251 ? -56.63994 68.88565 45.87101  1.000 41.35190  ? 228 LEU A CB  1 
ATOM   1846 C CG  . LEU A  1 251 ? -55.67170 67.72464 45.58902  1.000 44.33981  ? 228 LEU A CG  1 
ATOM   1847 C CD1 . LEU A  1 251 ? -56.38576 66.43676 45.14325  1.000 42.89673  ? 228 LEU A CD1 1 
ATOM   1848 C CD2 . LEU A  1 251 ? -54.74023 68.16993 44.49758  1.000 42.65989  ? 228 LEU A CD2 1 
ATOM   1849 N N   . GLU A  1 252 ? -57.03169 72.16898 47.39329  1.000 46.00338  ? 229 GLU A N   1 
ATOM   1850 C CA  . GLU A  1 252 ? -57.74997 73.42997 47.22198  1.000 46.26617  ? 229 GLU A CA  1 
ATOM   1851 C C   . GLU A  1 252 ? -57.11504 74.27089 46.11447  1.000 46.55858  ? 229 GLU A C   1 
ATOM   1852 O O   . GLU A  1 252 ? -55.89223 74.40622 46.04316  1.000 42.54527  ? 229 GLU A O   1 
ATOM   1853 C CB  . GLU A  1 252 ? -57.75694 74.22261 48.53438  1.000 48.79873  ? 229 GLU A CB  1 
ATOM   1854 C CG  . GLU A  1 252 ? -58.47757 73.54455 49.68691  1.000 60.59418  ? 229 GLU A CG  1 
ATOM   1855 C CD  . GLU A  1 252 ? -57.57695 72.61398 50.50873  1.000 71.02891  ? 229 GLU A CD  1 
ATOM   1856 O OE1 . GLU A  1 252 ? -56.46298 72.27043 50.04763  1.000 64.11572  ? 229 GLU A OE1 1 
ATOM   1857 O OE2 . GLU A  1 252 ? -57.99113 72.23303 51.63147  1.000 76.76826  ? 229 GLU A OE2 1 
ATOM   1858 N N   . GLY A  1 253 ? -57.94730 74.83385 45.24274  1.000 46.41444  ? 230 GLY A N   1 
ATOM   1859 C CA  . GLY A  1 253 ? -57.43662 75.71588 44.21740  1.000 45.58421  ? 230 GLY A CA  1 
ATOM   1860 C C   . GLY A  1 253 ? -56.98204 75.02834 42.94398  1.000 42.62614  ? 230 GLY A C   1 
ATOM   1861 O O   . GLY A  1 253 ? -56.53561 75.71644 42.01227  1.000 44.78693  ? 230 GLY A O   1 
ATOM   1862 N N   . TYR A  1 254 ? -57.05157 73.69881 42.87677  1.000 36.00648  ? 231 TYR A N   1 
ATOM   1863 C CA  . TYR A  1 254 ? -56.74778 72.97471 41.64909  1.000 32.04615  ? 231 TYR A CA  1 
ATOM   1864 C C   . TYR A  1 254 ? -57.98390 72.54639 40.88540  1.000 32.81431  ? 231 TYR A C   1 
ATOM   1865 O O   . TYR A  1 254 ? -57.85304 71.78565 39.92493  1.000 34.48008  ? 231 TYR A O   1 
ATOM   1866 C CB  . TYR A  1 254 ? -55.88724 71.74622 41.94567  1.000 34.12527  ? 231 TYR A CB  1 
ATOM   1867 C CG  . TYR A  1 254 ? -54.53303 72.13311 42.44089  1.000 38.70718  ? 231 TYR A CG  1 
ATOM   1868 C CD1 . TYR A  1 254 ? -53.56194 72.60410 41.56587  1.000 41.46929  ? 231 TYR A CD1 1 
ATOM   1869 C CD2 . TYR A  1 254 ? -54.22595 72.06206 43.79787  1.000 43.15874  ? 231 TYR A CD2 1 
ATOM   1870 C CE1 . TYR A  1 254 ? -52.28913 72.99702 42.04373  1.000 42.25299  ? 231 TYR A CE1 1 
ATOM   1871 C CE2 . TYR A  1 254 ? -52.97742 72.43208 44.26992  1.000 45.45368  ? 231 TYR A CE2 1 
ATOM   1872 C CZ  . TYR A  1 254 ? -52.02062 72.89964 43.39465  1.000 45.47168  ? 231 TYR A CZ  1 
ATOM   1873 O OH  . TYR A  1 254 ? -50.78681 73.25251 43.88985  1.000 52.79696  ? 231 TYR A OH  1 
ATOM   1874 N N   . ALA A  1 255 ? -59.17652 72.96357 41.32338  1.000 34.28816  ? 232 ALA A N   1 
ATOM   1875 C CA  . ALA A  1 255 ? -60.42548 72.78038 40.57372  1.000 34.73572  ? 232 ALA A CA  1 
ATOM   1876 C C   . ALA A  1 255 ? -60.79390 71.30556 40.37277  1.000 34.47696  ? 232 ALA A C   1 
ATOM   1877 O O   . ALA A  1 255 ? -61.44156 70.94840 39.38283  1.000 37.97666  ? 232 ALA A O   1 
ATOM   1878 C CB  . ALA A  1 255 ? -60.37191 73.50669 39.21991  1.000 34.87195  ? 232 ALA A CB  1 
ATOM   1879 N N   . PHE A  1 256 ? -60.42312 70.42849 41.31735  1.000 35.97057  ? 233 PHE A N   1 
ATOM   1880 C CA  . PHE A  1 256 ? -60.84566 69.03080 41.21585  1.000 35.38291  ? 233 PHE A CA  1 
ATOM   1881 C C   . PHE A  1 256 ? -62.35878 68.90045 41.22804  1.000 37.73609  ? 233 PHE A C   1 
ATOM   1882 O O   . PHE A  1 256 ? -62.90365 67.98246 40.59359  1.000 34.19344  ? 233 PHE A O   1 
ATOM   1883 C CB  . PHE A  1 256 ? -60.22760 68.19912 42.33987  1.000 33.82388  ? 233 PHE A CB  1 
ATOM   1884 C CG  . PHE A  1 256 ? -58.93390 67.54908 41.93699  1.000 40.17150  ? 233 PHE A CG  1 
ATOM   1885 C CD1 . PHE A  1 256 ? -58.02382 68.24822 41.16098  1.000 45.04696  ? 233 PHE A CD1 1 
ATOM   1886 C CD2 . PHE A  1 256 ? -58.63830 66.24185 42.29540  1.000 44.19315  ? 233 PHE A CD2 1 
ATOM   1887 C CE1 . PHE A  1 256 ? -56.82655 67.65905 40.76860  1.000 50.03835  ? 233 PHE A CE1 1 
ATOM   1888 C CE2 . PHE A  1 256 ? -57.44299 65.65073 41.90704  1.000 40.18822  ? 233 PHE A CE2 1 
ATOM   1889 C CZ  . PHE A  1 256 ? -56.54684 66.35549 41.14249  1.000 43.66411  ? 233 PHE A CZ  1 
ATOM   1890 N N   . GLU A  1 257 ? -63.05285 69.81388 41.91871  1.000 35.69042  ? 234 GLU A N   1 
ATOM   1891 C CA  . GLU A  1 257 ? -64.51742 69.75370 41.95447  1.000 38.88514  ? 234 GLU A CA  1 
ATOM   1892 C C   . GLU A  1 257 ? -65.08510 69.70958 40.54334  1.000 44.26282  ? 234 GLU A C   1 
ATOM   1893 O O   . GLU A  1 257 ? -65.99175 68.91569 40.24558  1.000 45.68818  ? 234 GLU A O   1 
ATOM   1894 C CB  . GLU A  1 257 ? -65.07738 70.95485 42.72454  1.000 38.52434  ? 234 GLU A CB  1 
ATOM   1895 C CG  . GLU A  1 257 ? -64.64596 71.02318 44.17821  1.000 46.06948  ? 234 GLU A CG  1 
ATOM   1896 C CD  . GLU A  1 257 ? -63.33801 71.80751 44.42763  1.000 55.14452  ? 234 GLU A CD  1 
ATOM   1897 O OE1 . GLU A  1 257 ? -62.45040 71.87859 43.53568  1.000 49.15952  ? 234 GLU A OE1 1 
ATOM   1898 O OE2 . GLU A  1 257 ? -63.20770 72.34730 45.54791  1.000 55.85050  ? 234 GLU A OE2 1 
ATOM   1899 N N   . HIS A  1 258 ? -64.50981 70.52369 39.65085  1.000 38.36933  ? 235 HIS A N   1 
ATOM   1900 C CA  . HIS A  1 258 ? -64.90792 70.62931 38.25057  1.000 32.99451  ? 235 HIS A CA  1 
ATOM   1901 C C   . HIS A  1 258 ? -64.23466 69.53727 37.41279  1.000 33.26357  ? 235 HIS A C   1 
ATOM   1902 O O   . HIS A  1 258 ? -64.90798 68.70195 36.80319  1.000 35.39258  ? 235 HIS A O   1 
ATOM   1903 C CB  . HIS A  1 258 ? -64.54672 72.05337 37.77183  1.000 31.16682  ? 235 HIS A CB  1 
ATOM   1904 C CG  . HIS A  1 258 ? -64.81219 72.32160 36.32097  1.000 36.53124  ? 235 HIS A CG  1 
ATOM   1905 N ND1 . HIS A  1 258 ? -66.03583 72.76266 35.85192  1.000 37.27232  ? 235 HIS A ND1 1 
ATOM   1906 C CD2 . HIS A  1 258 ? -63.99203 72.27212 35.24177  1.000 34.16872  ? 235 HIS A CD2 1 
ATOM   1907 C CE1 . HIS A  1 258 ? -65.96529 72.93757 34.54124  1.000 33.61216  ? 235 HIS A CE1 1 
ATOM   1908 N NE2 . HIS A  1 258 ? -64.73324 72.65013 34.14620  1.000 34.33226  ? 235 HIS A NE2 1 
ATOM   1909 N N   . ILE A  1 259 ? -62.89517 69.49092 37.43010  1.000 31.85089  ? 236 ILE A N   1 
ATOM   1910 C CA  . ILE A  1 259 ? -62.13645 68.65583 36.49233  1.000 31.06232  ? 236 ILE A CA  1 
ATOM   1911 C C   . ILE A  1 259 ? -62.39739 67.17233 36.73585  1.000 33.45332  ? 236 ILE A C   1 
ATOM   1912 O O   . ILE A  1 259 ? -62.61164 66.39747 35.79152  1.000 29.52287  ? 236 ILE A O   1 
ATOM   1913 C CB  . ILE A  1 259 ? -60.61880 68.94468 36.59962  1.000 28.29887  ? 236 ILE A CB  1 
ATOM   1914 C CG1 . ILE A  1 259 ? -60.30261 70.39648 36.29517  1.000 27.69184  ? 236 ILE A CG1 1 
ATOM   1915 C CG2 . ILE A  1 259 ? -59.85535 68.00512 35.65803  1.000 29.40508  ? 236 ILE A CG2 1 
ATOM   1916 C CD1 . ILE A  1 259 ? -58.90858 70.81449 36.77008  1.000 36.02853  ? 236 ILE A CD1 1 
ATOM   1917 N N   . VAL A  1 260 ? -62.30032 66.73711 37.98714  1.000 31.74591  ? 237 VAL A N   1 
ATOM   1918 C CA  . VAL A  1 260 ? -62.32073 65.31516 38.29901  1.000 30.50959  ? 237 VAL A CA  1 
ATOM   1919 C C   . VAL A  1 260 ? -63.71145 64.84628 38.72033  1.000 31.78303  ? 237 VAL A C   1 
ATOM   1920 O O   . VAL A  1 260 ? -64.22664 63.86832 38.17198  1.000 33.54015  ? 237 VAL A O   1 
ATOM   1921 C CB  . VAL A  1 260 ? -61.24762 64.96904 39.35990  1.000 35.39497  ? 237 VAL A CB  1 
ATOM   1922 C CG1 . VAL A  1 260 ? -61.27297 63.45020 39.68642  1.000 36.76691  ? 237 VAL A CG1 1 
ATOM   1923 C CG2 . VAL A  1 260 ? -59.86404 65.36947 38.85407  1.000 31.68661  ? 237 VAL A CG2 1 
ATOM   1924 N N   . TYR A  1 261 ? -64.34192 65.52918 39.68786  1.000 27.14086  ? 238 TYR A N   1 
ATOM   1925 C CA  . TYR A  1 261 ? -65.65471 65.08005 40.17676  1.000 30.45809  ? 238 TYR A CA  1 
ATOM   1926 C C   . TYR A  1 261 ? -66.77833 65.37014 39.18189  1.000 33.47925  ? 238 TYR A C   1 
ATOM   1927 O O   . TYR A  1 261 ? -67.78073 64.63622 39.13612  1.000 34.08194  ? 238 TYR A O   1 
ATOM   1928 C CB  . TYR A  1 261 ? -65.96785 65.75485 41.51939  1.000 34.21735  ? 238 TYR A CB  1 
ATOM   1929 C CG  . TYR A  1 261 ? -65.08274 65.26961 42.64691  1.000 36.53740  ? 238 TYR A CG  1 
ATOM   1930 C CD1 . TYR A  1 261 ? -65.45411 64.15534 43.40965  1.000 37.03038  ? 238 TYR A CD1 1 
ATOM   1931 C CD2 . TYR A  1 261 ? -63.86214 65.89559 42.93304  1.000 40.52799  ? 238 TYR A CD2 1 
ATOM   1932 C CE1 . TYR A  1 261 ? -64.65600 63.69191 44.44107  1.000 41.50467  ? 238 TYR A CE1 1 
ATOM   1933 C CE2 . TYR A  1 261 ? -63.03936 65.43059 43.96273  1.000 40.84652  ? 238 TYR A CE2 1 
ATOM   1934 C CZ  . TYR A  1 261 ? -63.44430 64.32671 44.70839  1.000 45.50242  ? 238 TYR A CZ  1 
ATOM   1935 O OH  . TYR A  1 261 ? -62.65604 63.83751 45.72100  1.000 40.90142  ? 238 TYR A OH  1 
ATOM   1936 N N   . GLY A  1 262 ? -66.63878 66.43036 38.38735  1.000 32.81702  ? 239 GLY A N   1 
ATOM   1937 C CA  . GLY A  1 262 ? -67.67561 66.81174 37.44545  1.000 31.50780  ? 239 GLY A CA  1 
ATOM   1938 C C   . GLY A  1 262 ? -68.71723 67.72981 38.05757  1.000 35.89427  ? 239 GLY A C   1 
ATOM   1939 O O   . GLY A  1 262 ? -69.04948 67.61062 39.24278  1.000 34.91285  ? 239 GLY A O   1 
ATOM   1940 N N   . ASP A  1 263 ? -69.23995 68.65472 37.25591  1.000 32.27786  ? 240 ASP A N   1 
ATOM   1941 C CA  . ASP A  1 263 ? -70.25826 69.61301 37.68485  1.000 34.23191  ? 240 ASP A CA  1 
ATOM   1942 C C   . ASP A  1 263 ? -71.50656 69.31187 36.86892  1.000 38.80463  ? 240 ASP A C   1 
ATOM   1943 O O   . ASP A  1 263 ? -71.51242 69.50210 35.64488  1.000 33.91161  ? 240 ASP A O   1 
ATOM   1944 C CB  . ASP A  1 263 ? -69.77294 71.04558 37.45555  1.000 36.90463  ? 240 ASP A CB  1 
ATOM   1945 C CG  . ASP A  1 263 ? -70.78683 72.10606 37.86472  1.000 46.23659  ? 240 ASP A CG  1 
ATOM   1946 O OD1 . ASP A  1 263 ? -71.96425 71.79354 38.20495  1.000 43.27314  ? 240 ASP A OD1 1 
ATOM   1947 O OD2 . ASP A  1 263 ? -70.37677 73.28850 37.82984  1.000 43.02450  ? 240 ASP A OD2 1 
ATOM   1948 N N   . PHE A  1 264 ? -72.55624 68.84580 37.54223  1.000 34.62875  ? 241 PHE A N   1 
ATOM   1949 C CA  . PHE A  1 264 ? -73.78935 68.45027 36.88353  1.000 37.23844  ? 241 PHE A CA  1 
ATOM   1950 C C   . PHE A  1 264 ? -74.89604 69.45609 37.11067  1.000 36.54744  ? 241 PHE A C   1 
ATOM   1951 O O   . PHE A  1 264 ? -76.07204 69.11931 36.92905  1.000 34.44354  ? 241 PHE A O   1 
ATOM   1952 C CB  . PHE A  1 264 ? -74.21767 67.04970 37.35216  1.000 35.67835  ? 241 PHE A CB  1 
ATOM   1953 C CG  . PHE A  1 264 ? -73.18507 65.99614 37.05251  1.000 38.63398  ? 241 PHE A CG  1 
ATOM   1954 C CD1 . PHE A  1 264 ? -72.07346 65.83928 37.88915  1.000 36.66298  ? 241 PHE A CD1 1 
ATOM   1955 C CD2 . PHE A  1 264 ? -73.29535 65.19538 35.92289  1.000 36.25537  ? 241 PHE A CD2 1 
ATOM   1956 C CE1 . PHE A  1 264 ? -71.09464 64.90427 37.59887  1.000 38.89911  ? 241 PHE A CE1 1 
ATOM   1957 C CE2 . PHE A  1 264 ? -72.30159 64.23732 35.62800  1.000 40.74961  ? 241 PHE A CE2 1 
ATOM   1958 C CZ  . PHE A  1 264 ? -71.21358 64.09583 36.46163  1.000 36.73212  ? 241 PHE A CZ  1 
ATOM   1959 N N   . SER A  1 265 ? -74.54992 70.69146 37.47854  1.000 34.31706  ? 242 SER A N   1 
ATOM   1960 C CA  . SER A  1 265 ? -75.57654 71.66030 37.85099  1.000 40.05753  ? 242 SER A CA  1 
ATOM   1961 C C   . SER A  1 265 ? -76.08928 72.48431 36.68026  1.000 39.36248  ? 242 SER A C   1 
ATOM   1962 O O   . SER A  1 265 ? -77.14142 73.11309 36.81239  1.000 38.00275  ? 242 SER A O   1 
ATOM   1963 C CB  . SER A  1 265 ? -75.05104 72.62220 38.92976  1.000 38.51730  ? 242 SER A CB  1 
ATOM   1964 O OG  . SER A  1 265 ? -74.00247 73.43213 38.39828  1.000 40.08118  ? 242 SER A OG  1 
ATOM   1965 N N   . HIS A  1 266 ? -75.38282 72.51644 35.55199  1.000 35.28963  ? 243 HIS A N   1 
ATOM   1966 C CA  . HIS A  1 266 ? -75.79227 73.32630 34.40622  1.000 36.67039  ? 243 HIS A CA  1 
ATOM   1967 C C   . HIS A  1 266 ? -76.08917 72.44513 33.19457  1.000 36.75224  ? 243 HIS A C   1 
ATOM   1968 O O   . HIS A  1 266 ? -75.74519 71.26187 33.14252  1.000 35.60852  ? 243 HIS A O   1 
ATOM   1969 C CB  . HIS A  1 266 ? -74.71334 74.35158 34.00933  1.000 43.56828  ? 243 HIS A CB  1 
ATOM   1970 C CG  . HIS A  1 266 ? -74.20126 75.17987 35.14615  1.000 56.66301  ? 243 HIS A CG  1 
ATOM   1971 N ND1 . HIS A  1 266 ? -74.94815 76.17352 35.74093  1.000 60.18301  ? 243 HIS A ND1 1 
ATOM   1972 C CD2 . HIS A  1 266 ? -73.00465 75.17528 35.78275  1.000 60.41343  ? 243 HIS A CD2 1 
ATOM   1973 C CE1 . HIS A  1 266 ? -74.24666 76.73050 36.71094  1.000 61.43040  ? 243 HIS A CE1 1 
ATOM   1974 N NE2 . HIS A  1 266 ? -73.06105 76.14735 36.75469  1.000 63.28689  ? 243 HIS A NE2 1 
ATOM   1975 N N   . SER A  1 267 ? -76.70029 73.08541 32.19696  1.000 35.08549  ? 244 SER A N   1 
ATOM   1976 C CA  . SER A  1 267 ? -77.03399 72.44146 30.93077  1.000 39.46321  ? 244 SER A CA  1 
ATOM   1977 C C   . SER A  1 267 ? -75.83165 71.70380 30.34389  1.000 36.88104  ? 244 SER A C   1 
ATOM   1978 O O   . SER A  1 267 ? -75.90238 70.52705 29.97158  1.000 33.55372  ? 244 SER A O   1 
ATOM   1979 C CB  . SER A  1 267 ? -77.50403 73.52977 29.96791  1.000 39.14125  ? 244 SER A CB  1 
ATOM   1980 O OG  . SER A  1 267 ? -77.98105 72.94473 28.79508  1.000 58.59205  ? 244 SER A OG  1 
ATOM   1981 N N   . GLN A  1 268 ? -74.71417 72.39446 30.22033  1.000 29.81106  ? 245 GLN A N   1 
ATOM   1982 C CA  . GLN A  1 268 ? -73.50677 71.73463 29.75959  1.000 30.03350  ? 245 GLN A CA  1 
ATOM   1983 C C   . GLN A  1 268 ? -72.76272 71.13847 30.95189  1.000 31.65514  ? 245 GLN A C   1 
ATOM   1984 O O   . GLN A  1 268 ? -72.39571 71.85666 31.88929  1.000 31.41385  ? 245 GLN A O   1 
ATOM   1985 C CB  . GLN A  1 268 ? -72.60032 72.69479 29.00200  1.000 32.49782  ? 245 GLN A CB  1 
ATOM   1986 C CG  . GLN A  1 268 ? -71.29349 71.96630 28.66074  1.000 37.32798  ? 245 GLN A CG  1 
ATOM   1987 C CD  . GLN A  1 268 ? -70.59731 72.51597 27.44704  1.000 51.52778  ? 245 GLN A CD  1 
ATOM   1988 O OE1 . GLN A  1 268 ? -71.09744 72.40153 26.32209  1.000 55.60024  ? 245 GLN A OE1 1 
ATOM   1989 N NE2 . GLN A  1 268 ? -69.42626 73.11477 27.66246  1.000 43.76125  ? 245 GLN A NE2 1 
ATOM   1990 N N   . LEU A  1 269 ? -72.51135 69.83452 30.88921  1.000 28.58296  ? 246 LEU A N   1 
ATOM   1991 C CA  . LEU A  1 269 ? -71.77957 69.13235 31.93167  1.000 29.84008  ? 246 LEU A CA  1 
ATOM   1992 C C   . LEU A  1 269 ? -70.35350 69.68480 32.07853  1.000 31.52193  ? 246 LEU A C   1 
ATOM   1993 O O   . LEU A  1 269 ? -69.61330 69.80124 31.09854  1.000 31.71140  ? 246 LEU A O   1 
ATOM   1994 C CB  . LEU A  1 269 ? -71.76446 67.64602 31.57096  1.000 29.51371  ? 246 LEU A CB  1 
ATOM   1995 C CG  . LEU A  1 269 ? -71.42176 66.58310 32.60701  1.000 38.82719  ? 246 LEU A CG  1 
ATOM   1996 C CD1 . LEU A  1 269 ? -71.96209 65.22083 32.14653  1.000 34.96931  ? 246 LEU A CD1 1 
ATOM   1997 C CD2 . LEU A  1 269 ? -69.91801 66.48437 32.79326  1.000 36.37722  ? 246 LEU A CD2 1 
ATOM   1998 N N   . GLY A  1 270 ? -69.96067 70.03054 33.29869  1.000 30.20755  ? 247 GLY A N   1 
ATOM   1999 C CA  . GLY A  1 270 ? -68.68140 70.69869 33.51497  1.000 34.27134  ? 247 GLY A CA  1 
ATOM   2000 C C   . GLY A  1 270 ? -67.59272 69.70319 33.86690  1.000 33.67190  ? 247 GLY A C   1 
ATOM   2001 O O   . GLY A  1 270 ? -67.78280 68.84790 34.73316  1.000 32.92258  ? 247 GLY A O   1 
ATOM   2002 N N   . GLY A  1 271 ? -66.44318 69.82346 33.19054  1.000 32.18245  ? 248 GLY A N   1 
ATOM   2003 C CA  . GLY A  1 271 ? -65.28206 69.00678 33.54985  1.000 29.48942  ? 248 GLY A CA  1 
ATOM   2004 C C   . GLY A  1 271 ? -65.50860 67.53233 33.25569  1.000 29.33947  ? 248 GLY A C   1 
ATOM   2005 O O   . GLY A  1 271 ? -65.97906 67.16069 32.16768  1.000 30.71696  ? 248 GLY A O   1 
ATOM   2006 N N   . LEU A  1 272 ? -65.16947 66.68791 34.23950  1.000 30.59674  ? 249 LEU A N   1 
ATOM   2007 C CA  . LEU A  1 272 ? -65.28722 65.22184 34.16606  1.000 28.78034  ? 249 LEU A CA  1 
ATOM   2008 C C   . LEU A  1 272 ? -64.35014 64.63486 33.09256  1.000 33.81708  ? 249 LEU A C   1 
ATOM   2009 O O   . LEU A  1 272 ? -64.76798 63.97286 32.13526  1.000 28.88002  ? 249 LEU A O   1 
ATOM   2010 C CB  . LEU A  1 272 ? -66.74335 64.79514 33.93191  1.000 30.45018  ? 249 LEU A CB  1 
ATOM   2011 C CG  . LEU A  1 272 ? -67.05805 63.34018 34.35056  1.000 36.61518  ? 249 LEU A CG  1 
ATOM   2012 C CD1 . LEU A  1 272 ? -67.05522 63.20574 35.88610  1.000 32.56402  ? 249 LEU A CD1 1 
ATOM   2013 C CD2 . LEU A  1 272 ? -68.39314 62.88019 33.78315  1.000 33.60217  ? 249 LEU A CD2 1 
ATOM   2014 N N   . HIS A  1 273 ? -63.04995 64.86740 33.27988  1.000 27.59848  ? 250 HIS A N   1 
ATOM   2015 C CA  . HIS A  1 273 ? -62.05804 64.49247 32.27441  1.000 29.69788  ? 250 HIS A CA  1 
ATOM   2016 C C   . HIS A  1 273 ? -61.16981 63.31149 32.67936  1.000 28.68762  ? 250 HIS A C   1 
ATOM   2017 O O   . HIS A  1 273 ? -60.31891 62.89489 31.88038  1.000 30.22385  ? 250 HIS A O   1 
ATOM   2018 C CB  . HIS A  1 273 ? -61.19555 65.72485 31.93811  1.000 24.74637  ? 250 HIS A CB  1 
ATOM   2019 C CG  . HIS A  1 273 ? -61.97656 66.81473 31.28284  1.000 28.69995  ? 250 HIS A CG  1 
ATOM   2020 N ND1 . HIS A  1 273 ? -62.58611 66.65447 30.05320  1.000 31.08890  ? 250 HIS A ND1 1 
ATOM   2021 C CD2 . HIS A  1 273 ? -62.30117 68.06356 31.70377  1.000 29.69351  ? 250 HIS A CD2 1 
ATOM   2022 C CE1 . HIS A  1 273 ? -63.22523 67.77077 29.73092  1.000 31.99368  ? 250 HIS A CE1 1 
ATOM   2023 N NE2 . HIS A  1 273 ? -63.07068 68.63948 30.71741  1.000 30.80121  ? 250 HIS A NE2 1 
ATOM   2024 N N   A LEU A  1 274 ? -61.35693 62.75653 33.87681  0.578 26.40958  ? 251 LEU A N   1 
ATOM   2025 N N   B LEU A  1 274 ? -61.33717 62.76773 33.88529  0.422 27.03647  ? 251 LEU A N   1 
ATOM   2026 C CA  A LEU A  1 274 ? -60.52853 61.67732 34.40382  0.578 29.62084  ? 251 LEU A CA  1 
ATOM   2027 C CA  B LEU A  1 274 ? -60.51765 61.66539 34.37988  0.422 29.51005  ? 251 LEU A CA  1 
ATOM   2028 C C   A LEU A  1 274 ? -61.39551 60.44484 34.61809  0.578 31.82383  ? 251 LEU A C   1 
ATOM   2029 C C   B LEU A  1 274 ? -61.40153 60.44875 34.59387  0.422 31.59434  ? 251 LEU A C   1 
ATOM   2030 O O   A LEU A  1 274 ? -62.43957 60.53966 35.26792  0.578 32.08664  ? 251 LEU A O   1 
ATOM   2031 O O   B LEU A  1 274 ? -62.46342 60.56144 35.21173  0.422 32.19832  ? 251 LEU A O   1 
ATOM   2032 C CB  A LEU A  1 274 ? -59.89610 62.08723 35.73938  0.578 30.35138  ? 251 LEU A CB  1 
ATOM   2033 C CB  B LEU A  1 274 ? -59.81832 62.02636 35.69906  0.422 30.81129  ? 251 LEU A CB  1 
ATOM   2034 C CG  A LEU A  1 274 ? -58.39584 62.15450 35.94312  0.578 36.36571  ? 251 LEU A CG  1 
ATOM   2035 C CG  B LEU A  1 274 ? -58.44892 62.67351 35.59561  0.422 35.31439  ? 251 LEU A CG  1 
ATOM   2036 C CD1 A LEU A  1 274 ? -58.11964 62.09863 37.42137  0.578 35.96490  ? 251 LEU A CD1 1 
ATOM   2037 C CD1 B LEU A  1 274 ? -57.38508 61.67605 35.06420  0.422 32.02194  ? 251 LEU A CD1 1 
ATOM   2038 C CD2 A LEU A  1 274 ? -57.61630 61.07813 35.19428  0.578 32.06236  ? 251 LEU A CD2 1 
ATOM   2039 C CD2 B LEU A  1 274 ? -58.53952 63.90216 34.72533  0.422 33.89206  ? 251 LEU A CD2 1 
ATOM   2040 N N   . LEU A  1 275 ? -60.94923 59.28209 34.11856  1.000 28.20021  ? 252 LEU A N   1 
ATOM   2041 C CA  . LEU A  1 275 ? -61.80924 58.09800 34.17140  1.000 29.59762  ? 252 LEU A CA  1 
ATOM   2042 C C   . LEU A  1 275 ? -62.27242 57.78616 35.59924  1.000 29.74427  ? 252 LEU A C   1 
ATOM   2043 O O   . LEU A  1 275 ? -63.43857 57.41817 35.81747  1.000 31.43007  ? 252 LEU A O   1 
ATOM   2044 C CB  . LEU A  1 275 ? -61.09436 56.88004 33.57087  1.000 30.09467  ? 252 LEU A CB  1 
ATOM   2045 C CG  . LEU A  1 275 ? -62.01056 55.65500 33.52915  1.000 34.53406  ? 252 LEU A CG  1 
ATOM   2046 C CD1 . LEU A  1 275 ? -63.24853 55.91192 32.65505  1.000 36.22927  ? 252 LEU A CD1 1 
ATOM   2047 C CD2 . LEU A  1 275 ? -61.26775 54.40159 33.07121  1.000 31.35486  ? 252 LEU A CD2 1 
ATOM   2048 N N   . ILE A  1 276 ? -61.38880 57.95313 36.59439  1.000 29.50668  ? 253 ILE A N   1 
ATOM   2049 C CA  . ILE A  1 276 ? -61.78902 57.59171 37.95747  1.000 32.12301  ? 253 ILE A CA  1 
ATOM   2050 C C   . ILE A  1 276 ? -62.98788 58.41423 38.42363  1.000 34.54533  ? 253 ILE A C   1 
ATOM   2051 O O   . ILE A  1 276 ? -63.81026 57.92250 39.20983  1.000 32.60594  ? 253 ILE A O   1 
ATOM   2052 C CB  . ILE A  1 276 ? -60.60671 57.69674 38.95134  1.000 32.21958  ? 253 ILE A CB  1 
ATOM   2053 C CG1 . ILE A  1 276 ? -61.01023 57.09043 40.30779  1.000 33.53821  ? 253 ILE A CG1 1 
ATOM   2054 C CG2 . ILE A  1 276 ? -60.11996 59.14017 39.15245  1.000 29.06282  ? 253 ILE A CG2 1 
ATOM   2055 C CD1 . ILE A  1 276 ? -59.83130 56.92377 41.27275  1.000 34.97623  ? 253 ILE A CD1 1 
ATOM   2056 N N   . GLY A  1 277 ? -63.11724 59.66710 37.96395  1.000 32.10433  ? 254 GLY A N   1 
ATOM   2057 C CA  . GLY A  1 277 ? -64.28893 60.45904 38.34860  1.000 32.27989  ? 254 GLY A CA  1 
ATOM   2058 C C   . GLY A  1 277 ? -65.57709 59.98713 37.68208  1.000 32.10309  ? 254 GLY A C   1 
ATOM   2059 O O   . GLY A  1 277 ? -66.66202 60.02670 38.28588  1.000 31.24285  ? 254 GLY A O   1 
ATOM   2060 N N   . LEU A  1 278 ? -65.48251 59.53102 36.42981  1.000 30.89588  ? 255 LEU A N   1 
ATOM   2061 C CA  . LEU A  1 278 ? -66.62504 58.86222 35.81743  1.000 34.64923  ? 255 LEU A CA  1 
ATOM   2062 C C   . LEU A  1 278 ? -66.98654 57.59306 36.57467  1.000 32.47074  ? 255 LEU A C   1 
ATOM   2063 O O   . LEU A  1 278 ? -68.17066 57.28996 36.75914  1.000 32.86852  ? 255 LEU A O   1 
ATOM   2064 C CB  . LEU A  1 278 ? -66.34562 58.52745 34.35363  1.000 30.65338  ? 255 LEU A CB  1 
ATOM   2065 C CG  . LEU A  1 278 ? -66.32627 59.67612 33.33940  1.000 34.75191  ? 255 LEU A CG  1 
ATOM   2066 C CD1 . LEU A  1 278 ? -65.00477 60.45420 33.39208  1.000 31.01434  ? 255 LEU A CD1 1 
ATOM   2067 C CD2 . LEU A  1 278 ? -66.51971 59.12065 31.94713  1.000 37.55238  ? 255 LEU A CD2 1 
ATOM   2068 N N   . ALA A  1 279 ? -65.98112 56.82560 37.01276  1.000 32.77203  ? 256 ALA A N   1 
ATOM   2069 C CA  . ALA A  1 279 ? -66.27474 55.59714 37.74767  1.000 35.24836  ? 256 ALA A CA  1 
ATOM   2070 C C   . ALA A  1 279 ? -66.98562 55.90250 39.06005  1.000 37.40081  ? 256 ALA A C   1 
ATOM   2071 O O   . ALA A  1 279 ? -67.94504 55.21197 39.42915  1.000 40.48264  ? 256 ALA A O   1 
ATOM   2072 C CB  . ALA A  1 279 ? -64.98283 54.80932 37.99681  1.000 35.54308  ? 256 ALA A CB  1 
ATOM   2073 N N   . LYS A  1 280 ? -66.55025 56.94971 39.77080  1.000 37.22523  ? 257 LYS A N   1 
ATOM   2074 C CA  . LYS A  1 280 ? -67.20238 57.28929 41.03631  1.000 41.53560  ? 257 LYS A CA  1 
ATOM   2075 C C   . LYS A  1 280 ? -68.66458 57.68585 40.81400  1.000 41.17748  ? 257 LYS A C   1 
ATOM   2076 O O   . LYS A  1 280 ? -69.56657 57.19383 41.50623  1.000 42.97916  ? 257 LYS A O   1 
ATOM   2077 C CB  . LYS A  1 280 ? -66.43734 58.40898 41.75430  1.000 37.39434  ? 257 LYS A CB  1 
ATOM   2078 C CG  . LYS A  1 280 ? -66.94034 58.68104 43.18595  1.000 43.88594  ? 257 LYS A CG  1 
ATOM   2079 C CD  . LYS A  1 280 ? -66.11355 59.76219 43.89069  1.000 44.23687  ? 257 LYS A CD  1 
ATOM   2080 C CE  . LYS A  1 280 ? -66.66004 60.12624 45.29695  1.000 47.19369  ? 257 LYS A CE  1 
ATOM   2081 N NZ  . LYS A  1 280 ? -66.31711 59.15810 46.40218  1.000 43.40403  ? 257 LYS A NZ  1 
ATOM   2082 N N   . ARG A  1 281 ? -68.91634 58.57418 39.84820  1.000 40.44979  ? 258 ARG A N   1 
ATOM   2083 C CA  . ARG A  1 281 ? -70.28815 58.96124 39.49307  1.000 38.71866  ? 258 ARG A CA  1 
ATOM   2084 C C   . ARG A  1 281 ? -71.11479 57.74890 39.10014  1.000 41.77050  ? 258 ARG A C   1 
ATOM   2085 O O   . ARG A  1 281 ? -72.25174 57.56657 39.56574  1.000 44.02247  ? 258 ARG A O   1 
ATOM   2086 C CB  . ARG A  1 281 ? -70.25040 59.95625 38.33053  1.000 42.80833  ? 258 ARG A CB  1 
ATOM   2087 C CG  . ARG A  1 281 ? -71.61358 60.33307 37.76391  1.000 45.32228  ? 258 ARG A CG  1 
ATOM   2088 C CD  . ARG A  1 281 ? -72.18013 61.46889 38.53981  1.000 48.42191  ? 258 ARG A CD  1 
ATOM   2089 N NE  . ARG A  1 281 ? -73.48666 61.93169 38.08423  1.000 45.24739  ? 258 ARG A NE  1 
ATOM   2090 C CZ  . ARG A  1 281 ? -74.23300 62.74188 38.82519  1.000 47.86559  ? 258 ARG A CZ  1 
ATOM   2091 N NH1 . ARG A  1 281 ? -73.76431 63.11556 40.01060  1.000 48.16021  ? 258 ARG A NH1 1 
ATOM   2092 N NH2 . ARG A  1 281 ? -75.43361 63.16005 38.41667  1.000 43.19313  ? 258 ARG A NH2 1 
ATOM   2093 N N   . PHE A  1 282 ? -70.55549 56.91000 38.22626  1.000 34.22228  ? 259 PHE A N   1 
ATOM   2094 C CA  . PHE A  1 282 ? -71.28842 55.77531 37.68612  1.000 38.24882  ? 259 PHE A CA  1 
ATOM   2095 C C   . PHE A  1 282 ? -71.73763 54.80359 38.77280  1.000 48.66988  ? 259 PHE A C   1 
ATOM   2096 O O   . PHE A  1 282 ? -72.75573 54.12738 38.60516  1.000 50.87995  ? 259 PHE A O   1 
ATOM   2097 C CB  . PHE A  1 282 ? -70.43123 55.05066 36.64969  1.000 42.73882  ? 259 PHE A CB  1 
ATOM   2098 C CG  . PHE A  1 282 ? -71.20143 54.06948 35.81369  1.000 52.09228  ? 259 PHE A CG  1 
ATOM   2099 C CD1 . PHE A  1 282 ? -71.96210 54.50997 34.72060  1.000 53.06056  ? 259 PHE A CD1 1 
ATOM   2100 C CD2 . PHE A  1 282 ? -71.15845 52.71311 36.10106  1.000 53.80056  ? 259 PHE A CD2 1 
ATOM   2101 C CE1 . PHE A  1 282 ? -72.68184 53.60691 33.93003  1.000 59.22733  ? 259 PHE A CE1 1 
ATOM   2102 C CE2 . PHE A  1 282 ? -71.87504 51.79980 35.31232  1.000 63.09523  ? 259 PHE A CE2 1 
ATOM   2103 C CZ  . PHE A  1 282 ? -72.63661 52.24989 34.22959  1.000 59.61451  ? 259 PHE A CZ  1 
ATOM   2104 N N   . LYS A  1 283 ? -71.00569 54.71604 39.88861  1.000 50.16477  ? 260 LYS A N   1 
ATOM   2105 C CA  . LYS A  1 283 ? -71.40847 53.80206 40.95401  1.000 57.62040  ? 260 LYS A CA  1 
ATOM   2106 C C   . LYS A  1 283 ? -72.65599 54.28102 41.68654  1.000 57.95873  ? 260 LYS A C   1 
ATOM   2107 O O   . LYS A  1 283 ? -73.38230 53.45813 42.24569  1.000 56.73447  ? 260 LYS A O   1 
ATOM   2108 C CB  . LYS A  1 283 ? -70.25314 53.58520 41.94398  1.000 62.39760  ? 260 LYS A CB  1 
ATOM   2109 C CG  . LYS A  1 283 ? -69.19054 52.62369 41.39642  1.000 73.66136  ? 260 LYS A CG  1 
ATOM   2110 C CD  . LYS A  1 283 ? -67.89681 52.54062 42.22711  1.000 77.75186  ? 260 LYS A CD  1 
ATOM   2111 C CE  . LYS A  1 283 ? -66.76002 51.90080 41.39487  1.000 75.37368  ? 260 LYS A CE  1 
ATOM   2112 N NZ  . LYS A  1 283 ? -65.50064 51.66861 42.16453  1.000 73.33032  ? 260 LYS A NZ  1 
ATOM   2113 N N   . GLU A  1 284 ? -72.93099 55.58519 41.68448  1.000 61.02164  ? 261 GLU A N   1 
ATOM   2114 C CA  . GLU A  1 284 ? -74.11913 56.12450 42.33004  1.000 64.48144  ? 261 GLU A CA  1 
ATOM   2115 C C   . GLU A  1 284 ? -75.23160 56.49403 41.35985  1.000 60.71474  ? 261 GLU A C   1 
ATOM   2116 O O   . GLU A  1 284 ? -76.39250 56.53650 41.76860  1.000 58.83628  ? 261 GLU A O   1 
ATOM   2117 C CB  . GLU A  1 284 ? -73.75039 57.36875 43.14909  1.000 73.58465  ? 261 GLU A CB  1 
ATOM   2118 C CG  . GLU A  1 284 ? -72.26181 57.67584 43.12509  1.000 83.36594  ? 261 GLU A CG  1 
ATOM   2119 C CD  . GLU A  1 284 ? -71.87183 58.87222 43.98341  1.000 91.94164  ? 261 GLU A CD  1 
ATOM   2120 O OE1 . GLU A  1 284 ? -72.72663 59.33897 44.76717  1.000 98.22572  ? 261 GLU A OE1 1 
ATOM   2121 O OE2 . GLU A  1 284 ? -70.71267 59.34458 43.87229  1.000 88.72573  ? 261 GLU A OE2 1 
ATOM   2122 N N   . SER A  1 285 ? -74.91729 56.71651 40.08818  1.000 55.49659  ? 262 SER A N   1 
ATOM   2123 C CA  . SER A  1 285 ? -75.83581 57.37669 39.17788  1.000 50.64151  ? 262 SER A CA  1 
ATOM   2124 C C   . SER A  1 285 ? -75.45308 57.07610 37.72792  1.000 44.96906  ? 262 SER A C   1 
ATOM   2125 O O   . SER A  1 285 ? -74.37983 57.48862 37.29043  1.000 49.89852  ? 262 SER A O   1 
ATOM   2126 C CB  . SER A  1 285 ? -75.78643 58.87836 39.46858  1.000 51.65858  ? 262 SER A CB  1 
ATOM   2127 O OG  . SER A  1 285 ? -76.87038 59.56581 38.89428  1.000 53.67956  ? 262 SER A OG  1 
ATOM   2128 N N   . PRO A  1 286 ? -76.29289 56.40007 36.95350  1.000 45.86193  ? 263 PRO A N   1 
ATOM   2129 C CA  . PRO A  1 286 ? -75.90248 55.98561 35.59876  1.000 47.01358  ? 263 PRO A CA  1 
ATOM   2130 C C   . PRO A  1 286 ? -75.91649 57.13148 34.59437  1.000 48.09396  ? 263 PRO A C   1 
ATOM   2131 O O   . PRO A  1 286 ? -76.61632 58.13444 34.75268  1.000 45.51294  ? 263 PRO A O   1 
ATOM   2132 C CB  . PRO A  1 286 ? -76.98064 54.95967 35.24004  1.000 53.69585  ? 263 PRO A CB  1 
ATOM   2133 C CG  . PRO A  1 286 ? -78.20671 55.50685 35.95125  1.000 53.16491  ? 263 PRO A CG  1 
ATOM   2134 C CD  . PRO A  1 286 ? -77.67148 55.97445 37.28047  1.000 52.68660  ? 263 PRO A CD  1 
ATOM   2135 N N   . PHE A  1 287 ? -75.13818 56.95603 33.52715  1.000 41.07624  ? 264 PHE A N   1 
ATOM   2136 C CA  . PHE A  1 287 ? -75.13132 57.94244 32.45759  1.000 38.88327  ? 264 PHE A CA  1 
ATOM   2137 C C   . PHE A  1 287 ? -74.72947 57.26046 31.16179  1.000 40.88666  ? 264 PHE A C   1 
ATOM   2138 O O   . PHE A  1 287 ? -74.21870 56.13651 31.15677  1.000 39.63796  ? 264 PHE A O   1 
ATOM   2139 C CB  . PHE A  1 287 ? -74.19338 59.11528 32.76351  1.000 38.01765  ? 264 PHE A CB  1 
ATOM   2140 C CG  . PHE A  1 287 ? -72.80038 58.70018 33.15218  1.000 38.56655  ? 264 PHE A CG  1 
ATOM   2141 C CD1 . PHE A  1 287 ? -71.87188 58.35721 32.18350  1.000 36.70863  ? 264 PHE A CD1 1 
ATOM   2142 C CD2 . PHE A  1 287 ? -72.43111 58.63196 34.49101  1.000 42.09775  ? 264 PHE A CD2 1 
ATOM   2143 C CE1 . PHE A  1 287 ? -70.58264 57.95420 32.53564  1.000 41.42523  ? 264 PHE A CE1 1 
ATOM   2144 C CE2 . PHE A  1 287 ? -71.14369 58.24059 34.86302  1.000 46.28069  ? 264 PHE A CE2 1 
ATOM   2145 C CZ  . PHE A  1 287 ? -70.21766 57.90924 33.88689  1.000 45.45862  ? 264 PHE A CZ  1 
ATOM   2146 N N   A GLU A  1 288 ? -74.91872 57.98771 30.07239  0.635 36.97257  ? 265 GLU A N   1 
ATOM   2147 N N   B GLU A  1 288 ? -74.99352 57.95106 30.05156  0.365 37.59762  ? 265 GLU A N   1 
ATOM   2148 C CA  A GLU A  1 288 ? -74.70743 57.48808 28.72762  0.635 38.10936  ? 265 GLU A CA  1 
ATOM   2149 C CA  B GLU A  1 288 ? -74.70622 57.45210 28.71115  0.365 38.44392  ? 265 GLU A CA  1 
ATOM   2150 C C   A GLU A  1 288 ? -73.40897 58.06545 28.17841  0.635 38.05497  ? 265 GLU A C   1 
ATOM   2151 C C   B GLU A  1 288 ? -73.39343 58.04637 28.21823  0.365 37.41071  ? 265 GLU A C   1 
ATOM   2152 O O   A GLU A  1 288 ? -73.20790 59.28529 28.23168  0.635 34.70534  ? 265 GLU A O   1 
ATOM   2153 O O   B GLU A  1 288 ? -73.16974 59.25576 28.34992  0.365 35.31130  ? 265 GLU A O   1 
ATOM   2154 C CB  A GLU A  1 288 ? -75.88440 57.90097 27.84778  0.635 42.57518  ? 265 GLU A CB  1 
ATOM   2155 C CB  B GLU A  1 288 ? -75.83270 57.80726 27.73137  0.365 43.06759  ? 265 GLU A CB  1 
ATOM   2156 C CG  A GLU A  1 288 ? -75.85397 57.33370 26.46700  0.635 50.76032  ? 265 GLU A CG  1 
ATOM   2157 C CG  B GLU A  1 288 ? -75.48932 57.54585 26.24275  0.365 48.48922  ? 265 GLU A CG  1 
ATOM   2158 C CD  A GLU A  1 288 ? -76.57120 56.01096 26.40094  0.635 53.64985  ? 265 GLU A CD  1 
ATOM   2159 C CD  B GLU A  1 288 ? -76.42491 58.25600 25.25641  0.365 51.12778  ? 265 GLU A CD  1 
ATOM   2160 O OE1 A GLU A  1 288 ? -77.60014 55.87147 27.10444  0.635 55.33588  ? 265 GLU A OE1 1 
ATOM   2161 O OE1 B GLU A  1 288 ? -77.06971 59.24017 25.65095  0.365 56.08142  ? 265 GLU A OE1 1 
ATOM   2162 O OE2 A GLU A  1 288 ? -76.08591 55.12503 25.66437  0.635 54.37181  ? 265 GLU A OE2 1 
ATOM   2163 O OE2 B GLU A  1 288 ? -76.51009 57.84659 24.08202  0.365 52.68208  ? 265 GLU A OE2 1 
ATOM   2164 N N   . LEU A  1 289 ? -72.53447 57.19406 27.64974  1.000 34.37275  ? 266 LEU A N   1 
ATOM   2165 C CA  . LEU A  1 289 ? -71.29720 57.60848 26.97155  1.000 35.23185  ? 266 LEU A CA  1 
ATOM   2166 C C   . LEU A  1 289 ? -71.37143 57.15510 25.51818  1.000 40.73076  ? 266 LEU A C   1 
ATOM   2167 O O   . LEU A  1 289 ? -71.35234 55.95368 25.24165  1.000 42.02554  ? 266 LEU A O   1 
ATOM   2168 C CB  . LEU A  1 289 ? -70.05120 57.00180 27.61217  1.000 39.64933  ? 266 LEU A CB  1 
ATOM   2169 C CG  . LEU A  1 289 ? -69.49372 57.44005 28.95687  1.000 40.80253  ? 266 LEU A CG  1 
ATOM   2170 C CD1 . LEU A  1 289 ? -68.19703 56.69052 29.20790  1.000 39.28195  ? 266 LEU A CD1 1 
ATOM   2171 C CD2 . LEU A  1 289 ? -69.27779 58.94181 29.01412  1.000 38.80033  ? 266 LEU A CD2 1 
ATOM   2172 N N   . GLU A  1 290 ? -71.46250 58.08969 24.58307  1.000 33.31504  ? 267 GLU A N   1 
ATOM   2173 C CA  . GLU A  1 290 ? -71.43824 57.71670 23.17573  1.000 31.03597  ? 267 GLU A CA  1 
ATOM   2174 C C   . GLU A  1 290 ? -69.98968 57.80001 22.68820  1.000 32.36619  ? 267 GLU A C   1 
ATOM   2175 O O   . GLU A  1 290 ? -69.40080 58.88781 22.62429  1.000 27.09475  ? 267 GLU A O   1 
ATOM   2176 C CB  . GLU A  1 290 ? -72.35471 58.60157 22.35077  1.000 32.61259  ? 267 GLU A CB  1 
ATOM   2177 C CG  . GLU A  1 290 ? -72.38390 58.16696 20.91567  1.000 44.35085  ? 267 GLU A CG  1 
ATOM   2178 C CD  . GLU A  1 290 ? -73.18905 59.10080 20.04270  1.000 56.80073  ? 267 GLU A CD  1 
ATOM   2179 O OE1 . GLU A  1 290 ? -72.87199 59.17609 18.83149  1.000 62.81047  ? 267 GLU A OE1 1 
ATOM   2180 O OE2 . GLU A  1 290 ? -74.11839 59.75868 20.57347  1.000 52.62609  ? 267 GLU A OE2 1 
ATOM   2181 N N   . ASP A  1 291 ? -69.42611 56.64049 22.35694  1.000 30.42304  ? 268 ASP A N   1 
ATOM   2182 C CA  . ASP A  1 291 ? -68.07026 56.49206 21.83065  1.000 27.92438  ? 268 ASP A CA  1 
ATOM   2183 C C   . ASP A  1 291 ? -68.12049 56.71646 20.32293  1.000 34.41588  ? 268 ASP A C   1 
ATOM   2184 O O   . ASP A  1 291 ? -68.15266 55.76627 19.53305  1.000 33.70750  ? 268 ASP A O   1 
ATOM   2185 C CB  . ASP A  1 291 ? -67.56518 55.08711 22.16731  1.000 29.54283  ? 268 ASP A CB  1 
ATOM   2186 C CG  . ASP A  1 291 ? -66.06320 54.90626 21.91384  1.000 33.17472  ? 268 ASP A CG  1 
ATOM   2187 O OD1 . ASP A  1 291 ? -65.40244 55.81247 21.36423  1.000 31.83176  ? 268 ASP A OD1 1 
ATOM   2188 O OD2 . ASP A  1 291 ? -65.53970 53.82120 22.28171  1.000 34.96237  ? 268 ASP A OD2 1 
ATOM   2189 N N   . PHE A  1 292 ? -68.12582 57.99692 19.90202  1.000 28.52471  ? 269 PHE A N   1 
ATOM   2190 C CA  . PHE A  1 292 ? -68.44881 58.26262 18.49392  1.000 29.75584  ? 269 PHE A CA  1 
ATOM   2191 C C   . PHE A  1 292 ? -67.25311 58.12186 17.55165  1.000 30.52875  ? 269 PHE A C   1 
ATOM   2192 O O   . PHE A  1 292 ? -67.45208 58.11854 16.33462  1.000 28.80097  ? 269 PHE A O   1 
ATOM   2193 C CB  . PHE A  1 292 ? -69.12859 59.64888 18.31695  1.000 28.53641  ? 269 PHE A CB  1 
ATOM   2194 C CG  . PHE A  1 292 ? -68.31831 60.82418 18.84164  1.000 29.49602  ? 269 PHE A CG  1 
ATOM   2195 C CD1 . PHE A  1 292 ? -68.50285 61.29551 20.13344  1.000 30.68382  ? 269 PHE A CD1 1 
ATOM   2196 C CD2 . PHE A  1 292 ? -67.39486 61.46819 18.02965  1.000 30.01455  ? 269 PHE A CD2 1 
ATOM   2197 C CE1 . PHE A  1 292 ? -67.77962 62.39125 20.61724  1.000 30.09569  ? 269 PHE A CE1 1 
ATOM   2198 C CE2 . PHE A  1 292 ? -66.65829 62.55011 18.49970  1.000 31.83352  ? 269 PHE A CE2 1 
ATOM   2199 C CZ  . PHE A  1 292 ? -66.85149 63.01825 19.79648  1.000 33.96409  ? 269 PHE A CZ  1 
ATOM   2200 N N   . ILE A  1 293 ? -66.04087 57.94018 18.06285  1.000 25.26314  ? 270 ILE A N   1 
ATOM   2201 C CA  . ILE A  1 293 ? -64.90286 57.49827 17.25360  1.000 29.84055  ? 270 ILE A CA  1 
ATOM   2202 C C   . ILE A  1 293 ? -64.35570 56.22884 17.90395  1.000 29.86679  ? 270 ILE A C   1 
ATOM   2203 O O   . ILE A  1 293 ? -63.45086 56.31627 18.74658  1.000 32.51328  ? 270 ILE A O   1 
ATOM   2204 C CB  . ILE A  1 293 ? -63.79595 58.56786 17.16743  1.000 34.53513  ? 270 ILE A CB  1 
ATOM   2205 C CG1 . ILE A  1 293 ? -64.35345 59.92605 16.75110  1.000 37.40186  ? 270 ILE A CG1 1 
ATOM   2206 C CG2 . ILE A  1 293 ? -62.70113 58.13396 16.18279  1.000 36.04226  ? 270 ILE A CG2 1 
ATOM   2207 C CD1 . ILE A  1 293 ? -63.31755 61.07196 16.93559  1.000 42.53341  ? 270 ILE A CD1 1 
ATOM   2208 N N   . PRO A  1 294 ? -64.89345 55.05759 17.58979  1.000 32.44079  ? 271 PRO A N   1 
ATOM   2209 C CA  . PRO A  1 294 ? -64.53159 53.84185 18.33758  1.000 30.90182  ? 271 PRO A CA  1 
ATOM   2210 C C   . PRO A  1 294 ? -63.21070 53.23462 17.89297  1.000 29.61105  ? 271 PRO A C   1 
ATOM   2211 O O   . PRO A  1 294 ? -63.10905 52.54963 16.87423  1.000 32.33982  ? 271 PRO A O   1 
ATOM   2212 C CB  . PRO A  1 294 ? -65.71347 52.89314 18.06139  1.000 35.55946  ? 271 PRO A CB  1 
ATOM   2213 C CG  . PRO A  1 294 ? -66.25491 53.36226 16.69602  1.000 34.80009  ? 271 PRO A CG  1 
ATOM   2214 C CD  . PRO A  1 294 ? -66.08537 54.86700 16.73195  1.000 33.26769  ? 271 PRO A CD  1 
ATOM   2215 N N   . MET A  1 295 ? -62.16877 53.51475 18.64914  1.000 30.21830  ? 272 MET A N   1 
ATOM   2216 C CA  . MET A  1 295 ? -60.82259 53.05331 18.34235  1.000 31.65907  ? 272 MET A CA  1 
ATOM   2217 C C   . MET A  1 295 ? -60.04360 53.17552 19.63986  1.000 27.27449  ? 272 MET A C   1 
ATOM   2218 O O   . MET A  1 295 ? -60.50237 53.79092 20.59448  1.000 30.62216  ? 272 MET A O   1 
ATOM   2219 C CB  . MET A  1 295 ? -60.15538 53.88731 17.23794  1.000 31.49613  ? 272 MET A CB  1 
ATOM   2220 C CG  . MET A  1 295 ? -60.04618 55.38456 17.61532  1.000 34.89841  ? 272 MET A CG  1 
ATOM   2221 S SD  . MET A  1 295 ? -59.32552 56.40904 16.30525  1.000 40.11507  ? 272 MET A SD  1 
ATOM   2222 C CE  . MET A  1 295 ? -57.60140 55.92290 16.31253  1.000 40.99089  ? 272 MET A CE  1 
ATOM   2223 N N   . ASP A  1 296 ? -58.86342 52.59003 19.66099  1.000 25.82140  ? 273 ASP A N   1 
ATOM   2224 C CA  . ASP A  1 296 ? -57.99809 52.66656 20.82550  1.000 28.45598  ? 273 ASP A CA  1 
ATOM   2225 C C   . ASP A  1 296 ? -57.17959 53.95348 20.73737  1.000 29.21155  ? 273 ASP A C   1 
ATOM   2226 O O   . ASP A  1 296 ? -56.44844 54.15544 19.76324  1.000 32.18668  ? 273 ASP A O   1 
ATOM   2227 C CB  . ASP A  1 296 ? -57.08190 51.44126 20.86023  1.000 29.39189  ? 273 ASP A CB  1 
ATOM   2228 C CG  . ASP A  1 296 ? -56.52402 51.15614 22.25025  1.000 36.38194  ? 273 ASP A CG  1 
ATOM   2229 O OD1 . ASP A  1 296 ? -57.13313 51.60387 23.26068  1.000 35.10227  ? 273 ASP A OD1 1 
ATOM   2230 O OD2 . ASP A  1 296 ? -55.46034 50.50023 22.31874  1.000 33.57600  ? 273 ASP A OD2 1 
ATOM   2231 N N   . SER A  1 297 ? -57.26725 54.80120 21.75182  1.000 27.44681  ? 274 SER A N   1 
ATOM   2232 C CA  . SER A  1 297 ? -56.35802 55.94370 21.79067  1.000 27.69392  ? 274 SER A CA  1 
ATOM   2233 C C   . SER A  1 297 ? -56.14149 56.39016 23.22685  1.000 24.89316  ? 274 SER A C   1 
ATOM   2234 O O   . SER A  1 297 ? -56.97505 56.17473 24.10959  1.000 26.49123  ? 274 SER A O   1 
ATOM   2235 C CB  . SER A  1 297 ? -56.85100 57.12524 20.93654  1.000 33.24263  ? 274 SER A CB  1 
ATOM   2236 O OG  . SER A  1 297 ? -58.15864 57.43400 21.28684  1.000 39.82969  ? 274 SER A OG  1 
ATOM   2237 N N   . THR A  1 298 ? -55.01597 57.07045 23.42016  1.000 24.85185  ? 275 THR A N   1 
ATOM   2238 C CA  . THR A  1 298 ? -54.62421 57.53647 24.74571  1.000 24.56978  ? 275 THR A CA  1 
ATOM   2239 C C   . THR A  1 298 ? -55.67531 58.45003 25.36036  1.000 24.73163  ? 275 THR A C   1 
ATOM   2240 O O   . THR A  1 298 ? -55.98032 58.34829 26.55497  1.000 28.15103  ? 275 THR A O   1 
ATOM   2241 C CB  . THR A  1 298 ? -53.27183 58.23664 24.61939  1.000 26.97754  ? 275 THR A CB  1 
ATOM   2242 O OG1 . THR A  1 298 ? -52.28129 57.23830 24.34432  1.000 28.34319  ? 275 THR A OG1 1 
ATOM   2243 C CG2 . THR A  1 298 ? -52.92762 59.00367 25.90718  1.000 27.64151  ? 275 THR A CG2 1 
ATOM   2244 N N   . VAL A  1 299 ? -56.24232 59.35468 24.56987  1.000 24.70065  ? 276 VAL A N   1 
ATOM   2245 C CA  . VAL A  1 299 ? -57.33942 60.20509 25.01107  1.000 24.59792  ? 276 VAL A CA  1 
ATOM   2246 C C   . VAL A  1 299 ? -58.57552 59.75524 24.24952  1.000 24.41547  ? 276 VAL A C   1 
ATOM   2247 O O   . VAL A  1 299 ? -58.50869 59.52860 23.03370  1.000 23.00214  ? 276 VAL A O   1 
ATOM   2248 C CB  . VAL A  1 299 ? -57.07421 61.70958 24.75555  1.000 29.31443  ? 276 VAL A CB  1 
ATOM   2249 C CG1 . VAL A  1 299 ? -58.29734 62.55464 25.18712  1.000 26.46205  ? 276 VAL A CG1 1 
ATOM   2250 C CG2 . VAL A  1 299 ? -55.80149 62.17456 25.45540  1.000 27.65132  ? 276 VAL A CG2 1 
ATOM   2251 N N   . LYS A  1 300 ? -59.69407 59.62784 24.94902  1.000 23.31677  ? 277 LYS A N   1 
ATOM   2252 C CA  . LYS A  1 300 ? -60.96303 59.25861 24.31643  1.000 27.12072  ? 277 LYS A CA  1 
ATOM   2253 C C   . LYS A  1 300 ? -61.93620 60.43318 24.39027  1.000 28.64125  ? 277 LYS A C   1 
ATOM   2254 O O   . LYS A  1 300 ? -61.97172 61.13795 25.39794  1.000 29.00298  ? 277 LYS A O   1 
ATOM   2255 C CB  . LYS A  1 300 ? -61.58039 58.03424 25.00041  1.000 24.50113  ? 277 LYS A CB  1 
ATOM   2256 C CG  . LYS A  1 300 ? -60.82233 56.70995 24.75280  1.000 27.52742  ? 277 LYS A CG  1 
ATOM   2257 C CD  . LYS A  1 300 ? -60.95925 56.22837 23.29833  1.000 26.43752  ? 277 LYS A CD  1 
ATOM   2258 C CE  . LYS A  1 300 ? -62.42335 55.92765 22.91582  1.000 27.95026  ? 277 LYS A CE  1 
ATOM   2259 N NZ  . LYS A  1 300 ? -62.50954 55.76519 21.40649  1.000 27.99390  ? 277 LYS A NZ  1 
ATOM   2260 N N   . ASN A  1 301 ? -62.75512 60.61908 23.34900  1.000 28.86362  ? 278 ASN A N   1 
ATOM   2261 C CA  . ASN A  1 301 ? -63.81498 61.63802 23.34522  1.000 24.18959  ? 278 ASN A CA  1 
ATOM   2262 C C   . ASN A  1 301 ? -65.17661 60.95865 23.38974  1.000 28.39840  ? 278 ASN A C   1 
ATOM   2263 O O   . ASN A  1 301 ? -65.43740 60.05792 22.58406  1.000 26.86692  ? 278 ASN A O   1 
ATOM   2264 C CB  . ASN A  1 301 ? -63.73510 62.51906 22.09420  1.000 28.95823  ? 278 ASN A CB  1 
ATOM   2265 C CG  . ASN A  1 301 ? -62.58218 63.55348 22.15858  1.000 38.40035  ? 278 ASN A CG  1 
ATOM   2266 O OD1 . ASN A  1 301 ? -62.03870 63.83038 23.22553  1.000 38.97448  ? 278 ASN A OD1 1 
ATOM   2267 N ND2 . ASN A  1 301 ? -62.24688 64.13614 21.01295  1.000 37.28968  ? 278 ASN A ND2 1 
ATOM   2268 N N   . TYR A  1 302 ? -66.05666 61.41766 24.28942  1.000 25.52119  ? 279 TYR A N   1 
ATOM   2269 C CA  . TYR A  1 302 ? -67.40320 60.85808 24.41924  1.000 27.26170  ? 279 TYR A CA  1 
ATOM   2270 C C   . TYR A  1 302 ? -68.44217 61.96894 24.41034  1.000 23.56021  ? 279 TYR A C   1 
ATOM   2271 O O   . TYR A  1 302 ? -68.21801 63.04663 24.96146  1.000 26.44928  ? 279 TYR A O   1 
ATOM   2272 C CB  . TYR A  1 302 ? -67.57955 60.08297 25.73548  1.000 26.39789  ? 279 TYR A CB  1 
ATOM   2273 C CG  . TYR A  1 302 ? -66.62873 58.92561 25.91866  1.000 29.06210  ? 279 TYR A CG  1 
ATOM   2274 C CD1 . TYR A  1 302 ? -66.83978 57.69919 25.25235  1.000 32.96325  ? 279 TYR A CD1 1 
ATOM   2275 C CD2 . TYR A  1 302 ? -65.54114 59.03556 26.75999  1.000 28.33520  ? 279 TYR A CD2 1 
ATOM   2276 C CE1 . TYR A  1 302 ? -65.96877 56.63115 25.42906  1.000 31.98069  ? 279 TYR A CE1 1 
ATOM   2277 C CE2 . TYR A  1 302 ? -64.66649 57.97096 26.93584  1.000 31.24565  ? 279 TYR A CE2 1 
ATOM   2278 C CZ  . TYR A  1 302 ? -64.89297 56.77972 26.27602  1.000 33.00746  ? 279 TYR A CZ  1 
ATOM   2279 O OH  . TYR A  1 302 ? -64.02649 55.72950 26.46438  1.000 31.64084  ? 279 TYR A OH  1 
ATOM   2280 N N   . PHE A  1 303 ? -69.59140 61.66622 23.82618  1.000 25.12691  ? 280 PHE A N   1 
ATOM   2281 C CA  . PHE A  1 303 ? -70.79638 62.48142 23.95012  1.000 26.30802  ? 280 PHE A CA  1 
ATOM   2282 C C   . PHE A  1 303 ? -71.53275 61.92519 25.16859  1.000 28.64905  ? 280 PHE A C   1 
ATOM   2283 O O   . PHE A  1 303 ? -72.07789 60.80942 25.12359  1.000 29.42545  ? 280 PHE A O   1 
ATOM   2284 C CB  . PHE A  1 303 ? -71.62068 62.37810 22.66393  1.000 27.30173  ? 280 PHE A CB  1 
ATOM   2285 C CG  . PHE A  1 303 ? -72.72581 63.39756 22.53139  1.000 29.74860  ? 280 PHE A CG  1 
ATOM   2286 C CD1 . PHE A  1 303 ? -73.44848 63.82629 23.63303  1.000 30.56181  ? 280 PHE A CD1 1 
ATOM   2287 C CD2 . PHE A  1 303 ? -73.04440 63.91222 21.28224  1.000 33.84267  ? 280 PHE A CD2 1 
ATOM   2288 C CE1 . PHE A  1 303 ? -74.48436 64.77244 23.50156  1.000 35.83033  ? 280 PHE A CE1 1 
ATOM   2289 C CE2 . PHE A  1 303 ? -74.08154 64.84477 21.12568  1.000 37.33828  ? 280 PHE A CE2 1 
ATOM   2290 C CZ  . PHE A  1 303 ? -74.80834 65.27347 22.24428  1.000 36.95256  ? 280 PHE A CZ  1 
ATOM   2291 N N   . ILE A  1 304 ? -71.50249 62.66482 26.27483  1.000 26.47387  ? 281 ILE A N   1 
ATOM   2292 C CA  . ILE A  1 304 ? -71.97378 62.16281 27.55924  1.000 26.73887  ? 281 ILE A CA  1 
ATOM   2293 C C   . ILE A  1 304 ? -73.28323 62.85302 27.90712  1.000 29.45520  ? 281 ILE A C   1 
ATOM   2294 O O   . ILE A  1 304 ? -73.41947 64.06642 27.70901  1.000 29.17609  ? 281 ILE A O   1 
ATOM   2295 C CB  . ILE A  1 304 ? -70.93113 62.37531 28.67474  1.000 28.87325  ? 281 ILE A CB  1 
ATOM   2296 C CG1 . ILE A  1 304 ? -71.49102 61.84647 29.99514  1.000 30.68497  ? 281 ILE A CG1 1 
ATOM   2297 C CG2 . ILE A  1 304 ? -70.58151 63.85793 28.84272  1.000 31.85434  ? 281 ILE A CG2 1 
ATOM   2298 C CD1 . ILE A  1 304 ? -70.48979 61.90241 31.11829  1.000 37.73176  ? 281 ILE A CD1 1 
ATOM   2299 N N   . THR A  1 305 ? -74.25665 62.06413 28.38907  1.000 27.47814  ? 282 THR A N   1 
ATOM   2300 C CA  . THR A  1 305 ? -75.55103 62.55290 28.87602  1.000 30.63118  ? 282 THR A CA  1 
ATOM   2301 C C   . THR A  1 305 ? -75.77825 61.97576 30.26507  1.000 32.87229  ? 282 THR A C   1 
ATOM   2302 O O   . THR A  1 305 ? -75.86357 60.75105 30.42019  1.000 29.46502  ? 282 THR A O   1 
ATOM   2303 C CB  . THR A  1 305 ? -76.69051 62.12349 27.94453  1.000 30.76242  ? 282 THR A CB  1 
ATOM   2304 O OG1 . THR A  1 305 ? -76.43012 62.60751 26.62513  1.000 31.21888  ? 282 THR A OG1 1 
ATOM   2305 C CG2 . THR A  1 305 ? -78.09344 62.66770 28.43261  1.000 32.36748  ? 282 THR A CG2 1 
ATOM   2306 N N   . ASP A  1 306 ? -75.87846 62.84155 31.27186  1.000 30.91816  ? 283 ASP A N   1 
ATOM   2307 C CA  . ASP A  1 306 ? -76.11245 62.36565 32.63480  1.000 36.83757  ? 283 ASP A CA  1 
ATOM   2308 C C   . ASP A  1 306 ? -77.59187 62.08836 32.82781  1.000 36.59153  ? 283 ASP A C   1 
ATOM   2309 O O   . ASP A  1 306 ? -78.42822 62.98501 32.64740  1.000 34.57645  ? 283 ASP A O   1 
ATOM   2310 C CB  . ASP A  1 306 ? -75.61752 63.37558 33.66956  1.000 36.25165  ? 283 ASP A CB  1 
ATOM   2311 C CG  . ASP A  1 306 ? -75.79668 62.87371 35.09955  1.000 41.89236  ? 283 ASP A CG  1 
ATOM   2312 O OD1 . ASP A  1 306 ? -75.13059 61.88665 35.49248  1.000 41.41716  ? 283 ASP A OD1 1 
ATOM   2313 O OD2 . ASP A  1 306 ? -76.58259 63.47152 35.83587  1.000 40.15869  ? 283 ASP A OD2 1 
ATOM   2314 N N   . ALA A  1 307 ? -77.92197 60.84723 33.20631  1.000 36.13997  ? 284 ALA A N   1 
ATOM   2315 C CA  . ALA A  1 307 ? -79.32448 60.44534 33.24787  1.000 35.95810  ? 284 ALA A CA  1 
ATOM   2316 C C   . ALA A  1 307 ? -80.07914 61.08633 34.40638  1.000 35.61968  ? 284 ALA A C   1 
ATOM   2317 O O   . ALA A  1 307 ? -81.27135 61.34875 34.27916  1.000 37.25373  ? 284 ALA A O   1 
ATOM   2318 C CB  . ALA A  1 307 ? -79.45495 58.91708 33.32895  1.000 37.78447  ? 284 ALA A CB  1 
ATOM   2319 N N   . GLN A  1 308 ? -79.41825 61.34539 35.53192  1.000 35.14447  ? 285 GLN A N   1 
ATOM   2320 C CA  . GLN A  1 308 ? -80.12721 61.88522 36.68584  1.000 38.82423  ? 285 GLN A CA  1 
ATOM   2321 C C   . GLN A  1 308 ? -80.49069 63.35548 36.48976  1.000 39.50535  ? 285 GLN A C   1 
ATOM   2322 O O   . GLN A  1 308 ? -81.61452 63.76623 36.81132  1.000 38.08754  ? 285 GLN A O   1 
ATOM   2323 C CB  . GLN A  1 308 ? -79.28388 61.71447 37.96029  1.000 38.11221  ? 285 GLN A CB  1 
ATOM   2324 C CG  . GLN A  1 308 ? -79.98505 62.22234 39.24555  1.000 44.80253  ? 285 GLN A CG  1 
ATOM   2325 C CD  . GLN A  1 308 ? -81.24418 61.45134 39.57996  1.000 50.05400  ? 285 GLN A CD  1 
ATOM   2326 O OE1 . GLN A  1 308 ? -81.28171 60.23532 39.44673  1.000 54.55187  ? 285 GLN A OE1 1 
ATOM   2327 N NE2 . GLN A  1 308 ? -82.29566 62.16254 40.01137  1.000 50.86335  ? 285 GLN A NE2 1 
ATOM   2328 N N   . THR A  1 309 ? -79.55947 64.15982 35.97475  1.000 35.59422  ? 286 THR A N   1 
ATOM   2329 C CA  . THR A  1 309 ? -79.75286 65.60076 35.88655  1.000 39.37557  ? 286 THR A CA  1 
ATOM   2330 C C   . THR A  1 309 ? -80.11945 66.08425 34.48815  1.000 37.12061  ? 286 THR A C   1 
ATOM   2331 O O   . THR A  1 309 ? -80.76747 67.12434 34.35635  1.000 35.26761  ? 286 THR A O   1 
ATOM   2332 C CB  . THR A  1 309 ? -78.47562 66.32776 36.32820  1.000 36.91002  ? 286 THR A CB  1 
ATOM   2333 O OG1 . THR A  1 309 ? -77.42673 66.01687 35.40126  1.000 33.76505  ? 286 THR A OG1 1 
ATOM   2334 C CG2 . THR A  1 309 ? -78.04318 65.87671 37.73013  1.000 35.07572  ? 286 THR A CG2 1 
ATOM   2335 N N   . GLY A  1 310 ? -79.73154 65.36635 33.44076  1.000 33.61321  ? 287 GLY A N   1 
ATOM   2336 C CA  . GLY A  1 310 ? -79.86698 65.89429 32.10160  1.000 31.21300  ? 287 GLY A CA  1 
ATOM   2337 C C   . GLY A  1 310 ? -78.70921 66.77642 31.67484  1.000 33.47600  ? 287 GLY A C   1 
ATOM   2338 O O   . GLY A  1 310 ? -78.73209 67.31282 30.55667  1.000 32.15708  ? 287 GLY A O   1 
ATOM   2339 N N   . SER A  1 311 ? -77.71881 66.97342 32.53854  1.000 29.54124  ? 288 SER A N   1 
ATOM   2340 C CA  . SER A  1 311 ? -76.49381 67.65944 32.12411  1.000 28.65888  ? 288 SER A CA  1 
ATOM   2341 C C   . SER A  1 311 ? -75.77194 66.83281 31.05541  1.000 31.19333  ? 288 SER A C   1 
ATOM   2342 O O   . SER A  1 311 ? -75.71641 65.60318 31.15113  1.000 33.54638  ? 288 SER A O   1 
ATOM   2343 C CB  . SER A  1 311 ? -75.60223 67.85299 33.34698  1.000 30.69758  ? 288 SER A CB  1 
ATOM   2344 O OG  . SER A  1 311 ? -74.60559 68.79937 33.11018  1.000 38.58346  ? 288 SER A OG  1 
ATOM   2345 N N   . SER A  1 312 ? -75.22974 67.49477 30.02328  1.000 27.18611  ? 289 SER A N   1 
ATOM   2346 C CA  . SER A  1 312 ? -74.65887 66.76987 28.88553  1.000 28.20270  ? 289 SER A CA  1 
ATOM   2347 C C   . SER A  1 312 ? -73.52460 67.56273 28.23368  1.000 29.74809  ? 289 SER A C   1 
ATOM   2348 O O   . SER A  1 312 ? -73.39675 68.77685 28.41727  1.000 29.58135  ? 289 SER A O   1 
ATOM   2349 C CB  . SER A  1 312 ? -75.74356 66.40826 27.83051  1.000 30.69896  ? 289 SER A CB  1 
ATOM   2350 O OG  . SER A  1 312 ? -76.22724 67.54397 27.13237  1.000 31.61270  ? 289 SER A OG  1 
ATOM   2351 N N   . LYS A  1 313 ? -72.67787 66.85602 27.47408  1.000 25.25550  ? 290 LYS A N   1 
ATOM   2352 C CA  . LYS A  1 313 ? -71.60226 67.53152 26.75178  1.000 26.60820  ? 290 LYS A CA  1 
ATOM   2353 C C   . LYS A  1 313 ? -71.25267 66.73299 25.49522  1.000 29.17713  ? 290 LYS A C   1 
ATOM   2354 O O   . LYS A  1 313 ? -71.01923 65.52883 25.58897  1.000 30.69981  ? 290 LYS A O   1 
ATOM   2355 C CB  . LYS A  1 313 ? -70.36442 67.71030 27.65389  1.000 28.43616  ? 290 LYS A CB  1 
ATOM   2356 C CG  . LYS A  1 313 ? -69.16286 68.39835 26.97546  1.000 28.54491  ? 290 LYS A CG  1 
ATOM   2357 C CD  . LYS A  1 313 ? -68.25958 69.14861 27.98544  1.000 31.76875  ? 290 LYS A CD  1 
ATOM   2358 C CE  . LYS A  1 313 ? -67.61707 68.16030 28.96891  1.000 30.00018  ? 290 LYS A CE  1 
ATOM   2359 N NZ  . LYS A  1 313 ? -67.08554 68.88098 30.20977  1.000 29.11573  ? 290 LYS A NZ  1 
ATOM   2360 N N   . CYS A  1 314 ? -71.19790 67.41555 24.33486  1.000 28.96298  ? 291 CYS A N   1 
ATOM   2361 C CA  . CYS A  1 314 ? -71.00498 66.73424 23.04509  1.000 28.23193  ? 291 CYS A CA  1 
ATOM   2362 C C   . CYS A  1 314 ? -69.64229 66.07711 22.93405  1.000 30.65504  ? 291 CYS A C   1 
ATOM   2363 O O   . CYS A  1 314 ? -69.51141 65.01452 22.31042  1.000 28.08872  ? 291 CYS A O   1 
ATOM   2364 C CB  . CYS A  1 314 ? -71.14388 67.73018 21.89089  1.000 30.97695  ? 291 CYS A CB  1 
ATOM   2365 S SG  . CYS A  1 314 ? -72.78623 68.45267 21.79601  1.000 37.77148  ? 291 CYS A SG  1 
ATOM   2366 N N   . VAL A  1 315 ? -68.59189 66.75248 23.41574  1.000 24.85291  ? 292 VAL A N   1 
ATOM   2367 C CA  . VAL A  1 315 ? -67.22014 66.26252 23.27273  1.000 27.19748  ? 292 VAL A CA  1 
ATOM   2368 C C   . VAL A  1 315 ? -66.61113 66.37231 24.65893  1.000 32.65828  ? 292 VAL A C   1 
ATOM   2369 O O   . VAL A  1 315 ? -66.16648 67.45423 25.06236  1.000 32.76154  ? 292 VAL A O   1 
ATOM   2370 C CB  . VAL A  1 315 ? -66.40286 67.06148 22.24311  1.000 29.91262  ? 292 VAL A CB  1 
ATOM   2371 C CG1 . VAL A  1 315 ? -64.97813 66.49227 22.13031  1.000 31.46409  ? 292 VAL A CG1 1 
ATOM   2372 C CG2 . VAL A  1 315 ? -67.07834 67.04184 20.84846  1.000 27.93123  ? 292 VAL A CG2 1 
ATOM   2373 N N   . CYS A  1 316 ? -66.59951 65.27743 25.38964  1.000 27.32658  ? 293 CYS A N   1 
ATOM   2374 C CA  . CYS A  1 316 ? -66.00648 65.22564 26.72285  1.000 29.54666  ? 293 CYS A CA  1 
ATOM   2375 C C   . CYS A  1 316 ? -64.76501 64.35544 26.60901  1.000 27.35078  ? 293 CYS A C   1 
ATOM   2376 O O   . CYS A  1 316 ? -64.87603 63.12641 26.48823  1.000 28.23370  ? 293 CYS A O   1 
ATOM   2377 C CB  . CYS A  1 316 ? -66.98847 64.64893 27.74875  1.000 29.18608  ? 293 CYS A CB  1 
ATOM   2378 S SG  . CYS A  1 316 ? -66.39646 64.80825 29.49076  1.000 34.05445  ? 293 CYS A SG  1 
ATOM   2379 N N   . SER A  1 317 ? -63.59030 64.98232 26.63487  1.000 24.45162  ? 294 SER A N   1 
ATOM   2380 C CA  . SER A  1 317 ? -62.34594 64.22348 26.52879  1.000 26.10481  ? 294 SER A CA  1 
ATOM   2381 C C   . SER A  1 317 ? -62.06537 63.55331 27.86895  1.000 29.85752  ? 294 SER A C   1 
ATOM   2382 O O   . SER A  1 317 ? -62.26694 64.14684 28.93423  1.000 33.09871  ? 294 SER A O   1 
ATOM   2383 C CB  . SER A  1 317 ? -61.18090 65.13639 26.10930  1.000 25.68615  ? 294 SER A CB  1 
ATOM   2384 O OG  . SER A  1 317 ? -61.02215 66.19956 27.05023  1.000 34.42766  ? 294 SER A OG  1 
ATOM   2385 N N   . VAL A  1 318 ? -61.64066 62.29531 27.81859  1.000 25.76215  ? 295 VAL A N   1 
ATOM   2386 C CA  . VAL A  1 318 ? -61.48122 61.47680 29.01885  1.000 24.36609  ? 295 VAL A CA  1 
ATOM   2387 C C   . VAL A  1 318 ? -60.16589 60.73171 28.89358  1.000 29.44604  ? 295 VAL A C   1 
ATOM   2388 O O   . VAL A  1 318 ? -59.85605 60.17187 27.83115  1.000 25.99307  ? 295 VAL A O   1 
ATOM   2389 C CB  . VAL A  1 318 ? -62.65749 60.49125 29.22058  1.000 28.16304  ? 295 VAL A CB  1 
ATOM   2390 C CG1 . VAL A  1 318 ? -62.42099 59.58591 30.42996  1.000 29.45160  ? 295 VAL A CG1 1 
ATOM   2391 C CG2 . VAL A  1 318 ? -63.98366 61.25981 29.39584  1.000 28.68314  ? 295 VAL A CG2 1 
ATOM   2392 N N   . ILE A  1 319 ? -59.36467 60.77645 29.95653  1.000 30.02827  ? 296 ILE A N   1 
ATOM   2393 C CA  . ILE A  1 319 ? -58.13438 60.01112 30.03996  1.000 27.15175  ? 296 ILE A CA  1 
ATOM   2394 C C   . ILE A  1 319 ? -58.12349 59.21296 31.34582  1.000 26.75273  ? 296 ILE A C   1 
ATOM   2395 O O   . ILE A  1 319 ? -58.61231 59.68992 32.37897  1.000 27.55418  ? 296 ILE A O   1 
ATOM   2396 C CB  . ILE A  1 319 ? -56.91945 60.95703 29.92201  1.000 28.04781  ? 296 ILE A CB  1 
ATOM   2397 C CG1 . ILE A  1 319 ? -55.61982 60.16577 29.73953  1.000 24.83213  ? 296 ILE A CG1 1 
ATOM   2398 C CG2 . ILE A  1 319 ? -56.81746 61.89589 31.14015  1.000 28.96767  ? 296 ILE A CG2 1 
ATOM   2399 C CD1 . ILE A  1 319 ? -54.42127 61.08674 29.33397  1.000 26.88193  ? 296 ILE A CD1 1 
ATOM   2400 N N   . ASP A  1 320 ? -57.59233 57.97803 31.30004  1.000 26.47851  ? 297 ASP A N   1 
ATOM   2401 C CA  . ASP A  1 320 ? -57.43034 57.16800 32.51822  1.000 26.97386  ? 297 ASP A CA  1 
ATOM   2402 C C   . ASP A  1 320 ? -55.96075 57.22820 32.95145  1.000 28.99555  ? 297 ASP A C   1 
ATOM   2403 O O   . ASP A  1 320 ? -55.15506 56.36209 32.63788  1.000 30.07309  ? 297 ASP A O   1 
ATOM   2404 C CB  . ASP A  1 320 ? -57.87575 55.71586 32.30666  1.000 29.62646  ? 297 ASP A CB  1 
ATOM   2405 C CG  . ASP A  1 320 ? -57.77368 54.88622 33.60044  1.000 38.75877  ? 297 ASP A CG  1 
ATOM   2406 O OD1 . ASP A  1 320 ? -57.65509 55.48411 34.70892  1.000 35.46398  ? 297 ASP A OD1 1 
ATOM   2407 O OD2 . ASP A  1 320 ? -57.77581 53.63600 33.51707  1.000 35.05905  ? 297 ASP A OD2 1 
ATOM   2408 N N   . LEU A  1 321 ? -55.61480 58.27782 33.67355  1.000 29.23366  ? 298 LEU A N   1 
ATOM   2409 C CA  . LEU A  1 321 ? -54.33929 58.34600 34.37253  1.000 27.91692  ? 298 LEU A CA  1 
ATOM   2410 C C   . LEU A  1 321 ? -54.55922 57.88808 35.80323  1.000 34.96065  ? 298 LEU A C   1 
ATOM   2411 O O   . LEU A  1 321 ? -55.61589 58.15299 36.38656  1.000 31.49156  ? 298 LEU A O   1 
ATOM   2412 C CB  . LEU A  1 321 ? -53.79834 59.77029 34.39469  1.000 27.18850  ? 298 LEU A CB  1 
ATOM   2413 C CG  . LEU A  1 321 ? -53.28719 60.24725 33.04924  1.000 30.32137  ? 298 LEU A CG  1 
ATOM   2414 C CD1 . LEU A  1 321 ? -53.04895 61.74334 33.13539  1.000 29.19995  ? 298 LEU A CD1 1 
ATOM   2415 C CD2 . LEU A  1 321 ? -52.00274 59.49360 32.70507  1.000 29.88757  ? 298 LEU A CD2 1 
ATOM   2416 N N   . LEU A  1 322 ? -53.54389 57.23629 36.37413  1.000 31.95577  ? 299 LEU A N   1 
ATOM   2417 C CA  . LEU A  1 322 ? -53.50263 57.06536 37.81763  1.000 32.16246  ? 299 LEU A CA  1 
ATOM   2418 C C   . LEU A  1 322 ? -53.71096 58.42183 38.47212  1.000 31.28246  ? 299 LEU A C   1 
ATOM   2419 O O   . LEU A  1 322 ? -53.07034 59.40254 38.09122  1.000 32.58252  ? 299 LEU A O   1 
ATOM   2420 C CB  . LEU A  1 322 ? -52.15626 56.47942 38.24608  1.000 31.17963  ? 299 LEU A CB  1 
ATOM   2421 C CG  . LEU A  1 322 ? -52.04305 56.03056 39.69559  1.000 33.57400  ? 299 LEU A CG  1 
ATOM   2422 C CD1 . LEU A  1 322 ? -52.84022 54.71413 39.85043  1.000 38.30759  ? 299 LEU A CD1 1 
ATOM   2423 C CD2 . LEU A  1 322 ? -50.57130 55.87171 40.12716  1.000 36.56510  ? 299 LEU A CD2 1 
ATOM   2424 N N   . LEU A  1 323 ? -54.61273 58.48475 39.45729  1.000 31.34780  ? 300 LEU A N   1 
ATOM   2425 C CA  . LEU A  1 323 ? -54.92156 59.78303 40.06011  1.000 31.07124  ? 300 LEU A CA  1 
ATOM   2426 C C   . LEU A  1 323 ? -53.66071 60.47477 40.58003  1.000 29.38564  ? 300 LEU A C   1 
ATOM   2427 O O   . LEU A  1 323 ? -53.50148 61.69197 40.40864  1.000 32.34379  ? 300 LEU A O   1 
ATOM   2428 C CB  . LEU A  1 323 ? -55.95341 59.61834 41.17547  1.000 35.80052  ? 300 LEU A CB  1 
ATOM   2429 C CG  . LEU A  1 323 ? -56.54144 60.90782 41.75396  1.000 41.42147  ? 300 LEU A CG  1 
ATOM   2430 C CD1 . LEU A  1 323 ? -57.10210 61.79037 40.66227  1.000 35.28271  ? 300 LEU A CD1 1 
ATOM   2431 C CD2 . LEU A  1 323 ? -57.63658 60.57900 42.78195  1.000 41.81295  ? 300 LEU A CD2 1 
ATOM   2432 N N   . ASP A  1 324 ? -52.73673 59.70928 41.18583  1.000 28.91235  ? 301 ASP A N   1 
ATOM   2433 C CA  . ASP A  1 324 ? -51.49118 60.28581 41.69259  1.000 30.01445  ? 301 ASP A CA  1 
ATOM   2434 C C   . ASP A  1 324 ? -50.68803 60.93389 40.57140  1.000 33.14943  ? 301 ASP A C   1 
ATOM   2435 O O   . ASP A  1 324 ? -50.02409 61.95682 40.78871  1.000 32.61359  ? 301 ASP A O   1 
ATOM   2436 C CB  . ASP A  1 324 ? -50.60834 59.22439 42.36139  1.000 32.38065  ? 301 ASP A CB  1 
ATOM   2437 C CG  . ASP A  1 324 ? -51.35085 58.36733 43.38006  1.000 40.87759  ? 301 ASP A CG  1 
ATOM   2438 O OD1 . ASP A  1 324 ? -52.38082 57.75502 43.01114  1.000 40.44137  ? 301 ASP A OD1 1 
ATOM   2439 O OD2 . ASP A  1 324 ? -50.88231 58.30220 44.54619  1.000 43.57523  ? 301 ASP A OD2 1 
ATOM   2440 N N   . ASP A  1 325 ? -50.67168 60.30045 39.38633  1.000 32.30210  ? 302 ASP A N   1 
ATOM   2441 C CA  . ASP A  1 325 ? -49.99295 60.88622 38.22953  1.000 32.00932  ? 302 ASP A CA  1 
ATOM   2442 C C   . ASP A  1 325 ? -50.66264 62.18911 37.81025  1.000 32.93820  ? 302 ASP A C   1 
ATOM   2443 O O   . ASP A  1 325 ? -49.98026 63.18206 37.51733  1.000 31.09337  ? 302 ASP A O   1 
ATOM   2444 C CB  . ASP A  1 325 ? -49.97048 59.90348 37.03536  1.000 30.27786  ? 302 ASP A CB  1 
ATOM   2445 C CG  . ASP A  1 325 ? -48.93118 58.77767 37.19756  1.000 35.33628  ? 302 ASP A CG  1 
ATOM   2446 O OD1 . ASP A  1 325 ? -48.02608 58.92786 38.03696  1.000 34.94830  ? 302 ASP A OD1 1 
ATOM   2447 O OD2 . ASP A  1 325 ? -49.00009 57.76094 36.46396  1.000 37.55710  ? 302 ASP A OD2 1 
ATOM   2448 N N   . PHE A  1 326 ? -51.99946 62.18772 37.71791  1.000 30.23506  ? 303 PHE A N   1 
ATOM   2449 C CA  . PHE A  1 326 ? -52.69387 63.41272 37.33899  1.000 28.66258  ? 303 PHE A CA  1 
ATOM   2450 C C   . PHE A  1 326 ? -52.42221 64.52619 38.34696  1.000 30.97333  ? 303 PHE A C   1 
ATOM   2451 O O   . PHE A  1 326 ? -52.22085 65.68181 37.96885  1.000 32.58891  ? 303 PHE A O   1 
ATOM   2452 C CB  . PHE A  1 326 ? -54.20251 63.14989 37.21667  1.000 27.64811  ? 303 PHE A CB  1 
ATOM   2453 C CG  . PHE A  1 326 ? -54.99117 64.36623 36.76405  1.000 30.53324  ? 303 PHE A CG  1 
ATOM   2454 C CD1 . PHE A  1 326 ? -54.86019 64.85127 35.45621  1.000 37.62144  ? 303 PHE A CD1 1 
ATOM   2455 C CD2 . PHE A  1 326 ? -55.84429 65.02923 37.63221  1.000 34.64782  ? 303 PHE A CD2 1 
ATOM   2456 C CE1 . PHE A  1 326 ? -55.57547 65.97499 35.02652  1.000 37.81387  ? 303 PHE A CE1 1 
ATOM   2457 C CE2 . PHE A  1 326 ? -56.56096 66.17160 37.21258  1.000 38.01524  ? 303 PHE A CE2 1 
ATOM   2458 C CZ  . PHE A  1 326 ? -56.42309 66.63465 35.91171  1.000 39.60365  ? 303 PHE A CZ  1 
ATOM   2459 N N   . VAL A  1 327 ? -52.41801 64.19687 39.63890  1.000 29.39057  ? 304 VAL A N   1 
ATOM   2460 C CA  . VAL A  1 327 ? -52.12355 65.19747 40.65572  1.000 29.56855  ? 304 VAL A CA  1 
ATOM   2461 C C   . VAL A  1 327 ? -50.70662 65.75545 40.47011  1.000 35.86099  ? 304 VAL A C   1 
ATOM   2462 O O   . VAL A  1 327 ? -50.48860 66.96938 40.57966  1.000 31.74028  ? 304 VAL A O   1 
ATOM   2463 C CB  . VAL A  1 327 ? -52.30582 64.59434 42.05632  1.000 30.87059  ? 304 VAL A CB  1 
ATOM   2464 C CG1 . VAL A  1 327 ? -51.60019 65.48712 43.09665  1.000 32.08516  ? 304 VAL A CG1 1 
ATOM   2465 C CG2 . VAL A  1 327 ? -53.80170 64.40280 42.37440  1.000 31.41072  ? 304 VAL A CG2 1 
ATOM   2466 N N   . GLU A  1 328 ? -49.72142 64.88308 40.20250  1.000 31.55939  ? 305 GLU A N   1 
ATOM   2467 C CA  . GLU A  1 328 ? -48.34679 65.36949 39.96585  1.000 31.05966  ? 305 GLU A CA  1 
ATOM   2468 C C   . GLU A  1 328 ? -48.28612 66.33965 38.78184  1.000 29.46630  ? 305 GLU A C   1 
ATOM   2469 O O   . GLU A  1 328 ? -47.63515 67.40058 38.84799  1.000 31.82890  ? 305 GLU A O   1 
ATOM   2470 C CB  . GLU A  1 328 ? -47.41402 64.18831 39.70023  1.000 31.52396  ? 305 GLU A CB  1 
ATOM   2471 C CG  . GLU A  1 328 ? -45.96082 64.60471 39.46237  1.000 38.42825  ? 305 GLU A CG  1 
ATOM   2472 C CD  . GLU A  1 328 ? -45.02159 63.41541 39.37911  1.000 39.13584  ? 305 GLU A CD  1 
ATOM   2473 O OE1 . GLU A  1 328 ? -45.00525 62.70171 38.35918  1.000 36.78111  ? 305 GLU A OE1 1 
ATOM   2474 O OE2 . GLU A  1 328 ? -44.31282 63.18798 40.36121  1.000 41.70824  ? 305 GLU A OE2 1 
ATOM   2475 N N   . ILE A  1 329 ? -48.96609 65.97987 37.68466  1.000 31.86611  ? 306 ILE A N   1 
ATOM   2476 C CA  . ILE A  1 329 ? -48.97859 66.80498 36.47581  1.000 30.61460  ? 306 ILE A CA  1 
ATOM   2477 C C   . ILE A  1 329 ? -49.56950 68.17311 36.77799  1.000 32.81906  ? 306 ILE A C   1 
ATOM   2478 O O   . ILE A  1 329 ? -48.94193 69.21361 36.51568  1.000 32.32367  ? 306 ILE A O   1 
ATOM   2479 C CB  . ILE A  1 329 ? -49.75751 66.08913 35.34767  1.000 31.15771  ? 306 ILE A CB  1 
ATOM   2480 C CG1 . ILE A  1 329 ? -48.99559 64.83980 34.82957  1.000 26.27824  ? 306 ILE A CG1 1 
ATOM   2481 C CG2 . ILE A  1 329 ? -50.07541 67.07131 34.21015  1.000 28.86176  ? 306 ILE A CG2 1 
ATOM   2482 C CD1 . ILE A  1 329 ? -49.94259 63.85114 34.03476  1.000 30.29513  ? 306 ILE A CD1 1 
ATOM   2483 N N   . ILE A  1 330 ? -50.77087 68.20046 37.37059  1.000 30.34793  ? 307 ILE A N   1 
ATOM   2484 C CA  . ILE A  1 330 ? -51.41427 69.49940 37.55525  1.000 29.54123  ? 307 ILE A CA  1 
ATOM   2485 C C   . ILE A  1 330 ? -50.68550 70.31386 38.61044  1.000 32.98833  ? 307 ILE A C   1 
ATOM   2486 O O   . ILE A  1 330 ? -50.61644 71.55337 38.51641  1.000 32.70993  ? 307 ILE A O   1 
ATOM   2487 C CB  . ILE A  1 330 ? -52.91926 69.33917 37.88065  1.000 35.04233  ? 307 ILE A CB  1 
ATOM   2488 C CG1 . ILE A  1 330 ? -53.62969 70.66118 37.57596  1.000 34.86807  ? 307 ILE A CG1 1 
ATOM   2489 C CG2 . ILE A  1 330 ? -53.16231 68.91971 39.35541  1.000 34.42840  ? 307 ILE A CG2 1 
ATOM   2490 C CD1 . ILE A  1 330 ? -55.10519 70.59204 37.66015  1.000 38.04901  ? 307 ILE A CD1 1 
ATOM   2491 N N   . LYS A  1 331 ? -50.07162 69.65811 39.59280  1.000 36.14500  ? 308 LYS A N   1 
ATOM   2492 C CA  . LYS A  1 331 ? -49.29225 70.43676 40.55272  1.000 37.34832  ? 308 LYS A CA  1 
ATOM   2493 C C   . LYS A  1 331 ? -47.92702 70.84923 40.01959  1.000 37.43152  ? 308 LYS A C   1 
ATOM   2494 O O   . LYS A  1 331 ? -47.17253 71.48459 40.75147  1.000 35.36671  ? 308 LYS A O   1 
ATOM   2495 C CB  . LYS A  1 331 ? -49.10194 69.66882 41.85886  1.000 40.10730  ? 308 LYS A CB  1 
ATOM   2496 C CG  . LYS A  1 331 ? -50.38915 69.56057 42.67675  1.000 44.25858  ? 308 LYS A CG  1 
ATOM   2497 C CD  . LYS A  1 331 ? -50.06912 69.08275 44.07474  1.000 51.67933  ? 308 LYS A CD  1 
ATOM   2498 C CE  . LYS A  1 331 ? -51.27791 69.11798 44.96722  1.000 53.12079  ? 308 LYS A CE  1 
ATOM   2499 N NZ  . LYS A  1 331 ? -50.93017 68.58563 46.32051  1.000 61.95513  ? 308 LYS A NZ  1 
ATOM   2500 N N   . SER A  1 332 ? -47.57675 70.49352 38.78590  1.000 34.43593  ? 309 SER A N   1 
ATOM   2501 C CA  . SER A  1 332 ? -46.27113 70.85540 38.24625  1.000 36.00105  ? 309 SER A CA  1 
ATOM   2502 C C   . SER A  1 332 ? -46.37274 71.94453 37.18351  1.000 40.04971  ? 309 SER A C   1 
ATOM   2503 O O   . SER A  1 332 ? -45.43245 72.12038 36.39948  1.000 39.47455  ? 309 SER A O   1 
ATOM   2504 C CB  . SER A  1 332 ? -45.56965 69.62108 37.68293  1.000 40.24268  ? 309 SER A CB  1 
ATOM   2505 O OG  . SER A  1 332 ? -45.45531 68.58711 38.65461  1.000 42.05339  ? 309 SER A OG  1 
ATOM   2506 N N   . GLN A  1 333 ? -47.48139 72.69946 37.16671  1.000 38.02291  ? 310 GLN A N   1 
ATOM   2507 C CA  . GLN A  1 333 ? -47.72952 73.72911 36.16448  1.000 38.77295  ? 310 GLN A CA  1 
ATOM   2508 C C   . GLN A  1 333 ? -47.70350 75.11224 36.79269  1.000 40.81607  ? 310 GLN A C   1 
ATOM   2509 O O   . GLN A  1 333 ? -48.03488 75.28596 37.97047  1.000 39.32541  ? 310 GLN A O   1 
ATOM   2510 C CB  . GLN A  1 333 ? -49.08378 73.53743 35.45930  1.000 34.07223  ? 310 GLN A CB  1 
ATOM   2511 C CG  . GLN A  1 333 ? -49.30074 72.15831 34.84350  1.000 33.87051  ? 310 GLN A CG  1 
ATOM   2512 C CD  . GLN A  1 333 ? -48.14670 71.72314 33.95345  1.000 37.89345  ? 310 GLN A CD  1 
ATOM   2513 O OE1 . GLN A  1 333 ? -47.60382 72.51626 33.18701  1.000 39.53187  ? 310 GLN A OE1 1 
ATOM   2514 N NE2 . GLN A  1 333 ? -47.76126 70.45497 34.05876  1.000 31.44866  ? 310 GLN A NE2 1 
ATOM   2515 N N   . ASP A  1 334 ? -47.27316 76.08788 35.98390  1.000 37.75345  ? 311 ASP A N   1 
ATOM   2516 C CA  . ASP A  1 334 ? -47.34137 77.49841 36.32072  1.000 35.67442  ? 311 ASP A CA  1 
ATOM   2517 C C   . ASP A  1 334 ? -48.76761 77.97042 36.05534  1.000 39.68161  ? 311 ASP A C   1 
ATOM   2518 O O   . ASP A  1 334 ? -49.36592 77.64954 35.01384  1.000 37.84324  ? 311 ASP A O   1 
ATOM   2519 C CB  . ASP A  1 334 ? -46.30937 78.27510 35.48928  1.000 37.22654  ? 311 ASP A CB  1 
ATOM   2520 C CG  . ASP A  1 334 ? -46.36681 79.79021 35.69930  1.000 46.84717  ? 311 ASP A CG  1 
ATOM   2521 O OD1 . ASP A  1 334 ? -47.35791 80.43731 35.31570  1.000 50.74806  ? 311 ASP A OD1 1 
ATOM   2522 O OD2 . ASP A  1 334 ? -45.38520 80.34544 36.20405  1.000 49.11215  ? 311 ASP A OD2 1 
ATOM   2523 N N   . LEU A  1 335 ? -49.33222 78.66093 37.03490  1.000 39.94633  ? 312 LEU A N   1 
ATOM   2524 C CA  . LEU A  1 335 ? -50.74140 79.02492 37.05869  1.000 42.40332  ? 312 LEU A CA  1 
ATOM   2525 C C   . LEU A  1 335 ? -50.95420 80.52265 36.85439  1.000 44.77487  ? 312 LEU A C   1 
ATOM   2526 O O   . LEU A  1 335 ? -52.02123 81.03624 37.21145  1.000 42.78357  ? 312 LEU A O   1 
ATOM   2527 C CB  . LEU A  1 335 ? -51.36521 78.58204 38.38710  1.000 42.98857  ? 312 LEU A CB  1 
ATOM   2528 C CG  . LEU A  1 335 ? -51.23377 77.10515 38.79156  1.000 43.00495  ? 312 LEU A CG  1 
ATOM   2529 C CD1 . LEU A  1 335 ? -51.96939 76.80518 40.09556  1.000 40.67605  ? 312 LEU A CD1 1 
ATOM   2530 C CD2 . LEU A  1 335 ? -51.69771 76.14459 37.68595  1.000 34.95260  ? 312 LEU A CD2 1 
ATOM   2531 N N   . SER A  1 336 ? -49.97189 81.23757 36.27456  1.000 38.70733  ? 313 SER A N   1 
ATOM   2532 C CA  . SER A  1 336 ? -50.01262 82.69956 36.24399  1.000 45.13824  ? 313 SER A CA  1 
ATOM   2533 C C   . SER A  1 336 ? -50.62547 83.29521 34.96818  1.000 55.48021  ? 313 SER A C   1 
ATOM   2534 O O   . SER A  1 336 ? -50.68155 84.52274 34.85208  1.000 51.49464  ? 313 SER A O   1 
ATOM   2535 C CB  . SER A  1 336 ? -48.60212 83.27725 36.42196  1.000 50.71619  ? 313 SER A CB  1 
ATOM   2536 O OG  . SER A  1 336 ? -47.82923 82.89599 35.29614  1.000 52.11271  ? 313 SER A OG  1 
ATOM   2537 N N   . VAL A  1 337 ? -51.13454 82.48541 34.03196  1.000 53.85235  ? 314 VAL A N   1 
ATOM   2538 C CA  . VAL A  1 337 ? -51.64218 82.99257 32.75641  1.000 49.41250  ? 314 VAL A CA  1 
ATOM   2539 C C   . VAL A  1 337 ? -53.06269 82.47180 32.52694  1.000 49.10615  ? 314 VAL A C   1 
ATOM   2540 O O   . VAL A  1 337 ? -53.40026 81.36236 32.95472  1.000 50.73771  ? 314 VAL A O   1 
ATOM   2541 C CB  . VAL A  1 337 ? -50.65163 82.57613 31.63372  1.000 64.37694  ? 314 VAL A CB  1 
ATOM   2542 C CG1 . VAL A  1 337 ? -51.31104 81.73257 30.53305  1.000 62.71459  ? 314 VAL A CG1 1 
ATOM   2543 C CG2 . VAL A  1 337 ? -49.84838 83.79211 31.08178  1.000 63.74586  ? 314 VAL A CG2 1 
ATOM   2544 N N   . VAL A  1 338 ? -53.90473 83.28320 31.85861  1.000 48.58439  ? 315 VAL A N   1 
ATOM   2545 C CA  . VAL A  1 338 ? -55.31859 82.92147 31.67280  1.000 46.25247  ? 315 VAL A CA  1 
ATOM   2546 C C   . VAL A  1 338 ? -55.45765 81.55118 30.98809  1.000 45.41017  ? 315 VAL A C   1 
ATOM   2547 O O   . VAL A  1 338 ? -56.15595 80.66227 31.49520  1.000 43.87146  ? 315 VAL A O   1 
ATOM   2548 C CB  . VAL A  1 338 ? -56.07710 84.02681 30.90860  1.000 50.96349  ? 315 VAL A CB  1 
ATOM   2549 C CG1 . VAL A  1 338 ? -57.50154 83.57463 30.55858  1.000 49.82155  ? 315 VAL A CG1 1 
ATOM   2550 C CG2 . VAL A  1 338 ? -56.15961 85.32950 31.74538  1.000 50.43998  ? 315 VAL A CG2 1 
ATOM   2551 N N   . SER A  1 339 ? -54.78183 81.34224 29.84963  1.000 45.42576  ? 316 SER A N   1 
ATOM   2552 C CA  . SER A  1 339 ? -54.88423 80.05113 29.17428  1.000 44.37350  ? 316 SER A CA  1 
ATOM   2553 C C   . SER A  1 339 ? -53.60562 79.72099 28.41406  1.000 45.39087  ? 316 SER A C   1 
ATOM   2554 O O   . SER A  1 339 ? -52.92501 80.60281 27.88457  1.000 46.55674  ? 316 SER A O   1 
ATOM   2555 C CB  . SER A  1 339 ? -56.08016 80.01000 28.21425  1.000 47.75940  ? 316 SER A CB  1 
ATOM   2556 O OG  . SER A  1 339 ? -55.82201 80.76079 27.04203  1.000 53.96832  ? 316 SER A OG  1 
ATOM   2557 N N   . LYS A  1 340 ? -53.28308 78.42997 28.35911  1.000 42.88522  ? 317 LYS A N   1 
ATOM   2558 C CA  . LYS A  1 340 ? -52.13948 78.00774 27.56342  1.000 40.74723  ? 317 LYS A CA  1 
ATOM   2559 C C   . LYS A  1 340 ? -52.19317 76.50381 27.35432  1.000 39.58794  ? 317 LYS A C   1 
ATOM   2560 O O   . LYS A  1 340 ? -52.93346 75.78202 28.03710  1.000 35.07343  ? 317 LYS A O   1 
ATOM   2561 C CB  . LYS A  1 340 ? -50.81955 78.38242 28.22098  1.000 42.64082  ? 317 LYS A CB  1 
ATOM   2562 C CG  . LYS A  1 340 ? -50.52969 77.61830 29.47640  1.000 41.81807  ? 317 LYS A CG  1 
ATOM   2563 C CD  . LYS A  1 340 ? -49.05588 77.68572 29.71668  1.000 45.81317  ? 317 LYS A CD  1 
ATOM   2564 C CE  . LYS A  1 340 ? -48.65923 77.00124 31.00748  1.000 51.37799  ? 317 LYS A CE  1 
ATOM   2565 N NZ  . LYS A  1 340 ? -47.19766 77.24798 31.17146  1.000 45.00317  ? 317 LYS A NZ  1 
ATOM   2566 N N   . VAL A  1 341 ? -51.38490 76.04907 26.40108  1.000 35.25745  ? 318 VAL A N   1 
ATOM   2567 C CA  . VAL A  1 341 ? -51.25903 74.63310 26.07555  1.000 34.88850  ? 318 VAL A CA  1 
ATOM   2568 C C   . VAL A  1 341 ? -50.16825 74.03613 26.95032  1.000 39.52930  ? 318 VAL A C   1 
ATOM   2569 O O   . VAL A  1 341 ? -49.06985 74.59195 27.04744  1.000 37.68291  ? 318 VAL A O   1 
ATOM   2570 C CB  . VAL A  1 341 ? -50.91046 74.43862 24.59037  1.000 39.10818  ? 318 VAL A CB  1 
ATOM   2571 C CG1 . VAL A  1 341 ? -50.63540 72.94715 24.32022  1.000 36.75679  ? 318 VAL A CG1 1 
ATOM   2572 C CG2 . VAL A  1 341 ? -52.02644 74.98789 23.68832  1.000 43.93009  ? 318 VAL A CG2 1 
ATOM   2573 N N   . VAL A  1 342 ? -50.47093 72.90832 27.57698  1.000 30.94046  ? 319 VAL A N   1 
ATOM   2574 C CA  . VAL A  1 342 ? -49.52790 72.13323 28.37572  1.000 30.34172  ? 319 VAL A CA  1 
ATOM   2575 C C   . VAL A  1 342 ? -49.31687 70.80392 27.65220  1.000 32.07571  ? 319 VAL A C   1 
ATOM   2576 O O   . VAL A  1 342 ? -50.29640 70.12592 27.31575  1.000 33.53353  ? 319 VAL A O   1 
ATOM   2577 C CB  . VAL A  1 342 ? -50.09916 71.91770 29.79249  1.000 36.81692  ? 319 VAL A CB  1 
ATOM   2578 C CG1 . VAL A  1 342 ? -49.31414 70.87414 30.56580  1.000 33.66027  ? 319 VAL A CG1 1 
ATOM   2579 C CG2 . VAL A  1 342 ? -50.15079 73.27868 30.56663  1.000 39.25116  ? 319 VAL A CG2 1 
ATOM   2580 N N   . LYS A  1 343 ? -48.05674 70.45670 27.36727  1.000 31.25857  ? 320 LYS A N   1 
ATOM   2581 C CA  . LYS A  1 343 ? -47.69460 69.17321 26.76188  1.000 32.14921  ? 320 LYS A CA  1 
ATOM   2582 C C   . LYS A  1 343 ? -47.29738 68.17319 27.84278  1.000 32.76226  ? 320 LYS A C   1 
ATOM   2583 O O   . LYS A  1 343 ? -46.47992 68.48673 28.71581  1.000 31.90984  ? 320 LYS A O   1 
ATOM   2584 C CB  . LYS A  1 343 ? -46.52303 69.32335 25.79489  1.000 35.55902  ? 320 LYS A CB  1 
ATOM   2585 C CG  . LYS A  1 343 ? -46.70399 70.40599 24.74084  1.000 45.78258  ? 320 LYS A CG  1 
ATOM   2586 C CD  . LYS A  1 343 ? -47.74221 69.99721 23.71946  1.000 49.45980  ? 320 LYS A CD  1 
ATOM   2587 C CE  . LYS A  1 343 ? -47.95002 71.11313 22.69131  1.000 61.05257  ? 320 LYS A CE  1 
ATOM   2588 N NZ  . LYS A  1 343 ? -47.37787 70.79858 21.35733  1.000 65.64043  ? 320 LYS A NZ  1 
ATOM   2589 N N   . VAL A  1 344 ? -47.84129 66.96723 27.75949  1.000 28.86638  ? 321 VAL A N   1 
ATOM   2590 C CA  . VAL A  1 344 ? -47.51035 65.88034 28.67983  1.000 30.39969  ? 321 VAL A CA  1 
ATOM   2591 C C   . VAL A  1 344 ? -47.24404 64.62731 27.84983  1.000 30.97994  ? 321 VAL A C   1 
ATOM   2592 O O   . VAL A  1 344 ? -48.09639 64.21890 27.04863  1.000 28.14323  ? 321 VAL A O   1 
ATOM   2593 C CB  . VAL A  1 344 ? -48.63600 65.61164 29.69834  1.000 26.66838  ? 321 VAL A CB  1 
ATOM   2594 C CG1 . VAL A  1 344 ? -48.13697 64.66377 30.79015  1.000 29.40389  ? 321 VAL A CG1 1 
ATOM   2595 C CG2 . VAL A  1 344 ? -49.10426 66.91032 30.33619  1.000 26.66774  ? 321 VAL A CG2 1 
ATOM   2596 N N   . THR A  1 345 ? -46.06752 64.03045 28.03369  1.000 25.85073  ? 322 THR A N   1 
ATOM   2597 C CA  . THR A  1 345 ? -45.75229 62.76025 27.38400  1.000 26.86098  ? 322 THR A CA  1 
ATOM   2598 C C   . THR A  1 345 ? -46.53779 61.64967 28.06347  1.000 28.98972  ? 322 THR A C   1 
ATOM   2599 O O   . THR A  1 345 ? -46.33052 61.38249 29.25409  1.000 27.01557  ? 322 THR A O   1 
ATOM   2600 C CB  . THR A  1 345 ? -44.25700 62.45858 27.48955  1.000 29.66037  ? 322 THR A CB  1 
ATOM   2601 O OG1 . THR A  1 345 ? -43.50476 63.60203 27.07019  1.000 32.65811  ? 322 THR A OG1 1 
ATOM   2602 C CG2 . THR A  1 345 ? -43.92503 61.25705 26.59159  1.000 32.38879  ? 322 THR A CG2 1 
ATOM   2603 N N   . ILE A  1 346 ? -47.42814 60.99242 27.30906  1.000 27.63026  ? 323 ILE A N   1 
ATOM   2604 C CA  . ILE A  1 346 ? -48.26557 59.92063 27.83626  1.000 27.10769  ? 323 ILE A CA  1 
ATOM   2605 C C   . ILE A  1 346 ? -48.33325 58.82884 26.78008  1.000 28.31630  ? 323 ILE A C   1 
ATOM   2606 O O   . ILE A  1 346 ? -48.59988 59.11862 25.60569  1.000 28.08051  ? 323 ILE A O   1 
ATOM   2607 C CB  . ILE A  1 346 ? -49.68692 60.42408 28.18333  1.000 26.39810  ? 323 ILE A CB  1 
ATOM   2608 C CG1 . ILE A  1 346 ? -49.61723 61.68122 29.10310  1.000 25.44932  ? 323 ILE A CG1 1 
ATOM   2609 C CG2 . ILE A  1 346 ? -50.48256 59.30248 28.85577  1.000 26.15132  ? 323 ILE A CG2 1 
ATOM   2610 C CD1 . ILE A  1 346 ? -51.00476 62.25688 29.45339  1.000 25.27409  ? 323 ILE A CD1 1 
ATOM   2611 N N   . ASP A  1 347 ? -48.07905 57.58216 27.18599  1.000 25.71570  ? 324 ASP A N   1 
ATOM   2612 C CA  . ASP A  1 347 ? -48.08388 56.46652 26.24170  1.000 24.26936  ? 324 ASP A CA  1 
ATOM   2613 C C   . ASP A  1 347 ? -47.13715 56.75425 25.07567  1.000 27.33380  ? 324 ASP A C   1 
ATOM   2614 O O   . ASP A  1 347 ? -47.44171 56.45042 23.91781  1.000 27.90162  ? 324 ASP A O   1 
ATOM   2615 C CB  . ASP A  1 347 ? -49.51004 56.18903 25.72111  1.000 25.64974  ? 324 ASP A CB  1 
ATOM   2616 C CG  . ASP A  1 347 ? -50.46401 55.74353 26.80303  1.000 32.19481  ? 324 ASP A CG  1 
ATOM   2617 O OD1 . ASP A  1 347 ? -49.99181 55.26800 27.87430  1.000 29.23322  ? 324 ASP A OD1 1 
ATOM   2618 O OD2 . ASP A  1 347 ? -51.70785 55.84277 26.56767  1.000 33.26891  ? 324 ASP A OD2 1 
ATOM   2619 N N   . TYR A  1 348 ? -46.00402 57.40985 25.37930  1.000 28.27246  ? 325 TYR A N   1 
ATOM   2620 C CA  . TYR A  1 348 ? -44.92559 57.75157 24.45549  1.000 31.53214  ? 325 TYR A CA  1 
ATOM   2621 C C   . TYR A  1 348 ? -45.26602 58.90147 23.50258  1.000 37.13573  ? 325 TYR A C   1 
ATOM   2622 O O   . TYR A  1 348 ? -44.38179 59.31668 22.75362  1.000 38.92074  ? 325 TYR A O   1 
ATOM   2623 C CB  . TYR A  1 348 ? -44.45732 56.54323 23.61758  1.000 30.87854  ? 325 TYR A CB  1 
ATOM   2624 C CG  . TYR A  1 348 ? -43.79877 55.47352 24.45819  1.000 32.49193  ? 325 TYR A CG  1 
ATOM   2625 C CD1 . TYR A  1 348 ? -42.58097 55.72100 25.10493  1.000 32.87329  ? 325 TYR A CD1 1 
ATOM   2626 C CD2 . TYR A  1 348 ? -44.38025 54.22018 24.60536  1.000 28.32987  ? 325 TYR A CD2 1 
ATOM   2627 C CE1 . TYR A  1 348 ? -41.96346 54.72916 25.88488  1.000 31.74585  ? 325 TYR A CE1 1 
ATOM   2628 C CE2 . TYR A  1 348 ? -43.77396 53.22055 25.38446  1.000 31.75475  ? 325 TYR A CE2 1 
ATOM   2629 C CZ  . TYR A  1 348 ? -42.55822 53.49771 26.01922  1.000 31.97816  ? 325 TYR A CZ  1 
ATOM   2630 O OH  . TYR A  1 348 ? -41.96293 52.52669 26.79042  1.000 34.17814  ? 325 TYR A OH  1 
ATOM   2631 N N   . THR A  1 349 ? -46.48879 59.45839 23.52533  1.000 27.94096  ? 326 THR A N   1 
ATOM   2632 C CA  . THR A  1 349 ? -46.83557 60.55754 22.62454  1.000 29.78021  ? 326 THR A CA  1 
ATOM   2633 C C   . THR A  1 349 ? -47.02249 61.85449 23.41074  1.000 30.45032  ? 326 THR A C   1 
ATOM   2634 O O   . THR A  1 349 ? -47.25136 61.83357 24.62365  1.000 29.43993  ? 326 THR A O   1 
ATOM   2635 C CB  . THR A  1 349 ? -48.11155 60.22223 21.82131  1.000 26.06629  ? 326 THR A CB  1 
ATOM   2636 O OG1 . THR A  1 349 ? -48.18470 61.04177 20.65279  1.000 32.29908  ? 326 THR A OG1 1 
ATOM   2637 C CG2 . THR A  1 349 ? -49.39311 60.42464 22.64215  1.000 27.82779  ? 326 THR A CG2 1 
ATOM   2638 N N   . GLU A  1 350 ? -46.94563 63.00368 22.71581  1.000 29.26847  ? 327 GLU A N   1 
ATOM   2639 C CA  . GLU A  1 350 ? -47.13722 64.30649 23.37205  1.000 26.31766  ? 327 GLU A CA  1 
ATOM   2640 C C   . GLU A  1 350 ? -48.62148 64.67059 23.35455  1.000 25.82957  ? 327 GLU A C   1 
ATOM   2641 O O   . GLU A  1 350 ? -49.16831 65.01718 22.30421  1.000 28.29583  ? 327 GLU A O   1 
ATOM   2642 C CB  . GLU A  1 350 ? -46.30126 65.39744 22.68678  1.000 31.57884  ? 327 GLU A CB  1 
ATOM   2643 C CG  . GLU A  1 350 ? -44.79327 65.10671 22.70018  1.000 36.79214  ? 327 GLU A CG  1 
ATOM   2644 C CD  . GLU A  1 350 ? -44.22051 65.06805 24.12797  1.000 44.96406  ? 327 GLU A CD  1 
ATOM   2645 O OE1 . GLU A  1 350 ? -43.91526 63.94764 24.62074  1.000 36.68387  ? 327 GLU A OE1 1 
ATOM   2646 O OE2 . GLU A  1 350 ? -44.09718 66.16881 24.75444  1.000 43.09357  ? 327 GLU A OE2 1 
ATOM   2647 N N   . ILE A  1 351 ? -49.28847 64.57958 24.51018  1.000 27.11911  ? 328 ILE A N   1 
ATOM   2648 C CA  . ILE A  1 351 ? -50.69883 64.94686 24.62232  1.000 28.23500  ? 328 ILE A CA  1 
ATOM   2649 C C   . ILE A  1 351 ? -50.78198 66.41946 24.98875  1.000 31.07707  ? 328 ILE A C   1 
ATOM   2650 O O   . ILE A  1 351 ? -50.13301 66.85819 25.94662  1.000 28.00945  ? 328 ILE A O   1 
ATOM   2651 C CB  . ILE A  1 351 ? -51.42639 64.08847 25.67546  1.000 25.44810  ? 328 ILE A CB  1 
ATOM   2652 C CG1 . ILE A  1 351 ? -51.39864 62.59882 25.27580  1.000 28.15062  ? 328 ILE A CG1 1 
ATOM   2653 C CG2 . ILE A  1 351 ? -52.89706 64.55923 25.79574  1.000 25.12226  ? 328 ILE A CG2 1 
ATOM   2654 C CD1 . ILE A  1 351 ? -52.11970 62.32852 23.92642  1.000 31.93128  ? 328 ILE A CD1 1 
ATOM   2655 N N   . SER A  1 352 ? -51.59288 67.18357 24.25189  1.000 28.37588  ? 329 SER A N   1 
ATOM   2656 C CA  . SER A  1 352 ? -51.82818 68.58932 24.59959  1.000 31.74826  ? 329 SER A CA  1 
ATOM   2657 C C   . SER A  1 352 ? -52.99922 68.71391 25.55665  1.000 34.45019  ? 329 SER A C   1 
ATOM   2658 O O   . SER A  1 352 ? -54.08343 68.16672 25.30141  1.000 31.26166  ? 329 SER A O   1 
ATOM   2659 C CB  . SER A  1 352 ? -52.10773 69.45008 23.36617  1.000 30.38466  ? 329 SER A CB  1 
ATOM   2660 O OG  . SER A  1 352 ? -50.96394 69.43961 22.53737  1.000 34.06019  ? 329 SER A OG  1 
ATOM   2661 N N   . PHE A  1 353 ? -52.78854 69.45752 26.63987  1.000 32.23441  ? 330 PHE A N   1 
ATOM   2662 C CA  . PHE A  1 353 ? -53.84845 69.83411 27.57180  1.000 31.79387  ? 330 PHE A CA  1 
ATOM   2663 C C   . PHE A  1 353 ? -54.04985 71.34080 27.50119  1.000 35.44694  ? 330 PHE A C   1 
ATOM   2664 O O   . PHE A  1 353 ? -53.08203 72.09268 27.33610  1.000 34.08755  ? 330 PHE A O   1 
ATOM   2665 C CB  . PHE A  1 353 ? -53.48783 69.47547 29.02121  1.000 30.59281  ? 330 PHE A CB  1 
ATOM   2666 C CG  . PHE A  1 353 ? -53.54823 67.99553 29.35136  1.000 31.51611  ? 330 PHE A CG  1 
ATOM   2667 C CD1 . PHE A  1 353 ? -52.53452 67.12367 28.93794  1.000 27.26539  ? 330 PHE A CD1 1 
ATOM   2668 C CD2 . PHE A  1 353 ? -54.58865 67.49400 30.14773  1.000 31.21572  ? 330 PHE A CD2 1 
ATOM   2669 C CE1 . PHE A  1 353 ? -52.57454 65.77104 29.26594  1.000 29.19326  ? 330 PHE A CE1 1 
ATOM   2670 C CE2 . PHE A  1 353 ? -54.64040 66.13802 30.49052  1.000 33.61749  ? 330 PHE A CE2 1 
ATOM   2671 C CZ  . PHE A  1 353 ? -53.63717 65.26932 30.04734  1.000 32.93765  ? 330 PHE A CZ  1 
ATOM   2672 N N   . MET A  1 354 ? -55.29342 71.79195 27.63108  1.000 31.47863  ? 331 MET A N   1 
ATOM   2673 C CA  . MET A  1 354 ? -55.56835 73.20693 27.82939  1.000 32.60513  ? 331 MET A CA  1 
ATOM   2674 C C   . MET A  1 354 ? -55.62046 73.47731 29.33366  1.000 35.31974  ? 331 MET A C   1 
ATOM   2675 O O   . MET A  1 354 ? -56.30062 72.75692 30.06843  1.000 35.09939  ? 331 MET A O   1 
ATOM   2676 C CB  . MET A  1 354 ? -56.89234 73.59822 27.15771  1.000 33.99102  ? 331 MET A CB  1 
ATOM   2677 C CG  . MET A  1 354 ? -56.82163 73.68150 25.62470  1.000 48.59041  ? 331 MET A CG  1 
ATOM   2678 S SD  . MET A  1 354 ? -55.51060 74.81040 25.01663  1.000 52.92150  ? 331 MET A SD  1 
ATOM   2679 C CE  . MET A  1 354 ? -56.00225 76.33924 25.80125  1.000 40.76451  ? 331 MET A CE  1 
ATOM   2680 N N   . LEU A  1 355 ? -54.86852 74.47368 29.79552  1.000 31.02350  ? 332 LEU A N   1 
ATOM   2681 C CA  . LEU A  1 355 ? -54.87870 74.89902 31.19474  1.000 31.55974  ? 332 LEU A CA  1 
ATOM   2682 C C   . LEU A  1 355 ? -55.42103 76.32665 31.27304  1.000 35.53194  ? 332 LEU A C   1 
ATOM   2683 O O   . LEU A  1 355 ? -54.84092 77.25005 30.67291  1.000 36.52220  ? 332 LEU A O   1 
ATOM   2684 C CB  . LEU A  1 355 ? -53.46821 74.84744 31.79788  1.000 33.42515  ? 332 LEU A CB  1 
ATOM   2685 C CG  . LEU A  1 355 ? -53.32605 75.38050 33.23449  1.000 34.32155  ? 332 LEU A CG  1 
ATOM   2686 C CD1 . LEU A  1 355 ? -54.18208 74.56231 34.22961  1.000 29.02841  ? 332 LEU A CD1 1 
ATOM   2687 C CD2 . LEU A  1 355 ? -51.84450 75.34828 33.65317  1.000 33.44287  ? 332 LEU A CD2 1 
ATOM   2688 N N   . TRP A  1 356 ? -56.51087 76.50357 32.02630  1.000 33.43629  ? 333 TRP A N   1 
ATOM   2689 C CA  . TRP A  1 356 ? -57.15515 77.79435 32.24742  1.000 33.80590  ? 333 TRP A CA  1 
ATOM   2690 C C   . TRP A  1 356 ? -57.07528 78.15108 33.72504  1.000 37.34180  ? 333 TRP A C   1 
ATOM   2691 O O   . TRP A  1 356 ? -57.50555 77.35946 34.57551  1.000 35.48154  ? 333 TRP A O   1 
ATOM   2692 C CB  . TRP A  1 356 ? -58.62037 77.75922 31.82299  1.000 33.80181  ? 333 TRP A CB  1 
ATOM   2693 C CG  . TRP A  1 356 ? -58.80656 77.57683 30.36657  1.000 40.66077  ? 333 TRP A CG  1 
ATOM   2694 C CD1 . TRP A  1 356 ? -58.70388 76.40117 29.65003  1.000 39.36618  ? 333 TRP A CD1 1 
ATOM   2695 C CD2 . TRP A  1 356 ? -59.15809 78.59379 29.42693  1.000 45.55248  ? 333 TRP A CD2 1 
ATOM   2696 N NE1 . TRP A  1 356 ? -58.95846 76.64343 28.31110  1.000 42.79699  ? 333 TRP A NE1 1 
ATOM   2697 C CE2 . TRP A  1 356 ? -59.24571 77.97900 28.15172  1.000 43.33337  ? 333 TRP A CE2 1 
ATOM   2698 C CE3 . TRP A  1 356 ? -59.40933 79.96794 29.53594  1.000 51.04346  ? 333 TRP A CE3 1 
ATOM   2699 C CZ2 . TRP A  1 356 ? -59.56303 78.69908 27.00040  1.000 44.50929  ? 333 TRP A CZ2 1 
ATOM   2700 C CZ3 . TRP A  1 356 ? -59.73022 80.68067 28.38988  1.000 51.62221  ? 333 TRP A CZ3 1 
ATOM   2701 C CH2 . TRP A  1 356 ? -59.79984 80.04773 27.14057  1.000 53.05442  ? 333 TRP A CH2 1 
ATOM   2702 N N   . CYS A  1 357 ? -56.55520 79.34776 34.02180  1.000 36.34225  ? 334 CYS A N   1 
ATOM   2703 C CA  . CYS A  1 357 ? -56.34949 79.80091 35.39155  1.000 40.81528  ? 334 CYS A CA  1 
ATOM   2704 C C   . CYS A  1 357 ? -56.94816 81.18984 35.57365  1.000 44.06268  ? 334 CYS A C   1 
ATOM   2705 O O   . CYS A  1 357 ? -57.07793 81.95803 34.62001  1.000 43.75594  ? 334 CYS A O   1 
ATOM   2706 C CB  . CYS A  1 357 ? -54.85981 79.85040 35.75101  1.000 41.18686  ? 334 CYS A CB  1 
ATOM   2707 S SG  . CYS A  1 357 ? -54.04647 78.24956 35.66619  1.000 38.92615  ? 334 CYS A SG  1 
ATOM   2708 N N   . LYS A  1 358 ? -57.27552 81.51757 36.82349  1.000 42.96842  ? 335 LYS A N   1 
ATOM   2709 C CA  . LYS A  1 358 ? -57.70204 82.86196 37.19428  1.000 46.51151  ? 335 LYS A CA  1 
ATOM   2710 C C   . LYS A  1 358 ? -57.13699 83.16306 38.57453  1.000 49.70004  ? 335 LYS A C   1 
ATOM   2711 O O   . LYS A  1 358 ? -57.30933 82.35958 39.49642  1.000 49.27641  ? 335 LYS A O   1 
ATOM   2712 C CB  . LYS A  1 358 ? -59.24044 82.97709 37.19877  1.000 52.05533  ? 335 LYS A CB  1 
ATOM   2713 C CG  . LYS A  1 358 ? -59.76234 84.36269 37.56501  1.000 58.89266  ? 335 LYS A CG  1 
ATOM   2714 C CD  . LYS A  1 358 ? -61.27350 84.47096 37.35831  1.000 63.80071  ? 335 LYS A CD  1 
ATOM   2715 C CE  . LYS A  1 358 ? -61.76596 85.88727 37.67484  1.000 73.17355  ? 335 LYS A CE  1 
ATOM   2716 N NZ  . LYS A  1 358 ? -60.99270 86.95811 36.95324  1.000 76.43276  ? 335 LYS A NZ  1 
ATOM   2717 N N   . ASP A  1 359 ? -56.44094 84.29607 38.71288  1.000 52.18678  ? 336 ASP A N   1 
ATOM   2718 C CA  . ASP A  1 359 ? -55.94836 84.75670 40.01541  1.000 53.49052  ? 336 ASP A CA  1 
ATOM   2719 C C   . ASP A  1 359 ? -55.07473 83.71523 40.71423  1.000 53.04199  ? 336 ASP A C   1 
ATOM   2720 O O   . ASP A  1 359 ? -55.11747 83.58107 41.93893  1.000 55.89560  ? 336 ASP A O   1 
ATOM   2721 C CB  . ASP A  1 359 ? -57.10734 85.15928 40.93951  1.000 58.18830  ? 336 ASP A CB  1 
ATOM   2722 C CG  . ASP A  1 359 ? -57.91849 86.34301 40.40565  1.000 67.05620  ? 336 ASP A CG  1 
ATOM   2723 O OD1 . ASP A  1 359 ? -57.34284 87.22847 39.73392  1.000 69.21181  ? 336 ASP A OD1 1 
ATOM   2724 O OD2 . ASP A  1 359 ? -59.14598 86.38464 40.66241  1.000 72.24721  ? 336 ASP A OD2 1 
ATOM   2725 N N   . GLY A  1 360 ? -54.30402 82.93629 39.95584  1.000 47.47916  ? 337 GLY A N   1 
ATOM   2726 C CA  . GLY A  1 360 ? -53.40657 81.98672 40.56871  1.000 48.96314  ? 337 GLY A CA  1 
ATOM   2727 C C   . GLY A  1 360 ? -54.01019 80.64867 40.95497  1.000 48.24344  ? 337 GLY A C   1 
ATOM   2728 O O   . GLY A  1 360 ? -53.30623 79.82360 41.55097  1.000 50.79005  ? 337 GLY A O   1 
ATOM   2729 N N   . HIS A  1 361 ? -55.28094 80.39852 40.66030  1.000 49.98405  ? 338 HIS A N   1 
ATOM   2730 C CA  . HIS A  1 361 ? -55.83135 79.06652 40.85308  1.000 47.11408  ? 338 HIS A CA  1 
ATOM   2731 C C   . HIS A  1 361 ? -56.33701 78.52020 39.52527  1.000 43.65688  ? 338 HIS A C   1 
ATOM   2732 O O   . HIS A  1 361 ? -56.56540 79.26436 38.56582  1.000 40.90740  ? 338 HIS A O   1 
ATOM   2733 C CB  . HIS A  1 361 ? -56.95284 79.05212 41.89829  1.000 48.95971  ? 338 HIS A CB  1 
ATOM   2734 C CG  . HIS A  1 361 ? -58.05375 80.02406 41.62117  1.000 57.45649  ? 338 HIS A CG  1 
ATOM   2735 N ND1 . HIS A  1 361 ? -59.07471 79.76293 40.72978  1.000 59.24231  ? 338 HIS A ND1 1 
ATOM   2736 C CD2 . HIS A  1 361 ? -58.30094 81.25628 42.12646  1.000 59.10393  ? 338 HIS A CD2 1 
ATOM   2737 C CE1 . HIS A  1 361 ? -59.89843 80.79533 40.69488  1.000 58.10548  ? 338 HIS A CE1 1 
ATOM   2738 N NE2 . HIS A  1 361 ? -59.44593 81.71740 41.52612  1.000 59.07054  ? 338 HIS A NE2 1 
ATOM   2739 N N   . VAL A  1 362 ? -56.51161 77.19938 39.48576  1.000 37.93840  ? 339 VAL A N   1 
ATOM   2740 C CA  . VAL A  1 362 ? -56.98824 76.52720 38.28159  1.000 35.43723  ? 339 VAL A CA  1 
ATOM   2741 C C   . VAL A  1 362 ? -58.47893 76.76894 38.11431  1.000 38.86442  ? 339 VAL A C   1 
ATOM   2742 O O   . VAL A  1 362 ? -59.23664 76.76720 39.09179  1.000 38.99545  ? 339 VAL A O   1 
ATOM   2743 C CB  . VAL A  1 362 ? -56.69055 75.02539 38.34414  1.000 35.95147  ? 339 VAL A CB  1 
ATOM   2744 C CG1 . VAL A  1 362 ? -57.22512 74.34451 37.07338  1.000 33.53397  ? 339 VAL A CG1 1 
ATOM   2745 C CG2 . VAL A  1 362 ? -55.17567 74.79362 38.50801  1.000 35.81909  ? 339 VAL A CG2 1 
ATOM   2746 N N   . GLU A  1 363 ? -58.90564 76.99873 36.87366  1.000 38.38956  ? 340 GLU A N   1 
ATOM   2747 C CA  . GLU A  1 363 ? -60.32427 76.91569 36.54191  1.000 38.79895  ? 340 GLU A CA  1 
ATOM   2748 C C   . GLU A  1 363 ? -60.67159 75.60258 35.85378  1.000 38.16802  ? 340 GLU A C   1 
ATOM   2749 O O   . GLU A  1 363 ? -61.62496 74.91959 36.25191  1.000 39.04728  ? 340 GLU A O   1 
ATOM   2750 C CB  . GLU A  1 363 ? -60.73104 78.09489 35.66269  1.000 41.84982  ? 340 GLU A CB  1 
ATOM   2751 C CG  . GLU A  1 363 ? -60.50171 79.42039 36.34183  1.000 55.18420  ? 340 GLU A CG  1 
ATOM   2752 C CD  . GLU A  1 363 ? -61.50324 80.46224 35.90221  1.000 65.47780  ? 340 GLU A CD  1 
ATOM   2753 O OE1 . GLU A  1 363 ? -62.39212 80.81082 36.70872  1.000 68.96629  ? 340 GLU A OE1 1 
ATOM   2754 O OE2 . GLU A  1 363 ? -61.40507 80.91536 34.74347  1.000 67.28829  ? 340 GLU A OE2 1 
ATOM   2755 N N   . THR A  1 364 ? -59.91522 75.22957 34.82385  1.000 33.88556  ? 341 THR A N   1 
ATOM   2756 C CA  . THR A  1 364 ? -60.04668 73.89557 34.25809  1.000 33.65264  ? 341 THR A CA  1 
ATOM   2757 C C   . THR A  1 364 ? -58.74348 73.48837 33.56943  1.000 33.43792  ? 341 THR A C   1 
ATOM   2758 O O   . THR A  1 364 ? -57.83741 74.29251 33.33440  1.000 32.29880  ? 341 THR A O   1 
ATOM   2759 C CB  . THR A  1 364 ? -61.24353 73.79505 33.29488  1.000 37.23231  ? 341 THR A CB  1 
ATOM   2760 O OG1 . THR A  1 364 ? -61.44829 72.41183 32.96628  1.000 37.77858  ? 341 THR A OG1 1 
ATOM   2761 C CG2 . THR A  1 364 ? -60.98024 74.59801 32.01771  1.000 39.37969  ? 341 THR A CG2 1 
ATOM   2762 N N   . PHE A  1 365 ? -58.65883 72.20103 33.28080  1.000 32.14880  ? 342 PHE A N   1 
ATOM   2763 C CA  . PHE A  1 365 ? -57.45616 71.57076 32.74151  1.000 30.11569  ? 342 PHE A CA  1 
ATOM   2764 C C   . PHE A  1 365 ? -57.94711 70.29782 32.07439  1.000 36.72110  ? 342 PHE A C   1 
ATOM   2765 O O   . PHE A  1 365 ? -58.56508 69.47057 32.75081  1.000 36.28851  ? 342 PHE A O   1 
ATOM   2766 C CB  . PHE A  1 365 ? -56.48230 71.26595 33.87264  1.000 28.62696  ? 342 PHE A CB  1 
ATOM   2767 C CG  . PHE A  1 365 ? -55.18034 70.64453 33.44156  1.000 32.08326  ? 342 PHE A CG  1 
ATOM   2768 C CD1 . PHE A  1 365 ? -54.35512 71.28123 32.54722  1.000 33.03125  ? 342 PHE A CD1 1 
ATOM   2769 C CD2 . PHE A  1 365 ? -54.77463 69.42643 33.97357  1.000 34.15415  ? 342 PHE A CD2 1 
ATOM   2770 C CE1 . PHE A  1 365 ? -53.12560 70.72199 32.18687  1.000 31.52986  ? 342 PHE A CE1 1 
ATOM   2771 C CE2 . PHE A  1 365 ? -53.55252 68.85048 33.61340  1.000 34.30462  ? 342 PHE A CE2 1 
ATOM   2772 C CZ  . PHE A  1 365 ? -52.73878 69.50201 32.73207  1.000 34.59497  ? 342 PHE A CZ  1 
ATOM   2773 N N   . TYR A  1 366 ? -57.78537 70.17747 30.75456  1.000 31.90354  ? 343 TYR A N   1 
ATOM   2774 C CA  . TYR A  1 366 ? -58.42005 69.06471 30.06044  1.000 32.44847  ? 343 TYR A CA  1 
ATOM   2775 C C   . TYR A  1 366 ? -57.59816 68.68395 28.83773  1.000 37.39647  ? 343 TYR A C   1 
ATOM   2776 O O   . TYR A  1 366 ? -56.99070 69.55957 28.19454  1.000 32.27999  ? 343 TYR A O   1 
ATOM   2777 C CB  . TYR A  1 366 ? -59.87896 69.37974 29.64765  1.000 32.13025  ? 343 TYR A CB  1 
ATOM   2778 C CG  . TYR A  1 366 ? -60.01455 70.63902 28.80398  1.000 36.44585  ? 343 TYR A CG  1 
ATOM   2779 C CD1 . TYR A  1 366 ? -59.94920 70.57954 27.41507  1.000 34.64135  ? 343 TYR A CD1 1 
ATOM   2780 C CD2 . TYR A  1 366 ? -60.16593 71.89331 29.39801  1.000 33.47178  ? 343 TYR A CD2 1 
ATOM   2781 C CE1 . TYR A  1 366 ? -60.06470 71.73443 26.64736  1.000 36.73802  ? 343 TYR A CE1 1 
ATOM   2782 C CE2 . TYR A  1 366 ? -60.26874 73.04746 28.63198  1.000 33.42019  ? 343 TYR A CE2 1 
ATOM   2783 C CZ  . TYR A  1 366 ? -60.22330 72.95052 27.25790  1.000 38.55579  ? 343 TYR A CZ  1 
ATOM   2784 O OH  . TYR A  1 366 ? -60.32512 74.07457 26.48398  1.000 44.71562  ? 343 TYR A OH  1 
ATOM   2785 N N   . PRO A  1 367 ? -57.56901 67.39364 28.49005  1.000 38.17373  ? 344 PRO A N   1 
ATOM   2786 C CA  . PRO A  1 367 ? -56.81046 66.93674 27.32532  1.000 42.68684  ? 344 PRO A CA  1 
ATOM   2787 C C   . PRO A  1 367 ? -57.55982 67.21710 26.04012  1.000 49.85189  ? 344 PRO A C   1 
ATOM   2788 O O   . PRO A  1 367 ? -58.76924 67.46484 26.03179  1.000 48.51331  ? 344 PRO A O   1 
ATOM   2789 C CB  . PRO A  1 367 ? -56.68528 65.42224 27.55448  1.000 39.97430  ? 344 PRO A CB  1 
ATOM   2790 C CG  . PRO A  1 367 ? -57.90125 65.06817 28.33942  1.000 37.97312  ? 344 PRO A CG  1 
ATOM   2791 C CD  . PRO A  1 367 ? -58.23922 66.27342 29.18655  1.000 34.28097  ? 344 PRO A CD  1 
ATOM   2792 N N   . LYS A  1 368 ? -56.80316 67.17296 24.93830  1.000 58.91081  ? 345 LYS A N   1 
ATOM   2793 C CA  . LYS A  1 368 ? -57.35263 67.21120 23.58569  1.000 63.87701  ? 345 LYS A CA  1 
ATOM   2794 C C   . LYS A  1 368 ? -56.93284 65.95529 22.81607  1.000 63.55718  ? 345 LYS A C   1 
ATOM   2795 O O   . LYS A  1 368 ? -55.84495 65.40310 23.03369  1.000 50.17556  ? 345 LYS A O   1 
ATOM   2796 C CB  . LYS A  1 368 ? -56.90268 68.48530 22.85288  1.000 60.58554  ? 345 LYS A CB  1 
ATOM   2797 C CG  . LYS A  1 368 ? -57.09122 69.74249 23.69943  1.000 61.12387  ? 345 LYS A CG  1 
ATOM   2798 C CD  . LYS A  1 368 ? -56.85338 71.02686 22.90073  1.000 64.57221  ? 345 LYS A CD  1 
ATOM   2799 C CE  . LYS A  1 368 ? -55.39300 71.21784 22.53726  1.000 64.93821  ? 345 LYS A CE  1 
ATOM   2800 N NZ  . LYS A  1 368 ? -55.16253 72.44659 21.71759  1.000 70.52372  ? 345 LYS A NZ  1 
ATOM   2801 N N   . LEU A  1 369 ? -57.81421 65.49824 21.92118  1.000 69.47149  ? 346 LEU A N   1 
ATOM   2802 C CA  . LEU A  1 369 ? -57.56425 64.29104 21.12354  1.000 69.46774  ? 346 LEU A CA  1 
ATOM   2803 C C   . LEU A  1 369 ? -57.11868 64.58719 19.68474  1.000 72.60730  ? 346 LEU A C   1 
ATOM   2804 O O   . LEU A  1 369 ? -56.86854 65.73149 19.31281  1.000 76.89682  ? 346 LEU A O   1 
ATOM   2805 C CB  . LEU A  1 369 ? -58.81908 63.40994 21.10359  1.000 65.72284  ? 346 LEU A CB  1 
ATOM   2806 C CG  . LEU A  1 369 ? -58.78089 62.17043 20.20081  1.000 66.07487  ? 346 LEU A CG  1 
ATOM   2807 C CD1 . LEU A  1 369 ? -57.59242 61.27681 20.53429  1.000 61.20452  ? 346 LEU A CD1 1 
ATOM   2808 C CD2 . LEU A  1 369 ? -60.10150 61.37227 20.25667  1.000 70.07801  ? 346 LEU A CD2 1 
ATOM   2809 N N   A ASN B  1 23  ? -62.64061 72.35442 -1.56815  0.550 65.96429  ? 0   ASN B N   1 
ATOM   2810 N N   B ASN B  1 23  ? -58.74481 68.22925 -1.11111  0.450 63.43502  ? 0   ASN B N   1 
ATOM   2811 C CA  A ASN B  1 23  ? -63.90765 71.79599 -1.10044  0.550 63.76625  ? 0   ASN B CA  1 
ATOM   2812 C CA  B ASN B  1 23  ? -60.13818 68.57477 -1.35145  0.450 56.72197  ? 0   ASN B CA  1 
ATOM   2813 C C   A ASN B  1 23  ? -64.28175 70.53551 -1.88395  0.550 53.19542  ? 0   ASN B C   1 
ATOM   2814 C C   B ASN B  1 23  ? -60.97459 67.31573 -1.59212  0.450 53.00051  ? 0   ASN B C   1 
ATOM   2815 O O   A ASN B  1 23  ? -65.31129 70.49015 -2.56256  0.550 47.28272  ? 0   ASN B O   1 
ATOM   2816 O O   B ASN B  1 23  ? -60.61150 66.45138 -2.39328  0.450 51.23392  ? 0   ASN B O   1 
ATOM   2817 C CB  A ASN B  1 23  ? -65.01077 72.83259 -1.20369  0.550 63.95581  ? 0   ASN B CB  1 
ATOM   2818 C CB  B ASN B  1 23  ? -60.25617 69.52888 -2.53044  0.450 57.20283  ? 0   ASN B CB  1 
ATOM   2819 N N   A MET B  1 24  ? -63.41976 69.52509 -1.80137  0.550 49.37027  ? 1   MET B N   1 
ATOM   2820 N N   B MET B  1 24  ? -62.10175 67.21152 -0.89403  0.450 43.79923  ? 1   MET B N   1 
ATOM   2821 C CA  A MET B  1 24  ? -63.69801 68.24069 -2.42889  0.550 42.08080  ? 1   MET B CA  1 
ATOM   2822 C CA  B MET B  1 24  ? -62.95805 66.04762 -1.04027  0.450 41.68516  ? 1   MET B CA  1 
ATOM   2823 C C   A MET B  1 24  ? -64.75691 67.50390 -1.62279  0.550 35.52329  ? 1   MET B C   1 
ATOM   2824 C C   B MET B  1 24  ? -64.40301 66.48770 -0.87041  0.450 35.08452  ? 1   MET B C   1 
ATOM   2825 O O   A MET B  1 24  ? -64.75923 67.54744 -0.39078  0.550 37.41649  ? 1   MET B O   1 
ATOM   2826 O O   B MET B  1 24  ? -64.69241 67.37478 -0.06215  0.450 39.17056  ? 1   MET B O   1 
ATOM   2827 C CB  A MET B  1 24  ? -62.41814 67.40511 -2.51165  0.550 46.04077  ? 1   MET B CB  1 
ATOM   2828 C CB  B MET B  1 24  ? -62.57521 64.95133 -0.03363  0.450 37.24323  ? 1   MET B CB  1 
ATOM   2829 C CG  A MET B  1 24  ? -62.53765 66.13500 -3.32142  0.550 48.92470  ? 1   MET B CG  1 
ATOM   2830 C CG  B MET B  1 24  ? -62.05864 65.49580 1.28173   0.450 39.77027  ? 1   MET B CG  1 
ATOM   2831 S SD  A MET B  1 24  ? -62.86619 66.46271 -5.06053  0.550 52.43155  ? 1   MET B SD  1 
ATOM   2832 S SD  B MET B  1 24  ? -61.36504 64.24512 2.40129   0.450 36.18075  ? 1   MET B SD  1 
ATOM   2833 C CE  A MET B  1 24  ? -61.41258 67.39526 -5.46896  0.550 41.93720  ? 1   MET B CE  1 
ATOM   2834 C CE  B MET B  1 24  ? -60.27337 65.23445 3.40787   0.450 33.31642  ? 1   MET B CE  1 
ATOM   2835 N N   A SER B  1 25  ? -65.66143 66.82802 -2.31749  0.550 32.42333  ? 2   SER B N   1 
ATOM   2836 N N   B SER B  1 25  ? -65.29198 65.88946 -1.66439  0.450 31.78652  ? 2   SER B N   1 
ATOM   2837 C CA  A SER B  1 25  ? -66.72212 66.09549 -1.64229  0.550 31.57213  ? 2   SER B CA  1 
ATOM   2838 C CA  B SER B  1 25  ? -66.72857 66.14036 -1.58954  0.450 31.76755  ? 2   SER B CA  1 
ATOM   2839 C C   A SER B  1 25  ? -67.41345 65.20098 -2.64369  0.550 29.68304  ? 2   SER B C   1 
ATOM   2840 C C   B SER B  1 25  ? -67.47624 65.27594 -2.59627  0.450 29.58270  ? 2   SER B C   1 
ATOM   2841 O O   A SER B  1 25  ? -67.32871 65.41255 -3.85627  0.550 29.63642  ? 2   SER B O   1 
ATOM   2842 O O   B SER B  1 25  ? -67.44563 65.55525 -3.79916  0.450 28.33339  ? 2   SER B O   1 
ATOM   2843 C CB  A SER B  1 25  ? -67.75319 67.02714 -1.02600  0.550 33.99508  ? 2   SER B CB  1 
ATOM   2844 C CB  B SER B  1 25  ? -67.04502 67.62148 -1.83977  0.450 31.84585  ? 2   SER B CB  1 
ATOM   2845 O OG  A SER B  1 25  ? -68.69649 67.45589 -1.99864  0.550 29.17666  ? 2   SER B OG  1 
ATOM   2846 O OG  B SER B  1 25  ? -68.44678 67.82374 -1.97990  0.450 30.90283  ? 2   SER B OG  1 
ATOM   2847 N N   . LEU B  1 26  ? -68.13965 64.22103 -2.11066  1.000 30.16996  ? 3   LEU B N   1 
ATOM   2848 C CA  . LEU B  1 26  ? -68.97016 63.37720 -2.95748  1.000 25.81386  ? 3   LEU B CA  1 
ATOM   2849 C C   . LEU B  1 26  ? -69.92651 64.20546 -3.80529  1.000 25.31464  ? 3   LEU B C   1 
ATOM   2850 O O   . LEU B  1 26  ? -70.06210 63.97830 -5.01520  1.000 24.07882  ? 3   LEU B O   1 
ATOM   2851 C CB  . LEU B  1 26  ? -69.76516 62.40128 -2.06586  1.000 26.57407  ? 3   LEU B CB  1 
ATOM   2852 C CG  . LEU B  1 26  ? -70.86181 61.54017 -2.69017  1.000 28.06451  ? 3   LEU B CG  1 
ATOM   2853 C CD1 . LEU B  1 26  ? -70.19789 60.63499 -3.74772  1.000 27.58227  ? 3   LEU B CD1 1 
ATOM   2854 C CD2 . LEU B  1 26  ? -71.58180 60.70690 -1.59701  1.000 27.57371  ? 3   LEU B CD2 1 
ATOM   2855 N N   . GLU B  1 27  ? -70.64464 65.14048 -3.16853  1.000 23.76313  ? 4   GLU B N   1 
ATOM   2856 C CA  . GLU B  1 27  ? -71.65403 65.89693 -3.89562  1.000 28.37711  ? 4   GLU B CA  1 
ATOM   2857 C C   . GLU B  1 27  ? -71.02670 66.78561 -4.95745  1.000 26.56916  ? 4   GLU B C   1 
ATOM   2858 O O   . GLU B  1 27  ? -71.65736 67.04490 -5.99065  1.000 27.20639  ? 4   GLU B O   1 
ATOM   2859 C CB  . GLU B  1 27  ? -72.51336 66.71871 -2.90949  1.000 27.87100  ? 4   GLU B CB  1 
ATOM   2860 C CG  . GLU B  1 27  ? -73.49863 65.79860 -2.10962  1.000 32.86024  ? 4   GLU B CG  1 
ATOM   2861 C CD  . GLU B  1 27  ? -72.87301 65.08587 -0.88116  1.000 37.27854  ? 4   GLU B CD  1 
ATOM   2862 O OE1 . GLU B  1 27  ? -71.62776 65.12037 -0.68756  1.000 29.54756  ? 4   GLU B OE1 1 
ATOM   2863 O OE2 . GLU B  1 27  ? -73.65128 64.51377 -0.06800  1.000 37.44222  ? 4   GLU B OE2 1 
ATOM   2864 N N   . ASN B  1 28  ? -69.79992 67.26583 -4.72941  1.000 25.53457  ? 5   ASN B N   1 
ATOM   2865 C CA  . ASN B  1 28  ? -69.13942 68.07692 -5.75943  1.000 24.01919  ? 5   ASN B CA  1 
ATOM   2866 C C   . ASN B  1 28  ? -68.65109 67.20977 -6.92208  1.000 25.64797  ? 5   ASN B C   1 
ATOM   2867 O O   . ASN B  1 28  ? -68.72724 67.62879 -8.08781  1.000 26.82711  ? 5   ASN B O   1 
ATOM   2868 C CB  . ASN B  1 28  ? -67.98649 68.87725 -5.13764  1.000 27.40756  ? 5   ASN B CB  1 
ATOM   2869 C CG  . ASN B  1 28  ? -67.14929 69.63886 -6.18624  1.000 31.41861  ? 5   ASN B CG  1 
ATOM   2870 O OD1 . ASN B  1 28  ? -66.01608 69.25293 -6.49171  1.000 29.81242  ? 5   ASN B OD1 1 
ATOM   2871 N ND2 . ASN B  1 28  ? -67.71007 70.72214 -6.73474  1.000 29.17076  ? 5   ASN B ND2 1 
ATOM   2872 N N   . VAL B  1 29  ? -68.12602 66.00819 -6.63743  1.000 25.17352  ? 6   VAL B N   1 
ATOM   2873 C CA  . VAL B  1 29  ? -67.79481 65.07772 -7.71995  1.000 26.26470  ? 6   VAL B CA  1 
ATOM   2874 C C   . VAL B  1 29  ? -69.03440 64.81697 -8.57877  1.000 26.67554  ? 6   VAL B C   1 
ATOM   2875 O O   . VAL B  1 29  ? -68.99891 64.88603 -9.81801  1.000 25.67532  ? 6   VAL B O   1 
ATOM   2876 C CB  . VAL B  1 29  ? -67.22634 63.75430 -7.15363  1.000 25.68952  ? 6   VAL B CB  1 
ATOM   2877 C CG1 . VAL B  1 29  ? -66.98458 62.75071 -8.31547  1.000 22.81274  ? 6   VAL B CG1 1 
ATOM   2878 C CG2 . VAL B  1 29  ? -65.90780 64.00278 -6.40949  1.000 26.79843  ? 6   VAL B CG2 1 
ATOM   2879 N N   . ALA B  1 30  ? -70.16509 64.55322 -7.92923  1.000 24.12152  ? 7   ALA B N   1 
ATOM   2880 C CA  . ALA B  1 30  ? -71.39196 64.29612 -8.68244  1.000 25.02990  ? 7   ALA B CA  1 
ATOM   2881 C C   . ALA B  1 30  ? -71.83196 65.51836 -9.48026  1.000 27.41508  ? 7   ALA B C   1 
ATOM   2882 O O   . ALA B  1 30  ? -72.31320 65.39347 -10.62148 1.000 27.29207  ? 7   ALA B O   1 
ATOM   2883 C CB  . ALA B  1 30  ? -72.49609 63.85098 -7.71852  1.000 23.66090  ? 7   ALA B CB  1 
ATOM   2884 N N   . PHE B  1 31  ? -71.70165 66.71827 -8.89968  1.000 24.93580  ? 8   PHE B N   1 
ATOM   2885 C CA  . PHE B  1 31  ? -72.02840 67.91324 -9.67611  1.000 26.46190  ? 8   PHE B CA  1 
ATOM   2886 C C   . PHE B  1 31  ? -71.20593 67.96815 -10.96766 1.000 28.59135  ? 8   PHE B C   1 
ATOM   2887 O O   . PHE B  1 31  ? -71.72566 68.28452 -12.04679 1.000 26.97115  ? 8   PHE B O   1 
ATOM   2888 C CB  . PHE B  1 31  ? -71.78301 69.17017 -8.83843  1.000 26.80469  ? 8   PHE B CB  1 
ATOM   2889 C CG  . PHE B  1 31  ? -71.93651 70.47011 -9.62356  1.000 27.36357  ? 8   PHE B CG  1 
ATOM   2890 C CD1 . PHE B  1 31  ? -70.84213 71.06260 -10.24011 1.000 30.13590  ? 8   PHE B CD1 1 
ATOM   2891 C CD2 . PHE B  1 31  ? -73.17777 71.09530 -9.71652  1.000 31.43966  ? 8   PHE B CD2 1 
ATOM   2892 C CE1 . PHE B  1 31  ? -70.98476 72.26337 -10.95656 1.000 37.02858  ? 8   PHE B CE1 1 
ATOM   2893 C CE2 . PHE B  1 31  ? -73.33364 72.29746 -10.42739 1.000 37.54372  ? 8   PHE B CE2 1 
ATOM   2894 C CZ  . PHE B  1 31  ? -72.23190 72.87243 -11.04870 1.000 39.97863  ? 8   PHE B CZ  1 
ATOM   2895 N N   . ASN B  1 32  ? -69.90202 67.71689 -10.86681 1.000 27.50638  ? 9   ASN B N   1 
ATOM   2896 C CA  . ASN B  1 32  ? -69.06074 67.76353 -12.05717 1.000 28.97628  ? 9   ASN B CA  1 
ATOM   2897 C C   . ASN B  1 32  ? -69.45945 66.71306 -13.08972 1.000 27.16830  ? 9   ASN B C   1 
ATOM   2898 O O   . ASN B  1 32  ? -69.48756 67.00213 -14.29633 1.000 31.13429  ? 9   ASN B O   1 
ATOM   2899 C CB  . ASN B  1 32  ? -67.59901 67.59623 -11.65339 1.000 27.29941  ? 9   ASN B CB  1 
ATOM   2900 C CG  . ASN B  1 32  ? -66.98736 68.90565 -11.21644 1.000 30.51580  ? 9   ASN B CG  1 
ATOM   2901 O OD1 . ASN B  1 32  ? -66.29373 69.57246 -11.98902 1.000 30.46381  ? 9   ASN B OD1 1 
ATOM   2902 N ND2 . ASN B  1 32  ? -67.26138 69.30101 -9.97949  1.000 27.47647  ? 9   ASN B ND2 1 
ATOM   2903 N N   . VAL B  1 33  ? -69.72781 65.47872 -12.64973 1.000 25.16037  ? 10  VAL B N   1 
ATOM   2904 C CA  . VAL B  1 33  ? -70.13894 64.43781 -13.59445 1.000 25.37285  ? 10  VAL B CA  1 
ATOM   2905 C C   . VAL B  1 33  ? -71.41228 64.87060 -14.32337 1.000 28.01570  ? 10  VAL B C   1 
ATOM   2906 O O   . VAL B  1 33  ? -71.51246 64.79554 -15.56218 1.000 29.55370  ? 10  VAL B O   1 
ATOM   2907 C CB  . VAL B  1 33  ? -70.32432 63.08992 -12.86482 1.000 27.16436  ? 10  VAL B CB  1 
ATOM   2908 C CG1 . VAL B  1 33  ? -70.96158 62.03919 -13.80510 1.000 29.96252  ? 10  VAL B CG1 1 
ATOM   2909 C CG2 . VAL B  1 33  ? -68.95851 62.55355 -12.29111 1.000 26.19815  ? 10  VAL B CG2 1 
ATOM   2910 N N   . VAL B  1 34  ? -72.38283 65.39766 -13.57440 1.000 25.09423  ? 11  VAL B N   1 
ATOM   2911 C CA  . VAL B  1 34  ? -73.66561 65.75116 -14.19471 1.000 25.05609  ? 11  VAL B CA  1 
ATOM   2912 C C   . VAL B  1 34  ? -73.49145 66.88683 -15.19473 1.000 31.86414  ? 11  VAL B C   1 
ATOM   2913 O O   . VAL B  1 34  ? -74.06952 66.85764 -16.28591 1.000 36.63867  ? 11  VAL B O   1 
ATOM   2914 C CB  . VAL B  1 34  ? -74.69424 66.09972 -13.10320 1.000 30.26248  ? 11  VAL B CB  1 
ATOM   2915 C CG1 . VAL B  1 34  ? -75.94946 66.78270 -13.69293 1.000 35.03191  ? 11  VAL B CG1 1 
ATOM   2916 C CG2 . VAL B  1 34  ? -75.04084 64.85091 -12.32432 1.000 30.35602  ? 11  VAL B CG2 1 
ATOM   2917 N N   . ASN B  1 35  ? -72.69887 67.91303 -14.84368 1.000 33.04885  ? 12  ASN B N   1 
ATOM   2918 C CA  . ASN B  1 35  ? -72.64489 69.14383 -15.63201 1.000 31.89993  ? 12  ASN B CA  1 
ATOM   2919 C C   . ASN B  1 35  ? -71.50854 69.18512 -16.64718 1.000 33.81920  ? 12  ASN B C   1 
ATOM   2920 O O   . ASN B  1 35  ? -71.60924 69.92357 -17.62626 1.000 35.05466  ? 12  ASN B O   1 
ATOM   2921 C CB  . ASN B  1 35  ? -72.51493 70.35056 -14.69703 1.000 34.65658  ? 12  ASN B CB  1 
ATOM   2922 C CG  . ASN B  1 35  ? -73.81596 70.64017 -13.95588 1.000 43.09891  ? 12  ASN B CG  1 
ATOM   2923 O OD1 . ASN B  1 35  ? -74.67838 71.29496 -14.49749 1.000 47.78512  ? 12  ASN B OD1 1 
ATOM   2924 N ND2 . ASN B  1 35  ? -73.97051 70.11429 -12.74082 1.000 36.94028  ? 12  ASN B ND2 1 
ATOM   2925 N N   . LYS B  1 36  ? -70.43502 68.42321 -16.44113 1.000 28.39464  ? 13  LYS B N   1 
ATOM   2926 C CA  . LYS B  1 36  ? -69.24653 68.48243 -17.28530 1.000 27.50961  ? 13  LYS B CA  1 
ATOM   2927 C C   . LYS B  1 36  ? -68.86656 67.13244 -17.89900 1.000 29.69818  ? 13  LYS B C   1 
ATOM   2928 O O   . LYS B  1 36  ? -67.90996 67.07857 -18.69445 1.000 31.38073  ? 13  LYS B O   1 
ATOM   2929 C CB  . LYS B  1 36  ? -68.04726 68.99279 -16.46936 1.000 30.38756  ? 13  LYS B CB  1 
ATOM   2930 C CG  . LYS B  1 36  ? -68.32028 70.32931 -15.74655 1.000 38.38338  ? 13  LYS B CG  1 
ATOM   2931 C CD  . LYS B  1 36  ? -68.74761 71.42355 -16.69591 1.000 43.17210  ? 13  LYS B CD  1 
ATOM   2932 C CE  . LYS B  1 36  ? -67.57977 71.98055 -17.46024 1.000 52.45637  ? 13  LYS B CE  1 
ATOM   2933 N NZ  . LYS B  1 36  ? -67.89811 73.34271 -18.07071 1.000 59.78712  ? 13  LYS B NZ  1 
ATOM   2934 N N   . GLY B  1 37  ? -69.56237 66.04832 -17.54727 1.000 28.79708  ? 14  GLY B N   1 
ATOM   2935 C CA  . GLY B  1 37  ? -69.25155 64.71847 -18.05761 1.000 32.00649  ? 14  GLY B CA  1 
ATOM   2936 C C   . GLY B  1 37  ? -68.13698 63.97732 -17.33253 1.000 33.66676  ? 14  GLY B C   1 
ATOM   2937 O O   . GLY B  1 37  ? -67.92232 62.79085 -17.60123 1.000 32.25580  ? 14  GLY B O   1 
ATOM   2938 N N   . HIS B  1 38  ? -67.42679 64.62739 -16.41894 1.000 30.12671  ? 15  HIS B N   1 
ATOM   2939 C CA  . HIS B  1 38  ? -66.29569 64.03073 -15.71008 1.000 28.28210  ? 15  HIS B CA  1 
ATOM   2940 C C   . HIS B  1 38  ? -65.87799 65.07021 -14.68520 1.000 30.03716  ? 15  HIS B C   1 
ATOM   2941 O O   . HIS B  1 38  ? -66.48305 66.14930 -14.64147 1.000 26.62770  ? 15  HIS B O   1 
ATOM   2942 C CB  . HIS B  1 38  ? -65.14418 63.68392 -16.65000 1.000 24.83787  ? 15  HIS B CB  1 
ATOM   2943 C CG  . HIS B  1 38  ? -64.38954 64.87873 -17.14913 1.000 28.03653  ? 15  HIS B CG  1 
ATOM   2944 N ND1 . HIS B  1 38  ? -63.03498 65.04568 -16.94797 1.000 30.34163  ? 15  HIS B ND1 1 
ATOM   2945 C CD2 . HIS B  1 38  ? -64.80274 65.96272 -17.85412 1.000 30.39299  ? 15  HIS B CD2 1 
ATOM   2946 C CE1 . HIS B  1 38  ? -62.64215 66.18204 -17.51156 1.000 33.49591  ? 15  HIS B CE1 1 
ATOM   2947 N NE2 . HIS B  1 38  ? -63.69975 66.76433 -18.05683 1.000 32.39626  ? 15  HIS B NE2 1 
ATOM   2948 N N   . PHE B  1 39  ? -64.87554 64.78282 -13.86328 1.000 29.27693  ? 16  PHE B N   1 
ATOM   2949 C CA  . PHE B  1 39  ? -64.44793 65.75772 -12.86709 1.000 27.60657  ? 16  PHE B CA  1 
ATOM   2950 C C   . PHE B  1 39  ? -63.67359 66.85577 -13.57170 1.000 28.57058  ? 16  PHE B C   1 
ATOM   2951 O O   . PHE B  1 39  ? -62.70394 66.58215 -14.28163 1.000 29.17522  ? 16  PHE B O   1 
ATOM   2952 C CB  . PHE B  1 39  ? -63.59838 65.15352 -11.74755 1.000 26.93008  ? 16  PHE B CB  1 
ATOM   2953 C CG  . PHE B  1 39  ? -63.30579 66.16810 -10.65159 1.000 31.97408  ? 16  PHE B CG  1 
ATOM   2954 C CD1 . PHE B  1 39  ? -64.31077 66.54453 -9.77784  1.000 35.28667  ? 16  PHE B CD1 1 
ATOM   2955 C CD2 . PHE B  1 39  ? -62.07105 66.82237 -10.57516 1.000 32.89954  ? 16  PHE B CD2 1 
ATOM   2956 C CE1 . PHE B  1 39  ? -64.08686 67.50271 -8.80076  1.000 35.92382  ? 16  PHE B CE1 1 
ATOM   2957 C CE2 . PHE B  1 39  ? -61.84454 67.78854 -9.60731  1.000 34.78172  ? 16  PHE B CE2 1 
ATOM   2958 C CZ  . PHE B  1 39  ? -62.86166 68.11331 -8.70832  1.000 33.52585  ? 16  PHE B CZ  1 
ATOM   2959 N N   . ASP B  1 40  ? -64.10172 68.10918 -13.38057 1.000 29.61600  ? 17  ASP B N   1 
ATOM   2960 C CA  . ASP B  1 40  ? -63.47428 69.22917 -14.07807 1.000 33.60378  ? 17  ASP B CA  1 
ATOM   2961 C C   . ASP B  1 40  ? -63.13454 70.36795 -13.11755 1.000 37.27645  ? 17  ASP B C   1 
ATOM   2962 O O   . ASP B  1 40  ? -62.92212 71.49076 -13.55621 1.000 36.26549  ? 17  ASP B O   1 
ATOM   2963 C CB  . ASP B  1 40  ? -64.40877 69.69611 -15.20332 1.000 40.19698  ? 17  ASP B CB  1 
ATOM   2964 C CG  . ASP B  1 40  ? -63.76046 70.68387 -16.17406 1.000 53.95515  ? 17  ASP B CG  1 
ATOM   2965 O OD1 . ASP B  1 40  ? -62.65752 70.41106 -16.71040 1.000 51.61252  ? 17  ASP B OD1 1 
ATOM   2966 O OD2 . ASP B  1 40  ? -64.40298 71.72844 -16.42384 1.000 52.39203  ? 17  ASP B OD2 1 
ATOM   2967 N N   . GLY B  1 41  ? -63.09097 70.11094 -11.81044 1.000 34.12176  ? 18  GLY B N   1 
ATOM   2968 C CA  . GLY B  1 41  ? -62.70652 71.17195 -10.89604 1.000 36.90720  ? 18  GLY B CA  1 
ATOM   2969 C C   . GLY B  1 41  ? -63.71236 72.30169 -10.72756 1.000 37.31264  ? 18  GLY B C   1 
ATOM   2970 O O   . GLY B  1 41  ? -63.34276 73.36941 -10.24314 1.000 37.91819  ? 18  GLY B O   1 
ATOM   2971 N N   . GLN B  1 42  ? -64.98036 72.09825 -11.08909 1.000 33.61235  ? 19  GLN B N   1 
ATOM   2972 C CA  . GLN B  1 42  ? -65.97252 73.16620 -11.02066 1.000 33.65407  ? 19  GLN B CA  1 
ATOM   2973 C C   . GLN B  1 42  ? -66.62464 73.17977 -9.64387  1.000 33.67466  ? 19  GLN B C   1 
ATOM   2974 O O   . GLN B  1 42  ? -66.77467 72.13938 -9.01265  1.000 32.15576  ? 19  GLN B O   1 
ATOM   2975 C CB  . GLN B  1 42  ? -67.04735 72.96466 -12.08952 1.000 34.52973  ? 19  GLN B CB  1 
ATOM   2976 C CG  . GLN B  1 42  ? -66.50935 73.00625 -13.50173 1.000 39.00593  ? 19  GLN B CG  1 
ATOM   2977 C CD  . GLN B  1 42  ? -65.86304 74.33120 -13.79818 1.000 44.56611  ? 19  GLN B CD  1 
ATOM   2978 O OE1 . GLN B  1 42  ? -66.38891 75.38612 -13.42821 1.000 50.49500  ? 19  GLN B OE1 1 
ATOM   2979 N NE2 . GLN B  1 42  ? -64.69568 74.29312 -14.43412 1.000 48.29863  ? 19  GLN B NE2 1 
ATOM   2980 N N   . GLN B  1 43  ? -67.05500 74.36072 -9.19956  1.000 34.31616  ? 20  GLN B N   1 
ATOM   2981 C CA  . GLN B  1 43  ? -67.73693 74.46710 -7.90991  1.000 38.05713  ? 20  GLN B CA  1 
ATOM   2982 C C   . GLN B  1 43  ? -69.21059 74.11323 -8.05944  1.000 39.15544  ? 20  GLN B C   1 
ATOM   2983 O O   . GLN B  1 43  ? -69.82833 74.42093 -9.07757  1.000 40.39701  ? 20  GLN B O   1 
ATOM   2984 C CB  . GLN B  1 43  ? -67.60911 75.88783 -7.34785  1.000 44.05348  ? 20  GLN B CB  1 
ATOM   2985 C CG  . GLN B  1 43  ? -66.29299 76.13580 -6.65182  1.000 54.66919  ? 20  GLN B CG  1 
ATOM   2986 C CD  . GLN B  1 43  ? -66.20333 77.52500 -6.06198  1.000 69.93372  ? 20  GLN B CD  1 
ATOM   2987 O OE1 . GLN B  1 43  ? -67.11785 78.33796 -6.21097  1.000 71.87659  ? 20  GLN B OE1 1 
ATOM   2988 N NE2 . GLN B  1 43  ? -65.09288 77.81031 -5.39068  1.000 80.83110  ? 20  GLN B NE2 1 
ATOM   2989 N N   . GLY B  1 44  ? -69.77740 73.47523 -7.03616  1.000 35.07335  ? 21  GLY B N   1 
ATOM   2990 C CA  . GLY B  1 44  ? -71.19595 73.17205 -7.05980  1.000 32.38544  ? 21  GLY B CA  1 
ATOM   2991 C C   . GLY B  1 44  ? -71.47823 71.83591 -6.40259  1.000 32.06771  ? 21  GLY B C   1 
ATOM   2992 O O   . GLY B  1 44  ? -70.54659 71.06574 -6.11543  1.000 32.77059  ? 21  GLY B O   1 
ATOM   2993 N N   . GLU B  1 45  ? -72.75269 71.54287 -6.14355  1.000 30.00991  ? 22  GLU B N   1 
ATOM   2994 C CA  . GLU B  1 45  ? -73.11967 70.29651 -5.48573  1.000 29.43384  ? 22  GLU B CA  1 
ATOM   2995 C C   . GLU B  1 45  ? -74.47001 69.83337 -6.01685  1.000 33.02784  ? 22  GLU B C   1 
ATOM   2996 O O   . GLU B  1 45  ? -75.29600 70.65474 -6.39415  1.000 31.96630  ? 22  GLU B O   1 
ATOM   2997 C CB  . GLU B  1 45  ? -73.19620 70.47647 -3.95741  1.000 38.04963  ? 22  GLU B CB  1 
ATOM   2998 C CG  . GLU B  1 45  ? -71.85470 70.52694 -3.25210  1.000 53.27628  ? 22  GLU B CG  1 
ATOM   2999 C CD  . GLU B  1 45  ? -71.34480 71.97086 -3.03445  1.000 67.82761  ? 22  GLU B CD  1 
ATOM   3000 O OE1 . GLU B  1 45  ? -72.13144 72.91697 -3.24417  1.000 71.53505  ? 22  GLU B OE1 1 
ATOM   3001 O OE2 . GLU B  1 45  ? -70.15811 72.15455 -2.65776  1.000 67.10286  ? 22  GLU B OE2 1 
ATOM   3002 N N   . VAL B  1 46  ? -74.69544 68.52066 -6.02668  1.000 31.50204  ? 23  VAL B N   1 
ATOM   3003 C CA  . VAL B  1 46  ? -76.03029 67.95949 -6.26055  1.000 33.63232  ? 23  VAL B CA  1 
ATOM   3004 C C   . VAL B  1 46  ? -76.29930 66.92279 -5.17932  1.000 32.35300  ? 23  VAL B C   1 
ATOM   3005 O O   . VAL B  1 46  ? -75.35980 66.32719 -4.63096  1.000 31.06828  ? 23  VAL B O   1 
ATOM   3006 C CB  . VAL B  1 46  ? -76.15186 67.30730 -7.66235  1.000 33.59654  ? 23  VAL B CB  1 
ATOM   3007 C CG1 . VAL B  1 46  ? -76.02584 68.35615 -8.77500  1.000 35.32142  ? 23  VAL B CG1 1 
ATOM   3008 C CG2 . VAL B  1 46  ? -75.12515 66.19039 -7.82592  1.000 29.68217  ? 23  VAL B CG2 1 
ATOM   3009 N N   . PRO B  1 47  ? -77.57144 66.63526 -4.89170  1.000 31.73379  ? 24  PRO B N   1 
ATOM   3010 C CA  . PRO B  1 47  ? -77.87705 65.60981 -3.88935  1.000 29.87596  ? 24  PRO B CA  1 
ATOM   3011 C C   . PRO B  1 47  ? -77.58406 64.23615 -4.44553  1.000 31.78419  ? 24  PRO B C   1 
ATOM   3012 O O   . PRO B  1 47  ? -77.84011 63.96107 -5.61816  1.000 29.66469  ? 24  PRO B O   1 
ATOM   3013 C CB  . PRO B  1 47  ? -79.37966 65.78647 -3.62502  1.000 33.42143  ? 24  PRO B CB  1 
ATOM   3014 C CG  . PRO B  1 47  ? -79.80391 67.05674 -4.36502  1.000 36.64974  ? 24  PRO B CG  1 
ATOM   3015 C CD  . PRO B  1 47  ? -78.79322 67.24222 -5.46070  1.000 31.15139  ? 24  PRO B CD  1 
ATOM   3016 N N   . VAL B  1 48  ? -77.06377 63.35950 -3.58562  1.000 26.04334  ? 25  VAL B N   1 
ATOM   3017 C CA  . VAL B  1 48  ? -76.56444 62.04659 -3.98481  1.000 24.15144  ? 25  VAL B CA  1 
ATOM   3018 C C   . VAL B  1 48  ? -77.14911 61.01958 -3.03078  1.000 26.97529  ? 25  VAL B C   1 
ATOM   3019 O O   . VAL B  1 48  ? -77.25613 61.28625 -1.82527  1.000 25.68428  ? 25  VAL B O   1 
ATOM   3020 C CB  . VAL B  1 48  ? -75.02350 62.01152 -3.93275  1.000 27.46396  ? 25  VAL B CB  1 
ATOM   3021 C CG1 . VAL B  1 48  ? -74.45398 60.55583 -4.09325  1.000 26.70496  ? 25  VAL B CG1 1 
ATOM   3022 C CG2 . VAL B  1 48  ? -74.44040 62.92985 -4.99489  1.000 28.46535  ? 25  VAL B CG2 1 
ATOM   3023 N N   . SER B  1 49  ? -77.54189 59.85907 -3.56592  1.000 25.52290  ? 26  SER B N   1 
ATOM   3024 C CA  . SER B  1 49  ? -77.92348 58.67996 -2.78726  1.000 24.34139  ? 26  SER B CA  1 
ATOM   3025 C C   . SER B  1 49  ? -76.94158 57.57591 -3.09702  1.000 22.84914  ? 26  SER B C   1 
ATOM   3026 O O   . SER B  1 49  ? -76.63731 57.33896 -4.26728  1.000 28.00756  ? 26  SER B O   1 
ATOM   3027 C CB  . SER B  1 49  ? -79.35464 58.13916 -3.12844  1.000 24.81794  ? 26  SER B CB  1 
ATOM   3028 O OG  . SER B  1 49  ? -80.28127 59.13167 -2.87524  1.000 41.24990  ? 26  SER B OG  1 
ATOM   3029 N N   . ILE B  1 50  ? -76.46980 56.88386 -2.06058  1.000 22.52063  ? 27  ILE B N   1 
ATOM   3030 C CA  . ILE B  1 50  ? -75.65180 55.67704 -2.22802  1.000 22.44878  ? 27  ILE B CA  1 
ATOM   3031 C C   . ILE B  1 50  ? -76.45580 54.46651 -1.78897  1.000 25.88809  ? 27  ILE B C   1 
ATOM   3032 O O   . ILE B  1 50  ? -76.89834 54.40152 -0.63192  1.000 24.37971  ? 27  ILE B O   1 
ATOM   3033 C CB  . ILE B  1 50  ? -74.35652 55.73570 -1.39052  1.000 22.39960  ? 27  ILE B CB  1 
ATOM   3034 C CG1 . ILE B  1 50  ? -73.54277 57.01719 -1.65638  1.000 32.91360  ? 27  ILE B CG1 1 
ATOM   3035 C CG2 . ILE B  1 50  ? -73.55252 54.43822 -1.60660  1.000 23.12520  ? 27  ILE B CG2 1 
ATOM   3036 C CD1 . ILE B  1 50  ? -72.85504 57.00369 -2.95793  1.000 33.66908  ? 27  ILE B CD1 1 
ATOM   3037 N N   A ILE B  1 51  ? -76.63709 53.49498 -2.67907  0.472 23.36716  ? 28  ILE B N   1 
ATOM   3038 N N   B ILE B  1 51  ? -76.60636 53.48284 -2.69457  0.528 22.77689  ? 28  ILE B N   1 
ATOM   3039 C CA  A ILE B  1 51  ? -77.34423 52.26123 -2.31784  0.472 24.63914  ? 28  ILE B CA  1 
ATOM   3040 C CA  B ILE B  1 51  ? -77.27814 52.20100 -2.42036  0.528 24.57037  ? 28  ILE B CA  1 
ATOM   3041 C C   A ILE B  1 51  ? -76.55110 51.10233 -2.86954  0.472 24.55198  ? 28  ILE B C   1 
ATOM   3042 C C   B ILE B  1 51  ? -76.75327 51.17050 -3.40234  0.528 23.90865  ? 28  ILE B C   1 
ATOM   3043 O O   A ILE B  1 51  ? -76.33994 51.02859 -4.08315  0.472 24.64128  ? 28  ILE B O   1 
ATOM   3044 O O   B ILE B  1 51  ? -76.48665 51.49559 -4.55462  0.528 24.33983  ? 28  ILE B O   1 
ATOM   3045 C CB  A ILE B  1 51  ? -78.78575 52.20831 -2.85975  0.472 28.78462  ? 28  ILE B CB  1 
ATOM   3046 C CB  B ILE B  1 51  ? -78.82063 52.21403 -2.60390  0.528 29.41133  ? 28  ILE B CB  1 
ATOM   3047 C CG1 A ILE B  1 51  ? -79.52544 53.48613 -2.52720  0.472 34.19825  ? 28  ILE B CG1 1 
ATOM   3048 C CG1 B ILE B  1 51  ? -79.43400 53.58496 -2.40306  0.528 34.71625  ? 28  ILE B CG1 1 
ATOM   3049 C CG2 A ILE B  1 51  ? -79.52070 50.98903 -2.25954  0.472 30.67151  ? 28  ILE B CG2 1 
ATOM   3050 C CG2 B ILE B  1 51  ? -79.50921 51.11220 -1.73390  0.528 29.97866  ? 28  ILE B CG2 1 
ATOM   3051 C CD1 A ILE B  1 51  ? -80.97355 53.45384 -2.88630  0.472 40.92566  ? 28  ILE B CD1 1 
ATOM   3052 C CD1 B ILE B  1 51  ? -80.84832 53.65383 -2.87752  0.528 40.03988  ? 28  ILE B CD1 1 
ATOM   3053 N N   A ASN B  1 52  ? -76.13067 50.19633 -1.99361  0.472 21.85523  ? 29  ASN B N   1 
ATOM   3054 N N   B ASN B  1 52  ? -76.70436 49.90357 -2.96915  0.528 28.25853  ? 29  ASN B N   1 
ATOM   3055 C CA  A ASN B  1 52  ? -75.27455 49.06945 -2.37395  0.472 30.10317  ? 29  ASN B CA  1 
ATOM   3056 C CA  B ASN B  1 52  ? -76.48429 48.74545 -3.86367  0.528 30.11222  ? 29  ASN B CA  1 
ATOM   3057 C C   A ASN B  1 52  ? -74.05257 49.65276 -3.06926  0.472 31.51924  ? 29  ASN B C   1 
ATOM   3058 C C   B ASN B  1 52  ? -75.22647 48.90124 -4.72189  0.528 32.26019  ? 29  ASN B C   1 
ATOM   3059 O O   A ASN B  1 52  ? -73.36070 50.50047 -2.47197  0.472 28.80150  ? 29  ASN B O   1 
ATOM   3060 O O   B ASN B  1 52  ? -75.20990 48.53421 -5.91295  0.528 21.99719  ? 29  ASN B O   1 
ATOM   3061 C CB  A ASN B  1 52  ? -76.08751 48.06403 -3.20514  0.472 29.41486  ? 29  ASN B CB  1 
ATOM   3062 C CB  B ASN B  1 52  ? -77.68948 48.49100 -4.77528  0.528 33.83694  ? 29  ASN B CB  1 
ATOM   3063 C CG  A ASN B  1 52  ? -77.22359 47.43350 -2.41752  0.472 33.10815  ? 29  ASN B CG  1 
ATOM   3064 C CG  B ASN B  1 52  ? -78.98204 48.37664 -4.02188  0.528 32.61530  ? 29  ASN B CG  1 
ATOM   3065 O OD1 A ASN B  1 52  ? -77.04320 47.06522 -1.25718  0.472 35.47012  ? 29  ASN B OD1 1 
ATOM   3066 O OD1 B ASN B  1 52  ? -79.08280 47.65223 -3.03668  0.528 31.86856  ? 29  ASN B OD1 1 
ATOM   3067 N ND2 A ASN B  1 52  ? -78.39702 47.29180 -3.04788  0.472 35.58538  ? 29  ASN B ND2 1 
ATOM   3068 N ND2 B ASN B  1 52  ? -79.97980 49.11249 -4.47655  0.528 31.77446  ? 29  ASN B ND2 1 
ATOM   3069 N N   A ASN B  1 53  ? -73.76609 49.27307 -4.30963  0.472 31.09021  ? 30  ASN B N   1 
ATOM   3070 N N   B ASN B  1 53  ? -74.17672 49.46628 -4.11178  0.528 29.11207  ? 30  ASN B N   1 
ATOM   3071 C CA  A ASN B  1 53  ? -72.59838 49.71283 -5.06213  0.472 28.69148  ? 30  ASN B CA  1 
ATOM   3072 C CA  B ASN B  1 53  ? -72.88731 49.67876 -4.76780  0.528 29.79838  ? 30  ASN B CA  1 
ATOM   3073 C C   A ASN B  1 53  ? -72.95691 50.74573 -6.11861  0.472 27.31432  ? 30  ASN B C   1 
ATOM   3074 C C   B ASN B  1 53  ? -73.04079 50.58373 -5.98687  0.528 27.41859  ? 30  ASN B C   1 
ATOM   3075 O O   A ASN B  1 53  ? -72.26445 50.87866 -7.13489  0.472 26.26802  ? 30  ASN B O   1 
ATOM   3076 O O   B ASN B  1 53  ? -72.28739 50.47144 -6.95759  0.528 28.53897  ? 30  ASN B O   1 
ATOM   3077 C CB  A ASN B  1 53  ? -71.91356 48.52141 -5.73171  0.472 34.87351  ? 30  ASN B CB  1 
ATOM   3078 C CB  B ASN B  1 53  ? -72.23976 48.33026 -5.13359  0.528 33.81796  ? 30  ASN B CB  1 
ATOM   3079 C CG  A ASN B  1 53  ? -70.63275 48.08494 -5.01235  0.472 32.79646  ? 30  ASN B CG  1 
ATOM   3080 C CG  B ASN B  1 53  ? -70.73192 48.28246 -4.83509  0.528 33.63758  ? 30  ASN B CG  1 
ATOM   3081 O OD1 A ASN B  1 53  ? -69.98043 48.87681 -4.30863  0.472 30.52458  ? 30  ASN B OD1 1 
ATOM   3082 O OD1 B ASN B  1 53  ? -70.15832 49.18727 -4.19890  0.528 30.92011  ? 30  ASN B OD1 1 
ATOM   3083 N ND2 A ASN B  1 53  ? -70.26251 46.83650 -5.20580  0.472 36.29685  ? 30  ASN B ND2 1 
ATOM   3084 N ND2 B ASN B  1 53  ? -70.08494 47.23886 -5.32549  0.528 32.33531  ? 30  ASN B ND2 1 
ATOM   3085 N N   . THR B  1 54  ? -74.04810 51.47293 -5.92586  1.000 24.19993  ? 31  THR B N   1 
ATOM   3086 C CA  . THR B  1 54  ? -74.45037 52.39446 -6.97847  1.000 26.83560  ? 31  THR B CA  1 
ATOM   3087 C C   . THR B  1 54  ? -74.59788 53.80312 -6.42591  1.000 27.02360  ? 31  THR B C   1 
ATOM   3088 O O   . THR B  1 54  ? -75.07816 53.99769 -5.30852  1.000 27.84444  ? 31  THR B O   1 
ATOM   3089 C CB  . THR B  1 54  ? -75.74936 51.91908 -7.61406  1.000 31.78878  ? 31  THR B CB  1 
ATOM   3090 O OG1 . THR B  1 54  ? -75.54959 50.57959 -8.08080  1.000 36.06867  ? 31  THR B OG1 1 
ATOM   3091 C CG2 . THR B  1 54  ? -76.17557 52.80684 -8.79263  1.000 31.89088  ? 31  THR B CG2 1 
ATOM   3092 N N   . VAL B  1 55  ? -74.20347 54.78049 -7.23287  1.000 24.44788  ? 32  VAL B N   1 
ATOM   3093 C CA  . VAL B  1 55  ? -74.34288 56.19823 -6.91957  1.000 22.82435  ? 32  VAL B CA  1 
ATOM   3094 C C   . VAL B  1 55  ? -75.50547 56.75952 -7.73266  1.000 25.34124  ? 32  VAL B C   1 
ATOM   3095 O O   . VAL B  1 55  ? -75.51843 56.63158 -8.96187  1.000 24.20946  ? 32  VAL B O   1 
ATOM   3096 C CB  . VAL B  1 55  ? -73.05112 56.95950 -7.25672  1.000 22.00488  ? 32  VAL B CB  1 
ATOM   3097 C CG1 . VAL B  1 55  ? -73.23521 58.45759 -6.91679  1.000 22.46836  ? 32  VAL B CG1 1 
ATOM   3098 C CG2 . VAL B  1 55  ? -71.85295 56.31845 -6.53702  1.000 23.38988  ? 32  VAL B CG2 1 
ATOM   3099 N N   . TYR B  1 56  ? -76.47900 57.39590 -7.06554  1.000 22.06293  ? 33  TYR B N   1 
ATOM   3100 C CA  . TYR B  1 56  ? -77.56660 58.07645 -7.74355  1.000 20.74661  ? 33  TYR B CA  1 
ATOM   3101 C C   . TYR B  1 56  ? -77.51547 59.56314 -7.44437  1.000 29.29842  ? 33  TYR B C   1 
ATOM   3102 O O   . TYR B  1 56  ? -76.98272 59.98801 -6.41283  1.000 26.27123  ? 33  TYR B O   1 
ATOM   3103 C CB  . TYR B  1 56  ? -78.93683 57.57366 -7.27866  1.000 23.00615  ? 33  TYR B CB  1 
ATOM   3104 C CG  . TYR B  1 56  ? -79.12586 56.08269 -7.48432  1.000 28.52376  ? 33  TYR B CG  1 
ATOM   3105 C CD1 . TYR B  1 56  ? -78.57371 55.15563 -6.58063  1.000 31.26748  ? 33  TYR B CD1 1 
ATOM   3106 C CD2 . TYR B  1 56  ? -79.85573 55.60146 -8.57422  1.000 27.90630  ? 33  TYR B CD2 1 
ATOM   3107 C CE1 . TYR B  1 56  ? -78.74961 53.78995 -6.76196  1.000 30.08059  ? 33  TYR B CE1 1 
ATOM   3108 C CE2 . TYR B  1 56  ? -80.05019 54.22500 -8.76755  1.000 30.03398  ? 33  TYR B CE2 1 
ATOM   3109 C CZ  . TYR B  1 56  ? -79.48492 53.33601 -7.85918  1.000 36.58600  ? 33  TYR B CZ  1 
ATOM   3110 O OH  . TYR B  1 56  ? -79.64510 51.99558 -8.04612  1.000 43.28647  ? 33  TYR B OH  1 
ATOM   3111 N N   . THR B  1 57  ? -78.15617 60.34744 -8.32426  1.000 27.04456  ? 34  THR B N   1 
ATOM   3112 C CA  . THR B  1 57  ? -78.44216 61.72975 -8.00424  1.000 28.74753  ? 34  THR B CA  1 
ATOM   3113 C C   . THR B  1 57  ? -79.90416 62.02385 -8.31344  1.000 29.14210  ? 34  THR B C   1 
ATOM   3114 O O   . THR B  1 57  ? -80.54619 61.36170 -9.14204  1.000 31.44336  ? 34  THR B O   1 
ATOM   3115 C CB  . THR B  1 57  ? -77.47686 62.69120 -8.76165  1.000 31.55566  ? 34  THR B CB  1 
ATOM   3116 O OG1 . THR B  1 57  ? -77.68606 64.02764 -8.28119  1.000 31.13570  ? 34  THR B OG1 1 
ATOM   3117 C CG2 . THR B  1 57  ? -77.75815 62.64231 -10.28370 1.000 31.88105  ? 34  THR B CG2 1 
ATOM   3118 N N   . LYS B  1 58  ? -80.44043 63.02310 -7.63131  1.000 29.95072  ? 35  LYS B N   1 
ATOM   3119 C CA  . LYS B  1 58  ? -81.84650 63.35961 -7.74459  1.000 35.60171  ? 35  LYS B CA  1 
ATOM   3120 C C   . LYS B  1 58  ? -82.03430 64.37070 -8.87966  1.000 41.46089  ? 35  LYS B C   1 
ATOM   3121 O O   . LYS B  1 58  ? -81.37524 65.41717 -8.91822  1.000 41.79903  ? 35  LYS B O   1 
ATOM   3122 C CB  . LYS B  1 58  ? -82.34780 63.87088 -6.39083  1.000 40.30623  ? 35  LYS B CB  1 
ATOM   3123 C CG  . LYS B  1 58  ? -83.82343 64.26100 -6.30184  1.000 48.75118  ? 35  LYS B CG  1 
ATOM   3124 C CD  . LYS B  1 58  ? -84.14256 64.99714 -4.95737  1.000 53.70793  ? 35  LYS B CD  1 
ATOM   3125 C CE  . LYS B  1 58  ? -85.07173 64.19631 -4.03764  1.000 65.17225  ? 35  LYS B CE  1 
ATOM   3126 N NZ  . LYS B  1 58  ? -86.53626 64.68237 -4.07125  1.000 71.30005  ? 35  LYS B NZ  1 
ATOM   3127 N N   . VAL B  1 59  ? -82.89353 64.03455 -9.83480  1.000 39.79277  ? 36  VAL B N   1 
ATOM   3128 C CA  . VAL B  1 59  ? -83.19394 64.90945 -10.96204 1.000 42.58894  ? 36  VAL B CA  1 
ATOM   3129 C C   . VAL B  1 59  ? -84.71171 64.98717 -11.04414 1.000 48.73280  ? 36  VAL B C   1 
ATOM   3130 O O   . VAL B  1 59  ? -85.38066 63.95949 -11.21646 1.000 48.87614  ? 36  VAL B O   1 
ATOM   3131 C CB  . VAL B  1 59  ? -82.58908 64.40889 -12.29253 1.000 40.84925  ? 36  VAL B CB  1 
ATOM   3132 C CG1 . VAL B  1 59  ? -82.88304 65.36721 -13.42510 1.000 49.05450  ? 36  VAL B CG1 1 
ATOM   3133 C CG2 . VAL B  1 59  ? -81.10692 64.15853 -12.18148 1.000 37.51242  ? 36  VAL B CG2 1 
ATOM   3134 N N   . ASP B  1 60  ? -85.26215 66.19239 -10.86456 1.000 51.67126  ? 37  ASP B N   1 
ATOM   3135 C CA  . ASP B  1 60  ? -86.71392 66.39350 -10.87509 1.000 50.30347  ? 37  ASP B CA  1 
ATOM   3136 C C   . ASP B  1 60  ? -87.42751 65.43255 -9.92664  1.000 51.89827  ? 37  ASP B C   1 
ATOM   3137 O O   . ASP B  1 60  ? -88.46036 64.85030 -10.26438 1.000 57.65180  ? 37  ASP B O   1 
ATOM   3138 C CB  . ASP B  1 60  ? -87.30757 66.24133 -12.28076 1.000 67.81720  ? 37  ASP B CB  1 
ATOM   3139 C CG  . ASP B  1 60  ? -86.58589 67.05474 -13.33949 1.000 77.65700  ? 37  ASP B CG  1 
ATOM   3140 O OD1 . ASP B  1 60  ? -86.40054 66.50150 -14.45838 1.000 77.46131  ? 37  ASP B OD1 1 
ATOM   3141 O OD2 . ASP B  1 60  ? -86.22394 68.22600 -13.05995 1.000 76.68895  ? 37  ASP B OD2 1 
ATOM   3142 N N   . GLY B  1 61  ? -86.87309 65.23902 -8.74238  1.000 45.69164  ? 38  GLY B N   1 
ATOM   3143 C CA  . GLY B  1 61  ? -87.55182 64.40245 -7.77777  1.000 51.19734  ? 38  GLY B CA  1 
ATOM   3144 C C   . GLY B  1 61  ? -87.40315 62.89343 -7.95024  1.000 48.43001  ? 38  GLY B C   1 
ATOM   3145 O O   . GLY B  1 61  ? -88.05197 62.14347 -7.20980  1.000 50.67430  ? 38  GLY B O   1 
ATOM   3146 N N   . VAL B  1 62  ? -86.60967 62.40349 -8.90802  1.000 40.87119  ? 39  VAL B N   1 
ATOM   3147 C CA  . VAL B  1 62  ? -86.39866 60.96072 -8.99578  1.000 36.14401  ? 39  VAL B CA  1 
ATOM   3148 C C   . VAL B  1 62  ? -84.91342 60.67987 -9.10905  1.000 31.42530  ? 39  VAL B C   1 
ATOM   3149 O O   . VAL B  1 62  ? -84.12832 61.52670 -9.54343  1.000 35.56785  ? 39  VAL B O   1 
ATOM   3150 C CB  . VAL B  1 62  ? -87.16171 60.29347 -10.16230 1.000 38.46768  ? 39  VAL B CB  1 
ATOM   3151 C CG1 . VAL B  1 62  ? -88.68992 60.52712 -10.01232 1.000 43.44153  ? 39  VAL B CG1 1 
ATOM   3152 C CG2 . VAL B  1 62  ? -86.61795 60.76898 -11.51712 1.000 38.16778  ? 39  VAL B CG2 1 
ATOM   3153 N N   . ASP B  1 63  ? -84.54114 59.45022 -8.73493  1.000 28.93868  ? 40  ASP B N   1 
ATOM   3154 C CA  . ASP B  1 63  ? -83.14057 59.05159 -8.65543  1.000 28.15522  ? 40  ASP B CA  1 
ATOM   3155 C C   . ASP B  1 63  ? -82.65742 58.58443 -10.02059 1.000 29.49663  ? 40  ASP B C   1 
ATOM   3156 O O   . ASP B  1 63  ? -83.32768 57.79724 -10.69306 1.000 34.45234  ? 40  ASP B O   1 
ATOM   3157 C CB  . ASP B  1 63  ? -82.96757 57.95465 -7.59582  1.000 30.40275  ? 40  ASP B CB  1 
ATOM   3158 C CG  . ASP B  1 63  ? -83.20682 58.49380 -6.17136  1.000 43.16736  ? 40  ASP B CG  1 
ATOM   3159 O OD1 . ASP B  1 63  ? -82.87670 59.67904 -5.92338  1.000 37.03048  ? 40  ASP B OD1 1 
ATOM   3160 O OD2 . ASP B  1 63  ? -83.75824 57.75634 -5.31868  1.000 44.75593  ? 40  ASP B OD2 1 
ATOM   3161 N N   . VAL B  1 64  ? -81.49895 59.07387 -10.42894 1.000 27.14055  ? 41  VAL B N   1 
ATOM   3162 C CA  . VAL B  1 64  ? -80.90417 58.71408 -11.70139 1.000 27.19418  ? 41  VAL B CA  1 
ATOM   3163 C C   . VAL B  1 64  ? -79.52586 58.14490 -11.42409 1.000 29.45607  ? 41  VAL B C   1 
ATOM   3164 O O   . VAL B  1 64  ? -78.71583 58.78143 -10.73836 1.000 28.62582  ? 41  VAL B O   1 
ATOM   3165 C CB  . VAL B  1 64  ? -80.79625 59.92573 -12.64917 1.000 29.21655  ? 41  VAL B CB  1 
ATOM   3166 C CG1 . VAL B  1 64  ? -80.13892 59.48609 -13.92276 1.000 32.39555  ? 41  VAL B CG1 1 
ATOM   3167 C CG2 . VAL B  1 64  ? -82.18501 60.51634 -12.91942 1.000 33.29751  ? 41  VAL B CG2 1 
ATOM   3168 N N   . GLU B  1 65  ? -79.24160 56.97444 -11.99275 1.000 26.41321  ? 42  GLU B N   1 
ATOM   3169 C CA  . GLU B  1 65  ? -77.94747 56.32420 -11.76538 1.000 27.12404  ? 42  GLU B CA  1 
ATOM   3170 C C   . GLU B  1 65  ? -76.79054 57.04871 -12.46305 1.000 29.74098  ? 42  GLU B C   1 
ATOM   3171 O O   . GLU B  1 65  ? -76.81432 57.26848 -13.67730 1.000 31.91511  ? 42  GLU B O   1 
ATOM   3172 C CB  . GLU B  1 65  ? -78.01452 54.87626 -12.25590 1.000 30.00226  ? 42  GLU B CB  1 
ATOM   3173 C CG  . GLU B  1 65  ? -76.66859 54.15589 -12.12627 1.000 36.46888  ? 42  GLU B CG  1 
ATOM   3174 C CD  . GLU B  1 65  ? -76.71299 52.75262 -12.73562 1.000 47.55298  ? 42  GLU B CD  1 
ATOM   3175 O OE1 . GLU B  1 65  ? -77.67393 51.99954 -12.44765 1.000 43.79966  ? 42  GLU B OE1 1 
ATOM   3176 O OE2 . GLU B  1 65  ? -75.79317 52.44235 -13.52615 1.000 56.16644  ? 42  GLU B OE2 1 
ATOM   3177 N N   . LEU B  1 66  ? -75.75586 57.39300 -11.70086 1.000 24.79269  ? 43  LEU B N   1 
ATOM   3178 C CA  . LEU B  1 66  ? -74.52943 57.96321 -12.24874 1.000 26.38165  ? 43  LEU B CA  1 
ATOM   3179 C C   . LEU B  1 66  ? -73.39217 56.95854 -12.38458 1.000 31.00252  ? 43  LEU B C   1 
ATOM   3180 O O   . LEU B  1 66  ? -72.51476 57.16047 -13.23072 1.000 31.58990  ? 43  LEU B O   1 
ATOM   3181 C CB  . LEU B  1 66  ? -74.03142 59.12001 -11.37119 1.000 28.45818  ? 43  LEU B CB  1 
ATOM   3182 C CG  . LEU B  1 66  ? -74.92660 60.34810 -11.23319 1.000 33.91510  ? 43  LEU B CG  1 
ATOM   3183 C CD1 . LEU B  1 66  ? -74.17548 61.45175 -10.48818 1.000 31.64069  ? 43  LEU B CD1 1 
ATOM   3184 C CD2 . LEU B  1 66  ? -75.40414 60.83003 -12.61059 1.000 34.58985  ? 43  LEU B CD2 1 
ATOM   3185 N N   . PHE B  1 67  ? -73.35078 55.90606 -11.55440 1.000 27.22456  ? 44  PHE B N   1 
ATOM   3186 C CA  . PHE B  1 67  ? -72.14929 55.06221 -11.48351 1.000 24.30854  ? 44  PHE B CA  1 
ATOM   3187 C C   . PHE B  1 67  ? -72.47816 53.75152 -10.78474 1.000 32.99343  ? 44  PHE B C   1 
ATOM   3188 O O   . PHE B  1 67  ? -73.03232 53.75822 -9.67915  1.000 28.96624  ? 44  PHE B O   1 
ATOM   3189 C CB  . PHE B  1 67  ? -71.03541 55.78821 -10.70562 1.000 22.40568  ? 44  PHE B CB  1 
ATOM   3190 C CG  . PHE B  1 67  ? -69.75321 54.97696 -10.54467 1.000 23.87708  ? 44  PHE B CG  1 
ATOM   3191 C CD1 . PHE B  1 67  ? -68.84417 54.86433 -11.59834 1.000 24.00733  ? 44  PHE B CD1 1 
ATOM   3192 C CD2 . PHE B  1 67  ? -69.45400 54.34197 -9.33778  1.000 24.66813  ? 44  PHE B CD2 1 
ATOM   3193 C CE1 . PHE B  1 67  ? -67.62829 54.11836 -11.44073 1.000 25.13883  ? 44  PHE B CE1 1 
ATOM   3194 C CE2 . PHE B  1 67  ? -68.26381 53.59169 -9.18750  1.000 24.16834  ? 44  PHE B CE2 1 
ATOM   3195 C CZ  . PHE B  1 67  ? -67.36016 53.48614 -10.23316 1.000 24.56416  ? 44  PHE B CZ  1 
ATOM   3196 N N   . GLU B  1 68  ? -72.12206 52.63170 -11.40104 1.000 28.92932  ? 45  GLU B N   1 
ATOM   3197 C CA  . GLU B  1 68  ? -72.25598 51.33585 -10.75442 1.000 26.65972  ? 45  GLU B CA  1 
ATOM   3198 C C   . GLU B  1 68  ? -70.85127 50.83055 -10.46345 1.000 29.19817  ? 45  GLU B C   1 
ATOM   3199 O O   . GLU B  1 68  ? -70.05233 50.63999 -11.38702 1.000 31.95302  ? 45  GLU B O   1 
ATOM   3200 C CB  . GLU B  1 68  ? -73.01522 50.32887 -11.62240 1.000 24.87491  ? 45  GLU B CB  1 
ATOM   3201 C CG  . GLU B  1 68  ? -73.24601 49.01885 -10.87064 1.000 40.98655  ? 45  GLU B CG  1 
ATOM   3202 C CD  . GLU B  1 68  ? -73.76162 47.87724 -11.76490 1.000 52.09882  ? 45  GLU B CD  1 
ATOM   3203 O OE1 . GLU B  1 68  ? -74.02920 48.11456 -12.96724 1.000 52.67296  ? 45  GLU B OE1 1 
ATOM   3204 O OE2 . GLU B  1 68  ? -73.88992 46.74876 -11.24899 1.000 51.99604  ? 45  GLU B OE2 1 
ATOM   3205 N N   . ASN B  1 69  ? -70.55477 50.60036 -9.19377  1.000 26.37638  ? 46  ASN B N   1 
ATOM   3206 C CA  . ASN B  1 69  ? -69.20687 50.21681 -8.78967  1.000 25.52448  ? 46  ASN B CA  1 
ATOM   3207 C C   . ASN B  1 69  ? -68.96736 48.75474 -9.13868  1.000 27.05720  ? 46  ASN B C   1 
ATOM   3208 O O   . ASN B  1 69  ? -69.64679 47.87291 -8.60849  1.000 25.80831  ? 46  ASN B O   1 
ATOM   3209 C CB  . ASN B  1 69  ? -69.04062 50.43558 -7.28318  1.000 27.47598  ? 46  ASN B CB  1 
ATOM   3210 C CG  . ASN B  1 69  ? -67.63335 50.09459 -6.79309  1.000 27.88176  ? 46  ASN B CG  1 
ATOM   3211 O OD1 . ASN B  1 69  ? -66.66412 50.17033 -7.56696  1.000 25.62937  ? 46  ASN B OD1 1 
ATOM   3212 N ND2 . ASN B  1 69  ? -67.51432 49.72215 -5.50018  1.000 21.19796  ? 46  ASN B ND2 1 
ATOM   3213 N N   . LYS B  1 70  ? -67.99433 48.48647 -10.01071 1.000 25.73245  ? 47  LYS B N   1 
ATOM   3214 C CA  . LYS B  1 70  ? -67.55699 47.11807 -10.29807 1.000 29.50684  ? 47  LYS B CA  1 
ATOM   3215 C C   . LYS B  1 70  ? -66.17231 46.82915 -9.72952  1.000 30.50326  ? 47  LYS B C   1 
ATOM   3216 O O   . LYS B  1 70  ? -65.60561 45.76140 -10.00887 1.000 28.69452  ? 47  LYS B O   1 
ATOM   3217 C CB  . LYS B  1 70  ? -67.56453 46.85971 -11.81186 1.000 34.52153  ? 47  LYS B CB  1 
ATOM   3218 C CG  . LYS B  1 70  ? -68.91223 47.27409 -12.45070 1.000 43.58000  ? 47  LYS B CG  1 
ATOM   3219 C CD  . LYS B  1 70  ? -69.72555 46.11869 -12.97436 1.000 53.93937  ? 47  LYS B CD  1 
ATOM   3220 C CE  . LYS B  1 70  ? -69.91657 45.00507 -11.95239 1.000 65.18974  ? 47  LYS B CE  1 
ATOM   3221 N NZ  . LYS B  1 70  ? -70.61883 43.81858 -12.56081 1.000 69.61948  ? 47  LYS B NZ  1 
ATOM   3222 N N   . THR B  1 71  ? -65.62152 47.74022 -8.92365  1.000 27.08749  ? 48  THR B N   1 
ATOM   3223 C CA  . THR B  1 71  ? -64.25568 47.61259 -8.41462  1.000 24.07655  ? 48  THR B CA  1 
ATOM   3224 C C   . THR B  1 71  ? -64.29386 46.95325 -7.04799  1.000 27.64846  ? 48  THR B C   1 
ATOM   3225 O O   . THR B  1 71  ? -65.36068 46.74580 -6.46100  1.000 27.67817  ? 48  THR B O   1 
ATOM   3226 C CB  . THR B  1 71  ? -63.55783 48.97331 -8.28085  1.000 26.46088  ? 48  THR B CB  1 
ATOM   3227 O OG1 . THR B  1 71  ? -63.93791 49.59392 -7.04054  1.000 24.45718  ? 48  THR B OG1 1 
ATOM   3228 C CG2 . THR B  1 71  ? -63.86638 49.89406 -9.43800  1.000 24.58537  ? 48  THR B CG2 1 
ATOM   3229 N N   . THR B  1 72  ? -63.10761 46.66914 -6.51005  1.000 28.06865  ? 49  THR B N   1 
ATOM   3230 C CA  . THR B  1 72  ? -63.01176 46.21603 -5.12738  1.000 30.44515  ? 49  THR B CA  1 
ATOM   3231 C C   . THR B  1 72  ? -62.79252 47.37311 -4.12249  1.000 29.22082  ? 49  THR B C   1 
ATOM   3232 O O   . THR B  1 72  ? -62.54350 47.11363 -2.94040  1.000 27.69131  ? 49  THR B O   1 
ATOM   3233 C CB  . THR B  1 72  ? -61.89969 45.17917 -5.00926  1.000 30.93526  ? 49  THR B CB  1 
ATOM   3234 O OG1 . THR B  1 72  ? -60.67996 45.76617 -5.43901  1.000 31.08143  ? 49  THR B OG1 1 
ATOM   3235 C CG2 . THR B  1 72  ? -62.20192 43.97791 -5.93995  1.000 31.80958  ? 49  THR B CG2 1 
ATOM   3236 N N   . LEU B  1 73  ? -62.92420 48.62046 -4.55740  1.000 22.89958  ? 50  LEU B N   1 
ATOM   3237 C CA  . LEU B  1 73  ? -62.87112 49.80654 -3.70194  1.000 24.51992  ? 50  LEU B CA  1 
ATOM   3238 C C   . LEU B  1 73  ? -64.25922 50.14225 -3.17453  1.000 24.32233  ? 50  LEU B C   1 
ATOM   3239 O O   . LEU B  1 73  ? -65.27038 49.72250 -3.75347  1.000 24.42752  ? 50  LEU B O   1 
ATOM   3240 C CB  . LEU B  1 73  ? -62.32218 51.00613 -4.49306  1.000 22.16865  ? 50  LEU B CB  1 
ATOM   3241 C CG  . LEU B  1 73  ? -60.85755 50.86464 -4.92840  1.000 29.21499  ? 50  LEU B CG  1 
ATOM   3242 C CD1 . LEU B  1 73  ? -60.48325 52.03735 -5.78254  1.000 26.52470  ? 50  LEU B CD1 1 
ATOM   3243 C CD2 . LEU B  1 73  ? -59.97641 50.84566 -3.71185  1.000 29.58295  ? 50  LEU B CD2 1 
ATOM   3244 N N   . PRO B  1 74  ? -64.34748 50.91179 -2.08679  1.000 26.03581  ? 51  PRO B N   1 
ATOM   3245 C CA  . PRO B  1 74  ? -65.66402 51.42317 -1.65433  1.000 25.67295  ? 51  PRO B CA  1 
ATOM   3246 C C   . PRO B  1 74  ? -66.32614 52.22289 -2.77131  1.000 24.14276  ? 51  PRO B C   1 
ATOM   3247 O O   . PRO B  1 74  ? -65.66044 52.94538 -3.52364  1.000 23.85532  ? 51  PRO B O   1 
ATOM   3248 C CB  . PRO B  1 74  ? -65.33099 52.30851 -0.44078  1.000 24.07285  ? 51  PRO B CB  1 
ATOM   3249 C CG  . PRO B  1 74  ? -63.94239 51.71483 0.07805   1.000 23.16544  ? 51  PRO B CG  1 
ATOM   3250 C CD  . PRO B  1 74  ? -63.24213 51.29533 -1.17897  1.000 25.48556  ? 51  PRO B CD  1 
ATOM   3251 N N   . VAL B  1 75  ? -67.65754 52.09954 -2.85716  1.000 21.02468  ? 52  VAL B N   1 
ATOM   3252 C CA  . VAL B  1 75  ? -68.42489 52.70242 -3.96027  1.000 24.75251  ? 52  VAL B CA  1 
ATOM   3253 C C   . VAL B  1 75  ? -68.09479 54.18604 -4.15949  1.000 24.60985  ? 52  VAL B C   1 
ATOM   3254 O O   . VAL B  1 75  ? -67.92011 54.64740 -5.29484  1.000 22.47718  ? 52  VAL B O   1 
ATOM   3255 C CB  . VAL B  1 75  ? -69.94212 52.49330 -3.73883  1.000 26.04677  ? 52  VAL B CB  1 
ATOM   3256 C CG1 . VAL B  1 75  ? -70.41876 53.05232 -2.39421  1.000 23.50764  ? 52  VAL B CG1 1 
ATOM   3257 C CG2 . VAL B  1 75  ? -70.76698 53.12649 -4.88060  1.000 24.14191  ? 52  VAL B CG2 1 
ATOM   3258 N N   . ASN B  1 76  ? -68.08258 54.97910 -3.08176  1.000 21.21722  ? 53  ASN B N   1 
ATOM   3259 C CA  . ASN B  1 76  ? -67.90242 56.42633 -3.25144  1.000 22.83146  ? 53  ASN B CA  1 
ATOM   3260 C C   . ASN B  1 76  ? -66.47194 56.76374 -3.65669  1.000 25.09123  ? 53  ASN B C   1 
ATOM   3261 O O   . ASN B  1 76  ? -66.23685 57.77331 -4.33464  1.000 25.21107  ? 53  ASN B O   1 
ATOM   3262 C CB  . ASN B  1 76  ? -68.23890 57.19620 -1.96154  1.000 26.98685  ? 53  ASN B CB  1 
ATOM   3263 C CG  . ASN B  1 76  ? -67.32861 56.80324 -0.79310  1.000 25.90147  ? 53  ASN B CG  1 
ATOM   3264 O OD1 . ASN B  1 76  ? -67.23231 55.62589 -0.46628  1.000 23.64311  ? 53  ASN B OD1 1 
ATOM   3265 N ND2 . ASN B  1 76  ? -66.67215 57.79090 -0.15630  1.000 23.44854  ? 53  ASN B ND2 1 
ATOM   3266 N N   . VAL B  1 77  ? -65.51542 55.92809 -3.26085  1.000 23.79360  ? 54  VAL B N   1 
ATOM   3267 C CA  . VAL B  1 77  ? -64.11545 56.12599 -3.66113  1.000 23.00276  ? 54  VAL B CA  1 
ATOM   3268 C C   . VAL B  1 77  ? -63.93337 55.79637 -5.14242  1.000 25.27018  ? 54  VAL B C   1 
ATOM   3269 O O   . VAL B  1 77  ? -63.32111 56.55699 -5.89540  1.000 22.72492  ? 54  VAL B O   1 
ATOM   3270 C CB  . VAL B  1 77  ? -63.20039 55.24529 -2.78891  1.000 24.19431  ? 54  VAL B CB  1 
ATOM   3271 C CG1 . VAL B  1 77  ? -61.73286 55.36799 -3.29567  1.000 24.97678  ? 54  VAL B CG1 1 
ATOM   3272 C CG2 . VAL B  1 77  ? -63.31825 55.66274 -1.28026  1.000 20.74527  ? 54  VAL B CG2 1 
ATOM   3273 N N   . ALA B  1 78  ? -64.44928 54.64280 -5.57290  1.000 24.77755  ? 55  ALA B N   1 
ATOM   3274 C CA  . ALA B  1 78  ? -64.34982 54.25541 -6.97761  1.000 23.09749  ? 55  ALA B CA  1 
ATOM   3275 C C   . ALA B  1 78  ? -65.01107 55.28465 -7.87686  1.000 23.83874  ? 55  ALA B C   1 
ATOM   3276 O O   . ALA B  1 78  ? -64.51152 55.57586 -8.96639  1.000 24.18799  ? 55  ALA B O   1 
ATOM   3277 C CB  . ALA B  1 78  ? -65.00625 52.88127 -7.19209  1.000 20.87092  ? 55  ALA B CB  1 
ATOM   3278 N N   . PHE B  1 79  ? -66.17054 55.80701 -7.45286  1.000 22.40230  ? 56  PHE B N   1 
ATOM   3279 C CA  . PHE B  1 79  ? -66.84460 56.88054 -8.18332  1.000 20.01198  ? 56  PHE B CA  1 
ATOM   3280 C C   . PHE B  1 79  ? -65.93233 58.07746 -8.38707  1.000 23.07317  ? 56  PHE B C   1 
ATOM   3281 O O   . PHE B  1 79  ? -65.85470 58.64711 -9.48328  1.000 22.81914  ? 56  PHE B O   1 
ATOM   3282 C CB  . PHE B  1 79  ? -68.08890 57.29445 -7.39254  1.000 22.46265  ? 56  PHE B CB  1 
ATOM   3283 C CG  . PHE B  1 79  ? -68.84661 58.47095 -7.96924  1.000 25.78349  ? 56  PHE B CG  1 
ATOM   3284 C CD1 . PHE B  1 79  ? -69.35423 58.42523 -9.25698  1.000 23.60844  ? 56  PHE B CD1 1 
ATOM   3285 C CD2 . PHE B  1 79  ? -69.13966 59.58276 -7.17578  1.000 23.99945  ? 56  PHE B CD2 1 
ATOM   3286 C CE1 . PHE B  1 79  ? -70.10852 59.49075 -9.77434  1.000 27.83013  ? 56  PHE B CE1 1 
ATOM   3287 C CE2 . PHE B  1 79  ? -69.91072 60.66110 -7.68165  1.000 24.04988  ? 56  PHE B CE2 1 
ATOM   3288 C CZ  . PHE B  1 79  ? -70.40246 60.59931 -8.97241  1.000 25.17377  ? 56  PHE B CZ  1 
ATOM   3289 N N   . GLU B  1 80  ? -65.24136 58.49165 -7.33338  1.000 21.58059  ? 57  GLU B N   1 
ATOM   3290 C CA  . GLU B  1 80  ? -64.37310 59.65722 -7.47600  1.000 23.41271  ? 57  GLU B CA  1 
ATOM   3291 C C   . GLU B  1 80  ? -63.18845 59.36915 -8.40729  1.000 24.86985  ? 57  GLU B C   1 
ATOM   3292 O O   . GLU B  1 80  ? -62.82142 60.22470 -9.21674  1.000 23.72692  ? 57  GLU B O   1 
ATOM   3293 C CB  . GLU B  1 80  ? -63.90355 60.10564 -6.08868  1.000 26.27523  ? 57  GLU B CB  1 
ATOM   3294 C CG  . GLU B  1 80  ? -62.91192 61.27062 -6.11818  1.000 28.37059  ? 57  GLU B CG  1 
ATOM   3295 C CD  . GLU B  1 80  ? -62.63013 61.86599 -4.73529  1.000 35.64889  ? 57  GLU B CD  1 
ATOM   3296 O OE1 . GLU B  1 80  ? -63.41236 61.62657 -3.78276  1.000 36.27296  ? 57  GLU B OE1 1 
ATOM   3297 O OE2 . GLU B  1 80  ? -61.64194 62.61562 -4.61853  1.000 35.13238  ? 57  GLU B OE2 1 
ATOM   3298 N N   . LEU B  1 81  ? -62.58173 58.16931 -8.32427  1.000 22.84474  ? 58  LEU B N   1 
ATOM   3299 C CA  . LEU B  1 81  ? -61.45010 57.86906 -9.21596  1.000 24.14996  ? 58  LEU B CA  1 
ATOM   3300 C C   . LEU B  1 81  ? -61.90116 57.78910 -10.67013 1.000 24.21194  ? 58  LEU B C   1 
ATOM   3301 O O   . LEU B  1 81  ? -61.21264 58.27356 -11.57610 1.000 24.91900  ? 58  LEU B O   1 
ATOM   3302 C CB  . LEU B  1 81  ? -60.75924 56.55702 -8.80985  1.000 22.36992  ? 58  LEU B CB  1 
ATOM   3303 C CG  . LEU B  1 81  ? -60.09211 56.49368 -7.41833  1.000 29.16294  ? 58  LEU B CG  1 
ATOM   3304 C CD1 . LEU B  1 81  ? -59.26560 55.18115 -7.21601  1.000 33.78652  ? 58  LEU B CD1 1 
ATOM   3305 C CD2 . LEU B  1 81  ? -59.22673 57.64334 -7.21922  1.000 31.09540  ? 58  LEU B CD2 1 
ATOM   3306 N N   . TRP B  1 82  ? -63.04974 57.17589 -10.91060 1.000 21.45450  ? 59  TRP B N   1 
ATOM   3307 C CA  . TRP B  1 82  ? -63.61017 57.15628 -12.25900 1.000 25.16065  ? 59  TRP B CA  1 
ATOM   3308 C C   . TRP B  1 82  ? -63.87667 58.57308 -12.77329 1.000 26.28161  ? 59  TRP B C   1 
ATOM   3309 O O   . TRP B  1 82  ? -63.49624 58.92342 -13.90306 1.000 24.87272  ? 59  TRP B O   1 
ATOM   3310 C CB  . TRP B  1 82  ? -64.89807 56.32279 -12.25290 1.000 25.83848  ? 59  TRP B CB  1 
ATOM   3311 C CG  . TRP B  1 82  ? -65.64707 56.45558 -13.56574 1.000 30.34259  ? 59  TRP B CG  1 
ATOM   3312 C CD1 . TRP B  1 82  ? -65.27985 55.92297 -14.79603 1.000 27.97921  ? 59  TRP B CD1 1 
ATOM   3313 C CD2 . TRP B  1 82  ? -66.84211 57.18154 -13.78368 1.000 28.51001  ? 59  TRP B CD2 1 
ATOM   3314 N NE1 . TRP B  1 82  ? -66.20096 56.27791 -15.74869 1.000 31.13178  ? 59  TRP B NE1 1 
ATOM   3315 C CE2 . TRP B  1 82  ? -67.17719 57.03863 -15.15453 1.000 32.03166  ? 59  TRP B CE2 1 
ATOM   3316 C CE3 . TRP B  1 82  ? -67.68302 57.92475 -12.95768 1.000 30.84733  ? 59  TRP B CE3 1 
ATOM   3317 C CZ2 . TRP B  1 82  ? -68.30079 57.60951 -15.69842 1.000 35.69660  ? 59  TRP B CZ2 1 
ATOM   3318 C CZ3 . TRP B  1 82  ? -68.81856 58.47197 -13.49561 1.000 37.35132  ? 59  TRP B CZ3 1 
ATOM   3319 C CH2 . TRP B  1 82  ? -69.11835 58.32334 -14.86074 1.000 42.98566  ? 59  TRP B CH2 1 
ATOM   3320 N N   . ALA B  1 83  ? -64.51174 59.42282 -11.94694 1.000 22.39621  ? 60  ALA B N   1 
ATOM   3321 C CA  . ALA B  1 83  ? -64.73827 60.80526 -12.37059 1.000 23.80363  ? 60  ALA B CA  1 
ATOM   3322 C C   . ALA B  1 83  ? -63.42948 61.53576 -12.67465 1.000 25.08045  ? 60  ALA B C   1 
ATOM   3323 O O   . ALA B  1 83  ? -63.40486 62.42216 -13.54643 1.000 25.41710  ? 60  ALA B O   1 
ATOM   3324 C CB  . ALA B  1 83  ? -65.53095 61.56772 -11.31069 1.000 24.37970  ? 60  ALA B CB  1 
ATOM   3325 N N   . LYS B  1 84  ? -62.34470 61.19701 -11.97281 1.000 24.20851  ? 61  LYS B N   1 
ATOM   3326 C CA  . LYS B  1 84  ? -61.05939 61.86654 -12.15513 1.000 23.74592  ? 61  LYS B CA  1 
ATOM   3327 C C   . LYS B  1 84  ? -60.14938 61.13634 -13.14682 1.000 27.84306  ? 61  LYS B C   1 
ATOM   3328 O O   . LYS B  1 84  ? -58.94278 61.41956 -13.20208 1.000 25.85227  ? 61  LYS B O   1 
ATOM   3329 C CB  . LYS B  1 84  ? -60.35657 62.03985 -10.80342 1.000 25.39117  ? 61  LYS B CB  1 
ATOM   3330 C CG  . LYS B  1 84  ? -61.08537 63.07899 -9.91261  1.000 27.34067  ? 61  LYS B CG  1 
ATOM   3331 C CD  . LYS B  1 84  ? -60.52041 63.15533 -8.48792  1.000 27.21691  ? 61  LYS B CD  1 
ATOM   3332 C CE  . LYS B  1 84  ? -61.14111 64.32426 -7.70968  1.000 31.33132  ? 61  LYS B CE  1 
ATOM   3333 N NZ  . LYS B  1 84  ? -60.67620 64.30923 -6.29581  1.000 29.56905  ? 61  LYS B NZ  1 
ATOM   3334 N N   . ARG B  1 85  ? -60.71178 60.26054 -13.96879 1.000 23.66024  ? 62  ARG B N   1 
ATOM   3335 C CA  . ARG B  1 85  ? -59.89650 59.53291 -14.94141 1.000 26.51305  ? 62  ARG B CA  1 
ATOM   3336 C C   . ARG B  1 85  ? -59.29103 60.50143 -15.95313 1.000 28.21295  ? 62  ARG B C   1 
ATOM   3337 O O   . ARG B  1 85  ? -59.83755 61.57349 -16.22690 1.000 23.69160  ? 62  ARG B O   1 
ATOM   3338 C CB  . ARG B  1 85  ? -60.74617 58.49177 -15.67653 1.000 26.06654  ? 62  ARG B CB  1 
ATOM   3339 C CG  . ARG B  1 85  ? -61.85227 59.10990 -16.55622 1.000 27.88431  ? 62  ARG B CG  1 
ATOM   3340 C CD  . ARG B  1 85  ? -62.89847 58.06674 -17.00352 1.000 29.05904  ? 62  ARG B CD  1 
ATOM   3341 N NE  . ARG B  1 85  ? -63.90938 58.65106 -17.90184 1.000 30.63710  ? 62  ARG B NE  1 
ATOM   3342 C CZ  . ARG B  1 85  ? -64.95901 59.37887 -17.51395 1.000 35.25876  ? 62  ARG B CZ  1 
ATOM   3343 N NH1 . ARG B  1 85  ? -65.17708 59.65191 -16.22033 1.000 27.58670  ? 62  ARG B NH1 1 
ATOM   3344 N NH2 . ARG B  1 85  ? -65.81213 59.84431 -18.41821 1.000 37.25593  ? 62  ARG B NH2 1 
ATOM   3345 N N   . ASN B  1 86  ? -58.12773 60.12395 -16.48702 1.000 26.99968  ? 63  ASN B N   1 
ATOM   3346 C CA  . ASN B  1 86  ? -57.50488 60.87167 -17.56640 1.000 28.79545  ? 63  ASN B CA  1 
ATOM   3347 C C   . ASN B  1 86  ? -58.34042 60.70751 -18.82940 1.000 24.90675  ? 63  ASN B C   1 
ATOM   3348 O O   . ASN B  1 86  ? -58.59694 59.57552 -19.26760 1.000 25.99145  ? 63  ASN B O   1 
ATOM   3349 C CB  . ASN B  1 86  ? -56.07593 60.35761 -17.80266 1.000 31.48402  ? 63  ASN B CB  1 
ATOM   3350 C CG  . ASN B  1 86  ? -55.23276 61.35110 -18.58921 1.000 35.89498  ? 63  ASN B CG  1 
ATOM   3351 O OD1 . ASN B  1 86  ? -55.67218 61.89553 -19.59548 1.000 37.43832  ? 63  ASN B OD1 1 
ATOM   3352 N ND2 . ASN B  1 86  ? -54.02646 61.60283 -18.11787 1.000 35.04880  ? 63  ASN B ND2 1 
ATOM   3353 N N   . ILE B  1 87  ? -58.77946 61.82606 -19.40626 1.000 24.05978  ? 64  ILE B N   1 
ATOM   3354 C CA  . ILE B  1 87  ? -59.60825 61.80593 -20.60744 1.000 26.45323  ? 64  ILE B CA  1 
ATOM   3355 C C   . ILE B  1 87  ? -58.82529 62.20176 -21.85449 1.000 29.26508  ? 64  ILE B C   1 
ATOM   3356 O O   . ILE B  1 87  ? -59.42871 62.45971 -22.89310 1.000 31.80828  ? 64  ILE B O   1 
ATOM   3357 C CB  . ILE B  1 87  ? -60.86624 62.68420 -20.45420 1.000 27.85060  ? 64  ILE B CB  1 
ATOM   3358 C CG1 . ILE B  1 87  ? -60.48856 64.16190 -20.23442 1.000 32.01908  ? 64  ILE B CG1 1 
ATOM   3359 C CG2 . ILE B  1 87  ? -61.75229 62.10387 -19.33748 1.000 27.80495  ? 64  ILE B CG2 1 
ATOM   3360 C CD1 . ILE B  1 87  ? -61.60785 65.15424 -20.71103 1.000 32.02951  ? 64  ILE B CD1 1 
ATOM   3361 N N   . LYS B  1 88  ? -57.49982 62.28054 -21.77561 1.000 28.88934  ? 65  LYS B N   1 
ATOM   3362 C CA  . LYS B  1 88  ? -56.66975 62.40409 -22.97167 1.000 29.65871  ? 65  LYS B CA  1 
ATOM   3363 C C   . LYS B  1 88  ? -56.26382 61.01550 -23.43545 1.000 27.94595  ? 65  LYS B C   1 
ATOM   3364 O O   . LYS B  1 88  ? -56.42873 60.04723 -22.69680 1.000 28.17173  ? 65  LYS B O   1 
ATOM   3365 C CB  . LYS B  1 88  ? -55.42905 63.25341 -22.65106 1.000 33.42133  ? 65  LYS B CB  1 
ATOM   3366 C CG  . LYS B  1 88  ? -55.77333 64.62142 -22.02886 1.000 41.22079  ? 65  LYS B CG  1 
ATOM   3367 C CD  . LYS B  1 88  ? -54.80134 65.71435 -22.46392 1.000 57.64124  ? 65  LYS B CD  1 
ATOM   3368 C CE  . LYS B  1 88  ? -53.34863 65.39030 -22.10996 1.000 62.38774  ? 65  LYS B CE  1 
ATOM   3369 N NZ  . LYS B  1 88  ? -52.39860 66.24905 -22.90960 1.000 67.91172  ? 65  LYS B NZ  1 
ATOM   3370 N N   . PRO B  1 89  ? -55.72403 60.86256 -24.65029 1.000 29.15097  ? 66  PRO B N   1 
ATOM   3371 C CA  . PRO B  1 89  ? -55.17970 59.55366 -25.03071 1.000 27.61094  ? 66  PRO B CA  1 
ATOM   3372 C C   . PRO B  1 89  ? -54.08127 59.15201 -24.05974 1.000 32.59718  ? 66  PRO B C   1 
ATOM   3373 O O   . PRO B  1 89  ? -53.18433 59.94862 -23.75086 1.000 29.29955  ? 66  PRO B O   1 
ATOM   3374 C CB  . PRO B  1 89  ? -54.61430 59.79316 -26.44220 1.000 28.83290  ? 66  PRO B CB  1 
ATOM   3375 C CG  . PRO B  1 89  ? -55.43891 60.99184 -26.96128 1.000 30.16629  ? 66  PRO B CG  1 
ATOM   3376 C CD  . PRO B  1 89  ? -55.58149 61.85461 -25.73855 1.000 32.86984  ? 66  PRO B CD  1 
ATOM   3377 N N   . VAL B  1 90  ? -54.16743 57.92415 -23.55477 1.000 27.54231  ? 67  VAL B N   1 
ATOM   3378 C CA  . VAL B  1 90  ? -53.13835 57.40227 -22.64934 1.000 27.62370  ? 67  VAL B CA  1 
ATOM   3379 C C   . VAL B  1 90  ? -52.70959 56.02570 -23.14087 1.000 28.66598  ? 67  VAL B C   1 
ATOM   3380 O O   . VAL B  1 90  ? -53.45634 55.35842 -23.88515 1.000 27.85035  ? 67  VAL B O   1 
ATOM   3381 C CB  . VAL B  1 90  ? -53.65279 57.33346 -21.19136 1.000 27.82659  ? 67  VAL B CB  1 
ATOM   3382 C CG1 . VAL B  1 90  ? -53.76883 58.75468 -20.56745 1.000 24.28625  ? 67  VAL B CG1 1 
ATOM   3383 C CG2 . VAL B  1 90  ? -55.00692 56.64402 -21.17503 1.000 26.48037  ? 67  VAL B CG2 1 
ATOM   3384 N N   . PRO B  1 91  ? -51.51233 55.55609 -22.73401 1.000 26.96114  ? 68  PRO B N   1 
ATOM   3385 C CA  . PRO B  1 91  ? -51.09171 54.19802 -23.09694 1.000 28.55708  ? 68  PRO B CA  1 
ATOM   3386 C C   . PRO B  1 91  ? -52.15351 53.18029 -22.70171 1.000 28.75338  ? 68  PRO B C   1 
ATOM   3387 O O   . PRO B  1 91  ? -52.82838 53.33002 -21.69014 1.000 27.29882  ? 68  PRO B O   1 
ATOM   3388 C CB  . PRO B  1 91  ? -49.80676 53.98803 -22.28122 1.000 25.30992  ? 68  PRO B CB  1 
ATOM   3389 C CG  . PRO B  1 91  ? -49.20348 55.43974 -22.18179 1.000 25.15386  ? 68  PRO B CG  1 
ATOM   3390 C CD  . PRO B  1 91  ? -50.48000 56.25527 -21.91305 1.000 26.54238  ? 68  PRO B CD  1 
ATOM   3391 N N   . GLU B  1 92  ? -52.28920 52.13673 -23.50851 1.000 26.91721  ? 69  GLU B N   1 
ATOM   3392 C CA  . GLU B  1 92  ? -53.11767 51.01155 -23.08347 1.000 27.40155  ? 69  GLU B CA  1 
ATOM   3393 C C   . GLU B  1 92  ? -52.52444 50.37854 -21.83268 1.000 28.44624  ? 69  GLU B C   1 
ATOM   3394 O O   . GLU B  1 92  ? -51.30314 50.34620 -21.63970 1.000 24.36411  ? 69  GLU B O   1 
ATOM   3395 C CB  . GLU B  1 92  ? -53.22956 49.98034 -24.20946 1.000 31.58106  ? 69  GLU B CB  1 
ATOM   3396 C CG  . GLU B  1 92  ? -54.01827 50.49032 -25.40927 1.000 32.87756  ? 69  GLU B CG  1 
ATOM   3397 C CD  . GLU B  1 92  ? -54.38205 49.39655 -26.40879 1.000 36.59730  ? 69  GLU B CD  1 
ATOM   3398 O OE1 . GLU B  1 92  ? -53.56184 49.10870 -27.31128 1.000 37.14569  ? 69  GLU B OE1 1 
ATOM   3399 O OE2 . GLU B  1 92  ? -55.49864 48.83241 -26.31163 1.000 37.53169  ? 69  GLU B OE2 1 
ATOM   3400 N N   . VAL B  1 93  ? -53.40514 49.83016 -20.99900 1.000 26.31486  ? 70  VAL B N   1 
ATOM   3401 C CA  . VAL B  1 93  ? -52.99514 49.27412 -19.71546 1.000 28.59001  ? 70  VAL B CA  1 
ATOM   3402 C C   . VAL B  1 93  ? -51.98803 48.14391 -19.90783 1.000 28.17665  ? 70  VAL B C   1 
ATOM   3403 O O   . VAL B  1 93  ? -51.06114 47.97007 -19.09426 1.000 27.57296  ? 70  VAL B O   1 
ATOM   3404 C CB  . VAL B  1 93  ? -54.24962 48.79820 -18.94845 1.000 32.42356  ? 70  VAL B CB  1 
ATOM   3405 C CG1 . VAL B  1 93  ? -53.84970 47.98600 -17.70313 1.000 31.63948  ? 70  VAL B CG1 1 
ATOM   3406 C CG2 . VAL B  1 93  ? -55.08566 49.99962 -18.54437 1.000 29.32841  ? 70  VAL B CG2 1 
ATOM   3407 N N   . LYS B  1 94  ? -52.15001 47.34505 -20.97260 1.000 25.54019  ? 71  LYS B N   1 
ATOM   3408 C CA  . LYS B  1 94  ? -51.19441 46.25689 -21.18054 1.000 26.81612  ? 71  LYS B CA  1 
ATOM   3409 C C   . LYS B  1 94  ? -49.76925 46.79451 -21.32497 1.000 26.61465  ? 71  LYS B C   1 
ATOM   3410 O O   . LYS B  1 94  ? -48.81111 46.14832 -20.86580 1.000 27.97076  ? 71  LYS B O   1 
ATOM   3411 C CB  . LYS B  1 94  ? -51.58402 45.40421 -22.40385 1.000 28.02072  ? 71  LYS B CB  1 
ATOM   3412 C CG  . LYS B  1 94  ? -51.50992 46.10098 -23.78243 1.000 30.19182  ? 71  LYS B CG  1 
ATOM   3413 C CD  . LYS B  1 94  ? -52.13818 45.21595 -24.90850 1.000 29.46166  ? 71  LYS B CD  1 
ATOM   3414 C CE  . LYS B  1 94  ? -52.30357 45.98130 -26.22872 1.000 35.14016  ? 71  LYS B CE  1 
ATOM   3415 N NZ  . LYS B  1 94  ? -52.92967 45.11660 -27.32108 1.000 32.27774  ? 71  LYS B NZ  1 
ATOM   3416 N N   . ILE B  1 95  ? -49.60875 47.97613 -21.92894 1.000 26.33801  ? 72  ILE B N   1 
ATOM   3417 C CA  . ILE B  1 95  ? -48.26945 48.57482 -22.07521 1.000 29.25219  ? 72  ILE B CA  1 
ATOM   3418 C C   . ILE B  1 95  ? -47.71953 48.99949 -20.71567 1.000 28.58926  ? 72  ILE B C   1 
ATOM   3419 O O   . ILE B  1 95  ? -46.55326 48.75566 -20.38675 1.000 30.41409  ? 72  ILE B O   1 
ATOM   3420 C CB  . ILE B  1 95  ? -48.30974 49.78005 -23.03410 1.000 27.47950  ? 72  ILE B CB  1 
ATOM   3421 C CG1 . ILE B  1 95  ? -48.79430 49.36474 -24.42576 1.000 28.66962  ? 72  ILE B CG1 1 
ATOM   3422 C CG2 . ILE B  1 95  ? -46.91894 50.43289 -23.09631 1.000 26.61601  ? 72  ILE B CG2 1 
ATOM   3423 C CD1 . ILE B  1 95  ? -47.87934 48.35029 -25.08722 1.000 34.02874  ? 72  ILE B CD1 1 
ATOM   3424 N N   . LEU B  1 96  ? -48.53388 49.68925 -19.92727 1.000 26.56558  ? 73  LEU B N   1 
ATOM   3425 C CA  . LEU B  1 96  ? -48.08782 50.13993 -18.60678 1.000 24.17477  ? 73  LEU B CA  1 
ATOM   3426 C C   . LEU B  1 96  ? -47.74570 48.95168 -17.71707 1.000 28.27394  ? 73  LEU B C   1 
ATOM   3427 O O   . LEU B  1 96  ? -46.71547 48.94711 -17.02882 1.000 29.57252  ? 73  LEU B O   1 
ATOM   3428 C CB  . LEU B  1 96  ? -49.19276 51.00737 -17.97306 1.000 27.00848  ? 73  LEU B CB  1 
ATOM   3429 C CG  . LEU B  1 96  ? -49.61798 52.25688 -18.78320 1.000 26.29549  ? 73  LEU B CG  1 
ATOM   3430 C CD1 . LEU B  1 96  ? -50.81883 52.97675 -18.13863 1.000 26.50264  ? 73  LEU B CD1 1 
ATOM   3431 C CD2 . LEU B  1 96  ? -48.46369 53.24907 -18.98207 1.000 29.78714  ? 73  LEU B CD2 1 
ATOM   3432 N N   . ASN B  1 97  ? -48.60300 47.92207 -17.72070 1.000 24.21815  ? 74  ASN B N   1 
ATOM   3433 C CA  . ASN B  1 97  ? -48.29714 46.69653 -16.98633 1.000 24.50458  ? 74  ASN B CA  1 
ATOM   3434 C C   . ASN B  1 97  ? -46.97767 46.09450 -17.43761 1.000 27.48433  ? 74  ASN B C   1 
ATOM   3435 O O   . ASN B  1 97  ? -46.17121 45.65780 -16.60574 1.000 29.48368  ? 74  ASN B O   1 
ATOM   3436 C CB  . ASN B  1 97  ? -49.41243 45.64960 -17.18183 1.000 27.29752  ? 74  ASN B CB  1 
ATOM   3437 C CG  . ASN B  1 97  ? -50.67223 46.00442 -16.43365 1.000 30.74081  ? 74  ASN B CG  1 
ATOM   3438 O OD1 . ASN B  1 97  ? -50.71649 47.00481 -15.70148 1.000 31.59761  ? 74  ASN B OD1 1 
ATOM   3439 N ND2 . ASN B  1 97  ? -51.72364 45.21844 -16.64927 1.000 29.46166  ? 74  ASN B ND2 1 
ATOM   3440 N N   . ASN B  1 98  ? -46.77058 45.98121 -18.75703 1.000 26.97682  ? 75  ASN B N   1 
ATOM   3441 C CA  . ASN B  1 98  ? -45.54643 45.33730 -19.23150 1.000 26.60945  ? 75  ASN B CA  1 
ATOM   3442 C C   . ASN B  1 98  ? -44.30603 46.14280 -18.84714 1.000 34.12768  ? 75  ASN B C   1 
ATOM   3443 O O   . ASN B  1 98  ? -43.20448 45.58038 -18.75745 1.000 31.02105  ? 75  ASN B O   1 
ATOM   3444 C CB  . ASN B  1 98  ? -45.57136 45.18292 -20.74958 1.000 27.96480  ? 75  ASN B CB  1 
ATOM   3445 C CG  . ASN B  1 98  ? -46.56360 44.12960 -21.22718 1.000 29.30533  ? 75  ASN B CG  1 
ATOM   3446 O OD1 . ASN B  1 98  ? -47.12734 43.36184 -20.44833 1.000 27.77282  ? 75  ASN B OD1 1 
ATOM   3447 N ND2 . ASN B  1 98  ? -46.75335 44.08203 -22.52583 1.000 31.02812  ? 75  ASN B ND2 1 
ATOM   3448 N N   . LEU B  1 99  ? -44.44883 47.45654 -18.66405 1.000 30.28781  ? 76  LEU B N   1 
ATOM   3449 C CA  . LEU B  1 99  ? -43.33661 48.30534 -18.23888 1.000 32.12987  ? 76  LEU B CA  1 
ATOM   3450 C C   . LEU B  1 99  ? -43.20704 48.39329 -16.71886 1.000 34.40855  ? 76  LEU B C   1 
ATOM   3451 O O   . LEU B  1 99  ? -42.34810 49.12352 -16.22426 1.000 36.95574  ? 76  LEU B O   1 
ATOM   3452 C CB  . LEU B  1 99  ? -43.49412 49.72346 -18.81380 1.000 30.62783  ? 76  LEU B CB  1 
ATOM   3453 C CG  . LEU B  1 99  ? -43.38068 49.77687 -20.32929 1.000 31.22177  ? 76  LEU B CG  1 
ATOM   3454 C CD1 . LEU B  1 99  ? -43.72750 51.17848 -20.84362 1.000 30.78032  ? 76  LEU B CD1 1 
ATOM   3455 C CD2 . LEU B  1 99  ? -41.95622 49.35240 -20.77322 1.000 35.08866  ? 76  LEU B CD2 1 
ATOM   3456 N N   . GLY B  1 100 ? -44.05270 47.69855 -15.97507 1.000 29.48914  ? 77  GLY B N   1 
ATOM   3457 C CA  . GLY B  1 100 ? -43.93681 47.65303 -14.53098 1.000 31.42112  ? 77  GLY B CA  1 
ATOM   3458 C C   . GLY B  1 100 ? -44.48750 48.85412 -13.79037 1.000 29.64574  ? 77  GLY B C   1 
ATOM   3459 O O   . GLY B  1 100 ? -44.07185 49.10356 -12.65824 1.000 32.76049  ? 77  GLY B O   1 
ATOM   3460 N N   . VAL B  1 101 ? -45.42458 49.59823 -14.38172 1.000 27.61443  ? 78  VAL B N   1 
ATOM   3461 C CA  . VAL B  1 101 ? -45.95487 50.79639 -13.72598 1.000 27.67334  ? 78  VAL B CA  1 
ATOM   3462 C C   . VAL B  1 101 ? -46.79369 50.40118 -12.51813 1.000 28.26004  ? 78  VAL B C   1 
ATOM   3463 O O   . VAL B  1 101 ? -47.67803 49.54468 -12.61063 1.000 28.88400  ? 78  VAL B O   1 
ATOM   3464 C CB  . VAL B  1 101 ? -46.77252 51.63700 -14.71983 1.000 25.24206  ? 78  VAL B CB  1 
ATOM   3465 C CG1 . VAL B  1 101 ? -47.58807 52.72693 -13.97638 1.000 26.49322  ? 78  VAL B CG1 1 
ATOM   3466 C CG2 . VAL B  1 101 ? -45.84059 52.26650 -15.79761 1.000 23.35685  ? 78  VAL B CG2 1 
ATOM   3467 N N   . ASP B  1 102 ? -46.52544 51.03257 -11.37284 1.000 30.24157  ? 79  ASP B N   1 
ATOM   3468 C CA  . ASP B  1 102 ? -47.26035 50.76156 -10.14007 1.000 30.66903  ? 79  ASP B CA  1 
ATOM   3469 C C   . ASP B  1 102 ? -48.33726 51.78861 -9.81842  1.000 29.64106  ? 79  ASP B C   1 
ATOM   3470 O O   . ASP B  1 102 ? -49.27252 51.47828 -9.06909  1.000 28.34495  ? 79  ASP B O   1 
ATOM   3471 C CB  . ASP B  1 102 ? -46.28301 50.71832 -8.95662  1.000 29.93002  ? 79  ASP B CB  1 
ATOM   3472 C CG  . ASP B  1 102 ? -45.30611 49.57829 -9.06866  1.000 35.17592  ? 79  ASP B CG  1 
ATOM   3473 O OD1 . ASP B  1 102 ? -45.79850 48.43358 -9.26432  1.000 32.39085  ? 79  ASP B OD1 1 
ATOM   3474 O OD2 . ASP B  1 102 ? -44.06228 49.81318 -9.00565  1.000 32.66801  ? 79  ASP B OD2 1 
ATOM   3475 N N   . ILE B  1 103 ? -48.20713 53.01745 -10.31919 1.000 27.45896  ? 80  ILE B N   1 
ATOM   3476 C CA  . ILE B  1 103 ? -49.01286 54.13414 -9.83117  1.000 26.26891  ? 80  ILE B CA  1 
ATOM   3477 C C   . ILE B  1 103 ? -48.77643 55.29054 -10.78678 1.000 29.87579  ? 80  ILE B C   1 
ATOM   3478 O O   . ILE B  1 103 ? -47.75547 55.32506 -11.47949 1.000 28.23261  ? 80  ILE B O   1 
ATOM   3479 C CB  . ILE B  1 103 ? -48.58065 54.47563 -8.37835  1.000 25.17926  ? 80  ILE B CB  1 
ATOM   3480 C CG1 . ILE B  1 103 ? -49.56186 55.41364 -7.67681  1.000 24.76000  ? 80  ILE B CG1 1 
ATOM   3481 C CG2 . ILE B  1 103 ? -47.16867 55.07501 -8.35301  1.000 23.63272  ? 80  ILE B CG2 1 
ATOM   3482 C CD1 . ILE B  1 103 ? -49.29792 55.52222 -6.14565  1.000 23.61476  ? 80  ILE B CD1 1 
ATOM   3483 N N   . ALA B  1 104 ? -49.72735 56.22985 -10.85130 1.000 26.91464  ? 81  ALA B N   1 
ATOM   3484 C CA  . ALA B  1 104 ? -49.58643 57.37298 -11.75204 1.000 25.78776  ? 81  ALA B CA  1 
ATOM   3485 C C   . ALA B  1 104 ? -49.44490 58.66954 -10.96609 1.000 29.74599  ? 81  ALA B C   1 
ATOM   3486 O O   . ALA B  1 104 ? -50.04246 58.82946 -9.89810  1.000 29.41142  ? 81  ALA B O   1 
ATOM   3487 C CB  . ALA B  1 104 ? -50.79772 57.48885 -12.69801 1.000 24.32811  ? 81  ALA B CB  1 
ATOM   3488 N N   . ALA B  1 105 ? -48.68032 59.62039 -11.52760 1.000 28.16219  ? 82  ALA B N   1 
ATOM   3489 C CA  . ALA B  1 105 ? -48.50569 60.93580 -10.91514 1.000 28.79998  ? 82  ALA B CA  1 
ATOM   3490 C C   . ALA B  1 105 ? -49.71027 61.82773 -11.23087 1.000 28.97102  ? 82  ALA B C   1 
ATOM   3491 O O   . ALA B  1 105 ? -49.88544 62.26123 -12.37108 1.000 31.38919  ? 82  ALA B O   1 
ATOM   3492 C CB  . ALA B  1 105 ? -47.21611 61.57585 -11.43114 1.000 27.95722  ? 82  ALA B CB  1 
ATOM   3493 N N   . ASN B  1 106 ? -50.53205 62.11509 -10.22475 1.000 27.08528  ? 83  ASN B N   1 
ATOM   3494 C CA  . ASN B  1 106 ? -51.56463 63.16950 -10.29260 1.000 33.76364  ? 83  ASN B CA  1 
ATOM   3495 C C   . ASN B  1 106 ? -52.58295 62.95523 -11.40869 1.000 31.05329  ? 83  ASN B C   1 
ATOM   3496 O O   . ASN B  1 106 ? -53.08700 63.90869 -12.00724 1.000 30.11871  ? 83  ASN B O   1 
ATOM   3497 C CB  . ASN B  1 106 ? -50.90608 64.54388 -10.40095 1.000 36.86652  ? 83  ASN B CB  1 
ATOM   3498 C CG  . ASN B  1 106 ? -49.96341 64.78128 -9.24930  1.000 38.20537  ? 83  ASN B CG  1 
ATOM   3499 O OD1 . ASN B  1 106 ? -48.86371 64.25954 -9.24238  1.000 40.59729  ? 83  ASN B OD1 1 
ATOM   3500 N ND2 . ASN B  1 106 ? -50.42566 65.48084 -8.22566  1.000 39.23835  ? 83  ASN B ND2 1 
ATOM   3501 N N   . THR B  1 107 ? -52.93113 61.70222 -11.65683 1.000 29.79065  ? 84  THR B N   1 
ATOM   3502 C CA  . THR B  1 107 ? -54.00258 61.37187 -12.58589 1.000 30.65043  ? 84  THR B CA  1 
ATOM   3503 C C   . THR B  1 107 ? -54.45211 59.95840 -12.25295 1.000 30.08922  ? 84  THR B C   1 
ATOM   3504 O O   . THR B  1 107 ? -53.82671 59.26930 -11.43767 1.000 27.29157  ? 84  THR B O   1 
ATOM   3505 C CB  . THR B  1 107 ? -53.53384 61.49957 -14.05261 1.000 37.64252  ? 84  THR B CB  1 
ATOM   3506 O OG1 . THR B  1 107 ? -54.65408 61.36994 -14.93196 1.000 36.08258  ? 84  THR B OG1 1 
ATOM   3507 C CG2 . THR B  1 107 ? -52.49702 60.42701 -14.40057 1.000 29.57716  ? 84  THR B CG2 1 
ATOM   3508 N N   . VAL B  1 108 ? -55.54752 59.52795 -12.88357 1.000 25.67211  ? 85  VAL B N   1 
ATOM   3509 C CA  . VAL B  1 108 ? -56.03566 58.15843 -12.74366 1.000 26.52661  ? 85  VAL B CA  1 
ATOM   3510 C C   . VAL B  1 108 ? -56.06223 57.55836 -14.13345 1.000 25.57993  ? 85  VAL B C   1 
ATOM   3511 O O   . VAL B  1 108 ? -56.68881 58.11680 -15.04013 1.000 25.93851  ? 85  VAL B O   1 
ATOM   3512 C CB  . VAL B  1 108 ? -57.44058 58.09249 -12.10853 1.000 28.37266  ? 85  VAL B CB  1 
ATOM   3513 C CG1 . VAL B  1 108 ? -57.99772 56.65801 -12.16487 1.000 24.71801  ? 85  VAL B CG1 1 
ATOM   3514 C CG2 . VAL B  1 108 ? -57.43168 58.64842 -10.65498 1.000 27.96053  ? 85  VAL B CG2 1 
ATOM   3515 N N   . ILE B  1 109 ? -55.39983 56.42404 -14.30894 1.000 24.63134  ? 86  ILE B N   1 
ATOM   3516 C CA  . ILE B  1 109 ? -55.53612 55.67901 -15.55775 1.000 26.39320  ? 86  ILE B CA  1 
ATOM   3517 C C   . ILE B  1 109 ? -56.68295 54.70194 -15.32542 1.000 26.17488  ? 86  ILE B C   1 
ATOM   3518 O O   . ILE B  1 109 ? -56.53860 53.74891 -14.55297 1.000 25.63271  ? 86  ILE B O   1 
ATOM   3519 C CB  . ILE B  1 109 ? -54.24418 54.93569 -15.94044 1.000 28.79580  ? 86  ILE B CB  1 
ATOM   3520 C CG1 . ILE B  1 109 ? -53.02711 55.87583 -16.02404 1.000 23.28230  ? 86  ILE B CG1 1 
ATOM   3521 C CG2 . ILE B  1 109 ? -54.44210 54.19926 -17.27996 1.000 27.53024  ? 86  ILE B CG2 1 
ATOM   3522 C CD1 . ILE B  1 109 ? -53.23831 57.05705 -16.98547 1.000 24.59339  ? 86  ILE B CD1 1 
ATOM   3523 N N   . TRP B  1 110 ? -57.82333 54.92985 -15.97257 1.000 21.08175  ? 87  TRP B N   1 
ATOM   3524 C CA  . TRP B  1 110 ? -58.96278 54.01793 -15.78741 1.000 20.69134  ? 87  TRP B CA  1 
ATOM   3525 C C   . TRP B  1 110 ? -58.82185 52.82305 -16.72053 1.000 26.98453  ? 87  TRP B C   1 
ATOM   3526 O O   . TRP B  1 110 ? -58.58646 52.98336 -17.92110 1.000 23.88681  ? 87  TRP B O   1 
ATOM   3527 C CB  . TRP B  1 110 ? -60.29560 54.74300 -16.05760 1.000 20.20013  ? 87  TRP B CB  1 
ATOM   3528 C CG  . TRP B  1 110 ? -61.53639 53.91958 -15.63068 1.000 24.16678  ? 87  TRP B CG  1 
ATOM   3529 C CD1 . TRP B  1 110 ? -62.38040 53.21619 -16.44719 1.000 23.53177  ? 87  TRP B CD1 1 
ATOM   3530 C CD2 . TRP B  1 110 ? -62.01444 53.73803 -14.29940 1.000 25.52489  ? 87  TRP B CD2 1 
ATOM   3531 N NE1 . TRP B  1 110 ? -63.34772 52.58835 -15.69839 1.000 24.60972  ? 87  TRP B NE1 1 
ATOM   3532 C CE2 . TRP B  1 110 ? -63.15572 52.90948 -14.37497 1.000 24.67072  ? 87  TRP B CE2 1 
ATOM   3533 C CE3 . TRP B  1 110 ? -61.58195 54.19928 -13.03520 1.000 26.06380  ? 87  TRP B CE3 1 
ATOM   3534 C CZ2 . TRP B  1 110 ? -63.89966 52.53341 -13.23957 1.000 27.04895  ? 87  TRP B CZ2 1 
ATOM   3535 C CZ3 . TRP B  1 110 ? -62.32825 53.83088 -11.90611 1.000 24.24074  ? 87  TRP B CZ3 1 
ATOM   3536 C CH2 . TRP B  1 110 ? -63.45888 52.98324 -12.01938 1.000 23.09317  ? 87  TRP B CH2 1 
ATOM   3537 N N   . ASP B  1 111 ? -59.00477 51.63013 -16.17676 1.000 25.83266  ? 88  ASP B N   1 
ATOM   3538 C CA  . ASP B  1 111 ? -58.87389 50.38423 -16.92923 1.000 28.38720  ? 88  ASP B CA  1 
ATOM   3539 C C   . ASP B  1 111 ? -60.26083 49.97099 -17.41009 1.000 29.77758  ? 88  ASP B C   1 
ATOM   3540 O O   . ASP B  1 111 ? -61.05412 49.41557 -16.64984 1.000 25.24081  ? 88  ASP B O   1 
ATOM   3541 C CB  . ASP B  1 111 ? -58.22563 49.33042 -16.04271 1.000 25.97356  ? 88  ASP B CB  1 
ATOM   3542 C CG  . ASP B  1 111 ? -57.93061 48.01667 -16.78811 1.000 30.55763  ? 88  ASP B CG  1 
ATOM   3543 O OD1 . ASP B  1 111 ? -58.57039 47.72188 -17.81593 1.000 33.77107  ? 88  ASP B OD1 1 
ATOM   3544 O OD2 . ASP B  1 111 ? -57.07555 47.27366 -16.29749 1.000 32.49566  ? 88  ASP B OD2 1 
ATOM   3545 N N   . TYR B  1 112 ? -60.55454 50.22759 -18.68347 1.000 27.15702  ? 89  TYR B N   1 
ATOM   3546 C CA  . TYR B  1 112 ? -61.88391 49.91727 -19.18209 1.000 32.14001  ? 89  TYR B CA  1 
ATOM   3547 C C   . TYR B  1 112 ? -62.08547 48.42551 -19.44490 1.000 38.90190  ? 89  TYR B C   1 
ATOM   3548 O O   . TYR B  1 112 ? -63.21867 48.01842 -19.68950 1.000 34.67723  ? 89  TYR B O   1 
ATOM   3549 C CB  . TYR B  1 112 ? -62.17279 50.69872 -20.47543 1.000 30.42355  ? 89  TYR B CB  1 
ATOM   3550 C CG  . TYR B  1 112 ? -62.44053 52.18665 -20.26276 1.000 28.72816  ? 89  TYR B CG  1 
ATOM   3551 C CD1 . TYR B  1 112 ? -61.38239 53.09876 -20.14560 1.000 23.96644  ? 89  TYR B CD1 1 
ATOM   3552 C CD2 . TYR B  1 112 ? -63.75256 52.65462 -20.12371 1.000 27.56136  ? 89  TYR B CD2 1 
ATOM   3553 C CE1 . TYR B  1 112 ? -61.63331 54.47565 -19.96840 1.000 28.46975  ? 89  TYR B CE1 1 
ATOM   3554 C CE2 . TYR B  1 112 ? -64.02343 54.01921 -19.93008 1.000 31.85851  ? 89  TYR B CE2 1 
ATOM   3555 C CZ  . TYR B  1 112 ? -62.96510 54.91726 -19.84352 1.000 31.74669  ? 89  TYR B CZ  1 
ATOM   3556 O OH  . TYR B  1 112 ? -63.26134 56.25241 -19.65648 1.000 31.38896  ? 89  TYR B OH  1 
ATOM   3557 N N   . LYS B  1 113 ? -61.02719 47.61445 -19.45169 1.000 33.23409  ? 90  LYS B N   1 
ATOM   3558 C CA  . LYS B  1 113 ? -61.25548 46.17808 -19.56482 1.000 37.87122  ? 90  LYS B CA  1 
ATOM   3559 C C   . LYS B  1 113 ? -61.72147 45.57471 -18.23641 1.000 33.35110  ? 90  LYS B C   1 
ATOM   3560 O O   . LYS B  1 113 ? -62.41320 44.56742 -18.24052 1.000 33.20857  ? 90  LYS B O   1 
ATOM   3561 C CB  . LYS B  1 113 ? -59.98545 45.45367 -20.04914 1.000 38.56355  ? 90  LYS B CB  1 
ATOM   3562 C CG  . LYS B  1 113 ? -59.35597 45.98717 -21.32990 1.000 45.45095  ? 90  LYS B CG  1 
ATOM   3563 C CD  . LYS B  1 113 ? -59.98147 45.42401 -22.56600 1.000 48.88459  ? 90  LYS B CD  1 
ATOM   3564 C CE  . LYS B  1 113 ? -59.13815 45.72191 -23.81752 1.000 47.41898  ? 90  LYS B CE  1 
ATOM   3565 N NZ  . LYS B  1 113 ? -58.98765 47.20135 -24.09283 1.000 42.63084  ? 90  LYS B NZ  1 
ATOM   3566 N N   . ARG B  1 114 ? -61.32154 46.14552 -17.10630 1.000 27.58485  ? 91  ARG B N   1 
ATOM   3567 C CA  . ARG B  1 114 ? -61.72171 45.67857 -15.78194 1.000 30.88774  ? 91  ARG B CA  1 
ATOM   3568 C C   . ARG B  1 114 ? -62.77296 46.57951 -15.14021 1.000 32.50431  ? 91  ARG B C   1 
ATOM   3569 O O   . ARG B  1 114 ? -63.25418 46.25355 -14.05235 1.000 33.88903  ? 91  ARG B O   1 
ATOM   3570 C CB  . ARG B  1 114 ? -60.47969 45.59617 -14.85143 1.000 29.87353  ? 91  ARG B CB  1 
ATOM   3571 C CG  . ARG B  1 114 ? -59.41057 44.51321 -15.23256 1.000 31.49394  ? 91  ARG B CG  1 
ATOM   3572 C CD  . ARG B  1 114 ? -58.02857 44.79246 -14.53388 1.000 34.14013  ? 91  ARG B CD  1 
ATOM   3573 N NE  . ARG B  1 114 ? -58.22127 44.97409 -13.09966 1.000 36.15888  ? 91  ARG B NE  1 
ATOM   3574 C CZ  . ARG B  1 114 ? -58.07051 46.10814 -12.43609 1.000 31.12377  ? 91  ARG B CZ  1 
ATOM   3575 N NH1 . ARG B  1 114 ? -58.37202 46.12738 -11.13791 1.000 30.89460  ? 91  ARG B NH1 1 
ATOM   3576 N NH2 . ARG B  1 114 ? -57.61956 47.21935 -13.04015 1.000 27.55097  ? 91  ARG B NH2 1 
ATOM   3577 N N   . ASP B  1 115 ? -63.15053 47.69539 -15.78175 1.000 29.14696  ? 92  ASP B N   1 
ATOM   3578 C CA  . ASP B  1 115 ? -64.02268 48.70228 -15.16417 1.000 28.86759  ? 92  ASP B CA  1 
ATOM   3579 C C   . ASP B  1 115 ? -63.51833 49.10203 -13.78360 1.000 26.01413  ? 92  ASP B C   1 
ATOM   3580 O O   . ASP B  1 115 ? -64.26836 49.06433 -12.79996 1.000 26.41120  ? 92  ASP B O   1 
ATOM   3581 C CB  . ASP B  1 115 ? -65.47788 48.20453 -15.03273 1.000 36.40692  ? 92  ASP B CB  1 
ATOM   3582 C CG  . ASP B  1 115 ? -66.17593 48.08641 -16.36007 1.000 53.29040  ? 92  ASP B CG  1 
ATOM   3583 O OD1 . ASP B  1 115 ? -66.65938 46.97952 -16.68937 1.000 60.88092  ? 92  ASP B OD1 1 
ATOM   3584 O OD2 . ASP B  1 115 ? -66.19977 49.10068 -17.09084 1.000 60.55319  ? 92  ASP B OD2 1 
ATOM   3585 N N   . ALA B  1 116 ? -62.24814 49.48905 -13.70385 1.000 22.06040  ? 93  ALA B N   1 
ATOM   3586 C CA  . ALA B  1 116 ? -61.63276 49.74865 -12.40465 1.000 24.47482  ? 93  ALA B CA  1 
ATOM   3587 C C   . ALA B  1 116 ? -60.36804 50.55984 -12.62334 1.000 23.71890  ? 93  ALA B C   1 
ATOM   3588 O O   . ALA B  1 116 ? -59.84742 50.60181 -13.74936 1.000 25.76208  ? 93  ALA B O   1 
ATOM   3589 C CB  . ALA B  1 116 ? -61.30912 48.42427 -11.68093 1.000 21.76384  ? 93  ALA B CB  1 
ATOM   3590 N N   . PRO B  1 117 ? -59.84585 51.21886 -11.57931 1.000 27.39164  ? 94  PRO B N   1 
ATOM   3591 C CA  . PRO B  1 117 ? -58.56237 51.92138 -11.73362 1.000 23.36653  ? 94  PRO B CA  1 
ATOM   3592 C C   . PRO B  1 117 ? -57.49250 50.93258 -12.14837 1.000 23.24561  ? 94  PRO B C   1 
ATOM   3593 O O   . PRO B  1 117 ? -57.47407 49.78893 -11.67534 1.000 22.19186  ? 94  PRO B O   1 
ATOM   3594 C CB  . PRO B  1 117 ? -58.27022 52.47742 -10.32732 1.000 26.03501  ? 94  PRO B CB  1 
ATOM   3595 C CG  . PRO B  1 117 ? -59.63190 52.49879 -9.61942  1.000 26.10180  ? 94  PRO B CG  1 
ATOM   3596 C CD  . PRO B  1 117 ? -60.31401 51.24841 -10.17616 1.000 24.19437  ? 94  PRO B CD  1 
ATOM   3597 N N   . ALA B  1 118 ? -56.58509 51.37930 -13.02054 1.000 23.65884  ? 95  ALA B N   1 
ATOM   3598 C CA  . ALA B  1 118 ? -55.46313 50.50555 -13.38532 1.000 25.69604  ? 95  ALA B CA  1 
ATOM   3599 C C   . ALA B  1 118 ? -54.53367 50.26860 -12.20408 1.000 28.00243  ? 95  ALA B C   1 
ATOM   3600 O O   . ALA B  1 118 ? -53.85610 49.23475 -12.14875 1.000 27.46690  ? 95  ALA B O   1 
ATOM   3601 C CB  . ALA B  1 118 ? -54.67014 51.10910 -14.55217 1.000 23.98590  ? 95  ALA B CB  1 
ATOM   3602 N N   . HIS B  1 119 ? -54.48422 51.20323 -11.25568 1.000 24.71330  ? 96  HIS B N   1 
ATOM   3603 C CA  . HIS B  1 119 ? -53.54309 51.15209 -10.14065 1.000 27.59894  ? 96  HIS B CA  1 
ATOM   3604 C C   . HIS B  1 119 ? -54.29810 51.28974 -8.82886  1.000 33.00400  ? 96  HIS B C   1 
ATOM   3605 O O   . HIS B  1 119 ? -55.26734 52.02727 -8.74715  1.000 34.95937  ? 96  HIS B O   1 
ATOM   3606 C CB  . HIS B  1 119 ? -52.47162 52.26640 -10.32683 1.000 24.51974  ? 96  HIS B CB  1 
ATOM   3607 C CG  . HIS B  1 119 ? -51.80648 52.15592 -11.66092 1.000 27.42857  ? 96  HIS B CG  1 
ATOM   3608 N ND1 . HIS B  1 119 ? -52.01738 53.06608 -12.67649 1.000 28.36679  ? 96  HIS B ND1 1 
ATOM   3609 C CD2 . HIS B  1 119 ? -51.09298 51.13795 -12.20498 1.000 26.61187  ? 96  HIS B CD2 1 
ATOM   3610 C CE1 . HIS B  1 119 ? -51.39165 52.65206 -13.76950 1.000 29.05812  ? 96  HIS B CE1 1 
ATOM   3611 N NE2 . HIS B  1 119 ? -50.82495 51.48230 -13.51031 1.000 27.18553  ? 96  HIS B NE2 1 
ATOM   3612 N N   . ILE B  1 120 ? -53.79793 50.63084 -7.78835  1.000 37.92594  ? 97  ILE B N   1 
ATOM   3613 C CA  . ILE B  1 120 ? -54.53748 50.57534 -6.52515  1.000 44.74972  ? 97  ILE B CA  1 
ATOM   3614 C C   . ILE B  1 120 ? -54.46814 51.90080 -5.75831  1.000 36.95363  ? 97  ILE B C   1 
ATOM   3615 O O   . ILE B  1 120 ? -55.44722 52.31432 -5.12184  1.000 33.58477  ? 97  ILE B O   1 
ATOM   3616 C CB  . ILE B  1 120 ? -54.02055 49.40151 -5.67185  1.000 55.43140  ? 97  ILE B CB  1 
ATOM   3617 C CG1 . ILE B  1 120 ? -54.83576 49.30296 -4.38775  1.000 65.93944  ? 97  ILE B CG1 1 
ATOM   3618 C CG2 . ILE B  1 120 ? -52.55108 49.55701 -5.37005  1.000 59.52307  ? 97  ILE B CG2 1 
ATOM   3619 C CD1 . ILE B  1 120 ? -56.35633 49.23106 -4.65086  1.000 69.39587  ? 97  ILE B CD1 1 
ATOM   3620 N N   . SER B  1 121 ? -53.31260 52.56841 -5.75943  1.000 26.84261  ? 98  SER B N   1 
ATOM   3621 C CA  . SER B  1 121 ? -53.13248 53.79632 -4.99382  1.000 28.63675  ? 98  SER B CA  1 
ATOM   3622 C C   . SER B  1 121 ? -53.02171 54.98038 -5.93899  1.000 27.95805  ? 98  SER B C   1 
ATOM   3623 O O   . SER B  1 121 ? -52.93095 54.82086 -7.15648  1.000 26.61387  ? 98  SER B O   1 
ATOM   3624 C CB  . SER B  1 121 ? -51.89315 53.69417 -4.10810  1.000 29.96935  ? 98  SER B CB  1 
ATOM   3625 O OG  . SER B  1 121 ? -52.12022 52.66826 -3.15444  1.000 31.53553  ? 98  SER B OG  1 
ATOM   3626 N N   . THR B  1 122 ? -53.03594 56.17964 -5.36874  1.000 25.10349  ? 99  THR B N   1 
ATOM   3627 C CA  . THR B  1 122 ? -52.92065 57.39509 -6.16138  1.000 25.03097  ? 99  THR B CA  1 
ATOM   3628 C C   . THR B  1 122 ? -51.93664 58.35197 -5.51370  1.000 26.88911  ? 99  THR B C   1 
ATOM   3629 O O   . THR B  1 122 ? -51.49941 58.18132 -4.36098  1.000 27.68035  ? 99  THR B O   1 
ATOM   3630 C CB  . THR B  1 122 ? -54.27437 58.11106 -6.33163  1.000 27.53212  ? 99  THR B CB  1 
ATOM   3631 O OG1 . THR B  1 122 ? -54.86098 58.31557 -5.03572  1.000 26.40887  ? 99  THR B OG1 1 
ATOM   3632 C CG2 . THR B  1 122 ? -55.23980 57.24955 -7.16720  1.000 27.52205  ? 99  THR B CG2 1 
ATOM   3633 N N   . ILE B  1 123 ? -51.62804 59.39472 -6.27564  1.000 26.58318  ? 100 ILE B N   1 
ATOM   3634 C CA  . ILE B  1 123 ? -50.74165 60.47690 -5.85865  1.000 25.77004  ? 100 ILE B CA  1 
ATOM   3635 C C   . ILE B  1 123 ? -51.44217 61.77099 -6.22341  1.000 29.25965  ? 100 ILE B C   1 
ATOM   3636 O O   . ILE B  1 123 ? -51.61135 62.07030 -7.41789  1.000 28.76488  ? 100 ILE B O   1 
ATOM   3637 C CB  . ILE B  1 123 ? -49.36787 60.41185 -6.53556  1.000 27.89239  ? 100 ILE B CB  1 
ATOM   3638 C CG1 . ILE B  1 123 ? -48.65006 59.09904 -6.16597  1.000 28.66855  ? 100 ILE B CG1 1 
ATOM   3639 C CG2 . ILE B  1 123 ? -48.52721 61.67021 -6.12935  1.000 27.44901  ? 100 ILE B CG2 1 
ATOM   3640 C CD1 . ILE B  1 123 ? -47.38196 58.82665 -7.03269  1.000 29.70200  ? 100 ILE B CD1 1 
ATOM   3641 N N   . GLY B  1 124 ? -51.86219 62.52569 -5.21095  1.000 28.40757  ? 101 GLY B N   1 
ATOM   3642 C CA  . GLY B  1 124 ? -52.50106 63.82279 -5.43299  1.000 29.58464  ? 101 GLY B CA  1 
ATOM   3643 C C   . GLY B  1 124 ? -53.84771 63.79689 -6.13121  1.000 36.87502  ? 101 GLY B C   1 
ATOM   3644 O O   . GLY B  1 124 ? -54.19113 64.76244 -6.83568  1.000 33.61898  ? 101 GLY B O   1 
ATOM   3645 N N   . VAL B  1 125 ? -54.63681 62.72835 -5.95419  1.000 27.84882  ? 102 VAL B N   1 
ATOM   3646 C CA  . VAL B  1 125 ? -55.93393 62.58989 -6.61754  1.000 31.56802  ? 102 VAL B CA  1 
ATOM   3647 C C   . VAL B  1 125 ? -57.08844 62.53967 -5.61671  1.000 31.35846  ? 102 VAL B C   1 
ATOM   3648 O O   . VAL B  1 125 ? -58.10031 63.23457 -5.77675  1.000 30.75654  ? 102 VAL B O   1 
ATOM   3649 C CB  . VAL B  1 125 ? -55.96673 61.34717 -7.53629  1.000 31.95157  ? 102 VAL B CB  1 
ATOM   3650 C CG1 . VAL B  1 125 ? -57.40155 61.13734 -8.13407  1.000 30.16406  ? 102 VAL B CG1 1 
ATOM   3651 C CG2 . VAL B  1 125 ? -54.92334 61.49033 -8.66048  1.000 30.47941  ? 102 VAL B CG2 1 
ATOM   3652 N N   . CYS B  1 126 ? -56.97734 61.68971 -4.60311  1.000 29.95117  ? 103 CYS B N   1 
ATOM   3653 C CA  . CYS B  1 126 ? -58.14660 61.31437 -3.82124  1.000 32.16072  ? 103 CYS B CA  1 
ATOM   3654 C C   . CYS B  1 126 ? -57.68755 61.03418 -2.40033  1.000 32.19331  ? 103 CYS B C   1 
ATOM   3655 O O   . CYS B  1 126 ? -56.74619 60.26133 -2.19873  1.000 30.62974  ? 103 CYS B O   1 
ATOM   3656 C CB  . CYS B  1 126 ? -58.83493 60.09192 -4.44108  1.000 29.29187  ? 103 CYS B CB  1 
ATOM   3657 S SG  . CYS B  1 126 ? -60.05460 59.27404 -3.34169  1.000 32.50758  ? 103 CYS B SG  1 
ATOM   3658 N N   . SER B  1 127 ? -58.33582 61.66939 -1.42442  1.000 26.81007  ? 104 SER B N   1 
ATOM   3659 C CA  . SER B  1 127 ? -57.81990 61.57577 -0.06226  1.000 31.82079  ? 104 SER B CA  1 
ATOM   3660 C C   . SER B  1 127 ? -57.93260 60.16507 0.50582   1.000 32.28485  ? 104 SER B C   1 
ATOM   3661 O O   . SER B  1 127 ? -57.17874 59.83632 1.42860   1.000 31.27924  ? 104 SER B O   1 
ATOM   3662 C CB  . SER B  1 127 ? -58.52562 62.57408 0.87523   1.000 36.29082  ? 104 SER B CB  1 
ATOM   3663 O OG  . SER B  1 127 ? -59.87785 62.16092 1.07745   1.000 46.82089  ? 104 SER B OG  1 
ATOM   3664 N N   . MET B  1 128 ? -58.83959 59.32081 -0.00973  1.000 25.40167  ? 105 MET B N   1 
ATOM   3665 C CA  . MET B  1 128 ? -58.91587 57.95082 0.51559   1.000 28.60778  ? 105 MET B CA  1 
ATOM   3666 C C   . MET B  1 128 ? -57.83516 57.03162 -0.05439  1.000 30.67670  ? 105 MET B C   1 
ATOM   3667 O O   . MET B  1 128 ? -57.43440 56.07746 0.61774   1.000 30.70001  ? 105 MET B O   1 
ATOM   3668 C CB  . MET B  1 128 ? -60.30853 57.33397 0.24786   1.000 28.04941  ? 105 MET B CB  1 
ATOM   3669 C CG  . MET B  1 128 ? -61.33201 57.56229 1.40017   1.000 29.51679  ? 105 MET B CG  1 
ATOM   3670 S SD  . MET B  1 128 ? -60.80845 56.84760 2.98548   1.000 32.90395  ? 105 MET B SD  1 
ATOM   3671 C CE  . MET B  1 128 ? -60.46085 55.14684 2.54628   1.000 36.85528  ? 105 MET B CE  1 
ATOM   3672 N N   . THR B  1 129 ? -57.37414 57.26496 -1.28826  1.000 26.83733  ? 106 THR B N   1 
ATOM   3673 C CA  . THR B  1 129 ? -56.40331 56.37456 -1.92067  1.000 29.49099  ? 106 THR B CA  1 
ATOM   3674 C C   . THR B  1 129 ? -55.00700 56.97288 -2.06456  1.000 27.63576  ? 106 THR B C   1 
ATOM   3675 O O   . THR B  1 129 ? -54.07673 56.23063 -2.41892  1.000 26.65720  ? 106 THR B O   1 
ATOM   3676 C CB  . THR B  1 129 ? -56.89225 55.95442 -3.32042  1.000 27.85799  ? 106 THR B CB  1 
ATOM   3677 O OG1 . THR B  1 129 ? -57.08335 57.12714 -4.11031  1.000 28.60426  ? 106 THR B OG1 1 
ATOM   3678 C CG2 . THR B  1 129 ? -58.23226 55.19060 -3.24091  1.000 26.22804  ? 106 THR B CG2 1 
ATOM   3679 N N   . ASP B  1 130 ? -54.82883 58.28156 -1.83881  1.000 24.80914  ? 107 ASP B N   1 
ATOM   3680 C CA  . ASP B  1 130 ? -53.50222 58.88916 -1.97668  1.000 27.81872  ? 107 ASP B CA  1 
ATOM   3681 C C   . ASP B  1 130 ? -52.51135 58.28043 -0.99687  1.000 27.71314  ? 107 ASP B C   1 
ATOM   3682 O O   . ASP B  1 130 ? -52.77966 58.20470 0.19632   1.000 31.30131  ? 107 ASP B O   1 
ATOM   3683 C CB  . ASP B  1 130 ? -53.56253 60.39700 -1.71423  1.000 28.01524  ? 107 ASP B CB  1 
ATOM   3684 C CG  . ASP B  1 130 ? -54.05450 61.20425 -2.91179  1.000 32.40111  ? 107 ASP B CG  1 
ATOM   3685 O OD1 . ASP B  1 130 ? -54.30906 60.62788 -4.00285  1.000 31.07419  ? 107 ASP B OD1 1 
ATOM   3686 O OD2 . ASP B  1 130 ? -54.17052 62.44218 -2.74491  1.000 34.86007  ? 107 ASP B OD2 1 
ATOM   3687 N N   . ILE B  1 131 ? -51.31416 57.94329 -1.47804  1.000 27.00807  ? 108 ILE B N   1 
ATOM   3688 C CA  . ILE B  1 131 ? -50.20865 57.67745 -0.55797  1.000 31.15570  ? 108 ILE B CA  1 
ATOM   3689 C C   . ILE B  1 131 ? -49.31371 58.88434 -0.40629  1.000 32.49977  ? 108 ILE B C   1 
ATOM   3690 O O   . ILE B  1 131 ? -48.44986 58.90012 0.48974   1.000 30.53058  ? 108 ILE B O   1 
ATOM   3691 C CB  . ILE B  1 131 ? -49.36506 56.46684 -1.01243  1.000 30.66384  ? 108 ILE B CB  1 
ATOM   3692 C CG1 . ILE B  1 131 ? -48.69516 56.76513 -2.35021  1.000 33.28934  ? 108 ILE B CG1 1 
ATOM   3693 C CG2 . ILE B  1 131 ? -50.24176 55.18897 -1.05666  1.000 29.63587  ? 108 ILE B CG2 1 
ATOM   3694 C CD1 . ILE B  1 131 ? -47.71714 55.70264 -2.76513  1.000 37.91665  ? 108 ILE B CD1 1 
ATOM   3695 N N   . ALA B  1 132 ? -49.51889 59.91198 -1.22444  1.000 30.80078  ? 109 ALA B N   1 
ATOM   3696 C CA  . ALA B  1 132 ? -48.68342 61.09937 -1.27051  1.000 32.48767  ? 109 ALA B CA  1 
ATOM   3697 C C   . ALA B  1 132 ? -49.46491 62.15941 -2.02496  1.000 35.81061  ? 109 ALA B C   1 
ATOM   3698 O O   . ALA B  1 132 ? -50.40578 61.84612 -2.76867  1.000 30.75365  ? 109 ALA B O   1 
ATOM   3699 C CB  . ALA B  1 132 ? -47.34772 60.81463 -1.97504  1.000 31.94821  ? 109 ALA B CB  1 
ATOM   3700 N N   . LYS B  1 133 ? -49.07207 63.41668 -1.83116  1.000 32.40296  ? 110 LYS B N   1 
ATOM   3701 C CA  . LYS B  1 133 ? -49.61872 64.47496 -2.67351  1.000 33.91352  ? 110 LYS B CA  1 
ATOM   3702 C C   . LYS B  1 133 ? -48.77547 64.71691 -3.91226  1.000 33.33017  ? 110 LYS B C   1 
ATOM   3703 O O   . LYS B  1 133 ? -49.31898 65.11685 -4.94556  1.000 34.01726  ? 110 LYS B O   1 
ATOM   3704 C CB  . LYS B  1 133 ? -49.73575 65.79151 -1.89744  1.000 41.82346  ? 110 LYS B CB  1 
ATOM   3705 C CG  . LYS B  1 133 ? -50.40896 65.62615 -0.54906  1.000 54.24272  ? 110 LYS B CG  1 
ATOM   3706 C CD  . LYS B  1 133 ? -51.83963 66.14978 -0.56919  1.000 70.36462  ? 110 LYS B CD  1 
ATOM   3707 C CE  . LYS B  1 133 ? -52.34769 66.42924 0.85132   1.000 76.42718  ? 110 LYS B CE  1 
ATOM   3708 N NZ  . LYS B  1 133 ? -53.46415 67.42426 0.88628   1.000 79.58950  ? 110 LYS B NZ  1 
ATOM   3709 N N   . LYS B  1 134 ? -47.45583 64.53695 -3.81923  1.000 31.22130  ? 111 LYS B N   1 
ATOM   3710 C CA  . LYS B  1 134 ? -46.56347 64.74220 -4.94879  1.000 33.39527  ? 111 LYS B CA  1 
ATOM   3711 C C   . LYS B  1 134 ? -45.65714 63.53008 -5.10261  1.000 31.24584  ? 111 LYS B C   1 
ATOM   3712 O O   . LYS B  1 134 ? -45.27960 62.91140 -4.10399  1.000 32.56449  ? 111 LYS B O   1 
ATOM   3713 C CB  . LYS B  1 134 ? -45.70667 66.00706 -4.74404  1.000 37.85798  ? 111 LYS B CB  1 
ATOM   3714 C CG  . LYS B  1 134 ? -46.54404 67.26821 -4.43334  1.000 45.65263  ? 111 LYS B CG  1 
ATOM   3715 C CD  . LYS B  1 134 ? -45.66082 68.53735 -4.31679  1.000 49.42153  ? 111 LYS B CD  1 
ATOM   3716 C CE  . LYS B  1 134 ? -46.45246 69.69307 -3.70359  1.000 54.41811  ? 111 LYS B CE  1 
ATOM   3717 N NZ  . LYS B  1 134 ? -45.61226 70.94427 -3.56251  1.000 62.75848  ? 111 LYS B NZ  1 
ATOM   3718 N N   . PRO B  1 135 ? -45.26708 63.18538 -6.33361  1.000 33.64349  ? 112 PRO B N   1 
ATOM   3719 C CA  . PRO B  1 135 ? -44.40408 62.00036 -6.52309  1.000 38.45589  ? 112 PRO B CA  1 
ATOM   3720 C C   . PRO B  1 135 ? -42.99097 62.18706 -5.97065  1.000 43.81808  ? 112 PRO B C   1 
ATOM   3721 O O   . PRO B  1 135 ? -42.22290 61.22855 -5.96236  1.000 47.26995  ? 112 PRO B O   1 
ATOM   3722 C CB  . PRO B  1 135 ? -44.36581 61.81005 -8.04956  1.000 39.41236  ? 112 PRO B CB  1 
ATOM   3723 C CG  . PRO B  1 135 ? -45.23183 62.87501 -8.64479  1.000 42.34690  ? 112 PRO B CG  1 
ATOM   3724 C CD  . PRO B  1 135 ? -45.51876 63.90760 -7.59271  1.000 36.13096  ? 112 PRO B CD  1 
ATOM   3725 N N   . THR B  1 136 ? -42.63147 63.37525 -5.51686  1.000 46.81860  ? 113 THR B N   1 
ATOM   3726 C CA  . THR B  1 136 ? -41.32174 63.56004 -4.90471  1.000 56.17832  ? 113 THR B CA  1 
ATOM   3727 C C   . THR B  1 136 ? -41.27758 63.07002 -3.47708  1.000 51.48025  ? 113 THR B C   1 
ATOM   3728 O O   . THR B  1 136 ? -40.19674 63.03506 -2.90101  1.000 44.32792  ? 113 THR B O   1 
ATOM   3729 C CB  . THR B  1 136 ? -40.92283 65.02552 -4.90879  1.000 52.30564  ? 113 THR B CB  1 
ATOM   3730 O OG1 . THR B  1 136 ? -42.05879 65.81308 -4.52734  1.000 55.77597  ? 113 THR B OG1 1 
ATOM   3731 C CG2 . THR B  1 136 ? -40.44291 65.42897 -6.28043  1.000 51.93144  ? 113 THR B CG2 1 
ATOM   3732 N N   . GLU B  1 137 ? -42.41703 62.71378 -2.88903  1.000 40.54981  ? 114 GLU B N   1 
ATOM   3733 C CA  . GLU B  1 137 ? -42.39768 62.24935 -1.51213  1.000 40.41438  ? 114 GLU B CA  1 
ATOM   3734 C C   . GLU B  1 137 ? -41.70947 60.88322 -1.42393  1.000 43.49849  ? 114 GLU B C   1 
ATOM   3735 O O   . GLU B  1 137 ? -41.77279 60.06639 -2.34934  1.000 43.51915  ? 114 GLU B O   1 
ATOM   3736 C CB  . GLU B  1 137 ? -43.82607 62.20262 -0.94877  1.000 39.25237  ? 114 GLU B CB  1 
ATOM   3737 C CG  . GLU B  1 137 ? -44.39611 63.60584 -0.70471  1.000 42.43282  ? 114 GLU B CG  1 
ATOM   3738 C CD  . GLU B  1 137 ? -45.86014 63.58769 -0.32898  1.000 42.86867  ? 114 GLU B CD  1 
ATOM   3739 O OE1 . GLU B  1 137 ? -46.66159 64.25069 -1.02447  1.000 43.11505  ? 114 GLU B OE1 1 
ATOM   3740 O OE2 . GLU B  1 137 ? -46.21755 62.89868 0.65394   1.000 44.49230  ? 114 GLU B OE2 1 
ATOM   3741 N N   . THR B  1 138 ? -41.06312 60.64484 -0.27662  1.000 42.25636  ? 115 THR B N   1 
ATOM   3742 C CA  . THR B  1 138 ? -40.19703 59.48125 -0.08258  1.000 43.16048  ? 115 THR B CA  1 
ATOM   3743 C C   . THR B  1 138 ? -40.94297 58.16528 -0.25841  1.000 40.40667  ? 115 THR B C   1 
ATOM   3744 O O   . THR B  1 138 ? -40.37078 57.18677 -0.74934  1.000 41.28363  ? 115 THR B O   1 
ATOM   3745 C CB  . THR B  1 138 ? -39.57031 59.54802 1.31323   1.000 49.84245  ? 115 THR B CB  1 
ATOM   3746 O OG1 . THR B  1 138 ? -38.76902 60.72922 1.40135   1.000 60.34717  ? 115 THR B OG1 1 
ATOM   3747 C CG2 . THR B  1 138 ? -38.67153 58.35322 1.55861   1.000 53.11481  ? 115 THR B CG2 1 
ATOM   3748 N N   . ILE B  1 139 ? -42.21937 58.11728 0.14032   1.000 35.46596  ? 116 ILE B N   1 
ATOM   3749 C CA  . ILE B  1 139 ? -43.02388 56.90321 -0.02643  1.000 37.77579  ? 116 ILE B CA  1 
ATOM   3750 C C   . ILE B  1 139 ? -43.04545 56.43403 -1.47685  1.000 38.74616  ? 116 ILE B C   1 
ATOM   3751 O O   . ILE B  1 139 ? -43.26399 55.24608 -1.74465  1.000 42.12416  ? 116 ILE B O   1 
ATOM   3752 C CB  . ILE B  1 139 ? -44.46270 57.13844 0.49024   1.000 41.93827  ? 116 ILE B CB  1 
ATOM   3753 C CG1 . ILE B  1 139 ? -45.22472 55.81524 0.61995   1.000 48.62259  ? 116 ILE B CG1 1 
ATOM   3754 C CG2 . ILE B  1 139 ? -45.23493 57.97063 -0.50115  1.000 36.84539  ? 116 ILE B CG2 1 
ATOM   3755 C CD1 . ILE B  1 139 ? -44.60488 54.82084 1.56495   1.000 56.43587  ? 116 ILE B CD1 1 
ATOM   3756 N N   . CYS B  1 140 ? -42.84832 57.34217 -2.43955  1.000 36.55216  ? 117 CYS B N   1 
ATOM   3757 C CA  . CYS B  1 140 ? -43.00101 56.97278 -3.84573  1.000 37.45666  ? 117 CYS B CA  1 
ATOM   3758 C C   . CYS B  1 140 ? -41.72538 56.42230 -4.45650  1.000 40.99365  ? 117 CYS B C   1 
ATOM   3759 O O   . CYS B  1 140 ? -41.77780 55.86855 -5.56585  1.000 38.70122  ? 117 CYS B O   1 
ATOM   3760 C CB  . CYS B  1 140 ? -43.42832 58.17323 -4.68859  1.000 38.48266  ? 117 CYS B CB  1 
ATOM   3761 S SG  . CYS B  1 140 ? -45.01924 58.93222 -4.21920  1.000 39.39776  ? 117 CYS B SG  1 
ATOM   3762 N N   . ALA B  1 141 ? -40.58472 56.61043 -3.78394  1.000 39.19147  ? 118 ALA B N   1 
ATOM   3763 C CA  . ALA B  1 141 ? -39.29524 56.17901 -4.32451  1.000 41.73397  ? 118 ALA B CA  1 
ATOM   3764 C C   . ALA B  1 141 ? -39.26428 54.71980 -4.76977  1.000 39.65188  ? 118 ALA B C   1 
ATOM   3765 O O   . ALA B  1 141 ? -38.76055 54.45808 -5.87301  1.000 40.83488  ? 118 ALA B O   1 
ATOM   3766 C CB  . ALA B  1 141 ? -38.17823 56.47039 -3.30606  1.000 44.65044  ? 118 ALA B CB  1 
ATOM   3767 N N   . PRO B  1 142 ? -39.76580 53.73804 -4.00459  1.000 45.73104  ? 119 PRO B N   1 
ATOM   3768 C CA  . PRO B  1 142 ? -39.71065 52.33949 -4.48516  1.000 45.79651  ? 119 PRO B CA  1 
ATOM   3769 C C   . PRO B  1 142 ? -40.71198 52.01003 -5.59200  1.000 44.20096  ? 119 PRO B C   1 
ATOM   3770 O O   . PRO B  1 142 ? -40.58967 50.95101 -6.21460  1.000 40.11835  ? 119 PRO B O   1 
ATOM   3771 C CB  . PRO B  1 142 ? -40.02498 51.51226 -3.23080  1.000 48.78808  ? 119 PRO B CB  1 
ATOM   3772 C CG  . PRO B  1 142 ? -40.20779 52.48212 -2.10512  1.000 53.50239  ? 119 PRO B CG  1 
ATOM   3773 C CD  . PRO B  1 142 ? -40.42932 53.82828 -2.69105  1.000 49.29183  ? 119 PRO B CD  1 
ATOM   3774 N N   . LEU B  1 143 ? -41.69075 52.86351 -5.86169  1.000 37.82558  ? 120 LEU B N   1 
ATOM   3775 C CA  . LEU B  1 143 ? -42.73552 52.55336 -6.83298  1.000 34.29824  ? 120 LEU B CA  1 
ATOM   3776 C C   . LEU B  1 143 ? -42.35299 53.06199 -8.21956  1.000 32.32566  ? 120 LEU B C   1 
ATOM   3777 O O   . LEU B  1 143 ? -41.79442 54.15003 -8.36466  1.000 30.27246  ? 120 LEU B O   1 
ATOM   3778 C CB  . LEU B  1 143 ? -44.05655 53.20922 -6.41506  1.000 31.13411  ? 120 LEU B CB  1 
ATOM   3779 C CG  . LEU B  1 143 ? -44.53041 52.87752 -4.99748  1.000 37.11758  ? 120 LEU B CG  1 
ATOM   3780 C CD1 . LEU B  1 143 ? -45.85137 53.59296 -4.73090  1.000 33.87478  ? 120 LEU B CD1 1 
ATOM   3781 C CD2 . LEU B  1 143 ? -44.69460 51.36511 -4.86074  1.000 38.59535  ? 120 LEU B CD2 1 
ATOM   3782 N N   . THR B  1 144 ? -42.73927 52.31836 -9.25221  1.000 32.46878  ? 121 THR B N   1 
ATOM   3783 C CA  . THR B  1 144 ? -42.58057 52.83570 -10.61406 1.000 32.20585  ? 121 THR B CA  1 
ATOM   3784 C C   . THR B  1 144 ? -43.76363 53.75399 -10.94933 1.000 32.20988  ? 121 THR B C   1 
ATOM   3785 O O   . THR B  1 144 ? -44.89121 53.29738 -11.19083 1.000 28.01719  ? 121 THR B O   1 
ATOM   3786 C CB  . THR B  1 144 ? -42.41308 51.67109 -11.59298 1.000 34.05564  ? 121 THR B CB  1 
ATOM   3787 O OG1 . THR B  1 144 ? -41.15307 51.03302 -11.34420 1.000 31.92448  ? 121 THR B OG1 1 
ATOM   3788 C CG2 . THR B  1 144 ? -42.44922 52.14141 -13.05580 1.000 28.44372  ? 121 THR B CG2 1 
ATOM   3789 N N   . VAL B  1 145 ? -43.49335 55.05699 -10.96071 1.000 31.01458  ? 122 VAL B N   1 
ATOM   3790 C CA  . VAL B  1 145 ? -44.49912 56.09506 -11.14078 1.000 30.95816  ? 122 VAL B CA  1 
ATOM   3791 C C   . VAL B  1 145 ? -44.60133 56.43556 -12.62313 1.000 33.20283  ? 122 VAL B C   1 
ATOM   3792 O O   . VAL B  1 145 ? -43.57892 56.62593 -13.28756 1.000 29.67127  ? 122 VAL B O   1 
ATOM   3793 C CB  . VAL B  1 145 ? -44.12124 57.34999 -10.33282 1.000 31.42789  ? 122 VAL B CB  1 
ATOM   3794 C CG1 . VAL B  1 145 ? -45.12506 58.48342 -10.58490 1.000 30.86307  ? 122 VAL B CG1 1 
ATOM   3795 C CG2 . VAL B  1 145 ? -43.96886 57.00248 -8.84532  1.000 29.92407  ? 122 VAL B CG2 1 
ATOM   3796 N N   . PHE B  1 146 ? -45.83315 56.53263 -13.13889 1.000 30.44373  ? 123 PHE B N   1 
ATOM   3797 C CA  . PHE B  1 146 ? -46.07410 56.94189 -14.52416 1.000 26.90836  ? 123 PHE B CA  1 
ATOM   3798 C C   . PHE B  1 146 ? -46.15957 58.46309 -14.58773 1.000 28.61262  ? 123 PHE B C   1 
ATOM   3799 O O   . PHE B  1 146 ? -46.94721 59.07460 -13.84930 1.000 29.50989  ? 123 PHE B O   1 
ATOM   3800 C CB  . PHE B  1 146 ? -47.37238 56.30816 -15.04297 1.000 29.18282  ? 123 PHE B CB  1 
ATOM   3801 C CG  . PHE B  1 146 ? -47.82451 56.84518 -16.37316 1.000 29.40760  ? 123 PHE B CG  1 
ATOM   3802 C CD1 . PHE B  1 146 ? -47.19678 56.45024 -17.55253 1.000 31.41488  ? 123 PHE B CD1 1 
ATOM   3803 C CD2 . PHE B  1 146 ? -48.86351 57.77071 -16.44336 1.000 30.87678  ? 123 PHE B CD2 1 
ATOM   3804 C CE1 . PHE B  1 146 ? -47.62773 56.96090 -18.79615 1.000 32.70207  ? 123 PHE B CE1 1 
ATOM   3805 C CE2 . PHE B  1 146 ? -49.27733 58.28685 -17.67301 1.000 35.29796  ? 123 PHE B CE2 1 
ATOM   3806 C CZ  . PHE B  1 146 ? -48.67071 57.85815 -18.84832 1.000 31.71963  ? 123 PHE B CZ  1 
ATOM   3807 N N   . PHE B  1 147 ? -45.34361 59.06996 -15.46286 1.000 27.43981  ? 124 PHE B N   1 
ATOM   3808 C CA  . PHE B  1 147 ? -45.26085 60.50879 -15.66502 1.000 28.53034  ? 124 PHE B CA  1 
ATOM   3809 C C   . PHE B  1 147 ? -45.66879 60.83345 -17.10122 1.000 34.78391  ? 124 PHE B C   1 
ATOM   3810 O O   . PHE B  1 147 ? -45.35100 60.09071 -18.03670 1.000 28.48388  ? 124 PHE B O   1 
ATOM   3811 C CB  . PHE B  1 147 ? -43.81317 61.03097 -15.41929 1.000 26.32957  ? 124 PHE B CB  1 
ATOM   3812 C CG  . PHE B  1 147 ? -43.32854 60.85857 -13.99571 1.000 28.39439  ? 124 PHE B CG  1 
ATOM   3813 C CD1 . PHE B  1 147 ? -43.66058 61.79235 -13.02182 1.000 28.29444  ? 124 PHE B CD1 1 
ATOM   3814 C CD2 . PHE B  1 147 ? -42.54845 59.77372 -13.63897 1.000 26.93668  ? 124 PHE B CD2 1 
ATOM   3815 C CE1 . PHE B  1 147 ? -43.23084 61.64546 -11.71509 1.000 29.52946  ? 124 PHE B CE1 1 
ATOM   3816 C CE2 . PHE B  1 147 ? -42.08003 59.62532 -12.33112 1.000 28.87483  ? 124 PHE B CE2 1 
ATOM   3817 C CZ  . PHE B  1 147 ? -42.43490 60.56027 -11.35851 1.000 27.24976  ? 124 PHE B CZ  1 
ATOM   3818 N N   . ASP B  1 148 ? -46.33046 61.96544 -17.28541 1.000 35.54426  ? 125 ASP B N   1 
ATOM   3819 C CA  . ASP B  1 148 ? -46.90351 62.35166 -18.57719 1.000 32.38873  ? 125 ASP B CA  1 
ATOM   3820 C C   . ASP B  1 148 ? -46.30543 63.70211 -18.96747 1.000 35.08887  ? 125 ASP B C   1 
ATOM   3821 O O   . ASP B  1 148 ? -46.71315 64.74929 -18.44547 1.000 36.85890  ? 125 ASP B O   1 
ATOM   3822 C CB  . ASP B  1 148 ? -48.43550 62.38298 -18.47191 1.000 33.39779  ? 125 ASP B CB  1 
ATOM   3823 C CG  . ASP B  1 148 ? -49.13035 62.72628 -19.79532 1.000 38.43075  ? 125 ASP B CG  1 
ATOM   3824 O OD1 . ASP B  1 148 ? -48.44888 63.11465 -20.78273 1.000 33.41159  ? 125 ASP B OD1 1 
ATOM   3825 O OD2 . ASP B  1 148 ? -50.38488 62.60590 -19.84335 1.000 36.35225  ? 125 ASP B OD2 1 
ATOM   3826 N N   . GLY B  1 149 ? -45.35164 63.67675 -19.90331 1.000 30.58669  ? 126 GLY B N   1 
ATOM   3827 C CA  . GLY B  1 149 ? -44.66703 64.87869 -20.36644 1.000 30.66044  ? 126 GLY B CA  1 
ATOM   3828 C C   . GLY B  1 149 ? -45.57477 65.92706 -20.97663 1.000 40.68853  ? 126 GLY B C   1 
ATOM   3829 O O   . GLY B  1 149 ? -45.13479 67.06552 -21.17769 1.000 39.59349  ? 126 GLY B O   1 
ATOM   3830 N N   . ARG B  1 150 ? -46.82861 65.58929 -21.26649 1.000 35.58768  ? 127 ARG B N   1 
ATOM   3831 C CA  . ARG B  1 150 ? -47.77240 66.61517 -21.70048 1.000 35.58119  ? 127 ARG B CA  1 
ATOM   3832 C C   . ARG B  1 150 ? -48.24690 67.50709 -20.55737 1.000 42.01188  ? 127 ARG B C   1 
ATOM   3833 O O   . ARG B  1 150 ? -48.93348 68.49564 -20.81096 1.000 47.01057  ? 127 ARG B O   1 
ATOM   3834 C CB  . ARG B  1 150 ? -48.99575 65.95248 -22.36542 1.000 34.40821  ? 127 ARG B CB  1 
ATOM   3835 C CG  . ARG B  1 150 ? -48.63641 65.12852 -23.62153 1.000 37.35081  ? 127 ARG B CG  1 
ATOM   3836 C CD  . ARG B  1 150 ? -49.79797 64.20357 -24.05171 1.000 37.39510  ? 127 ARG B CD  1 
ATOM   3837 N NE  . ARG B  1 150 ? -50.19175 63.27017 -22.99451 1.000 33.70696  ? 127 ARG B NE  1 
ATOM   3838 C CZ  . ARG B  1 150 ? -51.16042 62.36312 -23.14466 1.000 36.19596  ? 127 ARG B CZ  1 
ATOM   3839 N NH1 . ARG B  1 150 ? -51.80399 62.24269 -24.30863 1.000 29.00417  ? 127 ARG B NH1 1 
ATOM   3840 N NH2 . ARG B  1 150 ? -51.46832 61.55973 -22.14825 1.000 27.86802  ? 127 ARG B NH2 1 
ATOM   3841 N N   . VAL B  1 151 ? -47.94624 67.16740 -19.31219 1.000 36.54258  ? 128 VAL B N   1 
ATOM   3842 C CA  . VAL B  1 151 ? -48.33586 67.96881 -18.15646 1.000 39.64093  ? 128 VAL B CA  1 
ATOM   3843 C C   . VAL B  1 151 ? -47.10339 68.71705 -17.66317 1.000 42.61657  ? 128 VAL B C   1 
ATOM   3844 O O   . VAL B  1 151 ? -46.03138 68.11054 -17.48345 1.000 33.41428  ? 128 VAL B O   1 
ATOM   3845 C CB  . VAL B  1 151 ? -48.90777 67.08601 -17.03566 1.000 38.53250  ? 128 VAL B CB  1 
ATOM   3846 C CG1 . VAL B  1 151 ? -49.28680 67.94218 -15.83890 1.000 39.08266  ? 128 VAL B CG1 1 
ATOM   3847 C CG2 . VAL B  1 151 ? -50.09430 66.23708 -17.55368 1.000 40.23095  ? 128 VAL B CG2 1 
ATOM   3848 N N   . ASP B  1 152 ? -47.25666 70.02574 -17.42687 1.000 40.22088  ? 129 ASP B N   1 
ATOM   3849 C CA  . ASP B  1 152 ? -46.13932 70.86548 -16.99606 1.000 40.51976  ? 129 ASP B CA  1 
ATOM   3850 C C   . ASP B  1 152 ? -45.45819 70.28575 -15.76399 1.000 40.33702  ? 129 ASP B C   1 
ATOM   3851 O O   . ASP B  1 152 ? -46.11893 69.90958 -14.79507 1.000 38.45760  ? 129 ASP B O   1 
ATOM   3852 C CB  . ASP B  1 152 ? -46.63930 72.27823 -16.68714 1.000 50.04711  ? 129 ASP B CB  1 
ATOM   3853 C CG  . ASP B  1 152 ? -46.99737 73.06022 -17.93630 1.000 70.84462  ? 129 ASP B CG  1 
ATOM   3854 O OD1 . ASP B  1 152 ? -46.47246 72.71379 -19.02356 1.000 74.46469  ? 129 ASP B OD1 1 
ATOM   3855 O OD2 . ASP B  1 152 ? -47.79309 74.02885 -17.83090 1.000 78.36207  ? 129 ASP B OD2 1 
ATOM   3856 N N   . GLY B  1 153 ? -44.12647 70.21224 -15.80118 1.000 40.10049  ? 130 GLY B N   1 
ATOM   3857 C CA  . GLY B  1 153 ? -43.37229 69.76049 -14.65187 1.000 36.75186  ? 130 GLY B CA  1 
ATOM   3858 C C   . GLY B  1 153 ? -43.13384 68.26128 -14.55700 1.000 34.34108  ? 130 GLY B C   1 
ATOM   3859 O O   . GLY B  1 153 ? -42.28899 67.83832 -13.75439 1.000 35.94527  ? 130 GLY B O   1 
ATOM   3860 N N   . GLN B  1 154 ? -43.83770 67.42784 -15.32705 1.000 32.12980  ? 131 GLN B N   1 
ATOM   3861 C CA  . GLN B  1 154 ? -43.70560 65.99513 -15.05302 1.000 30.77842  ? 131 GLN B CA  1 
ATOM   3862 C C   . GLN B  1 154 ? -42.41233 65.38428 -15.61176 1.000 33.34636  ? 131 GLN B C   1 
ATOM   3863 O O   . GLN B  1 154 ? -41.90914 64.40429 -15.04355 1.000 33.40901  ? 131 GLN B O   1 
ATOM   3864 C CB  . GLN B  1 154 ? -44.93961 65.23776 -15.54765 1.000 28.46619  ? 131 GLN B CB  1 
ATOM   3865 C CG  . GLN B  1 154 ? -46.18595 65.61969 -14.67309 1.000 36.17759  ? 131 GLN B CG  1 
ATOM   3866 C CD  . GLN B  1 154 ? -47.15555 64.48204 -14.43598 1.000 43.19520  ? 131 GLN B CD  1 
ATOM   3867 O OE1 . GLN B  1 154 ? -47.09385 63.42548 -15.08440 1.000 38.71435  ? 131 GLN B OE1 1 
ATOM   3868 N NE2 . GLN B  1 154 ? -48.09449 64.70489 -13.52087 1.000 44.80665  ? 131 GLN B NE2 1 
ATOM   3869 N N   . VAL B  1 155 ? -41.84224 65.92965 -16.68653 1.000 33.62784  ? 132 VAL B N   1 
ATOM   3870 C CA  . VAL B  1 155 ? -40.51061 65.47448 -17.10580 1.000 34.99052  ? 132 VAL B CA  1 
ATOM   3871 C C   . VAL B  1 155 ? -39.49199 65.68069 -15.97857 1.000 37.04921  ? 132 VAL B C   1 
ATOM   3872 O O   . VAL B  1 155 ? -38.69629 64.78078 -15.66144 1.000 32.02891  ? 132 VAL B O   1 
ATOM   3873 C CB  . VAL B  1 155 ? -40.06207 66.20035 -18.38993 1.000 39.32337  ? 132 VAL B CB  1 
ATOM   3874 C CG1 . VAL B  1 155 ? -38.59893 65.83287 -18.71276 1.000 35.89077  ? 132 VAL B CG1 1 
ATOM   3875 C CG2 . VAL B  1 155 ? -40.97236 65.84276 -19.56943 1.000 37.26369  ? 132 VAL B CG2 1 
ATOM   3876 N N   . ASP B  1 156 ? -39.48424 66.87998 -15.37117 1.000 35.41243  ? 133 ASP B N   1 
ATOM   3877 C CA  . ASP B  1 156 ? -38.56216 67.14841 -14.26414 1.000 38.64028  ? 133 ASP B CA  1 
ATOM   3878 C C   . ASP B  1 156 ? -38.80573 66.19543 -13.09853 1.000 37.01807  ? 133 ASP B C   1 
ATOM   3879 O O   . ASP B  1 156 ? -37.86264 65.77389 -12.41605 1.000 34.02576  ? 133 ASP B O   1 
ATOM   3880 C CB  . ASP B  1 156 ? -38.70049 68.59279 -13.77918 1.000 45.77005  ? 133 ASP B CB  1 
ATOM   3881 C CG  . ASP B  1 156 ? -38.32529 69.60355 -14.83418 1.000 60.97741  ? 133 ASP B CG  1 
ATOM   3882 O OD1 . ASP B  1 156 ? -37.60005 69.23296 -15.78604 1.000 63.45894  ? 133 ASP B OD1 1 
ATOM   3883 O OD2 . ASP B  1 156 ? -38.76358 70.77438 -14.70427 1.000 67.72550  ? 133 ASP B OD2 1 
ATOM   3884 N N   . LEU B  1 157 ? -40.06612 65.85270 -12.84738 1.000 31.64673  ? 134 LEU B N   1 
ATOM   3885 C CA  . LEU B  1 157 ? -40.35495 64.91060 -11.77561 1.000 35.44772  ? 134 LEU B CA  1 
ATOM   3886 C C   . LEU B  1 157 ? -39.81445 63.52576 -12.11711 1.000 40.37525  ? 134 LEU B C   1 
ATOM   3887 O O   . LEU B  1 157 ? -39.30776 62.80852 -11.24234 1.000 34.79837  ? 134 LEU B O   1 
ATOM   3888 C CB  . LEU B  1 157 ? -41.86497 64.86841 -11.51439 1.000 28.34708  ? 134 LEU B CB  1 
ATOM   3889 C CG  . LEU B  1 157 ? -42.42681 66.17395 -10.92901 1.000 35.42271  ? 134 LEU B CG  1 
ATOM   3890 C CD1 . LEU B  1 157 ? -43.98931 66.11225 -10.95224 1.000 33.51288  ? 134 LEU B CD1 1 
ATOM   3891 C CD2 . LEU B  1 157 ? -41.90378 66.33513 -9.51728  1.000 36.26110  ? 134 LEU B CD2 1 
ATOM   3892 N N   . PHE B  1 158 ? -39.90603 63.13764 -13.38891 1.000 33.64187  ? 135 PHE B N   1 
ATOM   3893 C CA  . PHE B  1 158 ? -39.32385 61.86865 -13.80634 1.000 31.96149  ? 135 PHE B CA  1 
ATOM   3894 C C   . PHE B  1 158 ? -37.81530 61.84897 -13.55157 1.000 31.68785  ? 135 PHE B C   1 
ATOM   3895 O O   . PHE B  1 158 ? -37.27655 60.87787 -12.99840 1.000 33.45675  ? 135 PHE B O   1 
ATOM   3896 C CB  . PHE B  1 158 ? -39.65093 61.61494 -15.28546 1.000 31.66808  ? 135 PHE B CB  1 
ATOM   3897 C CG  . PHE B  1 158 ? -38.92014 60.42975 -15.88685 1.000 28.81142  ? 135 PHE B CG  1 
ATOM   3898 C CD1 . PHE B  1 158 ? -39.36395 59.13392 -15.66443 1.000 31.10524  ? 135 PHE B CD1 1 
ATOM   3899 C CD2 . PHE B  1 158 ? -37.81027 60.62130 -16.68854 1.000 32.43920  ? 135 PHE B CD2 1 
ATOM   3900 C CE1 . PHE B  1 158 ? -38.69822 58.03805 -16.23810 1.000 26.82823  ? 135 PHE B CE1 1 
ATOM   3901 C CE2 . PHE B  1 158 ? -37.14537 59.54195 -17.25694 1.000 35.51322  ? 135 PHE B CE2 1 
ATOM   3902 C CZ  . PHE B  1 158 ? -37.58658 58.25275 -17.03006 1.000 29.15032  ? 135 PHE B CZ  1 
ATOM   3903 N N   . ARG B  1 159 ? -37.10955 62.91443 -13.94342 1.000 29.84793  ? 136 ARG B N   1 
ATOM   3904 C CA  . ARG B  1 159 ? -35.67637 62.96277 -13.67818 1.000 33.67204  ? 136 ARG B CA  1 
ATOM   3905 C C   . ARG B  1 159 ? -35.34980 62.86146 -12.18724 1.000 37.42307  ? 136 ARG B C   1 
ATOM   3906 O O   . ARG B  1 159 ? -34.27099 62.37488 -11.82466 1.000 34.13546  ? 136 ARG B O   1 
ATOM   3907 C CB  . ARG B  1 159 ? -35.06232 64.24977 -14.23042 1.000 36.74777  ? 136 ARG B CB  1 
ATOM   3908 C CG  . ARG B  1 159 ? -35.21920 64.43737 -15.72407 1.000 34.45698  ? 136 ARG B CG  1 
ATOM   3909 C CD  . ARG B  1 159 ? -34.42468 65.68353 -16.05637 1.000 39.03138  ? 136 ARG B CD  1 
ATOM   3910 N NE  . ARG B  1 159 ? -34.38688 66.07316 -17.46221 1.000 39.86252  ? 136 ARG B NE  1 
ATOM   3911 C CZ  . ARG B  1 159 ? -33.48965 65.64550 -18.34329 1.000 41.88929  ? 136 ARG B CZ  1 
ATOM   3912 N NH1 . ARG B  1 159 ? -32.56251 64.75243 -17.98293 1.000 36.96694  ? 136 ARG B NH1 1 
ATOM   3913 N NH2 . ARG B  1 159 ? -33.50840 66.13793 -19.58205 1.000 37.01452  ? 136 ARG B NH2 1 
ATOM   3914 N N   . ASN B  1 160 ? -36.23150 63.33602 -11.31429 1.000 35.48102  ? 137 ASN B N   1 
ATOM   3915 C CA  . ASN B  1 160 ? -35.97388 63.24691 -9.88480  1.000 41.58012  ? 137 ASN B CA  1 
ATOM   3916 C C   . ASN B  1 160 ? -36.47059 61.93922 -9.26362  1.000 42.77552  ? 137 ASN B C   1 
ATOM   3917 O O   . ASN B  1 160 ? -36.06328 61.60612 -8.14045  1.000 41.64735  ? 137 ASN B O   1 
ATOM   3918 C CB  . ASN B  1 160 ? -36.58170 64.45622 -9.16569  1.000 46.07516  ? 137 ASN B CB  1 
ATOM   3919 C CG  . ASN B  1 160 ? -35.65794 65.70822 -9.24508  1.000 66.48531  ? 137 ASN B CG  1 
ATOM   3920 O OD1 . ASN B  1 160 ? -34.60144 65.76780 -8.59377  1.000 70.01587  ? 137 ASN B OD1 1 
ATOM   3921 N ND2 . ASN B  1 160 ? -36.05120 66.69191 -10.05754 1.000 70.71737  ? 137 ASN B ND2 1 
ATOM   3922 N N   . ALA B  1 161 ? -37.29084 61.17498 -9.97375  1.000 34.69897  ? 138 ALA B N   1 
ATOM   3923 C CA  . ALA B  1 161 ? -37.87896 59.95968 -9.41208  1.000 34.53793  ? 138 ALA B CA  1 
ATOM   3924 C C   . ALA B  1 161 ? -36.87124 58.81397 -9.45989  1.000 39.10115  ? 138 ALA B C   1 
ATOM   3925 O O   . ALA B  1 161 ? -36.05353 58.72397 -10.38062 1.000 37.57848  ? 138 ALA B O   1 
ATOM   3926 C CB  . ALA B  1 161 ? -39.15000 59.57423 -10.17257 1.000 28.99366  ? 138 ALA B CB  1 
ATOM   3927 N N   . ARG B  1 162 ? -36.90735 57.95119 -8.44133  1.000 38.06444  ? 139 ARG B N   1 
ATOM   3928 C CA  . ARG B  1 162 ? -36.00500 56.79850 -8.44103  1.000 39.92190  ? 139 ARG B CA  1 
ATOM   3929 C C   . ARG B  1 162 ? -36.46908 55.73823 -9.44961  1.000 34.50038  ? 139 ARG B C   1 
ATOM   3930 O O   . ARG B  1 162 ? -35.65037 55.14167 -10.15765 1.000 36.45576  ? 139 ARG B O   1 
ATOM   3931 C CB  . ARG B  1 162 ? -35.91446 56.22684 -7.02335  1.000 44.61389  ? 139 ARG B CB  1 
ATOM   3932 C CG  . ARG B  1 162 ? -34.99851 55.04877 -6.86750  1.000 54.70337  ? 139 ARG B CG  1 
ATOM   3933 C CD  . ARG B  1 162 ? -34.84008 54.64471 -5.40098  1.000 62.61020  ? 139 ARG B CD  1 
ATOM   3934 N NE  . ARG B  1 162 ? -34.14185 53.36825 -5.30173  1.000 70.75249  ? 139 ARG B NE  1 
ATOM   3935 C CZ  . ARG B  1 162 ? -32.81786 53.22506 -5.35942  1.000 73.28826  ? 139 ARG B CZ  1 
ATOM   3936 N NH1 . ARG B  1 162 ? -32.03348 54.28616 -5.50673  1.000 72.25512  ? 139 ARG B NH1 1 
ATOM   3937 N NH2 . ARG B  1 162 ? -32.27674 52.01325 -5.27058  1.000 74.69456  ? 139 ARG B NH2 1 
ATOM   3938 N N   . ASN B  1 163 ? -37.77130 55.49840 -9.52888  1.000 30.22733  ? 140 ASN B N   1 
ATOM   3939 C CA  . ASN B  1 163 ? -38.37053 54.51315 -10.43295 1.000 30.22749  ? 140 ASN B CA  1 
ATOM   3940 C C   . ASN B  1 163 ? -39.50304 55.17900 -11.19361 1.000 32.02081  ? 140 ASN B C   1 
ATOM   3941 O O   . ASN B  1 163 ? -40.33991 55.84983 -10.58130 1.000 32.23685  ? 140 ASN B O   1 
ATOM   3942 C CB  . ASN B  1 163 ? -38.90056 53.30404 -9.64350  1.000 29.82788  ? 140 ASN B CB  1 
ATOM   3943 C CG  . ASN B  1 163 ? -37.76643 52.52031 -9.01475  1.000 35.34228  ? 140 ASN B CG  1 
ATOM   3944 O OD1 . ASN B  1 163 ? -37.04672 51.80540 -9.70886  1.000 36.67227  ? 140 ASN B OD1 1 
ATOM   3945 N ND2 . ASN B  1 163 ? -37.56246 52.70189 -7.71672  1.000 36.45826  ? 140 ASN B ND2 1 
ATOM   3946 N N   . GLY B  1 164 ? -39.52500 55.03354 -12.52060 1.000 28.71143  ? 141 GLY B N   1 
ATOM   3947 C CA  . GLY B  1 164 ? -40.63291 55.66058 -13.22202 1.000 27.52152  ? 141 GLY B CA  1 
ATOM   3948 C C   . GLY B  1 164 ? -40.67315 55.30579 -14.69062 1.000 29.98903  ? 141 GLY B C   1 
ATOM   3949 O O   . GLY B  1 164 ? -39.73402 54.72665 -15.24188 1.000 29.91472  ? 141 GLY B O   1 
ATOM   3950 N N   . VAL B  1 165 ? -41.79927 55.65691 -15.31354 1.000 27.04027  ? 142 VAL B N   1 
ATOM   3951 C CA  . VAL B  1 165 ? -42.01354 55.52210 -16.75366 1.000 27.27441  ? 142 VAL B CA  1 
ATOM   3952 C C   . VAL B  1 165 ? -42.55979 56.85791 -17.22995 1.000 30.88608  ? 142 VAL B C   1 
ATOM   3953 O O   . VAL B  1 165 ? -43.47290 57.42525 -16.60690 1.000 29.53821  ? 142 VAL B O   1 
ATOM   3954 C CB  . VAL B  1 165 ? -42.97947 54.36554 -17.11166 1.000 28.38235  ? 142 VAL B CB  1 
ATOM   3955 C CG1 . VAL B  1 165 ? -43.46036 54.47040 -18.55942 1.000 28.15936  ? 142 VAL B CG1 1 
ATOM   3956 C CG2 . VAL B  1 165 ? -42.27943 53.02420 -16.88679 1.000 27.09213  ? 142 VAL B CG2 1 
ATOM   3957 N N   . LEU B  1 166 ? -41.97699 57.38831 -18.30520 1.000 28.28517  ? 143 LEU B N   1 
ATOM   3958 C CA  . LEU B  1 166 ? -42.37709 58.68168 -18.83228 1.000 26.41392  ? 143 LEU B CA  1 
ATOM   3959 C C   . LEU B  1 166 ? -42.83577 58.53892 -20.27165 1.000 30.89433  ? 143 LEU B C   1 
ATOM   3960 O O   . LEU B  1 166 ? -42.19738 57.83298 -21.04915 1.000 29.75507  ? 143 LEU B O   1 
ATOM   3961 C CB  . LEU B  1 166 ? -41.18036 59.66134 -18.75063 1.000 25.86840  ? 143 LEU B CB  1 
ATOM   3962 C CG  . LEU B  1 166 ? -41.30460 60.98619 -19.47794 1.000 26.36022  ? 143 LEU B CG  1 
ATOM   3963 C CD1 . LEU B  1 166 ? -42.29506 61.87945 -18.75414 1.000 27.36453  ? 143 LEU B CD1 1 
ATOM   3964 C CD2 . LEU B  1 166 ? -39.90884 61.68593 -19.57577 1.000 26.24413  ? 143 LEU B CD2 1 
ATOM   3965 N N   . ILE B  1 167 ? -43.93746 59.21890 -20.64098 1.000 28.08531  ? 144 ILE B N   1 
ATOM   3966 C CA  . ILE B  1 167 ? -44.30869 59.37260 -22.04428 1.000 26.56138  ? 144 ILE B CA  1 
ATOM   3967 C C   . ILE B  1 167 ? -44.21493 60.84402 -22.42355 1.000 28.66913  ? 144 ILE B C   1 
ATOM   3968 O O   . ILE B  1 167 ? -44.50401 61.73400 -21.60928 1.000 31.04785  ? 144 ILE B O   1 
ATOM   3969 C CB  . ILE B  1 167 ? -45.71708 58.82064 -22.35805 1.000 27.23816  ? 144 ILE B CB  1 
ATOM   3970 C CG1 . ILE B  1 167 ? -46.81786 59.58348 -21.59782 1.000 28.77750  ? 144 ILE B CG1 1 
ATOM   3971 C CG2 . ILE B  1 167 ? -45.74714 57.30089 -22.13393 1.000 24.36756  ? 144 ILE B CG2 1 
ATOM   3972 C CD1 . ILE B  1 167 ? -48.21397 59.31068 -22.18887 1.000 31.12695  ? 144 ILE B CD1 1 
ATOM   3973 N N   . THR B  1 168 ? -43.78429 61.11080 -23.66417 1.000 27.99923  ? 145 THR B N   1 
ATOM   3974 C CA  . THR B  1 168 ? -43.79548 62.46764 -24.18147 1.000 30.14144  ? 145 THR B CA  1 
ATOM   3975 C C   . THR B  1 168 ? -44.25451 62.45852 -25.62828 1.000 31.62873  ? 145 THR B C   1 
ATOM   3976 O O   . THR B  1 168 ? -44.26360 61.42366 -26.28390 1.000 31.73427  ? 145 THR B O   1 
ATOM   3977 C CB  . THR B  1 168 ? -42.40781 63.11660 -24.15677 1.000 33.36643  ? 145 THR B CB  1 
ATOM   3978 O OG1 . THR B  1 168 ? -41.54756 62.31885 -24.97978 1.000 35.05914  ? 145 THR B OG1 1 
ATOM   3979 C CG2 . THR B  1 168 ? -41.84026 63.19486 -22.74333 1.000 29.21358  ? 145 THR B CG2 1 
ATOM   3980 N N   . GLU B  1 169 ? -44.55770 63.65109 -26.14670 1.000 30.50468  ? 146 GLU B N   1 
ATOM   3981 C CA  . GLU B  1 169 ? -44.83224 63.80606 -27.56655 1.000 33.97833  ? 146 GLU B CA  1 
ATOM   3982 C C   . GLU B  1 169 ? -43.60658 64.21181 -28.38314 1.000 41.74719  ? 146 GLU B C   1 
ATOM   3983 O O   . GLU B  1 169 ? -43.69583 64.23689 -29.61283 1.000 42.66339  ? 146 GLU B O   1 
ATOM   3984 C CB  . GLU B  1 169 ? -45.95341 64.82748 -27.77427 1.000 28.23850  ? 146 GLU B CB  1 
ATOM   3985 C CG  . GLU B  1 169 ? -47.28017 64.34969 -27.16187 1.000 30.91407  ? 146 GLU B CG  1 
ATOM   3986 C CD  . GLU B  1 169 ? -48.38804 65.39284 -27.32476 1.000 43.40474  ? 146 GLU B CD  1 
ATOM   3987 O OE1 . GLU B  1 169 ? -48.08673 66.60889 -27.16985 1.000 44.10754  ? 146 GLU B OE1 1 
ATOM   3988 O OE2 . GLU B  1 169 ? -49.53528 64.99792 -27.63690 1.000 40.63158  ? 146 GLU B OE2 1 
ATOM   3989 N N   . GLY B  1 170 ? -42.47246 64.51367 -27.73978 1.000 37.28442  ? 147 GLY B N   1 
ATOM   3990 C CA  . GLY B  1 170 ? -41.26786 64.93165 -28.44141 1.000 33.42423  ? 147 GLY B CA  1 
ATOM   3991 C C   . GLY B  1 170 ? -40.00633 64.54627 -27.68003 1.000 33.26938  ? 147 GLY B C   1 
ATOM   3992 O O   . GLY B  1 170 ? -40.07550 63.83603 -26.66918 1.000 30.14827  ? 147 GLY B O   1 
ATOM   3993 N N   . SER B  1 171 ? -38.85405 64.99253 -28.16286 1.000 35.15307  ? 148 SER B N   1 
ATOM   3994 C CA  . SER B  1 171 ? -37.58696 64.62909 -27.53352 1.000 36.17350  ? 148 SER B CA  1 
ATOM   3995 C C   . SER B  1 171 ? -37.44552 65.30777 -26.16974 1.000 37.69031  ? 148 SER B C   1 
ATOM   3996 O O   . SER B  1 171 ? -37.97605 66.39832 -25.93282 1.000 33.33856  ? 148 SER B O   1 
ATOM   3997 C CB  . SER B  1 171 ? -36.41623 65.01977 -28.43812 1.000 30.96710  ? 148 SER B CB  1 
ATOM   3998 O OG  . SER B  1 171 ? -36.37763 66.42274 -28.67017 1.000 35.22408  ? 148 SER B OG  1 
ATOM   3999 N N   . VAL B  1 172 ? -36.76641 64.61443 -25.25687 1.000 34.99060  ? 149 VAL B N   1 
ATOM   4000 C CA  . VAL B  1 172 ? -36.32874 65.15500 -23.97254 1.000 31.43007  ? 149 VAL B CA  1 
ATOM   4001 C C   . VAL B  1 172 ? -34.80771 65.22511 -24.01345 1.000 33.22317  ? 149 VAL B C   1 
ATOM   4002 O O   . VAL B  1 172 ? -34.15391 64.22128 -24.32049 1.000 33.70341  ? 149 VAL B O   1 
ATOM   4003 C CB  . VAL B  1 172 ? -36.77738 64.25975 -22.80620 1.000 30.25453  ? 149 VAL B CB  1 
ATOM   4004 C CG1 . VAL B  1 172 ? -36.29982 64.84710 -21.48983 1.000 33.13361  ? 149 VAL B CG1 1 
ATOM   4005 C CG2 . VAL B  1 172 ? -38.28469 64.01693 -22.81704 1.000 31.33966  ? 149 VAL B CG2 1 
ATOM   4006 N N   . LYS B  1 173 ? -34.23476 66.38679 -23.70545 1.000 34.70996  ? 150 LYS B N   1 
ATOM   4007 C CA  . LYS B  1 173 ? -32.82060 66.56910 -24.00736 1.000 35.12318  ? 150 LYS B CA  1 
ATOM   4008 C C   . LYS B  1 173 ? -31.95986 65.53502 -23.28045 1.000 37.62671  ? 150 LYS B C   1 
ATOM   4009 O O   . LYS B  1 173 ? -32.11275 65.31748 -22.06972 1.000 36.78267  ? 150 LYS B O   1 
ATOM   4010 C CB  . LYS B  1 173 ? -32.34690 67.99027 -23.65738 1.000 37.94390  ? 150 LYS B CB  1 
ATOM   4011 C CG  . LYS B  1 173 ? -32.62236 68.47146 -22.24562 1.000 34.13354  ? 150 LYS B CG  1 
ATOM   4012 C CD  . LYS B  1 173 ? -32.16540 69.95446 -22.18223 1.000 35.93135  ? 150 LYS B CD  1 
ATOM   4013 C CE  . LYS B  1 173 ? -32.23096 70.54894 -20.79000 1.000 47.35378  ? 150 LYS B CE  1 
ATOM   4014 N NZ  . LYS B  1 173 ? -33.64611 70.62435 -20.32504 1.000 49.19430  ? 150 LYS B NZ  1 
ATOM   4015 N N   . GLY B  1 174 ? -31.05459 64.89659 -24.03636 1.000 34.07208  ? 151 GLY B N   1 
ATOM   4016 C CA  . GLY B  1 174 ? -30.16077 63.89194 -23.49313 1.000 37.32436  ? 151 GLY B CA  1 
ATOM   4017 C C   . GLY B  1 174 ? -30.76571 62.50748 -23.25247 1.000 31.74330  ? 151 GLY B C   1 
ATOM   4018 O O   . GLY B  1 174 ? -30.00183 61.54010 -23.09826 1.000 37.63080  ? 151 GLY B O   1 
ATOM   4019 N N   . LEU B  1 175 ? -32.08147 62.36423 -23.23597 1.000 30.35207  ? 152 LEU B N   1 
ATOM   4020 C CA  . LEU B  1 175 ? -32.70743 61.05658 -22.98208 1.000 31.16464  ? 152 LEU B CA  1 
ATOM   4021 C C   . LEU B  1 175 ? -32.90964 60.28477 -24.28504 1.000 36.78969  ? 152 LEU B C   1 
ATOM   4022 O O   . LEU B  1 175 ? -33.40235 60.84201 -25.27929 1.000 33.32897  ? 152 LEU B O   1 
ATOM   4023 C CB  . LEU B  1 175 ? -34.05383 61.19858 -22.26942 1.000 34.37399  ? 152 LEU B CB  1 
ATOM   4024 C CG  . LEU B  1 175 ? -34.03144 61.82365 -20.86797 1.000 38.14688  ? 152 LEU B CG  1 
ATOM   4025 C CD1 . LEU B  1 175 ? -35.32244 61.52300 -20.09918 1.000 33.75450  ? 152 LEU B CD1 1 
ATOM   4026 C CD2 . LEU B  1 175 ? -32.79036 61.41471 -20.06516 1.000 38.12836  ? 152 LEU B CD2 1 
ATOM   4027 N N   . GLN B  1 176 ? -32.54409 58.99241 -24.27383 1.000 31.49211  ? 153 GLN B N   1 
ATOM   4028 C CA  . GLN B  1 176 ? -32.66515 58.16339 -25.47773 1.000 31.74952  ? 153 GLN B CA  1 
ATOM   4029 C C   . GLN B  1 176 ? -34.07891 57.60212 -25.55290 1.000 33.33859  ? 153 GLN B C   1 
ATOM   4030 O O   . GLN B  1 176 ? -34.48875 56.88359 -24.63329 1.000 33.60303  ? 153 GLN B O   1 
ATOM   4031 C CB  . GLN B  1 176 ? -31.63905 57.03061 -25.47083 1.000 29.74727  ? 153 GLN B CB  1 
ATOM   4032 C CG  . GLN B  1 176 ? -30.19757 57.49246 -25.21760 1.000 30.73774  ? 153 GLN B CG  1 
ATOM   4033 C CD  . GLN B  1 176 ? -29.78080 58.66807 -26.11742 1.000 39.90594  ? 153 GLN B CD  1 
ATOM   4034 O OE1 . GLN B  1 176 ? -29.58864 58.49217 -27.32457 1.000 32.34965  ? 153 GLN B OE1 1 
ATOM   4035 N NE2 . GLN B  1 176 ? -29.62061 59.86706 -25.52261 1.000 31.81249  ? 153 GLN B NE2 1 
ATOM   4036 N N   . PRO B  1 177 ? -34.85898 57.91303 -26.59734 1.000 32.10317  ? 154 PRO B N   1 
ATOM   4037 C CA  . PRO B  1 177 ? -36.27255 57.52129 -26.62139 1.000 36.24720  ? 154 PRO B CA  1 
ATOM   4038 C C   . PRO B  1 177 ? -36.50255 56.13173 -27.20555 1.000 36.80458  ? 154 PRO B C   1 
ATOM   4039 O O   . PRO B  1 177 ? -35.67802 55.59014 -27.94571 1.000 31.45765  ? 154 PRO B O   1 
ATOM   4040 C CB  . PRO B  1 177 ? -36.91106 58.58742 -27.52718 1.000 32.31642  ? 154 PRO B CB  1 
ATOM   4041 C CG  . PRO B  1 177 ? -35.82889 58.90340 -28.54324 1.000 32.65937  ? 154 PRO B CG  1 
ATOM   4042 C CD  . PRO B  1 177 ? -34.48971 58.76715 -27.75794 1.000 37.47626  ? 154 PRO B CD  1 
ATOM   4043 N N   . SER B  1 178 ? -37.67411 55.58422 -26.88127 1.000 33.39901  ? 155 SER B N   1 
ATOM   4044 C CA  . SER B  1 178 ? -38.23967 54.40676 -27.53977 1.000 36.45649  ? 155 SER B CA  1 
ATOM   4045 C C   . SER B  1 178 ? -39.57501 54.81684 -28.16059 1.000 33.28468  ? 155 SER B C   1 
ATOM   4046 O O   . SER B  1 178 ? -40.44459 55.35089 -27.46317 1.000 32.47461  ? 155 SER B O   1 
ATOM   4047 C CB  . SER B  1 178 ? -38.43189 53.25020 -26.54100 1.000 34.96691  ? 155 SER B CB  1 
ATOM   4048 O OG  . SER B  1 178 ? -39.17320 52.18604 -27.15131 1.000 35.69347  ? 155 SER B OG  1 
ATOM   4049 N N   . VAL B  1 179 ? -39.73213 54.61997 -29.47213 1.000 29.86649  ? 156 VAL B N   1 
ATOM   4050 C CA  . VAL B  1 179 ? -41.00640 54.97650 -30.10076 1.000 30.74987  ? 156 VAL B CA  1 
ATOM   4051 C C   . VAL B  1 179 ? -42.05547 53.93049 -29.72599 1.000 36.15341  ? 156 VAL B C   1 
ATOM   4052 O O   . VAL B  1 179 ? -41.86264 52.72884 -29.95788 1.000 35.06510  ? 156 VAL B O   1 
ATOM   4053 C CB  . VAL B  1 179 ? -40.86325 55.09083 -31.62367 1.000 36.65733  ? 156 VAL B CB  1 
ATOM   4054 C CG1 . VAL B  1 179 ? -42.21967 55.42285 -32.25008 1.000 33.21973  ? 156 VAL B CG1 1 
ATOM   4055 C CG2 . VAL B  1 179 ? -39.82292 56.18070 -32.00729 1.000 36.62930  ? 156 VAL B CG2 1 
ATOM   4056 N N   . GLY B  1 180 ? -43.17435 54.38508 -29.14651 1.000 32.98675  ? 157 GLY B N   1 
ATOM   4057 C CA  . GLY B  1 180 ? -44.21854 53.49512 -28.66070 1.000 28.30500  ? 157 GLY B CA  1 
ATOM   4058 C C   . GLY B  1 180 ? -45.16220 53.01332 -29.75103 1.000 31.53596  ? 157 GLY B C   1 
ATOM   4059 O O   . GLY B  1 180 ? -44.94224 53.24171 -30.94292 1.000 30.39132  ? 157 GLY B O   1 
ATOM   4060 N N   . PRO B  1 181 ? -46.23128 52.32335 -29.36247 1.000 31.83102  ? 158 PRO B N   1 
ATOM   4061 C CA  . PRO B  1 181 ? -47.23597 51.90405 -30.35263 1.000 32.32278  ? 158 PRO B CA  1 
ATOM   4062 C C   . PRO B  1 181 ? -47.90593 53.10711 -31.01610 1.000 36.24782  ? 158 PRO B C   1 
ATOM   4063 O O   . PRO B  1 181 ? -47.92729 54.21487 -30.48420 1.000 34.32571  ? 158 PRO B O   1 
ATOM   4064 C CB  . PRO B  1 181 ? -48.23821 51.08448 -29.53129 1.000 36.65330  ? 158 PRO B CB  1 
ATOM   4065 C CG  . PRO B  1 181 ? -47.97849 51.43094 -28.08615 1.000 33.16843  ? 158 PRO B CG  1 
ATOM   4066 C CD  . PRO B  1 181 ? -46.56964 51.94176 -27.97833 1.000 28.37992  ? 158 PRO B CD  1 
ATOM   4067 N N   . LYS B  1 182 ? -48.45321 52.87408 -32.21061 1.000 33.32523  ? 159 LYS B N   1 
ATOM   4068 C CA  . LYS B  1 182 ? -49.20449 53.91537 -32.90672 1.000 35.18678  ? 159 LYS B CA  1 
ATOM   4069 C C   . LYS B  1 182 ? -50.48995 54.28854 -32.18140 1.000 36.36788  ? 159 LYS B C   1 
ATOM   4070 O O   . LYS B  1 182 ? -50.94205 55.44003 -32.28013 1.000 36.34542  ? 159 LYS B O   1 
ATOM   4071 C CB  . LYS B  1 182 ? -49.55652 53.44969 -34.32106 1.000 34.30073  ? 159 LYS B CB  1 
ATOM   4072 C CG  . LYS B  1 182 ? -48.34017 53.30390 -35.18813 1.000 40.33806  ? 159 LYS B CG  1 
ATOM   4073 C CD  . LYS B  1 182 ? -48.65905 53.57655 -36.64714 1.000 50.42878  ? 159 LYS B CD  1 
ATOM   4074 C CE  . LYS B  1 182 ? -49.50107 52.50109 -37.27511 1.000 60.72761  ? 159 LYS B CE  1 
ATOM   4075 N NZ  . LYS B  1 182 ? -49.86391 52.85576 -38.70208 1.000 71.00679  ? 159 LYS B NZ  1 
ATOM   4076 N N   . GLN B  1 183 ? -51.10165 53.33764 -31.47571 1.000 32.15667  ? 160 GLN B N   1 
ATOM   4077 C CA  . GLN B  1 183 ? -52.43667 53.51418 -30.90868 1.000 28.93347  ? 160 GLN B CA  1 
ATOM   4078 C C   . GLN B  1 183 ? -52.34509 53.86560 -29.43488 1.000 32.70401  ? 160 GLN B C   1 
ATOM   4079 O O   . GLN B  1 183 ? -51.35521 53.55679 -28.75672 1.000 31.63281  ? 160 GLN B O   1 
ATOM   4080 C CB  . GLN B  1 183 ? -53.30072 52.24621 -31.05637 1.000 30.94667  ? 160 GLN B CB  1 
ATOM   4081 C CG  . GLN B  1 183 ? -52.85832 51.04199 -30.15895 1.000 30.72071  ? 160 GLN B CG  1 
ATOM   4082 C CD  . GLN B  1 183 ? -51.84912 50.11728 -30.86983 1.000 35.48422  ? 160 GLN B CD  1 
ATOM   4083 O OE1 . GLN B  1 183 ? -50.96818 50.59277 -31.56736 1.000 37.46034  ? 160 GLN B OE1 1 
ATOM   4084 N NE2 . GLN B  1 183 ? -51.99747 48.80101 -30.70318 1.000 36.92690  ? 160 GLN B NE2 1 
ATOM   4085 N N   . ALA B  1 184 ? -53.41584 54.49217 -28.93616 1.000 31.09001  ? 161 ALA B N   1 
ATOM   4086 C CA  . ALA B  1 184 ? -53.55989 54.79376 -27.51409 1.000 29.09894  ? 161 ALA B CA  1 
ATOM   4087 C C   . ALA B  1 184 ? -55.04220 54.70711 -27.17069 1.000 32.52582  ? 161 ALA B C   1 
ATOM   4088 O O   . ALA B  1 184 ? -55.89485 54.52632 -28.04614 1.000 33.93817  ? 161 ALA B O   1 
ATOM   4089 C CB  . ALA B  1 184 ? -52.98830 56.18269 -27.16308 1.000 29.24636  ? 161 ALA B CB  1 
ATOM   4090 N N   . SER B  1 185 ? -55.35626 54.83070 -25.88818 1.000 31.92388  ? 162 SER B N   1 
ATOM   4091 C CA  . SER B  1 185 ? -56.73814 54.72209 -25.43006 1.000 31.55323  ? 162 SER B CA  1 
ATOM   4092 C C   . SER B  1 185 ? -57.27323 56.09266 -25.04861 1.000 30.77581  ? 162 SER B C   1 
ATOM   4093 O O   . SER B  1 185 ? -56.66803 56.78830 -24.22807 1.000 32.10482  ? 162 SER B O   1 
ATOM   4094 C CB  . SER B  1 185 ? -56.84562 53.78153 -24.22460 1.000 30.39137  ? 162 SER B CB  1 
ATOM   4095 O OG  . SER B  1 185 ? -58.19546 53.79280 -23.74514 1.000 31.08718  ? 162 SER B OG  1 
ATOM   4096 N N   . LEU B  1 186 ? -58.43771 56.44880 -25.58673 1.000 30.67953  ? 163 LEU B N   1 
ATOM   4097 C CA  . LEU B  1 186 ? -59.10239 57.71532 -25.29041 1.000 30.46902  ? 163 LEU B CA  1 
ATOM   4098 C C   . LEU B  1 186 ? -60.52135 57.42085 -24.78291 1.000 33.57466  ? 163 LEU B C   1 
ATOM   4099 O O   . LEU B  1 186 ? -61.36502 56.97330 -25.56398 1.000 35.62665  ? 163 LEU B O   1 
ATOM   4100 C CB  . LEU B  1 186 ? -59.13362 58.57417 -26.55870 1.000 28.08441  ? 163 LEU B CB  1 
ATOM   4101 C CG  . LEU B  1 186 ? -59.83781 59.92958 -26.47180 1.000 37.18018  ? 163 LEU B CG  1 
ATOM   4102 C CD1 . LEU B  1 186 ? -59.19002 60.69932 -25.36213 1.000 41.10271  ? 163 LEU B CD1 1 
ATOM   4103 C CD2 . LEU B  1 186 ? -59.69969 60.74137 -27.77785 1.000 32.73038  ? 163 LEU B CD2 1 
ATOM   4104 N N   A ASN B  1 187 ? -60.75463 57.62476 -23.48389 0.449 30.87844  ? 164 ASN B N   1 
ATOM   4105 N N   B ASN B  1 187 ? -60.79884 57.72199 -23.49674 0.551 30.48109  ? 164 ASN B N   1 
ATOM   4106 C CA  A ASN B  1 187 ? -62.05927 57.34852 -22.87181 0.449 34.32260  ? 164 ASN B CA  1 
ATOM   4107 C CA  B ASN B  1 187 ? -62.09715 57.41304 -22.84064 0.551 34.47586  ? 164 ASN B CA  1 
ATOM   4108 C C   A ASN B  1 187 ? -62.50608 55.92890 -23.15850 0.449 36.79756  ? 164 ASN B C   1 
ATOM   4109 C C   B ASN B  1 187 ? -62.52012 55.96823 -23.15758 0.551 37.10664  ? 164 ASN B C   1 
ATOM   4110 O O   A ASN B  1 187 ? -63.67865 55.65032 -23.41321 0.449 35.41679  ? 164 ASN B O   1 
ATOM   4111 O O   B ASN B  1 187 ? -63.68661 55.69153 -23.44167 0.551 35.10904  ? 164 ASN B O   1 
ATOM   4112 C CB  A ASN B  1 187 ? -63.09121 58.34703 -23.34849 0.449 33.44994  ? 164 ASN B CB  1 
ATOM   4113 C CB  B ASN B  1 187 ? -63.19671 58.44986 -23.24343 0.551 32.96256  ? 164 ASN B CB  1 
ATOM   4114 C CG  A ASN B  1 187 ? -62.58187 59.71262 -23.23267 0.449 28.86886  ? 164 ASN B CG  1 
ATOM   4115 C CG  B ASN B  1 187 ? -64.37606 58.66242 -22.16265 0.551 36.44791  ? 164 ASN B CG  1 
ATOM   4116 O OD1 A ASN B  1 187 ? -61.97737 60.04612 -22.22154 0.449 28.98356  ? 164 ASN B OD1 1 
ATOM   4117 O OD1 B ASN B  1 187 ? -64.16349 58.79231 -20.94246 0.551 32.11019  ? 164 ASN B OD1 1 
ATOM   4118 N ND2 A ASN B  1 187 ? -62.72849 60.50321 -24.28427 0.449 29.72273  ? 164 ASN B ND2 1 
ATOM   4119 N ND2 B ASN B  1 187 ? -65.62231 58.72328 -22.66594 0.551 38.63644  ? 164 ASN B ND2 1 
ATOM   4120 N N   . GLY B  1 188 ? -61.54912 55.03237 -23.14174 1.000 34.75662  ? 165 GLY B N   1 
ATOM   4121 C CA  . GLY B  1 188 ? -61.82761 53.62852 -23.34942 1.000 37.66514  ? 165 GLY B CA  1 
ATOM   4122 C C   . GLY B  1 188 ? -61.83916 53.18248 -24.79124 1.000 40.86899  ? 165 GLY B C   1 
ATOM   4123 O O   . GLY B  1 188 ? -62.06551 51.99625 -25.04858 1.000 39.25298  ? 165 GLY B O   1 
ATOM   4124 N N   . VAL B  1 189 ? -61.60814 54.08528 -25.74176 1.000 31.99265  ? 166 VAL B N   1 
ATOM   4125 C CA  . VAL B  1 189 ? -61.63167 53.73732 -27.15607 1.000 34.50972  ? 166 VAL B CA  1 
ATOM   4126 C C   . VAL B  1 189 ? -60.18737 53.68306 -27.61805 1.000 35.13773  ? 166 VAL B C   1 
ATOM   4127 O O   . VAL B  1 189 ? -59.48896 54.70076 -27.56977 1.000 31.75258  ? 166 VAL B O   1 
ATOM   4128 C CB  . VAL B  1 189 ? -62.42600 54.75626 -27.99366 1.000 34.86944  ? 166 VAL B CB  1 
ATOM   4129 C CG1 . VAL B  1 189 ? -62.39384 54.36142 -29.48892 1.000 32.27232  ? 166 VAL B CG1 1 
ATOM   4130 C CG2 . VAL B  1 189 ? -63.86363 54.89553 -27.49670 1.000 33.43411  ? 166 VAL B CG2 1 
ATOM   4131 N N   . THR B  1 190 ? -59.73190 52.50819 -28.05406 1.000 33.09946  ? 167 THR B N   1 
ATOM   4132 C CA  . THR B  1 190 ? -58.38689 52.40015 -28.58737 1.000 35.08342  ? 167 THR B CA  1 
ATOM   4133 C C   . THR B  1 190 ? -58.38572 52.85365 -30.03522 1.000 36.93630  ? 167 THR B C   1 
ATOM   4134 O O   . THR B  1 190 ? -59.22500 52.41023 -30.82543 1.000 37.53585  ? 167 THR B O   1 
ATOM   4135 C CB  . THR B  1 190 ? -57.88183 50.97188 -28.48015 1.000 40.62172  ? 167 THR B CB  1 
ATOM   4136 O OG1 . THR B  1 190 ? -57.76894 50.64912 -27.09289 1.000 39.44878  ? 167 THR B OG1 1 
ATOM   4137 C CG2 . THR B  1 190 ? -56.49767 50.85447 -29.15315 1.000 33.18440  ? 167 THR B CG2 1 
ATOM   4138 N N   . LEU B  1 191 ? -57.46026 53.75231 -30.37631 1.000 30.65258  ? 168 LEU B N   1 
ATOM   4139 C CA  . LEU B  1 191 ? -57.50671 54.38972 -31.68527 1.000 35.15017  ? 168 LEU B CA  1 
ATOM   4140 C C   . LEU B  1 191 ? -56.12707 54.92426 -32.05413 1.000 34.33710  ? 168 LEU B C   1 
ATOM   4141 O O   . LEU B  1 191 ? -55.26864 55.14483 -31.19250 1.000 33.92764  ? 168 LEU B O   1 
ATOM   4142 C CB  . LEU B  1 191 ? -58.54686 55.51806 -31.69679 1.000 34.71785  ? 168 LEU B CB  1 
ATOM   4143 C CG  . LEU B  1 191 ? -58.37216 56.69432 -30.70952 1.000 37.26177  ? 168 LEU B CG  1 
ATOM   4144 C CD1 . LEU B  1 191 ? -57.56646 57.80943 -31.32679 1.000 35.60599  ? 168 LEU B CD1 1 
ATOM   4145 C CD2 . LEU B  1 191 ? -59.77285 57.25562 -30.23378 1.000 32.13809  ? 168 LEU B CD2 1 
ATOM   4146 N N   . ILE B  1 192 ? -55.92953 55.12736 -33.35191 1.000 35.21643  ? 169 ILE B N   1 
ATOM   4147 C CA  . ILE B  1 192 ? -54.73606 55.76653 -33.88433 1.000 37.99830  ? 169 ILE B CA  1 
ATOM   4148 C C   . ILE B  1 192 ? -55.14342 57.19084 -34.22679 1.000 39.65565  ? 169 ILE B C   1 
ATOM   4149 O O   . ILE B  1 192 ? -55.98402 57.40593 -35.10695 1.000 37.82159  ? 169 ILE B O   1 
ATOM   4150 C CB  . ILE B  1 192 ? -54.18494 55.00472 -35.09465 1.000 39.77049  ? 169 ILE B CB  1 
ATOM   4151 C CG1 . ILE B  1 192 ? -53.71814 53.61869 -34.64078 1.000 45.84360  ? 169 ILE B CG1 1 
ATOM   4152 C CG2 . ILE B  1 192 ? -53.03743 55.78085 -35.77243 1.000 35.45518  ? 169 ILE B CG2 1 
ATOM   4153 C CD1 . ILE B  1 192 ? -53.32599 52.70500 -35.76649 1.000 41.05355  ? 169 ILE B CD1 1 
ATOM   4154 N N   . GLY B  1 193 ? -54.59247 58.15902 -33.49500 1.000 34.75546  ? 170 GLY B N   1 
ATOM   4155 C CA  . GLY B  1 193 ? -55.15912 59.49928 -33.50902 1.000 34.23851  ? 170 GLY B CA  1 
ATOM   4156 C C   . GLY B  1 193 ? -54.87825 60.23410 -34.81004 1.000 40.13489  ? 170 GLY B C   1 
ATOM   4157 O O   . GLY B  1 193 ? -53.77620 60.17463 -35.36370 1.000 37.84288  ? 170 GLY B O   1 
ATOM   4158 N N   . GLU B  1 194 ? -55.90040 60.92758 -35.30775 1.000 34.46445  ? 171 GLU B N   1 
ATOM   4159 C CA  . GLU B  1 194 ? -55.74088 61.84916 -36.42683 1.000 41.84043  ? 171 GLU B CA  1 
ATOM   4160 C C   . GLU B  1 194 ? -55.94224 63.29524 -36.02112 1.000 43.29897  ? 171 GLU B C   1 
ATOM   4161 O O   . GLU B  1 194 ? -55.20470 64.16041 -36.47377 1.000 38.34110  ? 171 GLU B O   1 
ATOM   4162 C CB  . GLU B  1 194 ? -56.71173 61.49036 -37.56396 1.000 38.16517  ? 171 GLU B CB  1 
ATOM   4163 C CG  . GLU B  1 194 ? -56.59050 60.03467 -37.96004 1.000 43.42718  ? 171 GLU B CG  1 
ATOM   4164 C CD  . GLU B  1 194 ? -57.59350 59.61091 -39.02368 1.000 57.23945  ? 171 GLU B CD  1 
ATOM   4165 O OE1 . GLU B  1 194 ? -58.33660 60.48122 -39.54350 1.000 58.10561  ? 171 GLU B OE1 1 
ATOM   4166 O OE2 . GLU B  1 194 ? -57.63179 58.39416 -39.33520 1.000 55.86178  ? 171 GLU B OE2 1 
ATOM   4167 N N   . ALA B  1 195 ? -56.92230 63.56773 -35.16998 1.000 39.92144  ? 172 ALA B N   1 
ATOM   4168 C CA  . ALA B  1 195 ? -57.13005 64.89082 -34.61118 1.000 39.94130  ? 172 ALA B CA  1 
ATOM   4169 C C   . ALA B  1 195 ? -56.36258 65.08798 -33.31489 1.000 43.06779  ? 172 ALA B C   1 
ATOM   4170 O O   . ALA B  1 195 ? -56.32948 66.20561 -32.79292 1.000 43.16393  ? 172 ALA B O   1 
ATOM   4171 C CB  . ALA B  1 195 ? -58.63891 65.12291 -34.37047 1.000 36.70649  ? 172 ALA B CB  1 
ATOM   4172 N N   . VAL B  1 196 ? -55.77479 64.01383 -32.78048 1.000 38.51398  ? 173 VAL B N   1 
ATOM   4173 C CA  . VAL B  1 196 ? -54.97644 64.02968 -31.56535 1.000 38.59604  ? 173 VAL B CA  1 
ATOM   4174 C C   . VAL B  1 196 ? -53.80251 63.08617 -31.78962 1.000 41.21230  ? 173 VAL B C   1 
ATOM   4175 O O   . VAL B  1 196 ? -53.85388 62.17829 -32.61980 1.000 37.19106  ? 173 VAL B O   1 
ATOM   4176 C CB  . VAL B  1 196 ? -55.75571 63.57058 -30.30173 1.000 38.36890  ? 173 VAL B CB  1 
ATOM   4177 C CG1 . VAL B  1 196 ? -56.85354 64.52965 -29.96216 1.000 45.82083  ? 173 VAL B CG1 1 
ATOM   4178 C CG2 . VAL B  1 196 ? -56.32645 62.14681 -30.48680 1.000 31.73419  ? 173 VAL B CG2 1 
ATOM   4179 N N   . LYS B  1 197 ? -52.75226 63.29521 -31.01625 1.000 36.45454  ? 174 LYS B N   1 
ATOM   4180 C CA  . LYS B  1 197 ? -51.55503 62.46449 -31.07337 1.000 34.10814  ? 174 LYS B CA  1 
ATOM   4181 C C   . LYS B  1 197 ? -51.67869 61.28836 -30.10937 1.000 31.14507  ? 174 LYS B C   1 
ATOM   4182 O O   . LYS B  1 197 ? -51.92428 61.48203 -28.91153 1.000 32.26254  ? 174 LYS B O   1 
ATOM   4183 C CB  . LYS B  1 197 ? -50.33799 63.30532 -30.70016 1.000 37.40376  ? 174 LYS B CB  1 
ATOM   4184 C CG  . LYS B  1 197 ? -49.03295 62.54998 -30.77178 1.000 49.72777  ? 174 LYS B CG  1 
ATOM   4185 C CD  . LYS B  1 197 ? -47.89889 63.53169 -31.07821 1.000 58.56607  ? 174 LYS B CD  1 
ATOM   4186 C CE  . LYS B  1 197 ? -46.61339 62.80530 -31.42031 1.000 64.60817  ? 174 LYS B CE  1 
ATOM   4187 N NZ  . LYS B  1 197 ? -46.84392 61.75082 -32.44683 1.000 70.82521  ? 174 LYS B NZ  1 
ATOM   4188 N N   . THR B  1 198 ? -51.49066 60.07378 -30.62521 1.000 31.83100  ? 175 THR B N   1 
ATOM   4189 C CA  . THR B  1 198 ? -51.52146 58.86801 -29.80310 1.000 29.43590  ? 175 THR B CA  1 
ATOM   4190 C C   . THR B  1 198 ? -50.19768 58.10929 -29.80667 1.000 30.13162  ? 175 THR B C   1 
ATOM   4191 O O   . THR B  1 198 ? -50.08509 57.09341 -29.11642 1.000 32.55765  ? 175 THR B O   1 
ATOM   4192 C CB  . THR B  1 198 ? -52.63548 57.92033 -30.27359 1.000 30.38665  ? 175 THR B CB  1 
ATOM   4193 O OG1 . THR B  1 198 ? -52.41863 57.59258 -31.65592 1.000 32.52505  ? 175 THR B OG1 1 
ATOM   4194 C CG2 . THR B  1 198 ? -54.00684 58.57787 -30.11555 1.000 30.93096  ? 175 THR B CG2 1 
ATOM   4195 N N   . GLN B  1 199 ? -49.18470 58.55411 -30.54138 1.000 29.11468  ? 176 GLN B N   1 
ATOM   4196 C CA  . GLN B  1 199 ? -47.91719 57.82172 -30.54926 1.000 34.20114  ? 176 GLN B CA  1 
ATOM   4197 C C   . GLN B  1 199 ? -46.92618 58.59844 -29.69917 1.000 37.08999  ? 176 GLN B C   1 
ATOM   4198 O O   . GLN B  1 199 ? -46.68416 59.78576 -29.95145 1.000 35.64264  ? 176 GLN B O   1 
ATOM   4199 C CB  . GLN B  1 199 ? -47.38339 57.60461 -31.96591 1.000 39.36877  ? 176 GLN B CB  1 
ATOM   4200 C CG  . GLN B  1 199 ? -46.03422 56.78721 -32.03141 1.000 37.74814  ? 176 GLN B CG  1 
ATOM   4201 C CD  . GLN B  1 199 ? -45.81194 56.20405 -33.39928 1.000 43.89484  ? 176 GLN B CD  1 
ATOM   4202 O OE1 . GLN B  1 199 ? -45.86975 56.91333 -34.40888 1.000 50.58691  ? 176 GLN B OE1 1 
ATOM   4203 N NE2 . GLN B  1 199 ? -45.55233 54.90404 -33.45559 1.000 44.55565  ? 176 GLN B NE2 1 
ATOM   4204 N N   . PHE B  1 200 ? -46.37145 57.94196 -28.68059 1.000 32.10608  ? 177 PHE B N   1 
ATOM   4205 C CA  . PHE B  1 200 ? -45.48505 58.60713 -27.73089 1.000 32.49048  ? 177 PHE B CA  1 
ATOM   4206 C C   . PHE B  1 200 ? -44.07839 58.03379 -27.78239 1.000 31.32957  ? 177 PHE B C   1 
ATOM   4207 O O   . PHE B  1 200 ? -43.88624 56.87669 -28.15116 1.000 29.44085  ? 177 PHE B O   1 
ATOM   4208 C CB  . PHE B  1 200 ? -46.00556 58.43373 -26.30434 1.000 30.53962  ? 177 PHE B CB  1 
ATOM   4209 C CG  . PHE B  1 200 ? -47.46215 58.77144 -26.14925 1.000 33.38642  ? 177 PHE B CG  1 
ATOM   4210 C CD1 . PHE B  1 200 ? -47.92136 60.04799 -26.47064 1.000 34.98409  ? 177 PHE B CD1 1 
ATOM   4211 C CD2 . PHE B  1 200 ? -48.36867 57.82757 -25.67822 1.000 31.88664  ? 177 PHE B CD2 1 
ATOM   4212 C CE1 . PHE B  1 200 ? -49.25256 60.36362 -26.33108 1.000 37.37661  ? 177 PHE B CE1 1 
ATOM   4213 C CE2 . PHE B  1 200 ? -49.72087 58.15479 -25.54785 1.000 34.21983  ? 177 PHE B CE2 1 
ATOM   4214 C CZ  . PHE B  1 200 ? -50.15003 59.40658 -25.84748 1.000 32.85848  ? 177 PHE B CZ  1 
ATOM   4215 N N   . ASN B  1 201 ? -43.10494 58.86622 -27.40248 1.000 27.18702  ? 178 ASN B N   1 
ATOM   4216 C CA  . ASN B  1 201 ? -41.81878 58.37358 -26.91746 1.000 31.25861  ? 178 ASN B CA  1 
ATOM   4217 C C   . ASN B  1 201 ? -41.99253 57.80162 -25.51361 1.000 32.80987  ? 178 ASN B C   1 
ATOM   4218 O O   . ASN B  1 201 ? -42.67306 58.40082 -24.67445 1.000 31.22405  ? 178 ASN B O   1 
ATOM   4219 C CB  . ASN B  1 201 ? -40.79833 59.52118 -26.85238 1.000 27.69574  ? 178 ASN B CB  1 
ATOM   4220 C CG  . ASN B  1 201 ? -40.26234 59.91249 -28.20502 1.000 33.13894  ? 178 ASN B CG  1 
ATOM   4221 O OD1 . ASN B  1 201 ? -40.25379 59.10509 -29.14428 1.000 31.00569  ? 178 ASN B OD1 1 
ATOM   4222 N ND2 . ASN B  1 201 ? -39.74003 61.14249 -28.29631 1.000 37.11873  ? 178 ASN B ND2 1 
ATOM   4223 N N   . TYR B  1 202 ? -41.32830 56.67436 -25.23691 1.000 32.35093  ? 179 TYR B N   1 
ATOM   4224 C CA  . TYR B  1 202 ? -41.29270 56.07854 -23.90046 1.000 28.46207  ? 179 TYR B CA  1 
ATOM   4225 C C   . TYR B  1 202 ? -39.89597 56.13041 -23.30299 1.000 32.38855  ? 179 TYR B C   1 
ATOM   4226 O O   . TYR B  1 202 ? -38.90421 55.92552 -24.01447 1.000 30.57856  ? 179 TYR B O   1 
ATOM   4227 C CB  . TYR B  1 202 ? -41.71095 54.61326 -23.93378 1.000 26.45911  ? 179 TYR B CB  1 
ATOM   4228 C CG  . TYR B  1 202 ? -43.19262 54.43488 -24.01407 1.000 31.24043  ? 179 TYR B CG  1 
ATOM   4229 C CD1 . TYR B  1 202 ? -43.88947 54.67840 -25.19210 1.000 31.37217  ? 179 TYR B CD1 1 
ATOM   4230 C CD2 . TYR B  1 202 ? -43.90026 54.01633 -22.90034 1.000 35.50597  ? 179 TYR B CD2 1 
ATOM   4231 C CE1 . TYR B  1 202 ? -45.29071 54.46975 -25.24370 1.000 31.24453  ? 179 TYR B CE1 1 
ATOM   4232 C CE2 . TYR B  1 202 ? -45.25404 53.81914 -22.94864 1.000 34.93921  ? 179 TYR B CE2 1 
ATOM   4233 C CZ  . TYR B  1 202 ? -45.93546 54.05971 -24.11753 1.000 36.35725  ? 179 TYR B CZ  1 
ATOM   4234 O OH  . TYR B  1 202 ? -47.28961 53.85315 -24.12213 1.000 41.20398  ? 179 TYR B OH  1 
ATOM   4235 N N   . TYR B  1 203 ? -39.83932 56.33921 -21.98164 1.000 26.55813  ? 180 TYR B N   1 
ATOM   4236 C CA  . TYR B  1 203 ? -38.60322 56.31339 -21.19979 1.000 26.99889  ? 180 TYR B CA  1 
ATOM   4237 C C   . TYR B  1 203 ? -38.87540 55.58331 -19.88896 1.000 30.24453  ? 180 TYR B C   1 
ATOM   4238 O O   . TYR B  1 203 ? -40.00314 55.60398 -19.38829 1.000 29.06323  ? 180 TYR B O   1 
ATOM   4239 C CB  . TYR B  1 203 ? -38.09167 57.72817 -20.88594 1.000 27.19544  ? 180 TYR B CB  1 
ATOM   4240 C CG  . TYR B  1 203 ? -38.06679 58.65316 -22.09387 1.000 34.21012  ? 180 TYR B CG  1 
ATOM   4241 C CD1 . TYR B  1 203 ? -39.21803 59.35491 -22.47801 1.000 32.32292  ? 180 TYR B CD1 1 
ATOM   4242 C CD2 . TYR B  1 203 ? -36.89816 58.83573 -22.84145 1.000 33.57300  ? 180 TYR B CD2 1 
ATOM   4243 C CE1 . TYR B  1 203 ? -39.21740 60.19973 -23.56976 1.000 31.20782  ? 180 TYR B CE1 1 
ATOM   4244 C CE2 . TYR B  1 203 ? -36.88741 59.70832 -23.94483 1.000 32.55215  ? 180 TYR B CE2 1 
ATOM   4245 C CZ  . TYR B  1 203 ? -38.05317 60.37809 -24.29630 1.000 30.73074  ? 180 TYR B CZ  1 
ATOM   4246 O OH  . TYR B  1 203 ? -38.07227 61.22578 -25.37727 1.000 30.81157  ? 180 TYR B OH  1 
ATOM   4247 N N   . LYS B  1 204 ? -37.84002 54.96089 -19.31357 1.000 30.01960  ? 181 LYS B N   1 
ATOM   4248 C CA  . LYS B  1 204 ? -38.02444 54.21875 -18.06245 1.000 29.69403  ? 181 LYS B CA  1 
ATOM   4249 C C   . LYS B  1 204 ? -36.77251 54.31945 -17.18834 1.000 34.14652  ? 181 LYS B C   1 
ATOM   4250 O O   . LYS B  1 204 ? -35.64276 54.36834 -17.68817 1.000 35.93029  ? 181 LYS B O   1 
ATOM   4251 C CB  . LYS B  1 204 ? -38.37040 52.74121 -18.35268 1.000 30.59942  ? 181 LYS B CB  1 
ATOM   4252 C CG  . LYS B  1 204 ? -38.49118 51.81458 -17.13278 1.000 31.87571  ? 181 LYS B CG  1 
ATOM   4253 C CD  . LYS B  1 204 ? -38.91785 50.42104 -17.59242 1.000 30.58765  ? 181 LYS B CD  1 
ATOM   4254 C CE  . LYS B  1 204 ? -38.65131 49.34247 -16.55717 1.000 36.40991  ? 181 LYS B CE  1 
ATOM   4255 N NZ  . LYS B  1 204 ? -39.70567 49.28196 -15.53517 1.000 41.45489  ? 181 LYS B NZ  1 
ATOM   4256 N N   . LYS B  1 205 ? -36.98399 54.33829 -15.86718 1.000 29.49422  ? 182 LYS B N   1 
ATOM   4257 C CA  . LYS B  1 205 ? -35.89472 54.39075 -14.89669 1.000 34.09971  ? 182 LYS B CA  1 
ATOM   4258 C C   . LYS B  1 205 ? -36.11257 53.32616 -13.83880 1.000 35.81315  ? 182 LYS B C   1 
ATOM   4259 O O   . LYS B  1 205 ? -37.23729 53.16151 -13.34308 1.000 31.80006  ? 182 LYS B O   1 
ATOM   4260 C CB  . LYS B  1 205 ? -35.81610 55.73933 -14.16313 1.000 38.84885  ? 182 LYS B CB  1 
ATOM   4261 C CG  . LYS B  1 205 ? -35.25576 56.86691 -14.94442 1.000 49.62359  ? 182 LYS B CG  1 
ATOM   4262 C CD  . LYS B  1 205 ? -35.46399 58.17927 -14.17204 1.000 46.28839  ? 182 LYS B CD  1 
ATOM   4263 C CE  . LYS B  1 205 ? -34.48324 58.30503 -13.02059 1.000 37.66879  ? 182 LYS B CE  1 
ATOM   4264 N NZ  . LYS B  1 205 ? -34.53978 59.68888 -12.40642 1.000 34.37602  ? 182 LYS B NZ  1 
ATOM   4265 N N   . VAL B  1 206 ? -35.02849 52.64923 -13.45827 1.000 35.70980  ? 183 VAL B N   1 
ATOM   4266 C CA  . VAL B  1 206 ? -35.05022 51.65263 -12.38790 1.000 38.08286  ? 183 VAL B CA  1 
ATOM   4267 C C   . VAL B  1 206 ? -33.92320 51.96592 -11.41470 1.000 35.71464  ? 183 VAL B C   1 
ATOM   4268 O O   . VAL B  1 206 ? -32.76582 52.12629 -11.82607 1.000 36.76631  ? 183 VAL B O   1 
ATOM   4269 C CB  . VAL B  1 206 ? -34.91265 50.21796 -12.93323 1.000 37.57407  ? 183 VAL B CB  1 
ATOM   4270 C CG1 . VAL B  1 206 ? -34.82108 49.20576 -11.77564 1.000 37.55063  ? 183 VAL B CG1 1 
ATOM   4271 C CG2 . VAL B  1 206 ? -36.09340 49.89179 -13.84439 1.000 36.49781  ? 183 VAL B CG2 1 
ATOM   4272 N N   . ASP B  1 207 ? -34.26375 52.08277 -10.13068 1.000 37.82926  ? 184 ASP B N   1 
ATOM   4273 C CA  . ASP B  1 207 ? -33.26326 52.27647 -9.08329  1.000 39.73328  ? 184 ASP B CA  1 
ATOM   4274 C C   . ASP B  1 207 ? -32.39174 53.49524 -9.37459  1.000 42.57776  ? 184 ASP B C   1 
ATOM   4275 O O   . ASP B  1 207 ? -31.18508 53.49560 -9.13068  1.000 41.64194  ? 184 ASP B O   1 
ATOM   4276 C CB  . ASP B  1 207 ? -32.40203 51.01495 -8.90784  1.000 49.34270  ? 184 ASP B CB  1 
ATOM   4277 C CG  . ASP B  1 207 ? -33.21937 49.81545 -8.41575  1.000 57.48999  ? 184 ASP B CG  1 
ATOM   4278 O OD1 . ASP B  1 207 ? -34.29197 50.03641 -7.80678  1.000 52.99128  ? 184 ASP B OD1 1 
ATOM   4279 O OD2 . ASP B  1 207 ? -32.79568 48.65782 -8.64459  1.000 67.18746  ? 184 ASP B OD2 1 
ATOM   4280 N N   . GLY B  1 208 ? -33.00740 54.54115 -9.92249  1.000 42.10829  ? 185 GLY B N   1 
ATOM   4281 C CA  . GLY B  1 208 ? -32.30807 55.78140 -10.17903 1.000 39.29744  ? 185 GLY B CA  1 
ATOM   4282 C C   . GLY B  1 208 ? -31.59380 55.86453 -11.51577 1.000 41.99318  ? 185 GLY B C   1 
ATOM   4283 O O   . GLY B  1 208 ? -31.05357 56.93152 -11.83922 1.000 41.15969  ? 185 GLY B O   1 
ATOM   4284 N N   . VAL B  1 209 ? -31.60207 54.79714 -12.31135 1.000 38.68408  ? 186 VAL B N   1 
ATOM   4285 C CA  . VAL B  1 209 ? -30.81962 54.71332 -13.53889 1.000 43.09410  ? 186 VAL B CA  1 
ATOM   4286 C C   . VAL B  1 209 ? -31.76229 54.54557 -14.71822 1.000 44.84873  ? 186 VAL B C   1 
ATOM   4287 O O   . VAL B  1 209 ? -32.63266 53.65417 -14.71161 1.000 38.71502  ? 186 VAL B O   1 
ATOM   4288 C CB  . VAL B  1 209 ? -29.81385 53.54641 -13.49073 1.000 45.21863  ? 186 VAL B CB  1 
ATOM   4289 C CG1 . VAL B  1 209 ? -29.02432 53.48270 -14.78129 1.000 47.46463  ? 186 VAL B CG1 1 
ATOM   4290 C CG2 . VAL B  1 209 ? -28.88710 53.69351 -12.29094 1.000 46.24783  ? 186 VAL B CG2 1 
ATOM   4291 N N   . VAL B  1 210 ? -31.58999 55.39748 -15.73293 1.000 37.41810  ? 187 VAL B N   1 
ATOM   4292 C CA  . VAL B  1 210 ? -32.36754 55.24538 -16.95451 1.000 36.44084  ? 187 VAL B CA  1 
ATOM   4293 C C   . VAL B  1 210 ? -32.05885 53.89501 -17.59354 1.000 41.39298  ? 187 VAL B C   1 
ATOM   4294 O O   . VAL B  1 210 ? -30.89398 53.46483 -17.66533 1.000 49.01874  ? 187 VAL B O   1 
ATOM   4295 C CB  . VAL B  1 210 ? -32.10142 56.41420 -17.91862 1.000 39.06133  ? 187 VAL B CB  1 
ATOM   4296 C CG1 . VAL B  1 210 ? -32.87693 56.19990 -19.20948 1.000 38.21142  ? 187 VAL B CG1 1 
ATOM   4297 C CG2 . VAL B  1 210 ? -32.54551 57.73212 -17.28123 1.000 37.11756  ? 187 VAL B CG2 1 
ATOM   4298 N N   . GLN B  1 211 ? -33.10959 53.19187 -18.00753 1.000 36.61042  ? 188 GLN B N   1 
ATOM   4299 C CA  . GLN B  1 211 ? -32.99769 51.83974 -18.56876 1.000 39.71285  ? 188 GLN B CA  1 
ATOM   4300 C C   . GLN B  1 211 ? -33.28244 51.87956 -20.06820 1.000 43.27843  ? 188 GLN B C   1 
ATOM   4301 O O   . GLN B  1 211 ? -34.30221 52.43338 -20.48976 1.000 52.27824  ? 188 GLN B O   1 
ATOM   4302 C CB  . GLN B  1 211 ? -33.98059 50.84620 -17.88108 1.000 39.62188  ? 188 GLN B CB  1 
ATOM   4303 C CG  . GLN B  1 211 ? -33.22874 49.64020 -17.27568 1.000 52.15094  ? 188 GLN B CG  1 
ATOM   4304 C CD  . GLN B  1 211 ? -34.08662 48.47090 -16.74266 1.000 58.42929  ? 188 GLN B CD  1 
ATOM   4305 O OE1 . GLN B  1 211 ? -35.21740 48.18699 -17.20815 1.000 50.46016  ? 188 GLN B OE1 1 
ATOM   4306 N NE2 . GLN B  1 211 ? -33.52601 47.77398 -15.75655 1.000 58.76459  ? 188 GLN B NE2 1 
ATOM   4307 N N   . GLN B  1 212 ? -32.41104 51.25801 -20.86259 1.000 38.53683  ? 189 GLN B N   1 
ATOM   4308 C CA  . GLN B  1 212 ? -32.66941 51.06846 -22.28867 1.000 41.31468  ? 189 GLN B CA  1 
ATOM   4309 C C   . GLN B  1 212 ? -33.86396 50.13570 -22.48930 1.000 46.08022  ? 189 GLN B C   1 
ATOM   4310 O O   . GLN B  1 212 ? -33.81630 48.97944 -22.06543 1.000 49.54780  ? 189 GLN B O   1 
ATOM   4311 C CB  . GLN B  1 212 ? -31.44613 50.46651 -22.96417 1.000 49.23365  ? 189 GLN B CB  1 
ATOM   4312 C CG  . GLN B  1 212 ? -31.62314 50.20621 -24.43955 1.000 56.68769  ? 189 GLN B CG  1 
ATOM   4313 C CD  . GLN B  1 212 ? -31.48011 51.47011 -25.25878 1.000 69.85448  ? 189 GLN B CD  1 
ATOM   4314 O OE1 . GLN B  1 212 ? -31.10273 52.52464 -24.73467 1.000 75.27850  ? 189 GLN B OE1 1 
ATOM   4315 N NE2 . GLN B  1 212 ? -31.78334 51.37924 -26.54918 1.000 72.08086  ? 189 GLN B NE2 1 
ATOM   4316 N N   . LEU B  1 213 ? -34.92971 50.62618 -23.15701 1.000 37.77633  ? 190 LEU B N   1 
ATOM   4317 C CA  . LEU B  1 213 ? -36.06860 49.77458 -23.49783 1.000 32.47916  ? 190 LEU B CA  1 
ATOM   4318 C C   . LEU B  1 213 ? -35.72649 48.89231 -24.70501 1.000 37.26263  ? 190 LEU B C   1 
ATOM   4319 O O   . LEU B  1 213 ? -35.00712 49.32459 -25.61871 1.000 37.28787  ? 190 LEU B O   1 
ATOM   4320 C CB  . LEU B  1 213 ? -37.30189 50.63258 -23.79064 1.000 33.02025  ? 190 LEU B CB  1 
ATOM   4321 C CG  . LEU B  1 213 ? -37.87573 51.28868 -22.52284 1.000 36.87355  ? 190 LEU B CG  1 
ATOM   4322 C CD1 . LEU B  1 213 ? -38.96388 52.29833 -22.86413 1.000 34.15462  ? 190 LEU B CD1 1 
ATOM   4323 C CD2 . LEU B  1 213 ? -38.42689 50.22943 -21.53901 1.000 34.24551  ? 190 LEU B CD2 1 
ATOM   4324 N N   . PRO B  1 214 ? -36.17520 47.64204 -24.71712 1.000 38.29363  ? 191 PRO B N   1 
ATOM   4325 C CA  . PRO B  1 214 ? -35.76962 46.72661 -25.79583 1.000 40.66647  ? 191 PRO B CA  1 
ATOM   4326 C C   . PRO B  1 214 ? -36.45722 47.05533 -27.11585 1.000 38.95380  ? 191 PRO B C   1 
ATOM   4327 O O   . PRO B  1 214 ? -37.54532 47.62854 -27.14709 1.000 36.59435  ? 191 PRO B O   1 
ATOM   4328 C CB  . PRO B  1 214 ? -36.22058 45.35063 -25.27585 1.000 39.58643  ? 191 PRO B CB  1 
ATOM   4329 C CG  . PRO B  1 214 ? -37.41615 45.67863 -24.40823 1.000 37.22541  ? 191 PRO B CG  1 
ATOM   4330 C CD  . PRO B  1 214 ? -37.07163 46.99399 -23.73852 1.000 36.81711  ? 191 PRO B CD  1 
ATOM   4331 N N   . GLU B  1 215 ? -35.81442 46.66177 -28.21817 1.000 38.50613  ? 192 GLU B N   1 
ATOM   4332 C CA  . GLU B  1 215 ? -36.50912 46.60086 -29.50216 1.000 39.50760  ? 192 GLU B CA  1 
ATOM   4333 C C   . GLU B  1 215 ? -37.66950 45.62757 -29.38822 1.000 39.75266  ? 192 GLU B C   1 
ATOM   4334 O O   . GLU B  1 215 ? -37.53523 44.57467 -28.76574 1.000 39.19355  ? 192 GLU B O   1 
ATOM   4335 C CB  . GLU B  1 215 ? -35.56322 46.13849 -30.61370 1.000 42.94750  ? 192 GLU B CB  1 
ATOM   4336 C CG  . GLU B  1 215 ? -34.35153 47.02829 -30.76833 1.000 56.65148  ? 192 GLU B CG  1 
ATOM   4337 C CD  . GLU B  1 215 ? -34.74740 48.48124 -31.01986 1.000 74.91214  ? 192 GLU B CD  1 
ATOM   4338 O OE1 . GLU B  1 215 ? -35.60790 48.70957 -31.90667 1.000 79.04536  ? 192 GLU B OE1 1 
ATOM   4339 O OE2 . GLU B  1 215 ? -34.22020 49.38915 -30.32092 1.000 78.61173  ? 192 GLU B OE2 1 
ATOM   4340 N N   . THR B  1 216 ? -38.80770 45.97272 -29.99728 1.000 36.66787  ? 193 THR B N   1 
ATOM   4341 C CA  . THR B  1 216 ? -40.04870 45.27023 -29.69167 1.000 38.89811  ? 193 THR B CA  1 
ATOM   4342 C C   . THR B  1 216 ? -41.01157 45.36242 -30.87185 1.000 37.67971  ? 193 THR B C   1 
ATOM   4343 O O   . THR B  1 216 ? -41.01892 46.35428 -31.60795 1.000 37.10886  ? 193 THR B O   1 
ATOM   4344 C CB  . THR B  1 216 ? -40.69827 45.84319 -28.39929 1.000 39.99312  ? 193 THR B CB  1 
ATOM   4345 O OG1 . THR B  1 216 ? -41.80984 45.04194 -28.01019 1.000 35.21392  ? 193 THR B OG1 1 
ATOM   4346 C CG2 . THR B  1 216 ? -41.18389 47.31424 -28.54905 1.000 36.41173  ? 193 THR B CG2 1 
ATOM   4347 N N   . TYR B  1 217 ? -41.79760 44.30214 -31.07049 1.000 36.82522  ? 194 TYR B N   1 
ATOM   4348 C CA  . TYR B  1 217 ? -43.01946 44.42337 -31.85752 1.000 39.29575  ? 194 TYR B CA  1 
ATOM   4349 C C   . TYR B  1 217 ? -44.12227 45.03472 -30.98525 1.000 37.04258  ? 194 TYR B C   1 
ATOM   4350 O O   . TYR B  1 217 ? -44.00711 45.10728 -29.75748 1.000 37.72238  ? 194 TYR B O   1 
ATOM   4351 C CB  . TYR B  1 217 ? -43.47327 43.05589 -32.39801 1.000 35.12885  ? 194 TYR B CB  1 
ATOM   4352 C CG  . TYR B  1 217 ? -42.52626 42.40199 -33.40517 1.000 36.41726  ? 194 TYR B CG  1 
ATOM   4353 C CD1 . TYR B  1 217 ? -42.57502 42.73603 -34.75571 1.000 35.40130  ? 194 TYR B CD1 1 
ATOM   4354 C CD2 . TYR B  1 217 ? -41.60494 41.43955 -33.00754 1.000 37.94103  ? 194 TYR B CD2 1 
ATOM   4355 C CE1 . TYR B  1 217 ? -41.72571 42.14531 -35.68664 1.000 38.54115  ? 194 TYR B CE1 1 
ATOM   4356 C CE2 . TYR B  1 217 ? -40.75326 40.83007 -33.93162 1.000 40.73468  ? 194 TYR B CE2 1 
ATOM   4357 C CZ  . TYR B  1 217 ? -40.81577 41.19706 -35.27086 1.000 46.34935  ? 194 TYR B CZ  1 
ATOM   4358 O OH  . TYR B  1 217 ? -39.96437 40.62076 -36.20260 1.000 49.62887  ? 194 TYR B OH  1 
ATOM   4359 N N   . PHE B  1 218 ? -45.21556 45.46209 -31.61483 1.000 31.07835  ? 195 PHE B N   1 
ATOM   4360 C CA  . PHE B  1 218 ? -46.39881 45.87185 -30.86719 1.000 35.07015  ? 195 PHE B CA  1 
ATOM   4361 C C   . PHE B  1 218 ? -47.62833 45.11462 -31.35714 1.000 34.87013  ? 195 PHE B C   1 
ATOM   4362 O O   . PHE B  1 218 ? -47.80099 44.93063 -32.56217 1.000 36.46653  ? 195 PHE B O   1 
ATOM   4363 C CB  . PHE B  1 218 ? -46.63887 47.37998 -30.99742 1.000 31.67158  ? 195 PHE B CB  1 
ATOM   4364 C CG  . PHE B  1 218 ? -45.61090 48.20808 -30.28743 1.000 32.66530  ? 195 PHE B CG  1 
ATOM   4365 C CD1 . PHE B  1 218 ? -45.47867 48.12623 -28.89880 1.000 31.03460  ? 195 PHE B CD1 1 
ATOM   4366 C CD2 . PHE B  1 218 ? -44.77157 49.06850 -31.00154 1.000 35.08314  ? 195 PHE B CD2 1 
ATOM   4367 C CE1 . PHE B  1 218 ? -44.48840 48.88543 -28.22667 1.000 33.23708  ? 195 PHE B CE1 1 
ATOM   4368 C CE2 . PHE B  1 218 ? -43.78937 49.84631 -30.34351 1.000 35.72007  ? 195 PHE B CE2 1 
ATOM   4369 C CZ  . PHE B  1 218 ? -43.66057 49.75576 -28.95344 1.000 36.06611  ? 195 PHE B CZ  1 
ATOM   4370 N N   . THR B  1 219 ? -48.49323 44.69594 -30.43355 1.000 29.22294  ? 196 THR B N   1 
ATOM   4371 C CA  . THR B  1 219 ? -49.78430 44.14851 -30.85815 1.000 33.47119  ? 196 THR B CA  1 
ATOM   4372 C C   . THR B  1 219 ? -50.67760 45.27168 -31.39612 1.000 37.66103  ? 196 THR B C   1 
ATOM   4373 O O   . THR B  1 219 ? -50.45328 46.45995 -31.12730 1.000 33.20655  ? 196 THR B O   1 
ATOM   4374 C CB  . THR B  1 219 ? -50.49115 43.42311 -29.71416 1.000 31.73182  ? 196 THR B CB  1 
ATOM   4375 O OG1 . THR B  1 219 ? -50.55271 44.28047 -28.57054 1.000 31.13860  ? 196 THR B OG1 1 
ATOM   4376 C CG2 . THR B  1 219 ? -49.75209 42.14375 -29.32561 1.000 29.80877  ? 196 THR B CG2 1 
ATOM   4377 N N   . GLN B  1 220 ? -51.70063 44.88258 -32.17902 1.000 36.70726  ? 197 GLN B N   1 
ATOM   4378 C CA  . GLN B  1 220 ? -52.50685 45.83505 -32.93895 1.000 36.00972  ? 197 GLN B CA  1 
ATOM   4379 C C   . GLN B  1 220 ? -53.79909 46.25403 -32.24143 1.000 33.90483  ? 197 GLN B C   1 
ATOM   4380 O O   . GLN B  1 220 ? -54.43923 47.20600 -32.70067 1.000 34.29068  ? 197 GLN B O   1 
ATOM   4381 C CB  . GLN B  1 220 ? -52.85496 45.26580 -34.32130 1.000 35.20197  ? 197 GLN B CB  1 
ATOM   4382 C CG  . GLN B  1 220 ? -51.61499 44.98859 -35.20970 1.000 33.66291  ? 197 GLN B CG  1 
ATOM   4383 C CD  . GLN B  1 220 ? -50.93417 46.25322 -35.68123 1.000 45.71280  ? 197 GLN B CD  1 
ATOM   4384 O OE1 . GLN B  1 220 ? -51.59230 47.17729 -36.16122 1.000 46.00399  ? 197 GLN B OE1 1 
ATOM   4385 N NE2 . GLN B  1 220 ? -49.59727 46.29806 -35.56302 1.000 45.52208  ? 197 GLN B NE2 1 
ATOM   4386 N N   . SER B  1 221 ? -54.19521 45.57797 -31.16214 1.000 28.49421  ? 198 SER B N   1 
ATOM   4387 C CA  . SER B  1 221 ? -55.35229 45.97958 -30.34258 1.000 34.42659  ? 198 SER B CA  1 
ATOM   4388 C C   . SER B  1 221 ? -56.65422 46.00297 -31.13796 1.000 36.43113  ? 198 SER B C   1 
ATOM   4389 O O   . SER B  1 221 ? -57.53972 46.81647 -30.87240 1.000 34.88058  ? 198 SER B O   1 
ATOM   4390 C CB  . SER B  1 221 ? -55.13252 47.34424 -29.67242 1.000 32.78208  ? 198 SER B CB  1 
ATOM   4391 O OG  . SER B  1 221 ? -53.88964 47.36022 -28.98032 1.000 32.20626  ? 198 SER B OG  1 
ATOM   4392 N N   . ARG B  1 222 ? -56.80811 45.10183 -32.09670 1.000 33.27350  ? 199 ARG B N   1 
ATOM   4393 C CA  . ARG B  1 222 ? -58.05244 45.04117 -32.84116 1.000 34.44621  ? 199 ARG B CA  1 
ATOM   4394 C C   . ARG B  1 222 ? -59.02688 44.09998 -32.14618 1.000 39.18903  ? 199 ARG B C   1 
ATOM   4395 O O   . ARG B  1 222 ? -58.65173 43.32484 -31.26661 1.000 34.81600  ? 199 ARG B O   1 
ATOM   4396 C CB  . ARG B  1 222 ? -57.78354 44.59328 -34.27108 1.000 35.84844  ? 199 ARG B CB  1 
ATOM   4397 C CG  . ARG B  1 222 ? -57.00665 45.66127 -35.05215 1.000 37.34532  ? 199 ARG B CG  1 
ATOM   4398 C CD  . ARG B  1 222 ? -56.56865 45.18577 -36.41608 1.000 41.21211  ? 199 ARG B CD  1 
ATOM   4399 N NE  . ARG B  1 222 ? -55.53809 44.16108 -36.30595 1.000 39.22625  ? 199 ARG B NE  1 
ATOM   4400 C CZ  . ARG B  1 222 ? -54.78257 43.75655 -37.32097 1.000 44.39995  ? 199 ARG B CZ  1 
ATOM   4401 N NH1 . ARG B  1 222 ? -54.95861 44.28645 -38.52743 1.000 42.77756  ? 199 ARG B NH1 1 
ATOM   4402 N NH2 . ARG B  1 222 ? -53.86569 42.80905 -37.13166 1.000 38.45061  ? 199 ARG B NH2 1 
ATOM   4403 N N   . ASN B  1 223 ? -60.29264 44.18253 -32.52547 1.000 40.16038  ? 200 ASN B N   1 
ATOM   4404 C CA  . ASN B  1 223 ? -61.23734 43.22017 -31.98041 1.000 41.53617  ? 200 ASN B CA  1 
ATOM   4405 C C   . ASN B  1 223 ? -61.91412 42.45009 -33.09880 1.000 42.50130  ? 200 ASN B C   1 
ATOM   4406 O O   . ASN B  1 223 ? -61.83049 42.79626 -34.28158 1.000 42.35994  ? 200 ASN B O   1 
ATOM   4407 C CB  . ASN B  1 223 ? -62.27566 43.86869 -31.05726 1.000 47.36776  ? 200 ASN B CB  1 
ATOM   4408 C CG  . ASN B  1 223 ? -63.03399 44.97483 -31.71626 1.000 56.52892  ? 200 ASN B CG  1 
ATOM   4409 O OD1 . ASN B  1 223 ? -63.76561 44.75011 -32.68449 1.000 59.48793  ? 200 ASN B OD1 1 
ATOM   4410 N ND2 . ASN B  1 223 ? -62.88959 46.18786 -31.17960 1.000 56.45301  ? 200 ASN B ND2 1 
ATOM   4411 N N   . LEU B  1 224 ? -62.58079 41.37923 -32.67640 1.000 44.80969  ? 201 LEU B N   1 
ATOM   4412 C CA  . LEU B  1 224 ? -63.00489 40.33636 -33.59894 1.000 52.34667  ? 201 LEU B CA  1 
ATOM   4413 C C   . LEU B  1 224 ? -64.00556 40.85850 -34.61877 1.000 54.83910  ? 201 LEU B C   1 
ATOM   4414 O O   . LEU B  1 224 ? -63.86479 40.60250 -35.81990 1.000 60.94218  ? 201 LEU B O   1 
ATOM   4415 C CB  . LEU B  1 224 ? -63.60085 39.17216 -32.80759 1.000 55.41573  ? 201 LEU B CB  1 
ATOM   4416 C CG  . LEU B  1 224 ? -63.61588 37.84478 -33.53773 1.000 58.82697  ? 201 LEU B CG  1 
ATOM   4417 C CD1 . LEU B  1 224 ? -62.21390 37.52233 -34.00888 1.000 55.40336  ? 201 LEU B CD1 1 
ATOM   4418 C CD2 . LEU B  1 224 ? -64.15908 36.76797 -32.62293 1.000 60.27351  ? 201 LEU B CD2 1 
ATOM   4419 N N   . GLN B  1 225 ? -65.01189 41.60013 -34.16861 1.000 55.01187  ? 202 GLN B N   1 
ATOM   4420 C CA  . GLN B  1 225 ? -66.10651 41.97005 -35.05177 1.000 69.23705  ? 202 GLN B CA  1 
ATOM   4421 C C   . GLN B  1 225 ? -65.81906 43.21584 -35.88107 1.000 72.33848  ? 202 GLN B C   1 
ATOM   4422 O O   . GLN B  1 225 ? -66.37139 43.34866 -36.97661 1.000 78.74847  ? 202 GLN B O   1 
ATOM   4423 C CB  . GLN B  1 225 ? -67.38734 42.13876 -34.23084 1.000 74.67452  ? 202 GLN B CB  1 
ATOM   4424 C CG  . GLN B  1 225 ? -67.60708 40.94629 -33.29369 1.000 79.16418  ? 202 GLN B CG  1 
ATOM   4425 C CD  . GLN B  1 225 ? -69.06915 40.65191 -32.99157 1.000 83.79192  ? 202 GLN B CD  1 
ATOM   4426 O OE1 . GLN B  1 225 ? -69.43109 40.38789 -31.84531 1.000 83.31656  ? 202 GLN B OE1 1 
ATOM   4427 N NE2 . GLN B  1 225 ? -69.90928 40.66726 -34.02186 1.000 86.79324  ? 202 GLN B NE2 1 
ATOM   4428 N N   . GLU B  1 226 ? -64.93991 44.10281 -35.41924 1.000 66.76070  ? 203 GLU B N   1 
ATOM   4429 C CA  . GLU B  1 226 ? -64.56454 45.29276 -36.17156 1.000 67.83898  ? 203 GLU B CA  1 
ATOM   4430 C C   . GLU B  1 226 ? -63.20764 45.15190 -36.86378 1.000 58.77771  ? 203 GLU B C   1 
ATOM   4431 O O   . GLU B  1 226 ? -62.56486 46.16434 -37.15239 1.000 57.57578  ? 203 GLU B O   1 
ATOM   4432 C CB  . GLU B  1 226 ? -64.54848 46.51529 -35.25170 1.000 72.60002  ? 203 GLU B CB  1 
ATOM   4433 C CG  . GLU B  1 226 ? -65.80176 46.68219 -34.40376 1.000 83.34198  ? 203 GLU B CG  1 
ATOM   4434 C CD  . GLU B  1 226 ? -65.83360 48.00994 -33.65864 1.000 91.23163  ? 203 GLU B CD  1 
ATOM   4435 O OE1 . GLU B  1 226 ? -66.94364 48.56818 -33.48534 1.000 95.38252  ? 203 GLU B OE1 1 
ATOM   4436 O OE2 . GLU B  1 226 ? -64.74995 48.49446 -33.25535 1.000 92.51897  ? 203 GLU B OE2 1 
ATOM   4437 N N   . PHE B  1 227 ? -62.76657 43.92576 -37.14397 1.000 55.05824  ? 204 PHE B N   1 
ATOM   4438 C CA  . PHE B  1 227 ? -61.40422 43.71297 -37.61475 1.000 45.00573  ? 204 PHE B CA  1 
ATOM   4439 C C   . PHE B  1 227 ? -61.19588 44.32840 -38.99242 1.000 48.76256  ? 204 PHE B C   1 
ATOM   4440 O O   . PHE B  1 227 ? -61.92017 44.01463 -39.93621 1.000 51.10988  ? 204 PHE B O   1 
ATOM   4441 C CB  . PHE B  1 227 ? -61.07475 42.22320 -37.66401 1.000 38.25420  ? 204 PHE B CB  1 
ATOM   4442 C CG  . PHE B  1 227 ? -59.62646 41.95567 -37.91101 1.000 43.91015  ? 204 PHE B CG  1 
ATOM   4443 C CD1 . PHE B  1 227 ? -59.10581 42.00057 -39.20642 1.000 47.28432  ? 204 PHE B CD1 1 
ATOM   4444 C CD2 . PHE B  1 227 ? -58.76524 41.69514 -36.84847 1.000 39.80739  ? 204 PHE B CD2 1 
ATOM   4445 C CE1 . PHE B  1 227 ? -57.75232 41.78994 -39.44563 1.000 47.94896  ? 204 PHE B CE1 1 
ATOM   4446 C CE2 . PHE B  1 227 ? -57.41461 41.47594 -37.07873 1.000 38.57435  ? 204 PHE B CE2 1 
ATOM   4447 C CZ  . PHE B  1 227 ? -56.90268 41.52648 -38.38166 1.000 41.36499  ? 204 PHE B CZ  1 
ATOM   4448 N N   . LYS B  1 228 ? -60.17798 45.17532 -39.11869 1.000 47.97997  ? 205 LYS B N   1 
ATOM   4449 C CA  . LYS B  1 228 ? -59.80751 45.74479 -40.40490 1.000 56.25532  ? 205 LYS B CA  1 
ATOM   4450 C C   . LYS B  1 228 ? -58.35043 45.43012 -40.71068 1.000 56.00269  ? 205 LYS B C   1 
ATOM   4451 O O   . LYS B  1 228 ? -57.48595 45.62711 -39.84347 1.000 53.31447  ? 205 LYS B O   1 
ATOM   4452 C CB  . LYS B  1 228 ? -60.02388 47.26551 -40.41481 1.000 62.19913  ? 205 LYS B CB  1 
ATOM   4453 C CG  . LYS B  1 228 ? -61.48776 47.66928 -40.37540 1.000 71.10160  ? 205 LYS B CG  1 
ATOM   4454 C CD  . LYS B  1 228 ? -61.64776 49.04953 -39.76186 1.000 78.61486  ? 205 LYS B CD  1 
ATOM   4455 C CE  . LYS B  1 228 ? -63.02752 49.62593 -40.02870 1.000 81.01737  ? 205 LYS B CE  1 
ATOM   4456 N NZ  . LYS B  1 228 ? -62.93619 50.82223 -40.91754 1.000 85.28864  ? 205 LYS B NZ  1 
ATOM   4457 N N   . PRO B  1 229 ? -58.03385 44.95400 -41.91436 1.000 54.70195  ? 206 PRO B N   1 
ATOM   4458 C CA  . PRO B  1 229 ? -56.63670 44.64819 -42.23826 1.000 56.34395  ? 206 PRO B CA  1 
ATOM   4459 C C   . PRO B  1 229 ? -55.80029 45.91733 -42.36210 1.000 57.44857  ? 206 PRO B C   1 
ATOM   4460 O O   . PRO B  1 229 ? -56.30678 46.99826 -42.67325 1.000 60.30486  ? 206 PRO B O   1 
ATOM   4461 C CB  . PRO B  1 229 ? -56.74108 43.90785 -43.57661 1.000 57.92911  ? 206 PRO B CB  1 
ATOM   4462 C CG  . PRO B  1 229 ? -57.98743 44.47209 -44.20219 1.000 57.55025  ? 206 PRO B CG  1 
ATOM   4463 C CD  . PRO B  1 229 ? -58.93820 44.72846 -43.05905 1.000 53.84851  ? 206 PRO B CD  1 
ATOM   4464 N N   . ARG B  1 230 ? -54.49220 45.77608 -42.11224 1.000 50.92600  ? 207 ARG B N   1 
ATOM   4465 C CA  . ARG B  1 230 ? -53.59566 46.92807 -42.09174 1.000 49.36127  ? 207 ARG B CA  1 
ATOM   4466 C C   . ARG B  1 230 ? -52.35968 46.73840 -42.96726 1.000 51.16054  ? 207 ARG B C   1 
ATOM   4467 O O   . ARG B  1 230 ? -51.36061 47.43586 -42.76714 1.000 56.75582  ? 207 ARG B O   1 
ATOM   4468 C CB  . ARG B  1 230 ? -53.17832 47.25043 -40.65241 1.000 47.43095  ? 207 ARG B CB  1 
ATOM   4469 C CG  . ARG B  1 230 ? -54.34377 47.75333 -39.81797 1.000 49.10506  ? 207 ARG B CG  1 
ATOM   4470 C CD  . ARG B  1 230 ? -53.99140 48.00816 -38.36711 1.000 43.63266  ? 207 ARG B CD  1 
ATOM   4471 N NE  . ARG B  1 230 ? -55.17909 48.49313 -37.66691 1.000 48.29536  ? 207 ARG B NE  1 
ATOM   4472 C CZ  . ARG B  1 230 ? -55.26509 48.66295 -36.34642 1.000 49.28402  ? 207 ARG B CZ  1 
ATOM   4473 N NH1 . ARG B  1 230 ? -54.22720 48.38264 -35.56238 1.000 43.36937  ? 207 ARG B NH1 1 
ATOM   4474 N NH2 . ARG B  1 230 ? -56.39621 49.10666 -35.81015 1.000 45.39564  ? 207 ARG B NH2 1 
ATOM   4475 N N   . SER B  1 231 ? -52.39567 45.81103 -43.92263 1.000 47.19471  ? 208 SER B N   1 
ATOM   4476 C CA  . SER B  1 231 ? -51.31928 45.64886 -44.89562 1.000 49.35902  ? 208 SER B CA  1 
ATOM   4477 C C   . SER B  1 231 ? -51.87163 44.87029 -46.07551 1.000 49.88866  ? 208 SER B C   1 
ATOM   4478 O O   . SER B  1 231 ? -52.93463 44.25074 -45.99112 1.000 48.90836  ? 208 SER B O   1 
ATOM   4479 C CB  . SER B  1 231 ? -50.11539 44.90435 -44.31337 1.000 54.12379  ? 208 SER B CB  1 
ATOM   4480 O OG  . SER B  1 231 ? -50.41362 43.51625 -44.16100 1.000 50.35228  ? 208 SER B OG  1 
ATOM   4481 N N   . GLN B  1 232 ? -51.11136 44.87133 -47.17069 1.000 54.80177  ? 209 GLN B N   1 
ATOM   4482 C CA  . GLN B  1 232 ? -51.51750 44.09374 -48.33488 1.000 53.11691  ? 209 GLN B CA  1 
ATOM   4483 C C   . GLN B  1 232 ? -51.60053 42.60862 -48.00283 1.000 58.44281  ? 209 GLN B C   1 
ATOM   4484 O O   . GLN B  1 232 ? -52.48813 41.89746 -48.49085 1.000 62.32168  ? 209 GLN B O   1 
ATOM   4485 C CB  . GLN B  1 232 ? -50.54605 44.33550 -49.48770 1.000 55.30849  ? 209 GLN B CB  1 
ATOM   4486 C CG  . GLN B  1 232 ? -51.00006 43.71317 -50.77572 1.000 61.39858  ? 209 GLN B CG  1 
ATOM   4487 C CD  . GLN B  1 232 ? -52.42553 44.10696 -51.12153 1.000 65.85634  ? 209 GLN B CD  1 
ATOM   4488 O OE1 . GLN B  1 232 ? -52.79768 45.27940 -51.05462 1.000 67.63736  ? 209 GLN B OE1 1 
ATOM   4489 N NE2 . GLN B  1 232 ? -53.23168 43.12485 -51.48798 1.000 67.31414  ? 209 GLN B NE2 1 
ATOM   4490 N N   . MET B  1 233 ? -50.69277 42.11820 -47.16571 1.000 56.42332  ? 210 MET B N   1 
ATOM   4491 C CA  . MET B  1 233 ? -50.72944 40.70500 -46.82078 1.000 54.46890  ? 210 MET B CA  1 
ATOM   4492 C C   . MET B  1 233 ? -52.00161 40.35559 -46.05236 1.000 51.47612  ? 210 MET B C   1 
ATOM   4493 O O   . MET B  1 233 ? -52.62424 39.31674 -46.31024 1.000 53.99181  ? 210 MET B O   1 
ATOM   4494 C CB  . MET B  1 233 ? -49.48738 40.34008 -46.01538 1.000 54.27181  ? 210 MET B CB  1 
ATOM   4495 C CG  . MET B  1 233 ? -49.43376 38.88558 -45.62714 1.000 53.11993  ? 210 MET B CG  1 
ATOM   4496 S SD  . MET B  1 233 ? -48.09327 38.59351 -44.46887 1.000 54.30179  ? 210 MET B SD  1 
ATOM   4497 C CE  . MET B  1 233 ? -46.65159 38.93871 -45.50028 1.000 52.17460  ? 210 MET B CE  1 
ATOM   4498 N N   . GLU B  1 234 ? -52.41450 41.21831 -45.11611 1.000 50.19593  ? 211 GLU B N   1 
ATOM   4499 C CA  . GLU B  1 234 ? -53.63988 40.95230 -44.36110 1.000 50.86127  ? 211 GLU B CA  1 
ATOM   4500 C C   . GLU B  1 234 ? -54.87676 41.03122 -45.25010 1.000 51.45641  ? 211 GLU B C   1 
ATOM   4501 O O   . GLU B  1 234 ? -55.81883 40.24809 -45.07541 1.000 49.74093  ? 211 GLU B O   1 
ATOM   4502 C CB  . GLU B  1 234 ? -53.76184 41.91696 -43.18597 1.000 45.94847  ? 211 GLU B CB  1 
ATOM   4503 C CG  . GLU B  1 234 ? -52.69404 41.71465 -42.13231 1.000 45.17550  ? 211 GLU B CG  1 
ATOM   4504 C CD  . GLU B  1 234 ? -53.09292 42.29884 -40.78643 1.000 50.19022  ? 211 GLU B CD  1 
ATOM   4505 O OE1 . GLU B  1 234 ? -53.85089 43.30101 -40.77620 1.000 47.04273  ? 211 GLU B OE1 1 
ATOM   4506 O OE2 . GLU B  1 234 ? -52.66045 41.74285 -39.74273 1.000 48.40881  ? 211 GLU B OE2 1 
ATOM   4507 N N   . ILE B  1 235 ? -54.90272 41.97409 -46.19719 1.000 51.00231  ? 212 ILE B N   1 
ATOM   4508 C CA  . ILE B  1 235 ? -55.97503 42.00025 -47.19087 1.000 54.79695  ? 212 ILE B CA  1 
ATOM   4509 C C   . ILE B  1 235 ? -56.03871 40.66991 -47.93474 1.000 59.71552  ? 212 ILE B C   1 
ATOM   4510 O O   . ILE B  1 235 ? -57.09975 40.03774 -48.02533 1.000 61.83775  ? 212 ILE B O   1 
ATOM   4511 C CB  . ILE B  1 235 ? -55.77290 43.16962 -48.17208 1.000 56.47535  ? 212 ILE B CB  1 
ATOM   4512 C CG1 . ILE B  1 235 ? -55.88980 44.51257 -47.44859 1.000 53.35583  ? 212 ILE B CG1 1 
ATOM   4513 C CG2 . ILE B  1 235 ? -56.76675 43.07667 -49.32788 1.000 53.66801  ? 212 ILE B CG2 1 
ATOM   4514 C CD1 . ILE B  1 235 ? -55.58356 45.69728 -48.35205 1.000 56.18581  ? 212 ILE B CD1 1 
ATOM   4515 N N   . ASP B  1 236 ? -54.89686 40.23069 -48.48124 1.000 55.60993  ? 213 ASP B N   1 
ATOM   4516 C CA  . ASP B  1 236 ? -54.84241 38.97105 -49.22320 1.000 54.50537  ? 213 ASP B CA  1 
ATOM   4517 C C   . ASP B  1 236 ? -55.27748 37.79298 -48.35587 1.000 55.21471  ? 213 ASP B C   1 
ATOM   4518 O O   . ASP B  1 236 ? -55.96882 36.88355 -48.82931 1.000 57.44169  ? 213 ASP B O   1 
ATOM   4519 C CB  . ASP B  1 236 ? -53.42617 38.73532 -49.76549 1.000 54.15115  ? 213 ASP B CB  1 
ATOM   4520 C CG  . ASP B  1 236 ? -53.05387 39.68778 -50.90911 1.000 66.93891  ? 213 ASP B CG  1 
ATOM   4521 O OD1 . ASP B  1 236 ? -53.95315 40.35566 -51.46713 1.000 67.56682  ? 213 ASP B OD1 1 
ATOM   4522 O OD2 . ASP B  1 236 ? -51.84896 39.76421 -51.25278 1.000 70.73785  ? 213 ASP B OD2 1 
ATOM   4523 N N   . PHE B  1 237 ? -54.87944 37.78830 -47.08420 1.000 51.35638  ? 214 PHE B N   1 
ATOM   4524 C CA  . PHE B  1 237 ? -55.27953 36.70100 -46.19251 1.000 52.13704  ? 214 PHE B CA  1 
ATOM   4525 C C   . PHE B  1 237 ? -56.79093 36.64423 -46.01519 1.000 52.39540  ? 214 PHE B C   1 
ATOM   4526 O O   . PHE B  1 237 ? -57.38366 35.55601 -46.00707 1.000 55.55560  ? 214 PHE B O   1 
ATOM   4527 C CB  . PHE B  1 237 ? -54.59910 36.85503 -44.83248 1.000 46.12607  ? 214 PHE B CB  1 
ATOM   4528 C CG  . PHE B  1 237 ? -55.02372 35.81984 -43.81835 1.000 48.78510  ? 214 PHE B CG  1 
ATOM   4529 C CD1 . PHE B  1 237 ? -54.37412 34.59734 -43.74440 1.000 45.47704  ? 214 PHE B CD1 1 
ATOM   4530 C CD2 . PHE B  1 237 ? -56.07334 36.07130 -42.93354 1.000 48.95551  ? 214 PHE B CD2 1 
ATOM   4531 C CE1 . PHE B  1 237 ? -54.74520 33.65306 -42.82290 1.000 45.01261  ? 214 PHE B CE1 1 
ATOM   4532 C CE2 . PHE B  1 237 ? -56.45585 35.10866 -42.00777 1.000 42.35993  ? 214 PHE B CE2 1 
ATOM   4533 C CZ  . PHE B  1 237 ? -55.78986 33.90361 -41.95531 1.000 42.33667  ? 214 PHE B CZ  1 
ATOM   4534 N N   . LEU B  1 238 ? -57.43270 37.79991 -45.84014 1.000 50.81582  ? 215 LEU B N   1 
ATOM   4535 C CA  . LEU B  1 238 ? -58.87861 37.78938 -45.65746 1.000 55.27679  ? 215 LEU B CA  1 
ATOM   4536 C C   . LEU B  1 238 ? -59.60798 37.39662 -46.93803 1.000 57.37659  ? 215 LEU B C   1 
ATOM   4537 O O   . LEU B  1 238 ? -60.66109 36.75874 -46.86589 1.000 61.75993  ? 215 LEU B O   1 
ATOM   4538 C CB  . LEU B  1 238 ? -59.35987 39.14910 -45.15152 1.000 52.44311  ? 215 LEU B CB  1 
ATOM   4539 C CG  . LEU B  1 238 ? -58.96664 39.46273 -43.69959 1.000 52.59016  ? 215 LEU B CG  1 
ATOM   4540 C CD1 . LEU B  1 238 ? -59.50096 40.81539 -43.25558 1.000 50.09163  ? 215 LEU B CD1 1 
ATOM   4541 C CD2 . LEU B  1 238 ? -59.40184 38.36948 -42.73995 1.000 47.74357  ? 215 LEU B CD2 1 
ATOM   4542 N N   . GLU B  1 239 ? -59.06075 37.73103 -48.10827 1.000 53.18112  ? 216 GLU B N   1 
ATOM   4543 C CA  . GLU B  1 239 ? -59.78223 37.54668 -49.36991 1.000 64.91002  ? 216 GLU B CA  1 
ATOM   4544 C C   . GLU B  1 239 ? -59.46396 36.23826 -50.08569 1.000 62.88019  ? 216 GLU B C   1 
ATOM   4545 O O   . GLU B  1 239 ? -60.34789 35.67465 -50.73899 1.000 64.96349  ? 216 GLU B O   1 
ATOM   4546 C CB  . GLU B  1 239 ? -59.49619 38.70433 -50.33408 1.000 72.91440  ? 216 GLU B CB  1 
ATOM   4547 C CG  . GLU B  1 239 ? -60.38793 39.91477 -50.12872 1.000 83.48397  ? 216 GLU B CG  1 
ATOM   4548 C CD  . GLU B  1 239 ? -59.90471 41.15802 -50.88511 1.000 93.82552  ? 216 GLU B CD  1 
ATOM   4549 O OE1 . GLU B  1 239 ? -59.15781 41.02024 -51.88757 1.000 95.90298  ? 216 GLU B OE1 1 
ATOM   4550 O OE2 . GLU B  1 239 ? -60.27170 42.28155 -50.46476 1.000 94.82854  ? 216 GLU B OE2 1 
ATOM   4551 N N   . LEU B  1 240 ? -58.23221 35.74856 -50.00523 1.000 59.47151  ? 217 LEU B N   1 
ATOM   4552 C CA  . LEU B  1 240 ? -57.86097 34.54314 -50.73224 1.000 61.49870  ? 217 LEU B CA  1 
ATOM   4553 C C   . LEU B  1 240 ? -58.29904 33.28130 -49.98976 1.000 64.08717  ? 217 LEU B C   1 
ATOM   4554 O O   . LEU B  1 240 ? -58.51236 33.28022 -48.77215 1.000 62.94823  ? 217 LEU B O   1 
ATOM   4555 C CB  . LEU B  1 240 ? -56.35194 34.49065 -50.94759 1.000 60.80719  ? 217 LEU B CB  1 
ATOM   4556 C CG  . LEU B  1 240 ? -55.77101 35.58149 -51.82971 1.000 61.73786  ? 217 LEU B CG  1 
ATOM   4557 C CD1 . LEU B  1 240 ? -54.26623 35.55587 -51.73081 1.000 62.20184  ? 217 LEU B CD1 1 
ATOM   4558 C CD2 . LEU B  1 240 ? -56.22847 35.33703 -53.26792 1.000 63.70122  ? 217 LEU B CD2 1 
ATOM   4559 N N   . ALA B  1 241 ? -58.41788 32.19023 -50.74732 1.000 63.84285  ? 218 ALA B N   1 
ATOM   4560 C CA  . ALA B  1 241 ? -58.53108 30.87725 -50.13440 1.000 63.22454  ? 218 ALA B CA  1 
ATOM   4561 C C   . ALA B  1 241 ? -57.20262 30.50421 -49.48828 1.000 66.36380  ? 218 ALA B C   1 
ATOM   4562 O O   . ALA B  1 241 ? -56.14013 31.02197 -49.85245 1.000 68.31437  ? 218 ALA B O   1 
ATOM   4563 C CB  . ALA B  1 241 ? -58.93281 29.81333 -51.16299 1.000 62.89644  ? 218 ALA B CB  1 
ATOM   4564 N N   . MET B  1 242 ? -57.27992 29.58402 -48.52185 1.000 64.18918  ? 219 MET B N   1 
ATOM   4565 C CA  . MET B  1 242 ? -56.11821 29.19218 -47.72705 1.000 63.70376  ? 219 MET B CA  1 
ATOM   4566 C C   . MET B  1 242 ? -54.90618 28.87171 -48.60006 1.000 63.39884  ? 219 MET B C   1 
ATOM   4567 O O   . MET B  1 242 ? -53.84000 29.47584 -48.45186 1.000 59.58118  ? 219 MET B O   1 
ATOM   4568 C CB  . MET B  1 242 ? -56.47237 27.98865 -46.84726 1.000 65.38777  ? 219 MET B CB  1 
ATOM   4569 C CG  . MET B  1 242 ? -55.36195 27.60454 -45.86209 1.000 66.59561  ? 219 MET B CG  1 
ATOM   4570 S SD  . MET B  1 242 ? -55.74808 26.23799 -44.74028 1.000 63.03415  ? 219 MET B SD  1 
ATOM   4571 C CE  . MET B  1 242 ? -57.46204 26.59931 -44.28746 1.000 65.98060  ? 219 MET B CE  1 
ATOM   4572 N N   . ASP B  1 243 ? -55.05162 27.91792 -49.52467 1.000 63.63825  ? 220 ASP B N   1 
ATOM   4573 C CA  . ASP B  1 243 ? -53.87721 27.43061 -50.23809 1.000 70.08952  ? 220 ASP B CA  1 
ATOM   4574 C C   . ASP B  1 243 ? -53.34497 28.43720 -51.24937 1.000 67.68477  ? 220 ASP B C   1 
ATOM   4575 O O   . ASP B  1 243 ? -52.16469 28.35954 -51.60530 1.000 64.36292  ? 220 ASP B O   1 
ATOM   4576 C CB  . ASP B  1 243 ? -54.18724 26.08836 -50.90596 1.000 77.39327  ? 220 ASP B CB  1 
ATOM   4577 C CG  . ASP B  1 243 ? -54.30448 24.95040 -49.88969 1.000 85.89044  ? 220 ASP B CG  1 
ATOM   4578 O OD1 . ASP B  1 243 ? -53.58481 24.97878 -48.85813 1.000 85.05974  ? 220 ASP B OD1 1 
ATOM   4579 O OD2 . ASP B  1 243 ? -55.12366 24.03329 -50.11212 1.000 90.75175  ? 220 ASP B OD2 1 
ATOM   4580 N N   . GLU B  1 244 ? -54.17825 29.37622 -51.71202 1.000 69.48253  ? 221 GLU B N   1 
ATOM   4581 C CA  . GLU B  1 244 ? -53.68191 30.47087 -52.54494 1.000 75.58781  ? 221 GLU B CA  1 
ATOM   4582 C C   . GLU B  1 244 ? -52.79724 31.40880 -51.73628 1.000 71.92994  ? 221 GLU B C   1 
ATOM   4583 O O   . GLU B  1 244 ? -51.70402 31.78785 -52.17786 1.000 68.14335  ? 221 GLU B O   1 
ATOM   4584 C CB  . GLU B  1 244 ? -54.84041 31.26711 -53.14164 1.000 84.13655  ? 221 GLU B CB  1 
ATOM   4585 C CG  . GLU B  1 244 ? -55.91769 30.46258 -53.82245 1.000 95.23252  ? 221 GLU B CG  1 
ATOM   4586 C CD  . GLU B  1 244 ? -57.00475 31.35886 -54.38303 1.000 101.67145 ? 221 GLU B CD  1 
ATOM   4587 O OE1 . GLU B  1 244 ? -57.89902 31.77760 -53.60939 1.000 100.34244 ? 221 GLU B OE1 1 
ATOM   4588 O OE2 . GLU B  1 244 ? -56.94368 31.66557 -55.59392 1.000 105.13599 ? 221 GLU B OE2 1 
ATOM   4589 N N   . PHE B  1 245 ? -53.27570 31.82311 -50.56016 1.000 55.24957  ? 222 PHE B N   1 
ATOM   4590 C CA  . PHE B  1 245 ? -52.47816 32.70258 -49.71620 1.000 53.80116  ? 222 PHE B CA  1 
ATOM   4591 C C   . PHE B  1 245 ? -51.12210 32.08347 -49.41484 1.000 58.33389  ? 222 PHE B C   1 
ATOM   4592 O O   . PHE B  1 245 ? -50.08133 32.73698 -49.55248 1.000 57.17561  ? 222 PHE B O   1 
ATOM   4593 C CB  . PHE B  1 245 ? -53.20710 33.01137 -48.40623 1.000 50.94374  ? 222 PHE B CB  1 
ATOM   4594 C CG  . PHE B  1 245 ? -52.41918 33.90941 -47.50659 1.000 51.14336  ? 222 PHE B CG  1 
ATOM   4595 C CD1 . PHE B  1 245 ? -52.43080 35.28301 -47.70829 1.000 52.90513  ? 222 PHE B CD1 1 
ATOM   4596 C CD2 . PHE B  1 245 ? -51.62469 33.38831 -46.49526 1.000 52.75504  ? 222 PHE B CD2 1 
ATOM   4597 C CE1 . PHE B  1 245 ? -51.68454 36.13376 -46.90023 1.000 50.35848  ? 222 PHE B CE1 1 
ATOM   4598 C CE2 . PHE B  1 245 ? -50.86696 34.23032 -45.68602 1.000 54.30250  ? 222 PHE B CE2 1 
ATOM   4599 C CZ  . PHE B  1 245 ? -50.89829 35.60720 -45.89163 1.000 50.97519  ? 222 PHE B CZ  1 
ATOM   4600 N N   . ILE B  1 246 ? -51.11761 30.81464 -49.00072 1.000 58.04703  ? 223 ILE B N   1 
ATOM   4601 C CA  . ILE B  1 246 ? -49.86871 30.17249 -48.60939 1.000 60.14683  ? 223 ILE B CA  1 
ATOM   4602 C C   . ILE B  1 246 ? -48.90495 30.10719 -49.78695 1.000 66.37519  ? 223 ILE B C   1 
ATOM   4603 O O   . ILE B  1 246 ? -47.70406 30.37315 -49.63822 1.000 66.83891  ? 223 ILE B O   1 
ATOM   4604 C CB  . ILE B  1 246 ? -50.15381 28.78705 -48.01060 1.000 57.30576  ? 223 ILE B CB  1 
ATOM   4605 C CG1 . ILE B  1 246 ? -50.79551 28.96357 -46.63126 1.000 59.38356  ? 223 ILE B CG1 1 
ATOM   4606 C CG2 . ILE B  1 246 ? -48.88282 28.00133 -47.86423 1.000 54.98434  ? 223 ILE B CG2 1 
ATOM   4607 C CD1 . ILE B  1 246 ? -51.32074 27.68090 -46.05076 1.000 61.18409  ? 223 ILE B CD1 1 
ATOM   4608 N N   . GLU B  1 247 ? -49.41426 29.78366 -50.97859 1.000 63.50379  ? 224 GLU B N   1 
ATOM   4609 C CA  . GLU B  1 247 ? -48.56330 29.78920 -52.16523 1.000 67.52741  ? 224 GLU B CA  1 
ATOM   4610 C C   . GLU B  1 247 ? -48.02028 31.18335 -52.45290 1.000 72.42143  ? 224 GLU B C   1 
ATOM   4611 O O   . GLU B  1 247 ? -46.81624 31.35441 -52.67772 1.000 79.46657  ? 224 GLU B O   1 
ATOM   4612 C CB  . GLU B  1 247 ? -49.32416 29.26599 -53.38355 1.000 71.11877  ? 224 GLU B CB  1 
ATOM   4613 C CG  . GLU B  1 247 ? -48.71186 29.75729 -54.69943 1.000 82.68443  ? 224 GLU B CG  1 
ATOM   4614 C CD  . GLU B  1 247 ? -49.26473 29.05269 -55.92453 1.000 88.76039  ? 224 GLU B CD  1 
ATOM   4615 O OE1 . GLU B  1 247 ? -48.66076 29.19184 -57.01674 1.000 91.30996  ? 224 GLU B OE1 1 
ATOM   4616 O OE2 . GLU B  1 247 ? -50.29927 28.36043 -55.79148 1.000 91.32890  ? 224 GLU B OE2 1 
ATOM   4617 N N   . ARG B  1 248 ? -48.89394 32.19653 -52.45996 1.000 70.85880  ? 225 ARG B N   1 
ATOM   4618 C CA  . ARG B  1 248 ? -48.45752 33.53054 -52.87210 1.000 72.52613  ? 225 ARG B CA  1 
ATOM   4619 C C   . ARG B  1 248 ? -47.39586 34.09514 -51.93093 1.000 70.26193  ? 225 ARG B C   1 
ATOM   4620 O O   . ARG B  1 248 ? -46.47689 34.79219 -52.37071 1.000 70.04372  ? 225 ARG B O   1 
ATOM   4621 C CB  . ARG B  1 248 ? -49.65185 34.48163 -52.96034 1.000 73.52002  ? 225 ARG B CB  1 
ATOM   4622 C CG  . ARG B  1 248 ? -49.24564 35.93840 -53.17921 1.000 74.89483  ? 225 ARG B CG  1 
ATOM   4623 C CD  . ARG B  1 248 ? -50.44300 36.86213 -53.26591 1.000 76.27364  ? 225 ARG B CD  1 
ATOM   4624 N NE  . ARG B  1 248 ? -51.31202 36.49010 -54.37668 1.000 80.81994  ? 225 ARG B NE  1 
ATOM   4625 C CZ  . ARG B  1 248 ? -52.41669 37.14612 -54.71438 1.000 79.22741  ? 225 ARG B CZ  1 
ATOM   4626 N NH1 . ARG B  1 248 ? -52.79025 38.21872 -54.02055 1.000 71.45053  ? 225 ARG B NH1 1 
ATOM   4627 N NH2 . ARG B  1 248 ? -53.14726 36.72285 -55.74413 1.000 77.11478  ? 225 ARG B NH2 1 
ATOM   4628 N N   . TYR B  1 249 ? -47.50043 33.81773 -50.63267 1.000 66.11316  ? 226 TYR B N   1 
ATOM   4629 C CA  . TYR B  1 249 ? -46.52179 34.33699 -49.68480 1.000 65.08832  ? 226 TYR B CA  1 
ATOM   4630 C C   . TYR B  1 249 ? -45.49415 33.28930 -49.26789 1.000 63.04240  ? 226 TYR B C   1 
ATOM   4631 O O   . TYR B  1 249 ? -44.79548 33.48047 -48.26606 1.000 61.54865  ? 226 TYR B O   1 
ATOM   4632 C CB  . TYR B  1 249 ? -47.23222 34.94213 -48.46915 1.000 57.09754  ? 226 TYR B CB  1 
ATOM   4633 C CG  . TYR B  1 249 ? -47.90684 36.24172 -48.84166 1.000 57.78628  ? 226 TYR B CG  1 
ATOM   4634 C CD1 . TYR B  1 249 ? -49.26024 36.27546 -49.14754 1.000 55.53984  ? 226 TYR B CD1 1 
ATOM   4635 C CD2 . TYR B  1 249 ? -47.16996 37.42291 -48.96782 1.000 55.78473  ? 226 TYR B CD2 1 
ATOM   4636 C CE1 . TYR B  1 249 ? -49.88315 37.45392 -49.52053 1.000 57.30050  ? 226 TYR B CE1 1 
ATOM   4637 C CE2 . TYR B  1 249 ? -47.78023 38.60760 -49.34277 1.000 56.39299  ? 226 TYR B CE2 1 
ATOM   4638 C CZ  . TYR B  1 249 ? -49.14232 38.61528 -49.61609 1.000 60.06678  ? 226 TYR B CZ  1 
ATOM   4639 O OH  . TYR B  1 249 ? -49.77270 39.78583 -49.98804 1.000 62.79008  ? 226 TYR B OH  1 
ATOM   4640 N N   . LYS B  1 250 ? -45.38786 32.19601 -50.02056 1.000 61.01181  ? 227 LYS B N   1 
ATOM   4641 C CA  . LYS B  1 250 ? -44.30977 31.22185 -49.87052 1.000 65.10231  ? 227 LYS B CA  1 
ATOM   4642 C C   . LYS B  1 250 ? -44.19514 30.74048 -48.42551 1.000 63.95308  ? 227 LYS B C   1 
ATOM   4643 O O   . LYS B  1 250 ? -43.15219 30.84025 -47.78308 1.000 66.41805  ? 227 LYS B O   1 
ATOM   4644 C CB  . LYS B  1 250 ? -42.98572 31.81099 -50.36497 1.000 69.34542  ? 227 LYS B CB  1 
ATOM   4645 C CG  . LYS B  1 250 ? -43.00489 32.23165 -51.82048 1.000 74.26303  ? 227 LYS B CG  1 
ATOM   4646 C CD  . LYS B  1 250 ? -41.63710 32.74428 -52.26590 1.000 83.57257  ? 227 LYS B CD  1 
ATOM   4647 C CE  . LYS B  1 250 ? -41.58952 32.98490 -53.77182 1.000 86.69865  ? 227 LYS B CE  1 
ATOM   4648 N NZ  . LYS B  1 250 ? -40.25961 33.48753 -54.21783 1.000 89.75532  ? 227 LYS B NZ  1 
ATOM   4649 N N   . LEU B  1 251 ? -45.30367 30.20834 -47.91669 1.000 60.73595  ? 228 LEU B N   1 
ATOM   4650 C CA  . LEU B  1 251 ? -45.39308 29.80757 -46.52211 1.000 60.13541  ? 228 LEU B CA  1 
ATOM   4651 C C   . LEU B  1 251 ? -45.51113 28.29449 -46.35156 1.000 59.98672  ? 228 LEU B C   1 
ATOM   4652 O O   . LEU B  1 251 ? -45.84559 27.82888 -45.25575 1.000 55.32310  ? 228 LEU B O   1 
ATOM   4653 C CB  . LEU B  1 251 ? -46.57200 30.51885 -45.85412 1.000 57.51139  ? 228 LEU B CB  1 
ATOM   4654 C CG  . LEU B  1 251 ? -46.36209 31.97773 -45.44333 1.000 60.73350  ? 228 LEU B CG  1 
ATOM   4655 C CD1 . LEU B  1 251 ? -47.69156 32.70243 -45.27478 1.000 61.51886  ? 228 LEU B CD1 1 
ATOM   4656 C CD2 . LEU B  1 251 ? -45.59832 32.00827 -44.14183 1.000 56.50919  ? 228 LEU B CD2 1 
ATOM   4657 N N   . GLU B  1 252 ? -45.24247 27.51741 -47.40719 1.000 59.75921  ? 229 GLU B N   1 
ATOM   4658 C CA  . GLU B  1 252 ? -45.25992 26.06148 -47.28598 1.000 62.85832  ? 229 GLU B CA  1 
ATOM   4659 C C   . GLU B  1 252 ? -44.25943 25.59882 -46.23086 1.000 62.37751  ? 229 GLU B C   1 
ATOM   4660 O O   . GLU B  1 252 ? -43.14562 26.12239 -46.13489 1.000 66.64649  ? 229 GLU B O   1 
ATOM   4661 C CB  . GLU B  1 252 ? -44.93228 25.39909 -48.62934 1.000 68.95442  ? 229 GLU B CB  1 
ATOM   4662 C CG  . GLU B  1 252 ? -45.87150 25.76634 -49.76223 1.000 74.55394  ? 229 GLU B CG  1 
ATOM   4663 C CD  . GLU B  1 252 ? -45.37723 26.95314 -50.56912 1.000 82.32137  ? 229 GLU B CD  1 
ATOM   4664 O OE1 . GLU B  1 252 ? -44.48276 27.68046 -50.08291 1.000 84.24581  ? 229 GLU B OE1 1 
ATOM   4665 O OE2 . GLU B  1 252 ? -45.87567 27.15306 -51.69777 1.000 87.25684  ? 229 GLU B OE2 1 
ATOM   4666 N N   . GLY B  1 253 ? -44.65759 24.60693 -45.43639 1.000 60.05989  ? 230 GLY B N   1 
ATOM   4667 C CA  . GLY B  1 253 ? -43.80403 24.11463 -44.37825 1.000 59.60687  ? 230 GLY B CA  1 
ATOM   4668 C C   . GLY B  1 253 ? -43.82405 24.92121 -43.09502 1.000 62.10023  ? 230 GLY B C   1 
ATOM   4669 O O   . GLY B  1 253 ? -43.11157 24.55767 -42.14875 1.000 62.23538  ? 230 GLY B O   1 
ATOM   4670 N N   . TYR B  1 254 ? -44.60332 26.00605 -43.02508 1.000 58.74734  ? 231 TYR B N   1 
ATOM   4671 C CA  . TYR B  1 254 ? -44.71053 26.80995 -41.81216 1.000 53.72154  ? 231 TYR B CA  1 
ATOM   4672 C C   . TYR B  1 254 ? -46.03078 26.60590 -41.08082 1.000 54.14829  ? 231 TYR B C   1 
ATOM   4673 O O   . TYR B  1 254 ? -46.31813 27.34146 -40.13110 1.000 50.09072  ? 231 TYR B O   1 
ATOM   4674 C CB  . TYR B  1 254 ? -44.49622 28.29301 -42.13243 1.000 54.41478  ? 231 TYR B CB  1 
ATOM   4675 C CG  . TYR B  1 254 ? -43.05697 28.58772 -42.44340 1.000 54.65616  ? 231 TYR B CG  1 
ATOM   4676 C CD1 . TYR B  1 254 ? -42.11592 28.70148 -41.42446 1.000 55.51634  ? 231 TYR B CD1 1 
ATOM   4677 C CD2 . TYR B  1 254 ? -42.61778 28.70579 -43.76184 1.000 58.33368  ? 231 TYR B CD2 1 
ATOM   4678 C CE1 . TYR B  1 254 ? -40.76269 28.95234 -41.71817 1.000 58.27629  ? 231 TYR B CE1 1 
ATOM   4679 C CE2 . TYR B  1 254 ? -41.28232 28.95827 -44.05737 1.000 59.35825  ? 231 TYR B CE2 1 
ATOM   4680 C CZ  . TYR B  1 254 ? -40.36112 29.07973 -43.03241 1.000 59.68902  ? 231 TYR B CZ  1 
ATOM   4681 O OH  . TYR B  1 254 ? -39.03659 29.33152 -43.32662 1.000 67.26110  ? 231 TYR B OH  1 
ATOM   4682 N N   . ALA B  1 255 ? -46.84242 25.63172 -41.50889 1.000 51.94567  ? 232 ALA B N   1 
ATOM   4683 C CA  . ALA B  1 255 ? -47.96793 25.13061 -40.72298 1.000 49.07107  ? 232 ALA B CA  1 
ATOM   4684 C C   . ALA B  1 255 ? -49.01939 26.20923 -40.46344 1.000 47.84369  ? 232 ALA B C   1 
ATOM   4685 O O   . ALA B  1 255 ? -49.69265 26.20472 -39.42455 1.000 50.14327  ? 232 ALA B O   1 
ATOM   4686 C CB  . ALA B  1 255 ? -47.48015 24.51621 -39.40540 1.000 46.37697  ? 232 ALA B CB  1 
ATOM   4687 N N   . PHE B  1 256 ? -49.17889 27.14054 -41.40797 1.000 44.57799  ? 233 PHE B N   1 
ATOM   4688 C CA  . PHE B  1 256 ? -50.22708 28.14615 -41.27450 1.000 47.94547  ? 233 PHE B CA  1 
ATOM   4689 C C   . PHE B  1 256 ? -51.61978 27.51729 -41.26992 1.000 53.47947  ? 233 PHE B C   1 
ATOM   4690 O O   . PHE B  1 256 ? -52.52121 28.01982 -40.58558 1.000 54.12859  ? 233 PHE B O   1 
ATOM   4691 C CB  . PHE B  1 256 ? -50.09852 29.17750 -42.39512 1.000 53.49751  ? 233 PHE B CB  1 
ATOM   4692 C CG  . PHE B  1 256 ? -49.42142 30.44785 -41.96901 1.000 52.38086  ? 233 PHE B CG  1 
ATOM   4693 C CD1 . PHE B  1 256 ? -48.30314 30.41010 -41.15133 1.000 57.45680  ? 233 PHE B CD1 1 
ATOM   4694 C CD2 . PHE B  1 256 ? -49.89850 31.67900 -42.38516 1.000 53.42207  ? 233 PHE B CD2 1 
ATOM   4695 C CE1 . PHE B  1 256 ? -47.67312 31.59259 -40.73881 1.000 57.89354  ? 233 PHE B CE1 1 
ATOM   4696 C CE2 . PHE B  1 256 ? -49.27310 32.85522 -41.98606 1.000 56.19855  ? 233 PHE B CE2 1 
ATOM   4697 C CZ  . PHE B  1 256 ? -48.15976 32.80871 -41.15990 1.000 53.79900  ? 233 PHE B CZ  1 
ATOM   4698 N N   . GLU B  1 257 ? -51.81843 26.42804 -42.02588 1.000 50.88028  ? 234 GLU B N   1 
ATOM   4699 C CA  . GLU B  1 257 ? -53.07223 25.68237 -41.93980 1.000 57.16182  ? 234 GLU B CA  1 
ATOM   4700 C C   . GLU B  1 257 ? -53.47178 25.44469 -40.48664 1.000 56.59336  ? 234 GLU B C   1 
ATOM   4701 O O   . GLU B  1 257 ? -54.63377 25.64082 -40.11037 1.000 58.63661  ? 234 GLU B O   1 
ATOM   4702 C CB  . GLU B  1 257 ? -52.94735 24.34667 -42.67906 1.000 59.87738  ? 234 GLU B CB  1 
ATOM   4703 C CG  . GLU B  1 257 ? -52.65110 24.46664 -44.17693 1.000 68.55232  ? 234 GLU B CG  1 
ATOM   4704 C CD  . GLU B  1 257 ? -51.15537 24.49792 -44.51324 1.000 74.17327  ? 234 GLU B CD  1 
ATOM   4705 O OE1 . GLU B  1 257 ? -50.32135 24.78983 -43.62376 1.000 72.97329  ? 234 GLU B OE1 1 
ATOM   4706 O OE2 . GLU B  1 257 ? -50.81675 24.22768 -45.68672 1.000 80.00605  ? 234 GLU B OE2 1 
ATOM   4707 N N   . HIS B  1 258 ? -52.50768 25.05839 -39.64767 1.000 52.40518  ? 235 HIS B N   1 
ATOM   4708 C CA  . HIS B  1 258 ? -52.78686 24.78071 -38.24320 1.000 47.95913  ? 235 HIS B CA  1 
ATOM   4709 C C   . HIS B  1 258 ? -52.75991 26.06892 -37.40827 1.000 44.39566  ? 235 HIS B C   1 
ATOM   4710 O O   . HIS B  1 258 ? -53.75628 26.42219 -36.76956 1.000 43.23695  ? 235 HIS B O   1 
ATOM   4711 C CB  . HIS B  1 258 ? -51.78271 23.72937 -37.74356 1.000 40.40024  ? 235 HIS B CB  1 
ATOM   4712 C CG  . HIS B  1 258 ? -51.89436 23.39608 -36.28219 1.000 41.56676  ? 235 HIS B CG  1 
ATOM   4713 N ND1 . HIS B  1 258 ? -52.71637 22.39745 -35.80223 1.000 43.46453  ? 235 HIS B ND1 1 
ATOM   4714 C CD2 . HIS B  1 258 ? -51.25324 23.90669 -35.19923 1.000 43.23871  ? 235 HIS B CD2 1 
ATOM   4715 C CE1 . HIS B  1 258 ? -52.58861 22.31498 -34.48856 1.000 43.57475  ? 235 HIS B CE1 1 
ATOM   4716 N NE2 . HIS B  1 258 ? -51.71149 23.22534 -34.09449 1.000 43.10460  ? 235 HIS B NE2 1 
ATOM   4717 N N   . ILE B  1 259 ? -51.65345 26.82294 -37.46810 1.000 44.23194  ? 236 ILE B N   1 
ATOM   4718 C CA  . ILE B  1 259 ? -51.40817 27.90649 -36.50840 1.000 44.52688  ? 236 ILE B CA  1 
ATOM   4719 C C   . ILE B  1 259 ? -52.39171 29.05636 -36.69756 1.000 42.47896  ? 236 ILE B C   1 
ATOM   4720 O O   . ILE B  1 259 ? -52.91404 29.61560 -35.72691 1.000 41.11778  ? 236 ILE B O   1 
ATOM   4721 C CB  . ILE B  1 259 ? -49.96317 28.41851 -36.63208 1.000 41.77338  ? 236 ILE B CB  1 
ATOM   4722 C CG1 . ILE B  1 259 ? -48.95953 27.28513 -36.46321 1.000 43.71058  ? 236 ILE B CG1 1 
ATOM   4723 C CG2 . ILE B  1 259 ? -49.71097 29.53404 -35.62089 1.000 41.44214  ? 236 ILE B CG2 1 
ATOM   4724 C CD1 . ILE B  1 259 ? -47.55630 27.66727 -36.98442 1.000 44.31770  ? 236 ILE B CD1 1 
ATOM   4725 N N   . VAL B  1 260 ? -52.61026 29.46599 -37.93868 1.000 38.89407  ? 237 VAL B N   1 
ATOM   4726 C CA  . VAL B  1 260 ? -53.34227 30.68890 -38.23624 1.000 39.43068  ? 237 VAL B CA  1 
ATOM   4727 C C   . VAL B  1 260 ? -54.77913 30.39084 -38.63665 1.000 40.19145  ? 237 VAL B C   1 
ATOM   4728 O O   . VAL B  1 260 ? -55.70929 31.01283 -38.13132 1.000 45.98659  ? 237 VAL B O   1 
ATOM   4729 C CB  . VAL B  1 260 ? -52.60713 31.49228 -39.33910 1.000 46.06366  ? 237 VAL B CB  1 
ATOM   4730 C CG1 . VAL B  1 260 ? -53.36803 32.76360 -39.68417 1.000 43.42027  ? 237 VAL B CG1 1 
ATOM   4731 C CG2 . VAL B  1 260 ? -51.16358 31.80975 -38.91698 1.000 40.56576  ? 237 VAL B CG2 1 
ATOM   4732 N N   . TYR B  1 261 ? -54.98066 29.45736 -39.56798 1.000 43.02473  ? 238 TYR B N   1 
ATOM   4733 C CA  . TYR B  1 261 ? -56.33508 29.17943 -40.03135 1.000 45.13671  ? 238 TYR B CA  1 
ATOM   4734 C C   . TYR B  1 261 ? -57.11946 28.36179 -39.01675 1.000 42.07437  ? 238 TYR B C   1 
ATOM   4735 O O   . TYR B  1 261 ? -58.34835 28.46552 -38.96770 1.000 46.07688  ? 238 TYR B O   1 
ATOM   4736 C CB  . TYR B  1 261 ? -56.30351 28.44319 -41.37276 1.000 49.01162  ? 238 TYR B CB  1 
ATOM   4737 C CG  . TYR B  1 261 ? -55.80951 29.29441 -42.52870 1.000 49.41285  ? 238 TYR B CG  1 
ATOM   4738 C CD1 . TYR B  1 261 ? -56.70432 30.04283 -43.29100 1.000 46.02736  ? 238 TYR B CD1 1 
ATOM   4739 C CD2 . TYR B  1 261 ? -54.45161 29.36344 -42.84797 1.000 47.50928  ? 238 TYR B CD2 1 
ATOM   4740 C CE1 . TYR B  1 261 ? -56.27316 30.82751 -44.33375 1.000 45.65013  ? 238 TYR B CE1 1 
ATOM   4741 C CE2 . TYR B  1 261 ? -54.00218 30.15844 -43.90321 1.000 48.25433  ? 238 TYR B CE2 1 
ATOM   4742 C CZ  . TYR B  1 261 ? -54.92215 30.88570 -44.63598 1.000 48.18454  ? 238 TYR B CZ  1 
ATOM   4743 O OH  . TYR B  1 261 ? -54.51368 31.67931 -45.67982 1.000 51.82467  ? 238 TYR B OH  1 
ATOM   4744 N N   . GLY B  1 262 ? -56.43538 27.53735 -38.22128 1.000 38.03745  ? 239 GLY B N   1 
ATOM   4745 C CA  . GLY B  1 262 ? -57.09496 26.64191 -37.28030 1.000 38.28600  ? 239 GLY B CA  1 
ATOM   4746 C C   . GLY B  1 262 ? -57.60277 25.34141 -37.88086 1.000 42.55829  ? 239 GLY B C   1 
ATOM   4747 O O   . GLY B  1 262 ? -58.00657 25.28414 -39.05000 1.000 39.88446  ? 239 GLY B O   1 
ATOM   4748 N N   . ASP B  1 263 ? -57.59083 24.28650 -37.07472 1.000 36.86117  ? 240 ASP B N   1 
ATOM   4749 C CA  . ASP B  1 263 ? -58.05213 22.96391 -37.47164 1.000 38.08061  ? 240 ASP B CA  1 
ATOM   4750 C C   . ASP B  1 263 ? -59.28789 22.64290 -36.63887 1.000 40.57143  ? 240 ASP B C   1 
ATOM   4751 O O   . ASP B  1 263 ? -59.20291 22.53781 -35.41269 1.000 38.59515  ? 240 ASP B O   1 
ATOM   4752 C CB  . ASP B  1 263 ? -56.94702 21.93699 -37.24432 1.000 39.44301  ? 240 ASP B CB  1 
ATOM   4753 C CG  . ASP B  1 263 ? -57.32205 20.54336 -37.70229 1.000 48.44303  ? 240 ASP B CG  1 
ATOM   4754 O OD1 . ASP B  1 263 ? -58.49534 20.27535 -38.07075 1.000 48.93932  ? 240 ASP B OD1 1 
ATOM   4755 O OD2 . ASP B  1 263 ? -56.40423 19.70274 -37.68218 1.000 54.55237  ? 240 ASP B OD2 1 
ATOM   4756 N N   . PHE B  1 264 ? -60.43078 22.49701 -37.30010 1.000 39.19374  ? 241 PHE B N   1 
ATOM   4757 C CA  . PHE B  1 264 ? -61.68140 22.23235 -36.60583 1.000 40.13127  ? 241 PHE B CA  1 
ATOM   4758 C C   . PHE B  1 264 ? -62.15218 20.79825 -36.79535 1.000 42.48573  ? 241 PHE B C   1 
ATOM   4759 O O   . PHE B  1 264 ? -63.33558 20.51071 -36.58673 1.000 40.74925  ? 241 PHE B O   1 
ATOM   4760 C CB  . PHE B  1 264 ? -62.75388 23.22005 -37.06869 1.000 39.47481  ? 241 PHE B CB  1 
ATOM   4761 C CG  . PHE B  1 264 ? -62.37800 24.66816 -36.84207 1.000 42.31469  ? 241 PHE B CG  1 
ATOM   4762 C CD1 . PHE B  1 264 ? -61.50850 25.32193 -37.71583 1.000 41.46026  ? 241 PHE B CD1 1 
ATOM   4763 C CD2 . PHE B  1 264 ? -62.89051 25.37393 -35.76869 1.000 43.22738  ? 241 PHE B CD2 1 
ATOM   4764 C CE1 . PHE B  1 264 ? -61.15367 26.63649 -37.50397 1.000 41.45125  ? 241 PHE B CE1 1 
ATOM   4765 C CE2 . PHE B  1 264 ? -62.53643 26.71184 -35.55334 1.000 43.83611  ? 241 PHE B CE2 1 
ATOM   4766 C CZ  . PHE B  1 264 ? -61.67431 27.33955 -36.42788 1.000 41.04926  ? 241 PHE B CZ  1 
ATOM   4767 N N   . SER B  1 265 ? -61.25132 19.88583 -37.17548 1.000 41.15706  ? 242 SER B N   1 
ATOM   4768 C CA  . SER B  1 265 ? -61.68036 18.54551 -37.54556 1.000 44.72352  ? 242 SER B CA  1 
ATOM   4769 C C   . SER B  1 265 ? -61.73496 17.57637 -36.36573 1.000 45.23752  ? 242 SER B C   1 
ATOM   4770 O O   . SER B  1 265 ? -62.41666 16.55556 -36.47099 1.000 46.74018  ? 242 SER B O   1 
ATOM   4771 C CB  . SER B  1 265 ? -60.77511 17.97691 -38.65241 1.000 43.24065  ? 242 SER B CB  1 
ATOM   4772 O OG  . SER B  1 265 ? -59.45762 17.76289 -38.17804 1.000 49.20168  ? 242 SER B OG  1 
ATOM   4773 N N   . HIS B  1 266 ? -61.07344 17.87145 -35.25070 1.000 41.62804  ? 243 HIS B N   1 
ATOM   4774 C CA  . HIS B  1 266 ? -61.04802 16.99751 -34.07910 1.000 43.95127  ? 243 HIS B CA  1 
ATOM   4775 C C   . HIS B  1 266 ? -61.77770 17.65001 -32.90245 1.000 43.69104  ? 243 HIS B C   1 
ATOM   4776 O O   . HIS B  1 266 ? -62.05948 18.85245 -32.90316 1.000 37.88819  ? 243 HIS B O   1 
ATOM   4777 C CB  . HIS B  1 266 ? -59.60428 16.67878 -33.66809 1.000 47.68234  ? 243 HIS B CB  1 
ATOM   4778 C CG  . HIS B  1 266 ? -58.71572 16.28727 -34.80702 1.000 58.90891  ? 243 HIS B CG  1 
ATOM   4779 N ND1 . HIS B  1 266 ? -58.88093 15.11191 -35.50978 1.000 58.03850  ? 243 HIS B ND1 1 
ATOM   4780 C CD2 . HIS B  1 266 ? -57.64319 16.90957 -35.35732 1.000 58.59266  ? 243 HIS B CD2 1 
ATOM   4781 C CE1 . HIS B  1 266 ? -57.95603 15.03156 -36.45000 1.000 61.47722  ? 243 HIS B CE1 1 
ATOM   4782 N NE2 . HIS B  1 266 ? -57.19025 16.10630 -36.37762 1.000 61.62654  ? 243 HIS B NE2 1 
ATOM   4783 N N   . SER B  1 267 ? -62.05775 16.85417 -31.86114 1.000 37.55349  ? 244 SER B N   1 
ATOM   4784 C CA  . SER B  1 267 ? -62.81092 17.40193 -30.73490 1.000 36.33528  ? 244 SER B CA  1 
ATOM   4785 C C   . SER B  1 267 ? -62.06854 18.56140 -30.09149 1.000 36.93985  ? 244 SER B C   1 
ATOM   4786 O O   . SER B  1 267 ? -62.68721 19.54835 -29.67326 1.000 37.16859  ? 244 SER B O   1 
ATOM   4787 C CB  . SER B  1 267 ? -63.11222 16.31546 -29.69871 1.000 40.68729  ? 244 SER B CB  1 
ATOM   4788 O OG  . SER B  1 267 ? -61.93134 15.77856 -29.14549 1.000 43.71568  ? 244 SER B OG  1 
ATOM   4789 N N   . GLN B  1 268 ? -60.74617 18.46557 -30.00001 1.000 35.48571  ? 245 GLN B N   1 
ATOM   4790 C CA  . GLN B  1 268 ? -59.92736 19.58134 -29.54570 1.000 34.48228  ? 245 GLN B CA  1 
ATOM   4791 C C   . GLN B  1 268 ? -59.53031 20.46447 -30.73503 1.000 37.26468  ? 245 GLN B C   1 
ATOM   4792 O O   . GLN B  1 268 ? -58.88698 19.99467 -31.67497 1.000 36.86171  ? 245 GLN B O   1 
ATOM   4793 C CB  . GLN B  1 268 ? -58.68739 19.08153 -28.80343 1.000 40.32718  ? 245 GLN B CB  1 
ATOM   4794 C CG  . GLN B  1 268 ? -57.64905 20.18606 -28.64430 1.000 51.76179  ? 245 GLN B CG  1 
ATOM   4795 C CD  . GLN B  1 268 ? -57.20000 20.38986 -27.21275 1.000 60.21692  ? 245 GLN B CD  1 
ATOM   4796 O OE1 . GLN B  1 268 ? -58.01467 20.41720 -26.27964 1.000 63.98158  ? 245 GLN B OE1 1 
ATOM   4797 N NE2 . GLN B  1 268 ? -55.89644 20.53180 -27.02949 1.000 53.86418  ? 245 GLN B NE2 1 
ATOM   4798 N N   . LEU B  1 269 ? -59.89549 21.74837 -30.67089 1.000 37.47835  ? 246 LEU B N   1 
ATOM   4799 C CA  . LEU B  1 269 ? -59.59104 22.69891 -31.73680 1.000 38.21369  ? 246 LEU B CA  1 
ATOM   4800 C C   . LEU B  1 269 ? -58.08001 22.90515 -31.86142 1.000 38.66089  ? 246 LEU B C   1 
ATOM   4801 O O   . LEU B  1 269 ? -57.39434 23.16229 -30.86938 1.000 37.28648  ? 246 LEU B O   1 
ATOM   4802 C CB  . LEU B  1 269 ? -60.29959 24.02544 -31.43129 1.000 36.75150  ? 246 LEU B CB  1 
ATOM   4803 C CG  . LEU B  1 269 ? -60.59294 25.02185 -32.55720 1.000 45.41936  ? 246 LEU B CG  1 
ATOM   4804 C CD1 . LEU B  1 269 ? -61.68963 25.99589 -32.14303 1.000 38.29402  ? 246 LEU B CD1 1 
ATOM   4805 C CD2 . LEU B  1 269 ? -59.32732 25.78935 -32.91945 1.000 48.56030  ? 246 LEU B CD2 1 
ATOM   4806 N N   . GLY B  1 270 ? -57.55287 22.78615 -33.08085 1.000 37.72204  ? 247 GLY B N   1 
ATOM   4807 C CA  . GLY B  1 270 ? -56.11657 22.85616 -33.31089 1.000 37.11196  ? 247 GLY B CA  1 
ATOM   4808 C C   . GLY B  1 270 ? -55.69315 24.24496 -33.75392 1.000 36.49655  ? 247 GLY B C   1 
ATOM   4809 O O   . GLY B  1 270 ? -56.34135 24.86379 -34.60068 1.000 37.27346  ? 247 GLY B O   1 
ATOM   4810 N N   . GLY B  1 271 ? -54.59474 24.72787 -33.17582 1.000 34.88809  ? 248 GLY B N   1 
ATOM   4811 C CA  . GLY B  1 271 ? -54.03323 26.01384 -33.59800 1.000 38.12413  ? 248 GLY B CA  1 
ATOM   4812 C C   . GLY B  1 271 ? -54.90795 27.21502 -33.25618 1.000 36.92811  ? 248 GLY B C   1 
ATOM   4813 O O   . GLY B  1 271 ? -55.45895 27.33064 -32.15208 1.000 36.48009  ? 248 GLY B O   1 
ATOM   4814 N N   . LEU B  1 272 ? -55.01184 28.13893 -34.22055 1.000 34.85231  ? 249 LEU B N   1 
ATOM   4815 C CA  . LEU B  1 272 ? -55.83612 29.34818 -34.14598 1.000 34.94498  ? 249 LEU B CA  1 
ATOM   4816 C C   . LEU B  1 272 ? -55.32641 30.32373 -33.07830 1.000 36.47861  ? 249 LEU B C   1 
ATOM   4817 O O   . LEU B  1 272 ? -56.03100 30.65879 -32.11320 1.000 34.24938  ? 249 LEU B O   1 
ATOM   4818 C CB  . LEU B  1 272 ? -57.31700 28.97772 -33.92055 1.000 34.85320  ? 249 LEU B CB  1 
ATOM   4819 C CG  . LEU B  1 272 ? -58.37227 30.00954 -34.37033 1.000 36.15642  ? 249 LEU B CG  1 
ATOM   4820 C CD1 . LEU B  1 272 ? -58.41867 30.15848 -35.89382 1.000 32.94932  ? 249 LEU B CD1 1 
ATOM   4821 C CD2 . LEU B  1 272 ? -59.77067 29.68981 -33.82345 1.000 37.32423  ? 249 LEU B CD2 1 
ATOM   4822 N N   . HIS B  1 273 ? -54.10596 30.82087 -33.26175 1.000 33.13227  ? 250 HIS B N   1 
ATOM   4823 C CA  . HIS B  1 273 ? -53.46405 31.67619 -32.26795 1.000 29.41831  ? 250 HIS B CA  1 
ATOM   4824 C C   . HIS B  1 273 ? -53.27049 33.12174 -32.72597 1.000 34.01757  ? 250 HIS B C   1 
ATOM   4825 O O   . HIS B  1 273 ? -52.73648 33.93603 -31.95782 1.000 33.95000  ? 250 HIS B O   1 
ATOM   4826 C CB  . HIS B  1 273 ? -52.11835 31.05613 -31.86102 1.000 32.33386  ? 250 HIS B CB  1 
ATOM   4827 C CG  . HIS B  1 273 ? -52.26361 29.70136 -31.22587 1.000 36.10508  ? 250 HIS B CG  1 
ATOM   4828 N ND1 . HIS B  1 273 ? -52.90870 29.51408 -30.02162 1.000 36.24292  ? 250 HIS B ND1 1 
ATOM   4829 C CD2 . HIS B  1 273 ? -51.87306 28.47056 -31.63756 1.000 35.84824  ? 250 HIS B CD2 1 
ATOM   4830 C CE1 . HIS B  1 273 ? -52.90002 28.22933 -29.71116 1.000 35.04650  ? 250 HIS B CE1 1 
ATOM   4831 N NE2 . HIS B  1 273 ? -52.28111 27.57366 -30.67883 1.000 37.12692  ? 250 HIS B NE2 1 
ATOM   4832 N N   . LEU B  1 274 ? -53.71873 33.48231 -33.92662 1.000 34.09611  ? 251 LEU B N   1 
ATOM   4833 C CA  . LEU B  1 274 ? -53.57203 34.84311 -34.45175 1.000 35.21664  ? 251 LEU B CA  1 
ATOM   4834 C C   . LEU B  1 274 ? -54.95364 35.46153 -34.61467 1.000 38.36976  ? 251 LEU B C   1 
ATOM   4835 O O   . LEU B  1 274 ? -55.84155 34.82512 -35.18888 1.000 36.71731  ? 251 LEU B O   1 
ATOM   4836 C CB  . LEU B  1 274 ? -52.86820 34.84396 -35.80875 1.000 37.35238  ? 251 LEU B CB  1 
ATOM   4837 C CG  . LEU B  1 274 ? -51.35805 35.05040 -35.82678 1.000 51.20351  ? 251 LEU B CG  1 
ATOM   4838 C CD1 . LEU B  1 274 ? -50.97422 36.47966 -35.39754 1.000 43.34113  ? 251 LEU B CD1 1 
ATOM   4839 C CD2 . LEU B  1 274 ? -50.72935 34.00222 -34.90298 1.000 55.74611  ? 251 LEU B CD2 1 
ATOM   4840 N N   . LEU B  1 275 ? -55.13668 36.71002 -34.16198 1.000 32.08263  ? 252 LEU B N   1 
ATOM   4841 C CA  . LEU B  1 275 ? -56.49725 37.25510 -34.17038 1.000 33.16946  ? 252 LEU B CA  1 
ATOM   4842 C C   . LEU B  1 275 ? -57.08655 37.30501 -35.58445 1.000 33.20465  ? 252 LEU B C   1 
ATOM   4843 O O   . LEU B  1 275 ? -58.27910 37.02514 -35.77929 1.000 39.07104  ? 252 LEU B O   1 
ATOM   4844 C CB  . LEU B  1 275 ? -56.53293 38.64400 -33.52693 1.000 32.25886  ? 252 LEU B CB  1 
ATOM   4845 C CG  . LEU B  1 275 ? -57.95034 39.21878 -33.48009 1.000 35.73871  ? 252 LEU B CG  1 
ATOM   4846 C CD1 . LEU B  1 275 ? -58.85946 38.39412 -32.52975 1.000 37.61263  ? 252 LEU B CD1 1 
ATOM   4847 C CD2 . LEU B  1 275 ? -57.95864 40.70652 -33.06329 1.000 35.20083  ? 252 LEU B CD2 1 
ATOM   4848 N N   . ILE B  1 276 ? -56.27405 37.64566 -36.58584 1.000 34.98794  ? 253 ILE B N   1 
ATOM   4849 C CA  . ILE B  1 276 ? -56.78905 37.73004 -37.95450 1.000 35.85619  ? 253 ILE B CA  1 
ATOM   4850 C C   . ILE B  1 276 ? -57.34883 36.38894 -38.42368 1.000 41.16448  ? 253 ILE B C   1 
ATOM   4851 O O   . ILE B  1 276 ? -58.27298 36.34408 -39.25599 1.000 38.76931  ? 253 ILE B O   1 
ATOM   4852 C CB  . ILE B  1 276 ? -55.68700 38.24367 -38.90645 1.000 37.15121  ? 253 ILE B CB  1 
ATOM   4853 C CG1 . ILE B  1 276 ? -56.25803 38.52523 -40.30054 1.000 39.70839  ? 253 ILE B CG1 1 
ATOM   4854 C CG2 . ILE B  1 276 ? -54.55861 37.22219 -39.04200 1.000 36.30100  ? 253 ILE B CG2 1 
ATOM   4855 C CD1 . ILE B  1 276 ? -55.21756 39.15030 -41.27905 1.000 39.03114  ? 253 ILE B CD1 1 
ATOM   4856 N N   . GLY B  1 277 ? -56.80601 35.27657 -37.91912 1.000 37.72698  ? 254 GLY B N   1 
ATOM   4857 C CA  . GLY B  1 277 ? -57.34403 33.98330 -38.30322 1.000 34.97670  ? 254 GLY B CA  1 
ATOM   4858 C C   . GLY B  1 277 ? -58.70270 33.73821 -37.68427 1.000 39.41612  ? 254 GLY B C   1 
ATOM   4859 O O   . GLY B  1 277 ? -59.58704 33.15115 -38.31267 1.000 38.51080  ? 254 GLY B O   1 
ATOM   4860 N N   . LEU B  1 278 ? -58.87968 34.17119 -36.43520 1.000 35.10984  ? 255 LEU B N   1 
ATOM   4861 C CA  . LEU B  1 278 ? -60.20493 34.16606 -35.83723 1.000 40.93479  ? 255 LEU B CA  1 
ATOM   4862 C C   . LEU B  1 278 ? -61.15126 35.06658 -36.60981 1.000 41.18915  ? 255 LEU B C   1 
ATOM   4863 O O   . LEU B  1 278 ? -62.32892 34.72697 -36.78552 1.000 40.82659  ? 255 LEU B O   1 
ATOM   4864 C CB  . LEU B  1 278 ? -60.14512 34.60797 -34.37497 1.000 35.40287  ? 255 LEU B CB  1 
ATOM   4865 C CG  . LEU B  1 278 ? -59.66383 33.65027 -33.28974 1.000 37.07911  ? 255 LEU B CG  1 
ATOM   4866 C CD1 . LEU B  1 278 ? -58.16324 33.51447 -33.31251 1.000 39.37490  ? 255 LEU B CD1 1 
ATOM   4867 C CD2 . LEU B  1 278 ? -60.10850 34.18424 -31.93126 1.000 38.56058  ? 255 LEU B CD2 1 
ATOM   4868 N N   . ALA B  1 279 ? -60.65853 36.22554 -37.07151 1.000 35.40837  ? 256 ALA B N   1 
ATOM   4869 C CA  . ALA B  1 279 ? -61.51651 37.14268 -37.81807 1.000 41.95313  ? 256 ALA B CA  1 
ATOM   4870 C C   . ALA B  1 279 ? -61.99784 36.50053 -39.11159 1.000 43.74683  ? 256 ALA B C   1 
ATOM   4871 O O   . ALA B  1 279 ? -63.15039 36.68733 -39.51456 1.000 46.04850  ? 256 ALA B O   1 
ATOM   4872 C CB  . ALA B  1 279 ? -60.77891 38.45519 -38.11723 1.000 40.50758  ? 256 ALA B CB  1 
ATOM   4873 N N   . LYS B  1 280 ? -61.13118 35.72993 -39.77306 1.000 39.15261  ? 257 LYS B N   1 
ATOM   4874 C CA  . LYS B  1 280 ? -61.53849 35.09286 -41.01708 1.000 43.02492  ? 257 LYS B CA  1 
ATOM   4875 C C   . LYS B  1 280 ? -62.60166 34.02935 -40.74984 1.000 46.58503  ? 257 LYS B C   1 
ATOM   4876 O O   . LYS B  1 280 ? -63.62682 33.97469 -41.43615 1.000 48.51080  ? 257 LYS B O   1 
ATOM   4877 C CB  . LYS B  1 280 ? -60.32256 34.48683 -41.71627 1.000 41.10939  ? 257 LYS B CB  1 
ATOM   4878 C CG  . LYS B  1 280 ? -60.60579 34.01647 -43.13208 1.000 42.88427  ? 257 LYS B CG  1 
ATOM   4879 C CD  . LYS B  1 280 ? -59.34093 33.49424 -43.79469 1.000 47.23375  ? 257 LYS B CD  1 
ATOM   4880 C CE  . LYS B  1 280 ? -59.61782 32.93650 -45.18104 1.000 49.36817  ? 257 LYS B CE  1 
ATOM   4881 N NZ  . LYS B  1 280 ? -60.05774 33.98220 -46.15021 1.000 53.34732  ? 257 LYS B NZ  1 
ATOM   4882 N N   . ARG B  1 281 ? -62.37953 33.19099 -39.73449 1.000 45.42886  ? 258 ARG B N   1 
ATOM   4883 C CA  . ARG B  1 281 ? -63.35290 32.15872 -39.38925 1.000 47.83066  ? 258 ARG B CA  1 
ATOM   4884 C C   . ARG B  1 281 ? -64.68765 32.77753 -38.98366 1.000 44.32347  ? 258 ARG B C   1 
ATOM   4885 O O   . ARG B  1 281 ? -65.75228 32.32551 -39.42545 1.000 45.94774  ? 258 ARG B O   1 
ATOM   4886 C CB  . ARG B  1 281 ? -62.79903 31.28144 -38.26212 1.000 43.72107  ? 258 ARG B CB  1 
ATOM   4887 C CG  . ARG B  1 281 ? -63.81624 30.27256 -37.70967 1.000 50.71537  ? 258 ARG B CG  1 
ATOM   4888 C CD  . ARG B  1 281 ? -63.93711 29.08622 -38.61657 1.000 51.91729  ? 258 ARG B CD  1 
ATOM   4889 N NE  . ARG B  1 281 ? -64.77411 28.01633 -38.07375 1.000 54.22630  ? 258 ARG B NE  1 
ATOM   4890 C CZ  . ARG B  1 281 ? -64.97529 26.87192 -38.72060 1.000 51.56699  ? 258 ARG B CZ  1 
ATOM   4891 N NH1 . ARG B  1 281 ? -64.38254 26.70497 -39.89328 1.000 55.16775  ? 258 ARG B NH1 1 
ATOM   4892 N NH2 . ARG B  1 281 ? -65.76412 25.90999 -38.22209 1.000 39.70452  ? 258 ARG B NH2 1 
ATOM   4893 N N   . PHE B  1 282 ? -64.63959 33.82930 -38.16172 1.000 43.39743  ? 259 PHE B N   1 
ATOM   4894 C CA  . PHE B  1 282 ? -65.84702 34.43171 -37.61221 1.000 46.94643  ? 259 PHE B CA  1 
ATOM   4895 C C   . PHE B  1 282 ? -66.77071 34.94451 -38.70738 1.000 52.19692  ? 259 PHE B C   1 
ATOM   4896 O O   . PHE B  1 282 ? -67.99697 34.80316 -38.61090 1.000 53.90643  ? 259 PHE B O   1 
ATOM   4897 C CB  . PHE B  1 282 ? -65.47530 35.56992 -36.66388 1.000 46.41082  ? 259 PHE B CB  1 
ATOM   4898 C CG  . PHE B  1 282 ? -66.58460 35.95767 -35.72997 1.000 56.51477  ? 259 PHE B CG  1 
ATOM   4899 C CD1 . PHE B  1 282 ? -66.87775 35.17289 -34.60724 1.000 59.68936  ? 259 PHE B CD1 1 
ATOM   4900 C CD2 . PHE B  1 282 ? -67.34335 37.09210 -35.96731 1.000 59.88149  ? 259 PHE B CD2 1 
ATOM   4901 C CE1 . PHE B  1 282 ? -67.90729 35.51957 -33.73235 1.000 60.60932  ? 259 PHE B CE1 1 
ATOM   4902 C CE2 . PHE B  1 282 ? -68.37707 37.45085 -35.09958 1.000 63.23192  ? 259 PHE B CE2 1 
ATOM   4903 C CZ  . PHE B  1 282 ? -68.65993 36.66001 -33.98463 1.000 65.36127  ? 259 PHE B CZ  1 
ATOM   4904 N N   . LYS B  1 283 ? -66.19807 35.55522 -39.74710 1.000 53.00403  ? 260 LYS B N   1 
ATOM   4905 C CA  . LYS B  1 283 ? -66.99646 36.05584 -40.86103 1.000 62.89233  ? 260 LYS B CA  1 
ATOM   4906 C C   . LYS B  1 283 ? -67.84792 34.94272 -41.47580 1.000 65.23061  ? 260 LYS B C   1 
ATOM   4907 O O   . LYS B  1 283 ? -69.01619 35.16246 -41.81582 1.000 66.97091  ? 260 LYS B O   1 
ATOM   4908 C CB  . LYS B  1 283 ? -66.06504 36.69272 -41.90237 1.000 64.84405  ? 260 LYS B CB  1 
ATOM   4909 C CG  . LYS B  1 283 ? -66.72432 37.55923 -42.96967 1.000 75.07466  ? 260 LYS B CG  1 
ATOM   4910 C CD  . LYS B  1 283 ? -67.46440 36.75828 -44.06504 1.000 88.13588  ? 260 LYS B CD  1 
ATOM   4911 C CE  . LYS B  1 283 ? -66.62139 35.62329 -44.66849 1.000 90.57243  ? 260 LYS B CE  1 
ATOM   4912 N NZ  . LYS B  1 283 ? -67.43965 34.64476 -45.46702 1.000 90.17457  ? 260 LYS B NZ  1 
ATOM   4913 N N   . GLU B  1 284 ? -67.27864 33.74300 -41.61881 1.000 63.62447  ? 261 GLU B N   1 
ATOM   4914 C CA  . GLU B  1 284 ? -67.93869 32.58804 -42.21616 1.000 70.44603  ? 261 GLU B CA  1 
ATOM   4915 C C   . GLU B  1 284 ? -68.82136 31.83354 -41.22876 1.000 67.82453  ? 261 GLU B C   1 
ATOM   4916 O O   . GLU B  1 284 ? -69.92518 31.40957 -41.58433 1.000 67.85148  ? 261 GLU B O   1 
ATOM   4917 C CB  . GLU B  1 284 ? -66.89561 31.62101 -42.78524 1.000 81.42634  ? 261 GLU B CB  1 
ATOM   4918 C CG  . GLU B  1 284 ? -66.02521 32.20594 -43.88912 1.000 95.33328  ? 261 GLU B CG  1 
ATOM   4919 C CD  . GLU B  1 284 ? -64.56761 31.77442 -43.78244 1.000 102.76216 ? 261 GLU B CD  1 
ATOM   4920 O OE1 . GLU B  1 284 ? -64.21618 31.10101 -42.78656 1.000 105.73768 ? 261 GLU B OE1 1 
ATOM   4921 O OE2 . GLU B  1 284 ? -63.77390 32.11103 -44.69124 1.000 104.53112 ? 261 GLU B OE2 1 
ATOM   4922 N N   . SER B  1 285 ? -68.35888 31.64786 -39.99150 1.000 56.88929  ? 262 SER B N   1 
ATOM   4923 C CA  . SER B  1 285 ? -69.05914 30.78126 -39.08530 1.000 51.77343  ? 262 SER B CA  1 
ATOM   4924 C C   . SER B  1 285 ? -68.83814 31.22150 -37.64459 1.000 51.10192  ? 262 SER B C   1 
ATOM   4925 O O   . SER B  1 285 ? -67.68036 31.30933 -37.21874 1.000 47.76382  ? 262 SER B O   1 
ATOM   4926 C CB  . SER B  1 285 ? -68.56824 29.34916 -39.27767 1.000 54.81950  ? 262 SER B CB  1 
ATOM   4927 O OG  . SER B  1 285 ? -69.39980 28.45555 -38.59292 1.000 62.74354  ? 262 SER B OG  1 
ATOM   4928 N N   . PRO B  1 286 ? -69.89283 31.47131 -36.87222 1.000 55.54755  ? 263 PRO B N   1 
ATOM   4929 C CA  . PRO B  1 286 ? -69.70763 32.03888 -35.53316 1.000 51.53135  ? 263 PRO B CA  1 
ATOM   4930 C C   . PRO B  1 286 ? -69.16956 31.02887 -34.53434 1.000 48.63993  ? 263 PRO B C   1 
ATOM   4931 O O   . PRO B  1 286 ? -69.37037 29.81432 -34.65353 1.000 44.59893  ? 263 PRO B O   1 
ATOM   4932 C CB  . PRO B  1 286 ? -71.12433 32.46662 -35.13881 1.000 53.73495  ? 263 PRO B CB  1 
ATOM   4933 C CG  . PRO B  1 286 ? -71.97635 31.39097 -35.77158 1.000 59.33786  ? 263 PRO B CG  1 
ATOM   4934 C CD  . PRO B  1 286 ? -71.30592 31.11746 -37.11935 1.000 62.26551  ? 263 PRO B CD  1 
ATOM   4935 N N   . PHE B  1 287 ? -68.48729 31.56155 -33.51990 1.000 43.85044  ? 264 PHE B N   1 
ATOM   4936 C CA  . PHE B  1 287 ? -68.01935 30.74841 -32.41195 1.000 38.06826  ? 264 PHE B CA  1 
ATOM   4937 C C   . PHE B  1 287 ? -68.05278 31.58544 -31.14127 1.000 40.93492  ? 264 PHE B C   1 
ATOM   4938 O O   . PHE B  1 287 ? -68.21464 32.80670 -31.17898 1.000 44.88569  ? 264 PHE B O   1 
ATOM   4939 C CB  . PHE B  1 287 ? -66.62574 30.18792 -32.68017 1.000 37.18803  ? 264 PHE B CB  1 
ATOM   4940 C CG  . PHE B  1 287 ? -65.60745 31.23417 -33.06500 1.000 41.15400  ? 264 PHE B CG  1 
ATOM   4941 C CD1 . PHE B  1 287 ? -65.02818 32.04251 -32.10211 1.000 41.90778  ? 264 PHE B CD1 1 
ATOM   4942 C CD2 . PHE B  1 287 ? -65.21722 31.39495 -34.38900 1.000 43.55809  ? 264 PHE B CD2 1 
ATOM   4943 C CE1 . PHE B  1 287 ? -64.09399 33.01555 -32.44999 1.000 43.24531  ? 264 PHE B CE1 1 
ATOM   4944 C CE2 . PHE B  1 287 ? -64.27040 32.34937 -34.73812 1.000 44.48388  ? 264 PHE B CE2 1 
ATOM   4945 C CZ  . PHE B  1 287 ? -63.70653 33.15282 -33.76887 1.000 43.44091  ? 264 PHE B CZ  1 
ATOM   4946 N N   . GLU B  1 288 ? -67.90537 30.90050 -30.01260 1.000 38.11002  ? 265 GLU B N   1 
ATOM   4947 C CA  . GLU B  1 288 ? -67.97412 31.49064 -28.68409 1.000 41.40863  ? 265 GLU B CA  1 
ATOM   4948 C C   . GLU B  1 288 ? -66.56207 31.63392 -28.12716 1.000 38.69363  ? 265 GLU B C   1 
ATOM   4949 O O   . GLU B  1 288 ? -65.76951 30.69199 -28.21185 1.000 37.64692  ? 265 GLU B O   1 
ATOM   4950 C CB  . GLU B  1 288 ? -68.81853 30.59265 -27.77925 1.000 43.36238  ? 265 GLU B CB  1 
ATOM   4951 C CG  . GLU B  1 288 ? -69.06331 31.10221 -26.37982 1.000 59.77901  ? 265 GLU B CG  1 
ATOM   4952 C CD  . GLU B  1 288 ? -70.25834 32.04521 -26.34003 1.000 75.31914  ? 265 GLU B CD  1 
ATOM   4953 O OE1 . GLU B  1 288 ? -70.10909 33.16705 -25.79110 1.000 76.02312  ? 265 GLU B OE1 1 
ATOM   4954 O OE2 . GLU B  1 288 ? -71.33122 31.66098 -26.88330 1.000 76.73873  ? 265 GLU B OE2 1 
ATOM   4955 N N   . LEU B  1 289 ? -66.23974 32.81042 -27.57296 1.000 36.83713  ? 266 LEU B N   1 
ATOM   4956 C CA  . LEU B  1 289 ? -64.95020 33.05515 -26.92073 1.000 35.78395  ? 266 LEU B CA  1 
ATOM   4957 C C   . LEU B  1 289 ? -65.23149 33.39301 -25.46944 1.000 39.71208  ? 266 LEU B C   1 
ATOM   4958 O O   . LEU B  1 289 ? -65.77953 34.46015 -25.18060 1.000 38.56227  ? 266 LEU B O   1 
ATOM   4959 C CB  . LEU B  1 289 ? -64.18255 34.20913 -27.56556 1.000 40.31447  ? 266 LEU B CB  1 
ATOM   4960 C CG  . LEU B  1 289 ? -63.38013 34.02444 -28.84056 1.000 42.71432  ? 266 LEU B CG  1 
ATOM   4961 C CD1 . LEU B  1 289 ? -62.60933 35.30985 -29.13661 1.000 39.00479  ? 266 LEU B CD1 1 
ATOM   4962 C CD2 . LEU B  1 289 ? -62.43625 32.82650 -28.70906 1.000 39.22843  ? 266 LEU B CD2 1 
ATOM   4963 N N   . GLU B  1 290 ? -64.86794 32.51295 -24.54658 1.000 33.60963  ? 267 GLU B N   1 
ATOM   4964 C CA  . GLU B  1 290 ? -65.04263 32.84922 -23.14443 1.000 35.48788  ? 267 GLU B CA  1 
ATOM   4965 C C   . GLU B  1 290 ? -63.75248 33.48595 -22.62951 1.000 33.80207  ? 267 GLU B C   1 
ATOM   4966 O O   . GLU B  1 290 ? -62.70513 32.83030 -22.57682 1.000 30.02055  ? 267 GLU B O   1 
ATOM   4967 C CB  . GLU B  1 290 ? -65.42950 31.63854 -22.30953 1.000 36.70305  ? 267 GLU B CB  1 
ATOM   4968 C CG  . GLU B  1 290 ? -65.71301 32.06353 -20.89272 1.000 40.95260  ? 267 GLU B CG  1 
ATOM   4969 C CD  . GLU B  1 290 ? -65.94046 30.88368 -19.98380 1.000 55.20578  ? 267 GLU B CD  1 
ATOM   4970 O OE1 . GLU B  1 290 ? -66.33200 29.79797 -20.49109 1.000 53.54375  ? 267 GLU B OE1 1 
ATOM   4971 O OE2 . GLU B  1 290 ? -65.71254 31.04892 -18.76716 1.000 57.25971  ? 267 GLU B OE2 1 
ATOM   4972 N N   . ASP B  1 291 ? -63.84450 34.76592 -22.25218 1.000 31.59800  ? 268 ASP B N   1 
ATOM   4973 C CA  . ASP B  1 291 ? -62.70894 35.56420 -21.77723 1.000 32.91729  ? 268 ASP B CA  1 
ATOM   4974 C C   . ASP B  1 291 ? -62.62088 35.37417 -20.26164 1.000 37.58281  ? 268 ASP B C   1 
ATOM   4975 O O   . ASP B  1 291 ? -63.14773 36.16628 -19.47097 1.000 34.98827  ? 268 ASP B O   1 
ATOM   4976 C CB  . ASP B  1 291 ? -62.92090 37.02302 -22.18927 1.000 33.40543  ? 268 ASP B CB  1 
ATOM   4977 C CG  . ASP B  1 291 ? -61.75713 37.94853 -21.81290 1.000 34.24841  ? 268 ASP B CG  1 
ATOM   4978 O OD1 . ASP B  1 291 ? -60.72763 37.49281 -21.27509 1.000 30.09149  ? 268 ASP B OD1 1 
ATOM   4979 O OD2 . ASP B  1 291 ? -61.89966 39.15804 -22.07584 1.000 34.73993  ? 268 ASP B OD2 1 
ATOM   4980 N N   . PHE B  1 292 ? -61.98004 34.26458 -19.84068 1.000 32.02824  ? 269 PHE B N   1 
ATOM   4981 C CA  . PHE B  1 292 ? -62.14987 33.85282 -18.44249 1.000 32.38634  ? 269 PHE B CA  1 
ATOM   4982 C C   . PHE B  1 292 ? -61.19081 34.55047 -17.48528 1.000 34.72556  ? 269 PHE B C   1 
ATOM   4983 O O   . PHE B  1 292 ? -61.37332 34.42815 -16.27264 1.000 30.47417  ? 269 PHE B O   1 
ATOM   4984 C CB  . PHE B  1 292 ? -62.05386 32.30880 -18.27135 1.000 28.56476  ? 269 PHE B CB  1 
ATOM   4985 C CG  . PHE B  1 292 ? -60.78552 31.69908 -18.80575 1.000 29.61923  ? 269 PHE B CG  1 
ATOM   4986 C CD1 . PHE B  1 292 ? -60.73852 31.18830 -20.11018 1.000 33.78174  ? 269 PHE B CD1 1 
ATOM   4987 C CD2 . PHE B  1 292 ? -59.64081 31.60556 -18.01143 1.000 30.49580  ? 269 PHE B CD2 1 
ATOM   4988 C CE1 . PHE B  1 292 ? -59.54610 30.59401 -20.62576 1.000 33.22447  ? 269 PHE B CE1 1 
ATOM   4989 C CE2 . PHE B  1 292 ? -58.45123 31.02636 -18.51266 1.000 32.99416  ? 269 PHE B CE2 1 
ATOM   4990 C CZ  . PHE B  1 292 ? -58.39351 30.52104 -19.82931 1.000 31.09234  ? 269 PHE B CZ  1 
ATOM   4991 N N   . ILE B  1 293 ? -60.21286 35.30939 -17.98061 1.000 30.25490  ? 270 ILE B N   1 
ATOM   4992 C CA  . ILE B  1 293 ? -59.45167 36.25430 -17.15457 1.000 29.42298  ? 270 ILE B CA  1 
ATOM   4993 C C   . ILE B  1 293 ? -59.60023 37.61301 -17.82912 1.000 31.05589  ? 270 ILE B C   1 
ATOM   4994 O O   . ILE B  1 293 ? -58.75026 37.97912 -18.65750 1.000 32.85710  ? 270 ILE B O   1 
ATOM   4995 C CB  . ILE B  1 293 ? -57.96249 35.89146 -17.05514 1.000 35.97397  ? 270 ILE B CB  1 
ATOM   4996 C CG1 . ILE B  1 293 ? -57.76499 34.42672 -16.71202 1.000 39.20388  ? 270 ILE B CG1 1 
ATOM   4997 C CG2 . ILE B  1 293 ? -57.25422 36.77980 -16.03823 1.000 40.71633  ? 270 ILE B CG2 1 
ATOM   4998 C CD1 . ILE B  1 293 ? -56.36570 33.92333 -17.10495 1.000 46.71685  ? 270 ILE B CD1 1 
ATOM   4999 N N   . PRO B  1 294 ? -60.67288 38.35893 -17.56146 1.000 28.39415  ? 271 PRO B N   1 
ATOM   5000 C CA  . PRO B  1 294 ? -60.93056 39.58877 -18.33430 1.000 32.16730  ? 271 PRO B CA  1 
ATOM   5001 C C   . PRO B  1 294 ? -60.04561 40.76028 -17.91856 1.000 35.13932  ? 271 PRO B C   1 
ATOM   5002 O O   . PRO B  1 294 ? -60.32307 41.47848 -16.96255 1.000 35.01809  ? 271 PRO B O   1 
ATOM   5003 C CB  . PRO B  1 294 ? -62.41885 39.86262 -18.06942 1.000 34.74152  ? 271 PRO B CB  1 
ATOM   5004 C CG  . PRO B  1 294 ? -62.69322 39.21561 -16.72702 1.000 33.19962  ? 271 PRO B CG  1 
ATOM   5005 C CD  . PRO B  1 294 ? -61.79450 37.99067 -16.67363 1.000 31.22312  ? 271 PRO B CD  1 
ATOM   5006 N N   . MET B  1 295 ? -58.96799 40.97604 -18.65357 1.000 33.33776  ? 272 MET B N   1 
ATOM   5007 C CA  . MET B  1 295 ? -58.04771 42.06726 -18.37111 1.000 32.64703  ? 272 MET B CA  1 
ATOM   5008 C C   . MET B  1 295 ? -57.30028 42.33508 -19.66361 1.000 28.68883  ? 272 MET B C   1 
ATOM   5009 O O   . MET B  1 295 ? -57.32786 41.52457 -20.58989 1.000 34.10965  ? 272 MET B O   1 
ATOM   5010 C CB  . MET B  1 295 ? -57.06459 41.71171 -17.25548 1.000 32.73769  ? 272 MET B CB  1 
ATOM   5011 C CG  . MET B  1 295 ? -56.22381 40.51480 -17.66312 1.000 38.87214  ? 272 MET B CG  1 
ATOM   5012 S SD  . MET B  1 295 ? -55.10265 39.95196 -16.37417 1.000 42.33001  ? 272 MET B SD  1 
ATOM   5013 C CE  . MET B  1 295 ? -53.89287 41.28617 -16.30120 1.000 42.80415  ? 272 MET B CE  1 
ATOM   5014 N N   . ASP B  1 296 ? -56.65539 43.48065 -19.72029 1.000 25.90460  ? 273 ASP B N   1 
ATOM   5015 C CA  . ASP B  1 296 ? -55.86996 43.84534 -20.89396 1.000 35.51022  ? 273 ASP B CA  1 
ATOM   5016 C C   . ASP B  1 296 ? -54.53937 43.10071 -20.83426 1.000 35.93004  ? 273 ASP B C   1 
ATOM   5017 O O   . ASP B  1 296 ? -53.84881 43.15288 -19.81475 1.000 33.33192  ? 273 ASP B O   1 
ATOM   5018 C CB  . ASP B  1 296 ? -55.63028 45.35451 -20.91151 1.000 31.25395  ? 273 ASP B CB  1 
ATOM   5019 C CG  . ASP B  1 296 ? -55.32070 45.89969 -22.30434 1.000 37.34572  ? 273 ASP B CG  1 
ATOM   5020 O OD1 . ASP B  1 296 ? -55.72296 45.25828 -23.30908 1.000 34.97432  ? 273 ASP B OD1 1 
ATOM   5021 O OD2 . ASP B  1 296 ? -54.67931 46.99385 -22.37913 1.000 34.57438  ? 273 ASP B OD2 1 
ATOM   5022 N N   . SER B  1 297 ? -54.17286 42.42311 -21.91681 1.000 31.08127  ? 274 SER B N   1 
ATOM   5023 C CA  . SER B  1 297 ? -52.95537 41.61732 -21.89339 1.000 28.06245  ? 274 SER B CA  1 
ATOM   5024 C C   . SER B  1 297 ? -52.41993 41.44756 -23.31074 1.000 27.12651  ? 274 SER B C   1 
ATOM   5025 O O   . SER B  1 297 ? -53.21065 41.29167 -24.24354 1.000 29.42582  ? 274 SER B O   1 
ATOM   5026 C CB  . SER B  1 297 ? -53.26874 40.25277 -21.25606 1.000 33.61706  ? 274 SER B CB  1 
ATOM   5027 O OG  . SER B  1 297 ? -52.08734 39.56705 -20.96330 1.000 45.71948  ? 274 SER B OG  1 
ATOM   5028 N N   . THR B  1 298 ? -51.07665 41.42320 -23.46362 1.000 25.96011  ? 275 THR B N   1 
ATOM   5029 C CA  . THR B  1 298 ? -50.46758 41.24630 -24.78693 1.000 23.59851  ? 275 THR B CA  1 
ATOM   5030 C C   . THR B  1 298 ? -50.93460 39.94842 -25.43645 1.000 29.26807  ? 275 THR B C   1 
ATOM   5031 O O   . THR B  1 298 ? -51.28717 39.92350 -26.62141 1.000 31.60962  ? 275 THR B O   1 
ATOM   5032 C CB  . THR B  1 298 ? -48.93011 41.29167 -24.66607 1.000 25.73625  ? 275 THR B CB  1 
ATOM   5033 O OG1 . THR B  1 298 ? -48.55676 42.62552 -24.31553 1.000 28.89056  ? 275 THR B OG1 1 
ATOM   5034 C CG2 . THR B  1 298 ? -48.22670 40.92264 -25.99151 1.000 27.40298  ? 275 THR B CG2 1 
ATOM   5035 N N   . VAL B  1 299 ? -50.98389 38.86774 -24.67111 1.000 27.71703  ? 276 VAL B N   1 
ATOM   5036 C CA  . VAL B  1 299 ? -51.55774 37.60345 -25.11929 1.000 29.26921  ? 276 VAL B CA  1 
ATOM   5037 C C   . VAL B  1 299 ? -52.82138 37.36816 -24.30740 1.000 30.12699  ? 276 VAL B C   1 
ATOM   5038 O O   . VAL B  1 299 ? -52.80555 37.50649 -23.07700 1.000 29.32380  ? 276 VAL B O   1 
ATOM   5039 C CB  . VAL B  1 299 ? -50.57390 36.42813 -24.94387 1.000 30.49776  ? 276 VAL B CB  1 
ATOM   5040 C CG1 . VAL B  1 299 ? -51.25072 35.10878 -25.35980 1.000 31.04376  ? 276 VAL B CG1 1 
ATOM   5041 C CG2 . VAL B  1 299 ? -49.30006 36.66447 -25.73793 1.000 32.81866  ? 276 VAL B CG2 1 
ATOM   5042 N N   . LYS B  1 300 ? -53.90948 37.01770 -24.98296 1.000 29.10988  ? 277 LYS B N   1 
ATOM   5043 C CA  . LYS B  1 300 ? -55.16208 36.69774 -24.30781 1.000 30.09754  ? 277 LYS B CA  1 
ATOM   5044 C C   . LYS B  1 300 ? -55.40573 35.19373 -24.40007 1.000 30.90485  ? 277 LYS B C   1 
ATOM   5045 O O   . LYS B  1 300 ? -55.05204 34.56962 -25.39776 1.000 33.09014  ? 277 LYS B O   1 
ATOM   5046 C CB  . LYS B  1 300 ? -56.33579 37.46105 -24.94236 1.000 27.73556  ? 277 LYS B CB  1 
ATOM   5047 C CG  . LYS B  1 300 ? -56.27592 38.97532 -24.72604 1.000 30.62508  ? 277 LYS B CG  1 
ATOM   5048 C CD  . LYS B  1 300 ? -56.63073 39.30093 -23.24560 1.000 28.71375  ? 277 LYS B CD  1 
ATOM   5049 C CE  . LYS B  1 300 ? -58.04485 38.82104 -22.90408 1.000 32.36523  ? 277 LYS B CE  1 
ATOM   5050 N NZ  . LYS B  1 300 ? -58.29318 38.91415 -21.43898 1.000 33.02140  ? 277 LYS B NZ  1 
ATOM   5051 N N   . ASN B  1 301 ? -56.03620 34.62273 -23.37231 1.000 30.84443  ? 278 ASN B N   1 
ATOM   5052 C CA  . ASN B  1 301 ? -56.42468 33.21228 -23.35349 1.000 29.53461  ? 278 ASN B CA  1 
ATOM   5053 C C   . ASN B  1 301 ? -57.94904 33.10416 -23.35388 1.000 32.11231  ? 278 ASN B C   1 
ATOM   5054 O O   . ASN B  1 301 ? -58.61167 33.71568 -22.50758 1.000 27.43865  ? 278 ASN B O   1 
ATOM   5055 C CB  . ASN B  1 301 ? -55.87633 32.50597 -22.10698 1.000 28.04234  ? 278 ASN B CB  1 
ATOM   5056 C CG  . ASN B  1 301 ? -54.36012 32.23412 -22.18478 1.000 41.60605  ? 278 ASN B CG  1 
ATOM   5057 O OD1 . ASN B  1 301 ? -53.80483 32.02747 -23.25651 1.000 40.07620  ? 278 ASN B OD1 1 
ATOM   5058 N ND2 . ASN B  1 301 ? -53.70794 32.20351 -21.02648 1.000 46.75242  ? 278 ASN B ND2 1 
ATOM   5059 N N   . TYR B  1 302 ? -58.49188 32.27615 -24.23973 1.000 27.92457  ? 279 TYR B N   1 
ATOM   5060 C CA  . TYR B  1 302 ? -59.93332 32.08853 -24.32700 1.000 31.11853  ? 279 TYR B CA  1 
ATOM   5061 C C   . TYR B  1 302 ? -60.28149 30.61274 -24.31003 1.000 29.80293  ? 279 TYR B C   1 
ATOM   5062 O O   . TYR B  1 302 ? -59.54184 29.77294 -24.83320 1.000 28.22250  ? 279 TYR B O   1 
ATOM   5063 C CB  . TYR B  1 302 ? -60.52127 32.67822 -25.61686 1.000 28.37215  ? 279 TYR B CB  1 
ATOM   5064 C CG  . TYR B  1 302 ? -60.26765 34.15719 -25.79014 1.000 33.48211  ? 279 TYR B CG  1 
ATOM   5065 C CD1 . TYR B  1 302 ? -61.04127 35.11922 -25.10691 1.000 29.50921  ? 279 TYR B CD1 1 
ATOM   5066 C CD2 . TYR B  1 302 ? -59.26198 34.60886 -26.65780 1.000 28.93547  ? 279 TYR B CD2 1 
ATOM   5067 C CE1 . TYR B  1 302 ? -60.78985 36.50327 -25.30641 1.000 28.80691  ? 279 TYR B CE1 1 
ATOM   5068 C CE2 . TYR B  1 302 ? -59.01294 35.97932 -26.84047 1.000 27.09440  ? 279 TYR B CE2 1 
ATOM   5069 C CZ  . TYR B  1 302 ? -59.78641 36.89903 -26.18490 1.000 29.76382  ? 279 TYR B CZ  1 
ATOM   5070 O OH  . TYR B  1 302 ? -59.52008 38.23708 -26.37646 1.000 32.68247  ? 279 TYR B OH  1 
ATOM   5071 N N   . PHE B  1 303 ? -61.43931 30.31799 -23.74201 1.000 26.57084  ? 280 PHE B N   1 
ATOM   5072 C CA  . PHE B  1 303 ? -62.07285 29.00481 -23.87892 1.000 27.14286  ? 280 PHE B CA  1 
ATOM   5073 C C   . PHE B  1 303 ? -62.98190 29.13330 -25.09875 1.000 31.07683  ? 280 PHE B C   1 
ATOM   5074 O O   . PHE B  1 303 ? -64.00384 29.82691 -25.04541 1.000 29.67491  ? 280 PHE B O   1 
ATOM   5075 C CB  . PHE B  1 303 ? -62.82523 28.68321 -22.58567 1.000 30.50173  ? 280 PHE B CB  1 
ATOM   5076 C CG  . PHE B  1 303 ? -63.34576 27.26595 -22.46260 1.000 31.24728  ? 280 PHE B CG  1 
ATOM   5077 C CD1 . PHE B  1 303 ? -63.71428 26.51525 -23.56548 1.000 27.77528  ? 280 PHE B CD1 1 
ATOM   5078 C CD2 . PHE B  1 303 ? -63.48460 26.70935 -21.20737 1.000 31.96143  ? 280 PHE B CD2 1 
ATOM   5079 C CE1 . PHE B  1 303 ? -64.23205 25.18986 -23.42916 1.000 32.35974  ? 280 PHE B CE1 1 
ATOM   5080 C CE2 . PHE B  1 303 ? -63.97695 25.40572 -21.05206 1.000 34.62699  ? 280 PHE B CE2 1 
ATOM   5081 C CZ  . PHE B  1 303 ? -64.36153 24.64437 -22.17424 1.000 30.41934  ? 280 PHE B CZ  1 
ATOM   5082 N N   . ILE B  1 304 ? -62.57937 28.53213 -26.22059 1.000 28.28229  ? 281 ILE B N   1 
ATOM   5083 C CA  . ILE B  1 304 ? -63.25725 28.72578 -27.49769 1.000 28.59586  ? 281 ILE B CA  1 
ATOM   5084 C C   . ILE B  1 304 ? -64.08333 27.48346 -27.84363 1.000 32.35725  ? 281 ILE B C   1 
ATOM   5085 O O   . ILE B  1 304 ? -63.62806 26.34491 -27.65835 1.000 28.07168  ? 281 ILE B O   1 
ATOM   5086 C CB  . ILE B  1 304 ? -62.25133 29.05475 -28.61642 1.000 29.23349  ? 281 ILE B CB  1 
ATOM   5087 C CG1 . ILE B  1 304 ? -62.98103 29.17978 -29.95170 1.000 29.50807  ? 281 ILE B CG1 1 
ATOM   5088 C CG2 . ILE B  1 304 ? -61.19012 27.96772 -28.71742 1.000 32.73702  ? 281 ILE B CG2 1 
ATOM   5089 C CD1 . ILE B  1 304 ? -62.13328 29.69966 -31.08208 1.000 39.36226  ? 281 ILE B CD1 1 
ATOM   5090 N N   . THR B  1 305 ? -65.30603 27.70865 -28.33552 1.000 27.40812  ? 282 THR B N   1 
ATOM   5091 C CA  . THR B  1 305 ? -66.18953 26.63726 -28.80582 1.000 28.14399  ? 282 THR B CA  1 
ATOM   5092 C C   . THR B  1 305 ? -66.69293 27.01569 -30.18704 1.000 31.07834  ? 282 THR B C   1 
ATOM   5093 O O   . THR B  1 305 ? -67.34976 28.05215 -30.34049 1.000 35.08670  ? 282 THR B O   1 
ATOM   5094 C CB  . THR B  1 305 ? -67.38698 26.43168 -27.85431 1.000 28.90752  ? 282 THR B CB  1 
ATOM   5095 O OG1 . THR B  1 305 ? -66.89766 26.15577 -26.54171 1.000 31.94112  ? 282 THR B OG1 1 
ATOM   5096 C CG2 . THR B  1 305 ? -68.27532 25.25970 -28.30756 1.000 28.18221  ? 282 THR B CG2 1 
ATOM   5097 N N   . ASP B  1 306 ? -66.41962 26.17478 -31.18080 1.000 30.70312  ? 283 ASP B N   1 
ATOM   5098 C CA  . ASP B  1 306 ? -66.86509 26.45437 -32.54026 1.000 30.88366  ? 283 ASP B CA  1 
ATOM   5099 C C   . ASP B  1 306 ? -68.30420 25.98984 -32.72785 1.000 38.12448  ? 283 ASP B C   1 
ATOM   5100 O O   . ASP B  1 306 ? -68.60353 24.80630 -32.53173 1.000 34.73258  ? 283 ASP B O   1 
ATOM   5101 C CB  . ASP B  1 306 ? -65.96401 25.75737 -33.54061 1.000 33.19498  ? 283 ASP B CB  1 
ATOM   5102 C CG  . ASP B  1 306 ? -66.32945 26.10896 -34.96076 1.000 42.63663  ? 283 ASP B CG  1 
ATOM   5103 O OD1 . ASP B  1 306 ? -66.21335 27.30758 -35.30418 1.000 46.85531  ? 283 ASP B OD1 1 
ATOM   5104 O OD2 . ASP B  1 306 ? -66.73773 25.20073 -35.71386 1.000 40.09412  ? 283 ASP B OD2 1 
ATOM   5105 N N   . ALA B  1 307 ? -69.19620 26.91161 -33.11645 1.000 35.39673  ? 284 ALA B N   1 
ATOM   5106 C CA  . ALA B  1 307 ? -70.61580 26.56446 -33.13994 1.000 34.76364  ? 284 ALA B CA  1 
ATOM   5107 C C   . ALA B  1 307 ? -70.95098 25.60485 -34.27420 1.000 38.13671  ? 284 ALA B C   1 
ATOM   5108 O O   . ALA B  1 307 ? -71.89207 24.80766 -34.15391 1.000 42.65170  ? 284 ALA B O   1 
ATOM   5109 C CB  . ALA B  1 307 ? -71.47919 27.83169 -33.23808 1.000 33.30655  ? 284 ALA B CB  1 
ATOM   5110 N N   . GLN B  1 308 ? -70.21555 25.66370 -35.38420 1.000 37.12914  ? 285 GLN B N   1 
ATOM   5111 C CA  . GLN B  1 308 ? -70.55726 24.80786 -36.51809 1.000 37.56630  ? 285 GLN B CA  1 
ATOM   5112 C C   . GLN B  1 308 ? -70.13630 23.35562 -36.29542 1.000 40.09552  ? 285 GLN B C   1 
ATOM   5113 O O   . GLN B  1 308 ? -70.90159 22.43652 -36.61942 1.000 41.71074  ? 285 GLN B O   1 
ATOM   5114 C CB  . GLN B  1 308 ? -69.92745 25.35201 -37.80828 1.000 40.66030  ? 285 GLN B CB  1 
ATOM   5115 C CG  . GLN B  1 308 ? -70.24408 24.50311 -39.05639 1.000 49.64931  ? 285 GLN B CG  1 
ATOM   5116 C CD  . GLN B  1 308 ? -71.72371 24.47405 -39.39862 1.000 50.92384  ? 285 GLN B CD  1 
ATOM   5117 O OE1 . GLN B  1 308 ? -72.39092 25.50083 -39.38897 1.000 50.28470  ? 285 GLN B OE1 1 
ATOM   5118 N NE2 . GLN B  1 308 ? -72.24503 23.28424 -39.69729 1.000 53.71325  ? 285 GLN B NE2 1 
ATOM   5119 N N   . THR B  1 309 ? -68.92720 23.11636 -35.76308 1.000 38.66858  ? 286 THR B N   1 
ATOM   5120 C CA  . THR B  1 309 ? -68.38794 21.75182 -35.67161 1.000 37.31129  ? 286 THR B CA  1 
ATOM   5121 C C   . THR B  1 309 ? -68.43172 21.14958 -34.26935 1.000 34.93185  ? 286 THR B C   1 
ATOM   5122 O O   . THR B  1 309 ? -68.43135 19.91420 -34.13847 1.000 36.25045  ? 286 THR B O   1 
ATOM   5123 C CB  . THR B  1 309 ? -66.92033 21.70287 -36.12006 1.000 35.14040  ? 286 THR B CB  1 
ATOM   5124 O OG1 . THR B  1 309 ? -66.13700 22.44130 -35.17893 1.000 33.79284  ? 286 THR B OG1 1 
ATOM   5125 C CG2 . THR B  1 309 ? -66.72049 22.27461 -37.54035 1.000 34.46928  ? 286 THR B CG2 1 
ATOM   5126 N N   . GLY B  1 310 ? -68.44641 21.96902 -33.22347 1.000 33.26259  ? 287 GLY B N   1 
ATOM   5127 C CA  . GLY B  1 310 ? -68.25548 21.44091 -31.88463 1.000 29.34839  ? 287 GLY B CA  1 
ATOM   5128 C C   . GLY B  1 310 ? -66.81166 21.27436 -31.46151 1.000 32.91759  ? 287 GLY B C   1 
ATOM   5129 O O   . GLY B  1 310 ? -66.55451 20.87906 -30.30902 1.000 35.10833  ? 287 GLY B O   1 
ATOM   5130 N N   . SER B  1 311 ? -65.85806 21.56016 -32.34485 1.000 31.63384  ? 288 SER B N   1 
ATOM   5131 C CA  . SER B  1 311 ? -64.45918 21.64388 -31.92838 1.000 36.50324  ? 288 SER B CA  1 
ATOM   5132 C C   . SER B  1 311 ? -64.27930 22.73495 -30.86240 1.000 32.54851  ? 288 SER B C   1 
ATOM   5133 O O   . SER B  1 311 ? -64.84203 23.83925 -30.97130 1.000 33.85989  ? 288 SER B O   1 
ATOM   5134 C CB  . SER B  1 311 ? -63.58143 21.92403 -33.15516 1.000 35.25887  ? 288 SER B CB  1 
ATOM   5135 O OG  . SER B  1 311 ? -62.23309 21.63828 -32.86358 1.000 39.80558  ? 288 SER B OG  1 
ATOM   5136 N N   . SER B  1 312 ? -63.51540 22.42306 -29.80801 1.000 29.91768  ? 289 SER B N   1 
ATOM   5137 C CA  . SER B  1 312 ? -63.31486 23.38737 -28.72427 1.000 30.88664  ? 289 SER B CA  1 
ATOM   5138 C C   . SER B  1 312 ? -61.92647 23.24826 -28.10974 1.000 30.61328  ? 289 SER B C   1 
ATOM   5139 O O   . SER B  1 312 ? -61.23684 22.24098 -28.28521 1.000 31.09752  ? 289 SER B O   1 
ATOM   5140 C CB  . SER B  1 312 ? -64.38574 23.23527 -27.61925 1.000 32.49372  ? 289 SER B CB  1 
ATOM   5141 O OG  . SER B  1 312 ? -64.26826 21.98473 -26.94214 1.000 34.13448  ? 289 SER B OG  1 
ATOM   5142 N N   . LYS B  1 313 ? -61.53892 24.26633 -27.33612 1.000 30.99419  ? 290 LYS B N   1 
ATOM   5143 C CA  . LYS B  1 313 ? -60.26808 24.24579 -26.62389 1.000 32.18949  ? 290 LYS B CA  1 
ATOM   5144 C C   . LYS B  1 313 ? -60.36316 25.12156 -25.37762 1.000 30.42817  ? 290 LYS B C   1 
ATOM   5145 O O   . LYS B  1 313 ? -60.72627 26.29793 -25.48469 1.000 30.36239  ? 290 LYS B O   1 
ATOM   5146 C CB  . LYS B  1 313 ? -59.12882 24.72998 -27.53919 1.000 28.81144  ? 290 LYS B CB  1 
ATOM   5147 C CG  . LYS B  1 313 ? -57.74831 24.75958 -26.84386 1.000 30.44659  ? 290 LYS B CG  1 
ATOM   5148 C CD  . LYS B  1 313 ? -56.58232 24.55432 -27.83311 1.000 32.93464  ? 290 LYS B CD  1 
ATOM   5149 C CE  . LYS B  1 313 ? -56.46294 25.72605 -28.80882 1.000 35.65956  ? 290 LYS B CE  1 
ATOM   5150 N NZ  . LYS B  1 313 ? -55.75308 25.35273 -30.09846 1.000 37.35316  ? 290 LYS B NZ  1 
ATOM   5151 N N   . CYS B  1 314 ? -59.98868 24.56478 -24.21347 1.000 28.45983  ? 291 CYS B N   1 
ATOM   5152 C CA  . CYS B  1 314 ? -60.17928 25.28433 -22.94798 1.000 25.27272  ? 291 CYS B CA  1 
ATOM   5153 C C   . CYS B  1 314 ? -59.29483 26.50723 -22.84108 1.000 30.83220  ? 291 CYS B C   1 
ATOM   5154 O O   . CYS B  1 314 ? -59.69483 27.51318 -22.23911 1.000 30.54416  ? 291 CYS B O   1 
ATOM   5155 C CB  . CYS B  1 314 ? -59.88809 24.38114 -21.76080 1.000 28.43434  ? 291 CYS B CB  1 
ATOM   5156 S SG  . CYS B  1 314 ? -60.97094 22.93690 -21.71419 1.000 36.43271  ? 291 CYS B SG  1 
ATOM   5157 N N   . VAL B  1 315 ? -58.04939 26.40952 -23.30202 1.000 26.94515  ? 292 VAL B N   1 
ATOM   5158 C CA  . VAL B  1 315 ? -57.10715 27.52315 -23.19484 1.000 31.18351  ? 292 VAL B CA  1 
ATOM   5159 C C   . VAL B  1 315 ? -56.52384 27.72612 -24.58342 1.000 36.00252  ? 292 VAL B C   1 
ATOM   5160 O O   . VAL B  1 315 ? -55.57406 27.03875 -24.97827 1.000 32.89058  ? 292 VAL B O   1 
ATOM   5161 C CB  . VAL B  1 315 ? -56.00787 27.28153 -22.15814 1.000 35.80758  ? 292 VAL B CB  1 
ATOM   5162 C CG1 . VAL B  1 315 ? -55.10797 28.53095 -22.02233 1.000 31.77238  ? 292 VAL B CG1 1 
ATOM   5163 C CG2 . VAL B  1 315 ? -56.63050 26.92457 -20.76718 1.000 32.91116  ? 292 VAL B CG2 1 
ATOM   5164 N N   . CYS B  1 316 ? -57.06627 28.68807 -25.31043 1.000 30.95143  ? 293 CYS B N   1 
ATOM   5165 C CA  . CYS B  1 316 ? -56.60547 29.02254 -26.64905 1.000 29.37622  ? 293 CYS B CA  1 
ATOM   5166 C C   . CYS B  1 316 ? -55.97277 30.40577 -26.55621 1.000 28.41290  ? 293 CYS B C   1 
ATOM   5167 O O   . CYS B  1 316 ? -56.66914 31.41087 -26.38042 1.000 30.74942  ? 293 CYS B O   1 
ATOM   5168 C CB  . CYS B  1 316 ? -57.74884 28.97464 -27.64647 1.000 30.05045  ? 293 CYS B CB  1 
ATOM   5169 S SG  . CYS B  1 316 ? -57.19339 29.17503 -29.37009 1.000 37.82815  ? 293 CYS B SG  1 
ATOM   5170 N N   . SER B  1 317 ? -54.64611 30.44589 -26.61443 1.000 31.90415  ? 294 SER B N   1 
ATOM   5171 C CA  . SER B  1 317 ? -53.93503 31.71416 -26.54854 1.000 30.69456  ? 294 SER B CA  1 
ATOM   5172 C C   . SER B  1 317 ? -54.00219 32.41365 -27.89730 1.000 32.31455  ? 294 SER B C   1 
ATOM   5173 O O   . SER B  1 317 ? -53.80457 31.79846 -28.95526 1.000 34.25791  ? 294 SER B O   1 
ATOM   5174 C CB  . SER B  1 317 ? -52.48409 31.48168 -26.15764 1.000 31.50396  ? 294 SER B CB  1 
ATOM   5175 O OG  . SER B  1 317 ? -51.91506 30.62882 -27.13550 1.000 39.03173  ? 294 SER B OG  1 
ATOM   5176 N N   . VAL B  1 318 ? -54.25956 33.71244 -27.85591 1.000 30.57723  ? 295 VAL B N   1 
ATOM   5177 C CA  . VAL B  1 318 ? -54.50223 34.50056 -29.05162 1.000 30.43423  ? 295 VAL B CA  1 
ATOM   5178 C C   . VAL B  1 318 ? -53.68758 35.77608 -28.93077 1.000 30.70686  ? 295 VAL B C   1 
ATOM   5179 O O   . VAL B  1 318 ? -53.73150 36.45233 -27.89693 1.000 30.51996  ? 295 VAL B O   1 
ATOM   5180 C CB  . VAL B  1 318 ? -55.99791 34.82290 -29.24018 1.000 27.78201  ? 295 VAL B CB  1 
ATOM   5181 C CG1 . VAL B  1 318 ? -56.18853 35.73356 -30.45315 1.000 31.08805  ? 295 VAL B CG1 1 
ATOM   5182 C CG2 . VAL B  1 318 ? -56.84968 33.52131 -29.44802 1.000 26.41184  ? 295 VAL B CG2 1 
ATOM   5183 N N   . ILE B  1 319 ? -52.97877 36.12691 -29.98372 1.000 28.70884  ? 296 ILE B N   1 
ATOM   5184 C CA  . ILE B  1 319 ? -52.28003 37.40260 -30.01470 1.000 29.37290  ? 296 ILE B CA  1 
ATOM   5185 C C   . ILE B  1 319 ? -52.66605 38.13224 -31.29934 1.000 31.90125  ? 296 ILE B C   1 
ATOM   5186 O O   . ILE B  1 319 ? -52.87764 37.49627 -32.34064 1.000 34.23229  ? 296 ILE B O   1 
ATOM   5187 C CB  . ILE B  1 319 ? -50.75930 37.16034 -29.89596 1.000 31.03016  ? 296 ILE B CB  1 
ATOM   5188 C CG1 . ILE B  1 319 ? -50.00997 38.48199 -29.70632 1.000 31.59751  ? 296 ILE B CG1 1 
ATOM   5189 C CG2 . ILE B  1 319 ? -50.26695 36.35483 -31.09340 1.000 33.57364  ? 296 ILE B CG2 1 
ATOM   5190 C CD1 . ILE B  1 319 ? -48.53652 38.31960 -29.31378 1.000 35.80199  ? 296 ILE B CD1 1 
ATOM   5191 N N   . ASP B  1 320 ? -52.78621 39.46173 -31.24021 1.000 31.59662  ? 297 ASP B N   1 
ATOM   5192 C CA  . ASP B  1 320 ? -53.09456 40.23209 -32.45882 1.000 33.14659  ? 297 ASP B CA  1 
ATOM   5193 C C   . ASP B  1 320 ? -51.82345 40.93083 -32.95000 1.000 36.82301  ? 297 ASP B C   1 
ATOM   5194 O O   . ASP B  1 320 ? -51.60779 42.12358 -32.72170 1.000 34.27648  ? 297 ASP B O   1 
ATOM   5195 C CB  . ASP B  1 320 ? -54.24208 41.26630 -32.24782 1.000 30.29990  ? 297 ASP B CB  1 
ATOM   5196 C CG  . ASP B  1 320 ? -54.55697 42.05583 -33.53461 1.000 42.22450  ? 297 ASP B CG  1 
ATOM   5197 O OD1 . ASP B  1 320 ? -54.21134 41.57811 -34.65326 1.000 43.51472  ? 297 ASP B OD1 1 
ATOM   5198 O OD2 . ASP B  1 320 ? -55.13126 43.16483 -33.44035 1.000 40.21937  ? 297 ASP B OD2 1 
ATOM   5199 N N   . LEU B  1 321 ? -50.98983 40.18374 -33.65834 1.000 37.40831  ? 298 LEU B N   1 
ATOM   5200 C CA  . LEU B  1 321 ? -49.88976 40.78308 -34.38869 1.000 37.12040  ? 298 LEU B CA  1 
ATOM   5201 C C   . LEU B  1 321 ? -50.32982 41.09305 -35.81456 1.000 41.17028  ? 298 LEU B C   1 
ATOM   5202 O O   . LEU B  1 321 ? -51.15927 40.39077 -36.39938 1.000 42.41724  ? 298 LEU B O   1 
ATOM   5203 C CB  . LEU B  1 321 ? -48.67874 39.84341 -34.41745 1.000 39.60299  ? 298 LEU B CB  1 
ATOM   5204 C CG  . LEU B  1 321 ? -47.96702 39.61112 -33.08436 1.000 41.78260  ? 298 LEU B CG  1 
ATOM   5205 C CD1 . LEU B  1 321 ? -47.02436 38.38954 -33.19871 1.000 38.20126  ? 298 LEU B CD1 1 
ATOM   5206 C CD2 . LEU B  1 321 ? -47.18801 40.90123 -32.68752 1.000 39.18859  ? 298 LEU B CD2 1 
ATOM   5207 N N   . LEU B  1 322 ? -49.76168 42.14985 -36.37806 1.000 36.51468  ? 299 LEU B N   1 
ATOM   5208 C CA  . LEU B  1 322 ? -49.82891 42.31423 -37.82044 1.000 38.13138  ? 299 LEU B CA  1 
ATOM   5209 C C   . LEU B  1 322 ? -49.33766 41.02876 -38.47665 1.000 40.14596  ? 299 LEU B C   1 
ATOM   5210 O O   . LEU B  1 322 ? -48.27772 40.50324 -38.11292 1.000 40.23715  ? 299 LEU B O   1 
ATOM   5211 C CB  . LEU B  1 322 ? -48.95535 43.50319 -38.23323 1.000 39.60508  ? 299 LEU B CB  1 
ATOM   5212 C CG  . LEU B  1 322 ? -49.01993 43.97570 -39.67683 1.000 43.14444  ? 299 LEU B CG  1 
ATOM   5213 C CD1 . LEU B  1 322 ? -50.32890 44.73771 -39.88491 1.000 45.82251  ? 299 LEU B CD1 1 
ATOM   5214 C CD2 . LEU B  1 322 ? -47.78171 44.82358 -40.01310 1.000 45.71946  ? 299 LEU B CD2 1 
ATOM   5215 N N   . LEU B  1 323 ? -50.10948 40.50688 -39.43700 1.000 40.59506  ? 300 LEU B N   1 
ATOM   5216 C CA  . LEU B  1 323 ? -49.71890 39.23640 -40.04909 1.000 43.02885  ? 300 LEU B CA  1 
ATOM   5217 C C   . LEU B  1 323 ? -48.29954 39.29782 -40.60868 1.000 46.38909  ? 300 LEU B C   1 
ATOM   5218 O O   . LEU B  1 323 ? -47.55679 38.30766 -40.53846 1.000 48.68049  ? 300 LEU B O   1 
ATOM   5219 C CB  . LEU B  1 323 ? -50.71457 38.82621 -41.13904 1.000 45.11347  ? 300 LEU B CB  1 
ATOM   5220 C CG  . LEU B  1 323 ? -50.54350 37.41308 -41.72408 1.000 49.13057  ? 300 LEU B CG  1 
ATOM   5221 C CD1 . LEU B  1 323 ? -50.50993 36.37303 -40.61847 1.000 45.07661  ? 300 LEU B CD1 1 
ATOM   5222 C CD2 . LEU B  1 323 ? -51.66117 37.08333 -42.70646 1.000 51.05960  ? 300 LEU B CD2 1 
ATOM   5223 N N   . ASP B  1 324 ? -47.89300 40.45717 -41.14428 1.000 46.96645  ? 301 ASP B N   1 
ATOM   5224 C CA  . ASP B  1 324 ? -46.53723 40.58646 -41.68146 1.000 48.93676  ? 301 ASP B CA  1 
ATOM   5225 C C   . ASP B  1 324 ? -45.49531 40.34299 -40.59393 1.000 49.87044  ? 301 ASP B C   1 
ATOM   5226 O O   . ASP B  1 324 ? -44.46072 39.70949 -40.84216 1.000 48.37762  ? 301 ASP B O   1 
ATOM   5227 C CB  . ASP B  1 324 ? -46.31824 41.97515 -42.29884 1.000 48.19726  ? 301 ASP B CB  1 
ATOM   5228 C CG  . ASP B  1 324 ? -47.35873 42.33791 -43.34472 1.000 54.41250  ? 301 ASP B CG  1 
ATOM   5229 O OD1 . ASP B  1 324 ? -48.57177 42.34308 -43.01996 1.000 53.29115  ? 301 ASP B OD1 1 
ATOM   5230 O OD2 . ASP B  1 324 ? -46.96306 42.64569 -44.49032 1.000 57.72679  ? 301 ASP B OD2 1 
ATOM   5231 N N   . ASP B  1 325 ? -45.74236 40.86296 -39.38748 1.000 46.47838  ? 302 ASP B N   1 
ATOM   5232 C CA  . ASP B  1 325 ? -44.82071 40.65909 -38.26808 1.000 45.40074  ? 302 ASP B CA  1 
ATOM   5233 C C   . ASP B  1 325 ? -44.73538 39.18344 -37.88842 1.000 43.13132  ? 302 ASP B C   1 
ATOM   5234 O O   . ASP B  1 325 ? -43.63906 38.63986 -37.70522 1.000 45.81149  ? 302 ASP B O   1 
ATOM   5235 C CB  . ASP B  1 325 ? -45.26896 41.50162 -37.05786 1.000 42.50977  ? 302 ASP B CB  1 
ATOM   5236 C CG  . ASP B  1 325 ? -45.04303 43.00759 -37.27423 1.000 48.50226  ? 302 ASP B CG  1 
ATOM   5237 O OD1 . ASP B  1 325 ? -44.30406 43.34208 -38.21968 1.000 49.50915  ? 302 ASP B OD1 1 
ATOM   5238 O OD2 . ASP B  1 325 ? -45.60275 43.84095 -36.52866 1.000 48.15822  ? 302 ASP B OD2 1 
ATOM   5239 N N   . PHE B  1 326 ? -45.88776 38.52060 -37.75529 1.000 41.18326  ? 303 PHE B N   1 
ATOM   5240 C CA  . PHE B  1 326 ? -45.88145 37.09895 -37.41220 1.000 43.34610  ? 303 PHE B CA  1 
ATOM   5241 C C   . PHE B  1 326 ? -45.15413 36.27497 -38.47175 1.000 43.66094  ? 303 PHE B C   1 
ATOM   5242 O O   . PHE B  1 326 ? -44.37423 35.37510 -38.13761 1.000 46.35359  ? 303 PHE B O   1 
ATOM   5243 C CB  . PHE B  1 326 ? -47.31421 36.58176 -37.21492 1.000 44.72757  ? 303 PHE B CB  1 
ATOM   5244 C CG  . PHE B  1 326 ? -47.37445 35.13365 -36.80177 1.000 48.23518  ? 303 PHE B CG  1 
ATOM   5245 C CD1 . PHE B  1 326 ? -46.97714 34.74513 -35.52507 1.000 54.20050  ? 303 PHE B CD1 1 
ATOM   5246 C CD2 . PHE B  1 326 ? -47.79112 34.15433 -37.69955 1.000 52.58542  ? 303 PHE B CD2 1 
ATOM   5247 C CE1 . PHE B  1 326 ? -47.00976 33.39731 -35.13953 1.000 54.76391  ? 303 PHE B CE1 1 
ATOM   5248 C CE2 . PHE B  1 326 ? -47.82326 32.81201 -37.32529 1.000 52.02832  ? 303 PHE B CE2 1 
ATOM   5249 C CZ  . PHE B  1 326 ? -47.43770 32.43776 -36.04073 1.000 54.09238  ? 303 PHE B CZ  1 
ATOM   5250 N N   . VAL B  1 327 ? -45.37424 36.58492 -39.75276 1.000 45.03369  ? 304 VAL B N   1 
ATOM   5251 C CA  . VAL B  1 327 ? -44.64756 35.90507 -40.83277 1.000 48.04057  ? 304 VAL B CA  1 
ATOM   5252 C C   . VAL B  1 327 ? -43.14128 36.12627 -40.69862 1.000 52.14739  ? 304 VAL B C   1 
ATOM   5253 O O   . VAL B  1 327 ? -42.33968 35.18991 -40.84280 1.000 51.72003  ? 304 VAL B O   1 
ATOM   5254 C CB  . VAL B  1 327 ? -45.16865 36.38624 -42.20242 1.000 46.71393  ? 304 VAL B CB  1 
ATOM   5255 C CG1 . VAL B  1 327 ? -44.18371 36.05511 -43.30767 1.000 48.07798  ? 304 VAL B CG1 1 
ATOM   5256 C CG2 . VAL B  1 327 ? -46.52989 35.76325 -42.48841 1.000 50.22303  ? 304 VAL B CG2 1 
ATOM   5257 N N   . GLU B  1 328 ? -42.73028 37.37098 -40.43702 1.000 46.72423  ? 305 GLU B N   1 
ATOM   5258 C CA  . GLU B  1 328 ? -41.31152 37.64360 -40.23295 1.000 48.96562  ? 305 GLU B CA  1 
ATOM   5259 C C   . GLU B  1 328 ? -40.76731 36.85551 -39.04658 1.000 48.14333  ? 305 GLU B C   1 
ATOM   5260 O O   . GLU B  1 328 ? -39.66430 36.29612 -39.11614 1.000 51.36037  ? 305 GLU B O   1 
ATOM   5261 C CB  . GLU B  1 328 ? -41.09735 39.14088 -40.02445 1.000 52.20755  ? 305 GLU B CB  1 
ATOM   5262 C CG  . GLU B  1 328 ? -39.65709 39.53086 -39.73495 1.000 56.33734  ? 305 GLU B CG  1 
ATOM   5263 C CD  . GLU B  1 328 ? -39.50100 41.03714 -39.64311 1.000 60.28993  ? 305 GLU B CD  1 
ATOM   5264 O OE1 . GLU B  1 328 ? -39.83831 41.61376 -38.59014 1.000 59.49748  ? 305 GLU B OE1 1 
ATOM   5265 O OE2 . GLU B  1 328 ? -39.08243 41.64816 -40.64651 1.000 65.71452  ? 305 GLU B OE2 1 
ATOM   5266 N N   . ILE B  1 329 ? -41.54147 36.77276 -37.96069 1.000 41.87134  ? 306 ILE B N   1 
ATOM   5267 C CA  . ILE B  1 329 ? -41.08263 36.06277 -36.76651 1.000 45.74326  ? 306 ILE B CA  1 
ATOM   5268 C C   . ILE B  1 329 ? -40.85054 34.58421 -37.07170 1.000 49.84128  ? 306 ILE B C   1 
ATOM   5269 O O   . ILE B  1 329 ? -39.78779 34.03041 -36.75870 1.000 50.60857  ? 306 ILE B O   1 
ATOM   5270 C CB  . ILE B  1 329 ? -42.08056 36.24314 -35.60687 1.000 42.38326  ? 306 ILE B CB  1 
ATOM   5271 C CG1 . ILE B  1 329 ? -42.02702 37.66703 -35.04941 1.000 42.32457  ? 306 ILE B CG1 1 
ATOM   5272 C CG2 . ILE B  1 329 ? -41.79125 35.23221 -34.48789 1.000 42.25218  ? 306 ILE B CG2 1 
ATOM   5273 C CD1 . ILE B  1 329 ? -43.24688 38.02207 -34.14847 1.000 36.13402  ? 306 ILE B CD1 1 
ATOM   5274 N N   . ILE B  1 330 ? -41.83014 33.92607 -37.70337 1.000 48.66952  ? 307 ILE B N   1 
ATOM   5275 C CA  . ILE B  1 330 ? -41.75223 32.47055 -37.82371 1.000 48.91248  ? 307 ILE B CA  1 
ATOM   5276 C C   . ILE B  1 330 ? -40.75136 32.06506 -38.89730 1.000 51.77635  ? 307 ILE B C   1 
ATOM   5277 O O   . ILE B  1 330 ? -40.09808 31.02345 -38.77297 1.000 53.55112  ? 307 ILE B O   1 
ATOM   5278 C CB  . ILE B  1 330 ? -43.14632 31.84929 -38.07623 1.000 50.46853  ? 307 ILE B CB  1 
ATOM   5279 C CG1 . ILE B  1 330 ? -43.09554 30.34364 -37.78508 1.000 49.23390  ? 307 ILE B CG1 1 
ATOM   5280 C CG2 . ILE B  1 330 ? -43.62763 32.10939 -39.52119 1.000 48.82185  ? 307 ILE B CG2 1 
ATOM   5281 C CD1 . ILE B  1 330 ? -44.42382 29.60640 -37.91538 1.000 47.26859  ? 307 ILE B CD1 1 
ATOM   5282 N N   . LYS B  1 331 ? -40.58588 32.88170 -39.94139 1.000 52.37885  ? 308 LYS B N   1 
ATOM   5283 C CA  . LYS B  1 331 ? -39.59996 32.58318 -40.97420 1.000 57.50377  ? 308 LYS B CA  1 
ATOM   5284 C C   . LYS B  1 331 ? -38.16700 32.80477 -40.50215 1.000 62.23631  ? 308 LYS B C   1 
ATOM   5285 O O   . LYS B  1 331 ? -37.23680 32.26183 -41.10852 1.000 67.00283  ? 308 LYS B O   1 
ATOM   5286 C CB  . LYS B  1 331 ? -39.86765 33.42389 -42.22382 1.000 60.25275  ? 308 LYS B CB  1 
ATOM   5287 C CG  . LYS B  1 331 ? -41.03992 32.90787 -43.05721 1.000 62.30316  ? 308 LYS B CG  1 
ATOM   5288 C CD  . LYS B  1 331 ? -41.10188 33.61002 -44.40128 1.000 68.00707  ? 308 LYS B CD  1 
ATOM   5289 C CE  . LYS B  1 331 ? -42.13281 32.96884 -45.31204 1.000 67.70218  ? 308 LYS B CE  1 
ATOM   5290 N NZ  . LYS B  1 331 ? -42.23050 33.68787 -46.61754 1.000 70.00609  ? 308 LYS B NZ  1 
ATOM   5291 N N   . SER B  1 332 ? -37.96395 33.57152 -39.43862 1.000 59.08912  ? 309 SER B N   1 
ATOM   5292 C CA  . SER B  1 332 ? -36.62548 33.76439 -38.89442 1.000 63.50570  ? 309 SER B CA  1 
ATOM   5293 C C   . SER B  1 332 ? -36.15349 32.59649 -38.04340 1.000 64.41946  ? 309 SER B C   1 
ATOM   5294 O O   . SER B  1 332 ? -35.01291 32.62778 -37.57034 1.000 65.82923  ? 309 SER B O   1 
ATOM   5295 C CB  . SER B  1 332 ? -36.58340 35.03163 -38.04706 1.000 65.08157  ? 309 SER B CB  1 
ATOM   5296 O OG  . SER B  1 332 ? -37.15833 36.10365 -38.75398 1.000 72.42881  ? 309 SER B OG  1 
ATOM   5297 N N   . GLN B  1 333 ? -36.98921 31.58031 -37.83656 1.000 61.10089  ? 310 GLN B N   1 
ATOM   5298 C CA  . GLN B  1 333 ? -36.70372 30.53000 -36.87302 1.000 59.06671  ? 310 GLN B CA  1 
ATOM   5299 C C   . GLN B  1 333 ? -35.86579 29.41283 -37.47649 1.000 65.64072  ? 310 GLN B C   1 
ATOM   5300 O O   . GLN B  1 333 ? -36.01889 29.04647 -38.64654 1.000 62.13800  ? 310 GLN B O   1 
ATOM   5301 C CB  . GLN B  1 333 ? -37.99439 29.93812 -36.32129 1.000 53.75137  ? 310 GLN B CB  1 
ATOM   5302 C CG  . GLN B  1 333 ? -38.86382 30.96188 -35.61766 1.000 52.67928  ? 310 GLN B CG  1 
ATOM   5303 C CD  . GLN B  1 333 ? -38.12691 31.64081 -34.48850 1.000 58.07189  ? 310 GLN B CD  1 
ATOM   5304 O OE1 . GLN B  1 333 ? -37.37526 31.00087 -33.75393 1.000 57.53961  ? 310 GLN B OE1 1 
ATOM   5305 N NE2 . GLN B  1 333 ? -38.34033 32.94302 -34.33676 1.000 56.97735  ? 310 GLN B NE2 1 
ATOM   5306 N N   . ASP B  1 334 ? -34.99230 28.85792 -36.63968 1.000 68.84460  ? 311 ASP B N   1 
ATOM   5307 C CA  . ASP B  1 334 ? -34.24447 27.65341 -36.97498 1.000 70.30820  ? 311 ASP B CA  1 
ATOM   5308 C C   . ASP B  1 334 ? -35.15666 26.44159 -36.81194 1.000 70.61000  ? 311 ASP B C   1 
ATOM   5309 O O   . ASP B  1 334 ? -35.64158 26.15599 -35.70781 1.000 68.17592  ? 311 ASP B O   1 
ATOM   5310 C CB  . ASP B  1 334 ? -33.00564 27.54241 -36.08874 1.000 74.67329  ? 311 ASP B CB  1 
ATOM   5311 C CG  . ASP B  1 334 ? -32.09707 26.41214 -36.49966 1.000 83.02380  ? 311 ASP B CG  1 
ATOM   5312 O OD1 . ASP B  1 334 ? -32.16180 25.33929 -35.86279 1.000 88.00470  ? 311 ASP B OD1 1 
ATOM   5313 O OD2 . ASP B  1 334 ? -31.33545 26.59285 -37.47542 1.000 84.68504  ? 311 ASP B OD2 1 
ATOM   5314 N N   . LEU B  1 335 ? -35.39760 25.73347 -37.91575 1.000 69.39436  ? 312 LEU B N   1 
ATOM   5315 C CA  . LEU B  1 335 ? -36.37705 24.65810 -37.96408 1.000 69.41619  ? 312 LEU B CA  1 
ATOM   5316 C C   . LEU B  1 335 ? -35.75655 23.27200 -37.76394 1.000 71.69101  ? 312 LEU B C   1 
ATOM   5317 O O   . LEU B  1 335 ? -36.39765 22.26159 -38.07901 1.000 73.42734  ? 312 LEU B O   1 
ATOM   5318 C CB  . LEU B  1 335 ? -37.13739 24.72291 -39.29053 1.000 70.79263  ? 312 LEU B CB  1 
ATOM   5319 C CG  . LEU B  1 335 ? -37.90375 26.02020 -39.57537 1.000 66.15398  ? 312 LEU B CG  1 
ATOM   5320 C CD1 . LEU B  1 335 ? -38.68010 25.91037 -40.87463 1.000 65.86746  ? 312 LEU B CD1 1 
ATOM   5321 C CD2 . LEU B  1 335 ? -38.85185 26.38160 -38.42300 1.000 63.28913  ? 312 LEU B CD2 1 
ATOM   5322 N N   . SER B  1 336 ? -34.54380 23.19948 -37.21224 1.000 74.35396  ? 313 SER B N   1 
ATOM   5323 C CA  . SER B  1 336 ? -33.77400 21.95863 -37.18289 1.000 81.07093  ? 313 SER B CA  1 
ATOM   5324 C C   . SER B  1 336 ? -33.87483 21.19207 -35.86457 1.000 80.82242  ? 313 SER B C   1 
ATOM   5325 O O   . SER B  1 336 ? -33.29145 20.11137 -35.75029 1.000 77.86184  ? 313 SER B O   1 
ATOM   5326 C CB  . SER B  1 336 ? -32.30540 22.25016 -37.49618 1.000 81.15339  ? 313 SER B CB  1 
ATOM   5327 O OG  . SER B  1 336 ? -31.79666 23.23459 -36.61625 1.000 81.90269  ? 313 SER B OG  1 
ATOM   5328 N N   . VAL B  1 337 ? -34.60144 21.70129 -34.87589 1.000 77.55223  ? 314 VAL B N   1 
ATOM   5329 C CA  . VAL B  1 337 ? -34.71842 21.01869 -33.59437 1.000 76.91022  ? 314 VAL B CA  1 
ATOM   5330 C C   . VAL B  1 337 ? -36.17276 20.62019 -33.38374 1.000 75.44432  ? 314 VAL B C   1 
ATOM   5331 O O   . VAL B  1 337 ? -37.09623 21.25333 -33.90467 1.000 73.04072  ? 314 VAL B O   1 
ATOM   5332 C CB  . VAL B  1 337 ? -34.19534 21.89662 -32.43450 1.000 78.96300  ? 314 VAL B CB  1 
ATOM   5333 C CG1 . VAL B  1 337 ? -34.98376 23.17911 -32.34708 1.000 75.85834  ? 314 VAL B CG1 1 
ATOM   5334 C CG2 . VAL B  1 337 ? -34.21370 21.13352 -31.10407 1.000 79.55594  ? 314 VAL B CG2 1 
ATOM   5335 N N   . VAL B  1 338 ? -36.37150 19.54296 -32.62412 1.000 75.27776  ? 315 VAL B N   1 
ATOM   5336 C CA  . VAL B  1 338 ? -37.71571 19.01578 -32.41160 1.000 71.10307  ? 315 VAL B CA  1 
ATOM   5337 C C   . VAL B  1 338 ? -38.58691 20.03825 -31.69222 1.000 72.32915  ? 315 VAL B C   1 
ATOM   5338 O O   . VAL B  1 338 ? -39.74738 20.26265 -32.06094 1.000 71.64333  ? 315 VAL B O   1 
ATOM   5339 C CB  . VAL B  1 338 ? -37.64600 17.68475 -31.64472 1.000 70.04712  ? 315 VAL B CB  1 
ATOM   5340 C CG1 . VAL B  1 338 ? -38.91278 17.45250 -30.85373 1.000 65.23763  ? 315 VAL B CG1 1 
ATOM   5341 C CG2 . VAL B  1 338 ? -37.39153 16.52326 -32.62155 1.000 71.08878  ? 315 VAL B CG2 1 
ATOM   5342 N N   . SER B  1 339 ? -38.04934 20.66754 -30.65253 1.000 70.41952  ? 316 SER B N   1 
ATOM   5343 C CA  . SER B  1 339 ? -38.84902 21.60405 -29.88075 1.000 69.04408  ? 316 SER B CA  1 
ATOM   5344 C C   . SER B  1 339 ? -37.92346 22.57660 -29.17529 1.000 66.77685  ? 316 SER B C   1 
ATOM   5345 O O   . SER B  1 339 ? -36.82143 22.21291 -28.76863 1.000 69.50617  ? 316 SER B O   1 
ATOM   5346 C CB  . SER B  1 339 ? -39.73411 20.88830 -28.85711 1.000 70.81728  ? 316 SER B CB  1 
ATOM   5347 O OG  . SER B  1 339 ? -38.96714 20.46851 -27.74517 1.000 75.63171  ? 316 SER B OG  1 
ATOM   5348 N N   . LYS B  1 340 ? -38.38975 23.81224 -29.01941 1.000 62.45597  ? 317 LYS B N   1 
ATOM   5349 C CA  . LYS B  1 340 ? -37.58420 24.81205 -28.33192 1.000 61.34397  ? 317 LYS B CA  1 
ATOM   5350 C C   . LYS B  1 340 ? -38.46463 25.99391 -27.95053 1.000 55.08377  ? 317 LYS B C   1 
ATOM   5351 O O   . LYS B  1 340 ? -39.51864 26.22957 -28.55510 1.000 50.35515  ? 317 LYS B O   1 
ATOM   5352 C CB  . LYS B  1 340 ? -36.39966 25.28177 -29.18690 1.000 65.99257  ? 317 LYS B CB  1 
ATOM   5353 C CG  . LYS B  1 340 ? -36.77931 25.81603 -30.54235 1.000 64.90241  ? 317 LYS B CG  1 
ATOM   5354 C CD  . LYS B  1 340 ? -36.08353 27.14113 -30.82489 1.000 69.63567  ? 317 LYS B CD  1 
ATOM   5355 C CE  . LYS B  1 340 ? -34.62419 27.00258 -31.13295 1.000 71.31544  ? 317 LYS B CE  1 
ATOM   5356 N NZ  . LYS B  1 340 ? -34.08305 28.31988 -31.58328 1.000 74.98354  ? 317 LYS B NZ  1 
ATOM   5357 N N   . VAL B  1 341 ? -38.03412 26.71006 -26.92493 1.000 53.34431  ? 318 VAL B N   1 
ATOM   5358 C CA  . VAL B  1 341 ? -38.71714 27.91991 -26.49321 1.000 57.28655  ? 318 VAL B CA  1 
ATOM   5359 C C   . VAL B  1 341 ? -38.12754 29.09133 -27.26316 1.000 56.03237  ? 318 VAL B C   1 
ATOM   5360 O O   . VAL B  1 341 ? -36.90886 29.26031 -27.30934 1.000 56.40938  ? 318 VAL B O   1 
ATOM   5361 C CB  . VAL B  1 341 ? -38.58385 28.12301 -24.97577 1.000 57.35356  ? 318 VAL B CB  1 
ATOM   5362 C CG1 . VAL B  1 341 ? -39.38749 29.35863 -24.53792 1.000 55.10792  ? 318 VAL B CG1 1 
ATOM   5363 C CG2 . VAL B  1 341 ? -39.07205 26.88393 -24.24734 1.000 57.81300  ? 318 VAL B CG2 1 
ATOM   5364 N N   . VAL B  1 342 ? -38.99215 29.88021 -27.89507 1.000 50.63838  ? 319 VAL B N   1 
ATOM   5365 C CA  . VAL B  1 342 ? -38.58755 31.03332 -28.68828 1.000 49.01837  ? 319 VAL B CA  1 
ATOM   5366 C C   . VAL B  1 342 ? -39.13028 32.27241 -27.99817 1.000 48.92495  ? 319 VAL B C   1 
ATOM   5367 O O   . VAL B  1 342 ? -40.33348 32.35092 -27.70606 1.000 45.11686  ? 319 VAL B O   1 
ATOM   5368 C CB  . VAL B  1 342 ? -39.10285 30.92831 -30.13509 1.000 50.96931  ? 319 VAL B CB  1 
ATOM   5369 C CG1 . VAL B  1 342 ? -38.94521 32.24592 -30.84746 1.000 54.85502  ? 319 VAL B CG1 1 
ATOM   5370 C CG2 . VAL B  1 342 ? -38.32866 29.83686 -30.88581 1.000 49.91534  ? 319 VAL B CG2 1 
ATOM   5371 N N   . LYS B  1 343 ? -38.25270 33.22891 -27.71339 1.000 47.67395  ? 320 LYS B N   1 
ATOM   5372 C CA  . LYS B  1 343 ? -38.65770 34.42876 -26.99527 1.000 47.76715  ? 320 LYS B CA  1 
ATOM   5373 C C   . LYS B  1 343 ? -38.69471 35.59993 -27.96038 1.000 48.38860  ? 320 LYS B C   1 
ATOM   5374 O O   . LYS B  1 343 ? -37.75219 35.79620 -28.72741 1.000 47.36973  ? 320 LYS B O   1 
ATOM   5375 C CB  . LYS B  1 343 ? -37.71605 34.69566 -25.82609 1.000 53.54929  ? 320 LYS B CB  1 
ATOM   5376 C CG  . LYS B  1 343 ? -37.72648 33.54422 -24.83726 1.000 61.28042  ? 320 LYS B CG  1 
ATOM   5377 C CD  . LYS B  1 343 ? -37.09147 33.89044 -23.51252 1.000 69.72137  ? 320 LYS B CD  1 
ATOM   5378 C CE  . LYS B  1 343 ? -37.58166 32.92467 -22.44363 1.000 76.04472  ? 320 LYS B CE  1 
ATOM   5379 N NZ  . LYS B  1 343 ? -37.34566 33.43709 -21.06502 1.000 82.26457  ? 320 LYS B NZ  1 
ATOM   5380 N N   . VAL B  1 344 ? -39.80968 36.33029 -27.96183 1.000 44.35662  ? 321 VAL B N   1 
ATOM   5381 C CA  . VAL B  1 344 ? -40.01771 37.47747 -28.83420 1.000 41.68320  ? 321 VAL B CA  1 
ATOM   5382 C C   . VAL B  1 344 ? -40.44837 38.64769 -27.96496 1.000 38.52021  ? 321 VAL B C   1 
ATOM   5383 O O   . VAL B  1 344 ? -41.36034 38.50678 -27.14060 1.000 31.99780  ? 321 VAL B O   1 
ATOM   5384 C CB  . VAL B  1 344 ? -41.08538 37.20621 -29.91293 1.000 41.91815  ? 321 VAL B CB  1 
ATOM   5385 C CG1 . VAL B  1 344 ? -41.15664 38.38175 -30.86765 1.000 42.85529  ? 321 VAL B CG1 1 
ATOM   5386 C CG2 . VAL B  1 344 ? -40.77900 35.91191 -30.68066 1.000 40.31897  ? 321 VAL B CG2 1 
ATOM   5387 N N   . THR B  1 345 ? -39.78328 39.79243 -28.12318 1.000 33.57849  ? 322 THR B N   1 
ATOM   5388 C CA  . THR B  1 345 ? -40.21165 40.97746 -27.38476 1.000 35.08753  ? 322 THR B CA  1 
ATOM   5389 C C   . THR B  1 345 ? -41.40603 41.59755 -28.09071 1.000 32.96467  ? 322 THR B C   1 
ATOM   5390 O O   . THR B  1 345 ? -41.30730 41.95270 -29.27516 1.000 33.65522  ? 322 THR B O   1 
ATOM   5391 C CB  . THR B  1 345 ? -39.07851 41.99300 -27.26905 1.000 37.77694  ? 322 THR B CB  1 
ATOM   5392 O OG1 . THR B  1 345 ? -37.96615 41.35415 -26.65203 1.000 39.00021  ? 322 THR B OG1 1 
ATOM   5393 C CG2 . THR B  1 345 ? -39.53667 43.19515 -26.39198 1.000 33.60930  ? 322 THR B CG2 1 
ATOM   5394 N N   . ILE B  1 346 ? -42.52791 41.71462 -27.36993 1.000 28.86627  ? 323 ILE B N   1 
ATOM   5395 C CA  . ILE B  1 346 ? -43.78076 42.25629 -27.88573 1.000 30.90875  ? 323 ILE B CA  1 
ATOM   5396 C C   . ILE B  1 346 ? -44.39041 43.15519 -26.81167 1.000 32.36479  ? 323 ILE B C   1 
ATOM   5397 O O   . ILE B  1 346 ? -44.47972 42.75863 -25.64490 1.000 32.06402  ? 323 ILE B O   1 
ATOM   5398 C CB  . ILE B  1 346 ? -44.77685 41.13237 -28.26457 1.000 32.24630  ? 323 ILE B CB  1 
ATOM   5399 C CG1 . ILE B  1 346 ? -44.13226 40.15829 -29.27240 1.000 35.06090  ? 323 ILE B CG1 1 
ATOM   5400 C CG2 . ILE B  1 346 ? -46.04599 41.73136 -28.84716 1.000 30.07202  ? 323 ILE B CG2 1 
ATOM   5401 C CD1 . ILE B  1 346 ? -45.01500 38.90537 -29.54144 1.000 37.39005  ? 323 ILE B CD1 1 
ATOM   5402 N N   . ASP B  1 347 ? -44.78455 44.37307 -27.19495 1.000 29.99670  ? 324 ASP B N   1 
ATOM   5403 C CA  . ASP B  1 347 ? -45.34694 45.33503 -26.24022 1.000 28.14652  ? 324 ASP B CA  1 
ATOM   5404 C C   . ASP B  1 347 ? -44.40283 45.55513 -25.05776 1.000 31.37702  ? 324 ASP B C   1 
ATOM   5405 O O   . ASP B  1 347 ? -44.85419 45.71921 -23.92409 1.000 29.19298  ? 324 ASP B O   1 
ATOM   5406 C CB  . ASP B  1 347 ? -46.72713 44.88805 -25.71684 1.000 26.17560  ? 324 ASP B CB  1 
ATOM   5407 C CG  . ASP B  1 347 ? -47.79191 44.83436 -26.80249 1.000 34.81357  ? 324 ASP B CG  1 
ATOM   5408 O OD1 . ASP B  1 347 ? -47.60847 45.51561 -27.84354 1.000 32.30443  ? 324 ASP B OD1 1 
ATOM   5409 O OD2 . ASP B  1 347 ? -48.83366 44.14356 -26.57617 1.000 30.21162  ? 324 ASP B OD2 1 
ATOM   5410 N N   . TYR B  1 348 ? -43.09016 45.54068 -25.32616 1.000 32.56378  ? 325 TYR B N   1 
ATOM   5411 C CA  . TYR B  1 348 ? -41.99185 45.68753 -24.37154 1.000 32.16210  ? 325 TYR B CA  1 
ATOM   5412 C C   . TYR B  1 348 ? -41.78329 44.47670 -23.44990 1.000 37.67793  ? 325 TYR B C   1 
ATOM   5413 O O   . TYR B  1 348 ? -40.86497 44.51334 -22.61987 1.000 38.87514  ? 325 TYR B O   1 
ATOM   5414 C CB  . TYR B  1 348 ? -42.14378 46.94184 -23.48973 1.000 30.85898  ? 325 TYR B CB  1 
ATOM   5415 C CG  . TYR B  1 348 ? -42.05867 48.21700 -24.27056 1.000 33.39069  ? 325 TYR B CG  1 
ATOM   5416 C CD1 . TYR B  1 348 ? -40.87851 48.57841 -24.91205 1.000 35.70358  ? 325 TYR B CD1 1 
ATOM   5417 C CD2 . TYR B  1 348 ? -43.15096 49.06465 -24.37570 1.000 33.60629  ? 325 TYR B CD2 1 
ATOM   5418 C CE1 . TYR B  1 348 ? -40.77950 49.77381 -25.63717 1.000 39.00831  ? 325 TYR B CE1 1 
ATOM   5419 C CE2 . TYR B  1 348 ? -43.06475 50.27214 -25.10221 1.000 29.79430  ? 325 TYR B CE2 1 
ATOM   5420 C CZ  . TYR B  1 348 ? -41.89523 50.60349 -25.73674 1.000 31.58705  ? 325 TYR B CZ  1 
ATOM   5421 O OH  . TYR B  1 348 ? -41.79391 51.79149 -26.44998 1.000 34.92663  ? 325 TYR B OH  1 
ATOM   5422 N N   . THR B  1 349 ? -42.57695 43.41192 -23.56125 1.000 33.41914  ? 326 THR B N   1 
ATOM   5423 C CA  . THR B  1 349 ? -42.40399 42.25319 -22.69003 1.000 34.93823  ? 326 THR B CA  1 
ATOM   5424 C C   . THR B  1 349 ? -41.90108 41.05480 -23.50435 1.000 37.04539  ? 326 THR B C   1 
ATOM   5425 O O   . THR B  1 349 ? -42.08499 40.97651 -24.72840 1.000 33.06803  ? 326 THR B O   1 
ATOM   5426 C CB  . THR B  1 349 ? -43.72694 41.92902 -21.95586 1.000 33.98589  ? 326 THR B CB  1 
ATOM   5427 O OG1 . THR B  1 349 ? -43.46403 41.19568 -20.74987 1.000 36.24835  ? 326 THR B OG1 1 
ATOM   5428 C CG2 . THR B  1 349 ? -44.69057 41.13241 -22.83674 1.000 29.30764  ? 326 THR B CG2 1 
ATOM   5429 N N   . GLU B  1 350 ? -41.23683 40.11967 -22.82510 1.000 35.98585  ? 327 GLU B N   1 
ATOM   5430 C CA  . GLU B  1 350 ? -40.74085 38.90265 -23.47876 1.000 34.85632  ? 327 GLU B CA  1 
ATOM   5431 C C   . GLU B  1 350 ? -41.85259 37.85150 -23.50306 1.000 35.18788  ? 327 GLU B C   1 
ATOM   5432 O O   . GLU B  1 350 ? -42.24827 37.32669 -22.45768 1.000 34.62043  ? 327 GLU B O   1 
ATOM   5433 C CB  . GLU B  1 350 ? -39.49191 38.37385 -22.77162 1.000 50.02247  ? 327 GLU B CB  1 
ATOM   5434 C CG  . GLU B  1 350 ? -38.69886 37.39065 -23.63291 1.000 67.16020  ? 327 GLU B CG  1 
ATOM   5435 C CD  . GLU B  1 350 ? -37.17641 37.54509 -23.50841 1.000 80.84220  ? 327 GLU B CD  1 
ATOM   5436 O OE1 . GLU B  1 350 ? -36.60327 37.06769 -22.50137 1.000 82.20353  ? 327 GLU B OE1 1 
ATOM   5437 O OE2 . GLU B  1 350 ? -36.55543 38.12891 -24.42788 1.000 81.42024  ? 327 GLU B OE2 1 
ATOM   5438 N N   . ILE B  1 351 ? -42.35753 37.53423 -24.69373 1.000 33.27150  ? 328 ILE B N   1 
ATOM   5439 C CA  . ILE B  1 351 ? -43.36503 36.49297 -24.85258 1.000 34.23707  ? 328 ILE B CA  1 
ATOM   5440 C C   . ILE B  1 351 ? -42.67063 35.20981 -25.29719 1.000 35.58546  ? 328 ILE B C   1 
ATOM   5441 O O   . ILE B  1 351 ? -41.94419 35.19952 -26.30023 1.000 36.65615  ? 328 ILE B O   1 
ATOM   5442 C CB  . ILE B  1 351 ? -44.45805 36.91815 -25.85247 1.000 35.21156  ? 328 ILE B CB  1 
ATOM   5443 C CG1 . ILE B  1 351 ? -45.14912 38.21813 -25.37121 1.000 30.97364  ? 328 ILE B CG1 1 
ATOM   5444 C CG2 . ILE B  1 351 ? -45.48237 35.78045 -26.04465 1.000 31.60332  ? 328 ILE B CG2 1 
ATOM   5445 C CD1 . ILE B  1 351 ? -45.90256 38.06839 -24.01528 1.000 28.69538  ? 328 ILE B CD1 1 
ATOM   5446 N N   . SER B  1 352 ? -42.88662 34.12888 -24.55011 1.000 39.57584  ? 329 SER B N   1 
ATOM   5447 C CA  . SER B  1 352 ? -42.34287 32.81768 -24.90421 1.000 42.96765  ? 329 SER B CA  1 
ATOM   5448 C C   . SER B  1 352 ? -43.29810 32.09417 -25.84410 1.000 37.13644  ? 329 SER B C   1 
ATOM   5449 O O   . SER B  1 352 ? -44.50515 32.02803 -25.58640 1.000 35.79126  ? 329 SER B O   1 
ATOM   5450 C CB  . SER B  1 352 ? -42.09967 31.97348 -23.65369 1.000 41.28598  ? 329 SER B CB  1 
ATOM   5451 O OG  . SER B  1 352 ? -41.06715 32.55076 -22.87666 1.000 40.99101  ? 329 SER B OG  1 
ATOM   5452 N N   . PHE B  1 353 ? -42.75532 31.58082 -26.94370 1.000 40.55414  ? 330 PHE B N   1 
ATOM   5453 C CA  . PHE B  1 353 ? -43.47380 30.71697 -27.86831 1.000 39.43987  ? 330 PHE B CA  1 
ATOM   5454 C C   . PHE B  1 353 ? -42.85330 29.32813 -27.81321 1.000 44.87407  ? 330 PHE B C   1 
ATOM   5455 O O   . PHE B  1 353 ? -41.63815 29.19404 -27.62500 1.000 47.29115  ? 330 PHE B O   1 
ATOM   5456 C CB  . PHE B  1 353 ? -43.39339 31.23846 -29.31101 1.000 42.28962  ? 330 PHE B CB  1 
ATOM   5457 C CG  . PHE B  1 353 ? -44.15799 32.50101 -29.55756 1.000 44.39025  ? 330 PHE B CG  1 
ATOM   5458 C CD1 . PHE B  1 353 ? -43.64071 33.73567 -29.15884 1.000 40.61920  ? 330 PHE B CD1 1 
ATOM   5459 C CD2 . PHE B  1 353 ? -45.38936 32.46480 -30.21265 1.000 41.14782  ? 330 PHE B CD2 1 
ATOM   5460 C CE1 . PHE B  1 353 ? -44.34275 34.89999 -29.39258 1.000 38.31192  ? 330 PHE B CE1 1 
ATOM   5461 C CE2 . PHE B  1 353 ? -46.09123 33.62716 -30.44737 1.000 39.71034  ? 330 PHE B CE2 1 
ATOM   5462 C CZ  . PHE B  1 353 ? -45.57413 34.84564 -30.03058 1.000 41.05809  ? 330 PHE B CZ  1 
ATOM   5463 N N   . MET B  1 354 ? -43.68494 28.30050 -27.95344 1.000 42.66273  ? 331 MET B N   1 
ATOM   5464 C CA  . MET B  1 354 ? -43.20138 26.95211 -28.20228 1.000 46.81744  ? 331 MET B CA  1 
ATOM   5465 C C   . MET B  1 354 ? -43.15368 26.73022 -29.70294 1.000 50.85277  ? 331 MET B C   1 
ATOM   5466 O O   . MET B  1 354 ? -44.13605 26.99984 -30.39889 1.000 49.92307  ? 331 MET B O   1 
ATOM   5467 C CB  . MET B  1 354 ? -44.10584 25.90398 -27.55172 1.000 54.28385  ? 331 MET B CB  1 
ATOM   5468 C CG  . MET B  1 354 ? -43.98786 25.85096 -26.04557 1.000 66.41853  ? 331 MET B CG  1 
ATOM   5469 S SD  . MET B  1 354 ? -42.28866 25.51918 -25.53808 1.000 77.07180  ? 331 MET B SD  1 
ATOM   5470 C CE  . MET B  1 354 ? -42.01341 23.90126 -26.27181 1.000 74.07698  ? 331 MET B CE  1 
ATOM   5471 N N   . LEU B  1 355 ? -42.01606 26.24116 -30.19690 1.000 51.57898  ? 332 LEU B N   1 
ATOM   5472 C CA  . LEU B  1 355 ? -41.84015 25.90246 -31.60396 1.000 49.72702  ? 332 LEU B CA  1 
ATOM   5473 C C   . LEU B  1 355 ? -41.56938 24.40921 -31.70935 1.000 54.39901  ? 332 LEU B C   1 
ATOM   5474 O O   . LEU B  1 355 ? -40.58589 23.91288 -31.14883 1.000 54.84653  ? 332 LEU B O   1 
ATOM   5475 C CB  . LEU B  1 355 ? -40.69517 26.70239 -32.23611 1.000 49.25200  ? 332 LEU B CB  1 
ATOM   5476 C CG  . LEU B  1 355 ? -40.28164 26.29756 -33.65948 1.000 52.09151  ? 332 LEU B CG  1 
ATOM   5477 C CD1 . LEU B  1 355 ? -41.40144 26.58098 -34.66215 1.000 52.20604  ? 332 LEU B CD1 1 
ATOM   5478 C CD2 . LEU B  1 355 ? -38.97253 26.99393 -34.09603 1.000 51.84761  ? 332 LEU B CD2 1 
ATOM   5479 N N   . TRP B  1 356 ? -42.44112 23.70110 -32.42107 1.000 54.85712  ? 333 TRP B N   1 
ATOM   5480 C CA  . TRP B  1 356 ? -42.32492 22.26296 -32.63907 1.000 58.49688  ? 333 TRP B CA  1 
ATOM   5481 C C   . TRP B  1 356 ? -42.11465 22.00657 -34.12015 1.000 58.76613  ? 333 TRP B C   1 
ATOM   5482 O O   . TRP B  1 356 ? -42.90321 22.46838 -34.95230 1.000 56.04798  ? 333 TRP B O   1 
ATOM   5483 C CB  . TRP B  1 356 ? -43.56885 21.51461 -32.16480 1.000 58.87570  ? 333 TRP B CB  1 
ATOM   5484 C CG  . TRP B  1 356 ? -43.71316 21.42869 -30.68633 1.000 61.44864  ? 333 TRP B CG  1 
ATOM   5485 C CD1 . TRP B  1 356 ? -44.33298 22.33026 -29.86263 1.000 58.93504  ? 333 TRP B CD1 1 
ATOM   5486 C CD2 . TRP B  1 356 ? -43.23823 20.37426 -29.84553 1.000 66.78795  ? 333 TRP B CD2 1 
ATOM   5487 N NE1 . TRP B  1 356 ? -44.27047 21.89761 -28.55996 1.000 62.08207  ? 333 TRP B NE1 1 
ATOM   5488 C CE2 . TRP B  1 356 ? -43.60411 20.69964 -28.52177 1.000 66.23713  ? 333 TRP B CE2 1 
ATOM   5489 C CE3 . TRP B  1 356 ? -42.53700 19.18587 -30.08324 1.000 74.83352  ? 333 TRP B CE3 1 
ATOM   5490 C CZ2 . TRP B  1 356 ? -43.29065 19.88367 -27.43954 1.000 70.22768  ? 333 TRP B CZ2 1 
ATOM   5491 C CZ3 . TRP B  1 356 ? -42.22881 18.37180 -29.00690 1.000 78.51713  ? 333 TRP B CZ3 1 
ATOM   5492 C CH2 . TRP B  1 356 ? -42.60608 18.72635 -27.69992 1.000 79.24645  ? 333 TRP B CH2 1 
ATOM   5493 N N   . CYS B  1 357 ? -41.05390 21.27645 -34.44469 1.000 62.13115  ? 334 CYS B N   1 
ATOM   5494 C CA  . CYS B  1 357 ? -40.67689 21.02318 -35.82386 1.000 65.42086  ? 334 CYS B CA  1 
ATOM   5495 C C   . CYS B  1 357 ? -40.51874 19.52562 -36.02586 1.000 69.76795  ? 334 CYS B C   1 
ATOM   5496 O O   . CYS B  1 357 ? -40.49692 18.74582 -35.06808 1.000 70.71789  ? 334 CYS B O   1 
ATOM   5497 C CB  . CYS B  1 357 ? -39.37465 21.74910 -36.19715 1.000 68.31675  ? 334 CYS B CB  1 
ATOM   5498 S SG  . CYS B  1 357 ? -39.46663 23.55643 -36.17492 1.000 64.38193  ? 334 CYS B SG  1 
ATOM   5499 N N   . LYS B  1 358 ? -40.41397 19.13545 -37.29535 1.000 71.06216  ? 335 LYS B N   1 
ATOM   5500 C CA  . LYS B  1 358 ? -40.17871 17.74181 -37.67508 1.000 72.97031  ? 335 LYS B CA  1 
ATOM   5501 C C   . LYS B  1 358 ? -39.71827 17.73657 -39.12178 1.000 77.90538  ? 335 LYS B C   1 
ATOM   5502 O O   . LYS B  1 358 ? -40.40404 18.29380 -39.98301 1.000 79.75086  ? 335 LYS B O   1 
ATOM   5503 C CB  . LYS B  1 358 ? -41.45093 16.89683 -37.50856 1.000 72.08625  ? 335 LYS B CB  1 
ATOM   5504 C CG  . LYS B  1 358 ? -41.23068 15.40922 -37.70672 1.000 80.39093  ? 335 LYS B CG  1 
ATOM   5505 C CD  . LYS B  1 358 ? -42.53962 14.62397 -37.75621 1.000 82.92215  ? 335 LYS B CD  1 
ATOM   5506 C CE  . LYS B  1 358 ? -42.26417 13.11914 -37.82270 1.000 87.49769  ? 335 LYS B CE  1 
ATOM   5507 N NZ  . LYS B  1 358 ? -43.43478 12.33232 -38.30204 1.000 87.71685  ? 335 LYS B NZ  1 
ATOM   5508 N N   . ASP B  1 359 ? -38.56325 17.12633 -39.39150 1.000 83.94077  ? 336 ASP B N   1 
ATOM   5509 C CA  . ASP B  1 359 ? -38.07158 16.96382 -40.76177 1.000 84.18110  ? 336 ASP B CA  1 
ATOM   5510 C C   . ASP B  1 359 ? -37.96577 18.30436 -41.49050 1.000 81.82047  ? 336 ASP B C   1 
ATOM   5511 O O   . ASP B  1 359 ? -38.27722 18.41207 -42.67951 1.000 78.31633  ? 336 ASP B O   1 
ATOM   5512 C CB  . ASP B  1 359 ? -38.95740 15.99382 -41.54312 1.000 88.35151  ? 336 ASP B CB  1 
ATOM   5513 C CG  . ASP B  1 359 ? -39.05925 14.62488 -40.87841 1.000 95.00201  ? 336 ASP B CG  1 
ATOM   5514 O OD1 . ASP B  1 359 ? -38.07839 14.17998 -40.23634 1.000 96.25942  ? 336 ASP B OD1 1 
ATOM   5515 O OD2 . ASP B  1 359 ? -40.12646 13.98702 -41.00824 1.000 97.17797  ? 336 ASP B OD2 1 
ATOM   5516 N N   . GLY B  1 360 ? -37.55489 19.34370 -40.76291 1.000 81.21650  ? 337 GLY B N   1 
ATOM   5517 C CA  . GLY B  1 360 ? -37.30012 20.63700 -41.36280 1.000 79.34071  ? 337 GLY B CA  1 
ATOM   5518 C C   . GLY B  1 360 ? -38.50620 21.52485 -41.57995 1.000 73.63241  ? 337 GLY B C   1 
ATOM   5519 O O   . GLY B  1 360 ? -38.35632 22.60976 -42.15391 1.000 74.10460  ? 337 GLY B O   1 
ATOM   5520 N N   . HIS B  1 361 ? -39.69680 21.11394 -41.15608 1.000 71.64309  ? 338 HIS B N   1 
ATOM   5521 C CA  . HIS B  1 361 ? -40.86476 21.97691 -41.26242 1.000 73.45537  ? 338 HIS B CA  1 
ATOM   5522 C C   . HIS B  1 361 ? -41.50784 22.17007 -39.89259 1.000 68.16625  ? 338 HIS B C   1 
ATOM   5523 O O   . HIS B  1 361 ? -41.26594 21.40514 -38.95370 1.000 69.98226  ? 338 HIS B O   1 
ATOM   5524 C CB  . HIS B  1 361 ? -41.88471 21.41759 -42.26005 1.000 78.28779  ? 338 HIS B CB  1 
ATOM   5525 C CG  . HIS B  1 361 ? -42.37313 20.04672 -41.91762 1.000 81.45846  ? 338 HIS B CG  1 
ATOM   5526 N ND1 . HIS B  1 361 ? -43.35014 19.81823 -40.97108 1.000 80.20447  ? 338 HIS B ND1 1 
ATOM   5527 C CD2 . HIS B  1 361 ? -42.01505 18.83086 -42.38954 1.000 83.44700  ? 338 HIS B CD2 1 
ATOM   5528 C CE1 . HIS B  1 361 ? -43.57790 18.51903 -40.88094 1.000 80.02065  ? 338 HIS B CE1 1 
ATOM   5529 N NE2 . HIS B  1 361 ? -42.77657 17.89874 -41.72667 1.000 83.73848  ? 338 HIS B NE2 1 
ATOM   5530 N N   . VAL B  1 362 ? -42.32314 23.21648 -39.79219 1.000 60.44174  ? 339 VAL B N   1 
ATOM   5531 C CA  . VAL B  1 362 ? -43.01407 23.55093 -38.55132 1.000 56.88006  ? 339 VAL B CA  1 
ATOM   5532 C C   . VAL B  1 362 ? -44.15599 22.56597 -38.34770 1.000 60.34235  ? 339 VAL B C   1 
ATOM   5533 O O   . VAL B  1 362 ? -44.90392 22.26595 -39.28674 1.000 58.21259  ? 339 VAL B O   1 
ATOM   5534 C CB  . VAL B  1 362 ? -43.54103 24.99664 -38.59523 1.000 56.80993  ? 339 VAL B CB  1 
ATOM   5535 C CG1 . VAL B  1 362 ? -44.29294 25.34975 -37.30645 1.000 45.03596  ? 339 VAL B CG1 1 
ATOM   5536 C CG2 . VAL B  1 362 ? -42.41676 25.98915 -38.81710 1.000 59.04743  ? 339 VAL B CG2 1 
ATOM   5537 N N   . GLU B  1 363 ? -44.29340 22.05091 -37.12577 1.000 60.33727  ? 340 GLU B N   1 
ATOM   5538 C CA  . GLU B  1 363 ? -45.52530 21.35914 -36.75160 1.000 64.85878  ? 340 GLU B CA  1 
ATOM   5539 C C   . GLU B  1 363 ? -46.49514 22.34037 -36.10088 1.000 60.44670  ? 340 GLU B C   1 
ATOM   5540 O O   . GLU B  1 363 ? -47.61590 22.53554 -36.58566 1.000 57.44191  ? 340 GLU B O   1 
ATOM   5541 C CB  . GLU B  1 363 ? -45.23384 20.18191 -35.81443 1.000 69.21837  ? 340 GLU B CB  1 
ATOM   5542 C CG  . GLU B  1 363 ? -44.52487 19.02198 -36.47279 1.000 80.19516  ? 340 GLU B CG  1 
ATOM   5543 C CD  . GLU B  1 363 ? -44.45149 17.80018 -35.57320 1.000 86.81731  ? 340 GLU B CD  1 
ATOM   5544 O OE1 . GLU B  1 363 ? -43.74271 17.84253 -34.53958 1.000 89.20590  ? 340 GLU B OE1 1 
ATOM   5545 O OE2 . GLU B  1 363 ? -45.11745 16.79965 -35.89785 1.000 89.48616  ? 340 GLU B OE2 1 
ATOM   5546 N N   . THR B  1 364 ? -46.06641 22.97989 -35.01424 1.000 55.06981  ? 341 THR B N   1 
ATOM   5547 C CA  . THR B  1 364 ? -46.86114 24.04298 -34.42394 1.000 55.04941  ? 341 THR B CA  1 
ATOM   5548 C C   . THR B  1 364 ? -45.94801 25.07591 -33.76828 1.000 50.41468  ? 341 THR B C   1 
ATOM   5549 O O   . THR B  1 364 ? -44.76034 24.83346 -33.52006 1.000 47.08107  ? 341 THR B O   1 
ATOM   5550 C CB  . THR B  1 364 ? -47.88587 23.49078 -33.42681 1.000 56.70654  ? 341 THR B CB  1 
ATOM   5551 O OG1 . THR B  1 364 ? -48.68539 24.57509 -32.93779 1.000 54.93130  ? 341 THR B OG1 1 
ATOM   5552 C CG2 . THR B  1 364 ? -47.20227 22.77641 -32.26298 1.000 54.06046  ? 341 THR B CG2 1 
ATOM   5553 N N   . PHE B  1 365 ? -46.52959 26.24923 -33.51703 1.000 44.93596  ? 342 PHE B N   1 
ATOM   5554 C CA  . PHE B  1 365 ? -45.83985 27.41753 -32.97365 1.000 42.11033  ? 342 PHE B CA  1 
ATOM   5555 C C   . PHE B  1 365 ? -46.91957 28.20126 -32.24707 1.000 46.26183  ? 342 PHE B C   1 
ATOM   5556 O O   . PHE B  1 365 ? -47.90138 28.59779 -32.87712 1.000 48.75716  ? 342 PHE B O   1 
ATOM   5557 C CB  . PHE B  1 365 ? -45.20045 28.24291 -34.09697 1.000 42.80182  ? 342 PHE B CB  1 
ATOM   5558 C CG  . PHE B  1 365 ? -44.35939 29.41814 -33.63523 1.000 46.55718  ? 342 PHE B CG  1 
ATOM   5559 C CD1 . PHE B  1 365 ? -43.21287 29.22314 -32.88193 1.000 53.33802  ? 342 PHE B CD1 1 
ATOM   5560 C CD2 . PHE B  1 365 ? -44.66643 30.70825 -34.03703 1.000 49.78913  ? 342 PHE B CD2 1 
ATOM   5561 C CE1 . PHE B  1 365 ? -42.41209 30.29951 -32.49592 1.000 50.02327  ? 342 PHE B CE1 1 
ATOM   5562 C CE2 . PHE B  1 365 ? -43.88209 31.79745 -33.64348 1.000 46.11320  ? 342 PHE B CE2 1 
ATOM   5563 C CZ  . PHE B  1 365 ? -42.75124 31.58944 -32.87864 1.000 46.35348  ? 342 PHE B CZ  1 
ATOM   5564 N N   . TYR B  1 366 ? -46.80294 28.34924 -30.92831 1.000 41.40546  ? 343 TYR B N   1 
ATOM   5565 C CA  . TYR B  1 366 ? -47.88055 28.97021 -30.16444 1.000 39.09272  ? 343 TYR B CA  1 
ATOM   5566 C C   . TYR B  1 366 ? -47.29787 29.67901 -28.95430 1.000 41.79755  ? 343 TYR B C   1 
ATOM   5567 O O   . TYR B  1 366 ? -46.26047 29.25417 -28.42768 1.000 38.84756  ? 343 TYR B O   1 
ATOM   5568 C CB  . TYR B  1 366 ? -48.93851 27.93937 -29.70597 1.000 40.32905  ? 343 TYR B CB  1 
ATOM   5569 C CG  . TYR B  1 366 ? -48.35841 26.77290 -28.94839 1.000 45.92125  ? 343 TYR B CG  1 
ATOM   5570 C CD1 . TYR B  1 366 ? -48.25106 26.78481 -27.56239 1.000 50.09656  ? 343 TYR B CD1 1 
ATOM   5571 C CD2 . TYR B  1 366 ? -47.91243 25.65661 -29.62122 1.000 49.56480  ? 343 TYR B CD2 1 
ATOM   5572 C CE1 . TYR B  1 366 ? -47.70450 25.68776 -26.87284 1.000 50.95660  ? 343 TYR B CE1 1 
ATOM   5573 C CE2 . TYR B  1 366 ? -47.36738 24.58144 -28.95073 1.000 54.83382  ? 343 TYR B CE2 1 
ATOM   5574 C CZ  . TYR B  1 366 ? -47.26206 24.60029 -27.58046 1.000 53.00868  ? 343 TYR B CZ  1 
ATOM   5575 O OH  . TYR B  1 366 ? -46.70200 23.50515 -26.94981 1.000 59.63426  ? 343 TYR B OH  1 
ATOM   5576 N N   . PRO B  1 367 ? -47.93809 30.76236 -28.48916 1.000 45.08542  ? 344 PRO B N   1 
ATOM   5577 C CA  . PRO B  1 367 ? -47.58490 31.33445 -27.17736 1.000 52.44869  ? 344 PRO B CA  1 
ATOM   5578 C C   . PRO B  1 367 ? -47.58555 30.29806 -26.06114 1.000 61.59819  ? 344 PRO B C   1 
ATOM   5579 O O   . PRO B  1 367 ? -48.59791 29.61820 -25.83983 1.000 61.21169  ? 344 PRO B O   1 
ATOM   5580 C CB  . PRO B  1 367 ? -48.67638 32.38553 -26.95759 1.000 51.41206  ? 344 PRO B CB  1 
ATOM   5581 C CG  . PRO B  1 367 ? -49.06765 32.81241 -28.35999 1.000 44.68168  ? 344 PRO B CG  1 
ATOM   5582 C CD  . PRO B  1 367 ? -49.01131 31.52431 -29.15959 1.000 42.11599  ? 344 PRO B CD  1 
ATOM   5583 N N   . LYS B  1 368 ? -46.45691 30.16685 -25.35692 1.000 62.55970  ? 345 LYS B N   1 
ATOM   5584 C CA  . LYS B  1 368 ? -46.30346 29.12838 -24.33896 1.000 68.80519  ? 345 LYS B CA  1 
ATOM   5585 C C   . LYS B  1 368 ? -47.15849 29.42872 -23.10948 1.000 75.03884  ? 345 LYS B C   1 
ATOM   5586 O O   . LYS B  1 368 ? -47.23029 30.57231 -22.64346 1.000 74.06540  ? 345 LYS B O   1 
ATOM   5587 C CB  . LYS B  1 368 ? -44.83255 28.98538 -23.93748 1.000 70.57691  ? 345 LYS B CB  1 
ATOM   5588 C CG  . LYS B  1 368 ? -44.58857 28.16788 -22.67542 1.000 73.08576  ? 345 LYS B CG  1 
ATOM   5589 C CD  . LYS B  1 368 ? -43.12018 28.14804 -22.29969 1.000 76.46334  ? 345 LYS B CD  1 
ATOM   5590 C CE  . LYS B  1 368 ? -42.92388 27.55670 -20.90765 1.000 83.34734  ? 345 LYS B CE  1 
ATOM   5591 N NZ  . LYS B  1 368 ? -41.84629 26.52230 -20.87484 1.000 85.75058  ? 345 LYS B NZ  1 
ATOM   5592 N N   . LEU B  1 369 ? -47.80938 28.38296 -22.58806 1.000 78.47970  ? 346 LEU B N   1 
ATOM   5593 C CA  . LEU B  1 369 ? -48.73538 28.48829 -21.45693 1.000 78.50555  ? 346 LEU B CA  1 
ATOM   5594 C C   . LEU B  1 369 ? -48.13777 27.86859 -20.19795 1.000 80.82846  ? 346 LEU B C   1 
ATOM   5595 O O   . LEU B  1 369 ? -47.46468 28.54783 -19.42774 1.000 83.72795  ? 346 LEU B O   1 
ATOM   5596 C CB  . LEU B  1 369 ? -50.07583 27.80678 -21.78323 1.000 79.84097  ? 346 LEU B CB  1 
ATOM   5597 C CG  . LEU B  1 369 ? -50.86470 28.33634 -22.98590 1.000 75.38986  ? 346 LEU B CG  1 
ATOM   5598 C CD1 . LEU B  1 369 ? -52.03705 27.42195 -23.33419 1.000 73.13543  ? 346 LEU B CD1 1 
ATOM   5599 C CD2 . LEU B  1 369 ? -51.31847 29.78685 -22.73706 1.000 72.56354  ? 346 LEU B CD2 1 
HETATM 5600 C C1  . EDO C  2 .   ? -65.71758 36.54473 15.74817  1.000 59.53229  ? 401 EDO A C1  1 
HETATM 5601 O O1  . EDO C  2 .   ? -65.89920 35.16473 15.44332  1.000 65.78432  ? 401 EDO A O1  1 
HETATM 5602 C C2  . EDO C  2 .   ? -66.04408 37.25672 14.45679  1.000 56.45740  ? 401 EDO A C2  1 
HETATM 5603 O O2  . EDO C  2 .   ? -67.45957 37.28479 14.25466  1.000 44.28942  ? 401 EDO A O2  1 
HETATM 5604 C C1  . EDO D  2 .   ? -66.97361 25.32301 0.07528   1.000 46.36661  ? 402 EDO A C1  1 
HETATM 5605 O O1  . EDO D  2 .   ? -66.08709 24.69079 1.03992   1.000 33.40071  ? 402 EDO A O1  1 
HETATM 5606 C C2  . EDO D  2 .   ? -67.54738 24.39515 -0.99027  1.000 49.62056  ? 402 EDO A C2  1 
HETATM 5607 O O2  . EDO D  2 .   ? -67.39375 23.00983 -0.58866  1.000 46.02421  ? 402 EDO A O2  1 
HETATM 5608 C C1  . EDO E  2 .   ? -48.46554 41.02971 39.04702  1.000 73.41914  ? 403 EDO A C1  1 
HETATM 5609 O O1  . EDO E  2 .   ? -48.02025 40.57234 37.76902  1.000 69.86106  ? 403 EDO A O1  1 
HETATM 5610 C C2  . EDO E  2 .   ? -49.86683 41.60198 38.91423  1.000 74.48110  ? 403 EDO A C2  1 
HETATM 5611 O O2  . EDO E  2 .   ? -50.11183 42.48731 40.00582  1.000 75.99766  ? 403 EDO A O2  1 
HETATM 5612 C C1  . EDO F  2 .   ? -53.57246 83.59619 36.06497  1.000 48.77319  ? 404 EDO A C1  1 
HETATM 5613 O O1  . EDO F  2 .   ? -53.82926 83.13374 37.40364  1.000 44.15001  ? 404 EDO A O1  1 
HETATM 5614 C C2  . EDO F  2 .   ? -54.68832 84.42750 35.43724  1.000 55.11281  ? 404 EDO A C2  1 
HETATM 5615 O O2  . EDO F  2 .   ? -55.06685 85.49808 36.32717  1.000 64.34377  ? 404 EDO A O2  1 
HETATM 5616 C C1  . PEG G  3 .   ? -60.81106 68.71690 21.66914  1.000 90.82113  ? 405 PEG A C1  1 
HETATM 5617 O O1  . PEG G  3 .   ? -60.87155 67.48785 20.96201  1.000 94.54030  ? 405 PEG A O1  1 
HETATM 5618 C C2  . PEG G  3 .   ? -62.06378 69.00440 22.45091  1.000 84.00813  ? 405 PEG A C2  1 
HETATM 5619 O O2  . PEG G  3 .   ? -61.88927 68.66489 23.82345  1.000 79.07100  ? 405 PEG A O2  1 
HETATM 5620 C C3  . PEG G  3 .   ? -63.03510 68.95231 24.61921  1.000 73.21822  ? 405 PEG A C3  1 
HETATM 5621 C C4  . PEG G  3 .   ? -62.81880 68.46371 26.02748  1.000 63.81634  ? 405 PEG A C4  1 
HETATM 5622 O O4  . PEG G  3 .   ? -64.02414 68.02871 26.65977  1.000 47.34836  ? 405 PEG A O4  1 
HETATM 5623 C C1  . PEG H  3 .   ? -43.77709 58.37433 15.55627  1.000 80.14701  ? 406 PEG A C1  1 
HETATM 5624 O O1  . PEG H  3 .   ? -45.01678 58.37247 14.87228  1.000 78.25109  ? 406 PEG A O1  1 
HETATM 5625 C C2  . PEG H  3 .   ? -43.94794 58.04554 17.00042  1.000 81.27380  ? 406 PEG A C2  1 
HETATM 5626 O O2  . PEG H  3 .   ? -42.74103 58.23293 17.73196  1.000 84.11173  ? 406 PEG A O2  1 
HETATM 5627 C C3  . PEG H  3 .   ? -42.94777 58.18796 19.14035  1.000 78.27372  ? 406 PEG A C3  1 
HETATM 5628 C C4  . PEG H  3 .   ? -41.65716 58.35342 19.86816  1.000 76.59772  ? 406 PEG A C4  1 
HETATM 5629 O O4  . PEG H  3 .   ? -41.85648 58.46534 21.26162  1.000 76.20534  ? 406 PEG A O4  1 
HETATM 5630 C C1  . EDO I  2 .   ? -49.93213 54.55093 12.85369  1.000 79.94269  ? 407 EDO A C1  1 
HETATM 5631 O O1  . EDO I  2 .   ? -50.43130 55.44080 13.86044  1.000 77.31789  ? 407 EDO A O1  1 
HETATM 5632 C C2  . EDO I  2 .   ? -48.40823 54.53980 12.88705  1.000 81.83040  ? 407 EDO A C2  1 
HETATM 5633 O O2  . EDO I  2 .   ? -47.86942 55.22721 11.74956  1.000 83.75999  ? 407 EDO A O2  1 
HETATM 5634 C C1  . EDO J  2 .   ? -52.40541 76.41325 44.62667  1.000 66.67015  ? 408 EDO A C1  1 
HETATM 5635 O O1  . EDO J  2 .   ? -53.47241 76.12304 45.51994  1.000 71.36919  ? 408 EDO A O1  1 
HETATM 5636 C C2  . EDO J  2 .   ? -52.75969 77.69414 43.89281  1.000 69.99765  ? 408 EDO A C2  1 
HETATM 5637 O O2  . EDO J  2 .   ? -54.09328 77.56932 43.40728  1.000 73.25678  ? 408 EDO A O2  1 
HETATM 5638 C C1  . EDO K  2 .   ? -65.02212 53.46357 29.38345  1.000 74.23133  ? 409 EDO A C1  1 
HETATM 5639 O O1  . EDO K  2 .   ? -65.53806 52.28912 30.01553  1.000 74.93110  ? 409 EDO A O1  1 
HETATM 5640 C C2  . EDO K  2 .   ? -63.55630 53.58117 29.78033  1.000 76.45544  ? 409 EDO A C2  1 
HETATM 5641 O O2  . EDO K  2 .   ? -62.72560 52.66916 29.04341  1.000 73.08584  ? 409 EDO A O2  1 
HETATM 5642 C C1  . EDO L  2 .   ? -49.17277 65.04915 46.22135  1.000 75.49999  ? 410 EDO A C1  1 
HETATM 5643 O O1  . EDO L  2 .   ? -48.68336 66.38857 46.35639  1.000 76.03804  ? 410 EDO A O1  1 
HETATM 5644 C C2  . EDO L  2 .   ? -50.17493 64.78013 47.33065  1.000 71.88872  ? 410 EDO A C2  1 
HETATM 5645 O O2  . EDO L  2 .   ? -51.02077 65.92965 47.41134  1.000 75.63769  ? 410 EDO A O2  1 
HETATM 5646 C C1  . EDO M  2 .   ? -44.94118 67.05038 42.55088  1.000 77.53389  ? 411 EDO A C1  1 
HETATM 5647 O O1  . EDO M  2 .   ? -44.17179 65.85739 42.32864  1.000 70.20742  ? 411 EDO A O1  1 
HETATM 5648 C C2  . EDO M  2 .   ? -44.30781 67.90924 43.64678  1.000 80.26250  ? 411 EDO A C2  1 
HETATM 5649 O O2  . EDO M  2 .   ? -44.92046 69.20706 43.67218  1.000 76.97373  ? 411 EDO A O2  1 
HETATM 5650 C C1  . CIT N  4 .   ? -66.97565 72.58484 30.36309  1.000 42.79480  ? 412 CIT A C1  1 
HETATM 5651 O O1  . CIT N  4 .   ? -68.12346 73.10363 30.32008  1.000 44.14580  ? 412 CIT A O1  1 
HETATM 5652 O O2  . CIT N  4 .   ? -66.65031 71.94777 31.39038  1.000 40.55389  ? 412 CIT A O2  1 
HETATM 5653 C C2  . CIT N  4 .   ? -66.02593 72.72247 29.20061  1.000 42.62163  ? 412 CIT A C2  1 
HETATM 5654 C C3  . CIT N  4 .   ? -64.68853 71.97328 29.40396  1.000 43.50357  ? 412 CIT A C3  1 
HETATM 5655 O O7  . CIT N  4 .   ? -64.91938 70.55073 29.17233  1.000 40.19307  ? 412 CIT A O7  1 
HETATM 5656 C C4  . CIT N  4 .   ? -63.65694 72.50954 28.43575  1.000 36.71858  ? 412 CIT A C4  1 
HETATM 5657 C C5  . CIT N  4 .   ? -64.15360 72.21712 27.05880  1.000 44.97566  ? 412 CIT A C5  1 
HETATM 5658 O O3  . CIT N  4 .   ? -64.04859 73.09138 26.17286  1.000 43.65959  ? 412 CIT A O3  1 
HETATM 5659 O O4  . CIT N  4 .   ? -64.69427 71.10024 26.81366  1.000 44.82514  ? 412 CIT A O4  1 
HETATM 5660 C C6  . CIT N  4 .   ? -64.04331 72.16173 30.76630  1.000 40.85288  ? 412 CIT A C6  1 
HETATM 5661 O O5  . CIT N  4 .   ? -63.97563 73.30713 31.20840  1.000 37.78992  ? 412 CIT A O5  1 
HETATM 5662 O O6  . CIT N  4 .   ? -63.61519 71.20193 31.45207  1.000 39.94865  ? 412 CIT A O6  1 
HETATM 5663 C C1  . EDO O  2 .   ? -50.18793 50.28549 34.83044  1.000 62.03407  ? 413 EDO A C1  1 
HETATM 5664 O O1  . EDO O  2 .   ? -50.39077 50.35415 36.26105  1.000 53.31049  ? 413 EDO A O1  1 
HETATM 5665 C C2  . EDO O  2 .   ? -49.34693 51.43400 34.26726  1.000 59.27629  ? 413 EDO A C2  1 
HETATM 5666 O O2  . EDO O  2 .   ? -48.09609 50.95504 33.76010  1.000 58.35921  ? 413 EDO A O2  1 
HETATM 5667 C C1  . EDO P  2 .   ? -41.23410 56.09977 32.42178  1.000 56.71830  ? 414 EDO A C1  1 
HETATM 5668 O O1  . EDO P  2 .   ? -40.79405 56.71012 31.20363  1.000 52.53088  ? 414 EDO A O1  1 
HETATM 5669 C C2  . EDO P  2 .   ? -41.62273 54.63434 32.19778  1.000 62.42192  ? 414 EDO A C2  1 
HETATM 5670 O O2  . EDO P  2 .   ? -40.67363 53.97344 31.34625  1.000 60.43915  ? 414 EDO A O2  1 
HETATM 5671 C C1  . EDO Q  2 .   ? -67.83331 53.11987 -14.93948 1.000 64.70559  ? 401 EDO B C1  1 
HETATM 5672 O O1  . EDO Q  2 .   ? -67.56097 51.76722 -14.49988 1.000 57.44904  ? 401 EDO B O1  1 
HETATM 5673 C C2  . EDO Q  2 .   ? -69.06901 53.20626 -15.85273 1.000 68.47047  ? 401 EDO B C2  1 
HETATM 5674 O O2  . EDO Q  2 .   ? -70.04275 54.16974 -15.38470 1.000 70.68486  ? 401 EDO B O2  1 
HETATM 5675 C C1  . EDO R  2 .   ? -76.83274 63.62676 -0.09190  1.000 50.15470  ? 402 EDO B C1  1 
HETATM 5676 O O1  . EDO R  2 .   ? -76.21767 64.59575 -0.96565  1.000 36.65477  ? 402 EDO B O1  1 
HETATM 5677 C C2  . EDO R  2 .   ? -77.59218 64.20015 1.10749   1.000 57.83889  ? 402 EDO B C2  1 
HETATM 5678 O O2  . EDO R  2 .   ? -78.38587 65.34210 0.72403   1.000 52.65456  ? 402 EDO B O2  1 
HETATM 5679 C C1  . EDO S  2 .   ? -48.53677 39.57470 -20.16377 1.000 58.34143  ? 403 EDO B C1  1 
HETATM 5680 O O1  . EDO S  2 .   ? -47.24251 39.50630 -19.51981 1.000 66.30050  ? 403 EDO B O1  1 
HETATM 5681 C C2  . EDO S  2 .   ? -48.45858 38.72922 -21.43556 1.000 53.69673  ? 403 EDO B C2  1 
HETATM 5682 O O2  . EDO S  2 .   ? -49.67339 38.72262 -22.18656 1.000 37.57897  ? 403 EDO B O2  1 
HETATM 5683 C C1  . EDO T  2 .   ? -46.74971 46.68378 -12.23407 1.000 87.09016  ? 404 EDO B C1  1 
HETATM 5684 O O1  . EDO T  2 .   ? -45.90606 45.93031 -11.35303 1.000 90.38634  ? 404 EDO B O1  1 
HETATM 5685 C C2  . EDO T  2 .   ? -47.67262 45.79347 -13.05823 1.000 82.66558  ? 404 EDO B C2  1 
HETATM 5686 O O2  . EDO T  2 .   ? -46.89592 44.99448 -13.96075 1.000 81.27308  ? 404 EDO B O2  1 
HETATM 5687 C C1  . EDO U  2 .   ? -34.74894 65.75727 -33.06174 1.000 60.73723  ? 405 EDO B C1  1 
HETATM 5688 O O1  . EDO U  2 .   ? -34.78376 64.33144 -32.93226 1.000 66.76238  ? 405 EDO B O1  1 
HETATM 5689 C C2  . EDO U  2 .   ? -34.86974 66.39050 -31.67952 1.000 56.64234  ? 405 EDO B C2  1 
HETATM 5690 O O2  . EDO U  2 .   ? -36.24763 66.52450 -31.31883 1.000 49.44709  ? 405 EDO B O2  1 
HETATM 5691 C C1  . EDO V  2 .   ? -42.76234 59.93075 -32.01984 1.000 74.00412  ? 406 EDO B C1  1 
HETATM 5692 O O1  . EDO V  2 .   ? -42.58740 58.84115 -31.10739 1.000 75.00994  ? 406 EDO B O1  1 
HETATM 5693 C C2  . EDO V  2 .   ? -42.89085 61.22070 -31.22067 1.000 74.00246  ? 406 EDO B C2  1 
HETATM 5694 O O2  . EDO V  2 .   ? -44.13328 61.20640 -30.51506 1.000 71.45413  ? 406 EDO B O2  1 
HETATM 5695 C C1  . EDO W  2 .   ? -49.15704 49.22315 -33.89139 1.000 71.95321  ? 407 EDO B C1  1 
HETATM 5696 O O1  . EDO W  2 .   ? -48.17808 50.21808 -33.56004 1.000 64.74182  ? 407 EDO B O1  1 
HETATM 5697 C C2  . EDO W  2 .   ? -50.39341 49.86850 -34.52958 1.000 77.69054  ? 407 EDO B C2  1 
HETATM 5698 O O2  . EDO W  2 .   ? -50.52137 49.57733 -35.93588 1.000 77.61043  ? 407 EDO B O2  1 
HETATM 5699 C C1  . CIT X  4 .   ? -53.66369 22.10768 -30.16646 1.000 59.82921  ? 408 CIT B C1  1 
HETATM 5700 O O1  . CIT X  4 .   ? -53.72606 22.73064 -31.24704 1.000 62.30786  ? 408 CIT B O1  1 
HETATM 5701 O O2  . CIT X  4 .   ? -54.54063 21.23020 -29.94578 1.000 60.58916  ? 408 CIT B O2  1 
HETATM 5702 C C2  . CIT X  4 .   ? -52.57527 22.40719 -29.15662 1.000 52.45151  ? 408 CIT B C2  1 
HETATM 5703 C C3  . CIT X  4 .   ? -51.93894 23.79092 -29.35485 1.000 56.20568  ? 408 CIT B C3  1 
HETATM 5704 O O7  . CIT X  4 .   ? -52.94832 24.82326 -29.18353 1.000 50.47341  ? 408 CIT B O7  1 
HETATM 5705 C C4  . CIT X  4 .   ? -50.83410 23.98336 -28.32787 1.000 57.01943  ? 408 CIT B C4  1 
HETATM 5706 C C5  . CIT X  4 .   ? -51.43357 23.91524 -26.94897 1.000 60.47858  ? 408 CIT B C5  1 
HETATM 5707 O O3  . CIT X  4 .   ? -52.47884 24.54291 -26.68972 1.000 54.22547  ? 408 CIT B O3  1 
HETATM 5708 O O4  . CIT X  4 .   ? -50.88747 23.23064 -26.05602 1.000 65.34954  ? 408 CIT B O4  1 
HETATM 5709 C C6  . CIT X  4 .   ? -51.28032 23.98439 -30.71821 1.000 56.85157  ? 408 CIT B C6  1 
HETATM 5710 O O5  . CIT X  4 .   ? -51.41028 25.06693 -31.33094 1.000 51.10044  ? 408 CIT B O5  1 
HETATM 5711 O O6  . CIT X  4 .   ? -50.61559 23.06787 -31.24424 1.000 52.12243  ? 408 CIT B O6  1 
HETATM 5712 C C1  . EDO Y  2 .   ? -32.04457 63.59584 -26.87206 1.000 33.75329  ? 409 EDO B C1  1 
HETATM 5713 O O1  . EDO Y  2 .   ? -31.51432 64.93229 -26.78499 1.000 31.43144  ? 409 EDO B O1  1 
HETATM 5714 C C2  . EDO Y  2 .   ? -31.87917 63.07530 -28.28914 1.000 30.86866  ? 409 EDO B C2  1 
HETATM 5715 O O2  . EDO Y  2 .   ? -32.87974 63.71817 -29.09188 1.000 36.38937  ? 409 EDO B O2  1 
HETATM 5716 C C1  . EDO Z  2 .   ? -40.36500 50.16343 -31.54562 1.000 46.71882  ? 410 EDO B C1  1 
HETATM 5717 O O1  . EDO Z  2 .   ? -39.81263 51.06003 -30.56592 1.000 43.26836  ? 410 EDO B O1  1 
HETATM 5718 C C2  . EDO Z  2 .   ? -39.30120 49.23035 -32.11622 1.000 45.36726  ? 410 EDO B C2  1 
HETATM 5719 O O2  . EDO Z  2 .   ? -38.50319 48.67124 -31.06439 1.000 45.94359  ? 410 EDO B O2  1 
HETATM 5720 C C1  . PEG AA 3 .   ? -39.81470 45.88780 -19.26893 1.000 70.44820  ? 411 PEG B C1  1 
HETATM 5721 O O1  . PEG AA 3 .   ? -38.81002 46.50440 -20.05633 1.000 65.74383  ? 411 PEG B O1  1 
HETATM 5722 C C2  . PEG AA 3 .   ? -39.80155 46.36806 -17.84715 1.000 79.03864  ? 411 PEG B C2  1 
HETATM 5723 O O2  . PEG AA 3 .   ? -40.85994 45.77278 -17.09825 1.000 84.28959  ? 411 PEG B O2  1 
HETATM 5724 C C3  . PEG AA 3 .   ? -40.91984 46.22247 -15.74660 1.000 86.64846  ? 411 PEG B C3  1 
HETATM 5725 C C4  . PEG AA 3 .   ? -39.66979 45.85396 -15.00144 1.000 88.24654  ? 411 PEG B C4  1 
HETATM 5726 O O4  . PEG AA 3 .   ? -39.32902 46.80982 -14.00713 1.000 82.98449  ? 411 PEG B O4  1 
HETATM 5727 C C1  . EDO BA 2 .   ? -38.17469 40.45913 -30.88224 1.000 48.28104  ? 412 EDO B C1  1 
HETATM 5728 O O1  . EDO BA 2 .   ? -37.51794 40.14023 -29.64530 1.000 52.13337  ? 412 EDO B O1  1 
HETATM 5729 C C2  . EDO BA 2 .   ? -38.17373 41.96842 -31.11844 1.000 58.84226  ? 412 EDO B C2  1 
HETATM 5730 O O2  . EDO BA 2 .   ? -36.82799 42.46924 -31.03111 1.000 69.21714  ? 412 EDO B O2  1 
HETATM 5731 C C1  . EDO CA 2 .   ? -41.46957 66.82977 -23.51439 1.000 67.62601  ? 413 EDO B C1  1 
HETATM 5732 O O1  . EDO CA 2 .   ? -40.91226 68.12837 -23.29851 1.000 78.50690  ? 413 EDO B O1  1 
HETATM 5733 C C2  . EDO CA 2 .   ? -41.07745 66.43068 -24.92659 1.000 62.14633  ? 413 EDO B C2  1 
HETATM 5734 O O2  . EDO CA 2 .   ? -42.21366 66.54112 -25.78964 1.000 58.83032  ? 413 EDO B O2  1 
HETATM 5735 O O   . HOH DA 5 .   ? -36.06493 61.62681 35.47570  1.000 52.04401  ? 501 HOH A O   1 
HETATM 5736 O O   . HOH DA 5 .   ? -64.20372 43.43290 19.74542  1.000 48.77191  ? 502 HOH A O   1 
HETATM 5737 O O   . HOH DA 5 .   ? -62.29822 81.09659 39.05991  1.000 63.21794  ? 503 HOH A O   1 
HETATM 5738 O O   . HOH DA 5 .   ? -43.32477 55.05210 9.06296   1.000 42.64410  ? 504 HOH A O   1 
HETATM 5739 O O   . HOH DA 5 .   ? -47.01593 47.20202 26.16400  1.000 35.62847  ? 505 HOH A O   1 
HETATM 5740 O O   . HOH DA 5 .   ? -71.89311 57.12516 17.89236  1.000 42.53951  ? 506 HOH A O   1 
HETATM 5741 O O   . HOH DA 5 .   ? -43.63783 68.28918 23.52345  1.000 43.38152  ? 507 HOH A O   1 
HETATM 5742 O O   . HOH DA 5 .   ? -57.24320 23.14880 1.34346   1.000 46.40426  ? 508 HOH A O   1 
HETATM 5743 O O   . HOH DA 5 .   ? -49.17910 74.33552 42.29233  1.000 43.99735  ? 509 HOH A O   1 
HETATM 5744 O O   . HOH DA 5 .   ? -78.08384 37.17832 1.18240   1.000 41.42696  ? 510 HOH A O   1 
HETATM 5745 O O   . HOH DA 5 .   ? -76.74886 60.07783 36.41990  1.000 38.14841  ? 511 HOH A O   1 
HETATM 5746 O O   . HOH DA 5 .   ? -58.87882 53.28982 24.00752  1.000 33.12805  ? 512 HOH A O   1 
HETATM 5747 O O   . HOH DA 5 .   ? -74.18892 37.84441 -0.07664  1.000 50.85078  ? 513 HOH A O   1 
HETATM 5748 O O   . HOH DA 5 .   ? -49.09261 59.79903 45.55355  1.000 55.54153  ? 514 HOH A O   1 
HETATM 5749 O O   . HOH DA 5 .   ? -62.96233 41.26665 16.87610  1.000 42.61034  ? 515 HOH A O   1 
HETATM 5750 O O   . HOH DA 5 .   ? -29.69113 51.71625 23.72343  1.000 50.01950  ? 516 HOH A O   1 
HETATM 5751 O O   . HOH DA 5 .   ? -76.23059 72.98197 26.94213  1.000 49.34503  ? 517 HOH A O   1 
HETATM 5752 O O   . HOH DA 5 .   ? -74.19492 54.90668 23.96522  1.000 66.14620  ? 518 HOH A O   1 
HETATM 5753 O O   . HOH DA 5 .   ? -65.79346 31.66285 15.38398  1.000 38.10895  ? 519 HOH A O   1 
HETATM 5754 O O   . HOH DA 5 .   ? -53.47370 41.39287 37.45619  1.000 58.55768  ? 520 HOH A O   1 
HETATM 5755 O O   . HOH DA 5 .   ? -47.66111 41.07980 9.48410   1.000 31.16205  ? 521 HOH A O   1 
HETATM 5756 O O   . HOH DA 5 .   ? -65.01655 58.26665 20.66934  1.000 31.33881  ? 522 HOH A O   1 
HETATM 5757 O O   . HOH DA 5 .   ? -49.65846 67.37631 21.35359  1.000 44.76295  ? 523 HOH A O   1 
HETATM 5758 O O   . HOH DA 5 .   ? -57.70852 51.61727 17.18383  1.000 30.07889  ? 524 HOH A O   1 
HETATM 5759 O O   . HOH DA 5 .   ? -51.38263 56.96923 46.72273  1.000 43.96569  ? 525 HOH A O   1 
HETATM 5760 O O   . HOH DA 5 .   ? -44.83032 43.90897 -2.15789  1.000 63.38102  ? 526 HOH A O   1 
HETATM 5761 O O   . HOH DA 5 .   ? -78.98394 72.24342 38.43831  1.000 51.60285  ? 527 HOH A O   1 
HETATM 5762 O O   . HOH DA 5 .   ? -35.10697 51.81382 24.52430  1.000 37.03822  ? 528 HOH A O   1 
HETATM 5763 O O   . HOH DA 5 .   ? -56.23624 48.04366 23.84316  1.000 40.73771  ? 529 HOH A O   1 
HETATM 5764 O O   . HOH DA 5 .   ? -43.73699 55.49381 11.58470  1.000 53.46291  ? 530 HOH A O   1 
HETATM 5765 O O   . HOH DA 5 .   ? -43.60290 60.49646 38.20282  1.000 56.13423  ? 531 HOH A O   1 
HETATM 5766 O O   . HOH DA 5 .   ? -50.99779 56.81810 35.04692  1.000 35.74344  ? 532 HOH A O   1 
HETATM 5767 O O   . HOH DA 5 .   ? -44.51811 34.05993 8.62127   1.000 45.71384  ? 533 HOH A O   1 
HETATM 5768 O O   . HOH DA 5 .   ? -46.589   74.628   27.913    1.000 47.03744  ? 534 HOH A O   1 
HETATM 5769 O O   . HOH DA 5 .   ? -64.58515 53.59752 25.03328  1.000 44.75848  ? 535 HOH A O   1 
HETATM 5770 O O   . HOH DA 5 .   ? -57.44076 54.46944 26.05667  1.000 33.46316  ? 536 HOH A O   1 
HETATM 5771 O O   . HOH DA 5 .   ? -38.62141 36.12563 26.26687  1.000 52.20604  ? 537 HOH A O   1 
HETATM 5772 O O   . HOH DA 5 .   ? -63.61934 61.66532 46.86026  1.000 39.76424  ? 538 HOH A O   1 
HETATM 5773 O O   . HOH DA 5 .   ? -63.53018 62.95017 35.80172  1.000 36.13233  ? 539 HOH A O   1 
HETATM 5774 O O   . HOH DA 5 .   ? -64.49695 40.46950 14.11657  1.000 44.53184  ? 540 HOH A O   1 
HETATM 5775 O O   . HOH DA 5 .   ? -34.31816 47.29564 7.38128   1.000 62.13222  ? 541 HOH A O   1 
HETATM 5776 O O   . HOH DA 5 .   ? -41.10929 54.44605 9.37185   1.000 42.08727  ? 542 HOH A O   1 
HETATM 5777 O O   . HOH DA 5 .   ? -45.84760 46.38279 28.50457  1.000 30.62488  ? 543 HOH A O   1 
HETATM 5778 O O   . HOH DA 5 .   ? -51.93242 34.71915 40.37329  1.000 51.86275  ? 544 HOH A O   1 
HETATM 5779 O O   . HOH DA 5 .   ? -53.52178 50.86392 14.07764  1.000 47.99066  ? 545 HOH A O   1 
HETATM 5780 O O   . HOH DA 5 .   ? -46.48541 59.84501 19.00929  1.000 40.21506  ? 546 HOH A O   1 
HETATM 5781 O O   . HOH DA 5 .   ? -64.946   27.921   -1.184    1.000 31.24997  ? 547 HOH A O   1 
HETATM 5782 O O   . HOH DA 5 .   ? -67.57979 62.19421 40.15458  1.000 37.23826  ? 548 HOH A O   1 
HETATM 5783 O O   . HOH DA 5 .   ? -37.65394 48.27985 8.83275   1.000 44.14865  ? 549 HOH A O   1 
HETATM 5784 O O   . HOH DA 5 .   ? -74.89780 60.72069 25.25483  1.000 30.09117  ? 550 HOH A O   1 
HETATM 5785 O O   . HOH DA 5 .   ? -59.64012 70.98529 44.20300  1.000 37.41927  ? 551 HOH A O   1 
HETATM 5786 O O   . HOH DA 5 .   ? -53.77202 32.87208 15.65170  1.000 29.99022  ? 552 HOH A O   1 
HETATM 5787 O O   . HOH DA 5 .   ? -64.35173 50.23471 20.43844  1.000 33.67886  ? 553 HOH A O   1 
HETATM 5788 O O   . HOH DA 5 .   ? -57.75040 47.69690 9.59684   1.000 37.67286  ? 554 HOH A O   1 
HETATM 5789 O O   . HOH DA 5 .   ? -63.32364 52.63586 21.36556  1.000 36.54276  ? 555 HOH A O   1 
HETATM 5790 O O   . HOH DA 5 .   ? -68.88672 40.15584 0.92407   1.000 28.41421  ? 556 HOH A O   1 
HETATM 5791 O O   . HOH DA 5 .   ? -56.26123 47.28795 41.84013  1.000 43.20806  ? 557 HOH A O   1 
HETATM 5792 O O   . HOH DA 5 .   ? -31.80113 46.05491 27.42977  1.000 50.60952  ? 558 HOH A O   1 
HETATM 5793 O O   . HOH DA 5 .   ? -63.48993 75.52384 38.09074  1.000 41.32412  ? 559 HOH A O   1 
HETATM 5794 O O   . HOH DA 5 .   ? -53.14782 78.80080 32.17855  1.000 39.32683  ? 560 HOH A O   1 
HETATM 5795 O O   . HOH DA 5 .   ? -54.30233 55.40963 18.73626  1.000 30.02372  ? 561 HOH A O   1 
HETATM 5796 O O   . HOH DA 5 .   ? -71.53192 26.47040 5.39021   1.000 30.79593  ? 562 HOH A O   1 
HETATM 5797 O O   . HOH DA 5 .   ? -67.56935 41.33967 16.58438  1.000 62.99105  ? 563 HOH A O   1 
HETATM 5798 O O   . HOH DA 5 .   ? -51.66736 57.18439 15.49800  1.000 53.22394  ? 564 HOH A O   1 
HETATM 5799 O O   . HOH DA 5 .   ? -55.10113 41.08066 22.08366  1.000 25.38475  ? 565 HOH A O   1 
HETATM 5800 O O   . HOH DA 5 .   ? -56.265   31.311   2.257     1.000 43.44745  ? 566 HOH A O   1 
HETATM 5801 O O   . HOH DA 5 .   ? -58.47808 57.75567 35.90286  1.000 30.64893  ? 567 HOH A O   1 
HETATM 5802 O O   . HOH DA 5 .   ? -64.18323 48.19782 11.83981  1.000 38.58730  ? 568 HOH A O   1 
HETATM 5803 O O   . HOH DA 5 .   ? -52.81006 33.28452 2.37998   1.000 33.60864  ? 569 HOH A O   1 
HETATM 5804 O O   . HOH DA 5 .   ? -39.23371 55.85001 28.56800  1.000 41.69068  ? 570 HOH A O   1 
HETATM 5805 O O   . HOH DA 5 .   ? -53.42587 38.72585 22.01031  1.000 25.96920  ? 571 HOH A O   1 
HETATM 5806 O O   . HOH DA 5 .   ? -54.35321 42.52091 19.88311  1.000 25.15109  ? 572 HOH A O   1 
HETATM 5807 O O   . HOH DA 5 .   ? -67.18186 39.97511 14.25366  1.000 40.45018  ? 573 HOH A O   1 
HETATM 5808 O O   . HOH DA 5 .   ? -74.96631 27.73912 2.95373   1.000 31.66470  ? 574 HOH A O   1 
HETATM 5809 O O   . HOH DA 5 .   ? -67.57415 22.02489 9.77504   1.000 34.00406  ? 575 HOH A O   1 
HETATM 5810 O O   . HOH DA 5 .   ? -45.20581 37.65486 27.47526  1.000 36.25596  ? 576 HOH A O   1 
HETATM 5811 O O   . HOH DA 5 .   ? -72.74663 71.79156 34.57977  1.000 32.84508  ? 577 HOH A O   1 
HETATM 5812 O O   . HOH DA 5 .   ? -53.08264 26.59146 19.58353  1.000 44.51271  ? 578 HOH A O   1 
HETATM 5813 O O   . HOH DA 5 .   ? -67.71753 73.81792 37.96803  1.000 36.93203  ? 579 HOH A O   1 
HETATM 5814 O O   . HOH DA 5 .   ? -47.58312 59.30606 40.69117  1.000 43.84957  ? 580 HOH A O   1 
HETATM 5815 O O   . HOH DA 5 .   ? -56.99186 56.90811 28.63423  1.000 27.61737  ? 581 HOH A O   1 
HETATM 5816 O O   . HOH DA 5 .   ? -60.31598 55.69182 52.50448  1.000 59.68230  ? 582 HOH A O   1 
HETATM 5817 O O   . HOH DA 5 .   ? -77.91031 69.09642 28.66567  1.000 31.18628  ? 583 HOH A O   1 
HETATM 5818 O O   . HOH DA 5 .   ? -69.63365 53.86416 18.25701  1.000 48.06278  ? 584 HOH A O   1 
HETATM 5819 O O   . HOH DA 5 .   ? -53.28256 66.01144 22.30875  1.000 35.16878  ? 585 HOH A O   1 
HETATM 5820 O O   . HOH DA 5 .   ? -56.83540 50.88799 25.88053  1.000 31.88096  ? 586 HOH A O   1 
HETATM 5821 O O   . HOH DA 5 .   ? -51.29482 44.89329 1.58987   1.000 43.16643  ? 587 HOH A O   1 
HETATM 5822 O O   . HOH DA 5 .   ? -45.79017 56.15157 10.23189  1.000 69.89633  ? 588 HOH A O   1 
HETATM 5823 O O   . HOH DA 5 .   ? -49.53738 73.90788 39.79455  1.000 35.42316  ? 589 HOH A O   1 
HETATM 5824 O O   . HOH DA 5 .   ? -59.32404 53.12666 29.53703  1.000 33.11212  ? 590 HOH A O   1 
HETATM 5825 O O   . HOH DA 5 .   ? -71.32043 70.41192 24.45401  1.000 39.92152  ? 591 HOH A O   1 
HETATM 5826 O O   . HOH DA 5 .   ? -43.254   67.734   40.043    1.000 38.14225  ? 592 HOH A O   1 
HETATM 5827 O O   . HOH DA 5 .   ? -50.86879 58.14334 17.84310  1.000 40.40867  ? 593 HOH A O   1 
HETATM 5828 O O   . HOH DA 5 .   ? -51.61260 31.72525 14.24055  1.000 48.19952  ? 594 HOH A O   1 
HETATM 5829 O O   . HOH DA 5 .   ? -36.01617 47.00703 32.08689  1.000 50.34288  ? 595 HOH A O   1 
HETATM 5830 O O   . HOH DA 5 .   ? -77.67952 18.98097 12.63238  1.000 42.18300  ? 596 HOH A O   1 
HETATM 5831 O O   . HOH DA 5 .   ? -32.96624 36.70687 12.73999  1.000 46.84959  ? 597 HOH A O   1 
HETATM 5832 O O   . HOH DA 5 .   ? -34.80054 52.47948 22.17833  1.000 36.93735  ? 598 HOH A O   1 
HETATM 5833 O O   . HOH DA 5 .   ? -58.34871 42.62425 33.13036  1.000 45.42850  ? 599 HOH A O   1 
HETATM 5834 O O   . HOH DA 5 .   ? -72.78564 68.84602 40.28122  1.000 45.27240  ? 600 HOH A O   1 
HETATM 5835 O O   . HOH DA 5 .   ? -46.94409 43.65297 34.46461  1.000 38.83919  ? 601 HOH A O   1 
HETATM 5836 O O   . HOH DA 5 .   ? -50.69079 79.34869 33.28442  1.000 37.87637  ? 602 HOH A O   1 
HETATM 5837 O O   . HOH DA 5 .   ? -55.36326 25.28023 19.95883  1.000 44.94899  ? 603 HOH A O   1 
HETATM 5838 O O   . HOH DA 5 .   ? -75.28626 23.46352 5.01465   1.000 57.53877  ? 604 HOH A O   1 
HETATM 5839 O O   . HOH DA 5 .   ? -46.72999 75.14097 33.24032  1.000 37.01878  ? 605 HOH A O   1 
HETATM 5840 O O   . HOH DA 5 .   ? -49.50275 50.79036 15.01214  1.000 26.78821  ? 606 HOH A O   1 
HETATM 5841 O O   . HOH DA 5 .   ? -46.37061 74.05424 40.09429  1.000 49.19326  ? 607 HOH A O   1 
HETATM 5842 O O   . HOH DA 5 .   ? -56.00420 37.42797 20.18971  1.000 42.35270  ? 608 HOH A O   1 
HETATM 5843 O O   . HOH DA 5 .   ? -38.12169 38.63650 25.27350  1.000 38.60009  ? 609 HOH A O   1 
HETATM 5844 O O   . HOH DA 5 .   ? -47.59474 56.52120 34.41553  1.000 33.84115  ? 610 HOH A O   1 
HETATM 5845 O O   . HOH DA 5 .   ? -54.87134 17.86826 11.58806  1.000 48.40270  ? 611 HOH A O   1 
HETATM 5846 O O   . HOH DA 5 .   ? -59.31153 81.40817 32.98524  1.000 58.28646  ? 612 HOH A O   1 
HETATM 5847 O O   . HOH DA 5 .   ? -48.47960 35.19460 15.65133  1.000 47.94056  ? 613 HOH A O   1 
HETATM 5848 O O   . HOH DA 5 .   ? -75.42914 20.47320 13.74676  1.000 39.83055  ? 614 HOH A O   1 
HETATM 5849 O O   . HOH DA 5 .   ? -56.44144 17.44546 4.21840   1.000 66.88475  ? 615 HOH A O   1 
HETATM 5850 O O   . HOH DA 5 .   ? -59.99589 44.62876 28.48025  1.000 49.63347  ? 616 HOH A O   1 
HETATM 5851 O O   . HOH DA 5 .   ? -54.84627 20.71803 4.54562   1.000 39.68311  ? 617 HOH A O   1 
HETATM 5852 O O   . HOH DA 5 .   ? -53.81315 73.50377 47.66402  1.000 58.52905  ? 618 HOH A O   1 
HETATM 5853 O O   . HOH DA 5 .   ? -41.43690 56.75507 13.81330  1.000 63.52456  ? 619 HOH A O   1 
HETATM 5854 O O   . HOH DA 5 .   ? -51.00485 50.13859 27.28067  1.000 26.51567  ? 620 HOH A O   1 
HETATM 5855 O O   . HOH DA 5 .   ? -44.39878 51.26502 33.68658  1.000 51.10615  ? 621 HOH A O   1 
HETATM 5856 O O   . HOH DA 5 .   ? -49.82274 34.73088 12.74574  1.000 56.66288  ? 622 HOH A O   1 
HETATM 5857 O O   . HOH DA 5 .   ? -45.055   66.202   35.885    1.000 29.88824  ? 623 HOH A O   1 
HETATM 5858 O O   . HOH DA 5 .   ? -62.19350 49.04947 1.55595   1.000 45.29829  ? 624 HOH A O   1 
HETATM 5859 O O   . HOH DA 5 .   ? -43.62541 40.25226 15.73126  1.000 58.87062  ? 625 HOH A O   1 
HETATM 5860 O O   . HOH DA 5 .   ? -71.12963 75.10992 39.81377  1.000 67.29531  ? 626 HOH A O   1 
HETATM 5861 O O   . HOH DA 5 .   ? -70.13326 73.52111 32.22018  1.000 40.44436  ? 627 HOH A O   1 
HETATM 5862 O O   . HOH DA 5 .   ? -54.73468 36.75418 41.82157  1.000 66.46440  ? 628 HOH A O   1 
HETATM 5863 O O   . HOH DA 5 .   ? -60.45988 57.84296 19.74468  1.000 44.30960  ? 629 HOH A O   1 
HETATM 5864 O O   . HOH DA 5 .   ? -46.25488 36.54835 0.62165   1.000 55.18969  ? 630 HOH A O   1 
HETATM 5865 O O   . HOH DA 5 .   ? -60.15990 32.17429 15.37108  1.000 32.68505  ? 631 HOH A O   1 
HETATM 5866 O O   . HOH DA 5 .   ? -70.05953 53.60409 26.08584  1.000 54.95325  ? 632 HOH A O   1 
HETATM 5867 O O   . HOH DA 5 .   ? -53.88597 44.99358 2.56551   1.000 42.72231  ? 633 HOH A O   1 
HETATM 5868 O O   . HOH DA 5 .   ? -53.27160 57.07836 20.78223  1.000 27.27791  ? 634 HOH A O   1 
HETATM 5869 O O   . HOH DA 5 .   ? -50.49431 43.64928 12.49609  1.000 28.62524  ? 635 HOH A O   1 
HETATM 5870 O O   . HOH DA 5 .   ? -55.58804 47.65570 32.86492  1.000 41.63092  ? 636 HOH A O   1 
HETATM 5871 O O   . HOH DA 5 .   ? -64.17346 41.89092 11.68368  1.000 23.71038  ? 637 HOH A O   1 
HETATM 5872 O O   . HOH DA 5 .   ? -66.378   41.034   1.414     1.000 26.89511  ? 638 HOH A O   1 
HETATM 5873 O O   . HOH DA 5 .   ? -46.424   31.341   34.902    1.000 56.82413  ? 639 HOH A O   1 
HETATM 5874 O O   . HOH DA 5 .   ? -68.78484 69.27106 41.52248  1.000 66.46270  ? 640 HOH A O   1 
HETATM 5875 O O   . HOH DA 5 .   ? -43.28847 61.93170 22.71723  1.000 37.44241  ? 641 HOH A O   1 
HETATM 5876 O O   . HOH DA 5 .   ? -48.06301 79.90278 32.62200  1.000 52.15064  ? 642 HOH A O   1 
HETATM 5877 O O   . HOH DA 5 .   ? -54.31710 32.96980 24.36993  1.000 38.82776  ? 643 HOH A O   1 
HETATM 5878 O O   . HOH DA 5 .   ? -74.65764 30.06509 13.61673  1.000 38.06767  ? 644 HOH A O   1 
HETATM 5879 O O   . HOH DA 5 .   ? -29.17948 49.42452 11.57850  1.000 59.86635  ? 645 HOH A O   1 
HETATM 5880 O O   . HOH DA 5 .   ? -49.57919 32.54863 3.11683   1.000 66.60768  ? 646 HOH A O   1 
HETATM 5881 O O   . HOH DA 5 .   ? -35.49625 37.07767 19.52236  1.000 46.62448  ? 647 HOH A O   1 
HETATM 5882 O O   . HOH DA 5 .   ? -49.36483 47.93609 7.03371   1.000 35.27812  ? 648 HOH A O   1 
HETATM 5883 O O   . HOH DA 5 .   ? -61.03363 47.67685 8.35512   1.000 28.96960  ? 649 HOH A O   1 
HETATM 5884 O O   . HOH DA 5 .   ? -47.82072 34.28573 3.61326   1.000 47.10294  ? 650 HOH A O   1 
HETATM 5885 O O   . HOH DA 5 .   ? -76.84839 36.07962 5.42159   1.000 52.04212  ? 651 HOH A O   1 
HETATM 5886 O O   . HOH DA 5 .   ? -61.25015 36.74545 18.73825  1.000 45.53058  ? 652 HOH A O   1 
HETATM 5887 O O   . HOH DA 5 .   ? -59.30973 32.93089 3.79217   1.000 44.41950  ? 653 HOH A O   1 
HETATM 5888 O O   . HOH DA 5 .   ? -56.64454 54.15732 29.27093  1.000 28.64956  ? 654 HOH A O   1 
HETATM 5889 O O   . HOH DA 5 .   ? -72.92262 54.36615 27.82096  1.000 46.01733  ? 655 HOH A O   1 
HETATM 5890 O O   . HOH DA 5 .   ? -49.31717 62.66012 43.46914  1.000 39.45187  ? 656 HOH A O   1 
HETATM 5891 O O   . HOH DA 5 .   ? -69.91458 65.64787 41.13955  1.000 43.98220  ? 657 HOH A O   1 
HETATM 5892 O O   . HOH DA 5 .   ? -58.47109 35.22259 21.03803  1.000 42.97790  ? 658 HOH A O   1 
HETATM 5893 O O   . HOH DA 5 .   ? -39.73439 31.36881 18.49234  1.000 58.37857  ? 659 HOH A O   1 
HETATM 5894 O O   . HOH DA 5 .   ? -53.59357 40.15673 18.31610  1.000 25.16537  ? 660 HOH A O   1 
HETATM 5895 O O   . HOH DA 5 .   ? -72.59552 17.75424 7.54169   1.000 47.10021  ? 661 HOH A O   1 
HETATM 5896 O O   . HOH DA 5 .   ? -50.60682 52.55446 28.57324  1.000 30.07260  ? 662 HOH A O   1 
HETATM 5897 O O   . HOH DA 5 .   ? -53.32239 44.87180 21.02442  1.000 27.86345  ? 663 HOH A O   1 
HETATM 5898 O O   . HOH DA 5 .   ? -69.13790 32.89878 15.41195  1.000 40.59344  ? 664 HOH A O   1 
HETATM 5899 O O   . HOH DA 5 .   ? -50.97712 71.69908 20.76678  1.000 60.20795  ? 665 HOH A O   1 
HETATM 5900 O O   . HOH DA 5 .   ? -49.02397 43.54959 10.03695  1.000 28.03611  ? 666 HOH A O   1 
HETATM 5901 O O   . HOH DA 5 .   ? -47.50458 68.24334 20.03235  1.000 52.52606  ? 667 HOH A O   1 
HETATM 5902 O O   . HOH DA 5 .   ? -59.95565 48.08917 36.85100  1.000 47.31783  ? 668 HOH A O   1 
HETATM 5903 O O   . HOH DA 5 .   ? -55.96091 52.62010 15.37119  1.000 30.02474  ? 669 HOH A O   1 
HETATM 5904 O O   . HOH DA 5 .   ? -61.92830 55.66792 28.45095  1.000 56.74003  ? 670 HOH A O   1 
HETATM 5905 O O   . HOH DA 5 .   ? -74.30420 75.24851 30.51005  1.000 34.59174  ? 671 HOH A O   1 
HETATM 5906 O O   . HOH DA 5 .   ? -46.05781 63.30243 19.96885  1.000 47.21702  ? 672 HOH A O   1 
HETATM 5907 O O   . HOH DA 5 .   ? -66.05400 44.83542 4.00786   1.000 48.10259  ? 673 HOH A O   1 
HETATM 5908 O O   . HOH DA 5 .   ? -76.98725 29.55786 10.13083  1.000 32.22013  ? 674 HOH A O   1 
HETATM 5909 O O   . HOH DA 5 .   ? -60.00427 17.47724 6.95044   1.000 39.90130  ? 675 HOH A O   1 
HETATM 5910 O O   . HOH DA 5 .   ? -45.15816 37.66700 17.78511  1.000 59.24671  ? 676 HOH A O   1 
HETATM 5911 O O   . HOH DA 5 .   ? -78.62658 69.43705 38.29071  1.000 45.51591  ? 677 HOH A O   1 
HETATM 5912 O O   . HOH DA 5 .   ? -37.86018 53.24127 31.53982  1.000 46.60289  ? 678 HOH A O   1 
HETATM 5913 O O   . HOH DA 5 .   ? -71.11367 54.27902 22.08676  1.000 35.74909  ? 679 HOH A O   1 
HETATM 5914 O O   . HOH DA 5 .   ? -44.63241 35.18649 30.15655  1.000 45.72368  ? 680 HOH A O   1 
HETATM 5915 O O   . HOH DA 5 .   ? -52.88881 43.98860 11.51701  1.000 33.88021  ? 681 HOH A O   1 
HETATM 5916 O O   . HOH DA 5 .   ? -50.54668 81.28373 26.33720  1.000 55.11061  ? 682 HOH A O   1 
HETATM 5917 O O   . HOH DA 5 .   ? -50.77342 50.39211 8.95662   1.000 43.31627  ? 683 HOH A O   1 
HETATM 5918 O O   . HOH DA 5 .   ? -78.32662 25.93794 7.77447   1.000 31.10157  ? 684 HOH A O   1 
HETATM 5919 O O   . HOH DA 5 .   ? -39.04493 44.16079 -1.42388  1.000 56.26332  ? 685 HOH A O   1 
HETATM 5920 O O   . HOH DA 5 .   ? -70.31095 17.56061 10.43683  1.000 46.52010  ? 686 HOH A O   1 
HETATM 5921 O O   . HOH DA 5 .   ? -51.61059 18.81437 11.03212  1.000 42.45026  ? 687 HOH A O   1 
HETATM 5922 O O   . HOH DA 5 .   ? -49.95785 63.30733 20.06889  1.000 53.00400  ? 688 HOH A O   1 
HETATM 5923 O O   . HOH DA 5 .   ? -55.16912 46.83651 21.89054  1.000 33.89659  ? 689 HOH A O   1 
HETATM 5924 O O   . HOH DA 5 .   ? -48.43749 79.74044 39.60654  1.000 43.65039  ? 690 HOH A O   1 
HETATM 5925 O O   . HOH DA 5 .   ? -49.81907 47.86279 26.44293  1.000 29.19069  ? 691 HOH A O   1 
HETATM 5926 O O   . HOH DA 5 .   ? -62.35266 58.93172 20.98155  1.000 30.55887  ? 692 HOH A O   1 
HETATM 5927 O O   . HOH DA 5 .   ? -34.94860 54.42882 25.39934  1.000 35.26030  ? 693 HOH A O   1 
HETATM 5928 O O   . HOH DA 5 .   ? -77.66297 75.86424 32.23205  1.000 51.10746  ? 694 HOH A O   1 
HETATM 5929 O O   . HOH DA 5 .   ? -45.66334 32.44903 31.65811  1.000 54.40771  ? 695 HOH A O   1 
HETATM 5930 O O   . HOH DA 5 .   ? -76.76328 64.44719 40.71129  1.000 55.85814  ? 696 HOH A O   1 
HETATM 5931 O O   . HOH DA 5 .   ? -50.36933 53.89764 47.36368  1.000 48.76779  ? 697 HOH A O   1 
HETATM 5932 O O   . HOH DA 5 .   ? -69.75253 18.87254 7.55695   1.000 53.28427  ? 698 HOH A O   1 
HETATM 5933 O O   . HOH DA 5 .   ? -60.37956 74.54337 43.59366  1.000 49.86399  ? 699 HOH A O   1 
HETATM 5934 O O   . HOH DA 5 .   ? -66.21165 70.32986 24.38533  1.000 57.28329  ? 700 HOH A O   1 
HETATM 5935 O O   . HOH DA 5 .   ? -68.78847 63.43737 47.43097  1.000 59.24862  ? 701 HOH A O   1 
HETATM 5936 O O   . HOH DA 5 .   ? -61.04935 48.11811 34.64361  1.000 41.14185  ? 702 HOH A O   1 
HETATM 5937 O O   . HOH DA 5 .   ? -50.06888 78.10625 24.71371  1.000 47.64267  ? 703 HOH A O   1 
HETATM 5938 O O   . HOH DA 5 .   ? -52.07804 24.67655 7.48157   1.000 48.63087  ? 704 HOH A O   1 
HETATM 5939 O O   . HOH DA 5 .   ? -49.92161 33.92689 18.47433  1.000 37.13000  ? 705 HOH A O   1 
HETATM 5940 O O   . HOH DA 5 .   ? -54.97692 60.33064 22.05419  1.000 33.77962  ? 706 HOH A O   1 
HETATM 5941 O O   . HOH DA 5 .   ? -67.14245 46.85179 15.01715  1.000 55.37567  ? 707 HOH A O   1 
HETATM 5942 O O   . HOH DA 5 .   ? -79.14625 56.41256 24.08908  1.000 60.19354  ? 708 HOH A O   1 
HETATM 5943 O O   . HOH DA 5 .   ? -63.57459 45.34213 0.65048   1.000 33.36263  ? 709 HOH A O   1 
HETATM 5944 O O   . HOH DA 5 .   ? -56.86534 45.14132 20.76374  1.000 42.86745  ? 710 HOH A O   1 
HETATM 5945 O O   . HOH DA 5 .   ? -73.89006 37.68931 10.59290  1.000 55.76876  ? 711 HOH A O   1 
HETATM 5946 O O   . HOH DA 5 .   ? -62.86788 17.87568 8.76324   1.000 44.42679  ? 712 HOH A O   1 
HETATM 5947 O O   . HOH DA 5 .   ? -84.061   61.619   35.462    1.000 51.92164  ? 713 HOH A O   1 
HETATM 5948 O O   . HOH DA 5 .   ? -53.57631 83.57542 27.91735  1.000 49.23581  ? 714 HOH A O   1 
HETATM 5949 O O   . HOH DA 5 .   ? -44.77693 56.33745 34.33638  1.000 47.11473  ? 715 HOH A O   1 
HETATM 5950 O O   . HOH DA 5 .   ? -59.92359 76.18343 42.00824  1.000 54.39052  ? 716 HOH A O   1 
HETATM 5951 O O   . HOH DA 5 .   ? -46.64225 41.07648 34.10741  1.000 39.69220  ? 717 HOH A O   1 
HETATM 5952 O O   . HOH DA 5 .   ? -68.71231 69.80884 23.63384  1.000 40.71575  ? 718 HOH A O   1 
HETATM 5953 O O   . HOH DA 5 .   ? -63.68895 19.38848 11.58079  1.000 39.86664  ? 719 HOH A O   1 
HETATM 5954 O O   . HOH DA 5 .   ? -32.91221 37.10722 17.68560  1.000 54.43882  ? 720 HOH A O   1 
HETATM 5955 O O   . HOH DA 5 .   ? -61.04195 45.25761 23.74874  1.000 64.89359  ? 721 HOH A O   1 
HETATM 5956 O O   . HOH DA 5 .   ? -68.39752 67.04832 49.78905  1.000 51.32196  ? 722 HOH A O   1 
HETATM 5957 O O   . HOH DA 5 .   ? -48.18920 44.75280 39.09932  1.000 60.66044  ? 723 HOH A O   1 
HETATM 5958 O O   . HOH DA 5 .   ? -54.52915 62.99175 21.49360  1.000 55.92591  ? 724 HOH A O   1 
HETATM 5959 O O   . HOH DA 5 .   ? -80.483   72.776   26.887    1.000 52.82525  ? 725 HOH A O   1 
HETATM 5960 O O   . HOH DA 5 .   ? -56.00525 46.81169 39.59815  1.000 51.83967  ? 726 HOH A O   1 
HETATM 5961 O O   . HOH DA 5 .   ? -74.43946 18.77930 15.72935  1.000 45.70663  ? 727 HOH A O   1 
HETATM 5962 O O   . HOH DA 5 .   ? -59.16122 48.39277 27.33572  1.000 46.80990  ? 728 HOH A O   1 
HETATM 5963 O O   . HOH DA 5 .   ? -68.91240 61.67354 42.61487  1.000 50.24421  ? 729 HOH A O   1 
HETATM 5964 O O   . HOH DA 5 .   ? -59.95806 57.02070 28.44162  1.000 47.91270  ? 730 HOH A O   1 
HETATM 5965 O O   . HOH DA 5 .   ? -38.28500 58.35719 18.01346  1.000 58.25175  ? 731 HOH A O   1 
HETATM 5966 O O   . HOH DA 5 .   ? -39.65099 45.32227 31.92032  1.000 57.95114  ? 732 HOH A O   1 
HETATM 5967 O O   . HOH DA 5 .   ? -49.30546 51.42222 39.56014  1.000 66.70420  ? 733 HOH A O   1 
HETATM 5968 O O   . HOH DA 5 .   ? -33.32024 40.28756 32.05808  1.000 63.00813  ? 734 HOH A O   1 
HETATM 5969 O O   . HOH DA 5 .   ? -69.26082 73.81744 34.77721  1.000 49.44123  ? 735 HOH A O   1 
HETATM 5970 O O   . HOH DA 5 .   ? -74.86934 70.83928 26.26140  1.000 56.41755  ? 736 HOH A O   1 
HETATM 5971 O O   . HOH DA 5 .   ? -61.51549 52.59489 23.54844  1.000 33.51475  ? 737 HOH A O   1 
HETATM 5972 O O   . HOH DA 5 .   ? -70.07926 45.33327 8.75608   1.000 67.23430  ? 738 HOH A O   1 
HETATM 5973 O O   . HOH DA 5 .   ? -63.75613 73.67661 40.65270  1.000 47.75707  ? 739 HOH A O   1 
HETATM 5974 O O   . HOH DA 5 .   ? -44.87726 38.71868 -0.39773  1.000 48.59729  ? 740 HOH A O   1 
HETATM 5975 O O   . HOH DA 5 .   ? -66.12857 43.67748 1.63643   1.000 41.81321  ? 741 HOH A O   1 
HETATM 5976 O O   . HOH DA 5 .   ? -62.77059 42.41451 23.27333  1.000 66.56827  ? 742 HOH A O   1 
HETATM 5977 O O   . HOH DA 5 .   ? -44.43792 41.26809 33.84955  1.000 58.38968  ? 743 HOH A O   1 
HETATM 5978 O O   . HOH DA 5 .   ? -79.41911 70.27487 26.67860  1.000 34.08652  ? 744 HOH A O   1 
HETATM 5979 O O   . HOH DA 5 .   ? -46.09397 35.16929 26.55696  1.000 40.68349  ? 745 HOH A O   1 
HETATM 5980 O O   . HOH DA 5 .   ? -53.43880 59.63770 20.23636  1.000 64.53757  ? 746 HOH A O   1 
HETATM 5981 O O   . HOH DA 5 .   ? -49.75725 76.97038 43.29360  1.000 51.99117  ? 747 HOH A O   1 
HETATM 5982 O O   . HOH DA 5 .   ? -49.46030 79.26872 41.98326  1.000 55.07166  ? 748 HOH A O   1 
HETATM 5983 O O   . HOH DA 5 .   ? -71.76196 75.71504 31.69632  1.000 46.49993  ? 749 HOH A O   1 
HETATM 5984 O O   . HOH DA 5 .   ? -55.93036 19.11215 14.15745  1.000 60.07995  ? 750 HOH A O   1 
HETATM 5985 O O   . HOH DA 5 .   ? -72.44258 67.03945 41.56433  1.000 58.67942  ? 751 HOH A O   1 
HETATM 5986 O O   . HOH DA 5 .   ? -55.79933 23.17138 21.29230  1.000 58.87000  ? 752 HOH A O   1 
HETATM 5987 O O   . HOH DA 5 .   ? -67.35173 50.41736 20.59161  1.000 57.95341  ? 753 HOH A O   1 
HETATM 5988 O O   . HOH DA 5 .   ? -59.16837 51.28610 27.26311  1.000 51.47221  ? 754 HOH A O   1 
HETATM 5989 O O   . HOH DA 5 .   ? -68.76129 63.09698 44.43637  1.000 48.07064  ? 755 HOH A O   1 
HETATM 5990 O O   . HOH DA 5 .   ? -49.26194 33.33700 10.43929  1.000 58.79314  ? 756 HOH A O   1 
HETATM 5991 O O   . HOH DA 5 .   ? -53.984   32.905   41.164    1.000 64.06110  ? 757 HOH A O   1 
HETATM 5992 O O   . HOH DA 5 .   ? -66.39141 20.29001 11.44359  1.000 44.64524  ? 758 HOH A O   1 
HETATM 5993 O O   . HOH DA 5 .   ? -68.96552 65.88826 43.81153  1.000 48.11684  ? 759 HOH A O   1 
HETATM 5994 O O   . HOH EA 5 .   ? -74.02501 53.46682 -14.60978 1.000 52.87847  ? 501 HOH B O   1 
HETATM 5995 O O   . HOH EA 5 .   ? -71.41997 52.89475 -13.99430 1.000 38.16189  ? 502 HOH B O   1 
HETATM 5996 O O   . HOH EA 5 .   ? -38.21865 35.63522 -20.99989 1.000 68.34542  ? 503 HOH B O   1 
HETATM 5997 O O   . HOH EA 5 .   ? -65.56357 33.15439 -17.69565 1.000 38.38254  ? 504 HOH B O   1 
HETATM 5998 O O   . HOH EA 5 .   ? -42.29123 48.24186 -8.76753  1.000 34.71531  ? 505 HOH B O   1 
HETATM 5999 O O   . HOH EA 5 .   ? -46.29966 60.75372 1.69683   1.000 59.83384  ? 506 HOH B O   1 
HETATM 6000 O O   . HOH EA 5 .   ? -48.71733 54.00602 -26.02941 1.000 38.60755  ? 507 HOH B O   1 
HETATM 6001 O O   . HOH EA 5 .   ? -45.88617 68.51024 -12.83980 1.000 48.43228  ? 508 HOH B O   1 
HETATM 6002 O O   . HOH EA 5 .   ? -58.23670 48.04531 -9.66250  1.000 34.79355  ? 509 HOH B O   1 
HETATM 6003 O O   . HOH EA 5 .   ? -35.62345 51.14185 -6.09157  1.000 54.32930  ? 510 HOH B O   1 
HETATM 6004 O O   . HOH EA 5 .   ? -68.63993 28.10848 -36.24284 1.000 40.61643  ? 511 HOH B O   1 
HETATM 6005 O O   . HOH EA 5 .   ? -47.21271 65.82488 -10.17258 1.000 56.64529  ? 512 HOH B O   1 
HETATM 6006 O O   . HOH EA 5 .   ? -64.19732 29.27289 -17.93317 1.000 42.60464  ? 513 HOH B O   1 
HETATM 6007 O O   . HOH EA 5 .   ? -55.52245 32.20003 -35.96019 1.000 47.35134  ? 514 HOH B O   1 
HETATM 6008 O O   . HOH EA 5 .   ? -35.96185 42.67092 -28.43149 1.000 50.13198  ? 515 HOH B O   1 
HETATM 6009 O O   . HOH EA 5 .   ? -65.76555 51.54466 -16.79892 1.000 39.89275  ? 516 HOH B O   1 
HETATM 6010 O O   . HOH EA 5 .   ? -40.152   70.492   -23.633   1.000 52.66922  ? 517 HOH B O   1 
HETATM 6011 O O   . HOH EA 5 .   ? -69.21534 70.07994 -1.18313  1.000 48.52563  ? 518 HOH B O   1 
HETATM 6012 O O   . HOH EA 5 .   ? -47.27675 42.40393 -18.09784 1.000 40.42414  ? 519 HOH B O   1 
HETATM 6013 O O   . HOH EA 5 .   ? -52.91281 66.49795 -8.18462  1.000 47.88334  ? 520 HOH B O   1 
HETATM 6014 O O   . HOH EA 5 .   ? -29.828   53.683   -26.609   1.000 49.68899  ? 521 HOH B O   1 
HETATM 6015 O O   . HOH EA 5 .   ? -65.57144 49.12935 -19.55912 1.000 46.91004  ? 522 HOH B O   1 
HETATM 6016 O O   . HOH EA 5 .   ? -34.302   67.276   -27.459   1.000 31.60440  ? 523 HOH B O   1 
HETATM 6017 O O   . HOH EA 5 .   ? -56.29966 33.08876 -46.86356 1.000 51.64925  ? 524 HOH B O   1 
HETATM 6018 O O   . HOH EA 5 .   ? -81.016   48.931   -6.819    1.000 53.91992  ? 525 HOH B O   1 
HETATM 6019 O O   . HOH EA 5 .   ? -37.72016 41.10040 -24.10340 1.000 54.65392  ? 526 HOH B O   1 
HETATM 6020 O O   . HOH EA 5 .   ? -41.18956 34.75696 -21.54900 1.000 48.23241  ? 527 HOH B O   1 
HETATM 6021 O O   . HOH EA 5 .   ? -56.29149 42.90064 -24.19600 1.000 34.75314  ? 528 HOH B O   1 
HETATM 6022 O O   . HOH EA 5 .   ? -61.02079 39.91415 -25.08459 1.000 49.54877  ? 529 HOH B O   1 
HETATM 6023 O O   . HOH EA 5 .   ? -48.16102 43.40710 -46.66512 1.000 54.73687  ? 530 HOH B O   1 
HETATM 6024 O O   . HOH EA 5 .   ? -37.92959 49.94499 -28.25706 1.000 37.54616  ? 531 HOH B O   1 
HETATM 6025 O O   . HOH EA 5 .   ? -72.67713 58.53293 -15.43845 1.000 38.57040  ? 532 HOH B O   1 
HETATM 6026 O O   . HOH EA 5 .   ? -63.30190 44.79087 -11.89621 1.000 38.60766  ? 533 HOH B O   1 
HETATM 6027 O O   . HOH EA 5 .   ? -61.56517 63.35312 -15.41092 1.000 28.08228  ? 534 HOH B O   1 
HETATM 6028 O O   . HOH EA 5 .   ? -58.71347 21.91441 -24.25701 1.000 38.34994  ? 535 HOH B O   1 
HETATM 6029 O O   . HOH EA 5 .   ? -59.11254 35.47130 -20.62571 1.000 33.40215  ? 536 HOH B O   1 
HETATM 6030 O O   . HOH EA 5 .   ? -47.92564 55.44040 -28.16600 1.000 30.86246  ? 537 HOH B O   1 
HETATM 6031 O O   . HOH EA 5 .   ? -52.52666 58.86390 -9.03847  1.000 24.99393  ? 538 HOH B O   1 
HETATM 6032 O O   . HOH EA 5 .   ? -64.40925 63.44814 -2.10253  1.000 46.53794  ? 539 HOH B O   1 
HETATM 6033 O O   . HOH EA 5 .   ? -65.00020 19.72391 -28.42759 1.000 31.46994  ? 540 HOH B O   1 
HETATM 6034 O O   . HOH EA 5 .   ? -48.98886 21.31377 -38.47219 1.000 63.38989  ? 541 HOH B O   1 
HETATM 6035 O O   . HOH EA 5 .   ? -73.90829 72.46098 -1.35089  1.000 68.75947  ? 542 HOH B O   1 
HETATM 6036 O O   . HOH EA 5 .   ? -82.68812 57.63712 -2.90558  1.000 37.32155  ? 543 HOH B O   1 
HETATM 6037 O O   . HOH EA 5 .   ? -38.50813 59.38203 -31.10985 1.000 37.65052  ? 544 HOH B O   1 
HETATM 6038 O O   . HOH EA 5 .   ? -35.57391 54.67244 -21.08893 1.000 30.12398  ? 545 HOH B O   1 
HETATM 6039 O O   . HOH EA 5 .   ? -71.44208 49.57794 -0.90211  1.000 30.11487  ? 546 HOH B O   1 
HETATM 6040 O O   . HOH EA 5 .   ? -56.64805 42.91548 -29.58720 1.000 31.27878  ? 547 HOH B O   1 
HETATM 6041 O O   . HOH EA 5 .   ? -78.92026 66.07331 -9.67628  1.000 39.88227  ? 548 HOH B O   1 
HETATM 6042 O O   . HOH EA 5 .   ? -58.82265 55.55821 -21.86708 1.000 29.60010  ? 549 HOH B O   1 
HETATM 6043 O O   . HOH EA 5 .   ? -61.57181 45.20761 -1.37064  1.000 40.94948  ? 550 HOH B O   1 
HETATM 6044 O O   . HOH EA 5 .   ? -48.57640 63.56627 1.67220   1.000 48.33449  ? 551 HOH B O   1 
HETATM 6045 O O   . HOH EA 5 .   ? -73.801   62.296   1.391     1.000 28.84590  ? 552 HOH B O   1 
HETATM 6046 O O   . HOH EA 5 .   ? -60.45729 41.29586 -21.42318 1.000 36.49632  ? 553 HOH B O   1 
HETATM 6047 O O   . HOH EA 5 .   ? -42.23470 47.85125 -11.19686 1.000 38.28348  ? 554 HOH B O   1 
HETATM 6048 O O   . HOH EA 5 .   ? -55.65482 64.58731 -3.26981  1.000 39.01168  ? 555 HOH B O   1 
HETATM 6049 O O   . HOH EA 5 .   ? -51.55292 63.38926 -26.98586 1.000 31.83251  ? 556 HOH B O   1 
HETATM 6050 O O   . HOH EA 5 .   ? -80.874   47.766   -1.069    1.000 38.46510  ? 557 HOH B O   1 
HETATM 6051 O O   . HOH EA 5 .   ? -44.16103 46.44508 -8.57603  1.000 55.66848  ? 558 HOH B O   1 
HETATM 6052 O O   . HOH EA 5 .   ? -53.92254 20.68130 -37.76844 1.000 51.07169  ? 559 HOH B O   1 
HETATM 6053 O O   . HOH EA 5 .   ? -54.44901 42.65994 -26.17318 1.000 37.76847  ? 560 HOH B O   1 
HETATM 6054 O O   . HOH EA 5 .   ? -69.92093 50.57600 -14.08854 1.000 49.23491  ? 561 HOH B O   1 
HETATM 6055 O O   . HOH EA 5 .   ? -31.35152 58.35020 -29.33200 1.000 38.78048  ? 562 HOH B O   1 
HETATM 6056 O O   . HOH EA 5 .   ? -53.92741 53.54577 -1.38734  1.000 39.20180  ? 563 HOH B O   1 
HETATM 6057 O O   . HOH EA 5 .   ? -40.39947 56.67433 -8.03641  1.000 36.52412  ? 564 HOH B O   1 
HETATM 6058 O O   . HOH EA 5 .   ? -47.83337 43.82469 -35.00070 1.000 36.72431  ? 565 HOH B O   1 
HETATM 6059 O O   . HOH EA 5 .   ? -67.39059 60.80584 -15.24797 1.000 34.43024  ? 566 HOH B O   1 
HETATM 6060 O O   . HOH EA 5 .   ? -39.17068 51.30655 -13.27865 1.000 36.13061  ? 567 HOH B O   1 
HETATM 6061 O O   . HOH EA 5 .   ? -66.54882 76.52430 -10.69870 1.000 43.99867  ? 568 HOH B O   1 
HETATM 6062 O O   . HOH EA 5 .   ? -57.27338 63.43503 -12.60849 1.000 55.72143  ? 569 HOH B O   1 
HETATM 6063 O O   . HOH EA 5 .   ? -56.26251 44.89645 -17.24758 1.000 34.30431  ? 570 HOH B O   1 
HETATM 6064 O O   . HOH EA 5 .   ? -33.12045 55.71867 -28.76182 1.000 48.16659  ? 571 HOH B O   1 
HETATM 6065 O O   . HOH EA 5 .   ? -62.53829 42.98985 -20.41293 1.000 40.24447  ? 572 HOH B O   1 
HETATM 6066 O O   . HOH EA 5 .   ? -42.63953 42.91974 -18.85436 1.000 40.16303  ? 573 HOH B O   1 
HETATM 6067 O O   . HOH EA 5 .   ? -50.51363 67.48895 -5.38434  1.000 57.44831  ? 574 HOH B O   1 
HETATM 6068 O O   . HOH EA 5 .   ? -53.79218 39.17674 -35.80595 1.000 39.51034  ? 575 HOH B O   1 
HETATM 6069 O O   . HOH EA 5 .   ? -65.38388 36.98978 -18.18779 1.000 53.75248  ? 576 HOH B O   1 
HETATM 6070 O O   . HOH EA 5 .   ? -51.30561 43.06363 -18.87329 1.000 33.14276  ? 577 HOH B O   1 
HETATM 6071 O O   . HOH EA 5 .   ? -57.45787 54.67305 -19.72056 1.000 26.76505  ? 578 HOH B O   1 
HETATM 6072 O O   . HOH EA 5 .   ? -33.31412 56.06640 -22.32529 1.000 39.32813  ? 579 HOH B O   1 
HETATM 6073 O O   . HOH EA 5 .   ? -53.55808 63.43395 -0.29144  1.000 50.21572  ? 580 HOH B O   1 
HETATM 6074 O O   . HOH EA 5 .   ? -60.68428 63.26475 -2.16045  1.000 29.31204  ? 581 HOH B O   1 
HETATM 6075 O O   . HOH EA 5 .   ? -36.60032 38.44301 -27.12643 1.000 59.61188  ? 582 HOH B O   1 
HETATM 6076 O O   . HOH EA 5 .   ? -40.48887 71.63683 -12.79022 1.000 52.10049  ? 583 HOH B O   1 
HETATM 6077 O O   . HOH EA 5 .   ? -86.67715 63.51916 -13.56433 1.000 54.33863  ? 584 HOH B O   1 
HETATM 6078 O O   . HOH EA 5 .   ? -66.808   58.734   -25.112   1.000 29.65386  ? 585 HOH B O   1 
HETATM 6079 O O   . HOH EA 5 .   ? -56.64050 48.73105 -23.83959 1.000 40.41363  ? 586 HOH B O   1 
HETATM 6080 O O   . HOH EA 5 .   ? -40.64952 49.81712 -8.95806  1.000 34.76790  ? 587 HOH B O   1 
HETATM 6081 O O   . HOH EA 5 .   ? -43.40318 43.01815 -40.77540 1.000 60.95224  ? 588 HOH B O   1 
HETATM 6082 O O   . HOH EA 5 .   ? -80.31537 60.39130 -5.30330  1.000 35.64955  ? 589 HOH B O   1 
HETATM 6083 O O   . HOH EA 5 .   ? -52.94534 40.69660 -28.65243 1.000 30.31909  ? 590 HOH B O   1 
HETATM 6084 O O   . HOH EA 5 .   ? -35.01293 61.99780 -29.02475 1.000 31.54636  ? 591 HOH B O   1 
HETATM 6085 O O   . HOH EA 5 .   ? -58.43869 58.40356 -21.74326 1.000 26.74705  ? 592 HOH B O   1 
HETATM 6086 O O   . HOH EA 5 .   ? -36.32394 55.11422 -23.54018 1.000 28.07101  ? 593 HOH B O   1 
HETATM 6087 O O   . HOH EA 5 .   ? -55.78731 63.82259 -15.42868 1.000 49.52708  ? 594 HOH B O   1 
HETATM 6088 O O   . HOH EA 5 .   ? -81.15967 55.74653 -13.53177 1.000 36.47550  ? 595 HOH B O   1 
HETATM 6089 O O   . HOH EA 5 .   ? -50.65931 51.98611 -6.74934  1.000 37.56867  ? 596 HOH B O   1 
HETATM 6090 O O   . HOH EA 5 .   ? -46.02480 66.91756 -0.79264  1.000 51.74261  ? 597 HOH B O   1 
HETATM 6091 O O   . HOH EA 5 .   ? -66.64349 69.30548 -19.70246 1.000 37.87982  ? 598 HOH B O   1 
HETATM 6092 O O   . HOH EA 5 .   ? -49.06428 46.69461 -47.44338 1.000 58.24877  ? 599 HOH B O   1 
HETATM 6093 O O   . HOH EA 5 .   ? -38.22999 68.63107 -27.52681 1.000 34.58999  ? 600 HOH B O   1 
HETATM 6094 O O   . HOH EA 5 .   ? -35.61185 62.04283 -26.40506 1.000 28.46106  ? 601 HOH B O   1 
HETATM 6095 O O   . HOH EA 5 .   ? -50.77264 49.17358 -8.85148  1.000 42.17000  ? 602 HOH B O   1 
HETATM 6096 O O   . HOH EA 5 .   ? -50.84951 49.62085 -27.29361 1.000 35.68414  ? 603 HOH B O   1 
HETATM 6097 O O   . HOH EA 5 .   ? -42.62196 71.42072 -17.78494 1.000 47.92444  ? 604 HOH B O   1 
HETATM 6098 O O   . HOH EA 5 .   ? -49.64719 42.33740 -20.97078 1.000 31.10067  ? 605 HOH B O   1 
HETATM 6099 O O   . HOH EA 5 .   ? -53.41865 27.55599 -26.64340 1.000 41.38987  ? 606 HOH B O   1 
HETATM 6100 O O   . HOH EA 5 .   ? -50.17074 57.33987 -34.15623 1.000 39.41073  ? 607 HOH B O   1 
HETATM 6101 O O   . HOH EA 5 .   ? -55.71735 46.06268 -25.97117 1.000 36.52471  ? 608 HOH B O   1 
HETATM 6102 O O   . HOH EA 5 .   ? -53.89283 43.37576 -29.26549 1.000 34.66894  ? 609 HOH B O   1 
HETATM 6103 O O   . HOH EA 5 .   ? -64.55674 16.40243 -38.24259 1.000 48.53532  ? 610 HOH B O   1 
HETATM 6104 O O   . HOH EA 5 .   ? -44.78769 65.77947 -24.36770 1.000 34.78014  ? 611 HOH B O   1 
HETATM 6105 O O   . HOH EA 5 .   ? -64.40606 40.37082 -22.06940 1.000 58.27749  ? 612 HOH B O   1 
HETATM 6106 O O   . HOH EA 5 .   ? -48.15876 26.77343 -44.11548 1.000 49.01507  ? 613 HOH B O   1 
HETATM 6107 O O   . HOH EA 5 .   ? -60.49377 52.96538 -33.24670 1.000 51.53920  ? 614 HOH B O   1 
HETATM 6108 O O   . HOH EA 5 .   ? -31.06196 50.07429 -12.65053 1.000 45.38098  ? 615 HOH B O   1 
HETATM 6109 O O   . HOH EA 5 .   ? -42.28232 47.63476 -33.74520 1.000 47.43246  ? 616 HOH B O   1 
HETATM 6110 O O   . HOH EA 5 .   ? -61.95422 40.38859 -30.13508 1.000 55.84224  ? 617 HOH B O   1 
HETATM 6111 O O   . HOH EA 5 .   ? -62.00150 63.20637 -24.23500 1.000 46.71237  ? 618 HOH B O   1 
HETATM 6112 O O   . HOH EA 5 .   ? -53.33018 47.47136 -14.26008 1.000 43.79820  ? 619 HOH B O   1 
HETATM 6113 O O   . HOH EA 5 .   ? -68.822   50.101   -1.276    1.000 24.02071  ? 620 HOH B O   1 
HETATM 6114 O O   . HOH EA 5 .   ? -67.77260 35.04477 -28.29312 1.000 51.59432  ? 621 HOH B O   1 
HETATM 6115 O O   . HOH EA 5 .   ? -49.48985 49.36143 -14.80539 1.000 29.23803  ? 622 HOH B O   1 
HETATM 6116 O O   . HOH EA 5 .   ? -45.17170 69.83066 -21.66016 1.000 69.42101  ? 623 HOH B O   1 
HETATM 6117 O O   . HOH EA 5 .   ? -38.04172 36.55723 -41.39316 1.000 54.42316  ? 624 HOH B O   1 
HETATM 6118 O O   . HOH EA 5 .   ? -60.16065 59.70762 -41.53378 1.000 59.83994  ? 625 HOH B O   1 
HETATM 6119 O O   . HOH EA 5 .   ? -49.76274 71.24065 -17.78893 1.000 47.47987  ? 626 HOH B O   1 
HETATM 6120 O O   . HOH EA 5 .   ? -31.295   57.858   -22.026   1.000 37.54239  ? 627 HOH B O   1 
HETATM 6121 O O   . HOH EA 5 .   ? -33.13315 49.09343 -27.74525 1.000 49.07728  ? 628 HOH B O   1 
HETATM 6122 O O   . HOH EA 5 .   ? -54.66401 67.84102 -31.22387 1.000 52.57087  ? 629 HOH B O   1 
HETATM 6123 O O   . HOH EA 5 .   ? -37.98950 58.88435 -6.01609  1.000 46.33421  ? 630 HOH B O   1 
HETATM 6124 O O   . HOH EA 5 .   ? -32.98419 60.58932 -14.58528 1.000 42.70553  ? 631 HOH B O   1 
HETATM 6125 O O   . HOH EA 5 .   ? -63.98424 69.24753 -19.37402 1.000 47.23865  ? 632 HOH B O   1 
HETATM 6126 O O   . HOH EA 5 .   ? -59.37481 30.91191 -40.03125 1.000 50.76132  ? 633 HOH B O   1 
HETATM 6127 O O   . HOH EA 5 .   ? -55.55958 53.82782 -11.21984 1.000 31.40650  ? 634 HOH B O   1 
HETATM 6128 O O   . HOH EA 5 .   ? -61.48863 50.28361 -28.17127 1.000 52.09822  ? 635 HOH B O   1 
HETATM 6129 O O   . HOH EA 5 .   ? -53.70102 55.31433 -12.26392 1.000 26.08018  ? 636 HOH B O   1 
HETATM 6130 O O   . HOH EA 5 .   ? -59.14864 19.84587 -34.50283 1.000 38.70595  ? 637 HOH B O   1 
HETATM 6131 O O   . HOH EA 5 .   ? -46.41348 67.64145 -25.11751 1.000 37.94573  ? 638 HOH B O   1 
HETATM 6132 O O   . HOH EA 5 .   ? -43.27259 60.07270 1.91544   1.000 44.35693  ? 639 HOH B O   1 
HETATM 6133 O O   . HOH EA 5 .   ? -55.54820 53.07077 -20.88741 1.000 27.87909  ? 640 HOH B O   1 
HETATM 6134 O O   . HOH EA 5 .   ? -55.39046 61.03183 3.29477   1.000 54.01618  ? 641 HOH B O   1 
HETATM 6135 O O   . HOH EA 5 .   ? -84.93441 61.02471 -4.48387  1.000 60.04968  ? 642 HOH B O   1 
HETATM 6136 O O   . HOH EA 5 .   ? -59.80998 26.55691 -40.85275 1.000 55.31362  ? 643 HOH B O   1 
HETATM 6137 O O   . HOH EA 5 .   ? -66.55050 50.33353 -11.63901 1.000 27.26709  ? 644 HOH B O   1 
HETATM 6138 O O   . HOH EA 5 .   ? -52.47150 55.94097 -9.74162  1.000 27.31354  ? 645 HOH B O   1 
HETATM 6139 O O   . HOH EA 5 .   ? -57.90549 64.18190 -18.05029 1.000 37.09638  ? 646 HOH B O   1 
HETATM 6140 O O   . HOH EA 5 .   ? -40.22866 62.41728 -8.56731  1.000 40.10421  ? 647 HOH B O   1 
HETATM 6141 O O   . HOH EA 5 .   ? -34.77754 53.03826 -24.68048 1.000 34.94965  ? 648 HOH B O   1 
HETATM 6142 O O   . HOH EA 5 .   ? -66.42429 35.96124 -21.96920 1.000 38.54450  ? 649 HOH B O   1 
HETATM 6143 O O   . HOH EA 5 .   ? -41.48770 69.59019 -11.63730 1.000 39.99255  ? 650 HOH B O   1 
HETATM 6144 O O   . HOH EA 5 .   ? -28.37856 57.94491 -12.02447 1.000 50.58122  ? 651 HOH B O   1 
HETATM 6145 O O   . HOH EA 5 .   ? -38.62665 42.81567 -22.04955 1.000 43.18066  ? 652 HOH B O   1 
HETATM 6146 O O   . HOH EA 5 .   ? -56.05070 52.33083 -2.31832  1.000 34.31342  ? 653 HOH B O   1 
HETATM 6147 O O   . HOH EA 5 .   ? -60.64115 22.41854 -40.15975 1.000 48.15748  ? 654 HOH B O   1 
HETATM 6148 O O   . HOH EA 5 .   ? -82.739   49.397   -3.729    1.000 38.52471  ? 655 HOH B O   1 
HETATM 6149 O O   . HOH EA 5 .   ? -60.14840 65.37166 -13.72618 1.000 45.54617  ? 656 HOH B O   1 
HETATM 6150 O O   . HOH EA 5 .   ? -44.72078 34.25373 -22.32853 1.000 43.87390  ? 657 HOH B O   1 
HETATM 6151 O O   . HOH EA 5 .   ? -50.40302 67.79819 -25.93001 1.000 59.52972  ? 658 HOH B O   1 
HETATM 6152 O O   . HOH EA 5 .   ? -60.71071 46.58272 -34.07020 1.000 51.60664  ? 659 HOH B O   1 
HETATM 6153 O O   . HOH EA 5 .   ? -59.78616 46.79896 -36.70613 1.000 48.10994  ? 660 HOH B O   1 
HETATM 6154 O O   . HOH EA 5 .   ? -44.81407 45.72474 -34.46312 1.000 46.13076  ? 661 HOH B O   1 
HETATM 6155 O O   . HOH EA 5 .   ? -49.52441 47.56002 -28.62197 1.000 31.67956  ? 662 HOH B O   1 
HETATM 6156 O O   . HOH EA 5 .   ? -42.82049 36.50267 -46.93027 1.000 56.31588  ? 663 HOH B O   1 
HETATM 6157 O O   . HOH EA 5 .   ? -43.30567 67.93629 -18.45729 1.000 35.57198  ? 664 HOH B O   1 
HETATM 6158 O O   . HOH EA 5 .   ? -35.72548 51.61654 -29.23392 1.000 61.02323  ? 665 HOH B O   1 
HETATM 6159 O O   . HOH EA 5 .   ? -60.97854 49.26739 -23.66799 1.000 60.08656  ? 666 HOH B O   1 
HETATM 6160 O O   . HOH EA 5 .   ? -54.27829 44.97462 -15.29270 1.000 35.89477  ? 667 HOH B O   1 
HETATM 6161 O O   . HOH EA 5 .   ? -59.20299 51.06298 -24.60168 1.000 51.90442  ? 668 HOH B O   1 
HETATM 6162 O O   . HOH EA 5 .   ? -73.840   22.929   -35.218   1.000 52.17608  ? 669 HOH B O   1 
HETATM 6163 O O   . HOH EA 5 .   ? -56.01311 19.71023 -32.02401 1.000 49.44670  ? 670 HOH B O   1 
HETATM 6164 O O   . HOH EA 5 .   ? -61.36946 14.03086 -32.02265 1.000 50.47018  ? 671 HOH B O   1 
HETATM 6165 O O   . HOH EA 5 .   ? -61.75376 17.20806 -26.61579 1.000 58.19233  ? 672 HOH B O   1 
HETATM 6166 O O   . HOH EA 5 .   ? -60.87661 46.82301 -8.37846  1.000 30.47412  ? 673 HOH B O   1 
HETATM 6167 O O   . HOH EA 5 .   ? -43.04673 45.48139 -11.01407 1.000 64.20855  ? 674 HOH B O   1 
HETATM 6168 O O   . HOH EA 5 .   ? -35.453   68.280   -19.940   1.000 37.60276  ? 675 HOH B O   1 
HETATM 6169 O O   . HOH EA 5 .   ? -68.24434 73.37246 -4.49050  1.000 39.93318  ? 676 HOH B O   1 
HETATM 6170 O O   . HOH EA 5 .   ? -48.63154 70.83420 -13.63597 1.000 55.41128  ? 677 HOH B O   1 
HETATM 6171 O O   . HOH EA 5 .   ? -46.76706 23.62319 -43.62713 1.000 60.87536  ? 678 HOH B O   1 
HETATM 6172 O O   . HOH EA 5 .   ? -39.21165 65.80615 -30.95023 1.000 46.59181  ? 679 HOH B O   1 
HETATM 6173 O O   . HOH EA 5 .   ? -57.30481 49.70177 -39.27416 1.000 55.17738  ? 680 HOH B O   1 
HETATM 6174 O O   . HOH EA 5 .   ? -57.95001 56.95907 -18.12452 1.000 27.21179  ? 681 HOH B O   1 
HETATM 6175 O O   . HOH EA 5 .   ? -82.09426 67.78318 -7.33824  1.000 49.52322  ? 682 HOH B O   1 
HETATM 6176 O O   . HOH EA 5 .   ? -66.50249 60.62121 -3.67741  1.000 40.57070  ? 683 HOH B O   1 
HETATM 6177 O O   . HOH EA 5 .   ? -65.41782 18.84701 -37.82615 1.000 44.65311  ? 684 HOH B O   1 
HETATM 6178 O O   . HOH EA 5 .   ? -33.35364 45.09740 -27.84601 1.000 44.84716  ? 685 HOH B O   1 
HETATM 6179 O O   . HOH EA 5 .   ? -83.489   54.916   -10.123   1.000 32.61381  ? 686 HOH B O   1 
HETATM 6180 O O   . HOH EA 5 .   ? -75.269   26.164   -39.375   1.000 61.02409  ? 687 HOH B O   1 
HETATM 6181 O O   . HOH EA 5 .   ? -74.54165 73.74024 -6.98091  1.000 41.45623  ? 688 HOH B O   1 
HETATM 6182 O O   . HOH EA 5 .   ? -42.43533 68.74962 -20.84227 1.000 53.59925  ? 689 HOH B O   1 
HETATM 6183 O O   . HOH EA 5 .   ? -50.94518 52.18854 -26.16637 1.000 32.68846  ? 690 HOH B O   1 
HETATM 6184 O O   . HOH EA 5 .   ? -40.08443 19.45923 -44.77949 1.000 67.90354  ? 691 HOH B O   1 
HETATM 6185 O O   . HOH EA 5 .   ? -66.24996 24.16904 -40.58225 1.000 55.61448  ? 692 HOH B O   1 
HETATM 6186 O O   . HOH EA 5 .   ? -58.48116 51.09153 -20.63638 1.000 40.98207  ? 693 HOH B O   1 
HETATM 6187 O O   . HOH EA 5 .   ? -62.53357 21.37032 -24.60231 1.000 64.86398  ? 694 HOH B O   1 
HETATM 6188 O O   . HOH EA 5 .   ? -55.73354 49.88750 -32.90158 1.000 68.45502  ? 695 HOH B O   1 
HETATM 6189 O O   . HOH EA 5 .   ? -64.37815 47.61765 -0.64066  1.000 36.47954  ? 696 HOH B O   1 
HETATM 6190 O O   . HOH EA 5 .   ? -56.63772 23.79534 -23.63932 1.000 40.73779  ? 697 HOH B O   1 
HETATM 6191 O O   . HOH EA 5 .   ? -56.62331 36.35347 -21.00419 1.000 32.70219  ? 698 HOH B O   1 
HETATM 6192 O O   . HOH EA 5 .   ? -37.46206 53.17998 -30.78709 1.000 42.77270  ? 699 HOH B O   1 
HETATM 6193 O O   . HOH EA 5 .   ? -40.93416 69.20076 -16.59178 1.000 38.57734  ? 700 HOH B O   1 
HETATM 6194 O O   . HOH EA 5 .   ? -51.30769 59.92182 -33.68279 1.000 47.98066  ? 701 HOH B O   1 
HETATM 6195 O O   . HOH EA 5 .   ? -74.83173 55.75266 -15.33878 1.000 44.07168  ? 702 HOH B O   1 
HETATM 6196 O O   . HOH EA 5 .   ? -41.29452 62.80716 1.80020   1.000 58.08150  ? 703 HOH B O   1 
HETATM 6197 O O   . HOH EA 5 .   ? -31.18862 54.64657 -22.59736 1.000 39.87035  ? 704 HOH B O   1 
HETATM 6198 O O   . HOH EA 5 .   ? -63.76050 71.22238 -6.89915  1.000 51.04429  ? 705 HOH B O   1 
HETATM 6199 O O   . HOH EA 5 .   ? -77.52609 49.35418 -10.01156 1.000 63.27847  ? 706 HOH B O   1 
HETATM 6200 O O   . HOH EA 5 .   ? -58.89998 16.08872 -30.32522 1.000 40.08847  ? 707 HOH B O   1 
HETATM 6201 O O   . HOH EA 5 .   ? -32.38867 59.53433 -10.26434 1.000 60.46506  ? 708 HOH B O   1 
HETATM 6202 O O   . HOH EA 5 .   ? -35.28161 33.05150 -28.37332 1.000 57.14312  ? 709 HOH B O   1 
HETATM 6203 O O   . HOH EA 5 .   ? -68.817   29.139   -18.846   1.000 49.17461  ? 710 HOH B O   1 
HETATM 6204 O O   . HOH EA 5 .   ? -57.69138 26.39658 -49.83899 1.000 61.52482  ? 711 HOH B O   1 
HETATM 6205 O O   . HOH EA 5 .   ? -51.50896 69.43776 -19.44353 1.000 70.17534  ? 712 HOH B O   1 
HETATM 6206 O O   . HOH EA 5 .   ? -76.60389 72.09183 -8.76587  1.000 49.87110  ? 713 HOH B O   1 
HETATM 6207 O O   . HOH EA 5 .   ? -76.67726 70.39653 -11.29470 1.000 43.54889  ? 714 HOH B O   1 
HETATM 6208 O O   . HOH EA 5 .   ? -37.49605 61.91477 -30.26353 1.000 47.17071  ? 715 HOH B O   1 
HETATM 6209 O O   . HOH EA 5 .   ? -86.52302 57.30216 -7.73300  1.000 37.39050  ? 716 HOH B O   1 
HETATM 6210 O O   . HOH EA 5 .   ? -56.29839 50.47337 -21.88723 1.000 38.88141  ? 717 HOH B O   1 
HETATM 6211 O O   . HOH EA 5 .   ? -64.27043 50.85286 -26.89784 1.000 47.19317  ? 718 HOH B O   1 
HETATM 6212 O O   . HOH EA 5 .   ? -35.28650 55.29579 -31.00928 1.000 64.82769  ? 719 HOH B O   1 
HETATM 6213 O O   . HOH EA 5 .   ? -51.53367 35.78319 -20.82764 1.000 60.05982  ? 720 HOH B O   1 
HETATM 6214 O O   . HOH EA 5 .   ? -38.07202 64.12218 -32.08959 1.000 48.93516  ? 721 HOH B O   1 
HETATM 6215 O O   . HOH EA 5 .   ? -39.88636 40.92421 -20.13541 1.000 60.41061  ? 722 HOH B O   1 
HETATM 6216 O O   . HOH EA 5 .   ? -60.24748 12.66901 -34.03255 1.000 61.22063  ? 723 HOH B O   1 
HETATM 6217 O O   . HOH EA 5 .   ? -36.92748 19.17805 -37.54990 1.000 54.75314  ? 724 HOH B O   1 
HETATM 6218 O O   . HOH EA 5 .   ? -55.50776 39.01497 -28.52270 1.000 51.33126  ? 725 HOH B O   1 
HETATM 6219 O O   . HOH EA 5 .   ? -44.28788 52.28047 -1.17119  1.000 56.53920  ? 726 HOH B O   1 
HETATM 6220 O O   . HOH EA 5 .   ? -55.05829 19.75273 -34.73781 1.000 49.84990  ? 727 HOH B O   1 
HETATM 6221 O O   . HOH EA 5 .   ? -39.07154 67.75836 -29.89415 1.000 46.82146  ? 728 HOH B O   1 
HETATM 6222 O O   . HOH EA 5 .   ? -39.42489 60.03082 -4.72068  1.000 61.02418  ? 729 HOH B O   1 
HETATM 6223 O O   . HOH EA 5 .   ? -66.42600 44.32171 -14.75021 1.000 55.75532  ? 730 HOH B O   1 
HETATM 6224 O O   . HOH EA 5 .   ? -59.00404 47.47317 -27.41502 1.000 54.84492  ? 731 HOH B O   1 
HETATM 6225 O O   . HOH EA 5 .   ? -61.35430 19.67364 -26.11608 1.000 52.53432  ? 732 HOH B O   1 
HETATM 6226 O O   . HOH EA 5 .   ? -53.49675 65.08355 -25.90930 1.000 45.15614  ? 733 HOH B O   1 
HETATM 6227 O O   . HOH EA 5 .   ? -58.23046 66.13681 -7.79560  1.000 56.09357  ? 734 HOH B O   1 
HETATM 6228 O O   . HOH EA 5 .   ? -58.27838 49.47197 -32.91491 1.000 65.10514  ? 735 HOH B O   1 
HETATM 6229 O O   . HOH EA 5 .   ? -60.86276 30.42520 -42.40443 1.000 61.71179  ? 736 HOH B O   1 
HETATM 6230 O O   . HOH EA 5 .   ? -59.01660 42.15568 -23.62144 1.000 36.50360  ? 737 HOH B O   1 
HETATM 6231 O O   . HOH EA 5 .   ? -51.13514 62.17547 0.98586   1.000 46.92516  ? 738 HOH B O   1 
HETATM 6232 O O   . HOH EA 5 .   ? -52.65332 61.05253 2.32367   1.000 66.68448  ? 739 HOH B O   1 
HETATM 6233 O O   . HOH EA 5 .   ? -67.285   47.716   -1.503    1.000 38.29999  ? 740 HOH B O   1 
HETATM 6234 O O   . HOH EA 5 .   ? -60.58348 48.87146 -0.44574  1.000 48.05990  ? 741 HOH B O   1 
HETATM 6235 O O   . HOH EA 5 .   ? -33.03176 60.34845 -30.43542 1.000 40.04305  ? 742 HOH B O   1 
HETATM 6236 O O   . HOH EA 5 .   ? -28.66788 49.76924 -25.58214 1.000 53.38350  ? 743 HOH B O   1 
HETATM 6237 O O   . HOH EA 5 .   ? -40.240   70.236   -26.260   1.000 47.39083  ? 744 HOH B O   1 
HETATM 6238 O O   . HOH EA 5 .   ? -46.67520 67.17523 -8.34285  1.000 45.66617  ? 745 HOH B O   1 
HETATM 6239 O O   . HOH EA 5 .   ? -39.85648 59.67230 -33.61711 1.000 53.29590  ? 746 HOH B O   1 
HETATM 6240 O O   . HOH EA 5 .   ? -67.98199 70.96726 -21.14884 1.000 56.10505  ? 747 HOH B O   1 
HETATM 6241 O O   . HOH EA 5 .   ? -53.87601 66.86542 -3.49748  1.000 64.48549  ? 748 HOH B O   1 
HETATM 6242 O O   . HOH EA 5 .   ? -57.47599 44.68654 -27.51831 1.000 46.97221  ? 749 HOH B O   1 
HETATM 6243 O O   . HOH EA 5 .   ? -37.95692 53.35681 -33.30348 1.000 54.50526  ? 750 HOH B O   1 
HETATM 6244 O O   . HOH EA 5 .   ? -61.52553 51.21604 -37.03630 1.000 65.80604  ? 751 HOH B O   1 
HETATM 6245 O O   . HOH EA 5 .   ? -58.126   64.529   -26.338   1.000 36.75200  ? 752 HOH B O   1 
HETATM 6246 O O   . HOH EA 5 .   ? -50.13848 68.24808 -12.04644 1.000 60.78468  ? 753 HOH B O   1 
HETATM 6247 O O   . HOH EA 5 .   ? -57.16857 64.88627 -10.06056 1.000 58.22233  ? 754 HOH B O   1 
HETATM 6248 O O   . HOH EA 5 .   ? -44.55587 70.01671 -10.60282 1.000 54.43562  ? 755 HOH B O   1 
HETATM 6249 O O   . HOH EA 5 .   ? -78.66408 68.11565 -11.31505 1.000 47.68453  ? 756 HOH B O   1 
HETATM 6250 O O   . HOH EA 5 .   ? -40.70500 46.58730 -8.67588  1.000 57.10832  ? 757 HOH B O   1 
HETATM 6251 O O   . HOH EA 5 .   ? -36.63222 57.60020 -32.22228 1.000 43.30510  ? 758 HOH B O   1 
HETATM 6252 O O   . HOH EA 5 .   ? -44.64016 68.77486 -7.83455  1.000 55.60209  ? 759 HOH B O   1 
HETATM 6253 O O   . HOH EA 5 .   ? -47.31877 52.36954 -0.92414  1.000 55.72783  ? 760 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   A ASN A 23  ? 0.67471 0.71348 0.81364 0.06083  0.05365  -0.13112 0   ASN A N   
2    N N   B ASN A 23  ? 0.71804 0.79587 0.85504 0.02584  0.09208  -0.12328 0   ASN A N   
3    C CA  A ASN A 23  ? 0.68202 0.69767 0.79069 0.06015  0.04458  -0.11728 0   ASN A CA  
4    C CA  B ASN A 23  ? 0.66324 0.72317 0.78868 0.03516  0.07544  -0.11462 0   ASN A CA  
5    C C   A ASN A 23  ? 0.63004 0.63788 0.71934 0.05421  0.03858  -0.09853 0   ASN A C   
6    C C   B ASN A 23  ? 0.64382 0.68577 0.73639 0.02969  0.06952  -0.09506 0   ASN A C   
7    O O   A ASN A 23  ? 0.57384 0.56636 0.65151 0.05673  0.02500  -0.08748 0   ASN A O   
8    O O   B ASN A 23  ? 0.63458 0.67811 0.72781 0.02722  0.06518  -0.08633 0   ASN A O   
9    C CB  A ASN A 23  ? 0.69998 0.70305 0.81871 0.07201  0.02745  -0.11948 0   ASN A CB  
10   C CB  B ASN A 23  ? 0.64883 0.71259 0.80292 0.04825  0.05771  -0.11749 0   ASN A CB  
11   N N   A MET A 24  ? 0.61308 0.63130 0.69946 0.04576  0.04915  -0.09589 1   MET A N   
12   N N   B MET A 24  ? 0.55206 0.57776 0.61747 0.02792  0.06919  -0.08946 1   MET A N   
13   C CA  A MET A 24  ? 0.54674 0.55764 0.61397 0.03977  0.04513  -0.07978 1   MET A CA  
14   C CA  B MET A 24  ? 0.52728 0.53743 0.56458 0.02347  0.06319  -0.07327 1   MET A CA  
15   C C   A MET A 24  ? 0.49130 0.48621 0.52663 0.03447  0.04611  -0.07119 1   MET A C   
16   C C   B MET A 24  ? 0.47016 0.46498 0.49316 0.02806  0.05388  -0.06947 1   MET A C   
17   O O   A MET A 24  ? 0.48834 0.48111 0.51063 0.03000  0.05666  -0.07668 1   MET A O   
18   O O   B MET A 24  ? 0.50076 0.49399 0.52533 0.03105  0.05696  -0.07897 1   MET A O   
19   C CB  A MET A 24  ? 0.59210 0.61545 0.66241 0.03157  0.05628  -0.07973 1   MET A CB  
20   C CB  B MET A 24  ? 0.52273 0.52854 0.53561 0.01157  0.07588  -0.06981 1   MET A CB  
21   C CG  A MET A 24  ? 0.62487 0.65929 0.71815 0.03467  0.04942  -0.07909 1   MET A CG  
22   C CG  B MET A 24  ? 0.46304 0.47109 0.46889 0.00594  0.09152  -0.08175 1   MET A CG  
23   S SD  A MET A 24  ? 0.50779 0.52918 0.59520 0.04013  0.02919  -0.06487 1   MET A SD  
24   S SD  B MET A 24  ? 0.49168 0.49600 0.47307 -0.01030 0.10723  -0.07825 1   MET A SD  
25   C CE  A MET A 24  ? 0.47767 0.48427 0.52973 0.03180  0.03160  -0.05086 1   MET A CE  
26   C CE  B MET A 24  ? 0.44595 0.46675 0.44112 -0.01649 0.12868  -0.09879 1   MET A CE  
27   N N   A SER A 25  ? 0.43048 0.41458 0.45314 0.03433  0.03525  -0.05845 2   SER A N   
28   N N   B SER A 25  ? 0.42943 0.41380 0.44012 0.02825  0.04286  -0.05673 2   SER A N   
29   C CA  A SER A 25  ? 0.40650 0.37693 0.40330 0.03036  0.03402  -0.05168 2   SER A CA  
30   C CA  B SER A 25  ? 0.40422 0.37423 0.40068 0.03052  0.03415  -0.05221 2   SER A CA  
31   C C   A SER A 25  ? 0.38365 0.34829 0.37230 0.02875  0.02457  -0.03923 2   SER A C   
32   C C   B SER A 25  ? 0.38429 0.34805 0.37259 0.02914  0.02422  -0.03969 2   SER A C   
33   O O   A SER A 25  ? 0.39506 0.36194 0.39552 0.03188  0.01683  -0.03601 2   SER A O   
34   O O   B SER A 25  ? 0.38188 0.34672 0.38178 0.03275  0.01573  -0.03672 2   SER A O   
35   C CB  A SER A 25  ? 0.43789 0.39884 0.43215 0.03507  0.02953  -0.05682 2   SER A CB  
36   C CB  B SER A 25  ? 0.44644 0.41388 0.45777 0.03906  0.02710  -0.05964 2   SER A CB  
37   O OG  A SER A 25  ? 0.40194 0.35265 0.39446 0.03807  0.01626  -0.04960 2   SER A OG  
38   O OG  B SER A 25  ? 0.43761 0.38993 0.43487 0.03982  0.01805  -0.05415 2   SER A OG  
39   N N   . LEU A 26  ? 0.38329 0.34010 0.35150 0.02380  0.02483  -0.03318 3   LEU A N   
40   C CA  . LEU A 26  ? 0.37487 0.32757 0.33716 0.02227  0.01651  -0.02372 3   LEU A CA  
41   C C   . LEU A 26  ? 0.35661 0.30346 0.32339 0.02564  0.00688  -0.02226 3   LEU A C   
42   O O   . LEU A 26  ? 0.35082 0.29838 0.32227 0.02543  0.00093  -0.01708 3   LEU A O   
43   C CB  . LEU A 26  ? 0.35832 0.30315 0.30045 0.01793  0.01647  -0.02006 3   LEU A CB  
44   C CG  . LEU A 26  ? 0.40549 0.34730 0.34328 0.01652  0.00813  -0.01328 3   LEU A CG  
45   C CD1 . LEU A 26  ? 0.39381 0.34269 0.33925 0.01543  0.00747  -0.00855 3   LEU A CD1 
46   C CD2 . LEU A 26  ? 0.43685 0.37073 0.35700 0.01376  0.00640  -0.01209 3   LEU A CD2 
47   N N   . GLU A 27  ? 0.34938 0.28834 0.31186 0.02758  0.00534  -0.02667 4   GLU A N   
48   C CA  . GLU A 27  ? 0.37468 0.30398 0.33770 0.02929  -0.00389 -0.02505 4   GLU A CA  
49   C C   . GLU A 27  ? 0.37868 0.30805 0.35649 0.03433  -0.00959 -0.02612 4   GLU A C   
50   O O   . GLU A 27  ? 0.37106 0.29157 0.34637 0.03348  -0.01825 -0.02100 4   GLU A O   
51   C CB  . GLU A 27  ? 0.37606 0.29611 0.33207 0.03058  -0.00404 -0.03091 4   GLU A CB  
52   C CG  . GLU A 27  ? 0.42275 0.33850 0.36187 0.02525  -0.00360 -0.02845 4   GLU A CG  
53   C CD  . GLU A 27  ? 0.50513 0.42502 0.43443 0.02306  0.00465  -0.03055 4   GLU A CD  
54   O OE1 . GLU A 27  ? 0.43507 0.36253 0.37005 0.02384  0.01218  -0.03345 4   GLU A OE1 
55   O OE2 . GLU A 27  ? 0.53763 0.45197 0.45222 0.01981  0.00320  -0.02953 4   GLU A OE2 
56   N N   . ASN A 28  ? 0.33503 0.27356 0.32795 0.03910  -0.00534 -0.03332 5   ASN A N   
57   C CA  . ASN A 28  ? 0.33353 0.27255 0.34254 0.04487  -0.01323 -0.03487 5   ASN A CA  
58   C C   . ASN A 28  ? 0.33107 0.27547 0.34165 0.04196  -0.01592 -0.02742 5   ASN A C   
59   O O   . ASN A 28  ? 0.38468 0.32161 0.39699 0.04376  -0.02647 -0.02363 5   ASN A O   
60   C CB  . ASN A 28  ? 0.35697 0.30681 0.38643 0.05128  -0.00822 -0.04735 5   ASN A CB  
61   C CG  . ASN A 28  ? 0.40272 0.35516 0.45260 0.05837  -0.01804 -0.05027 5   ASN A CG  
62   O OD1 . ASN A 28  ? 0.40156 0.36808 0.46507 0.05834  -0.01484 -0.05215 5   ASN A OD1 
63   N ND2 . ASN A 28  ? 0.36449 0.30168 0.41554 0.06415  -0.03129 -0.05041 5   ASN A ND2 
64   N N   . VAL A 29  ? 0.30447 0.25950 0.31256 0.03718  -0.00731 -0.02525 6   VAL A N   
65   C CA  . VAL A 29  ? 0.32342 0.28239 0.33114 0.03388  -0.00975 -0.01839 6   VAL A CA  
66   C C   . VAL A 29  ? 0.35541 0.30318 0.34899 0.02995  -0.01698 -0.01045 6   VAL A C   
67   O O   . VAL A 29  ? 0.35868 0.30284 0.35207 0.02922  -0.02406 -0.00633 6   VAL A O   
68   C CB  . VAL A 29  ? 0.34702 0.31540 0.35141 0.02901  0.00001  -0.01719 6   VAL A CB  
69   C CG1 . VAL A 29  ? 0.32799 0.29929 0.33129 0.02565  -0.00289 -0.01063 6   VAL A CG1 
70   C CG2 . VAL A 29  ? 0.35540 0.33514 0.37363 0.03049  0.00865  -0.02551 6   VAL A CG2 
71   N N   . ALA A 30  ? 0.34337 0.28539 0.32438 0.02649  -0.01512 -0.00891 7   ALA A N   
72   C CA  . ALA A 30  ? 0.34872 0.28223 0.31811 0.02113  -0.02002 -0.00322 7   ALA A CA  
73   C C   . ALA A 30  ? 0.32129 0.24033 0.28776 0.02219  -0.02932 -0.00192 7   ALA A C   
74   O O   . ALA A 30  ? 0.38243 0.29441 0.34042 0.01703  -0.03401 0.00343  7   ALA A O   
75   C CB  . ALA A 30  ? 0.37438 0.30592 0.33437 0.01775  -0.01690 -0.00383 7   ALA A CB  
76   N N   . PHE A 31  ? 0.34449 0.25721 0.31638 0.02833  -0.03229 -0.00709 8   PHE A N   
77   C CA  . PHE A 31  ? 0.38571 0.28100 0.35427 0.03032  -0.04355 -0.00571 8   PHE A CA  
78   C C   . PHE A 31  ? 0.41648 0.31021 0.38868 0.03182  -0.05114 -0.00237 8   PHE A C   
79   O O   . PHE A 31  ? 0.40024 0.27759 0.35934 0.02785  -0.06009 0.00359  8   PHE A O   
80   C CB  . PHE A 31  ? 0.40927 0.29967 0.38758 0.03879  -0.04610 -0.01399 8   PHE A CB  
81   C CG  . PHE A 31  ? 0.42126 0.29190 0.39881 0.04325  -0.06034 -0.01347 8   PHE A CG  
82   C CD1 . PHE A 31  ? 0.45988 0.33136 0.45108 0.05059  -0.06874 -0.01575 8   PHE A CD1 
83   C CD2 . PHE A 31  ? 0.44881 0.29854 0.41168 0.03992  -0.06654 -0.01087 8   PHE A CD2 
84   C CE1 . PHE A 31  ? 0.52601 0.37615 0.51519 0.05552  -0.08469 -0.01500 8   PHE A CE1 
85   C CE2 . PHE A 31  ? 0.55034 0.37730 0.50932 0.04366  -0.08132 -0.00951 8   PHE A CE2 
86   C CZ  . PHE A 31  ? 0.56581 0.39199 0.53738 0.05198  -0.09127 -0.01136 8   PHE A CZ  
87   N N   . ASN A 32  ? 0.33871 0.24804 0.32731 0.03674  -0.04797 -0.00643 9   ASN A N   
88   C CA  . ASN A 32  ? 0.38742 0.29649 0.38080 0.03843  -0.05596 -0.00416 9   ASN A CA  
89   C C   . ASN A 32  ? 0.38848 0.29594 0.36626 0.02920  -0.05503 0.00405  9   ASN A C   
90   O O   . ASN A 32  ? 0.42343 0.31817 0.39134 0.02702  -0.06483 0.00888  9   ASN A O   
91   C CB  . ASN A 32  ? 0.36895 0.29765 0.38517 0.04423  -0.05110 -0.01142 9   ASN A CB  
92   C CG  . ASN A 32  ? 0.41838 0.34770 0.45437 0.05451  -0.05657 -0.02124 9   ASN A CG  
93   O OD1 . ASN A 32  ? 0.42786 0.35497 0.47570 0.06055  -0.06799 -0.02363 9   ASN A OD1 
94   N ND2 . ASN A 32  ? 0.35591 0.28757 0.39567 0.05684  -0.04935 -0.02789 9   ASN A ND2 
95   N N   . VAL A 33  ? 0.36861 0.28805 0.34354 0.02373  -0.04389 0.00505  10  VAL A N   
96   C CA  . VAL A 33  ? 0.38976 0.30964 0.35265 0.01527  -0.04209 0.01059  10  VAL A CA  
97   C C   . VAL A 33  ? 0.42739 0.32890 0.37093 0.00808  -0.04741 0.01545  10  VAL A C   
98   O O   . VAL A 33  ? 0.45619 0.34842 0.38752 0.00274  -0.05259 0.01991  10  VAL A O   
99   C CB  . VAL A 33  ? 0.38718 0.32126 0.35207 0.01207  -0.03113 0.00947  10  VAL A CB  
100  C CG1 . VAL A 33  ? 0.36962 0.30507 0.32416 0.00331  -0.02869 0.01288  10  VAL A CG1 
101  C CG2 . VAL A 33  ? 0.32766 0.27634 0.30733 0.01666  -0.02615 0.00607  10  VAL A CG2 
102  N N   . VAL A 34  ? 0.40263 0.29686 0.34158 0.00713  -0.04644 0.01440  11  VAL A N   
103  C CA  . VAL A 34  ? 0.43891 0.31527 0.35897 -0.00171 -0.04998 0.01861  11  VAL A CA  
104  C C   . VAL A 34  ? 0.47797 0.33221 0.38702 -0.00099 -0.06301 0.02272  11  VAL A C   
105  O O   . VAL A 34  ? 0.54328 0.38260 0.43219 -0.01088 -0.06619 0.02827  11  VAL A O   
106  C CB  . VAL A 34  ? 0.44998 0.32242 0.36915 -0.00216 -0.04742 0.01578  11  VAL A CB  
107  C CG1 . VAL A 34  ? 0.52528 0.37500 0.42508 -0.01115 -0.05285 0.01992  11  VAL A CG1 
108  C CG2 . VAL A 34  ? 0.42766 0.31816 0.35246 -0.00527 -0.03682 0.01277  11  VAL A CG2 
109  N N   . ASN A 35  ? 0.44840 0.29878 0.36964 0.01027  -0.07124 0.01945  12  ASN A N   
110  C CA  . ASN A 35  ? 0.46012 0.28543 0.37102 0.01251  -0.08683 0.02275  12  ASN A CA  
111  C C   . ASN A 35  ? 0.52601 0.35046 0.43926 0.01615  -0.09600 0.02444  12  ASN A C   
112  O O   . ASN A 35  ? 0.54113 0.34122 0.43670 0.01388  -0.10964 0.02990  12  ASN A O   
113  C CB  . ASN A 35  ? 0.50950 0.32808 0.43342 0.02358  -0.09335 0.01663  12  ASN A CB  
114  C CG  . ASN A 35  ? 0.61573 0.42397 0.52927 0.01839  -0.08961 0.01669  12  ASN A CG  
115  O OD1 . ASN A 35  ? 0.69324 0.47621 0.58639 0.01185  -0.09751 0.02217  12  ASN A OD1 
116  N ND2 . ASN A 35  ? 0.51527 0.34193 0.44013 0.01963  -0.07740 0.01109  12  ASN A ND2 
117  N N   . LYS A 36  ? 0.45455 0.30286 0.38767 0.02127  -0.08990 0.01997  13  LYS A N   
118  C CA  . LYS A 36  ? 0.43159 0.28118 0.37132 0.02592  -0.09940 0.01984  13  LYS A CA  
119  C C   . LYS A 36  ? 0.48348 0.34776 0.42019 0.01895  -0.09100 0.02206  13  LYS A C   
120  O O   . LYS A 36  ? 0.44371 0.30854 0.38294 0.02095  -0.09867 0.02243  13  LYS A O   
121  C CB  . LYS A 36  ? 0.42722 0.29204 0.39828 0.03946  -0.10163 0.01015  13  LYS A CB  
122  C CG  . LYS A 36  ? 0.53528 0.38477 0.51249 0.04844  -0.11276 0.00591  13  LYS A CG  
123  C CD  . LYS A 36  ? 0.63090 0.45374 0.59528 0.05078  -0.13412 0.01061  13  LYS A CD  
124  C CE  . LYS A 36  ? 0.79537 0.60434 0.77248 0.06296  -0.14849 0.00429  13  LYS A CE  
125  N NZ  . LYS A 36  ? 0.83908 0.61582 0.79779 0.06441  -0.17191 0.01063  13  LYS A NZ  
126  N N   . GLY A 37  ? 0.44523 0.32049 0.37698 0.01116  -0.07678 0.02290  14  GLY A N   
127  C CA  . GLY A 37  ? 0.44305 0.33177 0.37330 0.00522  -0.06897 0.02374  14  GLY A CA  
128  C C   . GLY A 37  ? 0.47329 0.38540 0.42691 0.01127  -0.06170 0.01831  14  GLY A C   
129  O O   . GLY A 37  ? 0.44874 0.37148 0.40203 0.00681  -0.05523 0.01853  14  GLY A O   
130  N N   . HIS A 38  ? 0.42737 0.34727 0.40062 0.02038  -0.06182 0.01282  15  HIS A N   
131  C CA  . HIS A 38  ? 0.37423 0.31453 0.36852 0.02463  -0.05431 0.00724  15  HIS A CA  
132  C C   . HIS A 38  ? 0.41091 0.35450 0.42247 0.03326  -0.05521 0.00036  15  HIS A C   
133  O O   . HIS A 38  ? 0.42332 0.35293 0.43105 0.03677  -0.06341 0.00021  15  HIS A O   
134  C CB  . HIS A 38  ? 0.35783 0.30438 0.35973 0.02532  -0.05927 0.00658  15  HIS A CB  
135  C CG  . HIS A 38  ? 0.38032 0.31997 0.39157 0.03262  -0.07397 0.00395  15  HIS A CG  
136  N ND1 . HIS A 38  ? 0.40669 0.36079 0.44309 0.03906  -0.07588 -0.00337 15  HIS A ND1 
137  C CD2 . HIS A 38  ? 0.44272 0.36161 0.44233 0.03473  -0.08843 0.00700  15  HIS A CD2 
138  C CE1 . HIS A 38  ? 0.40269 0.34711 0.44522 0.04598  -0.09178 -0.00554 15  HIS A CE1 
139  N NE2 . HIS A 38  ? 0.44685 0.36801 0.46571 0.04373  -0.10042 0.00132  15  HIS A NE2 
140  N N   . PHE A 39  ? 0.35138 0.31257 0.38136 0.03599  -0.04638 -0.00598 16  PHE A N   
141  C CA  . PHE A 39  ? 0.36204 0.32857 0.40971 0.04328  -0.04523 -0.01469 16  PHE A CA  
142  C C   . PHE A 39  ? 0.39294 0.35741 0.45654 0.05113  -0.05898 -0.01941 16  PHE A C   
143  O O   . PHE A 39  ? 0.40329 0.37566 0.47709 0.05156  -0.06281 -0.02055 16  PHE A O   
144  C CB  . PHE A 39  ? 0.30122 0.28627 0.36267 0.04220  -0.03098 -0.02111 16  PHE A CB  
145  C CG  . PHE A 39  ? 0.32103 0.31161 0.39771 0.04793  -0.02687 -0.03132 16  PHE A CG  
146  C CD1 . PHE A 39  ? 0.36333 0.34589 0.42832 0.04759  -0.02265 -0.03143 16  PHE A CD1 
147  C CD2 . PHE A 39  ? 0.30945 0.31359 0.41351 0.05376  -0.02788 -0.04214 16  PHE A CD2 
148  C CE1 . PHE A 39  ? 0.39156 0.37878 0.46978 0.05273  -0.01838 -0.04212 16  PHE A CE1 
149  C CE2 . PHE A 39  ? 0.38282 0.39348 0.50256 0.05886  -0.02317 -0.05352 16  PHE A CE2 
150  C CZ  . PHE A 39  ? 0.40030 0.40185 0.50598 0.05832  -0.01808 -0.05346 16  PHE A CZ  
151  N N   . ASP A 40  ? 0.39849 0.35172 0.46523 0.05788  -0.06761 -0.02289 17  ASP A N   
152  C CA  . ASP A 40  ? 0.46183 0.40940 0.54355 0.06698  -0.08433 -0.02771 17  ASP A CA  
153  C C   . ASP A 40  ? 0.45185 0.40618 0.55808 0.07680  -0.08433 -0.04065 17  ASP A C   
154  O O   . ASP A 40  ? 0.47311 0.41817 0.59099 0.08614  -0.10039 -0.04544 17  ASP A O   
155  C CB  . ASP A 40  ? 0.52589 0.44499 0.58220 0.06545  -0.10054 -0.01778 17  ASP A CB  
156  C CG  . ASP A 40  ? 0.71217 0.62088 0.77777 0.07375  -0.12149 -0.02008 17  ASP A CG  
157  O OD1 . ASP A 40  ? 0.72489 0.64808 0.80791 0.07614  -0.12418 -0.02431 17  ASP A OD1 
158  O OD2 . ASP A 40  ? 0.71703 0.60133 0.77141 0.07762  -0.13631 -0.01751 17  ASP A OD2 
159  N N   . GLY A 41  ? 0.43740 0.40577 0.55006 0.07483  -0.06730 -0.04677 18  GLY A N   
160  C CA  . GLY A 41  ? 0.42438 0.40126 0.56108 0.08333  -0.06519 -0.06111 18  GLY A CA  
161  C C   . GLY A 41  ? 0.46860 0.42482 0.59758 0.08927  -0.07506 -0.06182 18  GLY A C   
162  O O   . GLY A 41  ? 0.46247 0.42322 0.61437 0.09874  -0.07791 -0.07505 18  GLY A O   
163  N N   . GLN A 42  ? 0.38520 0.31909 0.48368 0.08360  -0.07993 -0.04909 19  GLN A N   
164  C CA  . GLN A 42  ? 0.43700 0.34861 0.52635 0.08797  -0.08977 -0.04921 19  GLN A CA  
165  C C   . GLN A 42  ? 0.45497 0.37131 0.54093 0.08573  -0.07507 -0.05437 19  GLN A C   
166  O O   . GLN A 42  ? 0.46982 0.39788 0.54652 0.07743  -0.05945 -0.05152 19  GLN A O   
167  C CB  . GLN A 42  ? 0.47623 0.36100 0.53333 0.08081  -0.10044 -0.03404 19  GLN A CB  
168  C CG  . GLN A 42  ? 0.53275 0.40912 0.58553 0.08085  -0.11496 -0.02747 19  GLN A CG  
169  C CD  . GLN A 42  ? 0.66827 0.53619 0.74105 0.09413  -0.13458 -0.03531 19  GLN A CD  
170  O OE1 . GLN A 42  ? 0.73307 0.58951 0.81296 0.10211  -0.14196 -0.04179 19  GLN A OE1 
171  N NE2 . GLN A 42  ? 0.70114 0.57463 0.78428 0.09708  -0.14408 -0.03561 19  GLN A NE2 
172  N N   . GLN A 43  ? 0.40749 0.31226 0.49935 0.09331  -0.08159 -0.06198 20  GLN A N   
173  C CA  . GLN A 43  ? 0.43352 0.33779 0.51781 0.09093  -0.07016 -0.06637 20  GLN A CA  
174  C C   . GLN A 43  ? 0.51209 0.39502 0.56435 0.08194  -0.07262 -0.05321 20  GLN A C   
175  O O   . GLN A 43  ? 0.49567 0.35667 0.53394 0.08076  -0.08699 -0.04426 20  GLN A O   
176  C CB  . GLN A 43  ? 0.48748 0.38766 0.59160 0.10264  -0.07601 -0.08118 20  GLN A CB  
177  C CG  . GLN A 43  ? 0.60450 0.53117 0.74357 0.11015  -0.06834 -0.09837 20  GLN A CG  
178  C CD  . GLN A 43  ? 0.82814 0.75311 0.98796 0.12139  -0.07144 -0.11557 20  GLN A CD  
179  O OE1 . GLN A 43  ? 0.86497 0.76493 1.01664 0.12668  -0.08601 -0.11393 20  GLN A OE1 
180  N NE2 . GLN A 43  ? 0.88559 0.83668 1.07193 0.12431  -0.05705 -0.13288 20  GLN A NE2 
181  N N   . GLY A 44  ? 0.45887 0.34746 0.49918 0.07506  -0.05891 -0.05275 21  GLY A N   
182  C CA  . GLY A 44  ? 0.44702 0.31916 0.46148 0.06651  -0.05988 -0.04322 21  GLY A CA  
183  C C   . GLY A 44  ? 0.45169 0.33756 0.45558 0.05783  -0.04513 -0.04016 21  GLY A C   
184  O O   . GLY A 44  ? 0.42173 0.32640 0.43420 0.05733  -0.03514 -0.04292 21  GLY A O   
185  N N   . GLU A 45  ? 0.41917 0.29426 0.40408 0.05064  -0.04471 -0.03464 22  GLU A N   
186  C CA  . GLU A 45  ? 0.41976 0.30535 0.39425 0.04311  -0.03399 -0.03170 22  GLU A CA  
187  C C   . GLU A 45  ? 0.47751 0.35200 0.43490 0.03423  -0.03797 -0.02292 22  GLU A C   
188  O O   . GLU A 45  ? 0.44925 0.30588 0.39968 0.03309  -0.04618 -0.02140 22  GLU A O   
189  C CB  . GLU A 45  ? 0.46582 0.35500 0.43921 0.04465  -0.02577 -0.04063 22  GLU A CB  
190  C CG  . GLU A 45  ? 0.65921 0.56433 0.64661 0.04932  -0.01611 -0.04992 22  GLU A CG  
191  C CD  . GLU A 45  ? 0.83827 0.74196 0.84446 0.05911  -0.01967 -0.06144 22  GLU A CD  
192  O OE1 . GLU A 45  ? 0.88136 0.76830 0.88655 0.06285  -0.03031 -0.06217 22  GLU A OE1 
193  O OE2 . GLU A 45  ? 0.84919 0.76839 0.87211 0.06285  -0.01200 -0.07049 22  GLU A OE2 
194  N N   . VAL A 46  ? 0.43199 0.31672 0.38348 0.02762  -0.03229 -0.01792 23  VAL A N   
195  C CA  . VAL A 46  ? 0.47110 0.35034 0.41005 0.01871  -0.03345 -0.01296 23  VAL A CA  
196  C C   . VAL A 46  ? 0.42514 0.31509 0.36095 0.01634  -0.02658 -0.01511 23  VAL A C   
197  O O   . VAL A 46  ? 0.45255 0.35345 0.39240 0.01959  -0.02065 -0.01734 23  VAL A O   
198  C CB  . VAL A 46  ? 0.39633 0.27640 0.33174 0.01235  -0.03551 -0.00539 23  VAL A CB  
199  C CG1 . VAL A 46  ? 0.44168 0.30509 0.37393 0.01327  -0.04496 -0.00203 23  VAL A CG1 
200  C CG2 . VAL A 46  ? 0.37468 0.27226 0.31756 0.01364  -0.02973 -0.00421 23  VAL A CG2 
201  N N   . PRO A 47  ? 0.42164 0.30767 0.34964 0.01005  -0.02794 -0.01456 24  PRO A N   
202  C CA  . PRO A 47  ? 0.40036 0.29486 0.32516 0.00846  -0.02447 -0.01672 24  PRO A CA  
203  C C   . PRO A 47  ? 0.41277 0.32024 0.34120 0.00635  -0.02190 -0.01288 24  PRO A C   
204  O O   . PRO A 47  ? 0.40035 0.31010 0.33142 0.00199  -0.02296 -0.00904 24  PRO A O   
205  C CB  . PRO A 47  ? 0.41217 0.29959 0.33140 0.00205  -0.02839 -0.01795 24  PRO A CB  
206  C CG  . PRO A 47  ? 0.45004 0.32129 0.36685 0.00078  -0.03308 -0.01693 24  PRO A CG  
207  C CD  . PRO A 47  ? 0.42838 0.30064 0.34978 0.00367  -0.03343 -0.01261 24  PRO A CD  
208  N N   . VAL A 48  ? 0.35588 0.27004 0.28263 0.00887  -0.01865 -0.01420 25  VAL A N   
209  C CA  . VAL A 48  ? 0.32508 0.24946 0.25517 0.00815  -0.01697 -0.01108 25  VAL A CA  
210  C C   . VAL A 48  ? 0.35660 0.28257 0.28105 0.00721  -0.01927 -0.01268 25  VAL A C   
211  O O   . VAL A 48  ? 0.36592 0.28553 0.28075 0.00870  -0.01958 -0.01566 25  VAL A O   
212  C CB  . VAL A 48  ? 0.39872 0.32701 0.33162 0.01225  -0.01182 -0.01034 25  VAL A CB  
213  C CG1 . VAL A 48  ? 0.38476 0.32050 0.31843 0.01140  -0.01053 -0.00745 25  VAL A CG1 
214  C CG2 . VAL A 48  ? 0.36952 0.29745 0.31087 0.01391  -0.01231 -0.00904 25  VAL A CG2 
215  N N   . SER A 49  ? 0.31012 0.24398 0.24035 0.00503  -0.02158 -0.01146 26  SER A N   
216  C CA  . SER A 49  ? 0.34128 0.27693 0.26884 0.00588  -0.02604 -0.01290 26  SER A CA  
217  C C   . SER A 49  ? 0.35174 0.29235 0.28214 0.00778  -0.02474 -0.00983 26  SER A C   
218  O O   . SER A 49  ? 0.36567 0.31372 0.30571 0.00650  -0.02221 -0.00818 26  SER A O   
219  C CB  . SER A 49  ? 0.37224 0.31482 0.30926 0.00234  -0.03156 -0.01676 26  SER A CB  
220  O OG  . SER A 49  ? 0.53255 0.47021 0.46723 -0.00063 -0.03319 -0.01984 26  SER A OG  
221  N N   . ILE A 50  ? 0.33427 0.26895 0.25444 0.01009  -0.02723 -0.00912 27  ILE A N   
222  C CA  . ILE A 50  ? 0.29719 0.23343 0.21842 0.01157  -0.02812 -0.00635 27  ILE A CA  
223  C C   . ILE A 50  ? 0.33833 0.27338 0.26025 0.01336  -0.03851 -0.00875 27  ILE A C   
224  O O   . ILE A 50  ? 0.38133 0.30637 0.29047 0.01428  -0.04462 -0.00992 27  ILE A O   
225  C CB  . ILE A 50  ? 0.36880 0.29621 0.27587 0.01174  -0.02266 -0.00312 27  ILE A CB  
226  C CG1 . ILE A 50  ? 0.42042 0.35319 0.33443 0.01111  -0.01350 -0.00297 27  ILE A CG1 
227  C CG2 . ILE A 50  ? 0.35216 0.27694 0.25692 0.01238  -0.02495 0.00014  27  ILE A CG2 
228  C CD1 . ILE A 50  ? 0.56180 0.49188 0.46973 0.01038  -0.00618 -0.00182 27  ILE A CD1 
229  N N   A ILE A 51  ? 0.34274 0.28778 0.27998 0.01415  -0.04142 -0.01056 28  ILE A N   
230  N N   B ILE A 51  ? 0.33283 0.27796 0.27013 0.01412  -0.04113 -0.01041 28  ILE A N   
231  C CA  A ILE A 51  ? 0.35312 0.29842 0.29557 0.01734  -0.05282 -0.01468 28  ILE A CA  
232  C CA  B ILE A 51  ? 0.35277 0.29911 0.29660 0.01734  -0.05212 -0.01445 28  ILE A CA  
233  C C   A ILE A 51  ? 0.35657 0.30436 0.30625 0.01999  -0.05450 -0.01374 28  ILE A C   
234  C C   B ILE A 51  ? 0.35544 0.30877 0.31123 0.01903  -0.05180 -0.01452 28  ILE A C   
235  O O   A ILE A 51  ? 0.37032 0.32986 0.33332 0.01819  -0.04804 -0.01459 28  ILE A O   
236  O O   B ILE A 51  ? 0.34255 0.30666 0.30898 0.01621  -0.04393 -0.01474 28  ILE A O   
237  C CB  A ILE A 51  ? 0.37233 0.33114 0.33317 0.01561  -0.05621 -0.02255 28  ILE A CB  
238  C CB  B ILE A 51  ? 0.37741 0.33518 0.33710 0.01593  -0.05666 -0.02229 28  ILE A CB  
239  C CG1 A ILE A 51  ? 0.43188 0.38812 0.38671 0.01177  -0.05324 -0.02334 28  ILE A CG1 
240  C CG1 B ILE A 51  ? 0.42336 0.37798 0.37617 0.01222  -0.05363 -0.02284 28  ILE A CG1 
241  C CG2 A ILE A 51  ? 0.41397 0.37239 0.38123 0.02037  -0.07028 -0.02833 28  ILE A CG2 
242  C CG2 B ILE A 51  ? 0.40383 0.35983 0.36839 0.02095  -0.07110 -0.02755 28  ILE A CG2 
243  C CD1 A ILE A 51  ? 0.49817 0.46641 0.46988 0.00839  -0.05663 -0.03156 28  ILE A CD1 
244  C CD1 B ILE A 51  ? 0.51045 0.47761 0.48052 0.00847  -0.05596 -0.03074 28  ILE A CD1 
245  N N   A ASN A 52  ? 0.41911 0.35363 0.35790 0.02386  -0.06378 -0.01192 29  ASN A N   
246  N N   B ASN A 52  ? 0.41272 0.35806 0.36549 0.02360  -0.06153 -0.01463 29  ASN A N   
247  C CA  A ASN A 52  ? 0.48302 0.41481 0.42466 0.02641  -0.06597 -0.01003 29  ASN A CA  
248  C CA  B ASN A 52  ? 0.46885 0.41888 0.43427 0.02671  -0.06465 -0.01655 29  ASN A CA  
249  C C   A ASN A 52  ? 0.42514 0.35762 0.36207 0.02256  -0.05314 -0.00431 29  ASN A C   
250  C C   B ASN A 52  ? 0.40905 0.36450 0.37718 0.02371  -0.05334 -0.01283 29  ASN A C   
251  O O   A ASN A 52  ? 0.42724 0.35020 0.34697 0.01957  -0.04690 0.00058  29  ASN A O   
252  O O   B ASN A 52  ? 0.29004 0.25974 0.27560 0.02285  -0.04977 -0.01729 29  ASN A O   
253  C CB  A ASN A 52  ? 0.49312 0.44181 0.46175 0.02930  -0.07021 -0.01834 29  ASN A CB  
254  C CB  B ASN A 52  ? 0.58436 0.55088 0.57485 0.02879  -0.07049 -0.02706 29  ASN A CB  
255  C CG  A ASN A 52  ? 0.60736 0.55926 0.58661 0.03336  -0.08329 -0.02642 29  ASN A CG  
256  C CG  B ASN A 52  ? 0.60753 0.56728 0.59736 0.03367  -0.08551 -0.03142 29  ASN A CG  
257  O OD1 A ASN A 52  ? 0.68032 0.61627 0.64805 0.03813  -0.09658 -0.02531 29  ASN A OD1 
258  O OD1 B ASN A 52  ? 0.67309 0.61259 0.64363 0.03735  -0.09503 -0.02630 29  ASN A OD1 
259  N ND2 A ASN A 52  ? 0.58355 0.55503 0.58383 0.03071  -0.08002 -0.03479 29  ASN A ND2 
260  N ND2 B ASN A 52  ? 0.51969 0.49437 0.52780 0.03268  -0.08780 -0.04052 29  ASN A ND2 
261  N N   A ASN A 53  ? 0.36735 0.31270 0.32106 0.02228  -0.04881 -0.00633 30  ASN A N   
262  N N   B ASN A 53  ? 0.38741 0.33096 0.33756 0.02171  -0.04790 -0.00542 30  ASN A N   
263  C CA  A ASN A 53  ? 0.40738 0.35508 0.36031 0.01923  -0.03873 -0.00212 30  ASN A CA  
264  C CA  B ASN A 53  ? 0.40583 0.35248 0.35695 0.01902  -0.03840 -0.00168 30  ASN A CA  
265  C C   A ASN A 53  ? 0.39832 0.35998 0.36195 0.01583  -0.03049 -0.00378 30  ASN A C   
266  C C   B ASN A 53  ? 0.39814 0.35932 0.36115 0.01584  -0.03048 -0.00361 30  ASN A C   
267  O O   A ASN A 53  ? 0.40906 0.37646 0.37829 0.01412  -0.02497 -0.00263 30  ASN A O   
268  O O   B ASN A 53  ? 0.41040 0.37732 0.37927 0.01425  -0.02521 -0.00255 30  ASN A O   
269  C CB  A ASN A 53  ? 0.45041 0.39796 0.41026 0.02123  -0.04144 -0.00253 30  ASN A CB  
270  C CB  B ASN A 53  ? 0.45531 0.40076 0.41267 0.02135  -0.04216 -0.00210 30  ASN A CB  
271  C CG  A ASN A 53  ? 0.42876 0.36084 0.37214 0.01966  -0.03969 0.00414  30  ASN A CG  
272  C CG  B ASN A 53  ? 0.42980 0.36113 0.37156 0.01932  -0.03914 0.00459  30  ASN A CG  
273  O OD1 A ASN A 53  ? 0.41419 0.34070 0.34458 0.01596  -0.03271 0.00828  30  ASN A OD1 
274  O OD1 B ASN A 53  ? 0.40547 0.33108 0.33406 0.01569  -0.03235 0.00856  30  ASN A OD1 
275  N ND2 A ASN A 53  ? 0.43859 0.36369 0.38308 0.02193  -0.04562 0.00426  30  ASN A ND2 
276  N ND2 B ASN A 53  ? 0.42654 0.35264 0.37072 0.02109  -0.04360 0.00479  30  ASN A ND2 
277  N N   . THR A 54  ? 0.34046 0.30561 0.30527 0.01435  -0.03043 -0.00627 31  THR A N   
278  C CA  . THR A 54  ? 0.33048 0.30488 0.30248 0.01023  -0.02441 -0.00747 31  THR A CA  
279  C C   . THR A 54  ? 0.36784 0.33589 0.33021 0.00888  -0.02166 -0.00520 31  THR A C   
280  O O   . THR A 54  ? 0.35080 0.31182 0.30510 0.01023  -0.02523 -0.00589 31  THR A O   
281  C CB  . THR A 54  ? 0.41626 0.40220 0.40221 0.00808  -0.02663 -0.01462 31  THR A CB  
282  O OG1 . THR A 54  ? 0.44835 0.44051 0.44511 0.01052  -0.02927 -0.01836 31  THR A OG1 
283  C CG2 . THR A 54  ? 0.38173 0.37401 0.37057 0.00136  -0.01997 -0.01529 31  THR A CG2 
284  N N   . VAL A 55  ? 0.32581 0.29504 0.28855 0.00666  -0.01640 -0.00296 32  VAL A N   
285  C CA  . VAL A 55  ? 0.30244 0.26566 0.25906 0.00604  -0.01462 -0.00205 32  VAL A CA  
286  C C   . VAL A 55  ? 0.34759 0.31307 0.30756 0.00126  -0.01508 -0.00386 32  VAL A C   
287  O O   . VAL A 55  ? 0.32289 0.29327 0.28726 -0.00233 -0.01330 -0.00352 32  VAL A O   
288  C CB  . VAL A 55  ? 0.33447 0.29592 0.29051 0.00747  -0.01040 0.00082  32  VAL A CB  
289  C CG1 . VAL A 55  ? 0.33350 0.28846 0.28574 0.00835  -0.00977 0.00007  32  VAL A CG1 
290  C CG2 . VAL A 55  ? 0.32974 0.28967 0.28240 0.00968  -0.00817 0.00212  32  VAL A CG2 
291  N N   . TYR A 56  ? 0.28228 0.24273 0.23818 0.00009  -0.01709 -0.00583 33  TYR A N   
292  C CA  . TYR A 56  ? 0.28630 0.24581 0.24279 -0.00608 -0.01715 -0.00733 33  TYR A CA  
293  C C   . TYR A 56  ? 0.35888 0.30645 0.30740 -0.00535 -0.01762 -0.00557 33  TYR A C   
294  O O   . TYR A 56  ? 0.36832 0.31084 0.31258 -0.00013 -0.01781 -0.00578 33  TYR A O   
295  C CB  . TYR A 56  ? 0.34068 0.30496 0.30195 -0.00907 -0.02020 -0.01300 33  TYR A CB  
296  C CG  . TYR A 56  ? 0.39833 0.37507 0.37120 -0.00853 -0.02160 -0.01723 33  TYR A CG  
297  C CD1 . TYR A 56  ? 0.38637 0.36281 0.35938 -0.00176 -0.02631 -0.01760 33  TYR A CD1 
298  C CD2 . TYR A 56  ? 0.37128 0.35886 0.35422 -0.01518 -0.01842 -0.02157 33  TYR A CD2 
299  C CE1 . TYR A 56  ? 0.37621 0.36223 0.36111 0.00009  -0.02971 -0.02216 33  TYR A CE1 
300  C CE2 . TYR A 56  ? 0.41551 0.41594 0.41247 -0.01372 -0.01980 -0.02756 33  TYR A CE2 
301  C CZ  . TYR A 56  ? 0.49751 0.49686 0.49648 -0.00524 -0.02642 -0.02789 33  TYR A CZ  
302  O OH  . TYR A 56  ? 0.53961 0.54998 0.55371 -0.00261 -0.02975 -0.03451 33  TYR A OH  
303  N N   . THR A 57  ? 0.33480 0.27662 0.28032 -0.01126 -0.01783 -0.00456 34  THR A N   
304  C CA  . THR A 57  ? 0.31413 0.24220 0.25247 -0.01082 -0.02030 -0.00398 34  THR A CA  
305  C C   . THR A 57  ? 0.40400 0.32731 0.33896 -0.01965 -0.02135 -0.00587 34  THR A C   
306  O O   . THR A 57  ? 0.36642 0.29658 0.30402 -0.02754 -0.01886 -0.00691 34  THR A O   
307  C CB  . THR A 57  ? 0.39155 0.31083 0.32692 -0.00836 -0.02180 0.00014  34  THR A CB  
308  O OG1 . THR A 57  ? 0.40096 0.30680 0.33205 -0.00516 -0.02540 -0.00087 34  THR A OG1 
309  C CG2 . THR A 57  ? 0.38509 0.30052 0.31522 -0.01643 -0.02226 0.00366  34  THR A CG2 
310  N N   . LYS A 58  ? 0.39805 0.30998 0.32766 -0.01907 -0.02430 -0.00738 35  LYS A N   
311  C CA  . LYS A 58  ? 0.41883 0.32547 0.34534 -0.02814 -0.02530 -0.00980 35  LYS A CA  
312  C C   . LYS A 58  ? 0.51379 0.40359 0.42949 -0.03447 -0.02685 -0.00509 35  LYS A C   
313  O O   . LYS A 58  ? 0.48369 0.35981 0.39404 -0.02843 -0.03098 -0.00236 35  LYS A O   
314  C CB  . LYS A 58  ? 0.48383 0.38495 0.40861 -0.02502 -0.02854 -0.01423 35  LYS A CB  
315  C CG  . LYS A 58  ? 0.58742 0.48340 0.51037 -0.03515 -0.02986 -0.01763 35  LYS A CG  
316  C CD  . LYS A 58  ? 0.70170 0.58614 0.61946 -0.03189 -0.03418 -0.02132 35  LYS A CD  
317  C CE  . LYS A 58  ? 0.71702 0.61099 0.63819 -0.02437 -0.03557 -0.02569 35  LYS A CE  
318  N NZ  . LYS A 58  ? 0.75638 0.66008 0.68446 -0.02946 -0.03814 -0.03155 35  LYS A NZ  
319  N N   . VAL A 59  ? 0.46540 0.35570 0.37766 -0.04677 -0.02378 -0.00468 36  VAL A N   
320  C CA  . VAL A 59  ? 0.49378 0.36416 0.39021 -0.05579 -0.02554 0.00059  36  VAL A CA  
321  C C   . VAL A 59  ? 0.62873 0.49409 0.52085 -0.06915 -0.02343 -0.00269 36  VAL A C   
322  O O   . VAL A 59  ? 0.52829 0.40963 0.42811 -0.07835 -0.01678 -0.00762 36  VAL A O   
323  C CB  . VAL A 59  ? 0.52502 0.39783 0.41606 -0.06100 -0.02235 0.00469  36  VAL A CB  
324  C CG1 . VAL A 59  ? 0.59525 0.44211 0.46435 -0.07095 -0.02600 0.01111  36  VAL A CG1 
325  C CG2 . VAL A 59  ? 0.47034 0.35029 0.36829 -0.04821 -0.02432 0.00691  36  VAL A CG2 
326  N N   . ASP A 60  ? 0.62799 0.47212 0.50998 -0.07006 -0.02911 -0.00130 37  ASP A N   
327  C CA  . ASP A 60  ? 0.61705 0.45278 0.49347 -0.08353 -0.02781 -0.00419 37  ASP A CA  
328  C C   . ASP A 60  ? 0.59774 0.45793 0.49230 -0.08609 -0.02294 -0.01344 37  ASP A C   
329  O O   . ASP A 60  ? 0.58535 0.45399 0.48335 -0.10007 -0.01679 -0.01784 37  ASP A O   
330  C CB  . ASP A 60  ? 0.73523 0.55684 0.59398 -0.10034 -0.02438 0.00064  37  ASP A CB  
331  C CG  . ASP A 60  ? 0.91797 0.70723 0.75509 -0.09872 -0.03342 0.00969  37  ASP A CG  
332  O OD1 . ASP A 60  ? 0.99691 0.76994 0.83191 -0.09117 -0.04153 0.00979  37  ASP A OD1 
333  O OD2 . ASP A 60  ? 0.96681 0.74642 0.78944 -0.10418 -0.03344 0.01598  37  ASP A OD2 
334  N N   . GLY A 61  ? 0.53903 0.41043 0.44528 -0.07281 -0.02604 -0.01712 38  GLY A N   
335  C CA  . GLY A 61  ? 0.50536 0.39504 0.42674 -0.07383 -0.02527 -0.02581 38  GLY A CA  
336  C C   . GLY A 61  ? 0.48238 0.39782 0.42024 -0.07213 -0.02125 -0.03006 38  GLY A C   
337  O O   . GLY A 61  ? 0.52929 0.45976 0.48138 -0.07086 -0.02310 -0.03783 38  GLY A O   
338  N N   . VAL A 62  ? 0.43301 0.35333 0.36988 -0.07156 -0.01707 -0.02588 39  VAL A N   
339  C CA  . VAL A 62  ? 0.43221 0.37586 0.38564 -0.06859 -0.01416 -0.03078 39  VAL A CA  
340  C C   . VAL A 62  ? 0.41533 0.35899 0.36603 -0.05715 -0.01512 -0.02473 39  VAL A C   
341  O O   . VAL A 62  ? 0.40469 0.33318 0.34222 -0.05459 -0.01611 -0.01731 39  VAL A O   
342  C CB  . VAL A 62  ? 0.48612 0.44213 0.44614 -0.08279 -0.00561 -0.03573 39  VAL A CB  
343  C CG1 . VAL A 62  ? 0.51615 0.47385 0.48100 -0.09588 -0.00356 -0.04313 39  VAL A CG1 
344  C CG2 . VAL A 62  ? 0.43886 0.38212 0.38136 -0.08938 -0.00086 -0.02784 39  VAL A CG2 
345  N N   . ASP A 63  ? 0.39554 0.35619 0.35992 -0.05039 -0.01559 -0.02859 40  ASP A N   
346  C CA  . ASP A 63  ? 0.33969 0.30128 0.30275 -0.04015 -0.01638 -0.02371 40  ASP A CA  
347  C C   . ASP A 63  ? 0.35079 0.31847 0.31480 -0.04452 -0.01071 -0.02204 40  ASP A C   
348  O O   . ASP A 63  ? 0.38133 0.36233 0.35525 -0.05196 -0.00616 -0.02823 40  ASP A O   
349  C CB  . ASP A 63  ? 0.35105 0.32295 0.32441 -0.03095 -0.02115 -0.02778 40  ASP A CB  
350  C CG  . ASP A 63  ? 0.48113 0.44357 0.44796 -0.02572 -0.02722 -0.02830 40  ASP A CG  
351  O OD1 . ASP A 63  ? 0.46468 0.41276 0.41909 -0.02414 -0.02705 -0.02381 40  ASP A OD1 
352  O OD2 . ASP A 63  ? 0.51372 0.48255 0.48784 -0.02305 -0.03286 -0.03400 40  ASP A OD2 
353  N N   . VAL A 64  ? 0.31799 0.27713 0.27303 -0.03968 -0.01098 -0.01494 41  VAL A N   
354  C CA  . VAL A 64  ? 0.33466 0.29664 0.28744 -0.04321 -0.00687 -0.01257 41  VAL A CA  
355  C C   . VAL A 64  ? 0.33959 0.30605 0.29687 -0.03240 -0.00860 -0.01009 41  VAL A C   
356  O O   . VAL A 64  ? 0.33450 0.29343 0.28820 -0.02442 -0.01202 -0.00650 41  VAL A O   
357  C CB  . VAL A 64  ? 0.39519 0.33890 0.33025 -0.04945 -0.00718 -0.00586 41  VAL A CB  
358  C CG1 . VAL A 64  ? 0.45778 0.40368 0.38837 -0.05283 -0.00401 -0.00350 41  VAL A CG1 
359  C CG2 . VAL A 64  ? 0.43575 0.37177 0.36334 -0.06222 -0.00512 -0.00782 41  VAL A CG2 
360  N N   . GLU A 65  ? 0.30321 0.28197 0.26871 -0.03284 -0.00560 -0.01295 42  GLU A N   
361  C CA  . GLU A 65  ? 0.33168 0.31411 0.30156 -0.02386 -0.00714 -0.01099 42  GLU A CA  
362  C C   . GLU A 65  ? 0.40885 0.38233 0.36964 -0.02227 -0.00731 -0.00427 42  GLU A C   
363  O O   . GLU A 65  ? 0.40813 0.37818 0.36187 -0.02896 -0.00538 -0.00263 42  GLU A O   
364  C CB  . GLU A 65  ? 0.32401 0.32148 0.30676 -0.02448 -0.00485 -0.01729 42  GLU A CB  
365  C CG  . GLU A 65  ? 0.34181 0.34033 0.32654 -0.01739 -0.00597 -0.01453 42  GLU A CG  
366  C CD  . GLU A 65  ? 0.48326 0.49509 0.48163 -0.01684 -0.00490 -0.02167 42  GLU A CD  
367  O OE1 . GLU A 65  ? 0.48247 0.50407 0.49263 -0.01821 -0.00548 -0.02966 42  GLU A OE1 
368  O OE2 . GLU A 65  ? 0.54098 0.55366 0.53957 -0.01489 -0.00391 -0.02016 42  GLU A OE2 
369  N N   . LEU A 66  ? 0.33547 0.30503 0.29614 -0.01396 -0.00975 -0.00105 43  LEU A N   
370  C CA  . LEU A 66  ? 0.37160 0.33587 0.32886 -0.01120 -0.01072 0.00345  43  LEU A CA  
371  C C   . LEU A 66  ? 0.39770 0.36982 0.36172 -0.00738 -0.00937 0.00347  43  LEU A C   
372  O O   . LEU A 66  ? 0.40660 0.37741 0.36964 -0.00732 -0.01002 0.00584  43  LEU A O   
373  C CB  . LEU A 66  ? 0.36910 0.32490 0.32421 -0.00533 -0.01321 0.00524  43  LEU A CB  
374  C CG  . LEU A 66  ? 0.40111 0.34527 0.34880 -0.00774 -0.01605 0.00573  43  LEU A CG  
375  C CD1 . LEU A 66  ? 0.41498 0.35268 0.36393 -0.00037 -0.01826 0.00565  43  LEU A CD1 
376  C CD2 . LEU A 66  ? 0.43723 0.37303 0.37584 -0.01506 -0.01802 0.00874  43  LEU A CD2 
377  N N   . PHE A 67  ? 0.34793 0.32608 0.31782 -0.00405 -0.00880 0.00102  44  PHE A N   
378  C CA  . PHE A 67  ? 0.32809 0.30989 0.30244 -0.00047 -0.00810 0.00171  44  PHE A CA  
379  C C   . PHE A 67  ? 0.39512 0.38077 0.37393 0.00159  -0.00957 -0.00152 44  PHE A C   
380  O O   . PHE A 67  ? 0.39738 0.37968 0.37362 0.00350  -0.01190 -0.00244 44  PHE A O   
381  C CB  . PHE A 67  ? 0.33534 0.31229 0.30786 0.00384  -0.00747 0.00445  44  PHE A CB  
382  C CG  . PHE A 67  ? 0.34877 0.32817 0.32477 0.00578  -0.00585 0.00519  44  PHE A CG  
383  C CD1 . PHE A 67  ? 0.34503 0.32814 0.32564 0.00476  -0.00542 0.00588  44  PHE A CD1 
384  C CD2 . PHE A 67  ? 0.29302 0.26880 0.26541 0.00775  -0.00524 0.00540  44  PHE A CD2 
385  C CE1 . PHE A 67  ? 0.32920 0.31397 0.31338 0.00562  -0.00380 0.00626  44  PHE A CE1 
386  C CE2 . PHE A 67  ? 0.28372 0.25889 0.25694 0.00790  -0.00349 0.00659  44  PHE A CE2 
387  C CZ  . PHE A 67  ? 0.29672 0.27711 0.27704 0.00683  -0.00252 0.00675  44  PHE A CZ  
388  N N   . GLU A 68  ? 0.32872 0.32004 0.31384 0.00167  -0.00946 -0.00366 45  GLU A N   
389  C CA  . GLU A 68  ? 0.34436 0.33659 0.33428 0.00533  -0.01314 -0.00662 45  GLU A CA  
390  C C   . GLU A 68  ? 0.36196 0.34891 0.34933 0.00795  -0.01313 -0.00306 45  GLU A C   
391  O O   . GLU A 68  ? 0.36969 0.36004 0.36047 0.00651  -0.01079 -0.00284 45  GLU A O   
392  C CB  . GLU A 68  ? 0.34375 0.34660 0.34546 0.00372  -0.01352 -0.01401 45  GLU A CB  
393  C CG  . GLU A 68  ? 0.47332 0.47524 0.48177 0.00939  -0.01976 -0.01749 45  GLU A CG  
394  C CD  . GLU A 68  ? 0.59327 0.60790 0.61825 0.00923  -0.02056 -0.02764 45  GLU A CD  
395  O OE1 . GLU A 68  ? 0.56536 0.58956 0.59436 0.00328  -0.01395 -0.03144 45  GLU A OE1 
396  O OE2 . GLU A 68  ? 0.62082 0.63495 0.65415 0.01495  -0.02821 -0.03237 45  GLU A OE2 
397  N N   . ASN A 69  ? 0.31079 0.28847 0.29082 0.01078  -0.01586 -0.00064 46  ASN A N   
398  C CA  . ASN A 69  ? 0.34767 0.31799 0.32236 0.01116  -0.01472 0.00306  46  ASN A CA  
399  C C   . ASN A 69  ? 0.34374 0.31314 0.32404 0.01303  -0.01911 0.00080  46  ASN A C   
400  O O   . ASN A 69  ? 0.33520 0.30036 0.31608 0.01639  -0.02626 -0.00176 46  ASN A O   
401  C CB  . ASN A 69  ? 0.36673 0.32467 0.32715 0.01160  -0.01554 0.00628  46  ASN A CB  
402  C CG  . ASN A 69  ? 0.37717 0.32605 0.32922 0.00946  -0.01252 0.01004  46  ASN A CG  
403  O OD1 . ASN A 69  ? 0.31136 0.26559 0.27025 0.00753  -0.00813 0.01042  46  ASN A OD1 
404  N ND2 . ASN A 69  ? 0.31784 0.25169 0.25337 0.00875  -0.01491 0.01274  46  ASN A ND2 
405  N N   . LYS A 70  ? 0.36658 0.33898 0.35149 0.01141  -0.01609 0.00115  47  LYS A N   
406  C CA  . LYS A 70  ? 0.38859 0.35773 0.37790 0.01313  -0.02005 -0.00096 47  LYS A CA  
407  C C   . LYS A 70  ? 0.43228 0.38899 0.41228 0.01120  -0.01897 0.00422  47  LYS A C   
408  O O   . LYS A 70  ? 0.40021 0.35169 0.38245 0.01184  -0.02210 0.00325  47  LYS A O   
409  C CB  . LYS A 70  ? 0.43293 0.41419 0.43395 0.01170  -0.01747 -0.00581 47  LYS A CB  
410  C CG  . LYS A 70  ? 0.46977 0.46319 0.47804 0.01059  -0.01608 -0.01138 47  LYS A CG  
411  C CD  . LYS A 70  ? 0.57058 0.56627 0.58707 0.01454  -0.02192 -0.01795 47  LYS A CD  
412  C CE  . LYS A 70  ? 0.81590 0.81008 0.84151 0.01857  -0.02702 -0.02340 47  LYS A CE  
413  N NZ  . LYS A 70  ? 0.90719 0.91631 0.94803 0.01746  -0.02427 -0.03406 47  LYS A NZ  
414  N N   . THR A 71  ? 0.34353 0.29505 0.31320 0.00821  -0.01417 0.00880  48  THR A N   
415  C CA  . THR A 71  ? 0.33935 0.28112 0.30041 0.00380  -0.01022 0.01274  48  THR A CA  
416  C C   . THR A 71  ? 0.38885 0.31094 0.33154 0.00332  -0.01488 0.01639  48  THR A C   
417  O O   . THR A 71  ? 0.38513 0.30253 0.32310 0.00730  -0.02178 0.01569  48  THR A O   
418  C CB  . THR A 71  ? 0.35948 0.30818 0.32123 -0.00001 -0.00113 0.01360  48  THR A CB  
419  O OG1 . THR A 71  ? 0.36069 0.30318 0.31035 -0.00044 0.00059  0.01501  48  THR A OG1 
420  C CG2 . THR A 71  ? 0.33336 0.29805 0.30937 0.00169  0.00029  0.01061  48  THR A CG2 
421  N N   . THR A 72  ? 0.33737 0.24666 0.26801 -0.00253 -0.01128 0.02026  49  THR A N   
422  C CA  . THR A 72  ? 0.42892 0.31538 0.33538 -0.00549 -0.01459 0.02498  49  THR A CA  
423  C C   . THR A 72  ? 0.42776 0.31278 0.32097 -0.01131 -0.00489 0.02648  49  THR A C   
424  O O   . THR A 72  ? 0.45641 0.32115 0.32510 -0.01686 -0.00458 0.03061  49  THR A O   
425  C CB  . THR A 72  ? 0.45449 0.32342 0.35097 -0.01035 -0.01633 0.02849  49  THR A CB  
426  O OG1 . THR A 72  ? 0.44966 0.32759 0.35272 -0.01782 -0.00429 0.02806  49  THR A OG1 
427  C CG2 . THR A 72  ? 0.42625 0.29727 0.33775 -0.00327 -0.02651 0.02512  49  THR A CG2 
428  N N   . LEU A 73  ? 0.33573 0.24016 0.24329 -0.01033 0.00252  0.02275  50  LEU A N   
429  C CA  . LEU A 73  ? 0.36441 0.27035 0.26397 -0.01404 0.01130  0.02171  50  LEU A CA  
430  C C   . LEU A 73  ? 0.40715 0.31147 0.30119 -0.00874 0.00515  0.02092  50  LEU A C   
431  O O   . LEU A 73  ? 0.35547 0.26440 0.25909 -0.00227 -0.00390 0.01981  50  LEU A O   
432  C CB  . LEU A 73  ? 0.34749 0.27443 0.26810 -0.01421 0.02009  0.01702  50  LEU A CB  
433  C CG  . LEU A 73  ? 0.41084 0.34298 0.34048 -0.02013 0.02725  0.01601  50  LEU A CG  
434  C CD1 . LEU A 73  ? 0.43340 0.38689 0.38760 -0.01710 0.03042  0.01081  50  LEU A CD1 
435  C CD2 . LEU A 73  ? 0.46784 0.39017 0.38146 -0.03004 0.03774  0.01623  50  LEU A CD2 
436  N N   . PRO A 74  ? 0.35481 0.25393 0.23470 -0.01198 0.01073  0.02026  51  PRO A N   
437  C CA  . PRO A 74  ? 0.38372 0.28330 0.26058 -0.00725 0.00564  0.01844  51  PRO A CA  
438  C C   . PRO A 74  ? 0.35310 0.27223 0.25388 -0.00157 0.00502  0.01458  51  PRO A C   
439  O O   . PRO A 74  ? 0.35648 0.28868 0.27256 -0.00206 0.01164  0.01234  51  PRO A O   
440  C CB  . PRO A 74  ? 0.36321 0.25679 0.22350 -0.01296 0.01527  0.01675  51  PRO A CB  
441  C CG  . PRO A 74  ? 0.38783 0.26955 0.23278 -0.02261 0.02328  0.01959  51  PRO A CG  
442  C CD  . PRO A 74  ? 0.38584 0.27856 0.25183 -0.02127 0.02289  0.02010  51  PRO A CD  
443  N N   . VAL A 75  ? 0.32224 0.24214 0.22532 0.00326  -0.00364 0.01355  52  VAL A N   
444  C CA  . VAL A 75  ? 0.31448 0.24956 0.23648 0.00686  -0.00491 0.01054  52  VAL A CA  
445  C C   . VAL A 75  ? 0.33084 0.27395 0.25931 0.00629  0.00271  0.00809  52  VAL A C   
446  O O   . VAL A 75  ? 0.30569 0.25931 0.24876 0.00740  0.00386  0.00705  52  VAL A O   
447  C CB  . VAL A 75  ? 0.37410 0.30815 0.29599 0.01011  -0.01379 0.00862  52  VAL A CB  
448  C CG1 . VAL A 75  ? 0.36894 0.29233 0.27410 0.00942  -0.01465 0.00828  52  VAL A CG1 
449  C CG2 . VAL A 75  ? 0.34763 0.29557 0.28608 0.01126  -0.01366 0.00556  52  VAL A CG2 
450  N N   . ASN A 76  ? 0.33478 0.27210 0.25216 0.00478  0.00723  0.00647  53  ASN A N   
451  C CA  . ASN A 76  ? 0.31079 0.25607 0.23778 0.00591  0.01275  0.00243  53  ASN A CA  
452  C C   . ASN A 76  ? 0.37511 0.32881 0.31357 0.00424  0.02032  0.00070  53  ASN A C   
453  O O   . ASN A 76  ? 0.32942 0.29217 0.28285 0.00699  0.02132  -0.00260 53  ASN A O   
454  C CB  . ASN A 76  ? 0.33787 0.27592 0.25174 0.00499  0.01630  -0.00094 53  ASN A CB  
455  C CG  . ASN A 76  ? 0.37120 0.30013 0.26763 -0.00074 0.02346  -0.00070 53  ASN A CG  
456  O OD1 . ASN A 76  ? 0.37643 0.29505 0.25957 -0.00343 0.01982  0.00411  53  ASN A OD1 
457  N ND2 . ASN A 76  ? 0.36276 0.29457 0.25895 -0.00318 0.03370  -0.00640 53  ASN A ND2 
458  N N   . VAL A 77  ? 0.36142 0.31109 0.29291 -0.00044 0.02471  0.00253  54  VAL A N   
459  C CA  . VAL A 77  ? 0.35073 0.30941 0.29456 -0.00331 0.03212  0.00016  54  VAL A CA  
460  C C   . VAL A 77  ? 0.34468 0.31209 0.30483 -0.00048 0.02651  0.00189  54  VAL A C   
461  O O   . VAL A 77  ? 0.32962 0.30825 0.30697 0.00124  0.02780  -0.00155 54  VAL A O   
462  C CB  . VAL A 77  ? 0.34907 0.29763 0.27689 -0.01123 0.03858  0.00223  54  VAL A CB  
463  C CG1 . VAL A 77  ? 0.32412 0.28311 0.26660 -0.01566 0.04656  -0.00076 54  VAL A CG1 
464  C CG2 . VAL A 77  ? 0.36962 0.30834 0.27763 -0.01568 0.04542  -0.00012 54  VAL A CG2 
465  N N   . ALA A 78  ? 0.31985 0.28185 0.27484 0.00006  0.01970  0.00635  55  ALA A N   
466  C CA  . ALA A 78  ? 0.32041 0.28982 0.28816 0.00205  0.01482  0.00718  55  ALA A CA  
467  C C   . ALA A 78  ? 0.34499 0.32167 0.32255 0.00587  0.01122  0.00544  55  ALA A C   
468  O O   . ALA A 78  ? 0.34158 0.32534 0.33038 0.00658  0.00962  0.00466  55  ALA A O   
469  C CB  . ALA A 78  ? 0.28305 0.24604 0.24462 0.00282  0.00810  0.01001  55  ALA A CB  
470  N N   . PHE A 79  ? 0.27394 0.24677 0.24542 0.00778  0.00886  0.00509  56  PHE A N   
471  C CA  . PHE A 79  ? 0.30461 0.28017 0.28185 0.01022  0.00533  0.00395  56  PHE A CA  
472  C C   . PHE A 79  ? 0.32997 0.31064 0.31830 0.01221  0.00734  0.00070  56  PHE A C   
473  O O   . PHE A 79  ? 0.30700 0.29011 0.30273 0.01378  0.00257  0.00081  56  PHE A O   
474  C CB  . PHE A 79  ? 0.32909 0.29841 0.29756 0.01110  0.00367  0.00327  56  PHE A CB  
475  C CG  . PHE A 79  ? 0.30696 0.27520 0.27841 0.01258  -0.00016 0.00247  56  PHE A CG  
476  C CD1 . PHE A 79  ? 0.29433 0.26357 0.26782 0.01096  -0.00455 0.00441  56  PHE A CD1 
477  C CD2 . PHE A 79  ? 0.31310 0.27703 0.28266 0.01471  0.00056  -0.00044 56  PHE A CD2 
478  C CE1 . PHE A 79  ? 0.31364 0.27727 0.28504 0.01062  -0.00871 0.00468  56  PHE A CE1 
479  C CE2 . PHE A 79  ? 0.31978 0.27877 0.28998 0.01583  -0.00439 -0.00077 56  PHE A CE2 
480  C CZ  . PHE A 79  ? 0.32378 0.28152 0.29376 0.01337  -0.00925 0.00243  56  PHE A CZ  
481  N N   . GLU A 80  ? 0.30322 0.28514 0.29265 0.01192  0.01405  -0.00303 57  GLU A N   
482  C CA  . GLU A 80  ? 0.30316 0.29255 0.30791 0.01468  0.01589  -0.00876 57  GLU A CA  
483  C C   . GLU A 80  ? 0.32855 0.32672 0.34704 0.01396  0.01529  -0.00943 57  GLU A C   
484  O O   . GLU A 80  ? 0.31534 0.31847 0.34777 0.01786  0.01000  -0.01235 57  GLU A O   
485  C CB  . GLU A 80  ? 0.30153 0.29224 0.30499 0.01313  0.02555  -0.01464 57  GLU A CB  
486  C CG  . GLU A 80  ? 0.35962 0.36143 0.38367 0.01607  0.02875  -0.02340 57  GLU A CG  
487  C CD  . GLU A 80  ? 0.51857 0.52211 0.54096 0.01427  0.03950  -0.03134 57  GLU A CD  
488  O OE1 . GLU A 80  ? 0.51515 0.50832 0.51759 0.01176  0.04197  -0.02895 57  GLU A OE1 
489  O OE2 . GLU A 80  ? 0.47916 0.49482 0.52053 0.01516  0.04542  -0.04095 57  GLU A OE2 
490  N N   . LEU A 81  ? 0.32117 0.31983 0.33561 0.00916  0.01927  -0.00694 58  LEU A N   
491  C CA  . LEU A 81  ? 0.29997 0.30673 0.32747 0.00782  0.01866  -0.00806 58  LEU A CA  
492  C C   . LEU A 81  ? 0.28081 0.28671 0.30985 0.01030  0.00868  -0.00473 58  LEU A C   
493  O O   . LEU A 81  ? 0.31590 0.32790 0.35775 0.01204  0.00419  -0.00710 58  LEU A O   
494  C CB  . LEU A 81  ? 0.28373 0.28785 0.30409 0.00148  0.02450  -0.00570 58  LEU A CB  
495  C CG  . LEU A 81  ? 0.36031 0.36284 0.37489 -0.00406 0.03569  -0.00862 58  LEU A CG  
496  C CD1 . LEU A 81  ? 0.41414 0.40882 0.41745 -0.01140 0.03961  -0.00473 58  LEU A CD1 
497  C CD2 . LEU A 81  ? 0.37271 0.38867 0.40661 -0.00421 0.04197  -0.01742 58  LEU A CD2 
498  N N   . TRP A 82  ? 0.27198 0.27034 0.28773 0.00983  0.00516  0.00002  59  TRP A N   
499  C CA  . TRP A 82  ? 0.33698 0.33353 0.35069 0.01024  -0.00242 0.00246  59  TRP A CA  
500  C C   . TRP A 82  ? 0.35990 0.35396 0.37686 0.01382  -0.00895 0.00146  59  TRP A C   
501  O O   . TRP A 82  ? 0.32867 0.32251 0.34885 0.01438  -0.01575 0.00179  59  TRP A O   
502  C CB  . TRP A 82  ? 0.30946 0.30061 0.31076 0.00824  -0.00311 0.00545  59  TRP A CB  
503  C CG  . TRP A 82  ? 0.36057 0.34924 0.35705 0.00664  -0.00865 0.00692  59  TRP A CG  
504  C CD1 . TRP A 82  ? 0.36549 0.35603 0.36208 0.00416  -0.01125 0.00715  59  TRP A CD1 
505  C CD2 . TRP A 82  ? 0.37314 0.35548 0.36150 0.00585  -0.01155 0.00811  59  TRP A CD2 
506  N NE1 . TRP A 82  ? 0.39270 0.37790 0.37969 0.00119  -0.01488 0.00849  59  TRP A NE1 
507  C CE2 . TRP A 82  ? 0.37312 0.35301 0.35518 0.00183  -0.01507 0.00933  59  TRP A CE2 
508  C CE3 . TRP A 82  ? 0.32214 0.29957 0.30659 0.00725  -0.01129 0.00798  59  TRP A CE3 
509  C CZ2 . TRP A 82  ? 0.46318 0.43526 0.43429 -0.00190 -0.01755 0.01086  59  TRP A CZ2 
510  C CZ3 . TRP A 82  ? 0.43676 0.40697 0.41234 0.00438  -0.01459 0.00939  59  TRP A CZ3 
511  C CH2 . TRP A 82  ? 0.51331 0.48053 0.48185 -0.00067 -0.01738 0.01104  59  TRP A CH2 
512  N N   . ALA A 83  ? 0.31136 0.30142 0.32617 0.01637  -0.00820 0.00013  60  ALA A N   
513  C CA  . ALA A 83  ? 0.32682 0.31160 0.34470 0.02050  -0.01586 -0.00110 60  ALA A CA  
514  C C   . ALA A 83  ? 0.30538 0.29750 0.34150 0.02472  -0.01942 -0.00618 60  ALA A C   
515  O O   . ALA A 83  ? 0.33530 0.32173 0.37375 0.02801  -0.03001 -0.00605 60  ALA A O   
516  C CB  . ALA A 83  ? 0.29840 0.27813 0.31307 0.02295  -0.01382 -0.00326 60  ALA A CB  
517  N N   . LYS A 84  ? 0.28983 0.29365 0.33872 0.02422  -0.01125 -0.01113 61  LYS A N   
518  C CA  . LYS A 84  ? 0.29887 0.31376 0.37004 0.02761  -0.01283 -0.01846 61  LYS A CA  
519  C C   . LYS A 84  ? 0.32269 0.34332 0.39970 0.02489  -0.01583 -0.01739 61  LYS A C   
520  O O   . LYS A 84  ? 0.28229 0.31481 0.37968 0.02614  -0.01548 -0.02422 61  LYS A O   
521  C CB  . LYS A 84  ? 0.31328 0.33871 0.39560 0.02655  -0.00035 -0.02612 61  LYS A CB  
522  C CG  . LYS A 84  ? 0.33720 0.35830 0.41846 0.03090  0.00094  -0.03023 61  LYS A CG  
523  C CD  . LYS A 84  ? 0.36361 0.39376 0.45118 0.02818  0.01517  -0.03837 61  LYS A CD  
524  C CE  . LYS A 84  ? 0.32440 0.35028 0.41266 0.03353  0.01501  -0.04405 61  LYS A CE  
525  N NZ  . LYS A 84  ? 0.33302 0.36661 0.42356 0.02954  0.03019  -0.05257 61  LYS A NZ  
526  N N   . ARG A 85  ? 0.30099 0.31417 0.36207 0.02116  -0.01894 -0.01031 62  ARG A N   
527  C CA  . ARG A 85  ? 0.36124 0.37848 0.42567 0.01827  -0.02179 -0.00966 62  ARG A CA  
528  C C   . ARG A 85  ? 0.36075 0.37881 0.43662 0.02278  -0.03445 -0.01269 62  ARG A C   
529  O O   . ARG A 85  ? 0.31659 0.32620 0.39011 0.02759  -0.04378 -0.01234 62  ARG A O   
530  C CB  . ARG A 85  ? 0.32045 0.32918 0.36529 0.01380  -0.02280 -0.00311 62  ARG A CB  
531  C CG  . ARG A 85  ? 0.33995 0.33633 0.37026 0.01446  -0.03201 0.00090  62  ARG A CG  
532  C CD  . ARG A 85  ? 0.35914 0.34976 0.37150 0.00891  -0.02872 0.00520  62  ARG A CD  
533  N NE  . ARG A 85  ? 0.41225 0.39053 0.40857 0.00673  -0.03562 0.00870  62  ARG A NE  
534  C CZ  . ARG A 85  ? 0.48079 0.45074 0.46896 0.00705  -0.03638 0.01058  62  ARG A CZ  
535  N NH1 . ARG A 85  ? 0.42559 0.39910 0.42077 0.01040  -0.03106 0.00881  62  ARG A NH1 
536  N NH2 . ARG A 85  ? 0.51718 0.47362 0.48818 0.00303  -0.04236 0.01416  62  ARG A NH2 
537  N N   . ASN A 86  ? 0.29293 0.31943 0.38046 0.02116  -0.03618 -0.01567 63  ASN A N   
538  C CA  . ASN A 86  ? 0.30532 0.33165 0.40282 0.02546  -0.05056 -0.01859 63  ASN A CA  
539  C C   . ASN A 86  ? 0.31226 0.32165 0.38479 0.02344  -0.06079 -0.01092 63  ASN A C   
540  O O   . ASN A 86  ? 0.34852 0.35509 0.40626 0.01724  -0.05619 -0.00678 63  ASN A O   
541  C CB  . ASN A 86  ? 0.29173 0.33248 0.40885 0.02321  -0.04922 -0.02456 63  ASN A CB  
542  C CG  . ASN A 86  ? 0.35870 0.40296 0.49360 0.02921  -0.06470 -0.03045 63  ASN A CG  
543  O OD1 . ASN A 86  ? 0.40265 0.43264 0.52363 0.03186  -0.07932 -0.02618 63  ASN A OD1 
544  N ND2 . ASN A 86  ? 0.37147 0.43399 0.53690 0.03097  -0.06211 -0.04084 63  ASN A ND2 
545  N N   . ILE A 87  ? 0.29199 0.28889 0.35874 0.02810  -0.07458 -0.00955 64  ILE A N   
546  C CA  . ILE A 87  ? 0.36473 0.34239 0.40325 0.02411  -0.08375 -0.00205 64  ILE A CA  
547  C C   . ILE A 87  ? 0.40116 0.37277 0.43961 0.02583  -0.10036 -0.00299 64  ILE A C   
548  O O   . ILE A 87  ? 0.45820 0.41005 0.47166 0.02300  -0.11115 0.00282  64  ILE A O   
549  C CB  . ILE A 87  ? 0.38430 0.34491 0.40654 0.02542  -0.08789 0.00253  64  ILE A CB  
550  C CG1 . ILE A 87  ? 0.40014 0.35828 0.43977 0.03547  -0.10025 -0.00241 64  ILE A CG1 
551  C CG2 . ILE A 87  ? 0.35263 0.31752 0.37066 0.02239  -0.07238 0.00399  64  ILE A CG2 
552  C CD1 . ILE A 87  ? 0.45168 0.38521 0.47152 0.03717  -0.11229 0.00283  64  ILE A CD1 
553  N N   . LYS A 88  ? 0.33236 0.31936 0.39758 0.02997  -0.10346 -0.01058 65  LYS A N   
554  C CA  . LYS A 88  ? 0.33072 0.31450 0.39738 0.03084  -0.11886 -0.01236 65  LYS A CA  
555  C C   . LYS A 88  ? 0.34636 0.33665 0.40661 0.02275  -0.11081 -0.01168 65  LYS A C   
556  O O   . LYS A 88  ? 0.34399 0.34353 0.40515 0.01814  -0.09416 -0.01125 65  LYS A O   
557  C CB  . LYS A 88  ? 0.37697 0.37633 0.48050 0.03972  -0.12698 -0.02299 65  LYS A CB  
558  C CG  . LYS A 88  ? 0.54492 0.53610 0.65625 0.04935  -0.13830 -0.02525 65  LYS A CG  
559  C CD  . LYS A 88  ? 0.75061 0.76335 0.90552 0.05834  -0.14179 -0.03908 65  LYS A CD  
560  C CE  . LYS A 88  ? 0.85426 0.88800 1.02828 0.05630  -0.11898 -0.04490 65  LYS A CE  
561  N NZ  . LYS A 88  ? 0.87127 0.92524 1.08634 0.06450  -0.11980 -0.05967 65  LYS A NZ  
562  N N   . PRO A 89  ? 0.39000 0.37341 0.44130 0.02070  -0.12314 -0.01149 66  PRO A N   
563  C CA  . PRO A 89  ? 0.40279 0.39445 0.45293 0.01381  -0.11544 -0.01301 66  PRO A CA  
564  C C   . PRO A 89  ? 0.33555 0.35046 0.41952 0.01535  -0.10536 -0.02081 66  PRO A C   
565  O O   . PRO A 89  ? 0.36921 0.39512 0.48048 0.02151  -0.11203 -0.02791 66  PRO A O   
566  C CB  . PRO A 89  ? 0.36853 0.34953 0.40830 0.01326  -0.13393 -0.01352 66  PRO A CB  
567  C CG  . PRO A 89  ? 0.41760 0.37649 0.43787 0.01695  -0.14971 -0.00820 66  PRO A CG  
568  C CD  . PRO A 89  ? 0.36570 0.33212 0.40710 0.02468  -0.14577 -0.01033 66  PRO A CD  
569  N N   . VAL A 90  ? 0.34217 0.36388 0.42441 0.00934  -0.08944 -0.02012 67  VAL A N   
570  C CA  . VAL A 90  ? 0.31159 0.35149 0.42020 0.00799  -0.07880 -0.02645 67  VAL A CA  
571  C C   . VAL A 90  ? 0.28505 0.32584 0.38780 0.00087  -0.07358 -0.02666 67  VAL A C   
572  O O   . VAL A 90  ? 0.33897 0.36828 0.41754 -0.00276 -0.07349 -0.02209 67  VAL A O   
573  C CB  . VAL A 90  ? 0.27324 0.31818 0.38638 0.00818  -0.06359 -0.02546 67  VAL A CB  
574  C CG1 . VAL A 90  ? 0.29291 0.34069 0.41949 0.01580  -0.06833 -0.02852 67  VAL A CG1 
575  C CG2 . VAL A 90  ? 0.31322 0.34595 0.39956 0.00501  -0.05634 -0.01768 67  VAL A CG2 
576  N N   . PRO A 91  ? 0.29330 0.34766 0.41828 -0.00195 -0.06803 -0.03278 68  PRO A N   
577  C CA  . PRO A 91  ? 0.30593 0.35950 0.42606 -0.00875 -0.06315 -0.03332 68  PRO A CA  
578  C C   . PRO A 91  ? 0.29769 0.34196 0.39741 -0.01175 -0.05193 -0.02734 68  PRO A C   
579  O O   . PRO A 91  ? 0.30274 0.34666 0.40079 -0.01045 -0.04330 -0.02436 68  PRO A O   
580  C CB  . PRO A 91  ? 0.26268 0.33176 0.41073 -0.01214 -0.05593 -0.04036 68  PRO A CB  
581  C CG  . PRO A 91  ? 0.26772 0.34828 0.43921 -0.00604 -0.06450 -0.04667 68  PRO A CG  
582  C CD  . PRO A 91  ? 0.31397 0.38517 0.47060 0.00021  -0.06622 -0.04081 68  PRO A CD  
583  N N   . GLU A 92  ? 0.29739 0.33426 0.38226 -0.01546 -0.05269 -0.02661 69  GLU A N   
584  C CA  . GLU A 92  ? 0.33191 0.36224 0.40352 -0.01763 -0.04267 -0.02338 69  GLU A CA  
585  C C   . GLU A 92  ? 0.34284 0.37696 0.42642 -0.02017 -0.03224 -0.02387 69  GLU A C   
586  O O   . GLU A 92  ? 0.29512 0.33660 0.39549 -0.02332 -0.03138 -0.02800 69  GLU A O   
587  C CB  . GLU A 92  ? 0.38036 0.40416 0.43863 -0.02110 -0.04484 -0.02529 69  GLU A CB  
588  C CG  . GLU A 92  ? 0.39591 0.41242 0.43452 -0.02081 -0.05238 -0.02388 69  GLU A CG  
589  C CD  . GLU A 92  ? 0.41216 0.42269 0.43517 -0.02505 -0.05111 -0.02689 69  GLU A CD  
590  O OE1 . GLU A 92  ? 0.41132 0.42126 0.43420 -0.02780 -0.05734 -0.03109 69  GLU A OE1 
591  O OE2 . GLU A 92  ? 0.42652 0.43381 0.43872 -0.02564 -0.04393 -0.02623 69  GLU A OE2 
592  N N   . VAL A 93  ? 0.30177 0.32956 0.37521 -0.01976 -0.02457 -0.01991 70  VAL A N   
593  C CA  . VAL A 93  ? 0.30345 0.33002 0.38187 -0.02279 -0.01539 -0.01888 70  VAL A CA  
594  C C   . VAL A 93  ? 0.31625 0.33959 0.39882 -0.02857 -0.01397 -0.02164 70  VAL A C   
595  O O   . VAL A 93  ? 0.29262 0.31778 0.38453 -0.03379 -0.00816 -0.02277 70  VAL A O   
596  C CB  . VAL A 93  ? 0.32234 0.34017 0.38661 -0.02046 -0.01061 -0.01406 70  VAL A CB  
597  C CG1 . VAL A 93  ? 0.34617 0.35657 0.40866 -0.02451 -0.00319 -0.01212 70  VAL A CG1 
598  C CG2 . VAL A 93  ? 0.30322 0.32443 0.36586 -0.01600 -0.01049 -0.01167 70  VAL A CG2 
599  N N   . LYS A 94  ? 0.27310 0.29114 0.34839 -0.02867 -0.01859 -0.02347 71  LYS A N   
600  C CA  . LYS A 94  ? 0.30171 0.31535 0.38128 -0.03401 -0.01825 -0.02673 71  LYS A CA  
601  C C   . LYS A 94  ? 0.32903 0.35298 0.42662 -0.03870 -0.01965 -0.03115 71  LYS A C   
602  O O   . LYS A 94  ? 0.30835 0.32979 0.41276 -0.04534 -0.01533 -0.03277 71  LYS A O   
603  C CB  . LYS A 94  ? 0.31564 0.32398 0.38624 -0.03296 -0.02353 -0.03017 71  LYS A CB  
604  C CG  . LYS A 94  ? 0.33716 0.35187 0.40590 -0.03189 -0.03171 -0.03348 71  LYS A CG  
605  C CD  . LYS A 94  ? 0.32575 0.33424 0.38103 -0.03182 -0.03407 -0.03753 71  LYS A CD  
606  C CE  . LYS A 94  ? 0.35600 0.36682 0.40100 -0.03176 -0.04140 -0.03903 71  LYS A CE  
607  N NZ  . LYS A 94  ? 0.36848 0.37405 0.39924 -0.03361 -0.04152 -0.04448 71  LYS A NZ  
608  N N   . ILE A 95  ? 0.30741 0.34228 0.41336 -0.03566 -0.02629 -0.03356 72  ILE A N   
609  C CA  . ILE A 95  ? 0.27750 0.32472 0.40506 -0.03908 -0.02919 -0.03963 72  ILE A CA  
610  C C   . ILE A 95  ? 0.28172 0.33679 0.42380 -0.04270 -0.01903 -0.04043 72  ILE A C   
611  O O   . ILE A 95  ? 0.29684 0.35766 0.45392 -0.05026 -0.01432 -0.04511 72  ILE A O   
612  C CB  . ILE A 95  ? 0.26724 0.32198 0.39967 -0.03353 -0.04167 -0.04228 72  ILE A CB  
613  C CG1 . ILE A 95  ? 0.35612 0.40203 0.47115 -0.03249 -0.05112 -0.04233 72  ILE A CG1 
614  C CG2 . ILE A 95  ? 0.27650 0.34672 0.43660 -0.03558 -0.04540 -0.05001 72  ILE A CG2 
615  C CD1 . ILE A 95  ? 0.34808 0.39365 0.46864 -0.03820 -0.05432 -0.04807 72  ILE A CD1 
616  N N   . LEU A 96  ? 0.31810 0.37368 0.45562 -0.03836 -0.01484 -0.03669 73  LEU A N   
617  C CA  . LEU A 96  ? 0.27936 0.34214 0.42818 -0.04229 -0.00391 -0.03835 73  LEU A CA  
618  C C   . LEU A 96  ? 0.29109 0.34233 0.43036 -0.05152 0.00695  -0.03547 73  LEU A C   
619  O O   . LEU A 96  ? 0.32499 0.38230 0.47648 -0.06029 0.01589  -0.03962 73  LEU A O   
620  C CB  . LEU A 96  ? 0.27322 0.33534 0.41437 -0.03557 -0.00201 -0.03448 73  LEU A CB  
621  C CG  . LEU A 96  ? 0.28469 0.35368 0.43184 -0.02662 -0.01353 -0.03623 73  LEU A CG  
622  C CD1 . LEU A 96  ? 0.33148 0.39556 0.46673 -0.02088 -0.01137 -0.03137 73  LEU A CD1 
623  C CD2 . LEU A 96  ? 0.35866 0.44613 0.53585 -0.02615 -0.01710 -0.04596 73  LEU A CD2 
624  N N   . ASN A 97  ? 0.27824 0.31194 0.39537 -0.05005 0.00610  -0.02885 74  ASN A N   
625  C CA  . ASN A 97  ? 0.27826 0.29578 0.38318 -0.05782 0.01275  -0.02540 74  ASN A CA  
626  C C   . ASN A 97  ? 0.28378 0.30173 0.39931 -0.06651 0.01280  -0.03020 74  ASN A C   
627  O O   . ASN A 97  ? 0.34404 0.35583 0.45898 -0.07710 0.02156  -0.03015 74  ASN A O   
628  C CB  . ASN A 97  ? 0.29585 0.29599 0.38007 -0.05238 0.00783  -0.01983 74  ASN A CB  
629  C CG  . ASN A 97  ? 0.38051 0.37694 0.45223 -0.04593 0.00916  -0.01468 74  ASN A CG  
630  O OD1 . ASN A 97  ? 0.36380 0.36720 0.43879 -0.04638 0.01480  -0.01430 74  ASN A OD1 
631  N ND2 . ASN A 97  ? 0.34179 0.32778 0.40053 -0.04008 0.00401  -0.01195 74  ASN A ND2 
632  N N   . ASN A 98  ? 0.30689 0.32922 0.42881 -0.06323 0.00306  -0.03412 75  ASN A N   
633  C CA  . ASN A 98  ? 0.31883 0.34084 0.45072 -0.07154 0.00219  -0.03920 75  ASN A CA  
634  C C   . ASN A 98  ? 0.35915 0.39911 0.51536 -0.07920 0.00797  -0.04612 75  ASN A C   
635  O O   . ASN A 98  ? 0.34322 0.38164 0.50718 -0.08995 0.01224  -0.04976 75  ASN A O   
636  C CB  . ASN A 98  ? 0.34781 0.37231 0.48166 -0.06669 -0.00972 -0.04321 75  ASN A CB  
637  C CG  . ASN A 98  ? 0.35425 0.36218 0.46715 -0.06118 -0.01386 -0.03947 75  ASN A CG  
638  O OD1 . ASN A 98  ? 0.31876 0.31230 0.41783 -0.06086 -0.00944 -0.03415 75  ASN A OD1 
639  N ND2 . ASN A 98  ? 0.32649 0.33645 0.43760 -0.05728 -0.02263 -0.04334 75  ASN A ND2 
640  N N   . LEU A 99  ? 0.30419 0.36181 0.47467 -0.07393 0.00756  -0.04931 76  LEU A N   
641  C CA  . LEU A 99  ? 0.34628 0.42402 0.54444 -0.08042 0.01351  -0.05831 76  LEU A CA  
642  C C   . LEU A 99  ? 0.40698 0.48302 0.60164 -0.08894 0.02996  -0.05700 76  LEU A C   
643  O O   . LEU A 99  ? 0.37098 0.46544 0.58921 -0.09528 0.03802  -0.06582 76  LEU A O   
644  C CB  . LEU A 99  ? 0.30657 0.40433 0.52517 -0.07021 0.00392  -0.06441 76  LEU A CB  
645  C CG  . LEU A 99  ? 0.33201 0.43344 0.55699 -0.06435 -0.01297 -0.06793 76  LEU A CG  
646  C CD1 . LEU A 99  ? 0.31228 0.42485 0.54743 -0.05255 -0.02520 -0.07063 76  LEU A CD1 
647  C CD2 . LEU A 99  ? 0.33147 0.44350 0.57937 -0.07355 -0.01389 -0.07736 76  LEU A CD2 
648  N N   . GLY A 100 ? 0.33856 0.39341 0.50466 -0.08920 0.03480  -0.04717 77  GLY A N   
649  C CA  . GLY A 100 ? 0.40563 0.45414 0.56219 -0.09909 0.04997  -0.04516 77  GLY A CA  
650  C C   . GLY A 100 ? 0.39430 0.45545 0.55622 -0.09389 0.05553  -0.04713 77  GLY A C   
651  O O   . GLY A 100 ? 0.37941 0.44201 0.54007 -0.10357 0.06980  -0.04932 77  GLY A O   
652  N N   . VAL A 101 ? 0.34449 0.41337 0.51070 -0.07972 0.04503  -0.04672 78  VAL A N   
653  C CA  . VAL A 101 ? 0.34834 0.42778 0.52000 -0.07392 0.04898  -0.04901 78  VAL A CA  
654  C C   . VAL A 101 ? 0.38137 0.44180 0.52373 -0.07644 0.05739  -0.04039 78  VAL A C   
655  O O   . VAL A 101 ? 0.36722 0.40814 0.48556 -0.07245 0.05135  -0.03105 78  VAL A O   
656  C CB  . VAL A 101 ? 0.28708 0.37331 0.46485 -0.05893 0.03410  -0.04887 78  VAL A CB  
657  C CG1 . VAL A 101 ? 0.27541 0.36503 0.45091 -0.05211 0.03698  -0.04857 78  VAL A CG1 
658  C CG2 . VAL A 101 ? 0.27900 0.38480 0.48710 -0.05655 0.02527  -0.05884 78  VAL A CG2 
659  N N   . ASP A 102 ? 0.37003 0.43651 0.51495 -0.08330 0.07120  -0.04466 79  ASP A N   
660  C CA  . ASP A 102 ? 0.36666 0.41581 0.48338 -0.08657 0.07957  -0.03778 79  ASP A CA  
661  C C   . ASP A 102 ? 0.40118 0.45562 0.51677 -0.07509 0.07690  -0.03765 79  ASP A C   
662  O O   . ASP A 102 ? 0.37331 0.41028 0.46237 -0.07373 0.07778  -0.02981 79  ASP A O   
663  C CB  . ASP A 102 ? 0.36402 0.41501 0.48021 -0.10320 0.09824  -0.04325 79  ASP A CB  
664  C CG  . ASP A 102 ? 0.45789 0.49664 0.56712 -0.11734 0.10242  -0.04136 79  ASP A CG  
665  O OD1 . ASP A 102 ? 0.49002 0.50460 0.57563 -0.11604 0.09392  -0.03100 79  ASP A OD1 
666  O OD2 . ASP A 102 ? 0.45565 0.50938 0.58479 -0.12926 0.11347  -0.05108 79  ASP A OD2 
667  N N   . ILE A 103 ? 0.34161 0.41848 0.48523 -0.06722 0.07322  -0.04665 80  ILE A N   
668  C CA  . ILE A 103 ? 0.32725 0.41023 0.47306 -0.05888 0.07371  -0.04915 80  ILE A CA  
669  C C   . ILE A 103 ? 0.35362 0.45738 0.53119 -0.04834 0.06319  -0.05794 80  ILE A C   
670  O O   . ILE A 103 ? 0.32626 0.44379 0.52751 -0.05050 0.06034  -0.06506 80  ILE A O   
671  C CB  . ILE A 103 ? 0.35372 0.44022 0.49711 -0.06941 0.09225  -0.05529 80  ILE A CB  
672  C CG1 . ILE A 103 ? 0.38378 0.47018 0.52078 -0.06159 0.09341  -0.05612 80  ILE A CG1 
673  C CG2 . ILE A 103 ? 0.29338 0.40496 0.47112 -0.07661 0.10163  -0.07022 80  ILE A CG2 
674  C CD1 . ILE A 103 ? 0.32999 0.41291 0.45311 -0.07331 0.11215  -0.05990 80  ILE A CD1 
675  N N   . ALA A 104 ? 0.34984 0.45421 0.52728 -0.03698 0.05603  -0.05747 81  ALA A N   
676  C CA  . ALA A 104 ? 0.30267 0.42115 0.50568 -0.02586 0.04291  -0.06438 81  ALA A CA  
677  C C   . ALA A 104 ? 0.33075 0.46485 0.55512 -0.02247 0.04919  -0.07621 81  ALA A C   
678  O O   . ALA A 104 ? 0.33252 0.46058 0.54230 -0.02434 0.05929  -0.07504 81  ALA A O   
679  C CB  . ALA A 104 ? 0.30853 0.41262 0.49377 -0.01542 0.02739  -0.05457 81  ALA A CB  
680  N N   . ALA A 105 ? 0.27690 0.43095 0.53652 -0.01706 0.04240  -0.08858 82  ALA A N   
681  C CA  . ALA A 105 ? 0.30183 0.47257 0.58752 -0.01137 0.04580  -0.10232 82  ALA A CA  
682  C C   . ALA A 105 ? 0.34878 0.50799 0.62483 0.00240  0.03223  -0.09757 82  ALA A C   
683  O O   . ALA A 105 ? 0.35776 0.51379 0.64027 0.01259  0.01304  -0.09589 82  ALA A O   
684  C CB  . ALA A 105 ? 0.29676 0.49284 0.62645 -0.00901 0.04056  -0.11826 82  ALA A CB  
685  N N   . ASN A 106 ? 0.34541 0.49610 0.60346 0.00193  0.04159  -0.09506 83  ASN A N   
686  C CA  . ASN A 106 ? 0.38539 0.52931 0.64173 0.01406  0.03159  -0.09510 83  ASN A CA  
687  C C   . ASN A 106 ? 0.35090 0.47423 0.58389 0.02082  0.01397  -0.08085 83  ASN A C   
688  O O   . ASN A 106 ? 0.36570 0.48384 0.60341 0.03153  -0.00066 -0.08146 83  ASN A O   
689  C CB  . ASN A 106 ? 0.40253 0.56616 0.69953 0.02356  0.02477  -0.11205 83  ASN A CB  
690  C CG  . ASN A 106 ? 0.41575 0.60134 0.73651 0.01656  0.04473  -0.12852 83  ASN A CG  
691  O OD1 . ASN A 106 ? 0.43069 0.63192 0.76780 0.00692  0.05478  -0.13553 83  ASN A OD1 
692  N ND2 . ASN A 106 ? 0.48300 0.66919 0.80395 0.01994  0.05185  -0.13507 83  ASN A ND2 
693  N N   . THR A 107 ? 0.27990 0.39038 0.48691 0.01410  0.01543  -0.06851 84  THR A N   
694  C CA  . THR A 107 ? 0.34439 0.43609 0.52678 0.01805  0.00271  -0.05587 84  THR A CA  
695  C C   . THR A 107 ? 0.33140 0.41169 0.48662 0.00933  0.01178  -0.04575 84  THR A C   
696  O O   . THR A 107 ? 0.32770 0.41248 0.48286 0.00073  0.02513  -0.04782 84  THR A O   
697  C CB  . THR A 107 ? 0.38454 0.47674 0.57619 0.02242  -0.01401 -0.05550 84  THR A CB  
698  O OG1 . THR A 107 ? 0.42963 0.50294 0.59499 0.02476  -0.02466 -0.04411 84  THR A OG1 
699  C CG2 . THR A 107 ? 0.31663 0.41761 0.51634 0.01456  -0.00977 -0.05710 84  THR A CG2 
700  N N   . VAL A 108 ? 0.28175 0.34647 0.41385 0.01124  0.00426  -0.03545 85  VAL A N   
701  C CA  . VAL A 108 ? 0.29428 0.34801 0.40343 0.00513  0.00890  -0.02669 85  VAL A CA  
702  C C   . VAL A 108 ? 0.32495 0.37422 0.42915 0.00558  -0.00163 -0.02222 85  VAL A C   
703  O O   . VAL A 108 ? 0.32057 0.36388 0.41944 0.01053  -0.01250 -0.01964 85  VAL A O   
704  C CB  . VAL A 108 ? 0.32095 0.36211 0.40854 0.00645  0.01076  -0.02062 85  VAL A CB  
705  C CG1 . VAL A 108 ? 0.30051 0.33084 0.36783 0.00208  0.01224  -0.01286 85  VAL A CG1 
706  C CG2 . VAL A 108 ? 0.36737 0.41124 0.45626 0.00517  0.02148  -0.02528 85  VAL A CG2 
707  N N   . ILE A 109 ? 0.30117 0.35157 0.40507 -0.00038 0.00167  -0.02146 86  ILE A N   
708  C CA  . ILE A 109 ? 0.26767 0.31203 0.36244 -0.00108 -0.00610 -0.01733 86  ILE A CA  
709  C C   . ILE A 109 ? 0.26562 0.29781 0.33833 -0.00262 -0.00305 -0.01053 86  ILE A C   
710  O O   . ILE A 109 ? 0.31126 0.33956 0.37798 -0.00706 0.00439  -0.00896 86  ILE A O   
711  C CB  . ILE A 109 ? 0.30287 0.35354 0.40873 -0.00640 -0.00478 -0.02076 86  ILE A CB  
712  C CG1 . ILE A 109 ? 0.31422 0.38030 0.44690 -0.00540 -0.00642 -0.02969 86  ILE A CG1 
713  C CG2 . ILE A 109 ? 0.27120 0.31530 0.36676 -0.00685 -0.01313 -0.01768 86  ILE A CG2 
714  C CD1 . ILE A 109 ? 0.28323 0.35112 0.42371 0.00251  -0.02122 -0.03188 86  ILE A CD1 
715  N N   . TRP A 110 ? 0.24969 0.27501 0.31022 0.00064  -0.00927 -0.00692 87  TRP A N   
716  C CA  . TRP A 110 ? 0.28749 0.30421 0.33138 -0.00049 -0.00700 -0.00254 87  TRP A CA  
717  C C   . TRP A 110 ? 0.32769 0.34234 0.36729 -0.00346 -0.00886 -0.00236 87  TRP A C   
718  O O   . TRP A 110 ? 0.33587 0.35170 0.37604 -0.00379 -0.01507 -0.00356 87  TRP A O   
719  C CB  . TRP A 110 ? 0.28446 0.29577 0.31811 0.00235  -0.01155 -0.00006 87  TRP A CB  
720  C CG  . TRP A 110 ? 0.31758 0.32320 0.33877 0.00133  -0.00833 0.00249  87  TRP A CG  
721  C CD1 . TRP A 110 ? 0.32263 0.32551 0.33505 -0.00055 -0.01010 0.00297  87  TRP A CD1 
722  C CD2 . TRP A 110 ? 0.31382 0.31651 0.33110 0.00199  -0.00311 0.00357  87  TRP A CD2 
723  N NE1 . TRP A 110 ? 0.31103 0.31123 0.31803 -0.00025 -0.00693 0.00354  87  TRP A NE1 
724  C CE2 . TRP A 110 ? 0.33096 0.32966 0.33932 0.00149  -0.00363 0.00461  87  TRP A CE2 
725  C CE3 . TRP A 110 ? 0.33306 0.33614 0.35309 0.00253  0.00199  0.00287  87  TRP A CE3 
726  C CZ2 . TRP A 110 ? 0.35847 0.35263 0.36087 0.00240  -0.00141 0.00559  87  TRP A CZ2 
727  C CZ3 . TRP A 110 ? 0.31708 0.31382 0.32713 0.00243  0.00522  0.00459  87  TRP A CZ3 
728  C CH2 . TRP A 110 ? 0.33629 0.32822 0.33783 0.00283  0.00242  0.00624  87  TRP A CH2 
729  N N   . ASP A 111 ? 0.27902 0.28892 0.31292 -0.00536 -0.00452 -0.00122 88  ASP A N   
730  C CA  . ASP A 111 ? 0.30148 0.30895 0.33313 -0.00743 -0.00613 -0.00250 88  ASP A CA  
731  C C   . ASP A 111 ? 0.34992 0.35458 0.37194 -0.00608 -0.00792 -0.00251 88  ASP A C   
732  O O   . ASP A 111 ? 0.33217 0.33279 0.34961 -0.00466 -0.00605 -0.00169 88  ASP A O   
733  C CB  . ASP A 111 ? 0.32238 0.32411 0.35401 -0.01001 -0.00194 -0.00196 88  ASP A CB  
734  C CG  . ASP A 111 ? 0.38064 0.37864 0.41200 -0.01161 -0.00441 -0.00432 88  ASP A CG  
735  O OD1 . ASP A 111 ? 0.39983 0.39973 0.42879 -0.01030 -0.00780 -0.00679 88  ASP A OD1 
736  O OD2 . ASP A 111 ? 0.41255 0.40463 0.44501 -0.01484 -0.00244 -0.00409 88  ASP A OD2 
737  N N   . TYR A 112 ? 0.29052 0.29710 0.30904 -0.00718 -0.01169 -0.00408 89  TYR A N   
738  C CA  . TYR A 112 ? 0.35242 0.35788 0.36201 -0.00794 -0.01131 -0.00537 89  TYR A CA  
739  C C   . TYR A 112 ? 0.41658 0.42226 0.42747 -0.00852 -0.00963 -0.01008 89  TYR A C   
740  O O   . TYR A 112 ? 0.41287 0.42007 0.42082 -0.00881 -0.00792 -0.01318 89  TYR A O   
741  C CB  . TYR A 112 ? 0.32329 0.32779 0.32407 -0.01094 -0.01525 -0.00540 89  TYR A CB  
742  C CG  . TYR A 112 ? 0.33810 0.33936 0.33524 -0.00950 -0.01852 -0.00129 89  TYR A CG  
743  C CD1 . TYR A 112 ? 0.35719 0.35909 0.36191 -0.00692 -0.02353 -0.00008 89  TYR A CD1 
744  C CD2 . TYR A 112 ? 0.36096 0.35871 0.34888 -0.01066 -0.01714 0.00024  89  TYR A CD2 
745  C CE1 . TYR A 112 ? 0.36051 0.35846 0.36350 -0.00434 -0.02791 0.00247  89  TYR A CE1 
746  C CE2 . TYR A 112 ? 0.38478 0.37702 0.36850 -0.00922 -0.02104 0.00382  89  TYR A CE2 
747  C CZ  . TYR A 112 ? 0.34403 0.33587 0.33527 -0.00549 -0.02674 0.00486  89  TYR A CZ  
748  O OH  . TYR A 112 ? 0.39695 0.38246 0.38556 -0.00295 -0.03179 0.00726  89  TYR A OH  
749  N N   . LYS A 113 ? 0.36128 0.36573 0.37798 -0.00880 -0.01023 -0.01176 90  LYS A N   
750  C CA  . LYS A 113 ? 0.41205 0.41478 0.43127 -0.00796 -0.00988 -0.01685 90  LYS A CA  
751  C C   . LYS A 113 ? 0.44697 0.44418 0.46770 -0.00412 -0.00974 -0.01531 90  LYS A C   
752  O O   . LYS A 113 ? 0.39452 0.39114 0.41810 -0.00159 -0.01090 -0.02029 90  LYS A O   
753  C CB  . LYS A 113 ? 0.44545 0.44577 0.46927 -0.00973 -0.01154 -0.01920 90  LYS A CB  
754  C CG  . LYS A 113 ? 0.55768 0.56203 0.57937 -0.01354 -0.01370 -0.02136 90  LYS A CG  
755  C CD  . LYS A 113 ? 0.60473 0.61168 0.62024 -0.01568 -0.01298 -0.02797 90  LYS A CD  
756  C CE  . LYS A 113 ? 0.55687 0.56416 0.56717 -0.02006 -0.01637 -0.03045 90  LYS A CE  
757  N NZ  . LYS A 113 ? 0.52094 0.52800 0.52687 -0.02110 -0.02085 -0.02471 90  LYS A NZ  
758  N N   . ARG A 114 ? 0.36215 0.35479 0.38113 -0.00373 -0.00886 -0.00940 91  ARG A N   
759  C CA  . ARG A 114 ? 0.40811 0.39231 0.42357 -0.00103 -0.00962 -0.00679 91  ARG A CA  
760  C C   . ARG A 114 ? 0.38333 0.36986 0.39461 0.00070  -0.00857 -0.00445 91  ARG A C   
761  O O   . ARG A 114 ? 0.42517 0.40461 0.43220 0.00315  -0.01037 -0.00290 91  ARG A O   
762  C CB  . ARG A 114 ? 0.36788 0.34293 0.38032 -0.00386 -0.00796 -0.00220 91  ARG A CB  
763  C CG  . ARG A 114 ? 0.37918 0.34636 0.39359 -0.00606 -0.00984 -0.00380 91  ARG A CG  
764  C CD  . ARG A 114 ? 0.44133 0.40261 0.45337 -0.01226 -0.00545 0.00029  91  ARG A CD  
765  N NE  . ARG A 114 ? 0.48263 0.43399 0.48339 -0.01304 -0.00340 0.00522  91  ARG A NE  
766  C CZ  . ARG A 114 ? 0.41447 0.37083 0.41370 -0.01524 0.00238  0.00734  91  ARG A CZ  
767  N NH1 . ARG A 114 ? 0.42853 0.37411 0.41448 -0.01604 0.00385  0.01117  91  ARG A NH1 
768  N NH2 . ARG A 114 ? 0.37212 0.34325 0.38275 -0.01633 0.00578  0.00496  91  ARG A NH2 
769  N N   A ASP A 115 ? 0.34466 0.33888 0.35573 -0.00061 -0.00694 -0.00423 92  ASP A N   
770  N N   B ASP A 115 ? 0.35369 0.34775 0.36474 -0.00066 -0.00688 -0.00404 92  ASP A N   
771  C CA  A ASP A 115 ? 0.35054 0.34556 0.35736 0.00037  -0.00598 -0.00170 92  ASP A CA  
772  C CA  B ASP A 115 ? 0.36888 0.36374 0.37572 0.00044  -0.00602 -0.00176 92  ASP A CA  
773  C C   A ASP A 115 ? 0.37408 0.36279 0.37733 0.00113  -0.00425 0.00243  92  ASP A C   
774  C C   B ASP A 115 ? 0.36179 0.35050 0.36500 0.00114  -0.00423 0.00245  92  ASP A C   
775  O O   A ASP A 115 ? 0.35407 0.33811 0.35194 0.00300  -0.00488 0.00358  92  ASP A O   
776  O O   B ASP A 115 ? 0.36162 0.34580 0.35946 0.00297  -0.00478 0.00364  92  ASP A O   
777  C CB  A ASP A 115 ? 0.43102 0.42796 0.43730 0.00187  -0.00716 -0.00504 92  ASP A CB  
778  C CB  B ASP A 115 ? 0.43705 0.43354 0.44383 0.00211  -0.00742 -0.00536 92  ASP A CB  
779  C CG  A ASP A 115 ? 0.52090 0.52530 0.52908 -0.00106 -0.00622 -0.01035 92  ASP A CG  
780  C CG  B ASP A 115 ? 0.51576 0.51917 0.52128 -0.00098 -0.00597 -0.00804 92  ASP A CG  
781  O OD1 A ASP A 115 ? 0.54964 0.55573 0.55289 -0.00460 -0.00525 -0.00888 92  ASP A OD1 
782  O OD1 B ASP A 115 ? 0.56165 0.56499 0.56323 -0.00145 -0.00542 -0.00645 92  ASP A OD1 
783  O OD2 A ASP A 115 ? 0.54314 0.55079 0.55711 -0.00004 -0.00677 -0.01657 92  ASP A OD2 
784  O OD2 B ASP A 115 ? 0.53033 0.53768 0.53677 -0.00388 -0.00520 -0.01173 92  ASP A OD2 
785  N N   . ALA A 116 ? 0.31212 0.30111 0.31828 -0.00106 -0.00171 0.00380  93  ALA A N   
786  C CA  . ALA A 116 ? 0.30958 0.29300 0.31172 -0.00257 0.00229  0.00634  93  ALA A CA  
787  C C   . ALA A 116 ? 0.30259 0.29294 0.31379 -0.00531 0.00601  0.00515  93  ALA A C   
788  O O   . ALA A 116 ? 0.30483 0.30156 0.32435 -0.00576 0.00360  0.00306  93  ALA A O   
789  C CB  . ALA A 116 ? 0.31011 0.28117 0.30470 -0.00406 0.00140  0.00798  93  ALA A CB  
790  N N   . PRO A 117 ? 0.34341 0.33347 0.35403 -0.00732 0.01176  0.00528  94  PRO A N   
791  C CA  . PRO A 117 ? 0.30778 0.30696 0.33151 -0.01027 0.01598  0.00185  94  PRO A CA  
792  C C   . PRO A 117 ? 0.33430 0.33195 0.36154 -0.01503 0.01652  0.00137  94  PRO A C   
793  O O   . PRO A 117 ? 0.32071 0.30627 0.33677 -0.01781 0.01694  0.00428  94  PRO A O   
794  C CB  . PRO A 117 ? 0.29711 0.29439 0.31662 -0.01344 0.02445  0.00102  94  PRO A CB  
795  C CG  . PRO A 117 ? 0.36526 0.35463 0.37091 -0.00963 0.02222  0.00398  94  PRO A CG  
796  C CD  . PRO A 117 ? 0.37289 0.35477 0.37121 -0.00759 0.01500  0.00730  94  PRO A CD  
797  N N   . ALA A 118 ? 0.30263 0.31120 0.34538 -0.01576 0.01521  -0.00258 95  ALA A N   
798  C CA  . ALA A 118 ? 0.33389 0.34193 0.38184 -0.02123 0.01619  -0.00403 95  ALA A CA  
799  C C   . ALA A 118 ? 0.37252 0.37679 0.41869 -0.02934 0.02594  -0.00447 95  ALA A C   
800  O O   . ALA A 118 ? 0.33110 0.32725 0.37338 -0.03532 0.02741  -0.00345 95  ALA A O   
801  C CB  . ALA A 118 ? 0.28317 0.30425 0.34883 -0.02027 0.01146  -0.00895 95  ALA A CB  
802  N N   . HIS A 119 ? 0.32465 0.33327 0.37203 -0.03059 0.03312  -0.00635 96  HIS A N   
803  C CA  . HIS A 119 ? 0.37653 0.38310 0.42167 -0.04039 0.04471  -0.00825 96  HIS A CA  
804  C C   . HIS A 119 ? 0.41745 0.41296 0.44301 -0.04153 0.05015  -0.00502 96  HIS A C   
805  O O   . HIS A 119 ? 0.43380 0.43190 0.45802 -0.03422 0.04690  -0.00479 96  HIS A O   
806  C CB  . HIS A 119 ? 0.33329 0.36089 0.40477 -0.04245 0.05006  -0.01769 96  HIS A CB  
807  C CG  . HIS A 119 ? 0.34122 0.37891 0.43113 -0.04063 0.04235  -0.02102 96  HIS A CG  
808  N ND1 . HIS A 119 ? 0.33860 0.38897 0.44508 -0.03199 0.03308  -0.02482 96  HIS A ND1 
809  C CD2 . HIS A 119 ? 0.30554 0.33907 0.39620 -0.04603 0.04074  -0.02035 96  HIS A CD2 
810  C CE1 . HIS A 119 ? 0.35529 0.40989 0.47191 -0.03261 0.02645  -0.02673 96  HIS A CE1 
811  N NE2 . HIS A 119 ? 0.31510 0.36052 0.42335 -0.04093 0.03132  -0.02441 96  HIS A NE2 
812  N N   . ILE A 120 ? 0.49945 0.48188 0.50897 -0.05189 0.05874  -0.00298 97  ILE A N   
813  C CA  . ILE A 120 ? 0.58909 0.55560 0.57344 -0.05418 0.06234  0.00126  97  ILE A CA  
814  C C   . ILE A 120 ? 0.49076 0.47011 0.48210 -0.05437 0.07160  -0.00536 97  ILE A C   
815  O O   . ILE A 120 ? 0.49392 0.46747 0.47269 -0.04986 0.07003  -0.00355 97  ILE A O   
816  C CB  . ILE A 120 ? 0.67380 0.61845 0.63449 -0.06685 0.06817  0.00592  97  ILE A CB  
817  C CG1 . ILE A 120 ? 0.75319 0.68297 0.70741 -0.06500 0.05714  0.01183  97  ILE A CG1 
818  C CG2 . ILE A 120 ? 0.66995 0.59569 0.60080 -0.07030 0.07129  0.01029  97  ILE A CG2 
819  C CD1 . ILE A 120 ? 0.82581 0.74700 0.77174 -0.05328 0.04365  0.01653  97  ILE A CD1 
820  N N   . SER A 121 ? 0.40975 0.40688 0.42222 -0.05976 0.08141  -0.01428 98  SER A N   
821  C CA  . SER A 121 ? 0.40124 0.41186 0.42335 -0.06120 0.09221  -0.02330 98  SER A CA  
822  C C   . SER A 121 ? 0.36449 0.39936 0.42098 -0.05129 0.08703  -0.03189 98  SER A C   
823  O O   . SER A 121 ? 0.35177 0.39249 0.42254 -0.04585 0.07668  -0.03076 98  SER A O   
824  C CB  . SER A 121 ? 0.41068 0.42271 0.43029 -0.07718 0.10963  -0.02915 98  SER A CB  
825  O OG  . SER A 121 ? 0.43604 0.42056 0.41871 -0.08686 0.11269  -0.01999 98  SER A OG  
826  N N   . THR A 122 ? 0.33677 0.38441 0.40560 -0.04905 0.09371  -0.04109 99  THR A N   
827  C CA  . THR A 122 ? 0.32092 0.38871 0.42159 -0.03847 0.08689  -0.04980 99  THR A CA  
828  C C   . THR A 122 ? 0.34777 0.43600 0.47295 -0.04314 0.10047  -0.06518 99  THR A C   
829  O O   . THR A 122 ? 0.37661 0.46278 0.49054 -0.05521 0.11690  -0.06892 99  THR A O   
830  C CB  . THR A 122 ? 0.37417 0.43563 0.46780 -0.02627 0.07610  -0.04596 99  THR A CB  
831  O OG1 . THR A 122 ? 0.38417 0.43643 0.45786 -0.02945 0.08498  -0.04603 99  THR A OG1 
832  C CG2 . THR A 122 ? 0.34678 0.39351 0.42356 -0.02169 0.06297  -0.03371 99  THR A CG2 
833  N N   . ILE A 123 ? 0.35133 0.45902 0.51034 -0.03388 0.09314  -0.07488 100 ILE A N   
834  C CA  . ILE A 123 ? 0.31341 0.44478 0.50452 -0.03469 0.10306  -0.09258 100 ILE A CA  
835  C C   . ILE A 123 ? 0.37031 0.50628 0.57613 -0.01911 0.09101  -0.09724 100 ILE A C   
836  O O   . ILE A 123 ? 0.30807 0.44466 0.52588 -0.00837 0.07324  -0.09451 100 ILE A O   
837  C CB  . ILE A 123 ? 0.32415 0.47619 0.54869 -0.03816 0.10335  -0.10225 100 ILE A CB  
838  C CG1 . ILE A 123 ? 0.33368 0.47862 0.54234 -0.05481 0.11509  -0.09725 100 ILE A CG1 
839  C CG2 . ILE A 123 ? 0.33742 0.51786 0.60212 -0.03713 0.11243  -0.12361 100 ILE A CG2 
840  C CD1 . ILE A 123 ? 0.31280 0.47547 0.55213 -0.05840 0.11270  -0.10470 100 ILE A CD1 
841  N N   . GLY A 124 ? 0.37075 0.50762 0.57331 -0.01835 0.10004  -0.10409 101 GLY A N   
842  C CA  . GLY A 124 ? 0.38053 0.52102 0.59874 -0.00378 0.08897  -0.11018 101 GLY A CA  
843  C C   . GLY A 124 ? 0.45770 0.57743 0.65431 0.00602  0.07111  -0.09561 101 GLY A C   
844  O O   . GLY A 124 ? 0.41067 0.53171 0.62295 0.01838  0.05628  -0.09845 101 GLY A O   
845  N N   . VAL A 125 ? 0.35032 0.45026 0.51165 0.00056  0.07158  -0.08065 102 VAL A N   
846  C CA  . VAL A 125 ? 0.35544 0.43754 0.49696 0.00784  0.05683  -0.06799 102 VAL A CA  
847  C C   . VAL A 125 ? 0.44130 0.50834 0.55566 0.00679  0.06129  -0.06323 102 VAL A C   
848  O O   . VAL A 125 ? 0.43692 0.49632 0.54750 0.01494  0.05200  -0.06143 102 VAL A O   
849  C CB  . VAL A 125 ? 0.40349 0.47658 0.53101 0.00437  0.05009  -0.05568 102 VAL A CB  
850  C CG1 . VAL A 125 ? 0.36095 0.41777 0.46911 0.01043  0.03738  -0.04476 102 VAL A CG1 
851  C CG2 . VAL A 125 ? 0.36492 0.45133 0.51780 0.00593  0.04332  -0.06008 102 VAL A CG2 
852  N N   . CYS A 126 ? 0.39412 0.45444 0.48719 -0.00376 0.07427  -0.06055 103 CYS A N   
853  C CA  . CYS A 126 ? 0.44899 0.49092 0.51064 -0.00555 0.07492  -0.05258 103 CYS A CA  
854  C C   . CYS A 126 ? 0.45248 0.49121 0.49781 -0.01682 0.09185  -0.05667 103 CYS A C   
855  O O   . CYS A 126 ? 0.44490 0.48478 0.48669 -0.02698 0.10079  -0.05631 103 CYS A O   
856  C CB  . CYS A 126 ? 0.45685 0.48426 0.49858 -0.00641 0.06567  -0.03851 103 CYS A CB  
857  S SG  . CYS A 126 ? 0.50675 0.51216 0.51158 -0.00948 0.06535  -0.02946 103 CYS A SG  
858  N N   . SER A 127 ? 0.39720 0.42997 0.43007 -0.01612 0.09631  -0.06043 104 SER A N   
859  C CA  . SER A 127 ? 0.48725 0.51766 0.50434 -0.02786 0.11381  -0.06652 104 SER A CA  
860  C C   . SER A 127 ? 0.49673 0.50621 0.47798 -0.03856 0.11595  -0.05442 104 SER A C   
861  O O   . SER A 127 ? 0.50231 0.50847 0.46966 -0.05169 0.13061  -0.05745 104 SER A O   
862  C CB  . SER A 127 ? 0.58944 0.61671 0.59899 -0.02478 0.11760  -0.07380 104 SER A CB  
863  O OG  . SER A 127 ? 0.69751 0.70439 0.67959 -0.02159 0.10676  -0.06222 104 SER A OG  
864  N N   . MET A 128 ? 0.41963 0.41398 0.38522 -0.03371 0.10152  -0.04142 105 MET A N   
865  C CA  . MET A 128 ? 0.50097 0.47419 0.43477 -0.04220 0.10076  -0.03063 105 MET A CA  
866  C C   . MET A 128 ? 0.49275 0.46849 0.43334 -0.04872 0.10302  -0.02763 105 MET A C   
867  O O   . MET A 128 ? 0.50093 0.45996 0.41627 -0.05955 0.10778  -0.02216 105 MET A O   
868  C CB  . MET A 128 ? 0.47964 0.43768 0.39803 -0.03457 0.08443  -0.01995 105 MET A CB  
869  C CG  . MET A 128 ? 0.51188 0.45507 0.40464 -0.03435 0.08320  -0.01937 105 MET A CG  
870  S SD  . MET A 128 ? 0.61895 0.53855 0.46987 -0.04952 0.09344  -0.01658 105 MET A SD  
871  C CE  . MET A 128 ? 0.70550 0.61240 0.54818 -0.05322 0.08561  -0.00520 105 MET A CE  
872  N N   . THR A 129 ? 0.42789 0.42144 0.39970 -0.04257 0.09823  -0.03053 106 THR A N   
873  C CA  . THR A 129 ? 0.46853 0.46379 0.44706 -0.04806 0.09839  -0.02747 106 THR A CA  
874  C C   . THR A 129 ? 0.46193 0.47817 0.46738 -0.05410 0.11053  -0.03906 106 THR A C   
875  O O   . THR A 129 ? 0.44070 0.45691 0.44867 -0.06191 0.11358  -0.03746 106 THR A O   
876  C CB  . THR A 129 ? 0.41813 0.41562 0.40897 -0.03802 0.08245  -0.02123 106 THR A CB  
877  O OG1 . THR A 129 ? 0.39956 0.41411 0.41683 -0.02789 0.07707  -0.02761 106 THR A OG1 
878  C CG2 . THR A 129 ? 0.41518 0.39363 0.38244 -0.03339 0.07081  -0.01076 106 THR A CG2 
879  N N   . ASP A 130 ? 0.37614 0.41072 0.40400 -0.05030 0.11660  -0.05153 107 ASP A N   
880  C CA  . ASP A 130 ? 0.40803 0.46604 0.46739 -0.05487 0.12721  -0.06505 107 ASP A CA  
881  C C   . ASP A 130 ? 0.48297 0.53597 0.52620 -0.07326 0.14564  -0.06745 107 ASP A C   
882  O O   . ASP A 130 ? 0.48293 0.52100 0.49637 -0.08157 0.15534  -0.06606 107 ASP A O   
883  C CB  . ASP A 130 ? 0.38570 0.46239 0.47027 -0.04755 0.13116  -0.07980 107 ASP A CB  
884  C CG  . ASP A 130 ? 0.43023 0.51740 0.54229 -0.03089 0.11364  -0.08141 107 ASP A CG  
885  O OD1 . ASP A 130 ? 0.37078 0.45249 0.48278 -0.02546 0.09923  -0.07158 107 ASP A OD1 
886  O OD2 . ASP A 130 ? 0.42147 0.52109 0.55408 -0.02348 0.11427  -0.09321 107 ASP A OD2 
887  N N   . ILE A 131 ? 0.37706 0.44180 0.43890 -0.08069 0.15071  -0.07160 108 ILE A N   
888  C CA  . ILE A 131 ? 0.41964 0.48716 0.47612 -0.09941 0.17168  -0.07919 108 ILE A CA  
889  C C   . ILE A 131 ? 0.43310 0.53322 0.53027 -0.10026 0.18428  -0.09991 108 ILE A C   
890  O O   . ILE A 131 ? 0.44628 0.55297 0.54220 -0.11682 0.20508  -0.10983 108 ILE A O   
891  C CB  . ILE A 131 ? 0.47013 0.52926 0.52056 -0.11039 0.17206  -0.07223 108 ILE A CB  
892  C CG1 . ILE A 131 ? 0.46078 0.54421 0.55426 -0.10200 0.16281  -0.07861 108 ILE A CG1 
893  C CG2 . ILE A 131 ? 0.45693 0.48428 0.47030 -0.10814 0.15845  -0.05351 108 ILE A CG2 
894  C CD1 . ILE A 131 ? 0.51155 0.59063 0.60494 -0.11324 0.16426  -0.07479 108 ILE A CD1 
895  N N   . ALA A 132 ? 0.42901 0.54915 0.56229 -0.08353 0.17220  -0.10744 109 ALA A N   
896  C CA  . ALA A 132 ? 0.42410 0.57646 0.60181 -0.08130 0.18062  -0.12877 109 ALA A CA  
897  C C   . ALA A 132 ? 0.41175 0.57239 0.61325 -0.05990 0.16180  -0.13154 109 ALA A C   
898  O O   . ALA A 132 ? 0.37919 0.52339 0.56584 -0.04934 0.14344  -0.11702 109 ALA A O   
899  C CB  . ALA A 132 ? 0.40708 0.57973 0.61615 -0.08911 0.18518  -0.13721 109 ALA A CB  
900  N N   . LYS A 133 ? 0.40681 0.59252 0.64545 -0.05417 0.16664  -0.15111 110 LYS A N   
901  C CA  . LYS A 133 ? 0.42313 0.61775 0.69012 -0.03405 0.14767  -0.15628 110 LYS A CA  
902  C C   . LYS A 133 ? 0.38428 0.59727 0.69047 -0.02677 0.13406  -0.16196 110 LYS A C   
903  O O   . LYS A 133 ? 0.36414 0.57100 0.67638 -0.01191 0.11190  -0.15545 110 LYS A O   
904  C CB  . LYS A 133 ? 0.46568 0.67630 0.75436 -0.02938 0.15712  -0.17573 110 LYS A CB  
905  C CG  . LYS A 133 ? 0.55385 0.74363 0.80692 -0.02842 0.16039  -0.16927 110 LYS A CG  
906  C CD  . LYS A 133 ? 0.72194 0.88684 0.95098 -0.01621 0.13755  -0.14942 110 LYS A CD  
907  C CE  . LYS A 133 ? 0.78000 0.93149 0.99251 -0.00806 0.13403  -0.14882 110 LYS A CE  
908  N NZ  . LYS A 133 ? 0.81714 0.96121 1.00130 -0.02074 0.15430  -0.15197 110 LYS A NZ  
909  N N   . LYS A 134 ? 0.35809 0.59077 0.68774 -0.03764 0.14562  -0.17345 111 LYS A N   
910  C CA  . LYS A 134 ? 0.38347 0.63131 0.74725 -0.03203 0.13156  -0.17916 111 LYS A CA  
911  C C   . LYS A 134 ? 0.36004 0.60695 0.71551 -0.04806 0.14012  -0.17372 111 LYS A C   
912  O O   . LYS A 134 ? 0.34851 0.58690 0.67856 -0.06504 0.15926  -0.17140 111 LYS A O   
913  C CB  . LYS A 134 ? 0.36424 0.63091 0.76261 -0.02749 0.13028  -0.19924 111 LYS A CB  
914  C CG  . LYS A 134 ? 0.42856 0.69481 0.83778 -0.01083 0.11908  -0.20559 111 LYS A CG  
915  C CD  . LYS A 134 ? 0.48216 0.76687 0.92669 -0.00725 0.11798  -0.22657 111 LYS A CD  
916  C CE  . LYS A 134 ? 0.52002 0.80221 0.96463 0.00087  0.11863  -0.23419 111 LYS A CE  
917  N NZ  . LYS A 134 ? 0.61809 0.91932 1.09729 0.00223  0.12039  -0.25641 111 LYS A NZ  
918  N N   . PRO A 135 ? 0.37077 0.62355 0.74459 -0.04347 0.12519  -0.17126 112 PRO A N   
919  C CA  . PRO A 135 ? 0.42421 0.67451 0.78979 -0.05885 0.13254  -0.16611 112 PRO A CA  
920  C C   . PRO A 135 ? 0.49653 0.75860 0.87421 -0.07181 0.14727  -0.17992 112 PRO A C   
921  O O   . PRO A 135 ? 0.49889 0.75443 0.86166 -0.08774 0.15810  -0.17556 112 PRO A O   
922  C CB  . PRO A 135 ? 0.40602 0.66141 0.79219 -0.04840 0.11033  -0.16285 112 PRO A CB  
923  C CG  . PRO A 135 ? 0.43480 0.68637 0.82686 -0.02833 0.09015  -0.16124 112 PRO A CG  
924  C CD  . PRO A 135 ? 0.37893 0.63726 0.77770 -0.02472 0.09983  -0.17232 112 PRO A CD  
925  N N   . THR A 136 ? 0.49573 0.77384 0.89980 -0.06575 0.14766  -0.19685 113 THR A N   
926  C CA  . THR A 136 ? 0.55095 0.84248 0.96975 -0.07810 0.16233  -0.21244 113 THR A CA  
927  C C   . THR A 136 ? 0.51191 0.79175 0.89753 -0.09633 0.18662  -0.21113 113 THR A C   
928  O O   . THR A 136 ? 0.49894 0.78626 0.88982 -0.11024 0.20102  -0.22196 113 THR A O   
929  C CB  . THR A 136 ? 0.51390 0.82569 0.97212 -0.06564 0.15452  -0.23215 113 THR A CB  
930  O OG1 . THR A 136 ? 0.48655 0.79292 0.93866 -0.05408 0.15042  -0.23151 113 THR A OG1 
931  C CG2 . THR A 136 ? 0.44945 0.77139 0.93979 -0.05159 0.13088  -0.23529 113 THR A CG2 
932  N N   . GLU A 137 ? 0.53041 0.79069 0.88040 -0.09719 0.19106  -0.19826 114 GLU A N   
933  C CA  . GLU A 137 ? 0.46938 0.71441 0.78293 -0.11478 0.21204  -0.19609 114 GLU A CA  
934  C C   . GLU A 137 ? 0.53393 0.76428 0.82263 -0.13295 0.22077  -0.18634 114 GLU A C   
935  O O   . GLU A 137 ? 0.53257 0.75719 0.82006 -0.13088 0.21027  -0.17509 114 GLU A O   
936  C CB  . GLU A 137 ? 0.43825 0.66359 0.71775 -0.11066 0.21247  -0.18412 114 GLU A CB  
937  C CG  . GLU A 137 ? 0.46736 0.70376 0.76504 -0.09632 0.20829  -0.19532 114 GLU A CG  
938  C CD  . GLU A 137 ? 0.57068 0.78758 0.83666 -0.08987 0.20556  -0.18258 114 GLU A CD  
939  O OE1 . GLU A 137 ? 0.58515 0.80693 0.86790 -0.07164 0.19046  -0.18267 114 GLU A OE1 
940  O OE2 . GLU A 137 ? 0.61380 0.80827 0.83631 -0.10303 0.21722  -0.17207 114 GLU A OE2 
941  N N   . THR A 138 ? 0.54771 0.77118 0.81651 -0.15117 0.23965  -0.19143 115 THR A N   
942  C CA  . THR A 138 ? 0.53779 0.74729 0.78483 -0.16973 0.24871  -0.18513 115 THR A CA  
943  C C   . THR A 138 ? 0.57232 0.75208 0.77980 -0.17267 0.24248  -0.16214 115 THR A C   
944  O O   . THR A 138 ? 0.53044 0.70231 0.73283 -0.18025 0.24017  -0.15505 115 THR A O   
945  C CB  . THR A 138 ? 0.63581 0.83711 0.85935 -0.18875 0.26967  -0.19270 115 THR A CB  
946  O OG1 . THR A 138 ? 0.67854 0.90910 0.94248 -0.18790 0.27632  -0.21598 115 THR A OG1 
947  C CG2 . THR A 138 ? 0.61854 0.79984 0.81309 -0.20849 0.27825  -0.18437 115 THR A CG2 
948  N N   . ILE A 139 ? 0.56599 0.72829 0.74540 -0.16675 0.23922  -0.15080 116 ILE A N   
949  C CA  . ILE A 139 ? 0.54977 0.68122 0.68892 -0.17021 0.23352  -0.12967 116 ILE A CA  
950  C C   . ILE A 139 ? 0.50786 0.64508 0.66745 -0.16060 0.21761  -0.12256 116 ILE A C   
951  O O   . ILE A 139 ? 0.58414 0.69736 0.71623 -0.16601 0.21291  -0.10702 116 ILE A O   
952  C CB  . ILE A 139 ? 0.62070 0.73485 0.72948 -0.16422 0.23224  -0.12106 116 ILE A CB  
953  C CG1 . ILE A 139 ? 0.66200 0.73714 0.71826 -0.17319 0.23003  -0.10067 116 ILE A CG1 
954  C CG2 . ILE A 139 ? 0.51736 0.64907 0.65534 -0.14309 0.21853  -0.12265 116 ILE A CG2 
955  C CD1 . ILE A 139 ? 0.75969 0.81682 0.78627 -0.16618 0.22599  -0.09137 116 ILE A CD1 
956  N N   . CYS A 140 ? 0.51806 0.68492 0.72482 -0.14625 0.20769  -0.13393 117 CYS A N   
957  C CA  . CYS A 140 ? 0.48899 0.66268 0.71703 -0.13647 0.19097  -0.12873 117 CYS A CA  
958  C C   . CYS A 140 ? 0.52386 0.70729 0.77234 -0.14383 0.18988  -0.13418 117 CYS A C   
959  O O   . CYS A 140 ? 0.48113 0.66430 0.73908 -0.13937 0.17675  -0.12792 117 CYS A O   
960  C CB  . CYS A 140 ? 0.49357 0.69023 0.75868 -0.11567 0.17672  -0.13702 117 CYS A CB  
961  S SG  . CYS A 140 ? 0.50949 0.69319 0.75194 -0.10264 0.17251  -0.13027 117 CYS A SG  
962  N N   . ALA A 141 ? 0.50766 0.69990 0.76364 -0.15522 0.20321  -0.14650 118 ALA A N   
963  C CA  . ALA A 141 ? 0.52899 0.73353 0.80861 -0.16128 0.20212  -0.15383 118 ALA A CA  
964  C C   . ALA A 141 ? 0.56024 0.74258 0.81636 -0.17060 0.19822  -0.13877 118 ALA A C   
965  O O   . ALA A 141 ? 0.53909 0.73208 0.81971 -0.16609 0.18645  -0.14047 118 ALA A O   
966  C CB  . ALA A 141 ? 0.48080 0.69525 0.76664 -0.17474 0.22001  -0.16916 118 ALA A CB  
967  N N   . PRO A 142 ? 0.53786 0.68785 0.74703 -0.18282 0.20554  -0.12414 119 PRO A N   
968  C CA  . PRO A 142 ? 0.53725 0.66398 0.72548 -0.19024 0.19930  -0.11030 119 PRO A CA  
969  C C   . PRO A 142 ? 0.53547 0.65446 0.72269 -0.17788 0.18220  -0.09862 119 PRO A C   
970  O O   . PRO A 142 ? 0.51575 0.61911 0.69354 -0.18188 0.17458  -0.08982 119 PRO A O   
971  C CB  . PRO A 142 ? 0.57213 0.66376 0.70819 -0.20594 0.21092  -0.09918 119 PRO A CB  
972  C CG  . PRO A 142 ? 0.61532 0.70738 0.73955 -0.20138 0.21728  -0.10117 119 PRO A CG  
973  C CD  . PRO A 142 ? 0.58875 0.71959 0.76039 -0.19176 0.21930  -0.12063 119 PRO A CD  
974  N N   . LEU A 143 ? 0.49330 0.62112 0.68867 -0.16365 0.17608  -0.09860 120 LEU A N   
975  C CA  . LEU A 143 ? 0.43045 0.54355 0.61355 -0.14559 0.15371  -0.08550 120 LEU A CA  
976  C C   . LEU A 143 ? 0.41779 0.55445 0.64026 -0.13303 0.13817  -0.09307 120 LEU A C   
977  O O   . LEU A 143 ? 0.41370 0.58090 0.67566 -0.13000 0.14054  -0.10879 120 LEU A O   
978  C CB  . LEU A 143 ? 0.40450 0.51090 0.57138 -0.13220 0.14915  -0.08034 120 LEU A CB  
979  C CG  . LEU A 143 ? 0.45056 0.53149 0.57521 -0.14247 0.16145  -0.07224 120 LEU A CG  
980  C CD1 . LEU A 143 ? 0.47032 0.54953 0.58603 -0.12798 0.15569  -0.06968 120 LEU A CD1 
981  C CD2 . LEU A 143 ? 0.53706 0.58307 0.62392 -0.14747 0.15434  -0.05583 120 LEU A CD2 
982  N N   . THR A 144 ? 0.33769 0.45958 0.54915 -0.12526 0.12135  -0.08258 121 THR A N   
983  C CA  . THR A 144 ? 0.31973 0.45890 0.56078 -0.11229 0.10409  -0.08773 121 THR A CA  
984  C C   . THR A 144 ? 0.35147 0.49353 0.59325 -0.09343 0.09140  -0.08540 121 THR A C   
985  O O   . THR A 144 ? 0.37480 0.49624 0.58848 -0.08522 0.08218  -0.07260 121 THR A O   
986  C CB  . THR A 144 ? 0.34246 0.46517 0.57105 -0.11351 0.09307  -0.07928 121 THR A CB  
987  O OG1 . THR A 144 ? 0.38377 0.50734 0.61834 -0.13171 0.10495  -0.08421 121 THR A OG1 
988  C CG2 . THR A 144 ? 0.34873 0.48553 0.60116 -0.10006 0.07414  -0.08344 121 THR A CG2 
989  N N   . VAL A 145 ? 0.34126 0.50925 0.61676 -0.08678 0.09102  -0.09890 122 VAL A N   
990  C CA  . VAL A 145 ? 0.31852 0.48850 0.59558 -0.07036 0.08045  -0.09808 122 VAL A CA  
991  C C   . VAL A 145 ? 0.33261 0.50655 0.62354 -0.05696 0.05820  -0.09761 122 VAL A C   
992  O O   . VAL A 145 ? 0.33292 0.52390 0.65341 -0.05773 0.05243  -0.10739 122 VAL A O   
993  C CB  . VAL A 145 ? 0.30220 0.49542 0.60737 -0.06934 0.09066  -0.11360 122 VAL A CB  
994  C CG1 . VAL A 145 ? 0.26296 0.45615 0.57077 -0.05165 0.07727  -0.11293 122 VAL A CG1 
995  C CG2 . VAL A 145 ? 0.30753 0.49532 0.59446 -0.08446 0.11430  -0.11453 122 VAL A CG2 
996  N N   . PHE A 146 ? 0.29105 0.44928 0.56055 -0.04529 0.04554  -0.08701 123 PHE A N   
997  C CA  . PHE A 146 ? 0.28907 0.44742 0.56561 -0.03332 0.02450  -0.08579 123 PHE A CA  
998  C C   . PHE A 146 ? 0.30513 0.47831 0.60745 -0.02157 0.01603  -0.09564 123 PHE A C   
999  O O   . PHE A 146 ? 0.33756 0.50701 0.63212 -0.01672 0.01991  -0.09447 123 PHE A O   
1000 C CB  . PHE A 146 ? 0.27041 0.40453 0.51107 -0.02827 0.01611  -0.07064 123 PHE A CB  
1001 C CG  . PHE A 146 ? 0.29662 0.42730 0.53752 -0.01701 -0.00402 -0.06855 123 PHE A CG  
1002 C CD1 . PHE A 146 ? 0.36952 0.50264 0.61852 -0.01739 -0.01557 -0.07057 123 PHE A CD1 
1003 C CD2 . PHE A 146 ? 0.36532 0.48851 0.59635 -0.00699 -0.01177 -0.06465 123 PHE A CD2 
1004 C CE1 . PHE A 146 ? 0.41122 0.53783 0.65529 -0.00828 -0.03471 -0.06813 123 PHE A CE1 
1005 C CE2 . PHE A 146 ? 0.37834 0.49459 0.60515 0.00174  -0.03063 -0.06199 123 PHE A CE2 
1006 C CZ  . PHE A 146 ? 0.42145 0.53860 0.65304 0.00081  -0.04206 -0.06339 123 PHE A CZ  
1007 N N   . PHE A 147 ? 0.25553 0.44415 0.58829 -0.01658 0.00309  -0.10561 124 PHE A N   
1008 C CA  . PHE A 147 ? 0.28736 0.48930 0.64852 -0.00396 -0.00935 -0.11633 124 PHE A CA  
1009 C C   . PHE A 147 ? 0.36442 0.55428 0.71836 0.00720  -0.03491 -0.11063 124 PHE A C   
1010 O O   . PHE A 147 ? 0.33566 0.51984 0.68192 0.00391  -0.04299 -0.10639 124 PHE A O   
1011 C CB  . PHE A 147 ? 0.23754 0.46989 0.64593 -0.00714 -0.00456 -0.13598 124 PHE A CB  
1012 C CG  . PHE A 147 ? 0.28203 0.52784 0.69914 -0.01977 0.02178  -0.14408 124 PHE A CG  
1013 C CD1 . PHE A 147 ? 0.32823 0.58366 0.75730 -0.01570 0.03082  -0.15292 124 PHE A CD1 
1014 C CD2 . PHE A 147 ? 0.26665 0.51544 0.68086 -0.03656 0.03748  -0.14429 124 PHE A CD2 
1015 C CE1 . PHE A 147 ? 0.29334 0.56058 0.72789 -0.02898 0.05628  -0.16150 124 PHE A CE1 
1016 C CE2 . PHE A 147 ? 0.31562 0.57498 0.73512 -0.05050 0.06239  -0.15208 124 PHE A CE2 
1017 C CZ  . PHE A 147 ? 0.34601 0.61280 0.77202 -0.04668 0.07187  -0.16010 124 PHE A CZ  
1018 N N   . ASP A 148 ? 0.38565 0.57028 0.74112 0.01982  -0.04806 -0.11107 125 ASP A N   
1019 C CA  . ASP A 148 ? 0.35415 0.52069 0.69330 0.02917  -0.07193 -0.10330 125 ASP A CA  
1020 C C   . ASP A 148 ? 0.36864 0.54728 0.74318 0.04126  -0.09107 -0.11660 125 ASP A C   
1021 O O   . ASP A 148 ? 0.34701 0.52822 0.73407 0.05011  -0.09347 -0.12235 125 ASP A O   
1022 C CB  . ASP A 148 ? 0.34830 0.49071 0.64955 0.03219  -0.07183 -0.08925 125 ASP A CB  
1023 C CG  . ASP A 148 ? 0.40402 0.52446 0.68229 0.03914  -0.09420 -0.08026 125 ASP A CG  
1024 O OD1 . ASP A 148 ? 0.42879 0.55092 0.72045 0.04399  -0.11274 -0.08514 125 ASP A OD1 
1025 O OD2 . ASP A 148 ? 0.45993 0.56031 0.70486 0.03882  -0.09318 -0.06830 125 ASP A OD2 
1026 N N   . GLY A 149 ? 0.38983 0.57523 0.78108 0.04213  -0.10588 -0.12216 126 GLY A N   
1027 C CA  . GLY A 149 ? 0.38069 0.57291 0.80026 0.05280  -0.12387 -0.13442 126 GLY A CA  
1028 C C   . GLY A 149 ? 0.39088 0.55926 0.79275 0.06574  -0.14498 -0.12851 126 GLY A C   
1029 O O   . GLY A 149 ? 0.44136 0.60844 0.85927 0.07459  -0.15633 -0.13784 126 GLY A O   
1030 N N   . ARG A 150 ? 0.36913 0.51648 0.73647 0.06617  -0.15018 -0.11339 127 ARG A N   
1031 C CA  . ARG A 150 ? 0.44624 0.56794 0.79299 0.07660  -0.16857 -0.10680 127 ARG A CA  
1032 C C   . ARG A 150 ? 0.48310 0.60916 0.84287 0.08298  -0.16003 -0.11278 127 ARG A C   
1033 O O   . ARG A 150 ? 0.58960 0.69464 0.93675 0.09170  -0.17484 -0.11001 127 ARG A O   
1034 C CB  . ARG A 150 ? 0.39926 0.49129 0.69378 0.07102  -0.17059 -0.08750 127 ARG A CB  
1035 C CG  . ARG A 150 ? 0.43071 0.51369 0.70681 0.06503  -0.18089 -0.08188 127 ARG A CG  
1036 C CD  . ARG A 150 ? 0.48314 0.54228 0.70922 0.05593  -0.17359 -0.06519 127 ARG A CD  
1037 N NE  . ARG A 150 ? 0.42917 0.49702 0.64955 0.04771  -0.14662 -0.06182 127 ARG A NE  
1038 C CZ  . ARG A 150 ? 0.43337 0.48634 0.61801 0.04003  -0.13661 -0.05004 127 ARG A CZ  
1039 N NH1 . ARG A 150 ? 0.37456 0.40447 0.52533 0.03802  -0.14889 -0.04094 127 ARG A NH1 
1040 N NH2 . ARG A 150 ? 0.41941 0.48014 0.60196 0.03402  -0.11474 -0.04811 127 ARG A NH2 
1041 N N   . VAL A 151 ? 0.42541 0.57572 0.80668 0.07770  -0.13619 -0.12061 128 VAL A N   
1042 C CA  . VAL A 151 ? 0.46481 0.62116 0.85841 0.08225  -0.12528 -0.12801 128 VAL A CA  
1043 C C   . VAL A 151 ? 0.46738 0.64417 0.89801 0.08380  -0.12089 -0.14713 128 VAL A C   
1044 O O   . VAL A 151 ? 0.38005 0.57691 0.83006 0.07564  -0.11015 -0.15510 128 VAL A O   
1045 C CB  . VAL A 151 ? 0.46355 0.62306 0.83928 0.07125  -0.09755 -0.12193 128 VAL A CB  
1046 C CG1 . VAL A 151 ? 0.40362 0.57113 0.79366 0.07583  -0.08640 -0.13114 128 VAL A CG1 
1047 C CG2 . VAL A 151 ? 0.44649 0.57678 0.77072 0.06587  -0.09786 -0.10101 128 VAL A CG2 
1048 N N   . ASP A 152 ? 0.40130 0.57220 0.84174 0.09372  -0.12972 -0.15511 129 ASP A N   
1049 C CA  . ASP A 152 ? 0.45413 0.64432 0.93123 0.09583  -0.12710 -0.17489 129 ASP A CA  
1050 C C   . ASP A 152 ? 0.32869 0.54710 0.82525 0.08441  -0.09736 -0.18523 129 ASP A C   
1051 O O   . ASP A 152 ? 0.37673 0.59717 0.86102 0.07912  -0.07921 -0.18057 129 ASP A O   
1052 C CB  . ASP A 152 ? 0.61042 0.79007 1.09440 0.10751  -0.13900 -0.18232 129 ASP A CB  
1053 C CG  . ASP A 152 ? 0.80179 0.95064 1.26590 0.11745  -0.16919 -0.17361 129 ASP A CG  
1054 O OD1 . ASP A 152 ? 0.88541 1.01444 1.33521 0.12467  -0.17861 -0.16964 129 ASP A OD1 
1055 O OD2 . ASP A 152 ? 0.85065 0.99325 1.31074 0.11705  -0.18314 -0.17032 129 ASP A OD2 
1056 N N   . GLY A 153 ? 0.36024 0.59864 0.88508 0.07978  -0.09235 -0.19931 130 GLY A N   
1057 C CA  . GLY A 153 ? 0.39009 0.65298 0.93193 0.06720  -0.06473 -0.21031 130 GLY A CA  
1058 C C   . GLY A 153 ? 0.36269 0.63145 0.89175 0.05259  -0.04880 -0.20149 130 GLY A C   
1059 O O   . GLY A 153 ? 0.34548 0.63259 0.88887 0.04051  -0.02891 -0.21113 130 GLY A O   
1060 N N   . GLN A 154 ? 0.37904 0.63168 0.88098 0.05249  -0.05732 -0.18393 131 GLN A N   
1061 C CA  . GLN A 154 ? 0.33556 0.59292 0.82454 0.03775  -0.04025 -0.17597 131 GLN A CA  
1062 C C   . GLN A 154 ? 0.33335 0.60116 0.83692 0.03038  -0.04153 -0.18123 131 GLN A C   
1063 O O   . GLN A 154 ? 0.33281 0.61050 0.83613 0.01562  -0.02143 -0.18221 131 GLN A O   
1064 C CB  . GLN A 154 ? 0.30551 0.54385 0.76241 0.03909  -0.04723 -0.15711 131 GLN A CB  
1065 C CG  . GLN A 154 ? 0.32706 0.55535 0.76564 0.04246  -0.03880 -0.15151 131 GLN A CG  
1066 C CD  . GLN A 154 ? 0.52947 0.73642 0.92059 0.03164  -0.02472 -0.13298 131 GLN A CD  
1067 O OE1 . GLN A 154 ? 0.53334 0.72914 0.90285 0.02515  -0.02697 -0.12181 131 GLN A OE1 
1068 N NE2 . GLN A 154 ? 0.55898 0.75984 0.93437 0.03033  -0.01111 -0.13055 131 GLN A NE2 
1069 N N   . VAL A 155 ? 0.34944 0.61388 0.86464 0.03952  -0.06423 -0.18512 132 VAL A N   
1070 C CA  . VAL A 155 ? 0.31673 0.59293 0.84889 0.03262  -0.06437 -0.19234 132 VAL A CA  
1071 C C   . VAL A 155 ? 0.38892 0.68818 0.94859 0.02371  -0.04303 -0.20957 132 VAL A C   
1072 O O   . VAL A 155 ? 0.33274 0.64229 0.89585 0.00959  -0.02728 -0.21176 132 VAL A O   
1073 C CB  . VAL A 155 ? 0.32139 0.58920 0.86178 0.04476  -0.09292 -0.19516 132 VAL A CB  
1074 C CG1 . VAL A 155 ? 0.34406 0.62760 0.90830 0.03833  -0.09162 -0.20634 132 VAL A CG1 
1075 C CG2 . VAL A 155 ? 0.34677 0.59028 0.85428 0.04920  -0.11189 -0.17740 132 VAL A CG2 
1076 N N   . ASP A 156 ? 0.39972 0.70593 0.97771 0.03099  -0.04204 -0.22227 133 ASP A N   
1077 C CA  . ASP A 156 ? 0.38229 0.71013 0.98556 0.02220  -0.02145 -0.24014 133 ASP A CA  
1078 C C   . ASP A 156 ? 0.30890 0.63985 0.89412 0.00598  0.00789  -0.23559 133 ASP A C   
1079 O O   . ASP A 156 ? 0.33158 0.67671 0.92756 -0.00778 0.02720  -0.24532 133 ASP A O   
1080 C CB  . ASP A 156 ? 0.47574 0.80876 1.10155 0.03413  -0.02846 -0.25514 133 ASP A CB  
1081 C CG  . ASP A 156 ? 0.62324 0.95511 1.27213 0.04789  -0.05566 -0.26411 133 ASP A CG  
1082 O OD1 . ASP A 156 ? 0.71373 1.03584 1.36670 0.06201  -0.07273 -0.26704 133 ASP A OD1 
1083 O OD2 . ASP A 156 ? 0.67012 1.00871 1.33106 0.04442  -0.06084 -0.26763 133 ASP A OD2 
1084 N N   . LEU A 157 ? 0.29289 0.60932 0.84952 0.00690  0.01153  -0.22131 134 LEU A N   
1085 C CA  . LEU A 157 ? 0.38710 0.70169 0.92082 -0.00898 0.03747  -0.21454 134 LEU A CA  
1086 C C   . LEU A 157 ? 0.40849 0.72135 0.93107 -0.02325 0.04473  -0.20675 134 LEU A C   
1087 O O   . LEU A 157 ? 0.40413 0.72143 0.92078 -0.03984 0.06701  -0.20956 134 LEU A O   
1088 C CB  . LEU A 157 ? 0.32597 0.62400 0.83153 -0.00374 0.03666  -0.20016 134 LEU A CB  
1089 C CG  . LEU A 157 ? 0.38791 0.68619 0.89867 0.00608  0.03684  -0.20754 134 LEU A CG  
1090 C CD1 . LEU A 157 ? 0.38159 0.66229 0.86387 0.01186  0.03462  -0.19271 134 LEU A CD1 
1091 C CD2 . LEU A 157 ? 0.39138 0.70307 0.91011 -0.00586 0.06151  -0.22148 134 LEU A CD2 
1092 N N   . PHE A 158 ? 0.35573 0.66009 0.87340 -0.01764 0.02554  -0.19711 135 PHE A N   
1093 C CA  . PHE A 158 ? 0.33597 0.63867 0.84629 -0.03021 0.02963  -0.19146 135 PHE A CA  
1094 C C   . PHE A 158 ? 0.38258 0.70255 0.91908 -0.03842 0.03742  -0.20700 135 PHE A C   
1095 O O   . PHE A 158 ? 0.36636 0.68734 0.89502 -0.05520 0.05517  -0.20630 135 PHE A O   
1096 C CB  . PHE A 158 ? 0.30323 0.59427 0.80564 -0.02129 0.00515  -0.18088 135 PHE A CB  
1097 C CG  . PHE A 158 ? 0.30641 0.59553 0.80393 -0.03271 0.00592  -0.17677 135 PHE A CG  
1098 C CD1 . PHE A 158 ? 0.32577 0.60244 0.79656 -0.04495 0.01708  -0.16407 135 PHE A CD1 
1099 C CD2 . PHE A 158 ? 0.30845 0.60679 0.82803 -0.03091 -0.00542 -0.18608 135 PHE A CD2 
1100 C CE1 . PHE A 158 ? 0.30542 0.57788 0.77089 -0.05541 0.01700  -0.16066 135 PHE A CE1 
1101 C CE2 . PHE A 158 ? 0.29187 0.58764 0.80654 -0.04123 -0.00512 -0.18264 135 PHE A CE2 
1102 C CZ  . PHE A 158 ? 0.31063 0.59293 0.79776 -0.05358 0.00614  -0.16982 135 PHE A CZ  
1103 N N   . ARG A 159 ? 0.37848 0.71069 0.94561 -0.02706 0.02392  -0.22139 136 ARG A N   
1104 C CA  . ARG A 159 ? 0.39986 0.75035 0.99562 -0.03407 0.03038  -0.23797 136 ARG A CA  
1105 C C   . ARG A 159 ? 0.39896 0.75911 0.99483 -0.05021 0.05963  -0.24668 136 ARG A C   
1106 O O   . ARG A 159 ? 0.43489 0.80544 1.04199 -0.06309 0.07152  -0.25512 136 ARG A O   
1107 C CB  . ARG A 159 ? 0.42715 0.78846 1.05656 -0.01828 0.01150  -0.25363 136 ARG A CB  
1108 C CG  . ARG A 159 ? 0.40858 0.75959 1.03913 -0.00406 -0.01878 -0.24767 136 ARG A CG  
1109 C CD  . ARG A 159 ? 0.43725 0.79730 1.10080 0.01017  -0.03586 -0.26471 136 ARG A CD  
1110 N NE  . ARG A 159 ? 0.42794 0.77573 1.09154 0.02368  -0.06599 -0.26044 136 ARG A NE  
1111 C CZ  . ARG A 159 ? 0.52070 0.86948 1.18893 0.02105  -0.07572 -0.26006 136 ARG A CZ  
1112 N NH1 . ARG A 159 ? 0.48062 0.84200 1.15425 0.00526  -0.05793 -0.26301 136 ARG A NH1 
1113 N NH2 . ARG A 159 ? 0.60215 0.93703 1.26698 0.03369  -0.10378 -0.25626 136 ARG A NH2 
1114 N N   . ASN A 160 ? 0.43085 0.78657 1.01280 -0.05026 0.07125  -0.24496 137 ASN A N   
1115 C CA  . ASN A 160 ? 0.53320 0.89422 1.10879 -0.06581 0.09865  -0.25228 137 ASN A CA  
1116 C C   . ASN A 160 ? 0.51808 0.86073 1.05224 -0.08124 0.11605  -0.23544 137 ASN A C   
1117 O O   . ASN A 160 ? 0.50701 0.84960 1.02932 -0.09705 0.13889  -0.23961 137 ASN A O   
1118 C CB  . ASN A 160 ? 0.58846 0.95547 1.17429 -0.05689 0.10088  -0.26291 137 ASN A CB  
1119 C CG  . ASN A 160 ? 0.62594 1.01294 1.25519 -0.04681 0.09036  -0.28471 137 ASN A CG  
1120 O OD1 . ASN A 160 ? 0.65243 1.03858 1.29592 -0.02879 0.06958  -0.28747 137 ASN A OD1 
1121 N ND2 . ASN A 160 ? 0.63121 1.03475 1.28090 -0.05874 0.10395  -0.30034 137 ASN A ND2 
1122 N N   . ALA A 161 ? 0.45152 0.77713 0.96218 -0.07753 0.10551  -0.21706 138 ALA A N   
1123 C CA  . ALA A 161 ? 0.42714 0.73305 0.89845 -0.09141 0.12002  -0.20120 138 ALA A CA  
1124 C C   . ALA A 161 ? 0.45385 0.75531 0.91684 -0.10861 0.12925  -0.19849 138 ALA A C   
1125 O O   . ALA A 161 ? 0.44877 0.75812 0.93141 -0.10659 0.11765  -0.20221 138 ALA A O   
1126 C CB  . ALA A 161 ? 0.40240 0.69220 0.85366 -0.08157 0.10544  -0.18405 138 ALA A CB  
1127 N N   . ARG A 162 ? 0.45494 0.74099 0.88585 -0.12573 0.14932  -0.19140 139 ARG A N   
1128 C CA  . ARG A 162 ? 0.50684 0.78266 0.92311 -0.14311 0.15813  -0.18656 139 ARG A CA  
1129 C C   . ARG A 162 ? 0.45888 0.71758 0.85873 -0.14133 0.14433  -0.17019 139 ARG A C   
1130 O O   . ARG A 162 ? 0.40098 0.65980 0.80784 -0.14682 0.13940  -0.17015 139 ARG A O   
1131 C CB  . ARG A 162 ? 0.61460 0.87345 0.99574 -0.16136 0.18133  -0.18247 139 ARG A CB  
1132 C CG  . ARG A 162 ? 0.72735 0.97181 1.08920 -0.18073 0.19157  -0.17754 139 ARG A CG  
1133 C CD  . ARG A 162 ? 0.83153 1.06396 1.16541 -0.19874 0.21450  -0.17933 139 ARG A CD  
1134 N NE  . ARG A 162 ? 0.92391 1.14561 1.24510 -0.21736 0.22388  -0.17793 139 ARG A NE  
1135 C CZ  . ARG A 162 ? 0.92050 1.16223 1.27035 -0.22442 0.22992  -0.19352 139 ARG A CZ  
1136 N NH1 . ARG A 162 ? 0.91012 1.13904 1.24470 -0.24193 0.23827  -0.19054 139 ARG A NH1 
1137 N NH2 . ARG A 162 ? 0.90757 1.18096 1.30123 -0.21391 0.22691  -0.21235 139 ARG A NH2 
1138 N N   . ASN A 163 ? 0.38468 0.62846 0.76292 -0.13412 0.13823  -0.15710 140 ASN A N   
1139 C CA  . ASN A 163 ? 0.39579 0.62104 0.75526 -0.13342 0.12685  -0.14200 140 ASN A CA  
1140 C C   . ASN A 163 ? 0.37712 0.60607 0.74460 -0.11486 0.10924  -0.13842 140 ASN A C   
1141 O O   . ASN A 163 ? 0.35214 0.58181 0.71456 -0.10829 0.11280  -0.13819 140 ASN A O   
1142 C CB  . ASN A 163 ? 0.32732 0.52269 0.64222 -0.14773 0.14012  -0.12746 140 ASN A CB  
1143 C CG  . ASN A 163 ? 0.44182 0.62796 0.74375 -0.16656 0.15452  -0.12867 140 ASN A CG  
1144 O OD1 . ASN A 163 ? 0.44658 0.62962 0.75321 -0.17174 0.14900  -0.12762 140 ASN A OD1 
1145 N ND2 . ASN A 163 ? 0.43527 0.61614 0.71983 -0.17717 0.17267  -0.13129 140 ASN A ND2 
1146 N N   . GLY A 164 ? 0.31195 0.54074 0.68823 -0.10612 0.08964  -0.13532 141 GLY A N   
1147 C CA  . GLY A 164 ? 0.28493 0.50819 0.65565 -0.08612 0.07004  -0.12921 141 GLY A CA  
1148 C C   . GLY A 164 ? 0.32799 0.54296 0.69531 -0.07823 0.04881  -0.12320 141 GLY A C   
1149 O O   . GLY A 164 ? 0.33857 0.55942 0.71957 -0.08579 0.04654  -0.12788 141 GLY A O   
1150 N N   . VAL A 165 ? 0.29505 0.49612 0.64331 -0.06366 0.03367  -0.11343 142 VAL A N   
1151 C CA  . VAL A 165 ? 0.33968 0.53393 0.68442 -0.05397 0.01193  -0.10915 142 VAL A CA  
1152 C C   . VAL A 165 ? 0.34085 0.54198 0.69852 -0.03787 -0.00376 -0.11278 142 VAL A C   
1153 O O   . VAL A 165 ? 0.30694 0.50208 0.65257 -0.03191 -0.00035 -0.10867 142 VAL A O   
1154 C CB  . VAL A 165 ? 0.29000 0.45553 0.59223 -0.05402 0.00910  -0.09255 142 VAL A CB  
1155 C CG1 . VAL A 165 ? 0.27439 0.43221 0.56884 -0.04318 -0.01213 -0.08841 142 VAL A CG1 
1156 C CG2 . VAL A 165 ? 0.29974 0.45708 0.59281 -0.06868 0.01971  -0.09033 142 VAL A CG2 
1157 N N   . LEU A 166 ? 0.25368 0.46568 0.63508 -0.03103 -0.02193 -0.12061 143 LEU A N   
1158 C CA  . LEU A 166 ? 0.28041 0.49678 0.67564 -0.01565 -0.04040 -0.12493 143 LEU A CA  
1159 C C   . LEU A 166 ? 0.32972 0.52731 0.70256 -0.00843 -0.06257 -0.11572 143 LEU A C   
1160 O O   . LEU A 166 ? 0.31024 0.50693 0.68306 -0.01364 -0.06844 -0.11622 143 LEU A O   
1161 C CB  . LEU A 166 ? 0.23812 0.48509 0.68540 -0.01339 -0.04458 -0.14512 143 LEU A CB  
1162 C CG  . LEU A 166 ? 0.31249 0.55723 0.77011 0.00355  -0.06824 -0.14952 143 LEU A CG  
1163 C CD1 . LEU A 166 ? 0.30543 0.54467 0.75725 0.01372  -0.06928 -0.14702 143 LEU A CD1 
1164 C CD2 . LEU A 166 ? 0.31824 0.57885 0.80751 0.00565  -0.07041 -0.16533 143 LEU A CD2 
1165 N N   . ILE A 167 ? 0.28782 0.46918 0.63969 0.00235  -0.07441 -0.10753 144 ILE A N   
1166 C CA  . ILE A 167 ? 0.26166 0.42696 0.59619 0.00920  -0.09750 -0.10177 144 ILE A CA  
1167 C C   . ILE A 167 ? 0.33419 0.50502 0.69160 0.02240  -0.11849 -0.11004 144 ILE A C   
1168 O O   . ILE A 167 ? 0.32850 0.50751 0.70270 0.02886  -0.11543 -0.11556 144 ILE A O   
1169 C CB  . ILE A 167 ? 0.24246 0.38045 0.52999 0.00920  -0.09717 -0.08530 144 ILE A CB  
1170 C CG1 . ILE A 167 ? 0.28360 0.41486 0.56048 0.01478  -0.09122 -0.08039 144 ILE A CG1 
1171 C CG2 . ILE A 167 ? 0.25133 0.38291 0.51860 -0.00254 -0.08071 -0.07858 144 ILE A CG2 
1172 C CD1 . ILE A 167 ? 0.29626 0.40196 0.53176 0.01646  -0.09631 -0.06646 144 ILE A CD1 
1173 N N   . THR A 168 ? 0.31064 0.47564 0.66831 0.02669  -0.14115 -0.11146 145 THR A N   
1174 C CA  . THR A 168 ? 0.36829 0.52763 0.73504 0.03999  -0.16425 -0.11568 145 THR A CA  
1175 C C   . THR A 168 ? 0.45029 0.58186 0.78041 0.04244  -0.18615 -0.10498 145 THR A C   
1176 O O   . THR A 168 ? 0.39515 0.51840 0.70241 0.03401  -0.18473 -0.09846 145 THR A O   
1177 C CB  . THR A 168 ? 0.38331 0.55871 0.78501 0.04325  -0.16721 -0.13078 145 THR A CB  
1178 O OG1 . THR A 168 ? 0.37018 0.54737 0.77189 0.03675  -0.17207 -0.13237 145 THR A OG1 
1179 C CG2 . THR A 168 ? 0.36464 0.56648 0.79983 0.03896  -0.14415 -0.14273 145 THR A CG2 
1180 N N   . GLU A 169 ? 0.47280 0.58621 0.79285 0.05305  -0.20425 -0.10320 146 GLU A N   
1181 C CA  . GLU A 169 ? 0.50914 0.59380 0.79330 0.05454  -0.22520 -0.09424 146 GLU A CA  
1182 C C   . GLU A 169 ? 0.50324 0.58896 0.80176 0.05761  -0.23954 -0.10267 146 GLU A C   
1183 O O   . GLU A 169 ? 0.58748 0.64980 0.85613 0.05743  -0.25630 -0.09608 146 GLU A O   
1184 C CB  . GLU A 169 ? 0.51967 0.57765 0.77800 0.06248  -0.23758 -0.08586 146 GLU A CB  
1185 C CG  . GLU A 169 ? 0.46721 0.51863 0.70317 0.05906  -0.22638 -0.07538 146 GLU A CG  
1186 C CD  . GLU A 169 ? 0.55362 0.57832 0.76615 0.06647  -0.23778 -0.06803 146 GLU A CD  
1187 O OE1 . GLU A 169 ? 0.60973 0.63087 0.83892 0.07578  -0.24861 -0.07511 146 GLU A OE1 
1188 O OE2 . GLU A 169 ? 0.52393 0.52986 0.70077 0.06231  -0.23634 -0.05576 146 GLU A OE2 
1189 N N   . GLY A 170 ? 0.46019 0.57193 0.80209 0.05944  -0.23264 -0.11729 147 GLY A N   
1190 C CA  . GLY A 170 ? 0.51807 0.63175 0.87780 0.06389  -0.24743 -0.12691 147 GLY A CA  
1191 C C   . GLY A 170 ? 0.51814 0.66515 0.92286 0.05980  -0.23253 -0.14233 147 GLY A C   
1192 O O   . GLY A 170 ? 0.45800 0.62413 0.87449 0.05107  -0.21002 -0.14386 147 GLY A O   
1193 N N   . SER A 171 ? 0.51917 0.67139 0.94772 0.06550  -0.24544 -0.15393 148 SER A N   
1194 C CA  . SER A 171 ? 0.50714 0.68949 0.97737 0.06082  -0.23315 -0.16953 148 SER A CA  
1195 C C   . SER A 171 ? 0.51107 0.71617 1.01311 0.06122  -0.21372 -0.18039 148 SER A C   
1196 O O   . SER A 171 ? 0.50815 0.70674 1.01231 0.07055  -0.21832 -0.18189 148 SER A O   
1197 C CB  . SER A 171 ? 0.54490 0.72643 1.03418 0.06839  -0.25366 -0.18043 148 SER A CB  
1198 O OG  . SER A 171 ? 0.61260 0.77953 1.07736 0.06445  -0.26652 -0.17300 148 SER A OG  
1199 N N   . VAL A 172 ? 0.44201 0.67236 0.96707 0.05010  -0.19166 -0.18828 149 VAL A N   
1200 C CA  . VAL A 172 ? 0.42765 0.68188 0.98527 0.04801  -0.17166 -0.20171 149 VAL A CA  
1201 C C   . VAL A 172 ? 0.43670 0.71202 1.03179 0.04587  -0.17085 -0.21929 149 VAL A C   
1202 O O   . VAL A 172 ? 0.42821 0.70860 1.02366 0.03692  -0.16866 -0.21891 149 VAL A O   
1203 C CB  . VAL A 172 ? 0.42738 0.69114 0.97656 0.03434  -0.14381 -0.19591 149 VAL A CB  
1204 C CG1 . VAL A 172 ? 0.41178 0.69830 0.99077 0.03070  -0.12236 -0.21017 149 VAL A CG1 
1205 C CG2 . VAL A 172 ? 0.44034 0.68393 0.95357 0.03641  -0.14536 -0.17899 149 VAL A CG2 
1206 N N   . LYS A 173 ? 0.44251 0.73004 1.06954 0.05372  -0.17268 -0.23545 150 LYS A N   
1207 C CA  . LYS A 173 ? 0.44601 0.75377 1.11103 0.05280  -0.17392 -0.25388 150 LYS A CA  
1208 C C   . LYS A 173 ? 0.38389 0.71496 1.06298 0.03538  -0.14546 -0.25960 150 LYS A C   
1209 O O   . LYS A 173 ? 0.46180 0.80167 1.13997 0.02750  -0.12203 -0.25972 150 LYS A O   
1210 C CB  . LYS A 173 ? 0.51950 0.83598 1.21720 0.06458  -0.18086 -0.27178 150 LYS A CB  
1211 C CG  . LYS A 173 ? 0.59297 0.91628 1.32101 0.07166  -0.19974 -0.28726 150 LYS A CG  
1212 C CD  . LYS A 173 ? 0.68199 1.01720 1.44753 0.08205  -0.20441 -0.30814 150 LYS A CD  
1213 C CE  . LYS A 173 ? 0.70905 1.07586 1.50621 0.07088  -0.17436 -0.32472 150 LYS A CE  
1214 N NZ  . LYS A 173 ? 0.72272 1.10468 1.56165 0.07998  -0.17869 -0.34884 150 LYS A NZ  
1215 N N   . GLY A 174 ? 0.37782 0.71626 1.06645 0.02859  -0.14775 -0.26339 151 GLY A N   
1216 C CA  . GLY A 174 ? 0.46902 0.82667 1.16996 0.01122  -0.12289 -0.26899 151 GLY A CA  
1217 C C   . GLY A 174 ? 0.51123 0.85897 1.17891 -0.00269 -0.10834 -0.25200 151 GLY A C   
1218 O O   . GLY A 174 ? 0.57668 0.93652 1.25074 -0.01835 -0.08770 -0.25543 151 GLY A O   
1219 N N   . LEU A 175 ? 0.44287 0.76789 1.07480 0.00181  -0.11829 -0.23431 152 LEU A N   
1220 C CA  . LEU A 175 ? 0.39511 0.70951 0.99599 -0.01058 -0.10568 -0.21909 152 LEU A CA  
1221 C C   . LEU A 175 ? 0.41131 0.70581 0.98568 -0.00784 -0.12613 -0.20724 152 LEU A C   
1222 O O   . LEU A 175 ? 0.49545 0.77410 1.05590 0.00519  -0.14786 -0.20181 152 LEU A O   
1223 C CB  . LEU A 175 ? 0.36345 0.66970 0.94390 -0.01005 -0.09416 -0.20925 152 LEU A CB  
1224 C CG  . LEU A 175 ? 0.42649 0.74951 1.02471 -0.01602 -0.06988 -0.21889 152 LEU A CG  
1225 C CD1 . LEU A 175 ? 0.43933 0.75178 1.01415 -0.01478 -0.06106 -0.20790 152 LEU A CD1 
1226 C CD2 . LEU A 175 ? 0.51117 0.84634 1.11686 -0.03463 -0.04716 -0.22370 152 LEU A CD2 
1227 N N   . GLN A 176 ? 0.38754 0.68064 0.95230 -0.02082 -0.11892 -0.20323 153 GLN A N   
1228 C CA  . GLN A 176 ? 0.38149 0.65515 0.91830 -0.02020 -0.13586 -0.19263 153 GLN A CA  
1229 C C   . GLN A 176 ? 0.37738 0.63259 0.87813 -0.02228 -0.13165 -0.17689 153 GLN A C   
1230 O O   . GLN A 176 ? 0.25891 0.51687 0.75470 -0.03323 -0.11038 -0.17340 153 GLN A O   
1231 C CB  . GLN A 176 ? 0.39304 0.67180 0.93501 -0.03315 -0.13054 -0.19608 153 GLN A CB  
1232 C CG  . GLN A 176 ? 0.59058 0.89150 1.17212 -0.03404 -0.12948 -0.21321 153 GLN A CG  
1233 C CD  . GLN A 176 ? 0.73830 1.04119 1.33727 -0.01693 -0.15230 -0.22149 153 GLN A CD  
1234 O OE1 . GLN A 176 ? 0.79121 1.07542 1.36932 -0.00712 -0.17513 -0.21422 153 GLN A OE1 
1235 N NE2 . GLN A 176 ? 0.68107 1.00466 1.31663 -0.01382 -0.14613 -0.23709 153 GLN A NE2 
1236 N N   . PRO A 177 ? 0.38286 0.61784 0.85668 -0.01287 -0.15119 -0.16737 154 PRO A N   
1237 C CA  . PRO A 177 ? 0.35009 0.56824 0.79098 -0.01408 -0.14784 -0.15367 154 PRO A CA  
1238 C C   . PRO A 177 ? 0.36956 0.57492 0.78517 -0.02461 -0.14609 -0.14636 154 PRO A C   
1239 O O   . PRO A 177 ? 0.36786 0.57155 0.78358 -0.02827 -0.15398 -0.14966 154 PRO A O   
1240 C CB  . PRO A 177 ? 0.37972 0.58034 0.80226 0.00033  -0.17078 -0.14803 154 PRO A CB  
1241 C CG  . PRO A 177 ? 0.40903 0.60869 0.84092 0.00523  -0.18983 -0.15496 154 PRO A CG  
1242 C CD  . PRO A 177 ? 0.37758 0.60258 0.84857 -0.00097 -0.17762 -0.16909 154 PRO A CD  
1243 N N   . SER A 178 ? 0.38480 0.58058 0.77907 -0.02929 -0.13567 -0.13715 155 SER A N   
1244 C CA  . SER A 178 ? 0.37332 0.55102 0.73699 -0.03582 -0.13786 -0.12929 155 SER A CA  
1245 C C   . SER A 178 ? 0.35799 0.51325 0.68442 -0.02644 -0.14885 -0.11752 155 SER A C   
1246 O O   . SER A 178 ? 0.32220 0.47467 0.64153 -0.02135 -0.14147 -0.11166 155 SER A O   
1247 C CB  . SER A 178 ? 0.33475 0.50863 0.68805 -0.04724 -0.11256 -0.12396 155 SER A CB  
1248 O OG  . SER A 178 ? 0.35905 0.50780 0.67020 -0.04855 -0.11060 -0.11203 155 SER A OG  
1249 N N   . VAL A 179 ? 0.29147 0.42981 0.59231 -0.02513 -0.16549 -0.11427 156 VAL A N   
1250 C CA  . VAL A 179 ? 0.41080 0.52572 0.67237 -0.01846 -0.17538 -0.10327 156 VAL A CA  
1251 C C   . VAL A 179 ? 0.41942 0.51970 0.64834 -0.02362 -0.15606 -0.09231 156 VAL A C   
1252 O O   . VAL A 179 ? 0.41158 0.50687 0.62970 -0.03160 -0.14782 -0.09197 156 VAL A O   
1253 C CB  . VAL A 179 ? 0.48871 0.58883 0.73009 -0.01728 -0.19869 -0.10399 156 VAL A CB  
1254 C CG1 . VAL A 179 ? 0.48701 0.56026 0.68180 -0.01390 -0.20495 -0.09188 156 VAL A CG1 
1255 C CG2 . VAL A 179 ? 0.47942 0.58820 0.74548 -0.00933 -0.21458 -0.11165 156 VAL A CG2 
1256 N N   . GLY A 180 ? 0.35010 0.44331 0.56456 -0.01872 -0.14964 -0.08416 157 GLY A N   
1257 C CA  . GLY A 180 ? 0.31369 0.39563 0.50220 -0.02273 -0.13180 -0.07512 157 GLY A CA  
1258 C C   . GLY A 180 ? 0.32567 0.38573 0.47338 -0.02363 -0.13754 -0.06815 157 GLY A C   
1259 O O   . GLY A 180 ? 0.35865 0.41023 0.49439 -0.02307 -0.15465 -0.06998 157 GLY A O   
1260 N N   . PRO A 181 ? 0.35505 0.40556 0.48038 -0.02561 -0.12341 -0.06087 158 PRO A N   
1261 C CA  . PRO A 181 ? 0.38102 0.41295 0.46888 -0.02759 -0.12612 -0.05583 158 PRO A CA  
1262 C C   . PRO A 181 ? 0.42086 0.44078 0.48997 -0.02281 -0.14059 -0.05117 158 PRO A C   
1263 O O   . PRO A 181 ? 0.38463 0.40940 0.46864 -0.01623 -0.14640 -0.05034 158 PRO A O   
1264 C CB  . PRO A 181 ? 0.49576 0.52475 0.57296 -0.02940 -0.10739 -0.05071 158 PRO A CB  
1265 C CG  . PRO A 181 ? 0.46324 0.50484 0.56535 -0.02654 -0.09808 -0.05007 158 PRO A CG  
1266 C CD  . PRO A 181 ? 0.36489 0.42136 0.49858 -0.02673 -0.10445 -0.05792 158 PRO A CD  
1267 N N   . LYS A 182 ? 0.38880 0.39134 0.42352 -0.02680 -0.14668 -0.04870 159 LYS A N   
1268 C CA  . LYS A 182 ? 0.46901 0.45435 0.47800 -0.02453 -0.16040 -0.04293 159 LYS A CA  
1269 C C   . LYS A 182 ? 0.45392 0.43505 0.45349 -0.02240 -0.15012 -0.03546 159 LYS A C   
1270 O O   . LYS A 182 ? 0.46267 0.43362 0.45387 -0.01802 -0.16135 -0.03089 159 LYS A O   
1271 C CB  . LYS A 182 ? 0.44973 0.41571 0.41934 -0.03197 -0.16689 -0.04216 159 LYS A CB  
1272 C CG  . LYS A 182 ? 0.55893 0.52293 0.53097 -0.03297 -0.18486 -0.04851 159 LYS A CG  
1273 C CD  . LYS A 182 ? 0.64276 0.58478 0.57031 -0.04127 -0.19127 -0.04754 159 LYS A CD  
1274 C CE  . LYS A 182 ? 0.77565 0.71519 0.70520 -0.04226 -0.21017 -0.05430 159 LYS A CE  
1275 N NZ  . LYS A 182 ? 0.88336 0.80279 0.76914 -0.05203 -0.21322 -0.05510 159 LYS A NZ  
1276 N N   . GLN A 183 ? 0.41433 0.40145 0.41444 -0.02527 -0.13040 -0.03437 160 GLN A N   
1277 C CA  . GLN A 183 ? 0.42912 0.41101 0.41594 -0.02490 -0.12004 -0.02792 160 GLN A CA  
1278 C C   . GLN A 183 ? 0.40806 0.40410 0.42347 -0.01882 -0.11172 -0.02730 160 GLN A C   
1279 O O   . GLN A 183 ? 0.41684 0.42766 0.46010 -0.01743 -0.10774 -0.03214 160 GLN A O   
1280 C CB  . GLN A 183 ? 0.41434 0.39344 0.38310 -0.03157 -0.10472 -0.02828 160 GLN A CB  
1281 C CG  . GLN A 183 ? 0.39932 0.39228 0.39008 -0.03149 -0.09052 -0.03241 160 GLN A CG  
1282 C CD  . GLN A 183 ? 0.45427 0.44969 0.44985 -0.03534 -0.09303 -0.03959 160 GLN A CD  
1283 O OE1 . GLN A 183 ? 0.44114 0.43369 0.43524 -0.03605 -0.10651 -0.04211 160 GLN A OE1 
1284 N NE2 . GLN A 183 ? 0.42331 0.42259 0.42419 -0.03750 -0.08128 -0.04310 160 GLN A NE2 
1285 N N   . ALA A 184 ? 0.35537 0.34583 0.36186 -0.01642 -0.10834 -0.02158 161 ALA A N   
1286 C CA  . ALA A 184 ? 0.34478 0.34639 0.37226 -0.01176 -0.09835 -0.02078 161 ALA A CA  
1287 C C   . ALA A 184 ? 0.39177 0.38521 0.39963 -0.01333 -0.08904 -0.01495 161 ALA A C   
1288 O O   . ALA A 184 ? 0.39868 0.37925 0.37914 -0.01838 -0.09015 -0.01223 161 ALA A O   
1289 C CB  . ALA A 184 ? 0.36156 0.36830 0.40996 -0.00420 -0.10916 -0.02254 161 ALA A CB  
1290 N N   . SER A 185 ? 0.35231 0.35334 0.37385 -0.00985 -0.07954 -0.01373 162 SER A N   
1291 C CA  . SER A 185 ? 0.35286 0.34838 0.35996 -0.01101 -0.07046 -0.00916 162 SER A CA  
1292 C C   . SER A 185 ? 0.36726 0.35634 0.37222 -0.00636 -0.07667 -0.00542 162 SER A C   
1293 O O   . SER A 185 ? 0.38195 0.37906 0.40820 -0.00040 -0.07856 -0.00754 162 SER A O   
1294 C CB  . SER A 185 ? 0.34066 0.34608 0.36069 -0.01069 -0.05619 -0.01014 162 SER A CB  
1295 O OG  . SER A 185 ? 0.35991 0.36055 0.36738 -0.01137 -0.04931 -0.00661 162 SER A OG  
1296 N N   . LEU A 186 ? 0.36326 0.33788 0.34288 -0.00973 -0.07870 -0.00067 163 LEU A N   
1297 C CA  . LEU A 186 ? 0.36697 0.33121 0.34052 -0.00616 -0.08548 0.00347  163 LEU A CA  
1298 C C   . LEU A 186 ? 0.41597 0.37681 0.37622 -0.01009 -0.07384 0.00678  163 LEU A C   
1299 O O   . LEU A 186 ? 0.40873 0.36151 0.34651 -0.01796 -0.07031 0.00829  163 LEU A O   
1300 C CB  . LEU A 186 ? 0.38270 0.32771 0.33463 -0.00781 -0.10234 0.00660  163 LEU A CB  
1301 C CG  . LEU A 186 ? 0.47062 0.39906 0.41122 -0.00486 -0.11145 0.01168  163 LEU A CG  
1302 C CD1 . LEU A 186 ? 0.44081 0.38054 0.41203 0.00585  -0.11332 0.00822  163 LEU A CD1 
1303 C CD2 . LEU A 186 ? 0.44728 0.35153 0.36265 -0.00671 -0.13123 0.01564  163 LEU A CD2 
1304 N N   . ASN A 187 ? 0.36776 0.33624 0.34292 -0.00533 -0.06701 0.00661  164 ASN A N   
1305 C CA  . ASN A 187 ? 0.43890 0.40659 0.40585 -0.00821 -0.05635 0.00864  164 ASN A CA  
1306 C C   . ASN A 187 ? 0.43247 0.40540 0.39313 -0.01440 -0.04637 0.00642  164 ASN A C   
1307 O O   . ASN A 187 ? 0.42156 0.38981 0.36716 -0.02016 -0.04127 0.00719  164 ASN A O   
1308 C CB  . ASN A 187 ? 0.42180 0.37246 0.36771 -0.01107 -0.06205 0.01344  164 ASN A CB  
1309 C CG  . ASN A 187 ? 0.46623 0.40956 0.41850 -0.00400 -0.07446 0.01467  164 ASN A CG  
1310 O OD1 . ASN A 187 ? 0.48998 0.44403 0.46482 0.00338  -0.07267 0.01159  164 ASN A OD1 
1311 N ND2 . ASN A 187 ? 0.54198 0.46644 0.47477 -0.00610 -0.08790 0.01836  164 ASN A ND2 
1312 N N   . GLY A 188 ? 0.41842 0.40127 0.39204 -0.01344 -0.04368 0.00264  165 GLY A N   
1313 C CA  . GLY A 188 ? 0.44992 0.43793 0.42162 -0.01752 -0.03540 -0.00091 165 GLY A CA  
1314 C C   . GLY A 188 ? 0.45918 0.44182 0.41429 -0.02431 -0.03754 -0.00317 165 GLY A C   
1315 O O   . GLY A 188 ? 0.48455 0.47216 0.43950 -0.02743 -0.03068 -0.00796 165 GLY A O   
1316 N N   . VAL A 189 ? 0.42596 0.39735 0.36616 -0.02668 -0.04746 -0.00042 166 VAL A N   
1317 C CA  . VAL A 189 ? 0.36498 0.32850 0.28491 -0.03424 -0.05051 -0.00236 166 VAL A CA  
1318 C C   . VAL A 189 ? 0.40576 0.37162 0.33533 -0.03125 -0.05957 -0.00453 166 VAL A C   
1319 O O   . VAL A 189 ? 0.39025 0.35240 0.32583 -0.02632 -0.07121 -0.00194 166 VAL A O   
1320 C CB  . VAL A 189 ? 0.42307 0.36781 0.31467 -0.04020 -0.05763 0.00287  166 VAL A CB  
1321 C CG1 . VAL A 189 ? 0.44150 0.37637 0.30679 -0.05032 -0.05901 0.00046  166 VAL A CG1 
1322 C CG2 . VAL A 189 ? 0.45190 0.39417 0.33725 -0.04279 -0.04987 0.00546  166 VAL A CG2 
1323 N N   . THR A 190 ? 0.41724 0.38894 0.34894 -0.03424 -0.05528 -0.01026 167 THR A N   
1324 C CA  . THR A 190 ? 0.45865 0.43211 0.39849 -0.03272 -0.06409 -0.01301 167 THR A CA  
1325 C C   . THR A 190 ? 0.49090 0.44938 0.40372 -0.03888 -0.07454 -0.01233 167 THR A C   
1326 O O   . THR A 190 ? 0.52007 0.47149 0.40929 -0.04722 -0.06891 -0.01398 167 THR A O   
1327 C CB  . THR A 190 ? 0.50853 0.49230 0.46160 -0.03335 -0.05612 -0.01954 167 THR A CB  
1328 O OG1 . THR A 190 ? 0.46209 0.45577 0.43728 -0.02795 -0.04892 -0.01896 167 THR A OG1 
1329 C CG2 . THR A 190 ? 0.39484 0.37950 0.35456 -0.03340 -0.06561 -0.02306 167 THR A CG2 
1330 N N   . LEU A 191 ? 0.44012 0.39322 0.35571 -0.03521 -0.09001 -0.01055 168 LEU A N   
1331 C CA  . LEU A 191 ? 0.43553 0.36942 0.32076 -0.04080 -0.10303 -0.00830 168 LEU A CA  
1332 C C   . LEU A 191 ? 0.45945 0.39317 0.35717 -0.03544 -0.12055 -0.01005 168 LEU A C   
1333 O O   . LEU A 191 ? 0.42581 0.37400 0.35617 -0.02727 -0.12248 -0.01225 168 LEU A O   
1334 C CB  . LEU A 191 ? 0.42978 0.34663 0.29258 -0.04276 -0.10699 -0.00074 168 LEU A CB  
1335 C CG  . LEU A 191 ? 0.47196 0.38893 0.35272 -0.03288 -0.11536 0.00355  168 LEU A CG  
1336 C CD1 . LEU A 191 ? 0.48775 0.39171 0.36521 -0.02826 -0.13807 0.00515  168 LEU A CD1 
1337 C CD2 . LEU A 191 ? 0.49391 0.39977 0.35803 -0.03569 -0.11003 0.00967  168 LEU A CD2 
1338 N N   . ILE A 192 ? 0.51607 0.43377 0.38735 -0.04103 -0.13274 -0.01006 169 ILE A N   
1339 C CA  . ILE A 192 ? 0.52694 0.44006 0.40437 -0.03648 -0.15351 -0.01157 169 ILE A CA  
1340 C C   . ILE A 192 ? 0.59158 0.48267 0.44913 -0.03415 -0.17065 -0.00416 169 ILE A C   
1341 O O   . ILE A 192 ? 0.56751 0.43495 0.38380 -0.04293 -0.17392 0.00110  169 ILE A O   
1342 C CB  . ILE A 192 ? 0.46221 0.36896 0.32073 -0.04399 -0.15812 -0.01639 169 ILE A CB  
1343 C CG1 . ILE A 192 ? 0.49216 0.42058 0.37514 -0.04477 -0.14187 -0.02427 169 ILE A CG1 
1344 C CG2 . ILE A 192 ? 0.47610 0.37505 0.33732 -0.03956 -0.18300 -0.01780 169 ILE A CG2 
1345 C CD1 . ILE A 192 ? 0.53395 0.45750 0.39901 -0.05277 -0.14283 -0.03073 169 ILE A CD1 
1346 N N   . GLY A 193 ? 0.51648 0.41445 0.40278 -0.02294 -0.18084 -0.00423 170 GLY A N   
1347 C CA  . GLY A 193 ? 0.48159 0.35934 0.35353 -0.01903 -0.19513 0.00257  170 GLY A CA  
1348 C C   . GLY A 193 ? 0.55620 0.40672 0.39761 -0.02110 -0.22006 0.00549  170 GLY A C   
1349 O O   . GLY A 193 ? 0.55800 0.41231 0.40846 -0.01907 -0.23266 0.00006  170 GLY A O   
1350 N N   . GLU A 194 ? 0.57178 0.39253 0.37425 -0.02613 -0.22775 0.01432  171 GLU A N   
1351 C CA  . GLU A 194 ? 0.64933 0.44223 0.42802 -0.02643 -0.24544 0.01833  171 GLU A CA  
1352 C C   . GLU A 194 ? 0.67048 0.44880 0.45724 -0.01668 -0.25817 0.02234  171 GLU A C   
1353 O O   . GLU A 194 ? 0.63348 0.40021 0.42636 -0.00964 -0.27599 0.02100  171 GLU A O   
1354 C CB  . GLU A 194 ? 0.73187 0.49892 0.45792 -0.04284 -0.23757 0.02449  171 GLU A CB  
1355 C CG  . GLU A 194 ? 0.72824 0.50968 0.44356 -0.05410 -0.21959 0.01954  171 GLU A CG  
1356 C CD  . GLU A 194 ? 0.86860 0.62689 0.53531 -0.07054 -0.21082 0.02316  171 GLU A CD  
1357 O OE1 . GLU A 194 ? 0.88527 0.61576 0.52337 -0.07566 -0.21485 0.03121  171 GLU A OE1 
1358 O OE2 . GLU A 194 ? 0.88131 0.64919 0.53932 -0.07896 -0.19925 0.01700  171 GLU A OE2 
1359 N N   . ALA A 195 ? 0.60957 0.38769 0.39681 -0.01608 -0.24971 0.02637  172 ALA A N   
1360 C CA  . ALA A 195 ? 0.66421 0.43198 0.46460 -0.00586 -0.26016 0.02825  172 ALA A CA  
1361 C C   . ALA A 195 ? 0.66997 0.46919 0.52406 0.00894  -0.26084 0.01972  172 ALA A C   
1362 O O   . ALA A 195 ? 0.62898 0.42426 0.50197 0.01941  -0.26993 0.01799  172 ALA A O   
1363 C CB  . ALA A 195 ? 0.64897 0.39876 0.42062 -0.01398 -0.24989 0.03673  172 ALA A CB  
1364 N N   . VAL A 196 ? 0.56504 0.39495 0.44393 0.00904  -0.25053 0.01342  173 VAL A N   
1365 C CA  . VAL A 196 ? 0.57949 0.44246 0.51128 0.02017  -0.24430 0.00408  173 VAL A CA  
1366 C C   . VAL A 196 ? 0.59728 0.48463 0.55234 0.01873  -0.23886 -0.00434 173 VAL A C   
1367 O O   . VAL A 196 ? 0.55811 0.44073 0.48872 0.00838  -0.23284 -0.00246 173 VAL A O   
1368 C CB  . VAL A 196 ? 0.61289 0.48900 0.55291 0.01844  -0.21937 0.00581  173 VAL A CB  
1369 C CG1 . VAL A 196 ? 0.49636 0.38167 0.42176 0.00637  -0.19600 0.00738  173 VAL A CG1 
1370 C CG2 . VAL A 196 ? 0.69234 0.59664 0.68225 0.02973  -0.21368 -0.00331 173 VAL A CG2 
1371 N N   . LYS A 197 ? 0.50223 0.41523 0.50485 0.02863  -0.24130 -0.01461 174 LYS A N   
1372 C CA  . LYS A 197 ? 0.53576 0.47236 0.56437 0.02709  -0.23675 -0.02346 174 LYS A CA  
1373 C C   . LYS A 197 ? 0.48282 0.44126 0.52342 0.02091  -0.20731 -0.02469 174 LYS A C   
1374 O O   . LYS A 197 ? 0.40960 0.38062 0.46907 0.02437  -0.19374 -0.02564 174 LYS A O   
1375 C CB  . LYS A 197 ? 0.65387 0.60925 0.72955 0.03900  -0.25119 -0.03514 174 LYS A CB  
1376 C CG  . LYS A 197 ? 0.83866 0.80914 0.93459 0.03748  -0.25527 -0.04397 174 LYS A CG  
1377 C CD  . LYS A 197 ? 0.84474 0.81947 0.97065 0.04803  -0.26883 -0.05309 174 LYS A CD  
1378 C CE  . LYS A 197 ? 0.88970 0.87758 1.03258 0.04547  -0.27264 -0.06137 174 LYS A CE  
1379 N NZ  . LYS A 197 ? 0.87099 0.88612 1.03387 0.03749  -0.25426 -0.06623 174 LYS A NZ  
1380 N N   . THR A 198 ? 0.44743 0.40860 0.47568 0.01182  -0.19826 -0.02490 175 THR A N   
1381 C CA  . THR A 198 ? 0.39325 0.37251 0.43279 0.00652  -0.17327 -0.02646 175 THR A CA  
1382 C C   . THR A 198 ? 0.41632 0.41569 0.48348 0.00462  -0.16980 -0.03538 175 THR A C   
1383 O O   . THR A 198 ? 0.37442 0.38761 0.45351 0.00075  -0.15074 -0.03703 175 THR A O   
1384 C CB  . THR A 198 ? 0.39254 0.35796 0.39415 -0.00325 -0.16090 -0.01953 175 THR A CB  
1385 O OG1 . THR A 198 ? 0.42280 0.37313 0.39755 -0.00919 -0.17240 -0.01918 175 THR A OG1 
1386 C CG2 . THR A 198 ? 0.38912 0.33820 0.36685 -0.00334 -0.15854 -0.01114 175 THR A CG2 
1387 N N   . GLN A 199 ? 0.43520 0.43510 0.51195 0.00681  -0.18821 -0.04112 176 GLN A N   
1388 C CA  . GLN A 199 ? 0.45937 0.47814 0.56320 0.00405  -0.18567 -0.05029 176 GLN A CA  
1389 C C   . GLN A 199 ? 0.46314 0.50495 0.61392 0.01134  -0.18807 -0.05981 176 GLN A C   
1390 O O   . GLN A 199 ? 0.45966 0.49991 0.62296 0.01979  -0.20768 -0.06349 176 GLN A O   
1391 C CB  . GLN A 199 ? 0.51016 0.51773 0.59842 0.00115  -0.20405 -0.05262 176 GLN A CB  
1392 C CG  . GLN A 199 ? 0.42507 0.45061 0.53837 -0.00364 -0.20063 -0.06229 176 GLN A CG  
1393 C CD  . GLN A 199 ? 0.48359 0.49374 0.56919 -0.00928 -0.21270 -0.06249 176 GLN A CD  
1394 O OE1 . GLN A 199 ? 0.54821 0.54109 0.61432 -0.00650 -0.23441 -0.06064 176 GLN A OE1 
1395 N NE2 . GLN A 199 ? 0.59952 0.61341 0.68067 -0.01749 -0.19961 -0.06486 176 GLN A NE2 
1396 N N   . PHE A 200 ? 0.39864 0.46065 0.57450 0.00789  -0.16819 -0.06419 177 PHE A N   
1397 C CA  . PHE A 200 ? 0.31655 0.40241 0.53668 0.01253  -0.16557 -0.07443 177 PHE A CA  
1398 C C   . PHE A 200 ? 0.34936 0.45402 0.59912 0.00758  -0.16562 -0.08534 177 PHE A C   
1399 O O   . PHE A 200 ? 0.33455 0.43449 0.57011 -0.00059 -0.16089 -0.08360 177 PHE A O   
1400 C CB  . PHE A 200 ? 0.32354 0.41760 0.54909 0.01049  -0.14220 -0.07200 177 PHE A CB  
1401 C CG  . PHE A 200 ? 0.32764 0.40348 0.52323 0.01383  -0.14007 -0.06125 177 PHE A CG  
1402 C CD1 . PHE A 200 ? 0.40564 0.47212 0.59906 0.02313  -0.15659 -0.06032 177 PHE A CD1 
1403 C CD2 . PHE A 200 ? 0.29741 0.36462 0.46777 0.00772  -0.12301 -0.05271 177 PHE A CD2 
1404 C CE1 . PHE A 200 ? 0.41537 0.46388 0.58062 0.02504  -0.15455 -0.05050 177 PHE A CE1 
1405 C CE2 . PHE A 200 ? 0.39299 0.44481 0.53753 0.00998  -0.12085 -0.04378 177 PHE A CE2 
1406 C CZ  . PHE A 200 ? 0.42084 0.46338 0.56252 0.01799  -0.13597 -0.04254 177 PHE A CZ  
1407 N N   . ASN A 201 ? 0.33829 0.46413 0.63029 0.01281  -0.17228 -0.09771 178 ASN A N   
1408 C CA  . ASN A 201 ? 0.34631 0.49713 0.67554 0.00623  -0.16325 -0.10983 178 ASN A CA  
1409 C C   . ASN A 201 ? 0.30065 0.46262 0.63792 -0.00083 -0.13531 -0.10934 178 ASN A C   
1410 O O   . ASN A 201 ? 0.29974 0.46195 0.63655 0.00380  -0.12769 -0.10684 178 ASN A O   
1411 C CB  . ASN A 201 ? 0.29368 0.45916 0.65782 0.01426  -0.17357 -0.12220 178 ASN A CB  
1412 C CG  . ASN A 201 ? 0.34461 0.49564 0.69664 0.01942  -0.19650 -0.12218 178 ASN A CG  
1413 O OD1 . ASN A 201 ? 0.40435 0.54293 0.73224 0.01363  -0.20238 -0.11706 178 ASN A OD1 
1414 N ND2 . ASN A 201 ? 0.41855 0.57004 0.78685 0.03015  -0.20965 -0.12869 178 ASN A ND2 
1415 N N   . TYR A 202 ? 0.30449 0.47415 0.64837 -0.01245 -0.12108 -0.11210 179 TYR A N   
1416 C CA  . TYR A 202 ? 0.26775 0.44411 0.61499 -0.02173 -0.09538 -0.11122 179 TYR A CA  
1417 C C   . TYR A 202 ? 0.27007 0.47292 0.65970 -0.02944 -0.08679 -0.12603 179 TYR A C   
1418 O O   . TYR A 202 ? 0.29294 0.50490 0.70136 -0.03242 -0.09680 -0.13444 179 TYR A O   
1419 C CB  . TYR A 202 ? 0.24785 0.40580 0.56186 -0.03064 -0.08478 -0.10080 179 TYR A CB  
1420 C CG  . TYR A 202 ? 0.28425 0.42065 0.56002 -0.02614 -0.08269 -0.08723 179 TYR A CG  
1421 C CD1 . TYR A 202 ? 0.31840 0.43818 0.56829 -0.02020 -0.09838 -0.08100 179 TYR A CD1 
1422 C CD2 . TYR A 202 ? 0.27761 0.40978 0.54215 -0.02899 -0.06478 -0.08114 179 TYR A CD2 
1423 C CE1 . TYR A 202 ? 0.29354 0.39534 0.51018 -0.01758 -0.09493 -0.06985 179 TYR A CE1 
1424 C CE2 . TYR A 202 ? 0.23476 0.34925 0.46770 -0.02508 -0.06327 -0.07013 179 TYR A CE2 
1425 C CZ  . TYR A 202 ? 0.28039 0.38103 0.49116 -0.01959 -0.07779 -0.06501 179 TYR A CZ  
1426 O OH  . TYR A 202 ? 0.36187 0.44678 0.54319 -0.01719 -0.07470 -0.05534 179 TYR A OH  
1427 N N   . TYR A 203 ? 0.29951 0.51430 0.70282 -0.03388 -0.06737 -0.12961 180 TYR A N   
1428 C CA  . TYR A 203 ? 0.31403 0.55271 0.75285 -0.04367 -0.05332 -0.14334 180 TYR A CA  
1429 C C   . TYR A 203 ? 0.31097 0.54532 0.73564 -0.05576 -0.02748 -0.13816 180 TYR A C   
1430 O O   . TYR A 203 ? 0.29871 0.51773 0.69582 -0.05136 -0.02220 -0.12737 180 TYR A O   
1431 C CB  . TYR A 203 ? 0.26600 0.52043 0.73200 -0.03332 -0.05701 -0.15490 180 TYR A CB  
1432 C CG  . TYR A 203 ? 0.28796 0.53748 0.75743 -0.01814 -0.08417 -0.15665 180 TYR A CG  
1433 C CD1 . TYR A 203 ? 0.30543 0.54006 0.75634 -0.00602 -0.09941 -0.14829 180 TYR A CD1 
1434 C CD2 . TYR A 203 ? 0.26516 0.52246 0.75394 -0.01657 -0.09485 -0.16623 180 TYR A CD2 
1435 C CE1 . TYR A 203 ? 0.33373 0.55822 0.78131 0.00640  -0.12437 -0.14839 180 TYR A CE1 
1436 C CE2 . TYR A 203 ? 0.33211 0.58115 0.82051 -0.00316 -0.12038 -0.16720 180 TYR A CE2 
1437 C CZ  . TYR A 203 ? 0.37282 0.60393 0.83871 0.00795  -0.13495 -0.15775 180 TYR A CZ  
1438 O OH  . TYR A 203 ? 0.34841 0.56622 0.80821 0.02002  -0.16026 -0.15738 180 TYR A OH  
1439 N N   . LYS A 204 ? 0.26270 0.50592 0.69970 -0.07059 -0.01156 -0.14446 181 LYS A N   
1440 C CA  . LYS A 204 ? 0.31041 0.54549 0.72999 -0.08430 0.01224  -0.13906 181 LYS A CA  
1441 C C   . LYS A 204 ? 0.32653 0.57611 0.76457 -0.09602 0.02975  -0.14999 181 LYS A C   
1442 O O   . LYS A 204 ? 0.35303 0.61097 0.80755 -0.09940 0.02567  -0.15762 181 LYS A O   
1443 C CB  . LYS A 204 ? 0.32379 0.53056 0.70512 -0.09153 0.01405  -0.12495 181 LYS A CB  
1444 C CG  . LYS A 204 ? 0.29798 0.48920 0.65381 -0.10386 0.03535  -0.11707 181 LYS A CG  
1445 C CD  . LYS A 204 ? 0.34504 0.50658 0.66452 -0.10904 0.03471  -0.10381 181 LYS A CD  
1446 C CE  . LYS A 204 ? 0.42509 0.56809 0.71617 -0.11806 0.05217  -0.09489 181 LYS A CE  
1447 N NZ  . LYS A 204 ? 0.56134 0.67782 0.82500 -0.12660 0.05361  -0.08570 181 LYS A NZ  
1448 N N   . LYS A 205 ? 0.33853 0.58867 0.76970 -0.10266 0.04949  -0.15021 182 LYS A N   
1449 C CA  . LYS A 205 ? 0.39324 0.65319 0.83389 -0.11524 0.06882  -0.15963 182 LYS A CA  
1450 C C   . LYS A 205 ? 0.33603 0.57555 0.74336 -0.13219 0.08899  -0.14954 182 LYS A C   
1451 O O   . LYS A 205 ? 0.32788 0.55261 0.71118 -0.13090 0.09225  -0.13913 182 LYS A O   
1452 C CB  . LYS A 205 ? 0.38150 0.66007 0.84335 -0.10746 0.07390  -0.17179 182 LYS A CB  
1453 C CG  . LYS A 205 ? 0.45204 0.75065 0.94983 -0.09403 0.05729  -0.18551 182 LYS A CG  
1454 C CD  . LYS A 205 ? 0.43806 0.75118 0.95443 -0.08514 0.06140  -0.19728 182 LYS A CD  
1455 C CE  . LYS A 205 ? 0.41378 0.73974 0.94204 -0.09843 0.08354  -0.21050 182 LYS A CE  
1456 N NZ  . LYS A 205 ? 0.39539 0.73398 0.94037 -0.08994 0.08745  -0.22264 182 LYS A NZ  
1457 N N   . VAL A 206 ? 0.37824 0.61539 0.78293 -0.14804 0.10176  -0.15261 183 VAL A N   
1458 C CA  . VAL A 206 ? 0.45866 0.67282 0.82872 -0.16549 0.12031  -0.14337 183 VAL A CA  
1459 C C   . VAL A 206 ? 0.44269 0.66930 0.82333 -0.17755 0.13829  -0.15548 183 VAL A C   
1460 O O   . VAL A 206 ? 0.39644 0.63913 0.80309 -0.18026 0.13632  -0.16650 183 VAL A O   
1461 C CB  . VAL A 206 ? 0.48981 0.68012 0.83840 -0.17477 0.11565  -0.13250 183 VAL A CB  
1462 C CG1 . VAL A 206 ? 0.48333 0.64565 0.79376 -0.19300 0.13298  -0.12281 183 VAL A CG1 
1463 C CG2 . VAL A 206 ? 0.45395 0.63220 0.79260 -0.16324 0.09850  -0.12257 183 VAL A CG2 
1464 N N   . ASP A 207 ? 0.49201 0.71140 0.85261 -0.18477 0.15545  -0.15433 184 ASP A N   
1465 C CA  . ASP A 207 ? 0.51563 0.74621 0.88340 -0.19685 0.17435  -0.16707 184 ASP A CA  
1466 C C   . ASP A 207 ? 0.49950 0.76451 0.91581 -0.18833 0.16948  -0.18720 184 ASP A C   
1467 O O   . ASP A 207 ? 0.45153 0.72817 0.88427 -0.19882 0.17794  -0.19866 184 ASP A O   
1468 C CB  . ASP A 207 ? 0.62244 0.83380 0.96626 -0.21792 0.18674  -0.16220 184 ASP A CB  
1469 C CG  . ASP A 207 ? 0.74841 0.92146 1.04298 -0.22551 0.18839  -0.14203 184 ASP A CG  
1470 O OD1 . ASP A 207 ? 0.83220 0.98661 1.11283 -0.23249 0.18297  -0.13320 184 ASP A OD1 
1471 O OD2 . ASP A 207 ? 0.81999 0.98045 1.08980 -0.22380 0.19385  -0.13529 184 ASP A OD2 
1472 N N   . GLY A 208 ? 0.50696 0.78712 0.94593 -0.16903 0.15512  -0.19185 185 GLY A N   
1473 C CA  . GLY A 208 ? 0.46688 0.77631 0.94986 -0.15883 0.14852  -0.21095 185 GLY A CA  
1474 C C   . GLY A 208 ? 0.45924 0.77967 0.96910 -0.15210 0.13013  -0.21549 185 GLY A C   
1475 O O   . GLY A 208 ? 0.45580 0.79878 1.00241 -0.14203 0.12155  -0.23123 185 GLY A O   
1476 N N   . VAL A 209 ? 0.43884 0.74279 0.93110 -0.15688 0.12271  -0.20273 186 VAL A N   
1477 C CA  . VAL A 209 ? 0.39137 0.70323 0.90477 -0.15385 0.10712  -0.20692 186 VAL A CA  
1478 C C   . VAL A 209 ? 0.37092 0.67296 0.87739 -0.13887 0.08365  -0.19599 186 VAL A C   
1479 O O   . VAL A 209 ? 0.36003 0.64005 0.83506 -0.14121 0.08340  -0.18049 186 VAL A O   
1480 C CB  . VAL A 209 ? 0.40290 0.70342 0.90243 -0.17360 0.11807  -0.20332 186 VAL A CB  
1481 C CG1 . VAL A 209 ? 0.38007 0.68522 0.89693 -0.17019 0.10017  -0.20553 186 VAL A CG1 
1482 C CG2 . VAL A 209 ? 0.48743 0.79963 0.99635 -0.18876 0.14054  -0.21638 186 VAL A CG2 
1483 N N   . VAL A 210 ? 0.33747 0.65425 0.87189 -0.12367 0.06346  -0.20443 187 VAL A N   
1484 C CA  . VAL A 210 ? 0.41739 0.72392 0.94364 -0.10998 0.03990  -0.19503 187 VAL A CA  
1485 C C   . VAL A 210 ? 0.35140 0.64259 0.86062 -0.11941 0.03561  -0.18619 187 VAL A C   
1486 O O   . VAL A 210 ? 0.33419 0.63181 0.85614 -0.12855 0.03825  -0.19307 187 VAL A O   
1487 C CB  . VAL A 210 ? 0.42293 0.74510 0.97954 -0.09264 0.01851  -0.20622 187 VAL A CB  
1488 C CG1 . VAL A 210 ? 0.45039 0.75830 0.99274 -0.08014 -0.00647 -0.19573 187 VAL A CG1 
1489 C CG2 . VAL A 210 ? 0.40040 0.73443 0.97225 -0.08278 0.02212  -0.21498 187 VAL A CG2 
1490 N N   . GLN A 211 ? 0.34648 0.68388 0.80747 -0.00599 0.10316  -0.16122 188 GLN A N   
1491 C CA  . GLN A 211 ? 0.33945 0.65897 0.78380 -0.01835 0.10213  -0.14339 188 GLN A CA  
1492 C C   . GLN A 211 ? 0.38145 0.68459 0.83869 -0.01947 0.07704  -0.14249 188 GLN A C   
1493 O O   . GLN A 211 ? 0.41963 0.71490 0.88222 -0.01018 0.05790  -0.15013 188 GLN A O   
1494 C CB  . GLN A 211 ? 0.40857 0.70684 0.80364 -0.01930 0.10466  -0.13102 188 GLN A CB  
1495 C CG  . GLN A 211 ? 0.48184 0.79534 0.85760 -0.01614 0.12632  -0.13197 188 GLN A CG  
1496 C CD  . GLN A 211 ? 0.48193 0.81442 0.86871 -0.02579 0.15035  -0.12379 188 GLN A CD  
1497 O OE1 . GLN A 211 ? 0.48084 0.84154 0.89615 -0.02435 0.16414  -0.13372 188 GLN A OE1 
1498 N NE2 . GLN A 211 ? 0.52981 0.84705 0.89617 -0.03598 0.15601  -0.10529 188 GLN A NE2 
1499 N N   . GLN A 212 ? 0.32579 0.62363 0.78787 -0.03071 0.07687  -0.13297 189 GLN A N   
1500 C CA  . GLN A 212 ? 0.32569 0.60423 0.78500 -0.03260 0.05383  -0.12918 189 GLN A CA  
1501 C C   . GLN A 212 ? 0.34357 0.59591 0.75714 -0.03559 0.05192  -0.11564 189 GLN A C   
1502 O O   . GLN A 212 ? 0.39972 0.64800 0.79823 -0.04405 0.06598  -0.10534 189 GLN A O   
1503 C CB  . GLN A 212 ? 0.37500 0.66176 0.86413 -0.04245 0.05244  -0.12906 189 GLN A CB  
1504 C CG  . GLN A 212 ? 0.52851 0.83980 1.06705 -0.03893 0.04699  -0.14371 189 GLN A CG  
1505 C CD  . GLN A 212 ? 0.67018 0.98792 1.23813 -0.04884 0.04167  -0.14489 189 GLN A CD  
1506 O OE1 . GLN A 212 ? 0.69759 1.04033 1.30904 -0.05172 0.04874  -0.15418 189 GLN A OE1 
1507 N NE2 . GLN A 212 ? 0.68945 0.98591 1.23521 -0.05403 0.02918  -0.13690 189 GLN A NE2 
1508 N N   . LEU A 213 ? 0.25506 0.48983 0.64847 -0.02862 0.03491  -0.11526 190 LEU A N   
1509 C CA  . LEU A 213 ? 0.27968 0.49133 0.63317 -0.03144 0.03211  -0.10356 190 LEU A CA  
1510 C C   . LEU A 213 ? 0.28086 0.48167 0.63198 -0.03982 0.02290  -0.09658 190 LEU A C   
1511 O O   . LEU A 213 ? 0.28146 0.48687 0.65537 -0.03977 0.00922  -0.10173 190 LEU A O   
1512 C CB  . LEU A 213 ? 0.28522 0.48233 0.62210 -0.02256 0.01717  -0.10526 190 LEU A CB  
1513 C CG  . LEU A 213 ? 0.35359 0.55991 0.68993 -0.01405 0.02626  -0.11413 190 LEU A CG  
1514 C CD1 . LEU A 213 ? 0.33460 0.52750 0.66795 -0.00497 0.00868  -0.11869 190 LEU A CD1 
1515 C CD2 . LEU A 213 ? 0.33320 0.53668 0.63724 -0.01730 0.04319  -0.10681 190 LEU A CD2 
1516 N N   . PRO A 214 ? 0.27840 0.46561 0.60259 -0.04615 0.02923  -0.08608 191 PRO A N   
1517 C CA  . PRO A 214 ? 0.31761 0.49546 0.64017 -0.05387 0.02176  -0.08165 191 PRO A CA  
1518 C C   . PRO A 214 ? 0.39079 0.55497 0.69873 -0.05058 0.00036  -0.08104 191 PRO A C   
1519 O O   . PRO A 214 ? 0.33464 0.48912 0.62322 -0.04439 -0.00622 -0.07889 191 PRO A O   
1520 C CB  . PRO A 214 ? 0.32340 0.48987 0.61980 -0.05928 0.03533  -0.07086 191 PRO A CB  
1521 C CG  . PRO A 214 ? 0.31210 0.47396 0.58232 -0.05169 0.03925  -0.06873 191 PRO A CG  
1522 C CD  . PRO A 214 ? 0.25412 0.43398 0.54755 -0.04521 0.04188  -0.07898 191 PRO A CD  
1523 N N   . GLU A 215 ? 0.37580 0.54002 0.69383 -0.05508 -0.01036 -0.08308 192 GLU A N   
1524 C CA  . GLU A 215 ? 0.32074 0.47115 0.61619 -0.05470 -0.02665 -0.07951 192 GLU A CA  
1525 C C   . GLU A 215 ? 0.34207 0.47614 0.60209 -0.05605 -0.02013 -0.07024 192 GLU A C   
1526 O O   . GLU A 215 ? 0.29231 0.42396 0.54687 -0.06103 -0.00577 -0.06654 192 GLU A O   
1527 C CB  . GLU A 215 ? 0.40646 0.56001 0.71334 -0.06127 -0.03320 -0.08374 192 GLU A CB  
1528 C CG  . GLU A 215 ? 0.49723 0.66362 0.83043 -0.05876 -0.04868 -0.09274 192 GLU A CG  
1529 C CD  . GLU A 215 ? 0.43467 0.60258 0.77246 -0.06447 -0.05810 -0.09822 192 GLU A CD  
1530 O OE1 . GLU A 215 ? 0.38126 0.53788 0.69799 -0.06949 -0.05455 -0.09483 192 GLU A OE1 
1531 O OE2 . GLU A 215 ? 0.48365 0.66520 0.84794 -0.06327 -0.07001 -0.10750 192 GLU A OE2 
1532 N N   . THR A 216 ? 0.30979 0.43259 0.54711 -0.05187 -0.03102 -0.06578 193 THR A N   
1533 C CA  . THR A 216 ? 0.26253 0.37202 0.46973 -0.05293 -0.02497 -0.05820 193 THR A CA  
1534 C C   . THR A 216 ? 0.31110 0.40992 0.49672 -0.05229 -0.03880 -0.05338 193 THR A C   
1535 O O   . THR A 216 ? 0.30296 0.40255 0.49345 -0.04854 -0.05269 -0.05363 193 THR A O   
1536 C CB  . THR A 216 ? 0.32607 0.43519 0.52850 -0.04783 -0.01623 -0.05748 193 THR A CB  
1537 O OG1 . THR A 216 ? 0.30305 0.40087 0.47808 -0.04881 -0.01086 -0.05106 193 THR A OG1 
1538 C CG2 . THR A 216 ? 0.29713 0.40572 0.50689 -0.04051 -0.02827 -0.06021 193 THR A CG2 
1539 N N   . TYR A 217 ? 0.29110 0.38085 0.45361 -0.05589 -0.03474 -0.04848 194 TYR A N   
1540 C CA  . TYR A 217 ? 0.30250 0.38266 0.44156 -0.05525 -0.04299 -0.04230 194 TYR A CA  
1541 C C   . TYR A 217 ? 0.32649 0.40027 0.45809 -0.05136 -0.03971 -0.03856 194 TYR A C   
1542 O O   . TYR A 217 ? 0.25860 0.33550 0.39721 -0.04932 -0.02975 -0.04135 194 TYR A O   
1543 C CB  . TYR A 217 ? 0.25823 0.33330 0.37814 -0.06003 -0.03903 -0.04032 194 TYR A CB  
1544 C CG  . TYR A 217 ? 0.28635 0.36687 0.41225 -0.06374 -0.04378 -0.04619 194 TYR A CG  
1545 C CD1 . TYR A 217 ? 0.28796 0.37110 0.40592 -0.06335 -0.05756 -0.04673 194 TYR A CD1 
1546 C CD2 . TYR A 217 ? 0.28066 0.36404 0.42113 -0.06755 -0.03493 -0.05136 194 TYR A CD2 
1547 C CE1 . TYR A 217 ? 0.31922 0.40925 0.44282 -0.06611 -0.06320 -0.05497 194 TYR A CE1 
1548 C CE2 . TYR A 217 ? 0.33903 0.42736 0.48929 -0.07119 -0.04032 -0.05930 194 TYR A CE2 
1549 C CZ  . TYR A 217 ? 0.34981 0.44219 0.49132 -0.07014 -0.05474 -0.06238 194 TYR A CZ  
1550 O OH  . TYR A 217 ? 0.35908 0.45778 0.50964 -0.07312 -0.06094 -0.07271 194 TYR A OH  
1551 N N   . PHE A 218 ? 0.27185 0.33735 0.38913 -0.05062 -0.04784 -0.03241 195 PHE A N   
1552 C CA  . PHE A 218 ? 0.31597 0.37410 0.42707 -0.04805 -0.04578 -0.02965 195 PHE A CA  
1553 C C   . PHE A 218 ? 0.34163 0.39214 0.43030 -0.05197 -0.04493 -0.02299 195 PHE A C   
1554 O O   . PHE A 218 ? 0.38178 0.43103 0.45964 -0.05503 -0.05119 -0.01813 195 PHE A O   
1555 C CB  . PHE A 218 ? 0.33247 0.38691 0.45593 -0.04314 -0.05704 -0.02842 195 PHE A CB  
1556 C CG  . PHE A 218 ? 0.32653 0.38998 0.47530 -0.03789 -0.05712 -0.03691 195 PHE A CG  
1557 C CD1 . PHE A 218 ? 0.28838 0.35753 0.44496 -0.03500 -0.04588 -0.04432 195 PHE A CD1 
1558 C CD2 . PHE A 218 ? 0.31311 0.38119 0.47783 -0.03530 -0.06844 -0.03797 195 PHE A CD2 
1559 C CE1 . PHE A 218 ? 0.28797 0.36820 0.46895 -0.03006 -0.04435 -0.05308 195 PHE A CE1 
1560 C CE2 . PHE A 218 ? 0.32293 0.40146 0.51473 -0.03006 -0.06826 -0.04706 195 PHE A CE2 
1561 C CZ  . PHE A 218 ? 0.29661 0.38170 0.49680 -0.02779 -0.05528 -0.05479 195 PHE A CZ  
1562 N N   . THR A 219 ? 0.31491 0.36225 0.39671 -0.05154 -0.03729 -0.02344 196 THR A N   
1563 C CA  . THR A 219 ? 0.27860 0.31987 0.34403 -0.05486 -0.03733 -0.01777 196 THR A CA  
1564 C C   . THR A 219 ? 0.33412 0.36784 0.40195 -0.05463 -0.04668 -0.01174 196 THR A C   
1565 O O   . THR A 219 ? 0.33656 0.36814 0.41970 -0.05037 -0.05252 -0.01354 196 THR A O   
1566 C CB  . THR A 219 ? 0.32949 0.37060 0.38906 -0.05385 -0.02835 -0.02071 196 THR A CB  
1567 O OG1 . THR A 219 ? 0.27789 0.31969 0.34854 -0.04863 -0.02764 -0.02615 196 THR A OG1 
1568 C CG2 . THR A 219 ? 0.30586 0.35174 0.36108 -0.05465 -0.01949 -0.02317 196 THR A CG2 
1569 N N   . GLN A 220 ? 0.32522 0.35489 0.37945 -0.05928 -0.04750 -0.00438 197 GLN A N   
1570 C CA  . GLN A 220 ? 0.33203 0.35375 0.38640 -0.06100 -0.05594 0.00528  197 GLN A CA  
1571 C C   . GLN A 220 ? 0.34193 0.35615 0.40201 -0.06184 -0.05476 0.00622  197 GLN A C   
1572 O O   . GLN A 220 ? 0.36330 0.36843 0.42877 -0.06332 -0.06174 0.01463  197 GLN A O   
1573 C CB  . GLN A 220 ? 0.35210 0.37619 0.38771 -0.06643 -0.05723 0.01412  197 GLN A CB  
1574 C CG  . GLN A 220 ? 0.34517 0.37721 0.37652 -0.06524 -0.06143 0.01153  197 GLN A CG  
1575 C CD  . GLN A 220 ? 0.46600 0.49530 0.50751 -0.06131 -0.07392 0.01569  197 GLN A CD  
1576 O OE1 . GLN A 220 ? 0.48066 0.50140 0.52240 -0.06146 -0.08085 0.02627  197 GLN A OE1 
1577 N NE2 . GLN A 220 ? 0.43868 0.47509 0.49100 -0.05776 -0.07712 0.00767  197 GLN A NE2 
1578 N N   . SER A 221 ? 0.30710 0.32472 0.36695 -0.06089 -0.04692 -0.00186 198 SER A N   
1579 C CA  . SER A 221 ? 0.35120 0.36372 0.42004 -0.06051 -0.04702 -0.00503 198 SER A CA  
1580 C C   . SER A 221 ? 0.38601 0.39233 0.45236 -0.06757 -0.04882 0.00514  198 SER A C   
1581 O O   . SER A 221 ? 0.35663 0.35452 0.43685 -0.06838 -0.05319 0.00601  198 SER A O   
1582 C CB  . SER A 221 ? 0.32498 0.33243 0.41334 -0.05446 -0.05332 -0.01108 198 SER A CB  
1583 O OG  . SER A 221 ? 0.35344 0.36941 0.44485 -0.04841 -0.04938 -0.02078 198 SER A OG  
1584 N N   . ARG A 222 ? 0.37363 0.38478 0.42395 -0.07300 -0.04477 0.01219  199 ARG A N   
1585 C CA  . ARG A 222 ? 0.40316 0.41119 0.45099 -0.08050 -0.04404 0.02243  199 ARG A CA  
1586 C C   . ARG A 222 ? 0.43219 0.44621 0.48111 -0.08276 -0.03678 0.01582  199 ARG A C   
1587 O O   . ARG A 222 ? 0.39030 0.41062 0.43764 -0.07805 -0.03290 0.00492  199 ARG A O   
1588 C CB  . ARG A 222 ? 0.41419 0.42688 0.44353 -0.08495 -0.04319 0.03307  199 ARG A CB  
1589 C CG  . ARG A 222 ? 0.45121 0.45800 0.47996 -0.08270 -0.05283 0.04125  199 ARG A CG  
1590 C CD  . ARG A 222 ? 0.42950 0.44444 0.43681 -0.08503 -0.05299 0.04798  199 ARG A CD  
1591 N NE  . ARG A 222 ? 0.40515 0.43059 0.40549 -0.08169 -0.04950 0.03598  199 ARG A NE  
1592 C CZ  . ARG A 222 ? 0.44402 0.47715 0.42991 -0.08158 -0.05209 0.03670  199 ARG A CZ  
1593 N NH1 . ARG A 222 ? 0.44069 0.47319 0.41430 -0.08390 -0.05824 0.04970  199 ARG A NH1 
1594 N NH2 . ARG A 222 ? 0.38494 0.42617 0.36889 -0.07911 -0.04914 0.02485  199 ARG A NH2 
1595 N N   . ASN A 223 ? 0.44480 0.45718 0.49772 -0.08997 -0.03517 0.02309  200 ASN A N   
1596 C CA  . ASN A 223 ? 0.48432 0.50492 0.54015 -0.09242 -0.02879 0.01656  200 ASN A CA  
1597 C C   . ASN A 223 ? 0.51267 0.54164 0.55761 -0.10034 -0.02166 0.02548  200 ASN A C   
1598 O O   . ASN A 223 ? 0.52561 0.55226 0.56157 -0.10501 -0.02214 0.03853  200 ASN A O   
1599 C CB  . ASN A 223 ? 0.54170 0.55609 0.61974 -0.09338 -0.03263 0.01160  200 ASN A CB  
1600 C CG  . ASN A 223 ? 0.62961 0.63269 0.71984 -0.10088 -0.03629 0.02473  200 ASN A CG  
1601 O OD1 . ASN A 223 ? 0.67629 0.68272 0.76609 -0.10969 -0.03102 0.03428  200 ASN A OD1 
1602 N ND2 . ASN A 223 ? 0.69638 0.68609 0.79909 -0.09744 -0.04497 0.02573  200 ASN A ND2 
1603 N N   . LEU A 224 ? 0.58732 0.62768 0.63212 -0.10095 -0.01504 0.01787  201 LEU A N   
1604 C CA  . LEU A 224 ? 0.66186 0.71403 0.69748 -0.10739 -0.00665 0.02296  201 LEU A CA  
1605 C C   . LEU A 224 ? 0.71375 0.76303 0.75497 -0.11751 -0.00488 0.03759  201 LEU A C   
1606 O O   . LEU A 224 ? 0.85799 0.91135 0.88365 -0.12220 -0.00113 0.04891  201 LEU A O   
1607 C CB  . LEU A 224 ? 0.67746 0.74171 0.71978 -0.10597 -0.00132 0.01151  201 LEU A CB  
1608 C CG  . LEU A 224 ? 0.64774 0.71925 0.67911 -0.09839 0.00112  0.00142  201 LEU A CG  
1609 C CD1 . LEU A 224 ? 0.67127 0.75581 0.71071 -0.09854 0.00635  -0.00641 201 LEU A CD1 
1610 C CD2 . LEU A 224 ? 0.62435 0.69912 0.63739 -0.09940 0.00403  0.00614  201 LEU A CD2 
1611 N N   . GLN A 225 ? 0.64471 0.68703 0.70831 -0.12101 -0.00770 0.03763  202 GLN A N   
1612 C CA  . GLN A 225 ? 0.85994 0.90095 0.93427 -0.13231 -0.00376 0.05112  202 GLN A CA  
1613 C C   . GLN A 225 ? 0.91013 0.94030 0.97320 -0.13606 -0.00663 0.07033  202 GLN A C   
1614 O O   . GLN A 225 ? 0.96036 0.99600 1.01471 -0.14468 0.00050  0.08513  202 GLN A O   
1615 C CB  . GLN A 225 ? 1.02437 1.05730 1.12910 -0.13464 -0.00858 0.04545  202 GLN A CB  
1616 C CG  . GLN A 225 ? 1.17681 1.22153 1.29308 -0.13049 -0.00761 0.02670  202 GLN A CG  
1617 C CD  . GLN A 225 ? 1.31075 1.34801 1.45727 -0.13195 -0.01450 0.01863  202 GLN A CD  
1618 O OE1 . GLN A 225 ? 1.35278 1.37361 1.50953 -0.13047 -0.02280 0.02049  202 GLN A OE1 
1619 N NE2 . GLN A 225 ? 1.34478 1.39479 1.50789 -0.13441 -0.01188 0.00820  202 GLN A NE2 
1620 N N   . GLU A 226 ? 0.78832 0.80414 0.85156 -0.12937 -0.01708 0.07075  203 GLU A N   
1621 C CA  . GLU A 226 ? 0.78810 0.79254 0.84318 -0.13177 -0.02221 0.08946  203 GLU A CA  
1622 C C   . GLU A 226 ? 0.59078 0.59683 0.62455 -0.12333 -0.02752 0.08748  203 GLU A C   
1623 O O   . GLU A 226 ? 0.54982 0.54319 0.58579 -0.11918 -0.03760 0.09365  203 GLU A O   
1624 C CB  . GLU A 226 ? 0.93923 0.92325 1.02057 -0.13244 -0.03160 0.09425  203 GLU A CB  
1625 C CG  . GLU A 226 ? 1.00520 0.98346 1.10291 -0.12266 -0.03936 0.07490  203 GLU A CG  
1626 C CD  . GLU A 226 ? 1.05562 1.01975 1.18579 -0.12516 -0.04505 0.07218  203 GLU A CD  
1627 O OE1 . GLU A 226 ? 1.11894 1.07793 1.26151 -0.13567 -0.04194 0.08513  203 GLU A OE1 
1628 O OE2 . GLU A 226 ? 1.07121 1.03006 1.21540 -0.11680 -0.05226 0.05663  203 GLU A OE2 
1629 N N   . PHE A 227 ? 0.54013 0.56201 0.55578 -0.12088 -0.02117 0.07850  204 PHE A N   
1630 C CA  . PHE A 227 ? 0.49916 0.52444 0.49689 -0.11398 -0.02561 0.07498  204 PHE A CA  
1631 C C   . PHE A 227 ? 0.51665 0.53975 0.49699 -0.11654 -0.03000 0.09276  204 PHE A C   
1632 O O   . PHE A 227 ? 0.61834 0.64839 0.58601 -0.12400 -0.02324 0.10509  204 PHE A O   
1633 C CB  . PHE A 227 ? 0.45191 0.49396 0.43623 -0.11218 -0.01738 0.06239  204 PHE A CB  
1634 C CG  . PHE A 227 ? 0.45668 0.50172 0.42905 -0.10513 -0.02203 0.05488  204 PHE A CG  
1635 C CD1 . PHE A 227 ? 0.44837 0.49872 0.40060 -0.10561 -0.02492 0.06212  204 PHE A CD1 
1636 C CD2 . PHE A 227 ? 0.44132 0.48476 0.42293 -0.09825 -0.02357 0.04070  204 PHE A CD2 
1637 C CE1 . PHE A 227 ? 0.51461 0.56855 0.45951 -0.09961 -0.03011 0.05352  204 PHE A CE1 
1638 C CE2 . PHE A 227 ? 0.41935 0.46559 0.39396 -0.09299 -0.02723 0.03402  204 PHE A CE2 
1639 C CZ  . PHE A 227 ? 0.48343 0.53482 0.44146 -0.09381 -0.03097 0.03955  204 PHE A CZ  
1640 N N   . LYS A 228 ? 0.44851 0.46365 0.42778 -0.11000 -0.04121 0.09413  205 LYS A N   
1641 C CA  . LYS A 228 ? 0.59614 0.61010 0.55723 -0.11047 -0.04791 0.11041  205 LYS A CA  
1642 C C   . LYS A 228 ? 0.58187 0.60471 0.52921 -0.10303 -0.05378 0.10039  205 LYS A C   
1643 O O   . LYS A 228 ? 0.49683 0.51665 0.45842 -0.09634 -0.05839 0.08682  205 LYS A O   
1644 C CB  . LYS A 228 ? 0.62062 0.61470 0.59731 -0.10955 -0.05920 0.12482  205 LYS A CB  
1645 C CG  . LYS A 228 ? 0.66204 0.64639 0.64849 -0.11920 -0.05453 0.14183  205 LYS A CG  
1646 C CD  . LYS A 228 ? 0.75481 0.71682 0.76080 -0.11708 -0.06716 0.15448  205 LYS A CD  
1647 C CE  . LYS A 228 ? 0.89712 0.84834 0.90787 -0.12758 -0.06380 0.17793  205 LYS A CE  
1648 N NZ  . LYS A 228 ? 0.91016 0.87323 0.92194 -0.13775 -0.04783 0.17525  205 LYS A NZ  
1649 N N   . PRO A 229 ? 0.61061 0.64573 0.53143 -0.10417 -0.05341 0.10576  206 PRO A N   
1650 C CA  . PRO A 229 ? 0.51755 0.56188 0.42785 -0.09741 -0.06030 0.09447  206 PRO A CA  
1651 C C   . PRO A 229 ? 0.55217 0.58620 0.47115 -0.09084 -0.07609 0.09947  206 PRO A C   
1652 O O   . PRO A 229 ? 0.59645 0.61880 0.51688 -0.09159 -0.08327 0.11729  206 PRO A O   
1653 C CB  . PRO A 229 ? 0.49044 0.55096 0.36929 -0.10068 -0.05649 0.10019  206 PRO A CB  
1654 C CG  . PRO A 229 ? 0.55509 0.60959 0.42673 -0.10794 -0.05320 0.12362  206 PRO A CG  
1655 C CD  . PRO A 229 ? 0.59623 0.63879 0.49574 -0.11187 -0.04646 0.12209  206 PRO A CD  
1656 N N   . ARG A 230 ? 0.49614 0.53448 0.42348 -0.08428 -0.08165 0.08373  207 ARG A N   
1657 C CA  . ARG A 230 ? 0.52979 0.56099 0.47009 -0.07732 -0.09645 0.08553  207 ARG A CA  
1658 C C   . ARG A 230 ? 0.54610 0.59024 0.47307 -0.07273 -0.10621 0.07977  207 ARG A C   
1659 O O   . ARG A 230 ? 0.50896 0.55149 0.45085 -0.06621 -0.11803 0.07551  207 ARG A O   
1660 C CB  . ARG A 230 ? 0.49674 0.52085 0.46705 -0.07326 -0.09549 0.07227  207 ARG A CB  
1661 C CG  . ARG A 230 ? 0.57833 0.58791 0.56465 -0.07590 -0.09136 0.07864  207 ARG A CG  
1662 C CD  . ARG A 230 ? 0.51777 0.52226 0.53125 -0.07099 -0.09045 0.06466  207 ARG A CD  
1663 N NE  . ARG A 230 ? 0.55271 0.54457 0.58069 -0.07344 -0.08769 0.06884  207 ARG A NE  
1664 C CZ  . ARG A 230 ? 0.55423 0.54292 0.60199 -0.07043 -0.08428 0.05636  207 ARG A CZ  
1665 N NH1 . ARG A 230 ? 0.47575 0.47284 0.52997 -0.06525 -0.08180 0.04122  207 ARG A NH1 
1666 N NH2 . ARG A 230 ? 0.46578 0.44360 0.52735 -0.07270 -0.08333 0.05886  207 ARG A NH2 
1667 N N   . SER A 231 ? 0.50989 0.56829 0.41064 -0.07568 -0.10194 0.07812  208 SER A N   
1668 C CA  . SER A 231 ? 0.54088 0.61319 0.42740 -0.07133 -0.11231 0.07120  208 SER A CA  
1669 C C   . SER A 231 ? 0.53871 0.62492 0.39102 -0.07548 -0.10656 0.07580  208 SER A C   
1670 O O   . SER A 231 ? 0.51590 0.60240 0.36070 -0.08179 -0.09263 0.08036  208 SER A O   
1671 C CB  . SER A 231 ? 0.49362 0.57343 0.39755 -0.06857 -0.11118 0.04769  208 SER A CB  
1672 O OG  . SER A 231 ? 0.48399 0.57219 0.37891 -0.07291 -0.09756 0.03685  208 SER A OG  
1673 N N   . GLN A 232 ? 0.53416 0.63391 0.36623 -0.07154 -0.11752 0.07341  209 GLN A N   
1674 C CA  . GLN A 232 ? 0.54721 0.66350 0.34416 -0.07457 -0.11190 0.07579  209 GLN A CA  
1675 C C   . GLN A 232 ? 0.60759 0.73504 0.40601 -0.07759 -0.09763 0.05478  209 GLN A C   
1676 O O   . GLN A 232 ? 0.61791 0.75497 0.39665 -0.08239 -0.08525 0.05744  209 GLN A O   
1677 C CB  . GLN A 232 ? 0.55881 0.68906 0.33270 -0.06843 -0.12846 0.07544  209 GLN A CB  
1678 C CG  . GLN A 232 ? 0.61262 0.76258 0.34576 -0.07070 -0.12304 0.07830  209 GLN A CG  
1679 C CD  . GLN A 232 ? 0.71257 0.85693 0.42488 -0.07667 -0.11487 0.10711  209 GLN A CD  
1680 O OE1 . GLN A 232 ? 0.76148 0.89182 0.47435 -0.07538 -0.12445 0.12952  209 GLN A OE1 
1681 N NE2 . GLN A 232 ? 0.67907 0.83429 0.37582 -0.08335 -0.09693 0.10653  209 GLN A NE2 
1682 N N   . MET A 233 ? 0.55146 0.67769 0.37482 -0.07490 -0.09851 0.03440  210 MET A N   
1683 C CA  . MET A 233 ? 0.54089 0.67428 0.36911 -0.07722 -0.08561 0.01594  210 MET A CA  
1684 C C   . MET A 233 ? 0.52149 0.64693 0.35565 -0.08280 -0.06972 0.02332  210 MET A C   
1685 O O   . MET A 233 ? 0.49874 0.63464 0.32182 -0.08585 -0.05794 0.01742  210 MET A O   
1686 C CB  . MET A 233 ? 0.47329 0.60365 0.33015 -0.07399 -0.08925 -0.00359 210 MET A CB  
1687 C CG  . MET A 233 ? 0.46729 0.60150 0.33251 -0.07581 -0.07683 -0.02112 210 MET A CG  
1688 S SD  . MET A 233 ? 0.50370 0.63066 0.40530 -0.07363 -0.07846 -0.03906 210 MET A SD  
1689 C CE  . MET A 233 ? 0.49380 0.63306 0.39547 -0.06947 -0.09631 -0.05130 210 MET A CE  
1690 N N   . GLU A 234 ? 0.49480 0.60320 0.34743 -0.08381 -0.06975 0.03515  211 GLU A N   
1691 C CA  . GLU A 234 ? 0.48234 0.58384 0.34273 -0.08894 -0.05651 0.04118  211 GLU A CA  
1692 C C   . GLU A 234 ? 0.53209 0.63978 0.36974 -0.09473 -0.04993 0.05758  211 GLU A C   
1693 O O   . GLU A 234 ? 0.54378 0.65641 0.38126 -0.09954 -0.03650 0.05638  211 GLU A O   
1694 C CB  . GLU A 234 ? 0.44098 0.52407 0.32653 -0.08808 -0.05949 0.04788  211 GLU A CB  
1695 C CG  . GLU A 234 ? 0.46783 0.54645 0.37712 -0.08355 -0.06102 0.03186  211 GLU A CG  
1696 C CD  . GLU A 234 ? 0.53873 0.60281 0.47078 -0.08294 -0.05966 0.03528  211 GLU A CD  
1697 O OE1 . GLU A 234 ? 0.51116 0.56583 0.44496 -0.08439 -0.06329 0.04989  211 GLU A OE1 
1698 O OE2 . GLU A 234 ? 0.47301 0.53513 0.42116 -0.08088 -0.05499 0.02334  211 GLU A OE2 
1699 N N   . ILE A 235 ? 0.54727 0.65486 0.36697 -0.09444 -0.05906 0.07420  212 ILE A N   
1700 C CA  . ILE A 235 ? 0.57970 0.69524 0.37439 -0.10047 -0.05175 0.09161  212 ILE A CA  
1701 C C   . ILE A 235 ? 0.62090 0.75946 0.39496 -0.10159 -0.04147 0.07769  212 ILE A C   
1702 O O   . ILE A 235 ? 0.65187 0.79834 0.42237 -0.10760 -0.02655 0.07973  212 ILE A O   
1703 C CB  . ILE A 235 ? 0.63291 0.74552 0.40799 -0.09848 -0.06503 0.11205  212 ILE A CB  
1704 C CG1 . ILE A 235 ? 0.56601 0.65475 0.36504 -0.09713 -0.07477 0.12600  212 ILE A CG1 
1705 C CG2 . ILE A 235 ? 0.65738 0.78168 0.40080 -0.10489 -0.05622 0.13109  212 ILE A CG2 
1706 C CD1 . ILE A 235 ? 0.60434 0.68816 0.38564 -0.09421 -0.08939 0.14838  212 ILE A CD1 
1707 N N   . ASP A 236 ? 0.59504 0.74531 0.35910 -0.09551 -0.04951 0.06095  213 ASP A N   
1708 C CA  . ASP A 236 ? 0.58646 0.75902 0.33293 -0.09512 -0.04144 0.04374  213 ASP A CA  
1709 C C   . ASP A 236 ? 0.54793 0.72110 0.31518 -0.09725 -0.02732 0.02838  213 ASP A C   
1710 O O   . ASP A 236 ? 0.60424 0.79366 0.35990 -0.10008 -0.01450 0.02308  213 ASP A O   
1711 C CB  . ASP A 236 ? 0.56064 0.74244 0.30157 -0.08781 -0.05477 0.02490  213 ASP A CB  
1712 C CG  . ASP A 236 ? 0.65877 0.84599 0.37361 -0.08449 -0.06954 0.03789  213 ASP A CG  
1713 O OD1 . ASP A 236 ? 0.69851 0.88438 0.39408 -0.08812 -0.06751 0.06236  213 ASP A OD1 
1714 O OD2 . ASP A 236 ? 0.72100 0.91371 0.43596 -0.07818 -0.08387 0.02405  213 ASP A OD2 
1715 N N   . PHE A 237 ? 0.49104 0.64789 0.28881 -0.09534 -0.02951 0.02106  214 PHE A N   
1716 C CA  . PHE A 237 ? 0.53761 0.69374 0.35501 -0.09614 -0.01801 0.00783  214 PHE A CA  
1717 C C   . PHE A 237 ? 0.50858 0.66657 0.32642 -0.10277 -0.00474 0.01987  214 PHE A C   
1718 O O   . PHE A 237 ? 0.50661 0.67566 0.32785 -0.10393 0.00685  0.00931  214 PHE A O   
1719 C CB  . PHE A 237 ? 0.46165 0.59951 0.30846 -0.09306 -0.02284 0.00234  214 PHE A CB  
1720 C CG  . PHE A 237 ? 0.45511 0.59087 0.32073 -0.09297 -0.01253 -0.00871 214 PHE A CG  
1721 C CD1 . PHE A 237 ? 0.42218 0.56395 0.29410 -0.08915 -0.01060 -0.02862 214 PHE A CD1 
1722 C CD2 . PHE A 237 ? 0.44291 0.57085 0.32081 -0.09637 -0.00572 0.00053  214 PHE A CD2 
1723 C CE1 . PHE A 237 ? 0.41540 0.55436 0.30457 -0.08798 -0.00240 -0.03740 214 PHE A CE1 
1724 C CE2 . PHE A 237 ? 0.40853 0.53571 0.30284 -0.09513 0.00201  -0.00961 214 PHE A CE2 
1725 C CZ  . PHE A 237 ? 0.43149 0.56395 0.33059 -0.09066 0.00367  -0.02755 214 PHE A CZ  
1726 N N   . LEU A 238 ? 0.51850 0.66559 0.33652 -0.10710 -0.00667 0.04122  215 LEU A N   
1727 C CA  . LEU A 238 ? 0.55523 0.70337 0.37815 -0.11458 0.00542  0.05306  215 LEU A CA  
1728 C C   . LEU A 238 ? 0.56773 0.73713 0.36412 -0.11957 0.01576  0.05970  215 LEU A C   
1729 O O   . LEU A 238 ? 0.59455 0.77452 0.39640 -0.12469 0.02971  0.05853  215 LEU A O   
1730 C CB  . LEU A 238 ? 0.55095 0.67911 0.38598 -0.11789 -0.00049 0.07310  215 LEU A CB  
1731 C CG  . LEU A 238 ? 0.56058 0.67027 0.42444 -0.11366 -0.00712 0.06560  215 LEU A CG  
1732 C CD1 . LEU A 238 ? 0.51460 0.60575 0.39038 -0.11631 -0.01364 0.08380  215 LEU A CD1 
1733 C CD2 . LEU A 238 ? 0.49878 0.61131 0.38130 -0.11389 0.00250  0.05169  215 LEU A CD2 
1734 N N   . GLU A 239 ? 0.61456 0.79261 0.38225 -0.11777 0.00933  0.06566  216 GLU A N   
1735 C CA  . GLU A 239 ? 0.70244 0.90139 0.44035 -0.12270 0.01934  0.07574  216 GLU A CA  
1736 C C   . GLU A 239 ? 0.70957 0.93426 0.43172 -0.11895 0.02631  0.05289  216 GLU A C   
1737 O O   . GLU A 239 ? 0.76150 1.00711 0.46770 -0.12368 0.04069  0.05542  216 GLU A O   
1738 C CB  . GLU A 239 ? 0.81192 1.00807 0.52268 -0.12234 0.00836  0.09700  216 GLU A CB  
1739 C CG  . GLU A 239 ? 1.02180 1.19214 0.74813 -0.12582 0.00104  0.12125  216 GLU A CG  
1740 C CD  . GLU A 239 ? 1.19375 1.36053 0.89333 -0.12475 -0.01062 0.14469  216 GLU A CD  
1741 O OE1 . GLU A 239 ? 1.24091 1.42454 0.90983 -0.11963 -0.01640 0.13965  216 GLU A OE1 
1742 O OE2 . GLU A 239 ? 1.21030 1.35717 0.92032 -0.12848 -0.01499 0.16776  216 GLU A OE2 
1743 N N   . LEU A 240 ? 0.61345 0.83802 0.34091 -0.11079 0.01694  0.03029  217 LEU A N   
1744 C CA  . LEU A 240 ? 0.67242 0.92050 0.38591 -0.10639 0.02134  0.00682  217 LEU A CA  
1745 C C   . LEU A 240 ? 0.68478 0.93661 0.42385 -0.10576 0.03286  -0.01251 217 LEU A C   
1746 O O   . LEU A 240 ? 0.59867 0.83279 0.36689 -0.10661 0.03333  -0.01132 217 LEU A O   
1747 C CB  . LEU A 240 ? 0.56902 0.81579 0.27827 -0.09819 0.00481  -0.00953 217 LEU A CB  
1748 C CG  . LEU A 240 ? 0.59818 0.84599 0.28089 -0.09586 -0.01001 0.00316  217 LEU A CG  
1749 C CD1 . LEU A 240 ? 0.56561 0.81379 0.25407 -0.08785 -0.02549 -0.01936 217 LEU A CD1 
1750 C CD2 . LEU A 240 ? 0.65955 0.93198 0.30139 -0.09790 -0.00355 0.01229  217 LEU A CD2 
1751 N N   . ALA A 241 ? 0.63872 0.91490 0.36619 -0.10343 0.04163  -0.03105 218 ALA A N   
1752 C CA  . ALA A 241 ? 0.62553 0.90548 0.37827 -0.10010 0.04927  -0.05355 218 ALA A CA  
1753 C C   . ALA A 241 ? 0.68389 0.94916 0.45542 -0.09245 0.03627  -0.07277 218 ALA A C   
1754 O O   . ALA A 241 ? 0.65092 0.91358 0.41095 -0.08909 0.02331  -0.07613 218 ALA A O   
1755 C CB  . ALA A 241 ? 0.66228 0.97362 0.39915 -0.09904 0.06236  -0.06951 218 ALA A CB  
1756 N N   . MET A 242 ? 0.66073 0.91681 0.46255 -0.08982 0.03968  -0.08480 219 MET A N   
1757 C CA  . MET A 242 ? 0.61282 0.85147 0.43677 -0.08391 0.02904  -0.09887 219 MET A CA  
1758 C C   . MET A 242 ? 0.63944 0.88824 0.45285 -0.07862 0.02071  -0.11930 219 MET A C   
1759 O O   . MET A 242 ? 0.60498 0.84229 0.42093 -0.07682 0.00753  -0.12006 219 MET A O   
1760 C CB  . MET A 242 ? 0.60068 0.83377 0.45374 -0.08088 0.03581  -0.11040 219 MET A CB  
1761 C CG  . MET A 242 ? 0.58819 0.80444 0.46521 -0.07477 0.02714  -0.12559 219 MET A CG  
1762 S SD  . MET A 242 ? 0.54822 0.75507 0.45755 -0.07078 0.03396  -0.13264 219 MET A SD  
1763 C CE  . MET A 242 ? 0.50919 0.74272 0.41666 -0.06625 0.04330  -0.15764 219 MET A CE  
1764 N N   . ASP A 243 ? 0.59366 0.86576 0.39659 -0.07595 0.02806  -0.13753 220 ASP A N   
1765 C CA  . ASP A 243 ? 0.65742 0.94025 0.45334 -0.07023 0.01967  -0.16134 220 ASP A CA  
1766 C C   . ASP A 243 ? 0.68275 0.97189 0.44893 -0.07113 0.00848  -0.15254 220 ASP A C   
1767 O O   . ASP A 243 ? 0.72375 1.01034 0.49298 -0.06715 -0.00502 -0.16652 220 ASP A O   
1768 C CB  . ASP A 243 ? 0.82234 1.13166 0.61133 -0.06670 0.03061  -0.18343 220 ASP A CB  
1769 C CG  . ASP A 243 ? 0.93091 1.23324 0.75406 -0.06320 0.03785  -0.19736 220 ASP A CG  
1770 O OD1 . ASP A 243 ? 0.90472 1.18135 0.75603 -0.06194 0.03128  -0.19559 220 ASP A OD1 
1771 O OD2 . ASP A 243 ? 0.99734 1.32071 0.81911 -0.06136 0.05014  -0.20966 220 ASP A OD2 
1772 N N   . GLU A 244 ? 0.73402 1.03126 0.47284 -0.07630 0.01320  -0.12906 221 GLU A N   
1773 C CA  . GLU A 244 ? 0.76404 1.06635 0.47329 -0.07632 0.00136  -0.11769 221 GLU A CA  
1774 C C   . GLU A 244 ? 0.62376 0.90026 0.35057 -0.07616 -0.01376 -0.10702 221 GLU A C   
1775 O O   . GLU A 244 ? 0.62168 0.89967 0.34138 -0.07242 -0.02890 -0.11356 221 GLU A O   
1776 C CB  . GLU A 244 ? 0.91750 1.23129 0.59568 -0.08239 0.01058  -0.09128 221 GLU A CB  
1777 C CG  . GLU A 244 ? 1.07230 1.41364 0.73417 -0.08403 0.02874  -0.09835 221 GLU A CG  
1778 C CD  . GLU A 244 ? 1.22684 1.57599 0.86235 -0.09095 0.03849  -0.06830 221 GLU A CD  
1779 O OE1 . GLU A 244 ? 1.28816 1.65452 0.90149 -0.08801 0.04381  -0.06843 221 GLU A OE1 
1780 O OE2 . GLU A 244 ? 1.21666 1.54821 0.86159 -0.09792 0.04015  -0.04348 221 GLU A OE2 
1781 N N   . PHE A 245 ? 0.54739 0.80192 0.29781 -0.07990 -0.01002 -0.09153 222 PHE A N   
1782 C CA  . PHE A 245 ? 0.56001 0.79168 0.32887 -0.07948 -0.02260 -0.08247 222 PHE A CA  
1783 C C   . PHE A 245 ? 0.58272 0.80862 0.37494 -0.07459 -0.03186 -0.10583 222 PHE A C   
1784 O O   . PHE A 245 ? 0.55987 0.78136 0.35479 -0.07245 -0.04610 -0.10720 222 PHE A O   
1785 C CB  . PHE A 245 ? 0.49674 0.70836 0.28753 -0.08355 -0.01569 -0.06603 222 PHE A CB  
1786 C CG  . PHE A 245 ? 0.52473 0.71498 0.33527 -0.08266 -0.02680 -0.05840 222 PHE A CG  
1787 C CD1 . PHE A 245 ? 0.50360 0.68700 0.30403 -0.08419 -0.03493 -0.03787 222 PHE A CD1 
1788 C CD2 . PHE A 245 ? 0.46539 0.64314 0.30514 -0.07998 -0.02905 -0.07180 222 PHE A CD2 
1789 C CE1 . PHE A 245 ? 0.49387 0.65988 0.31431 -0.08262 -0.04480 -0.03281 222 PHE A CE1 
1790 C CE2 . PHE A 245 ? 0.46173 0.62301 0.31953 -0.07927 -0.03768 -0.06556 222 PHE A CE2 
1791 C CZ  . PHE A 245 ? 0.54134 0.69764 0.38997 -0.08034 -0.04550 -0.04710 222 PHE A CZ  
1792 N N   . ILE A 246 ? 0.57586 0.80085 0.38842 -0.07292 -0.02405 -0.12370 223 ILE A N   
1793 C CA  . ILE A 246 ? 0.54816 0.76436 0.38790 -0.06934 -0.03132 -0.14406 223 ILE A CA  
1794 C C   . ILE A 246 ? 0.59633 0.82862 0.42360 -0.06565 -0.04308 -0.16322 223 ILE A C   
1795 O O   . ILE A 246 ? 0.55906 0.78393 0.40296 -0.06429 -0.05540 -0.17113 223 ILE A O   
1796 C CB  . ILE A 246 ? 0.47390 0.68629 0.33607 -0.06761 -0.02063 -0.15812 223 ILE A CB  
1797 C CG1 . ILE A 246 ? 0.46038 0.65323 0.34050 -0.07025 -0.01383 -0.14030 223 ILE A CG1 
1798 C CG2 . ILE A 246 ? 0.46241 0.66979 0.34951 -0.06380 -0.02770 -0.18250 223 ILE A CG2 
1799 C CD1 . ILE A 246 ? 0.51075 0.70102 0.40904 -0.06812 -0.00320 -0.14908 223 ILE A CD1 
1800 N N   . GLU A 247 ? 0.63128 0.88758 0.42887 -0.06405 -0.03960 -0.17097 224 GLU A N   
1801 C CA  . GLU A 247 ? 0.62339 0.89814 0.40434 -0.05977 -0.05188 -0.18981 224 GLU A CA  
1802 C C   . GLU A 247 ? 0.71551 0.98845 0.48212 -0.05996 -0.06706 -0.17436 224 GLU A C   
1803 O O   . GLU A 247 ? 0.70225 0.97602 0.47934 -0.05697 -0.08216 -0.18873 224 GLU A O   
1804 C CB  . GLU A 247 ? 0.64540 0.94905 0.39228 -0.05774 -0.04374 -0.19923 224 GLU A CB  
1805 C CG  . GLU A 247 ? 0.79959 1.11622 0.53088 -0.05122 -0.05639 -0.21175 224 GLU A CG  
1806 C CD  . GLU A 247 ? 1.00278 1.34039 0.69559 -0.04879 -0.04903 -0.20407 224 GLU A CD  
1807 O OE1 . GLU A 247 ? 1.05572 1.40136 0.73989 -0.05158 -0.03187 -0.19680 224 GLU A OE1 
1808 O OE2 . GLU A 247 ? 1.06007 1.40646 0.73227 -0.04416 -0.06043 -0.20534 224 GLU A OE2 
1809 N N   . ARG A 248 ? 0.76501 1.03530 0.51038 -0.06334 -0.06392 -0.14534 225 ARG A N   
1810 C CA  . ARG A 248 ? 0.75759 1.02719 0.48704 -0.06234 -0.07905 -0.12940 225 ARG A CA  
1811 C C   . ARG A 248 ? 0.71171 0.96151 0.47585 -0.06179 -0.09112 -0.13015 225 ARG A C   
1812 O O   . ARG A 248 ? 0.68025 0.93464 0.44181 -0.05839 -0.10801 -0.13342 225 ARG A O   
1813 C CB  . ARG A 248 ? 0.76366 1.02947 0.47034 -0.06666 -0.07216 -0.09663 225 ARG A CB  
1814 C CG  . ARG A 248 ? 0.78599 1.04437 0.48363 -0.06533 -0.08803 -0.07623 225 ARG A CG  
1815 C CD  . ARG A 248 ? 0.77411 1.02797 0.44982 -0.06979 -0.08128 -0.04379 225 ARG A CD  
1816 N NE  . ARG A 248 ? 0.85704 1.13436 0.49229 -0.07073 -0.07289 -0.03979 225 ARG A NE  
1817 C CZ  . ARG A 248 ? 0.86669 1.14439 0.47874 -0.07554 -0.06504 -0.01171 225 ARG A CZ  
1818 N NH1 . ARG A 248 ? 0.94101 1.19544 0.56851 -0.07934 -0.06604 0.01285  225 ARG A NH1 
1819 N NH2 . ARG A 248 ? 0.83551 1.13698 0.41058 -0.07678 -0.05563 -0.00853 225 ARG A NH2 
1820 N N   . TYR A 249 ? 0.69055 0.91988 0.48721 -0.06483 -0.08278 -0.12704 226 TYR A N   
1821 C CA  . TYR A 249 ? 0.66115 0.87336 0.49102 -0.06484 -0.09137 -0.12707 226 TYR A CA  
1822 C C   . TYR A 249 ? 0.61096 0.82033 0.47244 -0.06391 -0.09241 -0.15300 226 TYR A C   
1823 O O   . TYR A 249 ? 0.56584 0.76068 0.45894 -0.06509 -0.09562 -0.15338 226 TYR A O   
1824 C CB  . TYR A 249 ? 0.58936 0.78085 0.43368 -0.06851 -0.08273 -0.10490 226 TYR A CB  
1825 C CG  . TYR A 249 ? 0.57825 0.76889 0.39958 -0.06927 -0.08659 -0.07947 226 TYR A CG  
1826 C CD1 . TYR A 249 ? 0.55005 0.74460 0.34748 -0.07236 -0.07565 -0.06418 226 TYR A CD1 
1827 C CD2 . TYR A 249 ? 0.59537 0.78225 0.42038 -0.06678 -0.10183 -0.07123 226 TYR A CD2 
1828 C CE1 . TYR A 249 ? 0.60733 0.79949 0.38537 -0.07362 -0.07932 -0.03974 226 TYR A CE1 
1829 C CE2 . TYR A 249 ? 0.55480 0.73912 0.36021 -0.06675 -0.10664 -0.04739 226 TYR A CE2 
1830 C CZ  . TYR A 249 ? 0.57149 0.75739 0.35334 -0.07048 -0.09524 -0.03107 226 TYR A CZ  
1831 O OH  . TYR A 249 ? 0.56370 0.74501 0.32819 -0.07114 -0.09974 -0.00589 226 TYR A OH  
1832 N N   . LYS A 250 ? 0.63925 0.86240 0.49408 -0.06190 -0.08927 -0.17468 227 LYS A N   
1833 C CA  . LYS A 250 ? 0.65915 0.88054 0.54418 -0.06062 -0.09257 -0.20165 227 LYS A CA  
1834 C C   . LYS A 250 ? 0.58051 0.77855 0.50177 -0.06365 -0.08282 -0.19768 227 LYS A C   
1835 O O   . LYS A 250 ? 0.55561 0.74242 0.50895 -0.06500 -0.08809 -0.20394 227 LYS A O   
1836 C CB  . LYS A 250 ? 0.68355 0.91139 0.57865 -0.05879 -0.11119 -0.21402 227 LYS A CB  
1837 C CG  . LYS A 250 ? 0.76821 1.01734 0.62459 -0.05508 -0.12332 -0.21115 227 LYS A CG  
1838 C CD  . LYS A 250 ? 0.87455 1.14493 0.70612 -0.05095 -0.12182 -0.23115 227 LYS A CD  
1839 C CE  . LYS A 250 ? 0.94942 1.22910 0.77828 -0.04491 -0.13770 -0.24399 227 LYS A CE  
1840 N NZ  . LYS A 250 ? 1.01692 1.31095 0.82937 -0.03948 -0.13351 -0.26156 227 LYS A NZ  
1841 N N   . LEU A 251 ? 0.56650 0.75830 0.48254 -0.06479 -0.06831 -0.18665 228 LEU A N   
1842 C CA  . LEU A 251 ? 0.49741 0.66804 0.44173 -0.06680 -0.05933 -0.17929 228 LEU A CA  
1843 C C   . LEU A 251 ? 0.55654 0.72431 0.51776 -0.06480 -0.05137 -0.19669 228 LEU A C   
1844 O O   . LEU A 251 ? 0.44858 0.60002 0.42872 -0.06547 -0.04303 -0.18930 228 LEU A O   
1845 C CB  . LEU A 251 ? 0.49209 0.65535 0.42375 -0.06904 -0.05077 -0.15342 228 LEU A CB  
1846 C CG  . LEU A 251 ? 0.53281 0.69005 0.46185 -0.07078 -0.05834 -0.13499 228 LEU A CG  
1847 C CD1 . LEU A 251 ? 0.52119 0.67327 0.43542 -0.07287 -0.05113 -0.11148 228 LEU A CD1 
1848 C CD2 . LEU A 251 ? 0.50564 0.64712 0.46813 -0.07181 -0.06027 -0.13597 228 LEU A CD2 
1849 N N   . GLU A 252 ? 0.53625 0.71952 0.49215 -0.06159 -0.05465 -0.22047 229 GLU A N   
1850 C CA  . GLU A 252 ? 0.53386 0.71331 0.51073 -0.05871 -0.04864 -0.23943 229 GLU A CA  
1851 C C   . GLU A 252 ? 0.53192 0.68771 0.54938 -0.06039 -0.04981 -0.24067 229 GLU A C   
1852 O O   . GLU A 252 ? 0.47741 0.62825 0.51086 -0.06294 -0.05910 -0.24316 229 GLU A O   
1853 C CB  . GLU A 252 ? 0.56158 0.76137 0.53117 -0.05463 -0.05496 -0.26892 229 GLU A CB  
1854 C CG  . GLU A 252 ? 0.71619 0.94225 0.64386 -0.05258 -0.05175 -0.26924 229 GLU A CG  
1855 C CD  . GLU A 252 ? 0.85347 1.09278 0.75253 -0.05369 -0.06308 -0.26102 229 GLU A CD  
1856 O OE1 . GLU A 252 ? 0.76573 0.99281 0.67757 -0.05629 -0.07238 -0.25095 229 GLU A OE1 
1857 O OE2 . GLU A 252 ? 0.93006 1.19315 0.79364 -0.05151 -0.06261 -0.26454 229 GLU A OE2 
1858 N N   . GLY A 253 ? 0.52897 0.67080 0.56377 -0.05896 -0.04027 -0.23808 230 GLY A N   
1859 C CA  . GLY A 253 ? 0.51366 0.63287 0.58546 -0.06037 -0.04023 -0.23786 230 GLY A CA  
1860 C C   . GLY A 253 ? 0.47971 0.58259 0.55731 -0.06423 -0.03653 -0.21172 230 GLY A C   
1861 O O   . GLY A 253 ? 0.50361 0.58804 0.61005 -0.06593 -0.03491 -0.20824 230 GLY A O   
1862 N N   . TYR A 254 ? 0.40232 0.51151 0.45425 -0.06570 -0.03503 -0.19343 231 TYR A N   
1863 C CA  . TYR A 254 ? 0.35538 0.45096 0.41127 -0.06827 -0.03092 -0.17046 231 TYR A CA  
1864 C C   . TYR A 254 ? 0.36994 0.46078 0.41607 -0.06622 -0.02097 -0.15670 231 TYR A C   
1865 O O   . TYR A 254 ? 0.39435 0.47689 0.43885 -0.06766 -0.01782 -0.13849 231 TYR A O   
1866 C CB  . TYR A 254 ? 0.38450 0.48767 0.42443 -0.07093 -0.03732 -0.15953 231 TYR A CB  
1867 C CG  . TYR A 254 ? 0.43630 0.54288 0.49152 -0.07287 -0.04803 -0.17114 231 TYR A CG  
1868 C CD1 . TYR A 254 ? 0.46547 0.55912 0.55106 -0.07595 -0.04813 -0.16880 231 TYR A CD1 
1869 C CD2 . TYR A 254 ? 0.49182 0.61623 0.53179 -0.07163 -0.05807 -0.18513 231 TYR A CD2 
1870 C CE1 . TYR A 254 ? 0.46739 0.56596 0.57207 -0.07836 -0.05836 -0.18128 231 TYR A CE1 
1871 C CE2 . TYR A 254 ? 0.51391 0.64321 0.56991 -0.07297 -0.06970 -0.19780 231 TYR A CE2 
1872 C CZ  . TYR A 254 ? 0.50705 0.62345 0.59723 -0.07658 -0.06986 -0.19638 231 TYR A CZ  
1873 O OH  . TYR A 254 ? 0.59112 0.71434 0.70058 -0.07840 -0.08166 -0.21009 231 TYR A OH  
1874 N N   . ALA A 255 ? 0.38824 0.48640 0.42815 -0.06257 -0.01643 -0.16636 232 ALA A N   
1875 C CA  . ALA A 255 ? 0.39606 0.49041 0.43334 -0.05988 -0.00771 -0.15681 232 ALA A CA  
1876 C C   . ALA A 255 ? 0.39828 0.49845 0.41324 -0.06228 -0.00467 -0.13850 232 ALA A C   
1877 O O   . ALA A 255 ? 0.44437 0.53728 0.46129 -0.06123 0.00056  -0.12628 232 ALA A O   
1878 C CB  . ALA A 255 ? 0.39668 0.46998 0.45831 -0.05816 -0.00484 -0.14975 232 ALA A CB  
1879 N N   . PHE A 256 ? 0.41983 0.53309 0.41380 -0.06521 -0.00855 -0.13649 233 PHE A N   
1880 C CA  . PHE A 256 ? 0.41722 0.53486 0.39232 -0.06786 -0.00568 -0.11916 233 PHE A CA  
1881 C C   . PHE A 256 ? 0.44629 0.57237 0.41515 -0.06662 0.00333  -0.11876 233 PHE A C   
1882 O O   . PHE A 256 ? 0.40353 0.52697 0.36870 -0.06831 0.00725  -0.10436 233 PHE A O   
1883 C CB  . PHE A 256 ? 0.40064 0.53047 0.35405 -0.07066 -0.01195 -0.11636 233 PHE A CB  
1884 C CG  . PHE A 256 ? 0.48270 0.60313 0.44050 -0.07257 -0.01975 -0.10582 233 PHE A CG  
1885 C CD1 . PHE A 256 ? 0.54075 0.64861 0.52222 -0.07197 -0.02267 -0.10967 233 PHE A CD1 
1886 C CD2 . PHE A 256 ? 0.53816 0.66212 0.47886 -0.07494 -0.02362 -0.09153 233 PHE A CD2 
1887 C CE1 . PHE A 256 ? 0.60375 0.70547 0.59201 -0.07352 -0.02882 -0.10128 233 PHE A CE1 
1888 C CE2 . PHE A 256 ? 0.48768 0.60363 0.43565 -0.07558 -0.03126 -0.08336 233 PHE A CE2 
1889 C CZ  . PHE A 256 ? 0.52702 0.63316 0.49886 -0.07479 -0.03348 -0.08902 233 PHE A CZ  
1890 N N   . GLU A 257 ? 0.41619 0.55325 0.38663 -0.06348 0.00652  -0.13592 234 GLU A N   
1891 C CA  . GLU A 257 ? 0.45378 0.60169 0.42199 -0.06193 0.01567  -0.13756 234 GLU A CA  
1892 C C   . GLU A 257 ? 0.52114 0.65509 0.50556 -0.05989 0.01870  -0.12762 234 GLU A C   
1893 O O   . GLU A 257 ? 0.53883 0.67834 0.51878 -0.06143 0.02404  -0.11827 234 GLU A O   
1894 C CB  . GLU A 257 ? 0.44317 0.60292 0.41766 -0.05708 0.01807  -0.16071 234 GLU A CB  
1895 C CG  . GLU A 257 ? 0.53910 0.71688 0.49446 -0.05808 0.01521  -0.17332 234 GLU A CG  
1896 C CD  . GLU A 257 ? 0.65366 0.82320 0.61838 -0.05696 0.00453  -0.18546 234 GLU A CD  
1897 O OE1 . GLU A 257 ? 0.57926 0.72905 0.55954 -0.05819 -0.00084 -0.17702 234 GLU A OE1 
1898 O OE2 . GLU A 257 ? 0.66012 0.84501 0.61693 -0.05495 0.00179  -0.20454 234 GLU A OE2 
1899 N N   . HIS A 258 ? 0.44619 0.56219 0.44948 -0.05674 0.01494  -0.12875 235 HIS A N   
1900 C CA  . HIS A 258 ? 0.37824 0.48017 0.39523 -0.05357 0.01649  -0.11925 235 HIS A CA  
1901 C C   . HIS A 258 ? 0.38676 0.47949 0.39761 -0.05721 0.01439  -0.10118 235 HIS A C   
1902 O O   . HIS A 258 ? 0.41456 0.50865 0.42154 -0.05758 0.01692  -0.09126 235 HIS A O   
1903 C CB  . HIS A 258 ? 0.35276 0.43982 0.39162 -0.04880 0.01401  -0.12760 235 HIS A CB  
1904 C CG  . HIS A 258 ? 0.42182 0.49311 0.47310 -0.04472 0.01473  -0.11660 235 HIS A CG  
1905 N ND1 . HIS A 258 ? 0.42798 0.50005 0.48815 -0.03836 0.01718  -0.11895 235 HIS A ND1 
1906 C CD2 . HIS A 258 ? 0.39556 0.45107 0.45162 -0.04543 0.01315  -0.10362 235 HIS A CD2 
1907 C CE1 . HIS A 258 ? 0.38428 0.44118 0.45165 -0.03506 0.01611  -0.10674 235 HIS A CE1 
1908 N NE2 . HIS A 258 ? 0.39776 0.44475 0.46196 -0.03950 0.01450  -0.09718 235 HIS A NE2 
1909 N N   . ILE A 259 ? 0.37123 0.45632 0.38264 -0.05990 0.00942  -0.09844 236 ILE A N   
1910 C CA  . ILE A 259 ? 0.36472 0.44002 0.37549 -0.06190 0.00756  -0.08378 236 ILE A CA  
1911 C C   . ILE A 259 ? 0.39770 0.48075 0.39263 -0.06558 0.00760  -0.07381 236 ILE A C   
1912 O O   . ILE A 259 ? 0.34948 0.42753 0.34472 -0.06541 0.00858  -0.06344 236 ILE A O   
1913 C CB  . ILE A 259 ? 0.32951 0.39829 0.34742 -0.06416 0.00244  -0.08508 236 ILE A CB  
1914 C CG1 . ILE A 259 ? 0.31853 0.37733 0.35630 -0.06182 0.00273  -0.09349 236 ILE A CG1 
1915 C CG2 . ILE A 259 ? 0.34593 0.40758 0.36375 -0.06569 0.00144  -0.07127 236 ILE A CG2 
1916 C CD1 . ILE A 259 ? 0.42133 0.47829 0.46931 -0.06507 -0.00267 -0.09985 236 ILE A CD1 
1917 N N   . VAL A 260 ? 0.37677 0.47149 0.35794 -0.06892 0.00590  -0.07641 237 VAL A N   
1918 C CA  . VAL A 260 ? 0.36422 0.46343 0.33158 -0.07312 0.00487  -0.06453 237 VAL A CA  
1919 C C   . VAL A 260 ? 0.37904 0.49033 0.33824 -0.07502 0.01151  -0.06296 237 VAL A C   
1920 O O   . VAL A 260 ? 0.40174 0.51111 0.36152 -0.07713 0.01338  -0.05266 237 VAL A O   
1921 C CB  . VAL A 260 ? 0.42838 0.53216 0.38431 -0.07565 -0.00210 -0.06421 237 VAL A CB  
1922 C CG1 . VAL A 260 ? 0.44953 0.55544 0.39201 -0.07969 -0.00386 -0.04924 237 VAL A CG1 
1923 C CG2 . VAL A 260 ? 0.38054 0.47384 0.34957 -0.07430 -0.00833 -0.06601 237 VAL A CG2 
1924 N N   . TYR A 261 ? 0.31754 0.44258 0.27111 -0.07444 0.01547  -0.07426 238 TYR A N   
1925 C CA  . TYR A 261 ? 0.35679 0.49681 0.30367 -0.07701 0.02349  -0.07307 238 TYR A CA  
1926 C C   . TYR A 261 ? 0.38997 0.52862 0.35347 -0.07379 0.02840  -0.07543 238 TYR A C   
1927 O O   . TYR A 261 ? 0.39461 0.54172 0.35863 -0.07696 0.03387  -0.06993 238 TYR A O   
1928 C CB  . TYR A 261 ? 0.40216 0.56035 0.33760 -0.07657 0.02706  -0.08640 238 TYR A CB  
1929 C CG  . TYR A 261 ? 0.43663 0.60107 0.35056 -0.07985 0.02218  -0.08257 238 TYR A CG  
1930 C CD1 . TYR A 261 ? 0.44555 0.62097 0.34046 -0.08565 0.02598  -0.06966 238 TYR A CD1 
1931 C CD2 . TYR A 261 ? 0.48899 0.64823 0.40266 -0.07727 0.01317  -0.09074 238 TYR A CD2 
1932 C CE1 . TYR A 261 ? 0.50765 0.68866 0.38068 -0.08772 0.02036  -0.06414 238 TYR A CE1 
1933 C CE2 . TYR A 261 ? 0.49733 0.66356 0.39109 -0.07925 0.00670  -0.08749 238 TYR A CE2 
1934 C CZ  . TYR A 261 ? 0.56002 0.73686 0.43201 -0.08395 0.00996  -0.07359 238 TYR A CZ  
1935 O OH  . TYR A 261 ? 0.50680 0.69031 0.35696 -0.08507 0.00261  -0.06818 238 TYR A OH  
1936 N N   . GLY A 262 ? 0.38007 0.50845 0.35838 -0.06759 0.02615  -0.08305 239 GLY A N   
1937 C CA  . GLY A 262 ? 0.35889 0.48597 0.35229 -0.06285 0.02891  -0.08541 239 GLY A CA  
1938 C C   . GLY A 262 ? 0.40745 0.54875 0.40762 -0.05908 0.03432  -0.10041 239 GLY A C   
1939 O O   . GLY A 262 ? 0.39280 0.55112 0.38262 -0.06226 0.03925  -0.10635 239 GLY A O   
1940 N N   . ASP A 263 ? 0.35797 0.49312 0.37532 -0.05169 0.03343  -0.10658 240 ASP A N   
1941 C CA  . ASP A 263 ? 0.37477 0.52192 0.40397 -0.04613 0.03753  -0.12229 240 ASP A CA  
1942 C C   . ASP A 263 ? 0.42666 0.57948 0.46825 -0.04306 0.03948  -0.11954 240 ASP A C   
1943 O O   . ASP A 263 ? 0.36628 0.50510 0.41711 -0.03799 0.03427  -0.11334 240 ASP A O   
1944 C CB  . ASP A 263 ? 0.40871 0.54190 0.45160 -0.03902 0.03297  -0.13229 240 ASP A CB  
1945 C CG  . ASP A 263 ? 0.51807 0.66173 0.57698 -0.03175 0.03596  -0.15033 240 ASP A CG  
1946 O OD1 . ASP A 263 ? 0.47315 0.63649 0.53454 -0.03134 0.04216  -0.15560 240 ASP A OD1 
1947 O OD2 . ASP A 263 ? 0.47701 0.60876 0.54897 -0.02636 0.03206  -0.15981 240 ASP A OD2 
1948 N N   . PHE A 264 ? 0.36639 0.54109 0.40825 -0.04611 0.04698  -0.12414 241 PHE A N   
1949 C CA  . PHE A 264 ? 0.39155 0.57558 0.44776 -0.04439 0.04889  -0.12291 241 PHE A CA  
1950 C C   . PHE A 264 ? 0.37180 0.56989 0.44695 -0.03648 0.05228  -0.13975 241 PHE A C   
1951 O O   . PHE A 264 ? 0.33538 0.54936 0.42396 -0.03600 0.05599  -0.14238 241 PHE A O   
1952 C CB  . PHE A 264 ? 0.36961 0.56833 0.41768 -0.05483 0.05539  -0.11400 241 PHE A CB  
1953 C CG  . PHE A 264 ? 0.41698 0.60074 0.45020 -0.06151 0.05086  -0.09769 241 PHE A CG  
1954 C CD1 . PHE A 264 ? 0.39999 0.57914 0.41389 -0.06610 0.05041  -0.09375 241 PHE A CD1 
1955 C CD2 . PHE A 264 ? 0.38767 0.56252 0.42735 -0.06213 0.04592  -0.08794 241 PHE A CD2 
1956 C CE1 . PHE A 264 ? 0.43648 0.60183 0.43968 -0.07096 0.04533  -0.07971 241 PHE A CE1 
1957 C CE2 . PHE A 264 ? 0.45303 0.61397 0.48130 -0.06725 0.04141  -0.07484 241 PHE A CE2 
1958 C CZ  . PHE A 264 ? 0.40951 0.56552 0.42063 -0.07151 0.04125  -0.07045 241 PHE A CZ  
1959 N N   . SER A 265 ? 0.34381 0.53648 0.42360 -0.02996 0.05052  -0.15228 242 SER A N   
1960 C CA  . SER A 265 ? 0.40514 0.61246 0.50440 -0.02188 0.05399  -0.17093 242 SER A CA  
1961 C C   . SER A 265 ? 0.39290 0.58755 0.51514 -0.01031 0.04609  -0.17245 242 SER A C   
1962 O O   . SER A 265 ? 0.36435 0.57262 0.50696 -0.00274 0.04804  -0.18654 242 SER A O   
1963 C CB  . SER A 265 ? 0.38594 0.59561 0.48193 -0.01976 0.05570  -0.18730 242 SER A CB  
1964 O OG  . SER A 265 ? 0.41366 0.59641 0.51283 -0.01563 0.04653  -0.18519 242 SER A OG  
1965 N N   . HIS A 266 ? 0.35040 0.52050 0.46994 -0.00814 0.03735  -0.15837 243 HIS A N   
1966 C CA  . HIS A 266 ? 0.36643 0.52286 0.50402 0.00340  0.02909  -0.15683 243 HIS A CA  
1967 C C   . HIS A 266 ? 0.36950 0.52296 0.50396 0.00339  0.02415  -0.14192 243 HIS A C   
1968 O O   . HIS A 266 ? 0.35921 0.51547 0.47829 -0.00577 0.02619  -0.13191 243 HIS A O   
1969 C CB  . HIS A 266 ? 0.46261 0.59160 0.60119 0.00765  0.02286  -0.15301 243 HIS A CB  
1970 C CG  . HIS A 266 ? 0.62742 0.75648 0.76903 0.00684  0.02585  -0.16821 243 HIS A CG  
1971 N ND1 . HIS A 266 ? 0.66222 0.80027 0.82419 0.01477  0.02707  -0.18794 243 HIS A ND1 
1972 C CD2 . HIS A 266 ? 0.68170 0.80370 0.81004 -0.00029 0.02683  -0.16827 243 HIS A CD2 
1973 C CE1 . HIS A 266 ? 0.67905 0.81596 0.83906 0.01234  0.02887  -0.20041 243 HIS A CE1 
1974 N NE2 . HIS A 266 ? 0.71253 0.83987 0.85222 0.00316  0.02833  -0.18854 243 HIS A NE2 
1975 N N   . SER A 267 ? 0.34553 0.49218 0.49538 0.01475  0.01641  -0.14099 244 SER A N   
1976 C CA  . SER A 267 ? 0.40254 0.54659 0.55029 0.01761  0.00940  -0.12910 244 SER A CA  
1977 C C   . SER A 267 ? 0.38278 0.51083 0.50769 0.01075  0.00779  -0.11275 244 SER A C   
1978 O O   . SER A 267 ? 0.34131 0.47590 0.45767 0.00510  0.00750  -0.10640 244 SER A O   
1979 C CB  . SER A 267 ? 0.39724 0.52972 0.56023 0.03233  -0.00030 -0.12814 244 SER A CB  
1980 O OG  . SER A 267 ? 0.64361 0.77802 0.80461 0.03660  -0.00799 -0.11938 244 SER A OG  
1981 N N   . GLN A 268 ? 0.30266 0.40977 0.42025 0.01134  0.00659  -0.10655 245 GLN A N   
1982 C CA  . GLN A 268 ? 0.31625 0.41048 0.41441 0.00469  0.00638  -0.09281 245 GLN A CA  
1983 C C   . GLN A 268 ? 0.33855 0.43826 0.42594 -0.00695 0.01336  -0.09595 245 GLN A C   
1984 O O   . GLN A 268 ? 0.33480 0.43326 0.42552 -0.00823 0.01648  -0.10459 245 GLN A O   
1985 C CB  . GLN A 268 ? 0.35594 0.42631 0.45252 0.00979  0.00264  -0.08298 245 GLN A CB  
1986 C CG  . GLN A 268 ? 0.42638 0.48729 0.50463 0.00197  0.00429  -0.07091 245 GLN A CG  
1987 C CD  . GLN A 268 ? 0.61413 0.65603 0.68766 0.00706  0.00100  -0.05669 245 GLN A CD  
1988 O OE1 . GLN A 268 ? 0.66718 0.70848 0.73689 0.01431  -0.00405 -0.04916 245 GLN A OE1 
1989 N NE2 . GLN A 268 ? 0.52051 0.54793 0.59429 0.00315  0.00393  -0.05281 245 GLN A NE2 
1990 N N   . LEU A 269 ? 0.30204 0.40713 0.37685 -0.01476 0.01469  -0.08909 246 LEU A N   
1991 C CA  . LEU A 269 ? 0.32057 0.42989 0.38332 -0.02525 0.01975  -0.08888 246 LEU A CA  
1992 C C   . LEU A 269 ? 0.34969 0.44253 0.40547 -0.02696 0.01887  -0.08537 246 LEU A C   
1993 O O   . LEU A 269 ? 0.35812 0.43590 0.41087 -0.02474 0.01542  -0.07569 246 LEU A O   
1994 C CB  . LEU A 269 ? 0.31785 0.43154 0.37200 -0.03166 0.01931  -0.08017 246 LEU A CB  
1995 C CG  . LEU A 269 ? 0.43657 0.55835 0.48034 -0.04248 0.02398  -0.07792 246 LEU A CG  
1996 C CD1 . LEU A 269 ? 0.38507 0.51336 0.43025 -0.04697 0.02315  -0.07213 246 LEU A CD1 
1997 C CD2 . LEU A 269 ? 0.41427 0.52258 0.44532 -0.04620 0.02241  -0.07144 246 LEU A CD2 
1998 N N   . GLY A 270 ? 0.33224 0.42956 0.38594 -0.03094 0.02215  -0.09384 247 GLY A N   
1999 C CA  . GLY A 270 ? 0.38874 0.47230 0.44111 -0.03224 0.02047  -0.09382 247 GLY A CA  
2000 C C   . GLY A 270 ? 0.38635 0.46926 0.42378 -0.04057 0.02027  -0.08641 247 GLY A C   
2001 O O   . GLY A 270 ? 0.37586 0.47194 0.40310 -0.04629 0.02273  -0.08742 247 GLY A O   
2002 N N   . GLY A 271 ? 0.37261 0.44046 0.40972 -0.04109 0.01753  -0.07827 248 GLY A N   
2003 C CA  . GLY A 271 ? 0.34226 0.40917 0.36903 -0.04786 0.01627  -0.07288 248 GLY A CA  
2004 C C   . GLY A 271 ? 0.34192 0.41438 0.35847 -0.05130 0.01618  -0.06383 248 GLY A C   
2005 O O   . GLY A 271 ? 0.35975 0.42944 0.37792 -0.04812 0.01561  -0.05778 248 GLY A O   
2006 N N   . LEU A 272 ? 0.35867 0.43885 0.36501 -0.05752 0.01598  -0.06308 249 LEU A N   
2007 C CA  . LEU A 272 ? 0.33698 0.42084 0.33570 -0.06195 0.01539  -0.05418 249 LEU A CA  
2008 C C   . LEU A 272 ? 0.40424 0.47663 0.40403 -0.06127 0.01188  -0.04555 249 LEU A C   
2009 O O   . LEU A 272 ? 0.34162 0.41239 0.34331 -0.05962 0.01127  -0.04098 249 LEU A O   
2010 C CB  . LEU A 272 ? 0.35384 0.44710 0.35602 -0.06144 0.01854  -0.05468 249 LEU A CB  
2011 C CG  . LEU A 272 ? 0.43156 0.53158 0.42807 -0.06831 0.01933  -0.04746 249 LEU A CG  
2012 C CD1 . LEU A 272 ? 0.38024 0.49129 0.36575 -0.07395 0.02259  -0.04860 249 LEU A CD1 
2013 C CD2 . LEU A 272 ? 0.38780 0.49531 0.39362 -0.06787 0.02143  -0.04795 249 LEU A CD2 
2014 N N   . HIS A 273 ? 0.32759 0.39380 0.32723 -0.06242 0.00941  -0.04485 250 HIS A N   
2015 C CA  . HIS A 273 ? 0.35606 0.41339 0.35894 -0.06126 0.00750  -0.03852 250 HIS A CA  
2016 C C   . HIS A 273 ? 0.34446 0.40217 0.34336 -0.06524 0.00340  -0.03358 250 HIS A C   
2017 O O   . HIS A 273 ? 0.36431 0.41666 0.36740 -0.06399 0.00203  -0.02976 250 HIS A O   
2018 C CB  . HIS A 273 ? 0.29303 0.34265 0.30457 -0.05915 0.00851  -0.04091 250 HIS A CB  
2019 C CG  . HIS A 273 ? 0.34260 0.38801 0.35986 -0.05405 0.01159  -0.04271 250 HIS A CG  
2020 N ND1 . HIS A 273 ? 0.37408 0.41693 0.39023 -0.04927 0.01269  -0.03729 250 HIS A ND1 
2021 C CD2 . HIS A 273 ? 0.35336 0.39684 0.37802 -0.05216 0.01273  -0.04982 250 HIS A CD2 
2022 C CE1 . HIS A 273 ? 0.38493 0.42376 0.40693 -0.04442 0.01407  -0.03917 250 HIS A CE1 
2023 N NE2 . HIS A 273 ? 0.36777 0.40614 0.39640 -0.04614 0.01433  -0.04693 250 HIS A NE2 
2024 N N   A LEU A 274 ? 0.31602 0.38044 0.30698 -0.06946 0.00155  -0.03316 251 LEU A N   
2025 N N   B LEU A 274 ? 0.32396 0.38835 0.31495 -0.06947 0.00150  -0.03322 251 LEU A N   
2026 C CA  A LEU A 274 ? 0.35818 0.42206 0.34522 -0.07260 -0.00378 -0.02718 251 LEU A CA  
2027 C CA  B LEU A 274 ? 0.35678 0.42050 0.34398 -0.07255 -0.00381 -0.02709 251 LEU A CA  
2028 C C   A LEU A 274 ? 0.38681 0.45334 0.36901 -0.07589 -0.00365 -0.02027 251 LEU A C   
2029 C C   B LEU A 274 ? 0.38388 0.45032 0.36625 -0.07582 -0.00360 -0.02031 251 LEU A C   
2030 O O   A LEU A 274 ? 0.38941 0.46396 0.36578 -0.07839 0.00027  -0.02120 251 LEU A O   
2031 O O   B LEU A 274 ? 0.39072 0.46512 0.36755 -0.07821 0.00042  -0.02140 251 LEU A O   
2032 C CB  A LEU A 274 ? 0.36787 0.43728 0.34806 -0.07478 -0.00731 -0.03077 251 LEU A CB  
2033 C CB  B LEU A 274 ? 0.37373 0.44262 0.35433 -0.07475 -0.00768 -0.03031 251 LEU A CB  
2034 C CG  A LEU A 274 ? 0.44322 0.51005 0.42846 -0.07440 -0.01372 -0.03178 251 LEU A CG  
2035 C CG  B LEU A 274 ? 0.42893 0.49426 0.41859 -0.07327 -0.01145 -0.03477 251 LEU A CG  
2036 C CD1 A LEU A 274 ? 0.43938 0.51468 0.41245 -0.07668 -0.01904 -0.03338 251 LEU A CD1 
2037 C CD1 B LEU A 274 ? 0.38671 0.44689 0.38309 -0.07270 -0.01633 -0.02828 251 LEU A CD1 
2038 C CD2 A LEU A 274 ? 0.38846 0.44882 0.38094 -0.07346 -0.01742 -0.02451 251 LEU A CD2 
2039 C CD2 B LEU A 274 ? 0.40886 0.46933 0.40955 -0.07044 -0.00624 -0.04048 251 LEU A CD2 
2040 N N   . LEU A 275 ? 0.34149 0.40183 0.32816 -0.07618 -0.00765 -0.01384 252 LEU A N   
2041 C CA  . LEU A 275 ? 0.35896 0.41949 0.34612 -0.07978 -0.00757 -0.00739 252 LEU A CA  
2042 C C   . LEU A 275 ? 0.36230 0.42987 0.33798 -0.08561 -0.00654 -0.00150 252 LEU A C   
2043 O O   . LEU A 275 ? 0.38187 0.45499 0.35734 -0.08959 -0.00178 0.00111  252 LEU A O   
2044 C CB  . LEU A 275 ? 0.36538 0.41691 0.36117 -0.07891 -0.01348 -0.00250 252 LEU A CB  
2045 C CG  . LEU A 275 ? 0.42044 0.47010 0.42159 -0.08306 -0.01381 0.00332  252 LEU A CG  
2046 C CD1 . LEU A 275 ? 0.43838 0.49258 0.44559 -0.08200 -0.00900 -0.00301 252 LEU A CD1 
2047 C CD2 . LEU A 275 ? 0.37994 0.41943 0.39197 -0.08193 -0.02084 0.00715  252 LEU A CD2 
2048 N N   . ILE A 276 ? 0.36199 0.43124 0.32789 -0.08620 -0.01068 0.00042  253 ILE A N   
2049 C CA  . ILE A 276 ? 0.39747 0.47472 0.34834 -0.09128 -0.00975 0.00754  253 ILE A CA  
2050 C C   . ILE A 276 ? 0.42588 0.51631 0.37038 -0.09300 -0.00065 0.00086  253 ILE A C   
2051 O O   . ILE A 276 ? 0.40137 0.50019 0.33731 -0.09833 0.00423  0.00756  253 ILE A O   
2052 C CB  . ILE A 276 ? 0.40197 0.48078 0.34145 -0.09027 -0.01749 0.00935  253 ILE A CB  
2053 C CG1 . ILE A 276 ? 0.42237 0.50911 0.34282 -0.09528 -0.01708 0.02033  253 ILE A CG1 
2054 C CG2 . ILE A 276 ? 0.36046 0.44536 0.29844 -0.08662 -0.01756 -0.00479 253 ILE A CG2 
2055 C CD1 . ILE A 276 ? 0.44442 0.53227 0.35225 -0.09354 -0.02748 0.02477  253 ILE A CD1 
2056 N N   . GLY A 277 ? 0.39238 0.48519 0.34225 -0.08854 0.00223  -0.01197 254 GLY A N   
2057 C CA  . GLY A 277 ? 0.39115 0.49660 0.33874 -0.08886 0.01039  -0.02008 254 GLY A CA  
2058 C C   . GLY A 277 ? 0.38455 0.49255 0.34267 -0.09069 0.01615  -0.01812 254 GLY A C   
2059 O O   . GLY A 277 ? 0.37002 0.49140 0.32567 -0.09397 0.02352  -0.01949 254 GLY A O   
2060 N N   . LEU A 278 ? 0.36863 0.46581 0.33946 -0.08846 0.01291  -0.01605 255 LEU A N   
2061 C CA  . LEU A 278 ? 0.41151 0.51133 0.39367 -0.09068 0.01605  -0.01422 255 LEU A CA  
2062 C C   . LEU A 278 ? 0.38382 0.48639 0.36353 -0.09913 0.01782  -0.00241 255 LEU A C   
2063 O O   . LEU A 278 ? 0.38339 0.49600 0.36946 -0.10378 0.02424  -0.00162 255 LEU A O   
2064 C CB  . LEU A 278 ? 0.36070 0.44931 0.35468 -0.08615 0.01090  -0.01524 255 LEU A CB  
2065 C CG  . LEU A 278 ? 0.41191 0.49825 0.41025 -0.07805 0.01055  -0.02425 255 LEU A CG  
2066 C CD1 . LEU A 278 ? 0.36898 0.44794 0.36149 -0.07464 0.00796  -0.02561 255 LEU A CD1 
2067 C CD2 . LEU A 278 ? 0.44591 0.52692 0.45399 -0.07447 0.00698  -0.02490 255 LEU A CD2 
2068 N N   . ALA A 279 ? 0.39301 0.48670 0.36547 -0.10131 0.01211  0.00761  256 ALA A N   
2069 C CA  . ALA A 279 ? 0.42516 0.51874 0.39538 -0.10937 0.01325  0.02183  256 ALA A CA  
2070 C C   . ALA A 279 ? 0.45178 0.56204 0.40724 -0.11464 0.02209  0.02476  256 ALA A C   
2071 O O   . ALA A 279 ? 0.48719 0.60426 0.44670 -0.12218 0.02897  0.03272  256 ALA A O   
2072 C CB  . ALA A 279 ? 0.43500 0.51527 0.40020 -0.10895 0.00386  0.03210  256 ALA A CB  
2073 N N   . LYS A 280 ? 0.45215 0.57056 0.39168 -0.11094 0.02260  0.01736  257 LYS A N   
2074 C CA  . LYS A 280 ? 0.50591 0.64300 0.42925 -0.11489 0.03139  0.01764  257 LYS A CA  
2075 C C   . LYS A 280 ? 0.49245 0.64403 0.42808 -0.11666 0.04236  0.00924  257 LYS A C   
2076 O O   . LYS A 280 ? 0.51175 0.67658 0.44469 -0.12403 0.05181  0.01636  257 LYS A O   
2077 C CB  . LYS A 280 ? 0.45689 0.60038 0.36355 -0.10940 0.02840  0.00702  257 LYS A CB  
2078 C CG  . LYS A 280 ? 0.53930 0.70383 0.42433 -0.11268 0.03641  0.00672  257 LYS A CG  
2079 C CD  . LYS A 280 ? 0.54667 0.71757 0.41655 -0.10670 0.03136  -0.00647 257 LYS A CD  
2080 C CE  . LYS A 280 ? 0.58377 0.77893 0.43044 -0.10864 0.03967  -0.01055 257 LYS A CE  
2081 N NZ  . LYS A 280 ? 0.54281 0.74316 0.36319 -0.11372 0.03836  0.00793  257 LYS A NZ  
2082 N N   . ARG A 281 ? 0.47896 0.62885 0.42910 -0.10988 0.04132  -0.00520 258 ARG A N   
2083 C CA  . ARG A 281 ? 0.44747 0.61049 0.41317 -0.10981 0.04944  -0.01424 258 ARG A CA  
2084 C C   . ARG A 281 ? 0.48086 0.64399 0.46224 -0.11727 0.05241  -0.00453 258 ARG A C   
2085 O O   . ARG A 281 ? 0.50158 0.68163 0.48944 -0.12310 0.06256  -0.00423 258 ARG A O   
2086 C CB  . ARG A 281 ? 0.49721 0.65313 0.47618 -0.10029 0.04452  -0.02763 258 ARG A CB  
2087 C CG  . ARG A 281 ? 0.51887 0.68634 0.51684 -0.09817 0.04967  -0.03706 258 ARG A CG  
2088 C CD  . ARG A 281 ? 0.55341 0.73781 0.54859 -0.09498 0.05682  -0.04984 258 ARG A CD  
2089 N NE  . ARG A 281 ? 0.50218 0.69959 0.51743 -0.09166 0.06134  -0.06038 258 ARG A NE  
2090 C CZ  . ARG A 281 ? 0.52832 0.74478 0.54558 -0.08970 0.06946  -0.07229 258 ARG A CZ  
2091 N NH1 . ARG A 281 ? 0.53590 0.75985 0.53411 -0.09107 0.07362  -0.07488 258 ARG A NH1 
2092 N NH2 . ARG A 281 ? 0.45774 0.68727 0.49613 -0.08590 0.07296  -0.08263 258 ARG A NH2 
2093 N N   . PHE A 282 ? 0.38835 0.53351 0.37843 -0.11725 0.04381  0.00223  259 PHE A N   
2094 C CA  . PHE A 282 ? 0.43354 0.57645 0.44330 -0.12355 0.04447  0.00850  259 PHE A CA  
2095 C C   . PHE A 282 ? 0.56437 0.71423 0.57063 -0.13527 0.05238  0.02391  259 PHE A C   
2096 O O   . PHE A 282 ? 0.58380 0.74003 0.60937 -0.14243 0.05773  0.02674  259 PHE A O   
2097 C CB  . PHE A 282 ? 0.49469 0.61684 0.51235 -0.12051 0.03307  0.01146  259 PHE A CB  
2098 C CG  . PHE A 282 ? 0.60586 0.72534 0.64806 -0.12449 0.03145  0.01169  259 PHE A CG  
2099 C CD1 . PHE A 282 ? 0.61084 0.73602 0.66921 -0.11903 0.02979  -0.00203 259 PHE A CD1 
2100 C CD2 . PHE A 282 ? 0.62766 0.73849 0.67802 -0.13321 0.03042  0.02524  259 PHE A CD2 
2101 C CE1 . PHE A 282 ? 0.68119 0.80559 0.76359 -0.12228 0.02679  -0.00437 259 PHE A CE1 
2102 C CE2 . PHE A 282 ? 0.73744 0.84548 0.81441 -0.13721 0.02808  0.02327  259 PHE A CE2 
2103 C CZ  . PHE A 282 ? 0.68545 0.80129 0.77834 -0.13174 0.02607  0.00739  259 PHE A CZ  
2104 N N   . LYS A 283 ? 0.59139 0.74079 0.57385 -0.13755 0.05310  0.03451  260 LYS A N   
2105 C CA  . LYS A 283 ? 0.68594 0.84183 0.66155 -0.14864 0.06114  0.05223  260 LYS A CA  
2106 C C   . LYS A 283 ? 0.68159 0.86406 0.65652 -0.15362 0.07660  0.04790  260 LYS A C   
2107 O O   . LYS A 283 ? 0.66178 0.85222 0.64165 -0.16450 0.08615  0.06132  260 LYS A O   
2108 C CB  . LYS A 283 ? 0.75807 0.90714 0.70562 -0.14837 0.05614  0.06535  260 LYS A CB  
2109 C CG  . LYS A 283 ? 0.90714 1.03078 0.86088 -0.14695 0.04268  0.07566  260 LYS A CG  
2110 C CD  . LYS A 283 ? 0.96976 1.08615 0.89830 -0.14377 0.03426  0.08560  260 LYS A CD  
2111 C CE  . LYS A 283 ? 0.94360 1.03627 0.88399 -0.13865 0.01969  0.08796  260 LYS A CE  
2112 N NZ  . LYS A 283 ? 0.92672 1.01199 0.84750 -0.13541 0.00981  0.09848  260 LYS A NZ  
2113 N N   . GLU A 284 ? 0.71692 0.91341 0.68821 -0.14604 0.07972  0.02942  261 GLU A N   
2114 C CA  . GLU A 284 ? 0.75093 0.97468 0.72439 -0.14908 0.09437  0.02174  261 GLU A CA  
2115 C C   . GLU A 284 ? 0.69011 0.92233 0.69444 -0.14655 0.09675  0.00681  261 GLU A C   
2116 O O   . GLU A 284 ? 0.65502 0.90985 0.67064 -0.15185 0.10954  0.00354  261 GLU A O   
2117 C CB  . GLU A 284 ? 0.86987 1.10642 0.81959 -0.14176 0.09656  0.00921  261 GLU A CB  
2118 C CG  . GLU A 284 ? 1.00617 1.22404 0.93732 -0.13464 0.08302  0.00944  261 GLU A CG  
2119 C CD  . GLU A 284 ? 1.11761 1.34817 1.02758 -0.12803 0.08409  -0.00435 261 GLU A CD  
2120 O OE1 . GLU A 284 ? 1.19078 1.44575 1.09560 -0.12951 0.09632  -0.01208 261 GLU A OE1 
2121 O OE2 . GLU A 284 ? 1.08450 1.30173 0.98494 -0.12141 0.07284  -0.00871 261 GLU A OE2 
2122 N N   . SER A 285 ? 0.62470 0.84079 0.64313 -0.13864 0.08488  -0.00169 262 SER A N   
2123 C CA  . SER A 285 ? 0.55242 0.77705 0.59467 -0.13246 0.08448  -0.01823 262 SER A CA  
2124 C C   . SER A 285 ? 0.48266 0.68704 0.53892 -0.12692 0.07091  -0.02039 262 SER A C   
2125 O O   . SER A 285 ? 0.55478 0.74255 0.59859 -0.11934 0.06157  -0.02178 262 SER A O   
2126 C CB  . SER A 285 ? 0.56540 0.79955 0.59784 -0.12237 0.08596  -0.03431 262 SER A CB  
2127 O OG  . SER A 285 ? 0.57890 0.82655 0.63413 -0.11679 0.08806  -0.04955 262 SER A OG  
2128 N N   . PRO A 286 ? 0.48447 0.69131 0.56676 -0.13021 0.06960  -0.02192 263 PRO A N   
2129 C CA  . PRO A 286 ? 0.50134 0.69045 0.59452 -0.12506 0.05648  -0.02433 263 PRO A CA  
2130 C C   . PRO A 286 ? 0.51478 0.70273 0.60985 -0.11145 0.04912  -0.03905 263 PRO A C   
2131 O O   . PRO A 286 ? 0.47574 0.67854 0.57501 -0.10638 0.05353  -0.04957 263 PRO A O   
2132 C CB  . PRO A 286 ? 0.57353 0.77051 0.69616 -0.13353 0.05830  -0.02372 263 PRO A CB  
2133 C CG  . PRO A 286 ? 0.55438 0.77834 0.68730 -0.13688 0.07114  -0.03005 263 PRO A CG  
2134 C CD  . PRO A 286 ? 0.55623 0.78455 0.66107 -0.13902 0.08033  -0.02285 263 PRO A CD  
2135 N N   . PHE A 287 ? 0.43263 0.60278 0.52530 -0.10519 0.03784  -0.03937 264 PHE A N   
2136 C CA  . PHE A 287 ? 0.40546 0.57302 0.49891 -0.09254 0.03056  -0.05021 264 PHE A CA  
2137 C C   . PHE A 287 ? 0.43345 0.58802 0.53204 -0.08876 0.01964  -0.05074 264 PHE A C   
2138 O O   . PHE A 287 ? 0.42055 0.56518 0.52033 -0.09493 0.01720  -0.04350 264 PHE A O   
2139 C CB  . PHE A 287 ? 0.40397 0.56385 0.47668 -0.08559 0.03065  -0.05084 264 PHE A CB  
2140 C CG  . PHE A 287 ? 0.42217 0.56638 0.47681 -0.08862 0.02868  -0.04073 264 PHE A CG  
2141 C CD1 . PHE A 287 ? 0.40512 0.53327 0.45637 -0.08442 0.02019  -0.03828 264 PHE A CD1 
2142 C CD2 . PHE A 287 ? 0.47026 0.61778 0.51148 -0.09518 0.03511  -0.03424 264 PHE A CD2 
2143 C CE1 . PHE A 287 ? 0.47353 0.58879 0.51166 -0.08668 0.01791  -0.02998 264 PHE A CE1 
2144 C CE2 . PHE A 287 ? 0.53282 0.66693 0.55871 -0.09711 0.03159  -0.02521 264 PHE A CE2 
2145 C CZ  . PHE A 287 ? 0.52776 0.64565 0.55381 -0.09284 0.02292  -0.02335 264 PHE A CZ  
2146 N N   A GLU A 288 ? 0.38324 0.53780 0.48375 -0.07773 0.01284  -0.05939 265 GLU A N   
2147 N N   B GLU A 288 ? 0.39043 0.54579 0.49232 -0.07790 0.01277  -0.05976 265 GLU A N   
2148 C CA  A GLU A 288 ? 0.39895 0.54595 0.50308 -0.07207 0.00247  -0.06287 265 GLU A CA  
2149 C CA  B GLU A 288 ? 0.40313 0.55002 0.50755 -0.07218 0.00231  -0.06286 265 GLU A CA  
2150 C C   A GLU A 288 ? 0.41039 0.54188 0.49365 -0.06420 -0.00133 -0.05947 265 GLU A C   
2151 C C   B GLU A 288 ? 0.40230 0.53368 0.48546 -0.06455 -0.00111 -0.05921 265 GLU A C   
2152 O O   A GLU A 288 ? 0.37166 0.50198 0.44500 -0.05770 0.00040  -0.06004 265 GLU A O   
2153 O O   B GLU A 288 ? 0.37951 0.50969 0.45247 -0.05858 0.00108  -0.05946 265 GLU A O   
2154 C CB  A GLU A 288 ? 0.44596 0.60626 0.56545 -0.06448 -0.00299 -0.07417 265 GLU A CB  
2155 C CB  B GLU A 288 ? 0.45255 0.61182 0.57201 -0.06425 -0.00399 -0.07425 265 GLU A CB  
2156 C CG  A GLU A 288 ? 0.54943 0.70639 0.67283 -0.05837 -0.01432 -0.07996 265 GLU A CG  
2157 C CG  B GLU A 288 ? 0.52472 0.67715 0.64050 -0.05526 -0.01559 -0.07887 265 GLU A CG  
2158 C CD  A GLU A 288 ? 0.57568 0.73967 0.72310 -0.06692 -0.01678 -0.08448 265 GLU A CD  
2159 C CD  B GLU A 288 ? 0.55212 0.71575 0.67475 -0.04384 -0.02330 -0.08859 265 GLU A CD  
2160 O OE1 A GLU A 288 ? 0.58586 0.76415 0.75251 -0.07425 -0.01091 -0.08641 265 GLU A OE1 
2161 O OE1 B GLU A 288 ? 0.61068 0.78290 0.73726 -0.04031 -0.02000 -0.09065 265 GLU A OE1 
2162 O OE2 A GLU A 288 ? 0.58728 0.74285 0.73575 -0.06650 -0.02402 -0.08655 265 GLU A OE2 
2163 O OE2 B GLU A 288 ? 0.57114 0.73553 0.69501 -0.03750 -0.03337 -0.09478 265 GLU A OE2 
2164 N N   . LEU A 289 ? 0.36894 0.48891 0.44816 -0.06492 -0.00617 -0.05648 266 LEU A N   
2165 C CA  . LEU A 289 ? 0.38952 0.49714 0.45199 -0.05772 -0.00926 -0.05404 266 LEU A CA  
2166 C C   . LEU A 289 ? 0.45825 0.56594 0.52339 -0.05046 -0.01779 -0.06095 266 LEU A C   
2167 O O   . LEU A 289 ? 0.47183 0.57797 0.54698 -0.05410 -0.02194 -0.06381 266 LEU A O   
2168 C CB  . LEU A 289 ? 0.45196 0.54785 0.50669 -0.06351 -0.00743 -0.04585 266 LEU A CB  
2169 C CG  . LEU A 289 ? 0.47059 0.56397 0.51575 -0.06891 -0.00101 -0.03845 266 LEU A CG  
2170 C CD1 . LEU A 289 ? 0.45713 0.53871 0.49670 -0.07190 -0.00311 -0.03169 266 LEU A CD1 
2171 C CD2 . LEU A 289 ? 0.44848 0.54221 0.48355 -0.06272 0.00186  -0.04014 266 LEU A CD2 
2172 N N   . GLU A 290 ? 0.36666 0.47615 0.42301 -0.03992 -0.02089 -0.06381 267 GLU A N   
2173 C CA  . GLU A 290 ? 0.33820 0.44932 0.39170 -0.03183 -0.02900 -0.07017 267 GLU A CA  
2174 C C   . GLU A 290 ? 0.36441 0.46456 0.40079 -0.02832 -0.02755 -0.06507 267 GLU A C   
2175 O O   . GLU A 290 ? 0.30388 0.39882 0.32677 -0.02408 -0.02352 -0.05848 267 GLU A O   
2176 C CB  . GLU A 290 ? 0.35564 0.47594 0.40754 -0.02154 -0.03406 -0.07477 267 GLU A CB  
2177 C CG  . GLU A 290 ? 0.50474 0.62933 0.55107 -0.01272 -0.04326 -0.08204 267 GLU A CG  
2178 C CD  . GLU A 290 ? 0.66147 0.79445 0.70225 -0.00085 -0.04969 -0.08442 267 GLU A CD  
2179 O OE1 . GLU A 290 ? 0.74248 0.87659 0.76744 0.00881  -0.05530 -0.08565 267 GLU A OE1 
2180 O OE2 . GLU A 290 ? 0.60290 0.74197 0.65468 -0.00069 -0.04908 -0.08491 267 GLU A OE2 
2181 N N   . ASP A 291 ? 0.33965 0.43664 0.37964 -0.03037 -0.03062 -0.06872 268 ASP A N   
2182 C CA  . ASP A 291 ? 0.31442 0.40410 0.34248 -0.02706 -0.02934 -0.06655 268 ASP A CA  
2183 C C   . ASP A 291 ? 0.39840 0.49469 0.41456 -0.01569 -0.03402 -0.07265 268 ASP A C   
2184 O O   . ASP A 291 ? 0.38662 0.48741 0.40670 -0.01265 -0.04019 -0.08292 268 ASP A O   
2185 C CB  . ASP A 291 ? 0.33250 0.41681 0.37319 -0.03344 -0.03153 -0.06944 268 ASP A CB  
2186 C CG  . ASP A 291 ? 0.38357 0.46076 0.41616 -0.03123 -0.02913 -0.06706 268 ASP A CG  
2187 O OD1 . ASP A 291 ? 0.37156 0.44918 0.38872 -0.02523 -0.02507 -0.06355 268 ASP A OD1 
2188 O OD2 . ASP A 291 ? 0.40442 0.47555 0.44845 -0.03575 -0.03127 -0.06838 268 ASP A OD2 
2189 N N   . PHE A 292 ? 0.32859 0.42552 0.32970 -0.00888 -0.03140 -0.06629 269 PHE A N   
2190 C CA  . PHE A 292 ? 0.34583 0.45104 0.33371 0.00257  -0.03690 -0.07054 269 PHE A CA  
2191 C C   . PHE A 292 ? 0.36128 0.46590 0.33277 0.00790  -0.03396 -0.06971 269 PHE A C   
2192 O O   . PHE A 292 ? 0.34083 0.45442 0.29905 0.01751  -0.03868 -0.07457 269 PHE A O   
2193 C CB  . PHE A 292 ? 0.33272 0.43912 0.31241 0.00902  -0.03702 -0.06335 269 PHE A CB  
2194 C CG  . PHE A 292 ? 0.35129 0.44622 0.32320 0.00723  -0.02770 -0.04979 269 PHE A CG  
2195 C CD1 . PHE A 292 ? 0.36432 0.45376 0.34777 -0.00011 -0.02333 -0.04642 269 PHE A CD1 
2196 C CD2 . PHE A 292 ? 0.36520 0.45605 0.31917 0.01280  -0.02312 -0.04110 269 PHE A CD2 
2197 C CE1 . PHE A 292 ? 0.36173 0.44095 0.34082 -0.00161 -0.01604 -0.03654 269 PHE A CE1 
2198 C CE2 . PHE A 292 ? 0.39280 0.47270 0.34403 0.01027  -0.01483 -0.02931 269 PHE A CE2 
2199 C CZ  . PHE A 292 ? 0.41738 0.49102 0.38209 0.00323  -0.01205 -0.02795 269 PHE A CZ  
2200 N N   . ILE A 293 ? 0.29692 0.39346 0.26951 0.00234  -0.02674 -0.06491 270 ILE A N   
2201 C CA  . ILE A 293 ? 0.35718 0.45598 0.32065 0.00622  -0.02373 -0.06767 270 ILE A CA  
2202 C C   . ILE A 293 ? 0.35300 0.44753 0.33427 -0.00076 -0.02507 -0.07462 270 ILE A C   
2203 O O   . ILE A 293 ? 0.38753 0.47381 0.37402 -0.00693 -0.01936 -0.06759 270 ILE A O   
2204 C CB  . ILE A 293 ? 0.42259 0.51638 0.37321 0.00688  -0.01317 -0.05454 270 ILE A CB  
2205 C CG1 . ILE A 293 ? 0.46372 0.55703 0.40035 0.01240  -0.01174 -0.04418 270 ILE A CG1 
2206 C CG2 . ILE A 293 ? 0.44270 0.54314 0.38360 0.01182  -0.00881 -0.05832 270 ILE A CG2 
2207 C CD1 . ILE A 293 ? 0.53348 0.61828 0.46432 0.01015  -0.00081 -0.02963 270 ILE A CD1 
2208 N N   . PRO A 294 ? 0.38021 0.47939 0.37300 -0.00003 -0.03340 -0.08812 271 PRO A N   
2209 C CA  . PRO A 294 ? 0.35619 0.44819 0.36976 -0.00736 -0.03587 -0.09279 271 PRO A CA  
2210 C C   . PRO A 294 ? 0.33987 0.43154 0.35367 -0.00423 -0.03349 -0.09785 271 PRO A C   
2211 O O   . PRO A 294 ? 0.37193 0.47161 0.38523 0.00272  -0.03763 -0.11164 271 PRO A O   
2212 C CB  . PRO A 294 ? 0.40834 0.50543 0.43733 -0.00757 -0.04610 -0.10606 271 PRO A CB  
2213 C CG  . PRO A 294 ? 0.39980 0.51071 0.41174 0.00376  -0.05016 -0.11400 271 PRO A CG  
2214 C CD  . PRO A 294 ? 0.38755 0.49767 0.37879 0.00638  -0.04240 -0.09881 271 PRO A CD  
2215 N N   . MET A 295 ? 0.34964 0.43366 0.36486 -0.00873 -0.02694 -0.08804 272 MET A N   
2216 C CA  . MET A 295 ? 0.36663 0.45140 0.38488 -0.00597 -0.02368 -0.09194 272 MET A CA  
2217 C C   . MET A 295 ? 0.31151 0.38560 0.33920 -0.01386 -0.02059 -0.08091 272 MET A C   
2218 O O   . MET A 295 ? 0.35631 0.42455 0.38264 -0.02012 -0.01949 -0.07063 272 MET A O   
2219 C CB  . MET A 295 ? 0.36775 0.46309 0.36587 0.00185  -0.01545 -0.09089 272 MET A CB  
2220 C CG  . MET A 295 ? 0.41627 0.50828 0.40144 -0.00089 -0.00722 -0.07441 272 MET A CG  
2221 S SD  . MET A 295 ? 0.48640 0.58931 0.44848 0.00702  0.00371  -0.06909 272 MET A SD  
2222 C CE  . MET A 295 ? 0.49250 0.59893 0.46603 0.00610  0.01134  -0.07241 272 MET A CE  
2223 N N   . ASP A 296 ? 0.29015 0.36331 0.32764 -0.01273 -0.01970 -0.08432 273 ASP A N   
2224 C CA  . ASP A 296 ? 0.32324 0.38813 0.36983 -0.01875 -0.01838 -0.07504 273 ASP A CA  
2225 C C   . ASP A 296 ? 0.33510 0.40446 0.37035 -0.01833 -0.00848 -0.06696 273 ASP A C   
2226 O O   . ASP A 296 ? 0.37127 0.44998 0.40170 -0.01260 -0.00229 -0.07126 273 ASP A O   
2227 C CB  . ASP A 296 ? 0.32957 0.39189 0.39530 -0.01670 -0.02321 -0.08305 273 ASP A CB  
2228 C CG  . ASP A 296 ? 0.41762 0.46902 0.49571 -0.02316 -0.02701 -0.07353 273 ASP A CG  
2229 O OD1 . ASP A 296 ? 0.40527 0.45044 0.47801 -0.03014 -0.02763 -0.06258 273 ASP A OD1 
2230 O OD2 . ASP A 296 ? 0.37752 0.42798 0.47023 -0.02049 -0.02950 -0.07753 273 ASP A OD2 
2231 N N   . SER A 297 ? 0.31567 0.37910 0.34808 -0.02457 -0.00657 -0.05592 274 SER A N   
2232 C CA  . SER A 297 ? 0.31942 0.38529 0.34753 -0.02537 0.00187  -0.04914 274 SER A CA  
2233 C C   . SER A 297 ? 0.28467 0.34312 0.31804 -0.03269 0.00015  -0.04128 274 SER A C   
2234 O O   . SER A 297 ? 0.30696 0.35964 0.33995 -0.03698 -0.00511 -0.03854 274 SER A O   
2235 C CB  . SER A 297 ? 0.39390 0.46406 0.40511 -0.02221 0.00898  -0.04474 274 SER A CB  
2236 O OG  . SER A 297 ? 0.48085 0.54685 0.48565 -0.02384 0.00509  -0.04214 274 SER A OG  
2237 N N   . THR A 298 ? 0.28187 0.34234 0.32004 -0.03409 0.00527  -0.03818 275 THR A N   
2238 C CA  . THR A 298 ? 0.27804 0.33377 0.32173 -0.04015 0.00286  -0.03307 275 THR A CA  
2239 C C   . THR A 298 ? 0.28507 0.33633 0.31830 -0.04373 0.00333  -0.02807 275 THR A C   
2240 O O   . THR A 298 ? 0.32954 0.37705 0.36302 -0.04824 -0.00175 -0.02592 275 THR A O   
2241 C CB  . THR A 298 ? 0.30373 0.36448 0.35681 -0.04072 0.00900  -0.03244 275 THR A CB  
2242 O OG1 . THR A 298 ? 0.31476 0.38066 0.38149 -0.03757 0.00682  -0.03842 275 THR A OG1 
2243 C CG2 . THR A 298 ? 0.31171 0.36897 0.36958 -0.04667 0.00653  -0.02882 275 THR A CG2 
2244 N N   . VAL A 299 ? 0.28749 0.33980 0.31123 -0.04124 0.00935  -0.02610 276 VAL A N   
2245 C CA  . VAL A 299 ? 0.28996 0.33868 0.30597 -0.04293 0.00948  -0.02303 276 VAL A CA  
2246 C C   . VAL A 299 ? 0.28968 0.34049 0.29751 -0.03871 0.00735  -0.02542 276 VAL A C   
2247 O O   . VAL A 299 ? 0.27192 0.32708 0.27498 -0.03309 0.00934  -0.02751 276 VAL A O   
2248 C CB  . VAL A 299 ? 0.35084 0.39743 0.36555 -0.04285 0.01658  -0.01828 276 VAL A CB  
2249 C CG1 . VAL A 299 ? 0.31784 0.36066 0.32693 -0.04311 0.01573  -0.01692 276 VAL A CG1 
2250 C CG2 . VAL A 299 ? 0.32599 0.37182 0.35282 -0.04746 0.01826  -0.01781 276 VAL A CG2 
2251 N N   . LYS A 300 ? 0.27658 0.32620 0.28315 -0.04126 0.00343  -0.02595 277 LYS A N   
2252 C CA  . LYS A 300 ? 0.32495 0.37801 0.32750 -0.03786 0.00056  -0.02935 277 LYS A CA  
2253 C C   . LYS A 300 ? 0.34587 0.39909 0.34328 -0.03640 0.00251  -0.02711 277 LYS A C   
2254 O O   . LYS A 300 ? 0.35066 0.40123 0.35009 -0.04039 0.00417  -0.02500 277 LYS A O   
2255 C CB  . LYS A 300 ? 0.28931 0.34238 0.29924 -0.04231 -0.00531 -0.03223 277 LYS A CB  
2256 C CG  . LYS A 300 ? 0.32543 0.37699 0.34349 -0.04210 -0.00928 -0.03571 277 LYS A CG  
2257 C CD  . LYS A 300 ? 0.31042 0.36708 0.32701 -0.03488 -0.01066 -0.04349 277 LYS A CD  
2258 C CE  . LYS A 300 ? 0.32800 0.38882 0.34517 -0.03366 -0.01497 -0.04858 277 LYS A CE  
2259 N NZ  . LYS A 300 ? 0.32822 0.39639 0.33904 -0.02485 -0.01644 -0.05682 277 LYS A NZ  
2260 N N   . ASN A 301 ? 0.34937 0.40649 0.34082 -0.02998 0.00131  -0.02872 278 ASN A N   
2261 C CA  . ASN A 301 ? 0.29077 0.34851 0.27981 -0.02701 0.00132  -0.02734 278 ASN A CA  
2262 C C   . ASN A 301 ? 0.34008 0.40496 0.33397 -0.02674 -0.00435 -0.03374 278 ASN A C   
2263 O O   . ASN A 301 ? 0.31910 0.38893 0.31279 -0.02374 -0.00879 -0.03890 278 ASN A O   
2264 C CB  . ASN A 301 ? 0.35487 0.41188 0.33353 -0.01882 0.00343  -0.02246 278 ASN A CB  
2265 C CG  . ASN A 301 ? 0.47734 0.52650 0.45520 -0.02026 0.01068  -0.01431 278 ASN A CG  
2266 O OD1 . ASN A 301 ? 0.48334 0.52802 0.46949 -0.02664 0.01282  -0.01414 278 ASN A OD1 
2267 N ND2 . ASN A 301 ? 0.46678 0.51511 0.43495 -0.01439 0.01430  -0.00751 278 ASN A ND2 
2268 N N   . TYR A 302 ? 0.30102 0.36783 0.30084 -0.02962 -0.00403 -0.03474 279 TYR A N   
2269 C CA  . TYR A 302 ? 0.31730 0.39297 0.32555 -0.03043 -0.00804 -0.04083 279 TYR A CA  
2270 C C   . TYR A 302 ? 0.26827 0.34805 0.27886 -0.02547 -0.00821 -0.04215 279 TYR A C   
2271 O O   . TYR A 302 ? 0.30679 0.38178 0.31638 -0.02530 -0.00423 -0.03918 279 TYR A O   
2272 C CB  . TYR A 302 ? 0.30288 0.38041 0.31971 -0.04037 -0.00644 -0.04138 279 TYR A CB  
2273 C CG  . TYR A 302 ? 0.33809 0.41035 0.35578 -0.04532 -0.00759 -0.03936 279 TYR A CG  
2274 C CD1 . TYR A 302 ? 0.38463 0.45857 0.40925 -0.04515 -0.01277 -0.04392 279 TYR A CD1 
2275 C CD2 . TYR A 302 ? 0.33227 0.39816 0.34618 -0.04961 -0.00472 -0.03415 279 TYR A CD2 
2276 C CE1 . TYR A 302 ? 0.37296 0.44077 0.40139 -0.04883 -0.01460 -0.04259 279 TYR A CE1 
2277 C CE2 . TYR A 302 ? 0.36988 0.43085 0.38647 -0.05301 -0.00703 -0.03215 279 TYR A CE2 
2278 C CZ  . TYR A 302 ? 0.38954 0.45082 0.41378 -0.05248 -0.01176 -0.03604 279 TYR A CZ  
2279 O OH  . TYR A 302 ? 0.37246 0.42762 0.40213 -0.05505 -0.01476 -0.03449 279 TYR A OH  
2280 N N   . PHE A 303 ? 0.28301 0.37216 0.29954 -0.02137 -0.01363 -0.04802 280 PHE A N   
2281 C CA  . PHE A 303 ? 0.29294 0.38927 0.31738 -0.01701 -0.01510 -0.05157 280 PHE A CA  
2282 C C   . PHE A 303 ? 0.31491 0.42013 0.35349 -0.02611 -0.01189 -0.05639 280 PHE A C   
2283 O O   . PHE A 303 ? 0.31901 0.43177 0.36725 -0.03050 -0.01454 -0.06084 280 PHE A O   
2284 C CB  . PHE A 303 ? 0.30293 0.40698 0.32743 -0.00752 -0.02371 -0.05598 280 PHE A CB  
2285 C CG  . PHE A 303 ? 0.32951 0.43961 0.36120 0.00035  -0.02710 -0.05841 280 PHE A CG  
2286 C CD1 . PHE A 303 ? 0.33305 0.44893 0.37923 -0.00344 -0.02307 -0.06253 280 PHE A CD1 
2287 C CD2 . PHE A 303 ? 0.38372 0.49481 0.40733 0.01240  -0.03468 -0.05679 280 PHE A CD2 
2288 C CE1 . PHE A 303 ? 0.39432 0.51658 0.45049 0.00497  -0.02673 -0.06635 280 PHE A CE1 
2289 C CE2 . PHE A 303 ? 0.42349 0.53971 0.45548 0.02108  -0.03958 -0.05870 280 PHE A CE2 
2290 C CZ  . PHE A 303 ? 0.41071 0.53241 0.46091 0.01744  -0.03569 -0.06422 280 PHE A CZ  
2291 N N   . ILE A 304 ? 0.28706 0.39167 0.32715 -0.02949 -0.00572 -0.05556 281 ILE A N   
2292 C CA  . ILE A 304 ? 0.28473 0.39808 0.33314 -0.03900 -0.00033 -0.05799 281 ILE A CA  
2293 C C   . ILE A 304 ? 0.31024 0.43699 0.37193 -0.03604 0.00124  -0.06556 281 ILE A C   
2294 O O   . ILE A 304 ? 0.30753 0.43174 0.36929 -0.02798 0.00041  -0.06748 281 ILE A O   
2295 C CB  . ILE A 304 ? 0.31736 0.42353 0.35616 -0.04518 0.00551  -0.05326 281 ILE A CB  
2296 C CG1 . ILE A 304 ? 0.33495 0.45223 0.37871 -0.05449 0.01146  -0.05447 281 ILE A CG1 
2297 C CG2 . ILE A 304 ? 0.35833 0.45858 0.39341 -0.03949 0.00735  -0.05433 281 ILE A CG2 
2298 C CD1 . ILE A 304 ? 0.42977 0.54207 0.46180 -0.06026 0.01549  -0.04998 281 ILE A CD1 
2299 N N   . THR A 305 ? 0.27584 0.41692 0.35128 -0.04250 0.00351  -0.06983 282 THR A N   
2300 C CA  . THR A 305 ? 0.30465 0.46280 0.39640 -0.04139 0.00683  -0.07829 282 THR A CA  
2301 C C   . THR A 305 ? 0.32853 0.49705 0.42341 -0.05339 0.01690  -0.07738 282 THR A C   
2302 O O   . THR A 305 ? 0.28307 0.45400 0.38247 -0.06243 0.01808  -0.07327 282 THR A O   
2303 C CB  . THR A 305 ? 0.29646 0.46646 0.40591 -0.03729 -0.00026 -0.08509 282 THR A CB  
2304 O OG1 . THR A 305 ? 0.30780 0.46872 0.40966 -0.02559 -0.01012 -0.08441 282 THR A OG1 
2305 C CG2 . THR A 305 ? 0.30274 0.49338 0.43370 -0.03541 0.00318  -0.09538 282 THR A CG2 
2306 N N   . ASP A 306 ? 0.30249 0.47719 0.39506 -0.05340 0.02413  -0.08110 283 ASP A N   
2307 C CA  . ASP A 306 ? 0.37362 0.56081 0.46523 -0.06415 0.03470  -0.07985 283 ASP A CA  
2308 C C   . ASP A 306 ? 0.35533 0.56534 0.46963 -0.06708 0.03975  -0.08717 283 ASP A C   
2309 O O   . ASP A 306 ? 0.32154 0.54259 0.44961 -0.05902 0.03939  -0.09807 283 ASP A O   
2310 C CB  . ASP A 306 ? 0.37027 0.55776 0.44937 -0.06274 0.04040  -0.08325 283 ASP A CB  
2311 C CG  . ASP A 306 ? 0.43902 0.64102 0.51168 -0.07330 0.05144  -0.08110 283 ASP A CG  
2312 O OD1 . ASP A 306 ? 0.43922 0.63477 0.49967 -0.08189 0.05233  -0.06947 283 ASP A OD1 
2313 O OD2 . ASP A 306 ? 0.40883 0.62898 0.48804 -0.07252 0.05922  -0.09075 283 ASP A OD2 
2314 N N   . ALA A 307 ? 0.34505 0.56226 0.46585 -0.07872 0.04452  -0.08105 284 ALA A N   
2315 C CA  . ALA A 307 ? 0.32662 0.56586 0.47377 -0.08290 0.04912  -0.08751 284 ALA A CA  
2316 C C   . ALA A 307 ? 0.31314 0.57487 0.46538 -0.08492 0.06207  -0.09466 284 ALA A C   
2317 O O   . ALA A 307 ? 0.31909 0.60082 0.49555 -0.08249 0.06451  -0.10544 284 ALA A O   
2318 C CB  . ALA A 307 ? 0.34678 0.58602 0.50285 -0.09600 0.05113  -0.07805 284 ALA A CB  
2319 N N   . GLN A 308 ? 0.31466 0.57544 0.44523 -0.08872 0.07011  -0.09025 285 GLN A N   
2320 C CA  . GLN A 308 ? 0.35231 0.63719 0.48564 -0.09083 0.08349  -0.09826 285 GLN A CA  
2321 C C   . GLN A 308 ? 0.35635 0.64678 0.49789 -0.07697 0.08082  -0.11508 285 GLN A C   
2322 O O   . GLN A 308 ? 0.32369 0.63815 0.48531 -0.07505 0.08808  -0.12730 285 GLN A O   
2323 C CB  . GLN A 308 ? 0.35328 0.63671 0.45810 -0.09816 0.09165  -0.08934 285 GLN A CB  
2324 C CG  . GLN A 308 ? 0.42916 0.74061 0.53252 -0.10061 0.10693  -0.09818 285 GLN A CG  
2325 C CD  . GLN A 308 ? 0.48008 0.81695 0.60480 -0.11078 0.11940  -0.09670 285 GLN A CD  
2326 O OE1 . GLN A 308 ? 0.53712 0.86938 0.66622 -0.12164 0.12036  -0.08223 285 GLN A OE1 
2327 N NE2 . GLN A 308 ? 0.47565 0.83999 0.61694 -0.10737 0.12924  -0.11243 285 GLN A NE2 
2328 N N   . THR A 309 ? 0.31833 0.58708 0.44701 -0.06734 0.07080  -0.11583 286 THR A N   
2329 C CA  . THR A 309 ? 0.36358 0.63324 0.49928 -0.05452 0.06802  -0.13001 286 THR A CA  
2330 C C   . THR A 309 ? 0.33261 0.59284 0.48496 -0.04270 0.05531  -0.13345 286 THR A C   
2331 O O   . THR A 309 ? 0.30142 0.56866 0.46992 -0.03210 0.05345  -0.14600 286 THR A O   
2332 C CB  . THR A 309 ? 0.34592 0.59789 0.45861 -0.05170 0.06586  -0.12893 286 THR A CB  
2333 O OG1 . THR A 309 ? 0.31864 0.54466 0.41961 -0.05079 0.05540  -0.11672 286 THR A OG1 
2334 C CG2 . THR A 309 ? 0.32618 0.58798 0.41856 -0.06206 0.07651  -0.12550 286 THR A CG2 
2335 N N   . GLY A 310 ? 0.29444 0.53960 0.44311 -0.04342 0.04608  -0.12307 287 GLY A N   
2336 C CA  . GLY A 310 ? 0.26502 0.49920 0.42173 -0.03119 0.03318  -0.12446 287 GLY A CA  
2337 C C   . GLY A 310 ? 0.30784 0.51690 0.44719 -0.02363 0.02667  -0.11935 287 GLY A C   
2338 O O   . GLY A 310 ? 0.29369 0.49190 0.43624 -0.01297 0.01645  -0.11803 287 GLY A O   
2339 N N   . SER A 311 ? 0.26666 0.46721 0.38856 -0.02870 0.03222  -0.11635 288 SER A N   
2340 C CA  . SER A 311 ? 0.26837 0.44480 0.37574 -0.02396 0.02661  -0.11025 288 SER A CA  
2341 C C   . SER A 311 ? 0.30925 0.47074 0.40521 -0.02555 0.01970  -0.09738 288 SER A C   
2342 O O   . SER A 311 ? 0.33897 0.50481 0.43083 -0.03437 0.02148  -0.09206 288 SER A O   
2343 C CB  . SER A 311 ? 0.29982 0.47388 0.39267 -0.03046 0.03343  -0.11112 288 SER A CB  
2344 O OG  . SER A 311 ? 0.40827 0.56277 0.49495 -0.02524 0.02903  -0.10968 288 SER A OG  
2345 N N   . SER A 312 ? 0.26571 0.40988 0.35735 -0.01691 0.01214  -0.09231 289 SER A N   
2346 C CA  . SER A 312 ? 0.28561 0.41905 0.36692 -0.01656 0.00586  -0.08219 289 SER A CA  
2347 C C   . SER A 312 ? 0.31606 0.42859 0.38564 -0.01122 0.00266  -0.07404 289 SER A C   
2348 O O   . SER A 312 ? 0.31505 0.42000 0.38891 -0.00577 0.00301  -0.07611 289 SER A O   
2349 C CB  . SER A 312 ? 0.31029 0.45330 0.40284 -0.01011 -0.00170 -0.08485 289 SER A CB  
2350 O OG  . SER A 312 ? 0.32065 0.46027 0.42022 0.00272  -0.00805 -0.08674 289 SER A OG  
2351 N N   . LYS A 313 ? 0.26652 0.36997 0.32310 -0.01317 0.00007  -0.06506 290 LYS A N   
2352 C CA  . LYS A 313 ? 0.29299 0.37883 0.33917 -0.00883 -0.00150 -0.05614 290 LYS A CA  
2353 C C   . LYS A 313 ? 0.33009 0.41318 0.36533 -0.00658 -0.00616 -0.04921 290 LYS A C   
2354 O O   . LYS A 313 ? 0.34898 0.43670 0.38077 -0.01319 -0.00572 -0.04968 290 LYS A O   
2355 C CB  . LYS A 313 ? 0.32105 0.39811 0.36128 -0.01637 0.00421  -0.05410 290 LYS A CB  
2356 C CG  . LYS A 313 ? 0.33045 0.39037 0.36375 -0.01380 0.00422  -0.04483 290 LYS A CG  
2357 C CD  . LYS A 313 ? 0.37273 0.42506 0.40928 -0.01863 0.00849  -0.04719 290 LYS A CD  
2358 C CE  . LYS A 313 ? 0.35042 0.40881 0.38064 -0.02853 0.01116  -0.04935 290 LYS A CE  
2359 N NZ  . LYS A 313 ? 0.33830 0.39540 0.37256 -0.03248 0.01382  -0.05634 290 LYS A NZ  
2360 N N   . CYS A 314 ? 0.33181 0.40724 0.36141 0.00306  -0.01059 -0.04271 291 CYS A N   
2361 C CA  . CYS A 314 ? 0.32641 0.40261 0.34367 0.00726  -0.01545 -0.03793 291 CYS A CA  
2362 C C   . CYS A 314 ? 0.36326 0.43273 0.36876 0.00092  -0.01104 -0.03254 291 CYS A C   
2363 O O   . CYS A 314 ? 0.33105 0.40582 0.33037 0.00044  -0.01381 -0.03408 291 CYS A O   
2364 C CB  . CYS A 314 ? 0.36590 0.43507 0.37602 0.01920  -0.02017 -0.02963 291 CYS A CB  
2365 S SG  . CYS A 314 ? 0.44390 0.52184 0.46941 0.02964  -0.02834 -0.03611 291 CYS A SG  
2366 N N   . VAL A 315 ? 0.29415 0.35211 0.29803 -0.00285 -0.00492 -0.02695 292 VAL A N   
2367 C CA  . VAL A 315 ? 0.32853 0.38084 0.32401 -0.00800 -0.00069 -0.02186 292 VAL A CA  
2368 C C   . VAL A 315 ? 0.39628 0.44548 0.39911 -0.01695 0.00397  -0.02476 292 VAL A C   
2369 O O   . VAL A 315 ? 0.39891 0.43953 0.40635 -0.01734 0.00710  -0.02255 292 VAL A O   
2370 C CB  . VAL A 315 ? 0.36938 0.41179 0.35538 -0.00284 0.00200  -0.01062 292 VAL A CB  
2371 C CG1 . VAL A 315 ? 0.39161 0.43156 0.37232 -0.00850 0.00730  -0.00721 292 VAL A CG1 
2372 C CG2 . VAL A 315 ? 0.34657 0.39349 0.32120 0.00765  -0.00355 -0.00696 292 VAL A CG2 
2373 N N   . CYS A 316 ? 0.32598 0.38189 0.33042 -0.02387 0.00378  -0.02967 293 CYS A N   
2374 C CA  . CYS A 316 ? 0.35328 0.40827 0.36109 -0.03193 0.00695  -0.03192 293 CYS A CA  
2375 C C   . CYS A 316 ? 0.32802 0.37990 0.33128 -0.03619 0.00743  -0.02830 293 CYS A C   
2376 O O   . CYS A 316 ? 0.33803 0.39443 0.34029 -0.03837 0.00489  -0.02942 293 CYS A O   
2377 C CB  . CYS A 316 ? 0.34351 0.40924 0.35618 -0.03658 0.00671  -0.03836 293 CYS A CB  
2378 S SG  . CYS A 316 ? 0.40481 0.47188 0.41722 -0.04488 0.01034  -0.04129 293 CYS A SG  
2379 N N   . SER A 317 ? 0.29374 0.33805 0.29727 -0.03730 0.01040  -0.02466 294 SER A N   
2380 C CA  . SER A 317 ? 0.31555 0.35843 0.31788 -0.04063 0.01089  -0.02223 294 SER A CA  
2381 C C   . SER A 317 ? 0.36135 0.40716 0.36594 -0.04761 0.00889  -0.02529 294 SER A C   
2382 O O   . SER A 317 ? 0.40143 0.44833 0.40784 -0.05047 0.00936  -0.02854 294 SER A O   
2383 C CB  . SER A 317 ? 0.31167 0.34746 0.31683 -0.04011 0.01534  -0.01741 294 SER A CB  
2384 O OG  . SER A 317 ? 0.42128 0.45281 0.43401 -0.04299 0.01651  -0.01978 294 SER A OG  
2385 N N   . VAL A 318 ? 0.30911 0.35657 0.31317 -0.04975 0.00620  -0.02448 295 VAL A N   
2386 C CA  . VAL A 318 ? 0.29054 0.34018 0.29508 -0.05575 0.00318  -0.02467 295 VAL A CA  
2387 C C   . VAL A 318 ? 0.35468 0.40151 0.36263 -0.05663 0.00079  -0.02266 295 VAL A C   
2388 O O   . VAL A 318 ? 0.31055 0.35666 0.32041 -0.05312 0.00062  -0.02270 295 VAL A O   
2389 C CB  . VAL A 318 ? 0.33713 0.39152 0.34142 -0.05786 0.00112  -0.02509 295 VAL A CB  
2390 C CG1 . VAL A 318 ? 0.35345 0.40869 0.35688 -0.06435 -0.00151 -0.02178 295 VAL A CG1 
2391 C CG2 . VAL A 318 ? 0.34193 0.40194 0.34595 -0.05668 0.00377  -0.02853 295 VAL A CG2 
2392 N N   . ILE A 319 ? 0.36171 0.40835 0.37088 -0.06046 -0.00139 -0.02213 296 ILE A N   
2393 C CA  . ILE A 319 ? 0.32387 0.36908 0.33870 -0.06107 -0.00529 -0.02068 296 ILE A CA  
2394 C C   . ILE A 319 ? 0.31959 0.36574 0.33115 -0.06544 -0.01120 -0.01762 296 ILE A C   
2395 O O   . ILE A 319 ? 0.33106 0.38064 0.33524 -0.06850 -0.01097 -0.01787 296 ILE A O   
2396 C CB  . ILE A 319 ? 0.33296 0.37779 0.35494 -0.06052 -0.00304 -0.02250 296 ILE A CB  
2397 C CG1 . ILE A 319 ? 0.28877 0.33431 0.32043 -0.05976 -0.00641 -0.02236 296 ILE A CG1 
2398 C CG2 . ILE A 319 ? 0.34446 0.39084 0.36534 -0.06392 -0.00426 -0.02535 296 ILE A CG2 
2399 C CD1 . ILE A 319 ? 0.31040 0.35757 0.35342 -0.05947 -0.00208 -0.02437 296 ILE A CD1 
2400 N N   . ASP A 320 ? 0.31533 0.35869 0.33205 -0.06528 -0.01654 -0.01454 297 ASP A N   
2401 C CA  . ASP A 320 ? 0.32298 0.36556 0.33635 -0.06888 -0.02314 -0.00867 297 ASP A CA  
2402 C C   . ASP A 320 ? 0.34639 0.38952 0.36579 -0.06756 -0.02885 -0.00933 297 ASP A C   
2403 O O   . ASP A 320 ? 0.35762 0.39766 0.38736 -0.06506 -0.03386 -0.00827 297 ASP A O   
2404 C CB  . ASP A 320 ? 0.35682 0.39402 0.37484 -0.06969 -0.02682 -0.00365 297 ASP A CB  
2405 C CG  . ASP A 320 ? 0.47487 0.50969 0.48810 -0.07374 -0.03332 0.00599  297 ASP A CG  
2406 O OD1 . ASP A 320 ? 0.43530 0.47536 0.43681 -0.07608 -0.03400 0.00813  297 ASP A OD1 
2407 O OD2 . ASP A 320 ? 0.42778 0.45537 0.44893 -0.07421 -0.03828 0.01149  297 ASP A OD2 
2408 N N   . LEU A 321 ? 0.34917 0.39714 0.36444 -0.06886 -0.02863 -0.01269 298 LEU A N   
2409 C CA  . LEU A 321 ? 0.32975 0.38061 0.35035 -0.06836 -0.03596 -0.01402 298 LEU A CA  
2410 C C   . LEU A 321 ? 0.42284 0.47621 0.42930 -0.07095 -0.04303 -0.00812 298 LEU A C   
2411 O O   . LEU A 321 ? 0.38269 0.43901 0.37484 -0.07398 -0.03925 -0.00661 298 LEU A O   
2412 C CB  . LEU A 321 ? 0.31717 0.37249 0.34339 -0.06864 -0.03278 -0.02246 298 LEU A CB  
2413 C CG  . LEU A 321 ? 0.35256 0.40615 0.39337 -0.06643 -0.02578 -0.02586 298 LEU A CG  
2414 C CD1 . LEU A 321 ? 0.33584 0.39134 0.38229 -0.06813 -0.02143 -0.03228 298 LEU A CD1 
2415 C CD2 . LEU A 321 ? 0.34138 0.39658 0.39763 -0.06390 -0.03042 -0.02610 298 LEU A CD2 
2416 N N   . LEU A 322 ? 0.38338 0.43699 0.39380 -0.06932 -0.05321 -0.00481 299 LEU A N   
2417 C CA  . LEU A 322 ? 0.38965 0.44804 0.38434 -0.07085 -0.06107 0.00027  299 LEU A CA  
2418 C C   . LEU A 322 ? 0.37852 0.44632 0.36376 -0.07260 -0.05798 -0.00926 299 LEU A C   
2419 O O   . LEU A 322 ? 0.38983 0.46025 0.38790 -0.07154 -0.05649 -0.01984 299 LEU A O   
2420 C CB  . LEU A 322 ? 0.37402 0.43305 0.37762 -0.06715 -0.07399 0.00228  299 LEU A CB  
2421 C CG  . LEU A 322 ? 0.40910 0.47215 0.39441 -0.06734 -0.08464 0.01084  299 LEU A CG  
2422 C CD1 . LEU A 322 ? 0.47522 0.52863 0.45166 -0.06928 -0.08498 0.02726  299 LEU A CD1 
2423 C CD2 . LEU A 322 ? 0.44181 0.50918 0.43831 -0.06242 -0.09879 0.00826  299 LEU A CD2 
2424 N N   . LEU A 323 ? 0.38449 0.45780 0.34879 -0.07545 -0.05648 -0.00595 300 LEU A N   
2425 C CA  . LEU A 323 ? 0.38042 0.46337 0.33677 -0.07640 -0.05305 -0.01764 300 LEU A CA  
2426 C C   . LEU A 323 ? 0.35456 0.44392 0.31804 -0.07418 -0.06226 -0.02800 300 LEU A C   
2427 O O   . LEU A 323 ? 0.38780 0.47989 0.36122 -0.07421 -0.05907 -0.04119 300 LEU A O   
2428 C CB  . LEU A 323 ? 0.44577 0.53716 0.37733 -0.07926 -0.05056 -0.01290 300 LEU A CB  
2429 C CG  . LEU A 323 ? 0.51600 0.61845 0.43938 -0.07972 -0.04511 -0.02677 300 LEU A CG  
2430 C CD1 . LEU A 323 ? 0.43469 0.53168 0.37421 -0.07925 -0.03548 -0.03527 300 LEU A CD1 
2431 C CD2 . LEU A 323 ? 0.52565 0.63874 0.42430 -0.08271 -0.04038 -0.02094 300 LEU A CD2 
2432 N N   . ASP A 324 ? 0.34858 0.43992 0.31004 -0.07209 -0.07449 -0.02234 301 ASP A N   
2433 C CA  . ASP A 324 ? 0.35672 0.45599 0.32770 -0.06968 -0.08514 -0.03305 301 ASP A CA  
2434 C C   . ASP A 324 ? 0.38766 0.48298 0.38889 -0.06930 -0.08156 -0.04231 301 ASP A C   
2435 O O   . ASP A 324 ? 0.37455 0.47633 0.38829 -0.06959 -0.08437 -0.05582 301 ASP A O   
2436 C CB  . ASP A 324 ? 0.38738 0.48850 0.35444 -0.06622 -0.10003 -0.02388 301 ASP A CB  
2437 C CG  . ASP A 324 ? 0.50453 0.60732 0.44131 -0.06690 -0.10312 -0.00922 301 ASP A CG  
2438 O OD1 . ASP A 324 ? 0.50408 0.59888 0.43363 -0.06993 -0.09384 0.00196  301 ASP A OD1 
2439 O OD2 . ASP A 324 ? 0.54068 0.65354 0.46144 -0.06448 -0.11506 -0.00866 301 ASP A OD2 
2440 N N   . ASP A 325 ? 0.37582 0.46147 0.39004 -0.06868 -0.07579 -0.03529 302 ASP A N   
2441 C CA  . ASP A 325 ? 0.36430 0.44740 0.40451 -0.06861 -0.06966 -0.04206 302 ASP A CA  
2442 C C   . ASP A 325 ? 0.37604 0.45740 0.41806 -0.07141 -0.05850 -0.04960 302 ASP A C   
2443 O O   . ASP A 325 ? 0.34572 0.42888 0.40681 -0.07268 -0.05649 -0.05880 302 ASP A O   
2444 C CB  . ASP A 325 ? 0.34197 0.41694 0.39151 -0.06659 -0.06499 -0.03389 302 ASP A CB  
2445 C CG  . ASP A 325 ? 0.40215 0.47823 0.46224 -0.06264 -0.07635 -0.02979 302 ASP A CG  
2446 O OD1 . ASP A 325 ? 0.39286 0.47692 0.45810 -0.06132 -0.08738 -0.03427 302 ASP A OD1 
2447 O OD2 . ASP A 325 ? 0.43078 0.50018 0.49603 -0.06023 -0.07504 -0.02341 302 ASP A OD2 
2448 N N   . PHE A 326 ? 0.34870 0.42606 0.37404 -0.07240 -0.05101 -0.04534 303 PHE A N   
2449 C CA  . PHE A 326 ? 0.32869 0.40372 0.35663 -0.07380 -0.04164 -0.05217 303 PHE A CA  
2450 C C   . PHE A 326 ? 0.35499 0.43733 0.38453 -0.07496 -0.04611 -0.06543 303 PHE A C   
2451 O O   . PHE A 326 ? 0.37093 0.45052 0.41679 -0.07605 -0.04182 -0.07389 303 PHE A O   
2452 C CB  . PHE A 326 ? 0.32245 0.39477 0.33328 -0.07401 -0.03461 -0.04654 303 PHE A CB  
2453 C CG  . PHE A 326 ? 0.35864 0.42797 0.37351 -0.07399 -0.02587 -0.05298 303 PHE A CG  
2454 C CD1 . PHE A 326 ? 0.44627 0.50746 0.47571 -0.07291 -0.01893 -0.05143 303 PHE A CD1 
2455 C CD2 . PHE A 326 ? 0.41235 0.48745 0.41666 -0.07442 -0.02465 -0.06037 303 PHE A CD2 
2456 C CE1 . PHE A 326 ? 0.44877 0.50544 0.48255 -0.07206 -0.01211 -0.05545 303 PHE A CE1 
2457 C CE2 . PHE A 326 ? 0.45390 0.52528 0.46522 -0.07330 -0.01768 -0.06695 303 PHE A CE2 
2458 C CZ  . PHE A 326 ? 0.47248 0.53353 0.49874 -0.07202 -0.01206 -0.06357 303 PHE A CZ  
2459 N N   . VAL A 327 ? 0.33742 0.42911 0.35018 -0.07460 -0.05498 -0.06745 304 VAL A N   
2460 C CA  . VAL A 327 ? 0.33645 0.43747 0.34955 -0.07489 -0.06084 -0.08270 304 VAL A CA  
2461 C C   . VAL A 327 ? 0.40654 0.50891 0.44711 -0.07548 -0.06702 -0.09184 304 VAL A C   
2462 O O   . VAL A 327 ? 0.34885 0.45213 0.40500 -0.07702 -0.06637 -0.10574 304 VAL A O   
2463 C CB  . VAL A 327 ? 0.35794 0.47090 0.34410 -0.07366 -0.06987 -0.08154 304 VAL A CB  
2464 C CG1 . VAL A 327 ? 0.36827 0.49339 0.35742 -0.07281 -0.08002 -0.09942 304 VAL A CG1 
2465 C CG2 . VAL A 327 ? 0.37210 0.48705 0.33432 -0.07444 -0.06125 -0.07644 304 VAL A CG2 
2466 N N   . GLU A 328 ? 0.34878 0.45169 0.39865 -0.07434 -0.07322 -0.08500 305 GLU A N   
2467 C CA  . GLU A 328 ? 0.33119 0.43760 0.41133 -0.07533 -0.07810 -0.09379 305 GLU A CA  
2468 C C   . GLU A 328 ? 0.30585 0.40336 0.41038 -0.07866 -0.06534 -0.09615 305 GLU A C   
2469 O O   . GLU A 328 ? 0.32723 0.42682 0.45531 -0.08160 -0.06618 -0.10816 305 GLU A O   
2470 C CB  . GLU A 328 ? 0.33377 0.44216 0.42183 -0.07268 -0.08492 -0.08524 305 GLU A CB  
2471 C CG  . GLU A 328 ? 0.40757 0.52268 0.52985 -0.07370 -0.08968 -0.09463 305 GLU A CG  
2472 C CD  . GLU A 328 ? 0.41209 0.53177 0.54312 -0.06961 -0.09868 -0.08843 305 GLU A CD  
2473 O OE1 . GLU A 328 ? 0.38240 0.49577 0.51934 -0.06835 -0.09119 -0.07901 305 GLU A OE1 
2474 O OE2 . GLU A 328 ? 0.44091 0.57114 0.57267 -0.06688 -0.11423 -0.09385 305 GLU A OE2 
2475 N N   . ILE A 329 ? 0.34125 0.42878 0.44073 -0.07828 -0.05379 -0.08430 306 ILE A N   
2476 C CA  . ILE A 329 ? 0.32227 0.40098 0.43996 -0.08062 -0.04122 -0.08278 306 ILE A CA  
2477 C C   . ILE A 329 ? 0.35038 0.42488 0.47172 -0.08266 -0.03790 -0.09226 306 ILE A C   
2478 O O   . ILE A 329 ? 0.33643 0.40828 0.48344 -0.08611 -0.03525 -0.09902 306 ILE A O   
2479 C CB  . ILE A 329 ? 0.33589 0.40663 0.44133 -0.07839 -0.03151 -0.06915 306 ILE A CB  
2480 C CG1 . ILE A 329 ? 0.27149 0.34543 0.38152 -0.07616 -0.03373 -0.06214 306 ILE A CG1 
2481 C CG2 . ILE A 329 ? 0.30636 0.36775 0.42250 -0.07983 -0.01881 -0.06631 306 ILE A CG2 
2482 C CD1 . ILE A 329 ? 0.33024 0.39801 0.42282 -0.07306 -0.02819 -0.05116 306 ILE A CD1 
2483 N N   . ILE A 330 ? 0.32685 0.40109 0.42515 -0.08069 -0.03801 -0.09359 307 ILE A N   
2484 C CA  . ILE A 330 ? 0.31630 0.38585 0.42028 -0.08140 -0.03424 -0.10343 307 ILE A CA  
2485 C C   . ILE A 330 ? 0.35270 0.42994 0.47077 -0.08324 -0.04370 -0.12138 307 ILE A C   
2486 O O   . ILE A 330 ? 0.34415 0.41531 0.48336 -0.08530 -0.04124 -0.13126 307 ILE A O   
2487 C CB  . ILE A 330 ? 0.39438 0.46410 0.47298 -0.07842 -0.03089 -0.10181 307 ILE A CB  
2488 C CG1 . ILE A 330 ? 0.39128 0.45220 0.48135 -0.07788 -0.02437 -0.10864 307 ILE A CG1 
2489 C CG2 . ILE A 330 ? 0.38918 0.47290 0.44604 -0.07728 -0.03983 -0.10958 307 ILE A CG2 
2490 C CD1 . ILE A 330 ? 0.43766 0.49891 0.50913 -0.07454 -0.01956 -0.10711 307 ILE A CD1 
2491 N N   . LYS A 331 ? 0.39134 0.48153 0.50048 -0.08238 -0.05549 -0.12613 308 LYS A N   
2492 C CA  . LYS A 331 ? 0.39850 0.49783 0.52273 -0.08369 -0.06611 -0.14511 308 LYS A CA  
2493 C C   . LYS A 331 ? 0.38764 0.48590 0.54869 -0.08783 -0.06757 -0.14858 308 LYS A C   
2494 O O   . LYS A 331 ? 0.35278 0.45920 0.53179 -0.08949 -0.07730 -0.16540 308 LYS A O   
2495 C CB  . LYS A 331 ? 0.43605 0.55146 0.53638 -0.08052 -0.07982 -0.14963 308 LYS A CB  
2496 C CG  . LYS A 331 ? 0.49801 0.61878 0.56483 -0.07754 -0.07847 -0.15132 308 LYS A CG  
2497 C CD  . LYS A 331 ? 0.59353 0.73191 0.63814 -0.07469 -0.09259 -0.15821 308 LYS A CD  
2498 C CE  . LYS A 331 ? 0.61952 0.76666 0.63217 -0.07230 -0.08998 -0.16213 308 LYS A CE  
2499 N NZ  . LYS A 331 ? 0.73398 0.89948 0.72055 -0.06918 -0.10360 -0.16620 308 LYS A NZ  
2500 N N   . SER A 332 ? 0.34819 0.43862 0.52160 -0.08957 -0.05820 -0.13423 309 SER A N   
2501 C CA  . SER A 332 ? 0.35544 0.44725 0.56518 -0.09414 -0.05739 -0.13668 309 SER A CA  
2502 C C   . SER A 332 ? 0.40360 0.48114 0.63697 -0.09884 -0.04343 -0.13284 309 SER A C   
2503 O O   . SER A 332 ? 0.38722 0.46432 0.64832 -0.10326 -0.03738 -0.12861 309 SER A O   
2504 C CB  . SER A 332 ? 0.40741 0.50460 0.61703 -0.09248 -0.05743 -0.12464 309 SER A CB  
2505 O OG  . SER A 332 ? 0.43361 0.54177 0.62247 -0.08776 -0.07118 -0.12575 309 SER A OG  
2506 N N   . GLN A 333 ? 0.38244 0.46116 0.60110 -0.06681 -0.09257 -0.16572 310 GLN A N   
2507 C CA  . GLN A 333 ? 0.37976 0.45542 0.63801 -0.07067 -0.06799 -0.15618 310 GLN A CA  
2508 C C   . GLN A 333 ? 0.39514 0.46797 0.68772 -0.07125 -0.06575 -0.17845 310 GLN A C   
2509 O O   . GLN A 333 ? 0.38429 0.45742 0.65248 -0.06795 -0.07986 -0.19705 310 GLN A O   
2510 C CB  . GLN A 333 ? 0.33207 0.40594 0.55658 -0.06967 -0.05095 -0.13120 310 GLN A CB  
2511 C CG  . GLN A 333 ? 0.34036 0.41660 0.52997 -0.07006 -0.05277 -0.11215 310 GLN A CG  
2512 C CD  . GLN A 333 ? 0.38300 0.45810 0.59867 -0.07088 -0.05093 -0.10617 310 GLN A CD  
2513 O OE1 . GLN A 333 ? 0.39113 0.46239 0.64851 -0.07062 -0.03576 -0.10330 310 GLN A OE1 
2514 N NE2 . GLN A 333 ? 0.30911 0.38498 0.50082 -0.07099 -0.06338 -0.10342 310 GLN A NE2 
2515 N N   . ASP A 334 ? 0.33950 0.40659 0.68837 -0.07452 -0.04570 -0.17648 311 ASP A N   
2516 C CA  . ASP A 334 ? 0.30220 0.36180 0.69147 -0.07601 -0.03546 -0.19367 311 ASP A CA  
2517 C C   . ASP A 334 ? 0.36521 0.41773 0.72477 -0.07115 -0.01736 -0.17549 311 ASP A C   
2518 O O   . ASP A 334 ? 0.34871 0.39975 0.68941 -0.06741 -0.00223 -0.14663 311 ASP A O   
2519 C CB  . ASP A 334 ? 0.30156 0.35335 0.75953 -0.07888 -0.01481 -0.19250 311 ASP A CB  
2520 C CG  . ASP A 334 ? 0.41304 0.45274 0.91420 -0.07840 0.00255  -0.20526 311 ASP A CG  
2521 O OD1 . ASP A 334 ? 0.46715 0.49372 0.96733 -0.07845 0.02238  -0.19398 311 ASP A OD1 
2522 O OD2 . ASP A 334 ? 0.42830 0.47225 0.96549 -0.07581 -0.00202 -0.22473 311 ASP A OD2 
2523 N N   . LEU A 335 ? 0.37178 0.42180 0.72420 -0.06948 -0.02147 -0.19420 312 LEU A N   
2524 C CA  . LEU A 335 ? 0.41388 0.46101 0.73624 -0.06373 -0.00844 -0.18174 312 LEU A CA  
2525 C C   . LEU A 335 ? 0.43398 0.46676 0.80050 -0.06169 0.01371  -0.18623 312 LEU A C   
2526 O O   . LEU A 335 ? 0.41534 0.44558 0.76466 -0.05612 0.02150  -0.18575 312 LEU A O   
2527 C CB  . LEU A 335 ? 0.43635 0.48870 0.70833 -0.06111 -0.02591 -0.19720 312 LEU A CB  
2528 C CG  . LEU A 335 ? 0.45032 0.51099 0.67268 -0.06099 -0.04554 -0.19288 312 LEU A CG  
2529 C CD1 . LEU A 335 ? 0.43924 0.49825 0.60802 -0.05545 -0.05454 -0.20439 312 LEU A CD1 
2530 C CD2 . LEU A 335 ? 0.35242 0.41920 0.55642 -0.06225 -0.03685 -0.16146 312 LEU A CD2 
2531 N N   . SER A 336 ? 0.34097 0.36256 0.76717 -0.06570 0.02712  -0.18982 313 SER A N   
2532 C CA  . SER A 336 ? 0.41228 0.41524 0.88753 -0.06489 0.04923  -0.19885 313 SER A CA  
2533 C C   . SER A 336 ? 0.54609 0.53329 1.02861 -0.05496 0.08206  -0.16414 313 SER A C   
2534 O O   . SER A 336 ? 0.48894 0.45573 1.01190 -0.05226 0.10494  -0.16705 313 SER A O   
2535 C CB  . SER A 336 ? 0.46130 0.45782 1.00786 -0.07525 0.04935  -0.22598 313 SER A CB  
2536 O OG  . SER A 336 ? 0.47200 0.46621 1.04183 -0.07682 0.06309  -0.20420 313 SER A OG  
2537 N N   . VAL A 337 ? 0.53638 0.53112 0.97864 -0.04732 0.08457  -0.13244 314 VAL A N   
2538 C CA  . VAL A 337 ? 0.48505 0.46523 0.92717 -0.03318 0.11224  -0.09938 314 VAL A CA  
2539 C C   . VAL A 337 ? 0.49400 0.49064 0.88117 -0.02157 0.10477  -0.08098 314 VAL A C   
2540 O O   . VAL A 337 ? 0.52010 0.53844 0.86926 -0.02683 0.08196  -0.08551 314 VAL A O   
2541 C CB  . VAL A 337 ? 0.67278 0.64485 1.12841 -0.03306 0.12439  -0.08095 314 VAL A CB  
2542 C CG1 . VAL A 337 ? 0.66659 0.64689 1.06940 -0.01985 0.12411  -0.04925 314 VAL A CG1 
2543 C CG2 . VAL A 337 ? 0.65447 0.59530 1.17228 -0.03179 0.15932  -0.07693 314 VAL A CG2 
2544 N N   . VAL A 338 ? 0.49112 0.47720 0.87767 -0.00485 0.12479  -0.06076 315 VAL A N   
2545 C CA  . VAL A 338 ? 0.46850 0.47441 0.81448 0.00737  0.11676  -0.04742 315 VAL A CA  
2546 C C   . VAL A 338 ? 0.46425 0.49089 0.77024 0.00785  0.10038  -0.03354 315 VAL A C   
2547 O O   . VAL A 338 ? 0.44605 0.49673 0.72413 0.00227  0.08119  -0.04077 315 VAL A O   
2548 C CB  . VAL A 338 ? 0.53050 0.52139 0.88450 0.02972  0.14001  -0.02590 315 VAL A CB  
2549 C CG1 . VAL A 338 ? 0.51919 0.53672 0.83708 0.04441  0.12846  -0.01272 315 VAL A CG1 
2550 C CG2 . VAL A 338 ? 0.51756 0.48915 0.90978 0.02865  0.15525  -0.04305 315 VAL A CG2 
2551 N N   . SER A 339 ? 0.46896 0.48449 0.77253 0.01422  0.10988  -0.01453 316 SER A N   
2552 C CA  . SER A 339 ? 0.46234 0.49552 0.72813 0.01512  0.09448  -0.00418 316 SER A CA  
2553 C C   . SER A 339 ? 0.47821 0.49547 0.75097 0.01284  0.10383  0.00456  316 SER A C   
2554 O O   . SER A 339 ? 0.49268 0.48344 0.79282 0.01957  0.12938  0.01490  316 SER A O   
2555 C CB  . SER A 339 ? 0.51131 0.55670 0.74662 0.03675  0.09349  0.01606  316 SER A CB  
2556 O OG  . SER A 339 ? 0.59811 0.61948 0.83296 0.05789  0.11614  0.04032  316 SER A OG  
2557 N N   . LYS A 340 ? 0.44919 0.48099 0.69926 0.00352  0.08591  0.00075  317 LYS A N   
2558 C CA  . LYS A 340 ? 0.42517 0.44397 0.67907 0.00310  0.09517  0.00984  317 LYS A CA  
2559 C C   . LYS A 340 ? 0.41642 0.45359 0.63414 -0.00229 0.07394  0.00863  317 LYS A C   
2560 O O   . LYS A 340 ? 0.35881 0.41682 0.55700 -0.01021 0.05277  -0.00265 317 LYS A O   
2561 C CB  . LYS A 340 ? 0.43675 0.44301 0.74040 -0.01202 0.10215  -0.00685 317 LYS A CB  
2562 C CG  . LYS A 340 ? 0.41973 0.44383 0.72534 -0.03000 0.07513  -0.03289 317 LYS A CG  
2563 C CD  . LYS A 340 ? 0.45768 0.47381 0.80920 -0.04071 0.07869  -0.04653 317 LYS A CD  
2564 C CE  . LYS A 340 ? 0.52254 0.55488 0.87471 -0.05415 0.04971  -0.07341 317 LYS A CE  
2565 N NZ  . LYS A 340 ? 0.42454 0.45200 0.83338 -0.06229 0.05295  -0.08916 317 LYS A NZ  
2566 N N   . VAL A 341 ? 0.36748 0.39381 0.57833 0.00228  0.08327  0.02050  318 VAL A N   
2567 C CA  . VAL A 341 ? 0.36909 0.40744 0.54908 -0.00211 0.06691  0.01937  318 VAL A CA  
2568 C C   . VAL A 341 ? 0.41909 0.45898 0.62387 -0.02078 0.05725  0.00183  318 VAL A C   
2569 O O   . VAL A 341 ? 0.38663 0.41299 0.63216 -0.02474 0.07118  -0.00169 318 VAL A O   
2570 C CB  . VAL A 341 ? 0.43530 0.45928 0.59135 0.01489  0.08278  0.04010  318 VAL A CB  
2571 C CG1 . VAL A 341 ? 0.41106 0.44500 0.54052 0.00837  0.06663  0.03504  318 VAL A CG1 
2572 C CG2 . VAL A 341 ? 0.50732 0.53102 0.63079 0.03889  0.08789  0.05734  318 VAL A CG2 
2573 N N   . VAL A 342 ? 0.31221 0.36829 0.49510 -0.03102 0.03416  -0.00939 319 VAL A N   
2574 C CA  . VAL A 342 ? 0.29991 0.35818 0.49476 -0.04425 0.02093  -0.02411 319 VAL A CA  
2575 C C   . VAL A 342 ? 0.33085 0.39055 0.49733 -0.04361 0.01527  -0.01749 319 VAL A C   
2576 O O   . VAL A 342 ? 0.35785 0.42672 0.48954 -0.04137 0.00706  -0.01354 319 VAL A O   
2577 C CB  . VAL A 342 ? 0.38101 0.45073 0.56714 -0.05372 0.00182  -0.04078 319 VAL A CB  
2578 C CG1 . VAL A 342 ? 0.34179 0.41344 0.52371 -0.06230 -0.01528 -0.05272 319 VAL A CG1 
2579 C CG2 . VAL A 342 ? 0.40278 0.46887 0.61971 -0.05422 0.00748  -0.05164 319 VAL A CG2 
2580 N N   . LYS A 343 ? 0.31686 0.36808 0.50274 -0.04524 0.02073  -0.01780 320 LYS A N   
2581 C CA  . LYS A 343 ? 0.33624 0.38621 0.49907 -0.04485 0.01636  -0.01384 320 LYS A CA  
2582 C C   . LYS A 343 ? 0.34220 0.39845 0.50417 -0.05569 -0.00453 -0.02803 320 LYS A C   
2583 O O   . LYS A 343 ? 0.32028 0.37776 0.51439 -0.06041 -0.01063 -0.04025 320 LYS A O   
2584 C CB  . LYS A 343 ? 0.37695 0.41257 0.56157 -0.03821 0.03759  -0.00474 320 LYS A CB  
2585 C CG  . LYS A 343 ? 0.51085 0.53248 0.69620 -0.02403 0.06428  0.01258  320 LYS A CG  
2586 C CD  . LYS A 343 ? 0.57551 0.59776 0.70597 -0.01048 0.06295  0.02509  320 LYS A CD  
2587 C CE  . LYS A 343 ? 0.73055 0.73599 0.85319 0.00916  0.08900  0.04485  320 LYS A CE  
2588 N NZ  . LYS A 343 ? 0.80314 0.79001 0.90089 0.02495  0.10938  0.06034  320 LYS A NZ  
2589 N N   . VAL A 344 ? 0.30384 0.36289 0.43007 -0.05807 -0.01531 -0.02715 321 VAL A N   
2590 C CA  . VAL A 344 ? 0.32625 0.38529 0.44351 -0.06512 -0.03171 -0.03611 321 VAL A CA  
2591 C C   . VAL A 344 ? 0.34242 0.39452 0.44016 -0.06376 -0.03046 -0.03083 321 VAL A C   
2592 O O   . VAL A 344 ? 0.31482 0.36814 0.38635 -0.06211 -0.02771 -0.02588 321 VAL A O   
2593 C CB  . VAL A 344 ? 0.28533 0.35020 0.37775 -0.07112 -0.04329 -0.04149 321 VAL A CB  
2594 C CG1 . VAL A 344 ? 0.32566 0.38452 0.40703 -0.07431 -0.05731 -0.04852 321 VAL A CG1 
2595 C CG2 . VAL A 344 ? 0.27841 0.34951 0.38533 -0.07078 -0.04159 -0.04643 321 VAL A CG2 
2596 N N   . THR A 345 ? 0.27446 0.32050 0.38725 -0.06340 -0.03363 -0.03407 322 THR A N   
2597 C CA  . THR A 345 ? 0.29616 0.33314 0.39129 -0.06203 -0.03255 -0.03078 322 THR A CA  
2598 C C   . THR A 345 ? 0.33471 0.36862 0.39815 -0.06859 -0.04503 -0.03394 322 THR A C   
2599 O O   . THR A 345 ? 0.31071 0.34259 0.37317 -0.07050 -0.05667 -0.03877 322 THR A O   
2600 C CB  . THR A 345 ? 0.32284 0.35546 0.44865 -0.05852 -0.03237 -0.03384 322 THR A CB  
2601 O OG1 . THR A 345 ? 0.34612 0.38175 0.51299 -0.05476 -0.01801 -0.03280 322 THR A OG1 
2602 C CG2 . THR A 345 ? 0.36706 0.38797 0.47560 -0.05521 -0.02612 -0.02938 322 THR A CG2 
2603 N N   . ILE A 346 ? 0.32660 0.35892 0.36431 -0.07081 -0.04194 -0.03203 323 ILE A N   
2604 C CA  . ILE A 346 ? 0.32916 0.35680 0.34401 -0.07907 -0.04841 -0.03553 323 ILE A CA  
2605 C C   . ILE A 346 ? 0.35218 0.37128 0.35243 -0.07925 -0.04449 -0.03700 323 ILE A C   
2606 O O   . ILE A 346 ? 0.34914 0.37406 0.34374 -0.07390 -0.03947 -0.03694 323 ILE A O   
2607 C CB  . ILE A 346 ? 0.31812 0.35893 0.32595 -0.08496 -0.04977 -0.03792 323 ILE A CB  
2608 C CG1 . ILE A 346 ? 0.29877 0.34732 0.32087 -0.08304 -0.05185 -0.03801 323 ILE A CG1 
2609 C CG2 . ILE A 346 ? 0.32282 0.35611 0.31470 -0.09490 -0.05133 -0.04129 323 ILE A CG2 
2610 C CD1 . ILE A 346 ? 0.29347 0.35529 0.31154 -0.08730 -0.05092 -0.04015 323 ILE A CD1 
2611 N N   . ASP A 347 ? 0.32751 0.33067 0.31890 -0.08324 -0.04649 -0.03860 324 ASP A N   
2612 C CA  . ASP A 347 ? 0.31683 0.30874 0.29656 -0.08404 -0.04241 -0.04287 324 ASP A CA  
2613 C C   . ASP A 347 ? 0.35461 0.34507 0.33888 -0.07270 -0.03504 -0.04042 324 ASP A C   
2614 O O   . ASP A 347 ? 0.36710 0.35665 0.33638 -0.06929 -0.03111 -0.04511 324 ASP A O   
2615 C CB  . ASP A 347 ? 0.33462 0.33611 0.30384 -0.09205 -0.04372 -0.05212 324 ASP A CB  
2616 C CG  . ASP A 347 ? 0.41804 0.41780 0.38742 -0.10456 -0.04465 -0.05457 324 ASP A CG  
2617 O OD1 . ASP A 347 ? 0.38745 0.36990 0.35338 -0.10573 -0.04313 -0.04822 324 ASP A OD1 
2618 O OD2 . ASP A 347 ? 0.42527 0.44067 0.39813 -0.11171 -0.04611 -0.06301 324 ASP A OD2 
2619 N N   . TYR A 348 ? 0.35895 0.34997 0.36530 -0.06584 -0.03242 -0.03431 325 TYR A N   
2620 C CA  . TYR A 348 ? 0.39673 0.38440 0.41695 -0.05523 -0.02000 -0.03012 325 TYR A CA  
2621 C C   . TYR A 348 ? 0.46608 0.46216 0.48274 -0.04798 -0.00925 -0.02510 325 TYR A C   
2622 O O   . TYR A 348 ? 0.48661 0.47701 0.51519 -0.03822 0.00652  -0.01905 325 TYR A O   
2623 C CB  . TYR A 348 ? 0.39857 0.36945 0.40522 -0.05121 -0.01323 -0.03286 325 TYR A CB  
2624 C CG  . TYR A 348 ? 0.42052 0.37862 0.43540 -0.05335 -0.01962 -0.03434 325 TYR A CG  
2625 C CD1 . TYR A 348 ? 0.41387 0.37417 0.46100 -0.04746 -0.02168 -0.03135 325 TYR A CD1 
2626 C CD2 . TYR A 348 ? 0.37983 0.32335 0.37323 -0.05989 -0.02350 -0.03945 325 TYR A CD2 
2627 C CE1 . TYR A 348 ? 0.40214 0.35070 0.45336 -0.04479 -0.02990 -0.03179 325 TYR A CE1 
2628 C CE2 . TYR A 348 ? 0.42760 0.35435 0.42459 -0.05866 -0.02716 -0.03773 325 TYR A CE2 
2629 C CZ  . TYR A 348 ? 0.42072 0.35053 0.44378 -0.04935 -0.03150 -0.03300 325 TYR A CZ  
2630 O OH  . TYR A 348 ? 0.45391 0.36761 0.47709 -0.04377 -0.03742 -0.03046 325 TYR A OH  
2631 N N   . THR A 349 ? 0.35035 0.35854 0.35274 -0.05071 -0.01512 -0.02618 326 THR A N   
2632 C CA  . THR A 349 ? 0.37430 0.38809 0.36912 -0.03975 -0.00522 -0.01924 326 THR A CA  
2633 C C   . THR A 349 ? 0.37124 0.39578 0.38995 -0.04193 -0.00542 -0.01507 326 THR A C   
2634 O O   . THR A 349 ? 0.35212 0.38325 0.38322 -0.05247 -0.01712 -0.02048 326 THR A O   
2635 C CB  . THR A 349 ? 0.33642 0.35760 0.29638 -0.03641 -0.01296 -0.02541 326 THR A CB  
2636 O OG1 . THR A 349 ? 0.42218 0.44186 0.36317 -0.01836 -0.00165 -0.01680 326 THR A OG1 
2637 C CG2 . THR A 349 ? 0.35158 0.39075 0.31500 -0.04689 -0.02736 -0.03181 326 THR A CG2 
2638 N N   . GLU A 350 ? 0.35549 0.37883 0.37775 -0.03034 0.00941  -0.00510 327 GLU A N   
2639 C CA  . GLU A 350 ? 0.30739 0.33800 0.35456 -0.03165 0.01193  -0.00191 327 GLU A CA  
2640 C C   . GLU A 350 ? 0.30392 0.34825 0.32923 -0.03007 0.00223  -0.00295 327 GLU A C   
2641 O O   . GLU A 350 ? 0.34330 0.38759 0.34422 -0.01581 0.00791  0.00401  327 GLU A O   
2642 C CB  . GLU A 350 ? 0.37104 0.38954 0.43927 -0.02010 0.03713  0.01046  327 GLU A CB  
2643 C CG  . GLU A 350 ? 0.42900 0.43758 0.53136 -0.02204 0.04897  0.00972  327 GLU A CG  
2644 C CD  . GLU A 350 ? 0.51552 0.53431 0.65860 -0.03576 0.03334  -0.00359 327 GLU A CD  
2645 O OE1 . GLU A 350 ? 0.41162 0.43223 0.54997 -0.04145 0.01831  -0.01161 327 GLU A OE1 
2646 O OE2 . GLU A 350 ? 0.47877 0.50240 0.65619 -0.03900 0.03571  -0.00663 327 GLU A OE2 
2647 N N   . ILE A 351 ? 0.31387 0.37005 0.34649 -0.04250 -0.01219 -0.01176 328 ILE A N   
2648 C CA  . ILE A 351 ? 0.32630 0.39846 0.34804 -0.04222 -0.02012 -0.01429 328 ILE A CA  
2649 C C   . ILE A 351 ? 0.35471 0.42873 0.39734 -0.03742 -0.01176 -0.00854 328 ILE A C   
2650 O O   . ILE A 351 ? 0.30855 0.37844 0.37724 -0.04460 -0.01030 -0.01200 328 ILE A O   
2651 C CB  . ILE A 351 ? 0.28877 0.36969 0.30846 -0.05765 -0.03408 -0.02570 328 ILE A CB  
2652 C CG1 . ILE A 351 ? 0.33052 0.40613 0.33295 -0.06302 -0.03980 -0.03202 328 ILE A CG1 
2653 C CG2 . ILE A 351 ? 0.27866 0.37911 0.29676 -0.05742 -0.03945 -0.02923 328 ILE A CG2 
2654 C CD1 . ILE A 351 ? 0.38262 0.46666 0.36396 -0.05350 -0.04293 -0.03504 328 ILE A CD1 
2655 N N   . SER A 352 ? 0.32217 0.40233 0.35366 -0.02390 -0.00758 -0.00136 329 SER A N   
2656 C CA  . SER A 352 ? 0.35829 0.43846 0.40954 -0.01845 0.00160  0.00428  329 SER A CA  
2657 C C   . SER A 352 ? 0.38473 0.48338 0.44084 -0.02666 -0.01069 -0.00535 329 SER A C   
2658 O O   . SER A 352 ? 0.34392 0.45962 0.38425 -0.02599 -0.02213 -0.01029 329 SER A O   
2659 C CB  . SER A 352 ? 0.34841 0.42220 0.38386 0.00434  0.01492  0.01993  329 SER A CB  
2660 O OG  . SER A 352 ? 0.40326 0.45555 0.43533 0.01269  0.03283  0.03074  329 SER A OG  
2661 N N   . PHE A 353 ? 0.34941 0.44524 0.43010 -0.03381 -0.00751 -0.00982 330 PHE A N   
2662 C CA  . PHE A 353 ? 0.33741 0.44695 0.42366 -0.03876 -0.01331 -0.01746 330 PHE A CA  
2663 C C   . PHE A 353 ? 0.37901 0.48450 0.48331 -0.02763 -0.00066 -0.01106 330 PHE A C   
2664 O O   . PHE A 353 ? 0.36121 0.44939 0.48457 -0.02392 0.01274  -0.00594 330 PHE A O   
2665 C CB  . PHE A 353 ? 0.32093 0.42737 0.41409 -0.05378 -0.02003 -0.02997 330 PHE A CB  
2666 C CG  . PHE A 353 ? 0.33852 0.44664 0.41231 -0.06438 -0.03054 -0.03541 330 PHE A CG  
2667 C CD1 . PHE A 353 ? 0.29027 0.38764 0.35804 -0.06616 -0.03284 -0.03364 330 PHE A CD1 
2668 C CD2 . PHE A 353 ? 0.33465 0.45221 0.39919 -0.07242 -0.03477 -0.04200 330 PHE A CD2 
2669 C CE1 . PHE A 353 ? 0.32124 0.41584 0.37213 -0.07491 -0.04030 -0.03776 330 PHE A CE1 
2670 C CE2 . PHE A 353 ? 0.37170 0.48526 0.42035 -0.08212 -0.03967 -0.04541 330 PHE A CE2 
2671 C CZ  . PHE A 353 ? 0.36978 0.47104 0.41067 -0.08311 -0.04307 -0.04314 330 PHE A CZ  
2672 N N   . MET A 354 ? 0.32394 0.44465 0.42745 -0.02233 -0.00296 -0.01186 331 MET A N   
2673 C CA  . MET A 354 ? 0.33346 0.44907 0.45631 -0.01304 0.00908  -0.00792 331 MET A CA  
2674 C C   . MET A 354 ? 0.36253 0.47832 0.50114 -0.02661 0.00704  -0.02320 331 MET A C   
2675 O O   . MET A 354 ? 0.35867 0.48792 0.48703 -0.03621 -0.00271 -0.03269 331 MET A O   
2676 C CB  . MET A 354 ? 0.34794 0.48094 0.46263 0.00352  0.00709  -0.00098 331 MET A CB  
2677 C CG  . MET A 354 ? 0.54163 0.66978 0.63480 0.02507  0.01059  0.01555  331 MET A CG  
2678 S SD  . MET A 354 ? 0.60582 0.69618 0.70878 0.03750  0.03858  0.03399  331 MET A SD  
2679 C CE  . MET A 354 ? 0.44320 0.52738 0.57828 0.04164  0.05187  0.03372  331 MET A CE  
2680 N N   . LEU A 355 ? 0.30550 0.40458 0.46867 -0.02713 0.01737  -0.02674 332 LEU A N   
2681 C CA  . LEU A 355 ? 0.30883 0.40608 0.48422 -0.03628 0.01481  -0.04392 332 LEU A CA  
2682 C C   . LEU A 355 ? 0.35376 0.44568 0.55061 -0.02645 0.02886  -0.04276 332 LEU A C   
2683 O O   . LEU A 355 ? 0.36431 0.43931 0.58406 -0.01862 0.04415  -0.03481 332 LEU A O   
2684 C CB  . LEU A 355 ? 0.33142 0.41530 0.52328 -0.04568 0.01101  -0.05626 332 LEU A CB  
2685 C CG  . LEU A 355 ? 0.34056 0.42085 0.54266 -0.05184 0.00549  -0.07790 332 LEU A CG  
2686 C CD1 . LEU A 355 ? 0.28183 0.37255 0.44857 -0.05655 -0.00589 -0.08520 332 LEU A CD1 
2687 C CD2 . LEU A 355 ? 0.32468 0.39611 0.54989 -0.05834 -0.00210 -0.09234 332 LEU A CD2 
2688 N N   . TRP A 356 ? 0.32506 0.42884 0.51652 -0.02660 0.02678  -0.05027 333 TRP A N   
2689 C CA  . TRP A 356 ? 0.32458 0.42435 0.53554 -0.01702 0.03966  -0.05124 333 TRP A CA  
2690 C C   . TRP A 356 ? 0.36961 0.46357 0.58564 -0.02618 0.03798  -0.07344 333 TRP A C   
2691 O O   . TRP A 356 ? 0.35037 0.45453 0.54324 -0.03397 0.02860  -0.08280 333 TRP A O   
2692 C CB  . TRP A 356 ? 0.32001 0.44146 0.52285 -0.00596 0.03958  -0.04228 333 TRP A CB  
2693 C CG  . TRP A 356 ? 0.40769 0.53541 0.60182 0.00851  0.03885  -0.02300 333 TRP A CG  
2694 C CD1 . TRP A 356 ? 0.39476 0.53371 0.56727 0.00600  0.02650  -0.01798 333 TRP A CD1 
2695 C CD2 . TRP A 356 ? 0.46924 0.59054 0.67101 0.03089  0.05080  -0.00638 333 TRP A CD2 
2696 N NE1 . TRP A 356 ? 0.44059 0.58154 0.60396 0.02627  0.02840  -0.00091 333 TRP A NE1 
2697 C CE2 . TRP A 356 ? 0.44594 0.57569 0.62484 0.04304  0.04338  0.00807  333 TRP A CE2 
2698 C CE3 . TRP A 356 ? 0.53639 0.64315 0.75988 0.04378  0.06776  -0.00211 333 TRP A CE3 
2699 C CZ2 . TRP A 356 ? 0.46538 0.58909 0.63668 0.07006  0.05152  0.02789  333 TRP A CZ2 
2700 C CZ3 . TRP A 356 ? 0.54731 0.64670 0.76740 0.06961  0.07793  0.01940  333 TRP A CZ3 
2701 C CH2 . TRP A 356 ? 0.57224 0.67997 0.76361 0.08372  0.06937  0.03487  333 TRP A CH2 
2702 N N   . CYS A 357 ? 0.35338 0.42893 0.59853 -0.02401 0.04874  -0.08219 334 CYS A N   
2703 C CA  . CYS A 357 ? 0.41095 0.47874 0.66110 -0.03067 0.04550  -0.10757 334 CYS A CA  
2704 C C   . CYS A 357 ? 0.44711 0.50483 0.72225 -0.02148 0.06261  -0.11157 334 CYS A C   
2705 O O   . CYS A 357 ? 0.43867 0.48780 0.73605 -0.01057 0.07845  -0.09507 334 CYS A O   
2706 C CB  . CYS A 357 ? 0.41353 0.46825 0.68313 -0.03984 0.03752  -0.12423 334 CYS A CB  
2707 S SG  . CYS A 357 ? 0.39073 0.45495 0.63334 -0.04875 0.01713  -0.12156 334 CYS A SG  
2708 N N   . LYS A 358 ? 0.43622 0.49175 0.70463 -0.02401 0.06060  -0.13352 335 LYS A N   
2709 C CA  . LYS A 358 ? 0.47702 0.51930 0.77090 -0.01662 0.07651  -0.14348 335 LYS A CA  
2710 C C   . LYS A 358 ? 0.52179 0.55301 0.81357 -0.02387 0.06768  -0.17732 335 LYS A C   
2711 O O   . LYS A 358 ? 0.52687 0.56632 0.77909 -0.02760 0.05416  -0.18851 335 LYS A O   
2712 C CB  . LYS A 358 ? 0.54632 0.60327 0.82828 -0.00588 0.08608  -0.13304 335 LYS A CB  
2713 C CG  . LYS A 358 ? 0.62895 0.67160 0.93710 0.00395  0.10426  -0.14212 335 LYS A CG  
2714 C CD  . LYS A 358 ? 0.68610 0.74724 0.99080 0.01711  0.11403  -0.12861 335 LYS A CD  
2715 C CE  . LYS A 358 ? 0.80090 0.84548 1.13387 0.02896  0.13384  -0.13644 335 LYS A CE  
2716 N NZ  . LYS A 358 ? 0.83933 0.85586 1.20891 0.03490  0.14735  -0.12984 335 LYS A NZ  
2717 N N   . ASP A 359 ? 0.54611 0.55723 0.87952 -0.02480 0.07553  -0.19436 336 ASP A N   
2718 C CA  . ASP A 359 ? 0.56521 0.56613 0.90106 -0.02936 0.06552  -0.23221 336 ASP A CA  
2719 C C   . ASP A 359 ? 0.56639 0.57610 0.87286 -0.03719 0.03756  -0.24886 336 ASP A C   
2720 O O   . ASP A 359 ? 0.61375 0.62251 0.88751 -0.03552 0.02399  -0.27396 336 ASP A O   
2721 C CB  . ASP A 359 ? 0.63355 0.63351 0.94383 -0.02127 0.07318  -0.24319 336 ASP A CB  
2722 C CG  . ASP A 359 ? 0.73809 0.72733 1.08241 -0.01105 0.09999  -0.23186 336 ASP A CG  
2723 O OD1 . ASP A 359 ? 0.75500 0.72672 1.14802 -0.01090 0.11314  -0.22919 336 ASP A OD1 
2724 O OD2 . ASP A 359 ? 0.80788 0.80528 1.13190 -0.00209 0.10989  -0.22487 336 ASP A OD2 
2725 N N   . GLY A 360 ? 0.49140 0.50861 0.80398 -0.04307 0.02900  -0.23420 337 GLY A N   
2726 C CA  . GLY A 360 ? 0.51534 0.54009 0.80495 -0.04816 0.00240  -0.24922 337 GLY A CA  
2727 C C   . GLY A 360 ? 0.52393 0.56036 0.74874 -0.04567 -0.00834 -0.23626 337 GLY A C   
2728 O O   . GLY A 360 ? 0.56391 0.60355 0.76233 -0.04658 -0.03027 -0.24734 337 GLY A O   
2729 N N   . HIS A 361 ? 0.55177 0.59436 0.75303 -0.04177 0.00671  -0.21414 338 HIS A N   
2730 C CA  . HIS A 361 ? 0.52885 0.58148 0.67980 -0.04201 0.00126  -0.19955 338 HIS A CA  
2731 C C   . HIS A 361 ? 0.47762 0.54313 0.63801 -0.04406 0.01056  -0.16879 338 HIS A C   
2732 O O   . HIS A 361 ? 0.43092 0.49732 0.62606 -0.04094 0.02367  -0.15680 338 HIS A O   
2733 C CB  . HIS A 361 ? 0.56603 0.61674 0.67747 -0.03596 0.00992  -0.20577 338 HIS A CB  
2734 C CG  . HIS A 361 ? 0.66480 0.71786 0.80042 -0.03100 0.03192  -0.20041 338 HIS A CG  
2735 N ND1 . HIS A 361 ? 0.67889 0.74780 0.82424 -0.02995 0.04516  -0.17560 338 HIS A ND1 
2736 C CD2 . HIS A 361 ? 0.68332 0.72550 0.83686 -0.02525 0.04196  -0.21822 338 HIS A CD2 
2737 C CE1 . HIS A 361 ? 0.65692 0.72566 0.82515 -0.02240 0.06193  -0.17669 338 HIS A CE1 
2738 N NE2 . HIS A 361 ? 0.67337 0.72420 0.84685 -0.01991 0.06198  -0.20146 338 HIS A NE2 
2739 N N   . VAL A 362 ? 0.41373 0.48736 0.54040 -0.04756 0.00364  -0.15674 339 VAL A N   
2740 C CA  . VAL A 362 ? 0.37580 0.46317 0.50749 -0.04957 0.00848  -0.13230 339 VAL A CA  
2741 C C   . VAL A 362 ? 0.41406 0.51445 0.54816 -0.04502 0.02372  -0.12320 339 VAL A C   
2742 O O   . VAL A 362 ? 0.42225 0.52233 0.53707 -0.04377 0.03063  -0.13142 339 VAL A O   
2743 C CB  . VAL A 362 ? 0.39225 0.48208 0.49166 -0.05568 -0.00286 -0.12554 339 VAL A CB  
2744 C CG1 . VAL A 362 ? 0.35431 0.45904 0.46079 -0.05782 0.00092  -0.10472 339 VAL A CG1 
2745 C CG2 . VAL A 362 ? 0.39319 0.47300 0.49478 -0.05790 -0.01970 -0.13541 339 VAL A CG2 
2746 N N   . GLU A 363 ? 0.39630 0.50835 0.55398 -0.04039 0.02938  -0.10666 340 GLU A N   
2747 C CA  . GLU A 363 ? 0.39309 0.52551 0.55558 -0.03558 0.03813  -0.09749 340 GLU A CA  
2748 C C   . GLU A 363 ? 0.38296 0.53274 0.53451 -0.04116 0.03071  -0.08621 340 GLU A C   
2749 O O   . GLU A 363 ? 0.39195 0.55537 0.53629 -0.04570 0.03491  -0.08746 340 GLU A O   
2750 C CB  . GLU A 363 ? 0.42019 0.55588 0.61403 -0.02187 0.04741  -0.08841 340 GLU A CB  
2751 C CG  . GLU A 363 ? 0.58988 0.70666 0.80022 -0.01695 0.05792  -0.10097 340 GLU A CG  
2752 C CD  . GLU A 363 ? 0.70968 0.83294 0.94524 -0.00170 0.07186  -0.09337 340 GLU A CD  
2753 O OE1 . GLU A 363 ? 0.75152 0.88010 0.98879 0.00097  0.08081  -0.10291 340 GLU A OE1 
2754 O OE2 . GLU A 363 ? 0.72783 0.84967 0.97915 0.00967  0.07492  -0.07685 340 GLU A OE2 
2755 N N   . THR A 364 ? 0.32882 0.47714 0.48154 -0.04116 0.02185  -0.07640 341 THR A N   
2756 C CA  . THR A 364 ? 0.32629 0.48656 0.46579 -0.04787 0.01318  -0.06994 341 THR A CA  
2757 C C   . THR A 364 ? 0.33008 0.47750 0.46290 -0.04976 0.00441  -0.06428 341 THR A C   
2758 O O   . THR A 364 ? 0.31645 0.44923 0.46152 -0.04502 0.00677  -0.06322 341 THR A O   
2759 C CB  . THR A 364 ? 0.35748 0.54484 0.51234 -0.04055 0.01279  -0.06271 341 THR A CB  
2760 O OG1 . THR A 364 ? 0.36393 0.56262 0.50886 -0.05025 0.00471  -0.06255 341 THR A OG1 
2761 C CG2 . THR A 364 ? 0.38124 0.56817 0.54685 -0.02438 0.01148  -0.05051 341 THR A CG2 
2762 N N   . PHE A 365 ? 0.31748 0.46951 0.43452 -0.05748 -0.00341 -0.06166 342 PHE A N   
2763 C CA  . PHE A 365 ? 0.29860 0.43881 0.40686 -0.06036 -0.01107 -0.05748 342 PHE A CA  
2764 C C   . PHE A 365 ? 0.38174 0.53439 0.47910 -0.06522 -0.01700 -0.05372 342 PHE A C   
2765 O O   . PHE A 365 ? 0.37783 0.53470 0.46627 -0.07456 -0.01616 -0.05883 342 PHE A O   
2766 C CB  . PHE A 365 ? 0.28995 0.41255 0.38519 -0.06754 -0.01581 -0.06687 342 PHE A CB  
2767 C CG  . PHE A 365 ? 0.33832 0.45014 0.43056 -0.06978 -0.02379 -0.06435 342 PHE A CG  
2768 C CD1 . PHE A 365 ? 0.34507 0.45170 0.45827 -0.06401 -0.02062 -0.05897 342 PHE A CD1 
2769 C CD2 . PHE A 365 ? 0.37461 0.47920 0.44389 -0.07647 -0.03167 -0.06657 342 PHE A CD2 
2770 C CE1 . PHE A 365 ? 0.32826 0.42578 0.44395 -0.06597 -0.02548 -0.05761 342 PHE A CE1 
2771 C CE2 . PHE A 365 ? 0.37940 0.47495 0.44907 -0.07713 -0.03910 -0.06496 342 PHE A CE2 
2772 C CZ  . PHE A 365 ? 0.37531 0.46905 0.47009 -0.07246 -0.03617 -0.06143 342 PHE A CZ  
2773 N N   . TYR A 366 ? 0.31861 0.47642 0.41716 -0.05788 -0.02081 -0.04565 343 TYR A N   
2774 C CA  . TYR A 366 ? 0.32264 0.49565 0.41460 -0.06127 -0.02822 -0.04676 343 TYR A CA  
2775 C C   . TYR A 366 ? 0.39158 0.55738 0.47194 -0.05473 -0.03316 -0.03974 343 TYR A C   
2776 O O   . TYR A 366 ? 0.32944 0.48576 0.41129 -0.04205 -0.02788 -0.03038 343 TYR A O   
2777 C CB  . TYR A 366 ? 0.30394 0.50512 0.41174 -0.05428 -0.02990 -0.04956 343 TYR A CB  
2778 C CG  . TYR A 366 ? 0.35499 0.56052 0.46926 -0.03374 -0.02832 -0.04032 343 TYR A CG  
2779 C CD1 . TYR A 366 ? 0.33430 0.54491 0.43700 -0.01867 -0.03567 -0.03324 343 TYR A CD1 
2780 C CD2 . TYR A 366 ? 0.31446 0.51484 0.44247 -0.02733 -0.01787 -0.03809 343 TYR A CD2 
2781 C CE1 . TYR A 366 ? 0.36153 0.57073 0.46362 0.00394  -0.03138 -0.02123 343 TYR A CE1 
2782 C CE2 . TYR A 366 ? 0.31243 0.51137 0.44601 -0.00703 -0.01306 -0.02721 343 TYR A CE2 
2783 C CZ  . TYR A 366 ? 0.38109 0.58370 0.50015 0.00928  -0.01927 -0.01734 343 TYR A CZ  
2784 O OH  . TYR A 366 ? 0.46152 0.65799 0.57949 0.03306  -0.01211 -0.00324 343 TYR A OH  
2785 N N   . PRO A 367 ? 0.40462 0.57203 0.47377 -0.06258 -0.04021 -0.04391 344 PRO A N   
2786 C CA  . PRO A 367 ? 0.46935 0.62872 0.52384 -0.05573 -0.04385 -0.03889 344 PRO A CA  
2787 C C   . PRO A 367 ? 0.55604 0.73302 0.60508 -0.03928 -0.05013 -0.03720 344 PRO A C   
2788 O O   . PRO A 367 ? 0.52717 0.72788 0.58823 -0.03590 -0.05572 -0.04315 344 PRO A O   
2789 C CB  . PRO A 367 ? 0.43939 0.59402 0.48543 -0.07053 -0.04888 -0.04685 344 PRO A CB  
2790 C CG  . PRO A 367 ? 0.40463 0.57465 0.46352 -0.08169 -0.04885 -0.05627 344 PRO A CG  
2791 C CD  . PRO A 367 ? 0.35295 0.52633 0.42324 -0.07822 -0.04176 -0.05362 344 PRO A CD  
2792 N N   . LYS A 368 ? 0.68121 0.84622 0.71091 -0.02682 -0.04904 -0.02926 345 LYS A N   
2793 C CA  . LYS A 368 ? 0.74627 0.92367 0.75709 -0.00720 -0.05747 -0.02820 345 LYS A CA  
2794 C C   . LYS A 368 ? 0.75115 0.92321 0.74052 -0.00952 -0.06489 -0.03540 345 LYS A C   
2795 O O   . LYS A 368 ? 0.59011 0.74073 0.57560 -0.01908 -0.05730 -0.03276 345 LYS A O   
2796 C CB  . LYS A 368 ? 0.71350 0.87623 0.71225 0.01655  -0.04467 -0.00931 345 LYS A CB  
2797 C CG  . LYS A 368 ? 0.71267 0.87337 0.73639 0.01679  -0.03364 -0.00278 345 LYS A CG  
2798 C CD  . LYS A 368 ? 0.76472 0.90971 0.77902 0.04230  -0.01858 0.01666  345 LYS A CD  
2799 C CE  . LYS A 368 ? 0.78178 0.89428 0.79129 0.04426  0.00137  0.02951  345 LYS A CE  
2800 N NZ  . LYS A 368 ? 0.86260 0.95405 0.86293 0.06981  0.02227  0.05101  345 LYS A NZ  
2801 N N   . LEU A 369 ? 0.82295 1.01604 0.80061 0.00021  -0.08121 -0.04686 346 LEU A N   
2802 C CA  . LEU A 369 ? 0.83089 1.02063 0.78794 -0.00090 -0.09032 -0.05843 346 LEU A CA  
2803 C C   . LEU A 369 ? 0.88848 1.06718 0.80308 0.02741  -0.08997 -0.04946 346 LEU A C   
2804 O O   . LEU A 369 ? 0.95083 1.11929 0.85161 0.04781  -0.07861 -0.03048 346 LEU A O   
2805 C CB  . LEU A 369 ? 0.76700 0.98750 0.74266 -0.01099 -0.11010 -0.08354 346 LEU A CB  
2806 C CG  . LEU A 369 ? 0.77698 0.99813 0.73544 -0.01139 -0.12301 -0.10188 346 LEU A CG  
2807 C CD1 . LEU A 369 ? 0.72836 0.91751 0.67962 -0.02699 -0.10957 -0.09798 346 LEU A CD1 
2808 C CD2 . LEU A 369 ? 0.80559 1.06032 0.79674 -0.02402 -0.14182 -0.13071 346 LEU A CD2 
2809 N N   A ASN B 23  ? 0.87740 0.79530 0.83364 -0.13437 -0.01137 -0.08365 0   ASN B N   
2810 N N   B ASN B 23  ? 0.74446 0.87562 0.79016 -0.13484 -0.08028 -0.04942 0   ASN B N   
2811 C CA  A ASN B 23  ? 0.86243 0.76901 0.79139 -0.11195 -0.00528 -0.08451 0   ASN B CA  
2812 C CA  B ASN B 23  ? 0.68655 0.76914 0.69950 -0.12269 -0.06144 -0.05264 0   ASN B CA  
2813 C C   A ASN B 23  ? 0.71279 0.65249 0.65591 -0.09011 -0.00503 -0.06379 0   ASN B C   
2814 C C   B ASN B 23  ? 0.64154 0.72928 0.64296 -0.09547 -0.05573 -0.04016 0   ASN B C   
2815 O O   A ASN B 23  ? 0.64175 0.56851 0.58626 -0.07215 0.00781  -0.05372 0   ASN B O   
2816 O O   B ASN B 23  ? 0.60216 0.71653 0.62796 -0.08369 -0.05282 -0.02565 0   ASN B O   
2817 C CB  A ASN B 23  ? 0.88644 0.74086 0.80274 -0.10336 0.01535  -0.08989 0   ASN B CB  
2818 C CB  B ASN B 23  ? 0.69520 0.75347 0.72478 -0.12745 -0.04166 -0.04842 0   ASN B CB  
2819 N N   A MET B 24  ? 0.64613 0.62840 0.60132 -0.09214 -0.01998 -0.05761 1   MET B N   
2820 N N   B MET B 24  ? 0.54641 0.60692 0.51084 -0.08646 -0.05214 -0.04681 1   MET B N   
2821 C CA  A MET B 24  ? 0.54171 0.55074 0.50643 -0.07306 -0.01957 -0.04129 1   MET B CA  
2822 C CA  B MET B 24  ? 0.52201 0.58540 0.47644 -0.06450 -0.04646 -0.03614 1   MET B CA  
2823 C C   A MET B 24  ? 0.46986 0.47247 0.40739 -0.05890 -0.01881 -0.04384 1   MET B C   
2824 C C   B MET B 24  ? 0.45952 0.48542 0.38811 -0.05669 -0.03135 -0.04240 1   MET B C   
2825 O O   A MET B 24  ? 0.50445 0.50080 0.41640 -0.06509 -0.02575 -0.05596 1   MET B O   
2826 O O   B MET B 24  ? 0.52771 0.52731 0.43328 -0.06583 -0.02927 -0.05751 1   MET B O   
2827 C CB  A MET B 24  ? 0.56933 0.62236 0.55765 -0.07747 -0.03330 -0.03407 1   MET B CB  
2828 C CB  B MET B 24  ? 0.46190 0.54919 0.40399 -0.05998 -0.06292 -0.03264 1   MET B CB  
2829 C CG  A MET B 24  ? 0.59460 0.66953 0.59479 -0.05905 -0.02966 -0.01859 1   MET B CG  
2830 C CG  B MET B 24  ? 0.50194 0.58881 0.42034 -0.07711 -0.08004 -0.04650 1   MET B CG  
2831 S SD  A MET B 24  ? 0.63827 0.70180 0.65209 -0.05267 -0.01137 -0.00669 1   MET B SD  
2832 S SD  B MET B 24  ? 0.44928 0.57041 0.35501 -0.07196 -0.10487 -0.03691 1   MET B SD  
2833 C CE  A MET B 24  ? 0.49065 0.56770 0.53508 -0.07379 -0.01053 -0.00643 1   MET B CE  
2834 C CE  B MET B 24  ? 0.41195 0.54527 0.30865 -0.10051 -0.13055 -0.05350 1   MET B CE  
2835 N N   A SER B 25  ? 0.42886 0.43291 0.37016 -0.04160 -0.01013 -0.03252 2   SER B N   
2836 N N   B SER B 25  ? 0.41639 0.44047 0.35088 -0.04028 -0.02039 -0.03152 2   SER B N   
2837 C CA  A SER B 25  ? 0.42602 0.42584 0.34774 -0.02960 -0.00658 -0.03306 2   SER B CA  
2838 C CA  B SER B 25  ? 0.42921 0.42793 0.34988 -0.03004 -0.00650 -0.03381 2   SER B CA  
2839 C C   A SER B 25  ? 0.39407 0.40453 0.32922 -0.01529 -0.00141 -0.01933 2   SER B C   
2840 C C   B SER B 25  ? 0.39381 0.40228 0.32792 -0.01536 -0.00077 -0.02008 2   SER B C   
2841 O O   A SER B 25  ? 0.38715 0.39969 0.33921 -0.01333 0.00171  -0.01134 2   SER B O   
2842 O O   B SER B 25  ? 0.37223 0.38124 0.32307 -0.01332 0.00280  -0.01232 2   SER B O   
2843 C CB  A SER B 25  ? 0.47358 0.44066 0.37742 -0.02799 0.00616  -0.04440 2   SER B CB  
2844 C CB  B SER B 25  ? 0.44004 0.40776 0.36219 -0.03522 0.00404  -0.04135 2   SER B CB  
2845 O OG  A SER B 25  ? 0.41098 0.36634 0.33126 -0.01682 0.01839  -0.03666 2   SER B OG  
2846 O OG  B SER B 25  ? 0.43480 0.38455 0.35481 -0.02104 0.01812  -0.03943 2   SER B OG  
2847 N N   . LEU B 26  ? 0.40254 0.41719 0.32660 -0.00690 -0.00003 -0.01703 3   LEU B N   
2848 C CA  . LEU B 26  ? 0.34141 0.36292 0.27648 0.00363  0.00452  -0.00701 3   LEU B CA  
2849 C C   . LEU B 26  ? 0.33491 0.34504 0.28189 0.00866  0.01284  -0.00448 3   LEU B C   
2850 O O   . LEU B 26  ? 0.31291 0.33005 0.27193 0.01222  0.01147  0.00425  3   LEU B O   
2851 C CB  . LEU B 26  ? 0.35536 0.37745 0.27688 0.00876  0.00798  -0.00621 3   LEU B CB  
2852 C CG  . LEU B 26  ? 0.36876 0.39585 0.30171 0.01596  0.01342  0.00134  3   LEU B CG  
2853 C CD1 . LEU B 26  ? 0.35558 0.39415 0.29827 0.01687  0.00638  0.00834  3   LEU B CD1 
2854 C CD2 . LEU B 26  ? 0.36797 0.39266 0.28704 0.01770  0.02003  0.00204  3   LEU B CD2 
2855 N N   . GLU B 27  ? 0.32310 0.31477 0.26503 0.01033  0.02187  -0.01162 4   GLU B N   
2856 C CA  . GLU B 27  ? 0.37928 0.36181 0.33711 0.01916  0.02961  -0.00632 4   GLU B CA  
2857 C C   . GLU B 27  ? 0.35645 0.33040 0.32266 0.01604  0.02709  -0.00048 4   GLU B C   
2858 O O   . GLU B 27  ? 0.36004 0.33462 0.33906 0.02401  0.02750  0.01087  4   GLU B O   
2859 C CB  . GLU B 27  ? 0.38145 0.34342 0.33410 0.02424  0.04379  -0.01586 4   GLU B CB  
2860 C CG  . GLU B 27  ? 0.44172 0.41517 0.39165 0.03000  0.05126  -0.01669 4   GLU B CG  
2861 C CD  . GLU B 27  ? 0.50781 0.48130 0.42731 0.02145  0.04894  -0.02487 4   GLU B CD  
2862 O OE1 . GLU B 27  ? 0.41514 0.38769 0.31983 0.01130  0.03723  -0.02906 4   GLU B OE1 
2863 O OE2 . GLU B 27  ? 0.51200 0.48765 0.42298 0.02491  0.05917  -0.02585 4   GLU B OE2 
2864 N N   . ASN B 28  ? 0.34783 0.31501 0.30736 0.00360  0.02396  -0.00674 5   ASN B N   
2865 C CA  . ASN B 28  ? 0.32848 0.28725 0.29689 -0.00166 0.02444  0.00050  5   ASN B CA  
2866 C C   . ASN B 28  ? 0.33954 0.32123 0.31373 -0.00092 0.01876  0.01233  5   ASN B C   
2867 O O   . ASN B 28  ? 0.35507 0.33147 0.33277 0.00164  0.02119  0.02400  5   ASN B O   
2868 C CB  . ASN B 28  ? 0.37677 0.32332 0.34127 -0.01855 0.02363  -0.01073 5   ASN B CB  
2869 C CG  . ASN B 28  ? 0.42585 0.36568 0.40223 -0.02755 0.02632  -0.00203 5   ASN B CG  
2870 O OD1 . ASN B 28  ? 0.39549 0.35666 0.38059 -0.03756 0.02140  0.00019  5   ASN B OD1 
2871 N ND2 . ASN B 28  ? 0.40657 0.31669 0.38509 -0.02301 0.03584  0.00458  5   ASN B ND2 
2872 N N   . VAL B 29  ? 0.32670 0.33084 0.29895 -0.00242 0.01240  0.01000  6   VAL B N   
2873 C CA  . VAL B 29  ? 0.33405 0.35504 0.30885 0.00061  0.01050  0.01865  6   VAL B CA  
2874 C C   . VAL B 29  ? 0.34109 0.35978 0.31267 0.01033  0.01046  0.02645  6   VAL B C   
2875 O O   . VAL B 29  ? 0.32972 0.34826 0.29756 0.01153  0.01094  0.03545  6   VAL B O   
2876 C CB  . VAL B 29  ? 0.32053 0.36066 0.29489 0.00130  0.00531  0.01515  6   VAL B CB  
2877 C CG1 . VAL B 29  ? 0.28063 0.33115 0.25500 0.00602  0.00703  0.02155  6   VAL B CG1 
2878 C CG2 . VAL B 29  ? 0.32852 0.37910 0.31060 -0.00831 0.00095  0.01010  6   VAL B CG2 
2879 N N   . ALA B 30  ? 0.30850 0.32680 0.28121 0.01647  0.00972  0.02356  7   ALA B N   
2880 C CA  . ALA B 30  ? 0.31702 0.34014 0.29387 0.02401  0.00673  0.03103  7   ALA B CA  
2881 C C   . ALA B 30  ? 0.34959 0.36098 0.33108 0.02894  0.00756  0.04127  7   ALA B C   
2882 O O   . ALA B 30  ? 0.34689 0.36423 0.32585 0.03251  0.00107  0.05167  7   ALA B O   
2883 C CB  . ALA B 30  ? 0.29532 0.32378 0.27990 0.02846  0.00866  0.02647  7   ALA B CB  
2884 N N   . PHE B 31  ? 0.32327 0.31514 0.30903 0.02923  0.01499  0.03889  8   PHE B N   
2885 C CA  . PHE B 31  ? 0.34691 0.32156 0.33696 0.03522  0.01732  0.05125  8   PHE B CA  
2886 C C   . PHE B 31  ? 0.37840 0.35229 0.35566 0.02962  0.01481  0.06233  8   PHE B C   
2887 O O   . PHE B 31  ? 0.35996 0.33180 0.33303 0.03634  0.01033  0.07776  8   PHE B O   
2888 C CB  . PHE B 31  ? 0.35989 0.30549 0.35307 0.03343  0.02833  0.04417  8   PHE B CB  
2889 C CG  . PHE B 31  ? 0.37448 0.29388 0.37132 0.03913  0.03323  0.05841  8   PHE B CG  
2890 C CD1 . PHE B 31  ? 0.41766 0.32154 0.40583 0.02785  0.03664  0.06397  8   PHE B CD1 
2891 C CD2 . PHE B 31  ? 0.42398 0.33466 0.43593 0.05646  0.03575  0.06788  8   PHE B CD2 
2892 C CE1 . PHE B 31  ? 0.51445 0.38895 0.50351 0.03290  0.04273  0.07979  8   PHE B CE1 
2893 C CE2 . PHE B 31  ? 0.50935 0.39235 0.52479 0.06445  0.04024  0.08422  8   PHE B CE2 
2894 C CZ  . PHE B 31  ? 0.55184 0.41419 0.55298 0.05210  0.04379  0.09051  8   PHE B CZ  
2895 N N   . ASN B 32  ? 0.36589 0.34222 0.33700 0.01762  0.01832  0.05582  9   ASN B N   
2896 C CA  . ASN B 32  ? 0.38826 0.36459 0.34812 0.01204  0.02113  0.06578  9   ASN B CA  
2897 C C   . ASN B 32  ? 0.36529 0.35738 0.30960 0.01659  0.01409  0.07128  9   ASN B C   
2898 O O   . ASN B 32  ? 0.42318 0.40916 0.35062 0.01776  0.01412  0.08464  9   ASN B O   
2899 C CB  . ASN B 32  ? 0.36262 0.34643 0.32820 -0.00093 0.02708  0.05711  9   ASN B CB  
2900 C CG  . ASN B 32  ? 0.40702 0.37019 0.38225 -0.01115 0.03443  0.05580  9   ASN B CG  
2901 O OD1 . ASN B 32  ? 0.40987 0.36317 0.38444 -0.01877 0.04289  0.06546  9   ASN B OD1 
2902 N ND2 . ASN B 32  ? 0.36968 0.32298 0.35133 -0.01272 0.03278  0.04333  9   ASN B ND2 
2903 N N   . VAL B 33  ? 0.33375 0.34289 0.27934 0.01777  0.00854  0.06097  10  VAL B N   
2904 C CA  . VAL B 33  ? 0.33866 0.35795 0.26744 0.01937  0.00178  0.06252  10  VAL B CA  
2905 C C   . VAL B 33  ? 0.37374 0.39248 0.29825 0.02613  -0.00928 0.07458  10  VAL B C   
2906 O O   . VAL B 33  ? 0.40142 0.41911 0.30237 0.02569  -0.01445 0.08352  10  VAL B O   
2907 C CB  . VAL B 33  ? 0.35545 0.38718 0.28950 0.01883  -0.00128 0.04971  10  VAL B CB  
2908 C CG1 . VAL B 33  ? 0.39486 0.43200 0.31158 0.01812  -0.00935 0.04867  10  VAL B CG1 
2909 C CG2 . VAL B 33  ? 0.34054 0.37614 0.27873 0.01477  0.00735  0.04145  10  VAL B CG2 
2910 N N   . VAL B 34  ? 0.32888 0.34880 0.27578 0.03325  -0.01269 0.07608  11  VAL B N   
2911 C CA  . VAL B 34  ? 0.32399 0.35113 0.27690 0.04210  -0.02511 0.08919  11  VAL B CA  
2912 C C   . VAL B 34  ? 0.42042 0.43092 0.35935 0.04654  -0.02535 0.10798  11  VAL B C   
2913 O O   . VAL B 34  ? 0.48361 0.50097 0.40753 0.04980  -0.03877 0.12128  11  VAL B O   
2914 C CB  . VAL B 34  ? 0.37683 0.41009 0.36292 0.05102  -0.02373 0.08681  11  VAL B CB  
2915 C CG1 . VAL B 34  ? 0.42846 0.47069 0.43190 0.06415  -0.03480 0.10434  11  VAL B CG1 
2916 C CG2 . VAL B 34  ? 0.36910 0.42003 0.36426 0.04579  -0.02461 0.07252  11  VAL B CG2 
2917 N N   . ASN B 35  ? 0.44232 0.42933 0.38405 0.04544  -0.01130 0.11013  12  ASN B N   
2918 C CA  . ASN B 35  ? 0.43824 0.40276 0.37105 0.05065  -0.00868 0.13045  12  ASN B CA  
2919 C C   . ASN B 35  ? 0.47665 0.43040 0.37793 0.04042  -0.00120 0.13757  12  ASN B C   
2920 O O   . ASN B 35  ? 0.50346 0.44200 0.38645 0.04454  -0.00227 0.15843  12  ASN B O   
2921 C CB  . ASN B 35  ? 0.47479 0.41290 0.42911 0.05388  0.00461  0.12893  12  ASN B CB  
2922 C CG  . ASN B 35  ? 0.57049 0.51313 0.55394 0.06921  0.00111  0.12848  12  ASN B CG  
2923 O OD1 . ASN B 35  ? 0.62830 0.56696 0.62035 0.08384  -0.00498 0.14719  12  ASN B OD1 
2924 N ND2 . ASN B 35  ? 0.48394 0.43690 0.48273 0.06692  0.00543  0.10873  12  ASN B ND2 
2925 N N   . LYS B 36  ? 0.40731 0.36885 0.30271 0.02844  0.00767  0.12258  13  LYS B N   
2926 C CA  . LYS B 36  ? 0.40620 0.36009 0.27895 0.01871  0.02059  0.12783  13  LYS B CA  
2927 C C   . LYS B 36  ? 0.43578 0.40709 0.28553 0.01439  0.02022  0.11833  13  LYS B C   
2928 O O   . LYS B 36  ? 0.46555 0.43233 0.29444 0.00781  0.03396  0.12222  13  LYS B O   
2929 C CB  . LYS B 36  ? 0.43772 0.38441 0.33247 0.00772  0.03652  0.11926  13  LYS B CB  
2930 C CG  . LYS B 36  ? 0.54051 0.46230 0.45559 0.00913  0.03970  0.12330  13  LYS B CG  
2931 C CD  . LYS B 36  ? 0.61518 0.50987 0.51529 0.01556  0.04171  0.14792  13  LYS B CD  
2932 C CE  . LYS B 36  ? 0.74249 0.62155 0.62907 0.00258  0.05877  0.15927  13  LYS B CE  
2933 N NZ  . LYS B 36  ? 0.85111 0.69226 0.72828 0.00746  0.06440  0.18442  13  LYS B NZ  
2934 N N   . GLY B 37  ? 0.41744 0.40586 0.27086 0.01744  0.00786  0.10560  14  GLY B N   
2935 C CA  . GLY B 37  ? 0.46211 0.46018 0.29381 0.01347  0.00876  0.09396  14  GLY B CA  
2936 C C   . GLY B 37  ? 0.47479 0.48094 0.32345 0.00932  0.02220  0.07851  14  GLY B C   
2937 O O   . GLY B 37  ? 0.45966 0.47068 0.29523 0.00856  0.02451  0.06741  14  GLY B O   
2938 N N   . HIS B 38  ? 0.42004 0.42709 0.29755 0.00667  0.03017  0.07740  15  HIS B N   
2939 C CA  . HIS B 38  ? 0.38549 0.40556 0.28354 0.00326  0.03977  0.06608  15  HIS B CA  
2940 C C   . HIS B 38  ? 0.39863 0.41750 0.32514 -0.00196 0.04111  0.06641  15  HIS B C   
2941 O O   . HIS B 38  ? 0.36073 0.36372 0.28728 -0.00177 0.03784  0.07427  15  HIS B O   
2942 C CB  . HIS B 38  ? 0.34475 0.36810 0.23087 0.00018  0.05734  0.06750  15  HIS B CB  
2943 C CG  . HIS B 38  ? 0.38686 0.40313 0.27527 -0.00741 0.07089  0.08026  15  HIS B CG  
2944 N ND1 . HIS B 38  ? 0.40270 0.43276 0.31738 -0.01456 0.08652  0.07936  15  HIS B ND1 
2945 C CD2 . HIS B 38  ? 0.42946 0.42619 0.29915 -0.00940 0.07154  0.09595  15  HIS B CD2 
2946 C CE1 . HIS B 38  ? 0.44765 0.46560 0.35945 -0.02305 0.09792  0.09281  15  HIS B CE1 
2947 N NE2 . HIS B 38  ? 0.45123 0.44595 0.33373 -0.01927 0.08940  0.10375  15  HIS B NE2 
2948 N N   . PHE B 39  ? 0.37600 0.41014 0.32625 -0.00647 0.04498  0.05803  16  PHE B N   
2949 C CA  . PHE B 39  ? 0.34777 0.38022 0.32093 -0.01504 0.04377  0.05537  16  PHE B CA  
2950 C C   . PHE B 39  ? 0.36175 0.38493 0.33887 -0.02558 0.05671  0.06551  16  PHE B C   
2951 O O   . PHE B 39  ? 0.36389 0.39980 0.34484 -0.02945 0.06941  0.06949  16  PHE B O   
2952 C CB  . PHE B 39  ? 0.32376 0.37899 0.32048 -0.01821 0.03956  0.04471  16  PHE B CB  
2953 C CG  . PHE B 39  ? 0.38386 0.43459 0.39642 -0.02957 0.03439  0.03879  16  PHE B CG  
2954 C CD1 . PHE B 39  ? 0.43464 0.46814 0.43795 -0.02687 0.02633  0.03249  16  PHE B CD1 
2955 C CD2 . PHE B 39  ? 0.38426 0.44570 0.42007 -0.04438 0.03946  0.03898  16  PHE B CD2 
2956 C CE1 . PHE B 39  ? 0.44417 0.46654 0.45423 -0.03803 0.02335  0.02402  16  PHE B CE1 
2957 C CE2 . PHE B 39  ? 0.40770 0.46035 0.45350 -0.05812 0.03349  0.03085  16  PHE B CE2 
2958 C CZ  . PHE B 39  ? 0.40473 0.43518 0.43391 -0.05455 0.02548  0.02224  16  PHE B CZ  
2959 N N   . ASP B 40  ? 0.38315 0.38185 0.36027 -0.02997 0.05623  0.07017  17  ASP B N   
2960 C CA  . ASP B 40  ? 0.43862 0.42079 0.41738 -0.04096 0.06991  0.08227  17  ASP B CA  
2961 C C   . ASP B 40  ? 0.48344 0.44985 0.48305 -0.05473 0.06996  0.07577  17  ASP B C   
2962 O O   . ASP B 40  ? 0.47916 0.41996 0.47880 -0.06369 0.08044  0.08595  17  ASP B O   
2963 C CB  . ASP B 40  ? 0.54048 0.49763 0.48919 -0.03154 0.07164  0.09981  17  ASP B CB  
2964 C CG  . ASP B 40  ? 0.72366 0.66134 0.66506 -0.04130 0.08867  0.11735  17  ASP B CG  
2965 O OD1 . ASP B 40  ? 0.68727 0.64059 0.63319 -0.05057 0.10329  0.11959  17  ASP B OD1 
2966 O OD2 . ASP B 40  ? 0.71785 0.62346 0.64934 -0.03824 0.08893  0.13058  17  ASP B OD2 
2967 N N   . GLY B 41  ? 0.43527 0.41260 0.44861 -0.05756 0.05877  0.05881  18  GLY B N   
2968 C CA  . GLY B 41  ? 0.47160 0.43179 0.49892 -0.07369 0.05819  0.04903  18  GLY B CA  
2969 C C   . GLY B 41  ? 0.49611 0.41126 0.51034 -0.06946 0.06100  0.05056  18  GLY B C   
2970 O O   . GLY B 41  ? 0.50965 0.39936 0.53171 -0.08477 0.06549  0.04402  18  GLY B O   
2971 N N   . GLN B 42  ? 0.45841 0.36306 0.45565 -0.04921 0.05847  0.05845  19  GLN B N   
2972 C CA  . GLN B 42  ? 0.47451 0.33885 0.46534 -0.04054 0.06275  0.06329  19  GLN B CA  
2973 C C   . GLN B 42  ? 0.47701 0.33399 0.46849 -0.03631 0.05763  0.04390  19  GLN B C   
2974 O O   . GLN B 42  ? 0.44889 0.33401 0.43887 -0.03240 0.04842  0.03349  19  GLN B O   
2975 C CB  . GLN B 42  ? 0.49058 0.35343 0.46796 -0.02010 0.06058  0.08313  19  GLN B CB  
2976 C CG  . GLN B 42  ? 0.55075 0.41502 0.51628 -0.02331 0.06696  0.10329  19  GLN B CG  
2977 C CD  . GLN B 42  ? 0.63189 0.46040 0.60103 -0.03640 0.08157  0.11308  19  GLN B CD  
2978 O OE1 . GLN B 42  ? 0.71839 0.50908 0.69112 -0.03281 0.08580  0.11475  19  GLN B OE1 
2979 N NE2 . GLN B 42  ? 0.67539 0.51382 0.64592 -0.05216 0.09188  0.11909  19  GLN B NE2 
2980 N N   . GLN B 43  ? 0.49921 0.31434 0.49031 -0.03598 0.06597  0.03981  20  GLN B N   
2981 C CA  . GLN B 43  ? 0.55232 0.35471 0.53896 -0.03087 0.06589  0.02046  20  GLN B CA  
2982 C C   . GLN B 43  ? 0.56429 0.37180 0.55164 -0.00466 0.06546  0.02918  20  GLN B C   
2983 O O   . GLN B 43  ? 0.58083 0.38142 0.57265 0.00949  0.06717  0.05005  20  GLN B O   
2984 C CB  . GLN B 43  ? 0.64631 0.39655 0.63097 -0.04094 0.07817  0.00943  20  GLN B CB  
2985 C CG  . GLN B 43  ? 0.78110 0.53058 0.76550 -0.07071 0.07470  -0.00937 20  GLN B CG  
2986 C CD  . GLN B 43  ? 0.99540 0.68767 0.97409 -0.08371 0.08677  -0.02414 20  GLN B CD  
2987 O OE1 . GLN B 43  ? 1.03517 0.68458 1.01123 -0.06757 0.10056  -0.01868 20  GLN B OE1 
2988 N NE2 . GLN B 43  ? 1.13399 0.82483 1.11239 -0.11320 0.08129  -0.04311 20  GLN B NE2 
2989 N N   . GLY B 44  ? 0.50922 0.33055 0.49286 0.00114  0.06280  0.01442  21  GLY B N   
2990 C CA  . GLY B 44  ? 0.46979 0.29936 0.46135 0.02382  0.06431  0.02132  21  GLY B CA  
2991 C C   . GLY B 44  ? 0.45503 0.32058 0.44282 0.02515  0.05669  0.01249  21  GLY B C   
2992 O O   . GLY B 44  ? 0.46040 0.34588 0.43886 0.01136  0.04827  0.00505  21  GLY B O   
2993 N N   . GLU B 45  ? 0.42248 0.29725 0.42051 0.04195  0.06039  0.01461  22  GLU B N   
2994 C CA  . GLU B 45  ? 0.40628 0.31083 0.40124 0.04246  0.05622  0.00773  22  GLU B CA  
2995 C C   . GLU B 45  ? 0.43653 0.36413 0.45425 0.05937  0.05467  0.02124  22  GLU B C   
2996 O O   . GLU B 45  ? 0.42038 0.33732 0.45688 0.07405  0.06065  0.03099  22  GLU B O   
2997 C CB  . GLU B 45  ? 0.52634 0.41424 0.50513 0.03887  0.06757  -0.01296 22  GLU B CB  
2998 C CG  . GLU B 45  ? 0.73046 0.60918 0.68462 0.01854  0.06202  -0.02816 22  GLU B CG  
2999 C CD  . GLU B 45  ? 0.93136 0.76773 0.87805 0.00972  0.07042  -0.03877 22  GLU B CD  
3000 O OE1 . GLU B 45  ? 0.98412 0.79246 0.94143 0.02257  0.08429  -0.03568 22  GLU B OE1 
3001 O OE2 . GLU B 45  ? 0.92850 0.75974 0.86136 -0.01029 0.06292  -0.04977 22  GLU B OE2 
3002 N N   . VAL B 46  ? 0.40641 0.36556 0.42497 0.05701  0.04626  0.02221  23  VAL B N   
3003 C CA  . VAL B 46  ? 0.41668 0.40161 0.45958 0.06852  0.04488  0.03090  23  VAL B CA  
3004 C C   . VAL B 46  ? 0.39771 0.39638 0.43518 0.06378  0.05036  0.02016  23  VAL B C   
3005 O O   . VAL B 46  ? 0.39068 0.38616 0.40361 0.05192  0.04772  0.01115  23  VAL B O   
3006 C CB  . VAL B 46  ? 0.40619 0.41509 0.45524 0.06776  0.02705  0.04583  23  VAL B CB  
3007 C CG1 . VAL B 46  ? 0.43209 0.42694 0.48303 0.07419  0.02229  0.06074  23  VAL B CG1 
3008 C CG2 . VAL B 46  ? 0.36137 0.37859 0.38783 0.05327  0.01862  0.04024  23  VAL B CG2 
3009 N N   . PRO B 47  ? 0.37557 0.39229 0.43788 0.07287  0.05765  0.02326  24  PRO B N   
3010 C CA  . PRO B 47  ? 0.35026 0.37845 0.40645 0.06728  0.06544  0.01573  24  PRO B CA  
3011 C C   . PRO B 47  ? 0.36931 0.41765 0.42070 0.05648  0.05011  0.02024  24  PRO B C   
3012 O O   . PRO B 47  ? 0.33202 0.39689 0.39821 0.05649  0.03599  0.02999  24  PRO B O   
3013 C CB  . PRO B 47  ? 0.37694 0.42248 0.47045 0.08016  0.07926  0.02038  24  PRO B CB  
3014 C CG  . PRO B 47  ? 0.41154 0.45078 0.53020 0.09567  0.07902  0.02959  24  PRO B CG  
3015 C CD  . PRO B 47  ? 0.35111 0.38079 0.45170 0.08907  0.05957  0.03583  24  PRO B CD  
3016 N N   . VAL B 48  ? 0.30578 0.35015 0.33359 0.04757  0.05313  0.01318  25  VAL B N   
3017 C CA  . VAL B 48  ? 0.28187 0.33566 0.30011 0.03817  0.04137  0.01590  25  VAL B CA  
3018 C C   . VAL B 48  ? 0.31634 0.37570 0.33290 0.03427  0.05159  0.01505  25  VAL B C   
3019 O O   . VAL B 48  ? 0.30840 0.35689 0.31060 0.03588  0.06619  0.00947  25  VAL B O   
3020 C CB  . VAL B 48  ? 0.33787 0.37774 0.32789 0.03230  0.03370  0.01154  25  VAL B CB  
3021 C CG1 . VAL B 48  ? 0.32991 0.37527 0.30948 0.02590  0.02620  0.01382  25  VAL B CG1 
3022 C CG2 . VAL B 48  ? 0.35109 0.38608 0.34439 0.03367  0.02583  0.01444  25  VAL B CG2 
3023 N N   . SER B 49  ? 0.28957 0.36262 0.31756 0.02793  0.04523  0.02017  26  SER B N   
3024 C CA  . SER B 49  ? 0.27579 0.34938 0.29969 0.02117  0.05418  0.02155  26  SER B CA  
3025 C C   . SER B 49  ? 0.26742 0.33038 0.27036 0.01474  0.04386  0.02241  26  SER B C   
3026 O O   . SER B 49  ? 0.33020 0.39644 0.33752 0.01247  0.03082  0.02262  26  SER B O   
3027 C CB  . SER B 49  ? 0.26125 0.35854 0.32319 0.01655  0.05765  0.02664  26  SER B CB  
3028 O OG  . SER B 49  ? 0.45581 0.56686 0.54464 0.02555  0.06851  0.02753  26  SER B OG  
3029 N N   . ILE B 50  ? 0.27594 0.32501 0.25473 0.01292  0.05064  0.02369  27  ILE B N   
3030 C CA  . ILE B 50  ? 0.28402 0.32137 0.24756 0.00963  0.04400  0.02708  27  ILE B CA  
3031 C C   . ILE B 50  ? 0.32780 0.36010 0.29572 0.00216  0.05427  0.03286  27  ILE B C   
3032 O O   . ILE B 50  ? 0.31335 0.34140 0.27157 0.00170  0.06850  0.03671  27  ILE B O   
3033 C CB  . ILE B 50  ? 0.29746 0.32273 0.23088 0.01451  0.04076  0.02805  27  ILE B CB  
3034 C CG1 . ILE B 50  ? 0.43004 0.45975 0.36077 0.01832  0.03244  0.02157  27  ILE B CG1 
3035 C CG2 . ILE B 50  ? 0.31321 0.32742 0.23803 0.01510  0.03529  0.03409  27  ILE B CG2 
3036 C CD1 . ILE B 50  ? 0.43449 0.46893 0.37586 0.01898  0.02172  0.02081  27  ILE B CD1 
3037 N N   A ILE B 51  ? 0.29312 0.32254 0.27219 -0.00508 0.04884  0.03302  28  ILE B N   
3038 N N   B ILE B 51  ? 0.28591 0.31496 0.26455 -0.00500 0.04856  0.03298  28  ILE B N   
3039 C CA  A ILE B 51  ? 0.31084 0.33029 0.29505 -0.01534 0.05897  0.03828  28  ILE B CA  
3040 C CA  B ILE B 51  ? 0.31043 0.32886 0.29427 -0.01548 0.05773  0.03791  28  ILE B CA  
3041 C C   A ILE B 51  ? 0.32204 0.31793 0.29289 -0.01697 0.05308  0.03843  28  ILE B C   
3042 C C   B ILE B 51  ? 0.30922 0.31060 0.28860 -0.01990 0.04900  0.03475  28  ILE B C   
3043 O O   A ILE B 51  ? 0.32091 0.31806 0.29728 -0.01923 0.04210  0.03074  28  ILE B O   
3044 O O   B ILE B 51  ? 0.31106 0.31922 0.29452 -0.01949 0.03682  0.02719  28  ILE B O   
3045 C CB  A ILE B 51  ? 0.34375 0.38470 0.36523 -0.02736 0.06084  0.03614  28  ILE B CB  
3046 C CB  B ILE B 51  ? 0.35261 0.39257 0.37231 -0.02681 0.06408  0.03745  28  ILE B CB  
3047 C CG1 A ILE B 51  ? 0.39696 0.46366 0.43876 -0.02110 0.06659  0.03577  28  ILE B CG1 
3048 C CG1 B ILE B 51  ? 0.40510 0.47050 0.44346 -0.01946 0.06756  0.03589  28  ILE B CG1 
3049 C CG2 A ILE B 51  ? 0.36912 0.39885 0.39741 -0.04072 0.07535  0.04252  28  ILE B CG2 
3050 C CG2 B ILE B 51  ? 0.36292 0.39097 0.38517 -0.03792 0.08170  0.04546  28  ILE B CG2 
3051 C CD1 A ILE B 51  ? 0.45765 0.55307 0.54427 -0.03064 0.06936  0.03679  28  ILE B CD1 
3052 C CD1 B ILE B 51  ? 0.44753 0.54265 0.53116 -0.02793 0.06862  0.03634  28  ILE B CD1 
3053 N N   A ASN B 52  ? 0.30229 0.27454 0.25356 -0.01491 0.06156  0.04770  29  ASN B N   
3054 N N   B ASN B 52  ? 0.37592 0.35206 0.34571 -0.02478 0.05744  0.04062  29  ASN B N   
3055 C CA  A ASN B 52  ? 0.42007 0.36484 0.35887 -0.01191 0.05905  0.04979  29  ASN B CA  
3056 C CA  B ASN B 52  ? 0.40797 0.36052 0.37564 -0.03173 0.05423  0.03565  29  ASN B CA  
3057 C C   A ASN B 52  ? 0.43768 0.38937 0.37054 0.00021  0.04648  0.04405  29  ASN B C   
3058 C C   B ASN B 52  ? 0.44204 0.38817 0.39553 -0.02019 0.04406  0.02938  29  ASN B C   
3059 O O   A ASN B 52  ? 0.40226 0.36627 0.32580 0.00989  0.04214  0.04705  29  ASN B O   
3060 O O   B ASN B 52  ? 0.31447 0.25318 0.26815 -0.02628 0.03817  0.01862  29  ASN B O   
3061 C CB  A ASN B 52  ? 0.41084 0.34199 0.36481 -0.02797 0.06177  0.04371  29  ASN B CB  
3062 C CB  B ASN B 52  ? 0.44302 0.40685 0.43578 -0.05079 0.04985  0.02652  29  ASN B CB  
3063 C CG  A ASN B 52  ? 0.45635 0.38126 0.42034 -0.04186 0.07668  0.05154  29  ASN B CG  
3064 C CG  B ASN B 52  ? 0.41470 0.39261 0.43192 -0.06339 0.06138  0.03278  29  ASN B CG  
3065 O OD1 A ASN B 52  ? 0.49735 0.40651 0.44385 -0.03698 0.08831  0.06531  29  ASN B OD1 
3066 O OD1 B ASN B 52  ? 0.41444 0.37241 0.42402 -0.06599 0.07696  0.04288  29  ASN B OD1 
3067 N ND2 A ASN B 52  ? 0.47368 0.41239 0.46601 -0.06018 0.07610  0.04394  29  ASN B ND2 
3068 N ND2 B ASN B 52  ? 0.38170 0.39557 0.43002 -0.07027 0.05475  0.02867  29  ASN B ND2 
3069 N N   A ASN B 53  ? 0.43333 0.37776 0.37020 -0.00156 0.04141  0.03496  30  ASN B N   
3070 N N   B ASN B 53  ? 0.40504 0.35538 0.34570 -0.00476 0.04244  0.03553  30  ASN B N   
3071 C CA  A ASN B 53  ? 0.40261 0.35247 0.33506 0.00909  0.03397  0.03011  30  ASN B CA  
3072 C CA  B ASN B 53  ? 0.41635 0.36626 0.34959 0.00698  0.03558  0.03204  30  ASN B CA  
3073 C C   A ASN B 53  ? 0.37531 0.34653 0.31597 0.00391  0.02557  0.02027  30  ASN B C   
3074 C C   B ASN B 53  ? 0.37757 0.34608 0.31812 0.00321  0.02684  0.02115  30  ASN B C   
3075 O O   A ASN B 53  ? 0.36395 0.33452 0.29960 0.00745  0.02207  0.01403  30  ASN B O   
3076 O O   B ASN B 53  ? 0.39563 0.35866 0.33005 0.00719  0.02454  0.01509  30  ASN B O   
3077 C CB  A ASN B 53  ? 0.49264 0.41432 0.41808 0.01331  0.03852  0.02712  30  ASN B CB  
3078 C CB  B ASN B 53  ? 0.48044 0.39876 0.40573 0.01140  0.04123  0.03238  30  ASN B CB  
3079 C CG  A ASN B 53  ? 0.47109 0.38389 0.39114 0.03116  0.04112  0.03890  30  ASN B CG  
3080 C CG  B ASN B 53  ? 0.48003 0.39770 0.40034 0.03035  0.04000  0.03996  30  ASN B CG  
3081 O OD1 A ASN B 53  ? 0.43496 0.36931 0.35552 0.03971  0.03472  0.04609  30  ASN B OD1 
3082 O OD1 B ASN B 53  ? 0.43781 0.37844 0.35858 0.03748  0.03322  0.04556  30  ASN B OD1 
3083 N ND2 A ASN B 53  ? 0.52734 0.40840 0.44337 0.03673  0.04959  0.04070  30  ASN B ND2 
3084 N ND2 B ASN B 53  ? 0.47289 0.36491 0.39079 0.03810  0.04659  0.03918  30  ASN B ND2 
3085 N N   . THR B 54  ? 0.32546 0.31518 0.27884 -0.00340 0.02365  0.02009  31  THR B N   
3086 C CA  . THR B 54  ? 0.34985 0.35817 0.31162 -0.00665 0.01424  0.01409  31  THR B CA  
3087 C C   . THR B 54  ? 0.34286 0.37092 0.31299 -0.00061 0.01336  0.01782  31  THR B C   
3088 O O   . THR B 54  ? 0.35046 0.38208 0.32542 0.00011  0.02087  0.02203  31  THR B O   
3089 C CB  . THR B 54  ? 0.40623 0.41976 0.38184 -0.02142 0.00996  0.00951  31  THR B CB  
3090 O OG1 . THR B 54  ? 0.47332 0.46042 0.43670 -0.02879 0.01235  0.00331  31  THR B OG1 
3091 C CG2 . THR B 54  ? 0.39885 0.43255 0.38031 -0.02380 -0.00359 0.00605  31  THR B CG2 
3092 N N   . VAL B 55  ? 0.30755 0.34461 0.27675 0.00331  0.00625  0.01599  32  VAL B N   
3093 C CA  . VAL B 55  ? 0.28019 0.32973 0.25730 0.00868  0.00580  0.01838  32  VAL B CA  
3094 C C   . VAL B 55  ? 0.30071 0.36621 0.29594 0.00594  -0.00107 0.01974  32  VAL B C   
3095 O O   . VAL B 55  ? 0.28744 0.35480 0.27761 0.00240  -0.01075 0.01855  32  VAL B O   
3096 C CB  . VAL B 55  ? 0.27443 0.32113 0.24052 0.01434  0.00336  0.01801  32  VAL B CB  
3097 C CG1 . VAL B 55  ? 0.27606 0.32824 0.24939 0.01814  0.00428  0.01937  32  VAL B CG1 
3098 C CG2 . VAL B 55  ? 0.29854 0.33681 0.25336 0.01776  0.00664  0.01833  32  VAL B CG2 
3099 N N   . TYR B 56  ? 0.24828 0.32610 0.26391 0.00852  0.00398  0.02280  33  TYR B N   
3100 C CA  . TYR B 56  ? 0.21662 0.31459 0.25707 0.00996  -0.00318 0.02724  33  TYR B CA  
3101 C C   . TYR B 56  ? 0.32299 0.42054 0.36967 0.02178  0.00156  0.03061  33  TYR B C   
3102 O O   . TYR B 56  ? 0.29276 0.37694 0.32849 0.02579  0.01294  0.02703  33  TYR B O   
3103 C CB  . TYR B 56  ? 0.22872 0.34568 0.29973 0.00451  0.00141  0.02913  33  TYR B CB  
3104 C CG  . TYR B 56  ? 0.30094 0.41410 0.36873 -0.01023 -0.00138 0.02519  33  TYR B CG  
3105 C CD1 . TYR B 56  ? 0.34892 0.44061 0.39849 -0.01358 0.01069  0.02292  33  TYR B CD1 
3106 C CD2 . TYR B 56  ? 0.28356 0.41209 0.36466 -0.02138 -0.01688 0.02405  33  TYR B CD2 
3107 C CE1 . TYR B 56  ? 0.33840 0.41943 0.38509 -0.02674 0.01042  0.01988  33  TYR B CE1 
3108 C CE2 . TYR B 56  ? 0.31501 0.43421 0.39194 -0.03770 -0.01853 0.01780  33  TYR B CE2 
3109 C CZ  . TYR B 56  ? 0.41223 0.50520 0.47267 -0.03967 -0.00327 0.01587  33  TYR B CZ  
3110 O OH  . TYR B 56  ? 0.50417 0.58071 0.55981 -0.05499 -0.00271 0.01029  33  TYR B OH  
3111 N N   . THR B 57  ? 0.28410 0.39524 0.34823 0.02706  -0.00772 0.03784  34  THR B N   
3112 C CA  . THR B 57  ? 0.30151 0.41080 0.37996 0.03990  -0.00070 0.04250  34  THR B CA  
3113 C C   . THR B 57  ? 0.28341 0.42102 0.40284 0.04634  -0.00502 0.05163  34  THR B C   
3114 O O   . THR B 57  ? 0.30058 0.46084 0.43329 0.03928  -0.02054 0.05582  34  THR B O   
3115 C CB  . THR B 57  ? 0.34967 0.44123 0.40808 0.04410  -0.00599 0.04626  34  THR B CB  
3116 O OG1 . THR B 57  ? 0.34409 0.42462 0.41431 0.05587  0.00427  0.04896  34  THR B OG1 
3117 C CG2 . THR B 57  ? 0.35012 0.45384 0.40738 0.04298  -0.02444 0.05618  34  THR B CG2 
3118 N N   . LYS B 58  ? 0.28662 0.42364 0.42773 0.05971  0.00881  0.05408  35  LYS B N   
3119 C CA  . LYS B 58  ? 0.33183 0.49961 0.52127 0.06956  0.00868  0.06383  35  LYS B CA  
3120 C C   . LYS B 58  ? 0.40087 0.57320 0.60125 0.08196  -0.00674 0.07857  35  LYS B C   
3121 O O   . LYS B 58  ? 0.42063 0.56405 0.60350 0.09119  -0.00110 0.08039  35  LYS B O   
3122 C CB  . LYS B 58  ? 0.38737 0.54986 0.59422 0.07984  0.03601  0.05854  35  LYS B CB  
3123 C CG  . LYS B 58  ? 0.46332 0.66011 0.72889 0.09334  0.04314  0.06828  35  LYS B CG  
3124 C CD  . LYS B 58  ? 0.52896 0.70943 0.80226 0.10681  0.07640  0.06063  35  LYS B CD  
3125 C CE  . LYS B 58  ? 0.65659 0.86242 0.95724 0.10173  0.09589  0.05756  35  LYS B CE  
3126 N NZ  . LYS B 58  ? 0.69717 0.94342 1.06848 0.11871  0.10627  0.06899  35  LYS B NZ  
3127 N N   . VAL B 59  ? 0.35939 0.56661 0.58595 0.08040  -0.02775 0.08976  36  VAL B N   
3128 C CA  . VAL B 59  ? 0.38867 0.60461 0.62491 0.09280  -0.04612 0.10780  36  VAL B CA  
3129 C C   . VAL B 59  ? 0.42966 0.69341 0.72856 0.10251  -0.05360 0.12040  36  VAL B C   
3130 O O   . VAL B 59  ? 0.41288 0.71155 0.73264 0.08799  -0.06587 0.11799  36  VAL B O   
3131 C CB  . VAL B 59  ? 0.38094 0.59389 0.57726 0.07964  -0.07112 0.11071  36  VAL B CB  
3132 C CG1 . VAL B 59  ? 0.48191 0.70086 0.68107 0.09318  -0.08978 0.13233  36  VAL B CG1 
3133 C CG2 . VAL B 59  ? 0.36937 0.54301 0.51292 0.06941  -0.06150 0.09784  36  VAL B CG2 
3134 N N   . ASP B 60  ? 0.45498 0.72027 0.78802 0.12681  -0.04442 0.13336  37  ASP B N   
3135 C CA  . ASP B 60  ? 0.40752 0.70973 0.79406 0.13566  -0.04720 0.14049  37  ASP B CA  
3136 C C   . ASP B 60  ? 0.40652 0.73817 0.82720 0.12469  -0.03258 0.12917  37  ASP B C   
3137 O O   . ASP B 60  ? 0.45465 0.82685 0.90901 0.11600  -0.04658 0.13140  37  ASP B O   
3138 C CB  . ASP B 60  ? 0.61960 0.94917 1.00797 0.13039  -0.08266 0.15237  37  ASP B CB  
3139 C CG  . ASP B 60  ? 0.76821 1.06787 1.11453 0.13769  -0.09770 0.16471  37  ASP B CG  
3140 O OD1 . ASP B 60  ? 0.77327 1.08078 1.08912 0.12371  -0.12475 0.16731  37  ASP B OD1 
3141 O OD2 . ASP B 60  ? 0.76899 1.03472 1.11012 0.15587  -0.08111 0.17068  37  ASP B OD2 
3142 N N   . GLY B 61  ? 0.33871 0.64901 0.74836 0.12359  -0.00396 0.11679  38  GLY B N   
3143 C CA  . GLY B 61  ? 0.39215 0.72434 0.82878 0.11347  0.01464  0.10743  38  GLY B CA  
3144 C C   . GLY B 61  ? 0.35609 0.70327 0.78076 0.08534  0.00193  0.10018  38  GLY B C   
3145 O O   . GLY B 61  ? 0.36820 0.73638 0.82082 0.07529  0.01728  0.09562  38  GLY B O   
3146 N N   . VAL B 62  ? 0.38954 0.66377 0.49961 0.07038  0.01606  -0.00060 39  VAL B N   
3147 C CA  . VAL B 62  ? 0.32853 0.60876 0.43602 0.05385  0.01397  -0.01207 39  VAL B CA  
3148 C C   . VAL B 62  ? 0.28414 0.53538 0.37450 0.04705  0.01324  -0.00851 39  VAL B C   
3149 O O   . VAL B 62  ? 0.34442 0.58106 0.42594 0.05552  0.01175  0.00244  39  VAL B O   
3150 C CB  . VAL B 62  ? 0.34065 0.66345 0.45749 0.05345  0.00649  -0.01845 39  VAL B CB  
3151 C CG1 . VAL B 62  ? 0.38601 0.74223 0.52234 0.05987  0.00704  -0.02330 39  VAL B CG1 
3152 C CG2 . VAL B 62  ? 0.33633 0.66921 0.44466 0.06382  -0.00140 -0.00806 39  VAL B CG2 
3153 N N   . ASP B 63  ? 0.25639 0.49991 0.34324 0.03175  0.01515  -0.01776 40  ASP B N   
3154 C CA  . ASP B 63  ? 0.26059 0.47653 0.33266 0.02452  0.01544  -0.01538 40  ASP B CA  
3155 C C   . ASP B 63  ? 0.27450 0.50391 0.34233 0.02357  0.00863  -0.01506 40  ASP B C   
3156 O O   . ASP B 63  ? 0.32535 0.58244 0.40125 0.01893  0.00581  -0.02381 40  ASP B O   
3157 C CB  . ASP B 63  ? 0.29461 0.49554 0.36502 0.01050  0.02183  -0.02352 40  ASP B CB  
3158 C CG  . ASP B 63  ? 0.46195 0.64611 0.53210 0.01154  0.02887  -0.02272 40  ASP B CG  
3159 O OD1 . ASP B 63  ? 0.38999 0.56106 0.45594 0.02050  0.02919  -0.01544 40  ASP B OD1 
3160 O OD2 . ASP B 63  ? 0.48041 0.66505 0.55505 0.00338  0.03501  -0.02979 40  ASP B OD2 
3161 N N   . VAL B 64  ? 0.25482 0.46588 0.31052 0.02732  0.00659  -0.00615 41  VAL B N   
3162 C CA  . VAL B 64  ? 0.25423 0.47523 0.30380 0.02684  0.00094  -0.00492 41  VAL B CA  
3163 C C   . VAL B 64  ? 0.29592 0.48894 0.33433 0.01775  0.00308  -0.00496 41  VAL B C   
3164 O O   . VAL B 64  ? 0.29661 0.46305 0.32799 0.01963  0.00600  0.00155  41  VAL B O   
3165 C CB  . VAL B 64  ? 0.27875 0.50689 0.32446 0.04205  -0.00312 0.00797  41  VAL B CB  
3166 C CG1 . VAL B 64  ? 0.31822 0.55679 0.35588 0.04062  -0.00831 0.00876  41  VAL B CG1 
3167 C CG2 . VAL B 64  ? 0.31643 0.57466 0.37406 0.05346  -0.00532 0.00965  41  VAL B CG2 
3168 N N   . GLU B 65  ? 0.25518 0.45557 0.29283 0.00816  0.00192  -0.01281 42  GLU B N   
3169 C CA  . GLU B 65  ? 0.27538 0.45118 0.30404 0.00017  0.00434  -0.01285 42  GLU B CA  
3170 C C   . GLU B 65  ? 0.31597 0.48031 0.33375 0.00630  0.00122  -0.00294 42  GLU B C   
3171 O O   . GLU B 65  ? 0.33844 0.52006 0.35413 0.01125  -0.00336 -0.00050 42  GLU B O   
3172 C CB  . GLU B 65  ? 0.30681 0.49351 0.33963 -0.01130 0.00558  -0.02451 42  GLU B CB  
3173 C CG  . GLU B 65  ? 0.39939 0.56212 0.42415 -0.01809 0.00850  -0.02383 42  GLU B CG  
3174 C CD  . GLU B 65  ? 0.53481 0.70710 0.56488 -0.02895 0.01128  -0.03574 42  GLU B CD  
3175 O OE1 . GLU B 65  ? 0.47994 0.66336 0.52088 -0.03604 0.01565  -0.04587 42  GLU B OE1 
3176 O OE2 . GLU B 65  ? 0.64703 0.81584 0.67120 -0.03056 0.00992  -0.03555 42  GLU B OE2 
3177 N N   . LEU B 66  ? 0.26481 0.40159 0.27560 0.00558  0.00405  0.00234  43  LEU B N   
3178 C CA  . LEU B 66  ? 0.29239 0.41582 0.29418 0.00892  0.00272  0.01019  43  LEU B CA  
3179 C C   . LEU B 66  ? 0.35621 0.46882 0.35292 0.00028  0.00344  0.00688  43  LEU B C   
3180 O O   . LEU B 66  ? 0.36652 0.47648 0.35728 0.00197  0.00174  0.01113  43  LEU B O   
3181 C CB  . LEU B 66  ? 0.32690 0.42854 0.32584 0.01358  0.00581  0.01706  43  LEU B CB  
3182 C CG  . LEU B 66  ? 0.39290 0.49889 0.39682 0.02389  0.00706  0.02230  43  LEU B CG  
3183 C CD1 . LEU B 66  ? 0.37322 0.45473 0.37426 0.02645  0.01165  0.02723  43  LEU B CD1 
3184 C CD2 . LEU B 66  ? 0.39453 0.52064 0.39909 0.03364  0.00338  0.02884  43  LEU B CD2 
3185 N N   . PHE B 67  ? 0.31003 0.41532 0.30906 -0.00816 0.00689  0.00042  44  PHE B N   
3186 C CA  . PHE B 67  ? 0.27932 0.37035 0.27395 -0.01435 0.00876  -0.00046 44  PHE B CA  
3187 C C   . PHE B 67  ? 0.38859 0.47692 0.38809 -0.02249 0.01385  -0.00748 44  PHE B C   
3188 O O   . PHE B 67  ? 0.33846 0.42208 0.34005 -0.02315 0.01699  -0.00783 44  PHE B O   
3189 C CB  . PHE B 67  ? 0.26422 0.33467 0.25242 -0.01201 0.00931  0.00640  44  PHE B CB  
3190 C CG  . PHE B 67  ? 0.28827 0.34611 0.27285 -0.01683 0.01083  0.00649  44  PHE B CG  
3191 C CD1 . PHE B 67  ? 0.29074 0.34889 0.27254 -0.01702 0.00924  0.00781  44  PHE B CD1 
3192 C CD2 . PHE B 67  ? 0.30220 0.34906 0.28602 -0.02020 0.01421  0.00606  44  PHE B CD2 
3193 C CE1 . PHE B 67  ? 0.30929 0.35660 0.28927 -0.02059 0.01102  0.00809  44  PHE B CE1 
3194 C CE2 . PHE B 67  ? 0.29998 0.33704 0.28127 -0.02275 0.01564  0.00754  44  PHE B CE2 
3195 C CZ  . PHE B 67  ? 0.30527 0.34255 0.28550 -0.02294 0.01403  0.00824  44  PHE B CZ  
3196 N N   . GLU B 68  ? 0.33594 0.42592 0.33732 -0.02862 0.01600  -0.01289 45  GLU B N   
3197 C CA  . GLU B 68  ? 0.30802 0.39051 0.31441 -0.03614 0.02325  -0.01817 45  GLU B CA  
3198 C C   . GLU B 68  ? 0.34830 0.41172 0.34937 -0.03688 0.02565  -0.01331 45  GLU B C   
3199 O O   . GLU B 68  ? 0.38366 0.44747 0.38294 -0.03735 0.02415  -0.01386 45  GLU B O   
3200 C CB  . GLU B 68  ? 0.27692 0.37560 0.29261 -0.04352 0.02633  -0.03002 45  GLU B CB  
3201 C CG  . GLU B 68  ? 0.48227 0.57006 0.50497 -0.05151 0.03658  -0.03512 45  GLU B CG  
3202 C CD  . GLU B 68  ? 0.61529 0.71549 0.64874 -0.06108 0.04203  -0.04910 45  GLU B CD  
3203 O OE1 . GLU B 68  ? 0.61498 0.73661 0.64974 -0.06150 0.03649  -0.05577 45  GLU B OE1 
3204 O OE2 . GLU B 68  ? 0.61546 0.70417 0.65599 -0.06813 0.05260  -0.05345 45  GLU B OE2 
3205 N N   . ASN B 69  ? 0.31827 0.36708 0.31683 -0.03649 0.02946  -0.00848 46  ASN B N   
3206 C CA  . ASN B 69  ? 0.31419 0.34788 0.30774 -0.03523 0.03087  -0.00242 46  ASN B CA  
3207 C C   . ASN B 69  ? 0.33347 0.36163 0.33295 -0.04052 0.03846  -0.00638 46  ASN B C   
3208 O O   . ASN B 69  ? 0.31707 0.34152 0.32201 -0.04457 0.04635  -0.00913 46  ASN B O   
3209 C CB  . ASN B 69  ? 0.34394 0.36793 0.33208 -0.03226 0.03230  0.00412  46  ASN B CB  
3210 C CG  . ASN B 69  ? 0.35448 0.36741 0.33749 -0.02957 0.03265  0.01098  46  ASN B CG  
3211 O OD1 . ASN B 69  ? 0.32627 0.33864 0.30889 -0.02869 0.02967  0.01167  46  ASN B OD1 
3212 N ND2 . ASN B 69  ? 0.27349 0.27951 0.25242 -0.02771 0.03638  0.01641  46  ASN B ND2 
3213 N N   . LYS B 70  ? 0.31739 0.34376 0.31656 -0.04065 0.03755  -0.00680 47  LYS B N   
3214 C CA  . LYS B 70  ? 0.36598 0.38392 0.37123 -0.04479 0.04601  -0.01002 47  LYS B CA  
3215 C C   . LYS B 70  ? 0.38456 0.38836 0.38607 -0.03986 0.04734  -0.00070 47  LYS B C   
3216 O O   . LYS B 70  ? 0.36274 0.35803 0.36950 -0.04141 0.05456  -0.00168 47  LYS B O   
3217 C CB  . LYS B 70  ? 0.42442 0.45345 0.43379 -0.04932 0.04547  -0.01974 47  LYS B CB  
3218 C CG  . LYS B 70  ? 0.53130 0.58073 0.54381 -0.05275 0.04207  -0.02869 47  LYS B CG  
3219 C CD  . LYS B 70  ? 0.65641 0.71296 0.68008 -0.06213 0.05023  -0.04228 47  LYS B CD  
3220 C CE  . LYS B 70  ? 0.80235 0.84139 0.83317 -0.06606 0.06224  -0.04201 47  LYS B CE  
3221 N NZ  . LYS B 70  ? 0.85234 0.89647 0.89641 -0.07695 0.07253  -0.05737 47  LYS B NZ  
3222 N N   . THR B 71  ? 0.34442 0.34671 0.33806 -0.03394 0.04110  0.00762  48  THR B N   
3223 C CA  . THR B 71  ? 0.30990 0.30463 0.30026 -0.02875 0.04042  0.01579  48  THR B CA  
3224 C C   . THR B 71  ? 0.35858 0.34478 0.34715 -0.02557 0.04606  0.02322  48  THR B C   
3225 O O   . THR B 71  ? 0.35920 0.34427 0.34818 -0.02772 0.05031  0.02218  48  THR B O   
3226 C CB  . THR B 71  ? 0.34049 0.34071 0.32419 -0.02498 0.03106  0.01914  48  THR B CB  
3227 O OG1 . THR B 71  ? 0.31674 0.31767 0.29485 -0.02258 0.02883  0.02273  48  THR B OG1 
3228 C CG2 . THR B 71  ? 0.31397 0.32270 0.29746 -0.02696 0.02602  0.01393  48  THR B CG2 
3229 N N   . THR B 72  ? 0.36609 0.34806 0.35232 -0.01972 0.04602  0.03141  49  THR B N   
3230 C CA  . THR B 72  ? 0.39929 0.37659 0.38089 -0.01437 0.04981  0.04093  49  THR B CA  
3231 C C   . THR B 72  ? 0.38396 0.37064 0.35565 -0.01073 0.04110  0.04431  49  THR B C   
3232 O O   . THR B 72  ? 0.36649 0.35354 0.33211 -0.00532 0.04255  0.05252  49  THR B O   
3233 C CB  . THR B 72  ? 0.40680 0.37689 0.39171 -0.00846 0.05528  0.04898  49  THR B CB  
3234 O OG1 . THR B 72  ? 0.40623 0.38395 0.39078 -0.00565 0.04734  0.04925  49  THR B OG1 
3235 C CG2 . THR B 72  ? 0.41798 0.37663 0.41400 -0.01305 0.06643  0.04395  49  THR B CG2 
3236 N N   . LEU B 73  ? 0.30191 0.29627 0.27191 -0.01353 0.03323  0.03801  50  LEU B N   
3237 C CA  . LEU B 73  ? 0.32231 0.32441 0.28492 -0.01204 0.02663  0.03796  50  LEU B CA  
3238 C C   . LEU B 73  ? 0.32054 0.32286 0.28074 -0.01452 0.02872  0.03497  50  LEU B C   
3239 O O   . LEU B 73  ? 0.32106 0.32039 0.28669 -0.01834 0.03319  0.03103  50  LEU B O   
3240 C CB  . LEU B 73  ? 0.29037 0.29765 0.25429 -0.01385 0.01956  0.03281  50  LEU B CB  
3241 C CG  . LEU B 73  ? 0.37800 0.38740 0.34464 -0.01175 0.01706  0.03497  50  LEU B CG  
3242 C CD1 . LEU B 73  ? 0.34230 0.35472 0.31080 -0.01450 0.01238  0.02989  50  LEU B CD1 
3243 C CD2 . LEU B 73  ? 0.38184 0.39834 0.34384 -0.00700 0.01451  0.04006  50  LEU B CD2 
3244 N N   . PRO B 74  ? 0.34288 0.35058 0.29578 -0.01285 0.02580  0.03548  51  PRO B N   
3245 C CA  . PRO B 74  ? 0.33836 0.34719 0.28991 -0.01520 0.02761  0.03142  51  PRO B CA  
3246 C C   . PRO B 74  ? 0.31635 0.32665 0.27431 -0.01843 0.02504  0.02437  51  PRO B C   
3247 O O   . PRO B 74  ? 0.31167 0.32342 0.27130 -0.01835 0.02017  0.02250  51  PRO B O   
3248 C CB  . PRO B 74  ? 0.31870 0.33448 0.26148 -0.01307 0.02390  0.03133  51  PRO B CB  
3249 C CG  . PRO B 74  ? 0.30748 0.32708 0.24562 -0.00841 0.02202  0.03841  51  PRO B CG  
3250 C CD  . PRO B 74  ? 0.33568 0.35083 0.28183 -0.00890 0.02113  0.03884  51  PRO B CD  
3251 N N   . VAL B 75  ? 0.27531 0.28648 0.23706 -0.02078 0.02883  0.02100  52  VAL B N   
3252 C CA  . VAL B 75  ? 0.31868 0.33474 0.28706 -0.02244 0.02666  0.01540  52  VAL B CA  
3253 C C   . VAL B 75  ? 0.31674 0.33494 0.28338 -0.02006 0.02101  0.01411  52  VAL B C   
3254 O O   . VAL B 75  ? 0.28799 0.30814 0.25790 -0.01954 0.01806  0.01318  52  VAL B O   
3255 C CB  . VAL B 75  ? 0.33204 0.35252 0.30510 -0.02464 0.03124  0.01156  52  VAL B CB  
3256 C CG1 . VAL B 75  ? 0.30161 0.32223 0.26934 -0.02311 0.03294  0.01212  52  VAL B CG1 
3257 C CG2 . VAL B 75  ? 0.30231 0.33247 0.28250 -0.02477 0.02817  0.00645  52  VAL B CG2 
3258 N N   . ASN B 76  ? 0.27549 0.29337 0.23730 -0.01873 0.02061  0.01361  53  ASN B N   
3259 C CA  . ASN B 76  ? 0.29581 0.31347 0.25821 -0.01721 0.01779  0.01111  53  ASN B CA  
3260 C C   . ASN B 76  ? 0.32569 0.34072 0.28694 -0.01737 0.01438  0.01230  53  ASN B C   
3261 O O   . ASN B 76  ? 0.32695 0.33983 0.29113 -0.01657 0.01327  0.01132  53  ASN B O   
3262 C CB  . ASN B 76  ? 0.34960 0.36770 0.30808 -0.01691 0.01952  0.00788  53  ASN B CB  
3263 C CG  . ASN B 76  ? 0.33809 0.35778 0.28828 -0.01770 0.01894  0.00889  53  ASN B CG  
3264 O OD1 . ASN B 76  ? 0.31036 0.33069 0.25728 -0.01744 0.02047  0.01346  53  ASN B OD1 
3265 N ND2 . ASN B 76  ? 0.30745 0.32877 0.25472 -0.01845 0.01740  0.00447  53  ASN B ND2 
3266 N N   . VAL B 77  ? 0.31030 0.32569 0.26807 -0.01790 0.01353  0.01500  54  VAL B N   
3267 C CA  . VAL B 77  ? 0.30013 0.31543 0.25844 -0.01820 0.01042  0.01574  54  VAL B CA  
3268 C C   . VAL B 77  ? 0.32795 0.34109 0.29111 -0.01839 0.01009  0.01738  54  VAL B C   
3269 O O   . VAL B 77  ? 0.29540 0.30717 0.26087 -0.01868 0.00871  0.01677  54  VAL B O   
3270 C CB  . VAL B 77  ? 0.31539 0.33459 0.26930 -0.01706 0.00959  0.01914  54  VAL B CB  
3271 C CG1 . VAL B 77  ? 0.32357 0.34515 0.28028 -0.01726 0.00637  0.01949  54  VAL B CG1 
3272 C CG2 . VAL B 77  ? 0.27204 0.29716 0.21903 -0.01669 0.00938  0.01699  54  VAL B CG2 
3273 N N   . ALA B 78  ? 0.32117 0.33422 0.28604 -0.01872 0.01234  0.01890  55  ALA B N   
3274 C CA  . ALA B 78  ? 0.29841 0.31188 0.26732 -0.01959 0.01241  0.01865  55  ALA B CA  
3275 C C   . ALA B 78  ? 0.30628 0.32267 0.27682 -0.01863 0.01100  0.01713  55  ALA B C   
3276 O O   . ALA B 78  ? 0.31014 0.32734 0.28156 -0.01824 0.00986  0.01797  55  ALA B O   
3277 C CB  . ALA B 78  ? 0.26918 0.28277 0.24105 -0.02148 0.01659  0.01781  55  ALA B CB  
3278 N N   . PHE B 79  ? 0.28714 0.30590 0.25815 -0.01744 0.01169  0.01566  56  PHE B N   
3279 C CA  . PHE B 79  ? 0.25511 0.27719 0.22807 -0.01429 0.01084  0.01599  56  PHE B CA  
3280 C C   . PHE B 79  ? 0.29636 0.31198 0.26834 -0.01264 0.01043  0.01823  56  PHE B C   
3281 O O   . PHE B 79  ? 0.29259 0.30913 0.26530 -0.01003 0.01027  0.02117  56  PHE B O   
3282 C CB  . PHE B 79  ? 0.28476 0.30942 0.25930 -0.01269 0.01244  0.01409  56  PHE B CB  
3283 C CG  . PHE B 79  ? 0.32470 0.35267 0.30229 -0.00747 0.01242  0.01568  56  PHE B CG  
3284 C CD1 . PHE B 79  ? 0.29301 0.33112 0.27288 -0.00455 0.01069  0.01747  56  PHE B CD1 
3285 C CD2 . PHE B 79  ? 0.30366 0.32610 0.28211 -0.00492 0.01476  0.01520  56  PHE B CD2 
3286 C CE1 . PHE B 79  ? 0.34393 0.38696 0.32653 0.00243  0.01089  0.02100  56  PHE B CE1 
3287 C CE2 . PHE B 79  ? 0.30227 0.32664 0.28488 0.00153  0.01620  0.01797  56  PHE B CE2 
3288 C CZ  . PHE B 79  ? 0.31231 0.34732 0.29686 0.00593  0.01406  0.02187  56  PHE B CZ  
3289 N N   . GLU B 80  ? 0.27984 0.28984 0.25029 -0.01431 0.01093  0.01658  57  GLU B N   
3290 C CA  . GLU B 80  ? 0.30475 0.30841 0.27642 -0.01440 0.01207  0.01663  57  GLU B CA  
3291 C C   . GLU B 80  ? 0.32326 0.32635 0.29533 -0.01586 0.01111  0.01886  57  GLU B C   
3292 O O   . GLU B 80  ? 0.30966 0.30844 0.28342 -0.01471 0.01319  0.02124  57  GLU B O   
3293 C CB  . GLU B 80  ? 0.34202 0.34365 0.31267 -0.01722 0.01274  0.01164  57  GLU B CB  
3294 C CG  . GLU B 80  ? 0.36943 0.36509 0.34343 -0.01952 0.01513  0.00887  57  GLU B CG  
3295 C CD  . GLU B 80  ? 0.46139 0.45794 0.43516 -0.02310 0.01631  0.00107  57  GLU B CD  
3296 O OE1 . GLU B 80  ? 0.46927 0.46946 0.43947 -0.02249 0.01605  -0.00121 57  GLU B OE1 
3297 O OE2 . GLU B 80  ? 0.45429 0.44877 0.43181 -0.02703 0.01818  -0.00368 57  GLU B OE2 
3298 N N   . LEU B 81  ? 0.29677 0.30351 0.26771 -0.01789 0.00910  0.01872  58  LEU B N   
3299 C CA  . LEU B 81  ? 0.31284 0.31963 0.28512 -0.01908 0.00882  0.02028  58  LEU B CA  
3300 C C   . LEU B 81  ? 0.31305 0.32201 0.28489 -0.01721 0.00951  0.02303  58  LEU B C   
3301 O O   . LEU B 81  ? 0.32245 0.32970 0.29466 -0.01704 0.01083  0.02525  58  LEU B O   
3302 C CB  . LEU B 81  ? 0.28921 0.29919 0.26155 -0.02028 0.00756  0.02016  58  LEU B CB  
3303 C CG  . LEU B 81  ? 0.37467 0.38718 0.34621 -0.02087 0.00600  0.01876  58  LEU B CG  
3304 C CD1 . LEU B 81  ? 0.43176 0.44781 0.40416 -0.01971 0.00548  0.02137  58  LEU B CD1 
3305 C CD2 . LEU B 81  ? 0.39828 0.41094 0.37227 -0.02305 0.00572  0.01564  58  LEU B CD2 
3306 N N   . TRP B 82  ? 0.27652 0.29106 0.24759 -0.01605 0.00895  0.02245  59  TRP B N   
3307 C CA  . TRP B 82  ? 0.32141 0.34307 0.29150 -0.01400 0.00880  0.02391  59  TRP B CA  
3308 C C   . TRP B 82  ? 0.33655 0.35645 0.30558 -0.00921 0.00995  0.02885  59  TRP B C   
3309 O O   . TRP B 82  ? 0.31886 0.34051 0.28568 -0.00719 0.01093  0.03278  59  TRP B O   
3310 C CB  . TRP B 82  ? 0.32652 0.35735 0.29788 -0.01445 0.00813  0.02035  59  TRP B CB  
3311 C CG  . TRP B 82  ? 0.37962 0.42330 0.34996 -0.01173 0.00694  0.02082  59  TRP B CG  
3312 C CD1 . TRP B 82  ? 0.34775 0.39914 0.31619 -0.01299 0.00677  0.01953  59  TRP B CD1 
3313 C CD2 . TRP B 82  ? 0.35323 0.40595 0.32407 -0.00662 0.00572  0.02277  59  TRP B CD2 
3314 N NE1 . TRP B 82  ? 0.38318 0.44986 0.34983 -0.00899 0.00487  0.02049  59  TRP B NE1 
3315 C CE2 . TRP B 82  ? 0.39343 0.46159 0.36204 -0.00451 0.00402  0.02301  59  TRP B CE2 
3316 C CE3 . TRP B 82  ? 0.38263 0.43356 0.35588 -0.00315 0.00611  0.02409  59  TRP B CE3 
3317 C CZ2 . TRP B 82  ? 0.43475 0.51804 0.40351 0.00177  0.00199  0.02552  59  TRP B CZ2 
3318 C CZ3 . TRP B 82  ? 0.46020 0.52409 0.43489 0.00295  0.00483  0.02638  59  TRP B CZ3 
3319 C CH2 . TRP B 82  ? 0.52667 0.60747 0.49912 0.00589  0.00242  0.02764  59  TRP B CH2 
3320 N N   . ALA B 83  ? 0.28824 0.30384 0.25887 -0.00686 0.01100  0.02925  60  ALA B N   
3321 C CA  . ALA B 83  ? 0.30751 0.31830 0.27862 -0.00141 0.01415  0.03482  60  ALA B CA  
3322 C C   . ALA B 83  ? 0.32711 0.32716 0.29867 -0.00307 0.01791  0.03728  60  ALA B C   
3323 O O   . ALA B 83  ? 0.33279 0.32936 0.30358 0.00162  0.02169  0.04409  60  ALA B O   
3324 C CB  . ALA B 83  ? 0.31537 0.32128 0.28967 0.00068  0.01614  0.03331  60  ALA B CB  
3325 N N   . LYS B 84  ? 0.31694 0.31269 0.29018 -0.00923 0.01752  0.03231  61  LYS B N   
3326 C CA  . LYS B 84  ? 0.31290 0.30052 0.28882 -0.01227 0.02139  0.03255  61  LYS B CA  
3327 C C   . LYS B 84  ? 0.36385 0.35594 0.33812 -0.01407 0.02052  0.03411  61  LYS B C   
3328 O O   . LYS B 84  ? 0.33888 0.32682 0.31656 -0.01789 0.02316  0.03280  61  LYS B O   
3329 C CB  . LYS B 84  ? 0.33346 0.31789 0.31340 -0.01785 0.02135  0.02510  61  LYS B CB  
3330 C CG  . LYS B 84  ? 0.35957 0.33729 0.34195 -0.01687 0.02473  0.02241  61  LYS B CG  
3331 C CD  . LYS B 84  ? 0.35672 0.33592 0.34147 -0.02269 0.02382  0.01323  61  LYS B CD  
3332 C CE  . LYS B 84  ? 0.41035 0.38169 0.39841 -0.02266 0.02909  0.00887  61  LYS B CE  
3333 N NZ  . LYS B 84  ? 0.38595 0.36298 0.37456 -0.02852 0.02745  -0.00135 61  LYS B NZ  
3334 N N   . ARG B 85  ? 0.30920 0.31058 0.27920 -0.01180 0.01767  0.03590  62  ARG B N   
3335 C CA  . ARG B 85  ? 0.34431 0.35033 0.31273 -0.01368 0.01770  0.03615  62  ARG B CA  
3336 C C   . ARG B 85  ? 0.36792 0.36913 0.33491 -0.01191 0.02293  0.04226  62  ARG B C   
3337 O O   . ARG B 85  ? 0.31271 0.30922 0.27824 -0.00711 0.02633  0.04833  62  ARG B O   
3338 C CB  . ARG B 85  ? 0.33593 0.35406 0.30042 -0.01229 0.01471  0.03497  62  ARG B CB  
3339 C CG  . ARG B 85  ? 0.35801 0.38373 0.31773 -0.00604 0.01465  0.04031  62  ARG B CG  
3340 C CD  . ARG B 85  ? 0.36817 0.40982 0.32612 -0.00603 0.01092  0.03576  62  ARG B CD  
3341 N NE  . ARG B 85  ? 0.38541 0.43977 0.33889 0.00084  0.00985  0.04089  62  ARG B NE  
3342 C CZ  . ARG B 85  ? 0.44278 0.49923 0.39765 0.00649  0.00904  0.04441  62  ARG B CZ  
3343 N NH1 . ARG B 85  ? 0.34749 0.39309 0.30758 0.00522  0.00960  0.04242  62  ARG B NH1 
3344 N NH2 . ARG B 85  ? 0.46447 0.53565 0.41544 0.01412  0.00778  0.05006  62  ARG B NH2 
3345 N N   . ASN B 86  ? 0.35203 0.35373 0.32010 -0.01538 0.02465  0.04125  63  ASN B N   
3346 C CA  . ASN B 86  ? 0.37668 0.37475 0.34266 -0.01416 0.03061  0.04730  63  ASN B CA  
3347 C C   . ASN B 86  ? 0.32714 0.33534 0.28386 -0.00838 0.02999  0.05303  63  ASN B C   
3348 O O   . ASN B 86  ? 0.33793 0.35806 0.29156 -0.00939 0.02602  0.04874  63  ASN B O   
3349 C CB  . ASN B 86  ? 0.40910 0.40784 0.37930 -0.01960 0.03243  0.04361  63  ASN B CB  
3350 C CG  . ASN B 86  ? 0.46715 0.45866 0.43804 -0.02014 0.04059  0.04897  63  ASN B CG  
3351 O OD1 . ASN B 86  ? 0.48925 0.48037 0.45286 -0.01511 0.04440  0.05721  63  ASN B OD1 
3352 N ND2 . ASN B 86  ? 0.45492 0.44190 0.43488 -0.02600 0.04374  0.04456  63  ASN B ND2 
3353 N N   . ILE B 87  ? 0.31900 0.32348 0.27168 -0.00208 0.03443  0.06246  64  ILE B N   
3354 C CA  . ILE B 87  ? 0.34812 0.36599 0.29100 0.00516  0.03343  0.06933  64  ILE B CA  
3355 C C   . ILE B 87  ? 0.38587 0.40364 0.32243 0.00698  0.03981  0.07692  64  ILE B C   
3356 O O   . ILE B 87  ? 0.41760 0.44638 0.34459 0.01457  0.04034  0.08527  64  ILE B O   
3357 C CB  . ILE B 87  ? 0.36616 0.38441 0.30763 0.01396  0.03340  0.07677  64  ILE B CB  
3358 C CG1 . ILE B 87  ? 0.42433 0.42257 0.36968 0.01710  0.04282  0.08535  64  ILE B CG1 
3359 C CG2 . ILE B 87  ? 0.36252 0.38478 0.30916 0.01188  0.02684  0.06834  64  ILE B CG2 
3360 C CD1 . ILE B 87  ? 0.42527 0.42521 0.36650 0.02977  0.04584  0.09829  64  ILE B CD1 
3361 N N   . LYS B 88  ? 0.38289 0.39022 0.32456 0.00060  0.04492  0.07455  65  LYS B N   
3362 C CA  . LYS B 88  ? 0.39397 0.40302 0.32990 0.00076  0.05112  0.07983  65  LYS B CA  
3363 C C   . LYS B 88  ? 0.36832 0.39128 0.30222 -0.00420 0.04673  0.07070  65  LYS B C   
3364 O O   . LYS B 88  ? 0.36813 0.39487 0.30740 -0.00839 0.04050  0.06084  65  LYS B O   
3365 C CB  . LYS B 88  ? 0.44466 0.43574 0.38946 -0.00431 0.06030  0.08099  65  LYS B CB  
3366 C CG  . LYS B 88  ? 0.54740 0.52144 0.49735 -0.00121 0.06655  0.08723  65  LYS B CG  
3367 C CD  . LYS B 88  ? 0.75940 0.71756 0.71314 -0.00289 0.07996  0.09399  65  LYS B CD  
3368 C CE  . LYS B 88  ? 0.81677 0.77239 0.78129 -0.01411 0.08230  0.08361  65  LYS B CE  
3369 N NZ  . LYS B 88  ? 0.88987 0.83433 0.85613 -0.01585 0.09611  0.09071  65  LYS B NZ  
3370 N N   . PRO B 89  ? 0.38369 0.41386 0.31006 -0.00376 0.05094  0.07369  66  PRO B N   
3371 C CA  . PRO B 89  ? 0.36048 0.40125 0.28735 -0.00947 0.04871  0.06336  66  PRO B CA  
3372 C C   . PRO B 89  ? 0.42251 0.45277 0.36326 -0.01689 0.04932  0.05542  66  PRO B C   
3373 O O   . PRO B 89  ? 0.38250 0.40075 0.33000 -0.01922 0.05502  0.05834  66  PRO B O   
3374 C CB  . PRO B 89  ? 0.37721 0.42429 0.29402 -0.00763 0.05560  0.06949  66  PRO B CB  
3375 C CG  . PRO B 89  ? 0.39746 0.44484 0.30388 0.00210  0.05823  0.08423  66  PRO B CG  
3376 C CD  . PRO B 89  ? 0.43443 0.46317 0.35131 0.00235  0.05904  0.08695  66  PRO B CD  
3377 N N   . VAL B 90  ? 0.35501 0.39066 0.30082 -0.02037 0.04396  0.04539  67  VAL B N   
3378 C CA  . VAL B 90  ? 0.35390 0.38327 0.31241 -0.02553 0.04389  0.03886  67  VAL B CA  
3379 C C   . VAL B 90  ? 0.36374 0.40139 0.32405 -0.02831 0.04424  0.03081  67  VAL B C   
3380 O O   . VAL B 90  ? 0.35247 0.40037 0.30534 -0.02755 0.04302  0.02747  67  VAL B O   
3381 C CB  . VAL B 90  ? 0.35607 0.38013 0.32108 -0.02569 0.03813  0.03622  67  VAL B CB  
3382 C CG1 . VAL B 90  ? 0.31415 0.32774 0.28087 -0.02446 0.03976  0.04198  67  VAL B CG1 
3383 C CG2 . VAL B 90  ? 0.33838 0.36986 0.29790 -0.02345 0.03292  0.03364  67  VAL B CG2 
3384 N N   . PRO B 91  ? 0.33948 0.37420 0.31072 -0.03154 0.04636  0.02670  68  PRO B N   
3385 C CA  . PRO B 91  ? 0.35649 0.39684 0.33171 -0.03337 0.04797  0.01906  68  PRO B CA  
3386 C C   . PRO B 91  ? 0.35842 0.40114 0.33294 -0.03293 0.04380  0.01371  68  PRO B C   
3387 O O   . PRO B 91  ? 0.34093 0.37946 0.31685 -0.03159 0.03901  0.01524  68  PRO B O   
3388 C CB  . PRO B 91  ? 0.31187 0.34853 0.30126 -0.03481 0.04906  0.01736  68  PRO B CB  
3389 C CG  . PRO B 91  ? 0.31091 0.34303 0.30179 -0.03604 0.05148  0.02309  68  PRO B CG  
3390 C CD  . PRO B 91  ? 0.33300 0.36072 0.31477 -0.03357 0.04782  0.02814  68  PRO B CD  
3391 N N   . GLU B 92  ? 0.33342 0.38289 0.30641 -0.03475 0.04676  0.00646  69  GLU B N   
3392 C CA  . GLU B 92  ? 0.33838 0.38823 0.31453 -0.03584 0.04533  -0.00047 69  GLU B CA  
3393 C C   . GLU B 92  ? 0.35067 0.39081 0.33934 -0.03479 0.04530  -0.00023 69  GLU B C   
3394 O O   . GLU B 92  ? 0.29723 0.33474 0.29375 -0.03398 0.04773  0.00139  69  GLU B O   
3395 C CB  . GLU B 92  ? 0.38901 0.44753 0.36339 -0.03932 0.05052  -0.01057 69  GLU B CB  
3396 C CG  . GLU B 92  ? 0.40518 0.47855 0.36547 -0.03966 0.04933  -0.01143 69  GLU B CG  
3397 C CD  . GLU B 92  ? 0.44883 0.53448 0.40722 -0.04437 0.05358  -0.02466 69  GLU B CD  
3398 O OE1 . GLU B 92  ? 0.45475 0.54460 0.41201 -0.04630 0.05951  -0.02881 69  GLU B OE1 
3399 O OE2 . GLU B 92  ? 0.45845 0.55063 0.41696 -0.04683 0.05161  -0.03210 69  GLU B OE2 
3400 N N   . VAL B 93  ? 0.32420 0.36076 0.31489 -0.03440 0.04292  -0.00172 70  VAL B N   
3401 C CA  . VAL B 93  ? 0.35255 0.38094 0.35280 -0.03186 0.04259  0.00074  70  VAL B CA  
3402 C C   . VAL B 93  ? 0.34478 0.37052 0.35528 -0.03123 0.04938  -0.00268 70  VAL B C   
3403 O O   . VAL B 93  ? 0.33525 0.35814 0.35426 -0.02734 0.04931  0.00179  70  VAL B O   
3404 C CB  . VAL B 93  ? 0.40252 0.42751 0.40191 -0.03196 0.04079  -0.00045 70  VAL B CB  
3405 C CG1 . VAL B 93  ? 0.39240 0.40908 0.40068 -0.02845 0.04237  0.00284  70  VAL B CG1 
3406 C CG2 . VAL B 93  ? 0.36524 0.39236 0.35675 -0.03114 0.03412  0.00414  70  VAL B CG2 
3407 N N   . LYS B 94  ? 0.31059 0.33874 0.32108 -0.03466 0.05563  -0.01110 71  LYS B N   
3408 C CA  . LYS B 94  ? 0.32438 0.34854 0.34597 -0.03368 0.06369  -0.01483 71  LYS B CA  
3409 C C   . LYS B 94  ? 0.31918 0.34672 0.34534 -0.03117 0.06383  -0.01043 71  LYS B C   
3410 O O   . LYS B 94  ? 0.33341 0.35787 0.37148 -0.02702 0.06744  -0.00854 71  LYS B O   
3411 C CB  . LYS B 94  ? 0.33884 0.36632 0.35950 -0.03915 0.07131  -0.02700 71  LYS B CB  
3412 C CG  . LYS B 94  ? 0.36570 0.40585 0.37561 -0.04280 0.07097  -0.03090 71  LYS B CG  
3413 C CD  . LYS B 94  ? 0.35480 0.40228 0.36233 -0.04912 0.07754  -0.04528 71  LYS B CD  
3414 C CE  . LYS B 94  ? 0.42602 0.49002 0.41913 -0.05176 0.07571  -0.04785 71  LYS B CE  
3415 N NZ  . LYS B 94  ? 0.38679 0.46265 0.37697 -0.05854 0.08147  -0.06391 71  LYS B NZ  
3416 N N   . ILE B 95  ? 0.31622 0.35043 0.33407 -0.03314 0.06060  -0.00819 72  ILE B N   
3417 C CA  . ILE B 95  ? 0.35013 0.38792 0.37340 -0.03213 0.06173  -0.00480 72  ILE B CA  
3418 C C   . ILE B 95  ? 0.33947 0.37631 0.37049 -0.02830 0.05631  0.00192  72  ILE B C   
3419 O O   . ILE B 95  ? 0.35754 0.39781 0.40024 -0.02551 0.05801  0.00306  72  ILE B O   
3420 C CB  . ILE B 95  ? 0.32961 0.37270 0.34179 -0.03527 0.06137  -0.00301 72  ILE B CB  
3421 C CG1 . ILE B 95  ? 0.34584 0.39468 0.34879 -0.03848 0.06626  -0.00979 72  ILE B CG1 
3422 C CG2 . ILE B 95  ? 0.31522 0.36110 0.33497 -0.03536 0.06380  0.00000  72  ILE B CG2 
3423 C CD1 . ILE B 95  ? 0.41033 0.46087 0.42174 -0.03951 0.07478  -0.01706 72  ILE B CD1 
3424 N N   . LEU B 96  ? 0.31666 0.35127 0.34144 -0.02810 0.04966  0.00586  73  LEU B N   
3425 C CA  . LEU B 96  ? 0.28388 0.32010 0.31455 -0.02522 0.04422  0.01065  73  LEU B CA  
3426 C C   . LEU B 96  ? 0.33283 0.36839 0.37306 -0.01951 0.04493  0.01225  73  LEU B C   
3427 O O   . LEU B 96  ? 0.34368 0.38641 0.39354 -0.01578 0.04328  0.01496  73  LEU B O   
3428 C CB  . LEU B 96  ? 0.32394 0.35695 0.34531 -0.02626 0.03819  0.01332  73  LEU B CB  
3429 C CG  . LEU B 96  ? 0.31826 0.35063 0.33022 -0.02992 0.03821  0.01413  73  LEU B CG  
3430 C CD1 . LEU B 96  ? 0.32476 0.35328 0.32894 -0.02964 0.03320  0.01673  73  LEU B CD1 
3431 C CD2 . LEU B 96  ? 0.35972 0.39522 0.37684 -0.03221 0.04023  0.01520  73  LEU B CD2 
3432 N N   . ASN B 97  ? 0.28462 0.31255 0.32301 -0.01847 0.04807  0.01074  74  ASN B N   
3433 C CA  . ASN B 97  ? 0.28637 0.31057 0.33413 -0.01214 0.05159  0.01366  74  ASN B CA  
3434 C C   . ASN B 97  ? 0.31868 0.34685 0.37875 -0.00877 0.05745  0.01286  74  ASN B C   
3435 O O   . ASN B 97  ? 0.33931 0.37179 0.40915 -0.00132 0.05709  0.01857  74  ASN B O   
3436 C CB  . ASN B 97  ? 0.32614 0.33932 0.37172 -0.01352 0.05744  0.01007  74  ASN B CB  
3437 C CG  . ASN B 97  ? 0.37381 0.38367 0.41053 -0.01487 0.05232  0.01214  74  ASN B CG  
3438 O OD1 . ASN B 97  ? 0.38462 0.39944 0.41650 -0.01413 0.04449  0.01657  74  ASN B OD1 
3439 N ND2 . ASN B 97  ? 0.36065 0.36279 0.39597 -0.01775 0.05741  0.00753  74  ASN B ND2 
3440 N N   . ASN B 98  ? 0.31237 0.34037 0.37226 -0.01339 0.06344  0.00589  75  ASN B N   
3441 C CA  . ASN B 98  ? 0.30239 0.33369 0.37495 -0.01019 0.07040  0.00423  75  ASN B CA  
3442 C C   . ASN B 98  ? 0.39075 0.43529 0.47066 -0.00784 0.06571  0.00815  75  ASN B C   
3443 O O   . ASN B 98  ? 0.34486 0.39534 0.43846 -0.00221 0.06945  0.00949  75  ASN B O   
3444 C CB  . ASN B 98  ? 0.32091 0.35151 0.39011 -0.01651 0.07769  -0.00498 75  ASN B CB  
3445 C CG  . ASN B 98  ? 0.34204 0.36272 0.40870 -0.01932 0.08469  -0.01224 75  ASN B CG  
3446 O OD1 . ASN B 98  ? 0.32452 0.33614 0.39458 -0.01612 0.08630  -0.00999 75  ASN B OD1 
3447 N ND2 . ASN B 98  ? 0.36483 0.38824 0.42585 -0.02570 0.08971  -0.02155 75  ASN B ND2 
3448 N N   . LEU B 99  ? 0.34282 0.39269 0.41529 -0.01231 0.05858  0.00919  76  LEU B N   
3449 C CA  . LEU B 99  ? 0.35901 0.42224 0.43954 -0.01208 0.05463  0.01079  76  LEU B CA  
3450 C C   . LEU B 99  ? 0.38392 0.45500 0.46844 -0.00651 0.04684  0.01625  76  LEU B C   
3451 O O   . LEU B 99  ? 0.40907 0.49432 0.50075 -0.00703 0.04262  0.01597  76  LEU B O   
3452 C CB  . LEU B 99  ? 0.34263 0.40642 0.41468 -0.02027 0.05308  0.00856  76  LEU B CB  
3453 C CG  . LEU B 99  ? 0.35256 0.41335 0.42037 -0.02499 0.06078  0.00437  76  LEU B CG  
3454 C CD1 . LEU B 99  ? 0.35114 0.40995 0.40841 -0.03134 0.06010  0.00511  76  LEU B CD1 
3455 C CD2 . LEU B 99  ? 0.39356 0.46348 0.47617 -0.02347 0.06690  0.00177  76  LEU B CD2 
3456 N N   . GLY B 100 ? 0.32569 0.38921 0.40555 -0.00183 0.04527  0.02049  77  GLY B N   
3457 C CA  . GLY B 100 ? 0.34652 0.41874 0.42861 0.00470  0.03860  0.02662  77  GLY B CA  
3458 C C   . GLY B 100 ? 0.32580 0.40175 0.39885 -0.00004 0.03044  0.02594  77  GLY B C   
3459 O O   . GLY B 100 ? 0.35963 0.44935 0.43577 0.00372  0.02417  0.02855  77  GLY B O   
3460 N N   . VAL B 101 ? 0.30726 0.37261 0.36935 -0.00764 0.03061  0.02240  78  VAL B N   
3461 C CA  . VAL B 101 ? 0.30989 0.37692 0.36465 -0.01203 0.02445  0.02134  78  VAL B CA  
3462 C C   . VAL B 101 ? 0.32002 0.38514 0.36859 -0.00740 0.02018  0.02584  78  VAL B C   
3463 O O   . VAL B 101 ? 0.33343 0.38704 0.37699 -0.00505 0.02324  0.02842  78  VAL B O   
3464 C CB  . VAL B 101 ? 0.28603 0.34192 0.33113 -0.01922 0.02679  0.01832  78  VAL B CB  
3465 C CG1 . VAL B 101 ? 0.30524 0.35886 0.34252 -0.02228 0.02183  0.01811  78  VAL B CG1 
3466 C CG2 . VAL B 101 ? 0.25931 0.31849 0.30965 -0.02403 0.03140  0.01490  78  VAL B CG2 
3467 N N   . ASP B 102 ? 0.34088 0.41819 0.38998 -0.00673 0.01376  0.02591  79  ASP B N   
3468 C CA  . ASP B 102 ? 0.34843 0.42635 0.39050 -0.00233 0.00967  0.03029  79  ASP B CA  
3469 C C   . ASP B 102 ? 0.34101 0.41240 0.37281 -0.00825 0.00688  0.02705  79  ASP B C   
3470 O O   . ASP B 102 ? 0.32876 0.39543 0.35279 -0.00562 0.00554  0.03042  79  ASP B O   
3471 C CB  . ASP B 102 ? 0.32974 0.42952 0.37795 0.00341  0.00396  0.03235  79  ASP B CB  
3472 C CG  . ASP B 102 ? 0.39014 0.49752 0.44887 0.01235  0.00668  0.03802  79  ASP B CG  
3473 O OD1 . ASP B 102 ? 0.36000 0.45359 0.41712 0.01801  0.01233  0.04438  79  ASP B OD1 
3474 O OD2 . ASP B 102 ? 0.34823 0.47488 0.41813 0.01349  0.00425  0.03557  79  ASP B OD2 
3475 N N   . ILE B 103 ? 0.31338 0.38419 0.34575 -0.01575 0.00693  0.02100  80  ILE B N   
3476 C CA  . ILE B 103 ? 0.30190 0.36886 0.32733 -0.02050 0.00468  0.01763  80  ILE B CA  
3477 C C   . ILE B 103 ? 0.34856 0.41008 0.37650 -0.02765 0.00843  0.01301  80  ILE B C   
3478 O O   . ILE B 103 ? 0.32348 0.38964 0.35959 -0.02943 0.01126  0.01134  80  ILE B O   
3479 C CB  . ILE B 103 ? 0.28201 0.36567 0.30901 -0.01953 -0.00121 0.01511  80  ILE B CB  
3480 C CG1 . ILE B 103 ? 0.28089 0.35987 0.30000 -0.02334 -0.00287 0.01152  80  ILE B CG1 
3481 C CG2 . ILE B 103 ? 0.25281 0.35335 0.29177 -0.02319 -0.00229 0.00875  80  ILE B CG2 
3482 C CD1 . ILE B 103 ? 0.26073 0.35794 0.27858 -0.02153 -0.00878 0.00898  80  ILE B CD1 
3483 N N   . ALA B 104 ? 0.31675 0.36785 0.33803 -0.03114 0.00951  0.01176  81  ALA B N   
3484 C CA  . ALA B 104 ? 0.30448 0.34792 0.32742 -0.03662 0.01473  0.00960  81  ALA B CA  
3485 C C   . ALA B 104 ? 0.35284 0.39797 0.37940 -0.04204 0.01505  0.00327  81  ALA B C   
3486 O O   . ALA B 104 ? 0.34914 0.39642 0.37193 -0.04143 0.01135  0.00121  81  ALA B O   
3487 C CB  . ALA B 104 ? 0.29390 0.32327 0.30719 -0.03527 0.01772  0.01427  81  ALA B CB  
3488 N N   . ALA B 105 ? 0.33090 0.37410 0.36504 -0.04793 0.02084  -0.00042 82  ALA B N   
3489 C CA  . ALA B 105 ? 0.33737 0.37964 0.37726 -0.05474 0.02395  -0.00816 82  ALA B CA  
3490 C C   . ALA B 105 ? 0.34836 0.37157 0.38084 -0.05442 0.02888  -0.00468 82  ALA B C   
3491 O O   . ALA B 105 ? 0.38386 0.39449 0.41429 -0.05400 0.03556  0.00099  82  ALA B O   
3492 C CB  . ALA B 105 ? 0.32110 0.36736 0.37379 -0.06172 0.03031  -0.01357 82  ALA B CB  
3493 N N   . ASN B 106 ? 0.32617 0.34836 0.35458 -0.05387 0.02600  -0.00754 83  ASN B N   
3494 C CA  . ASN B 106 ? 0.41742 0.42318 0.44226 -0.05394 0.03159  -0.00623 83  ASN B CA  
3495 C C   . ASN B 106 ? 0.39021 0.38404 0.40563 -0.04718 0.03332  0.00503  83  ASN B C   
3496 O O   . ASN B 106 ? 0.38331 0.36329 0.39778 -0.04621 0.04050  0.00920  83  ASN B O   
3497 C CB  . ASN B 106 ? 0.45576 0.45377 0.49124 -0.06172 0.04137  -0.01276 83  ASN B CB  
3498 C CG  . ASN B 106 ? 0.46402 0.47803 0.50958 -0.06948 0.03920  -0.02656 83  ASN B CG  
3499 O OD1 . ASN B 106 ? 0.48694 0.51656 0.53901 -0.07185 0.03601  -0.03003 83  ASN B OD1 
3500 N ND2 . ASN B 106 ? 0.47705 0.49024 0.52358 -0.07281 0.04012  -0.03488 83  ASN B ND2 
3501 N N   . THR B 107 ? 0.37434 0.37448 0.38309 -0.04214 0.02718  0.00978  84  THR B N   
3502 C CA  . THR B 107 ? 0.39020 0.38434 0.39003 -0.03631 0.02733  0.01797  84  THR B CA  
3503 C C   . THR B 107 ? 0.38187 0.38438 0.37700 -0.03297 0.02040  0.01861  84  THR B C   
3504 O O   . THR B 107 ? 0.34244 0.35370 0.34082 -0.03397 0.01647  0.01503  84  THR B O   
3505 C CB  . THR B 107 ? 0.48020 0.47077 0.47927 -0.03580 0.03268  0.02346  84  THR B CB  
3506 O OG1 . THR B 107 ? 0.46441 0.45230 0.45426 -0.02997 0.03273  0.03071  84  THR B OG1 
3507 C CG2 . THR B 107 ? 0.37375 0.37409 0.37596 -0.03719 0.03052  0.02173  84  THR B CG2 
3508 N N   . VAL B 108 ? 0.32890 0.32957 0.31695 -0.02874 0.01957  0.02327  85  VAL B N   
3509 C CA  . VAL B 108 ? 0.33883 0.34534 0.32371 -0.02654 0.01541  0.02335  85  VAL B CA  
3510 C C   . VAL B 108 ? 0.32715 0.33560 0.30917 -0.02536 0.01714  0.02592  85  VAL B C   
3511 O O   . VAL B 108 ? 0.33375 0.34069 0.31111 -0.02334 0.01916  0.02946  85  VAL B O   
3512 C CB  . VAL B 108 ? 0.36399 0.36961 0.34443 -0.02409 0.01315  0.02357  85  VAL B CB  
3513 C CG1 . VAL B 108 ? 0.31691 0.32699 0.29527 -0.02279 0.01120  0.02340  85  VAL B CG1 
3514 C CG2 . VAL B 108 ? 0.35840 0.36341 0.34056 -0.02550 0.01175  0.01994  85  VAL B CG2 
3515 N N   . ILE B 109 ? 0.31277 0.32564 0.29747 -0.02601 0.01677  0.02424  86  ILE B N   
3516 C CA  . ILE B 109 ? 0.33499 0.35094 0.31689 -0.02562 0.01877  0.02434  86  ILE B CA  
3517 C C   . ILE B 109 ? 0.33232 0.35040 0.31181 -0.02462 0.01700  0.02232  86  ILE B C   
3518 O O   . ILE B 109 ? 0.32444 0.34189 0.30760 -0.02458 0.01658  0.02073  86  ILE B O   
3519 C CB  . ILE B 109 ? 0.36262 0.38122 0.35027 -0.02702 0.02111  0.02255  86  ILE B CB  
3520 C CG1 . ILE B 109 ? 0.29135 0.30934 0.28393 -0.02912 0.02337  0.02326  86  ILE B CG1 
3521 C CG2 . ILE B 109 ? 0.34652 0.36877 0.33073 -0.02737 0.02413  0.02089  86  ILE B CG2 
3522 C CD1 . ILE B 109 ? 0.31097 0.32501 0.29846 -0.02948 0.02718  0.02695  86  ILE B CD1 
3523 N N   . TRP B 110 ? 0.26851 0.29001 0.24249 -0.02351 0.01656  0.02267  87  TRP B N   
3524 C CA  . TRP B 110 ? 0.26245 0.28778 0.23595 -0.02388 0.01563  0.01902  87  TRP B CA  
3525 C C   . TRP B 110 ? 0.34005 0.37040 0.31484 -0.02642 0.01864  0.01381  87  TRP B C   
3526 O O   . TRP B 110 ? 0.29998 0.33631 0.27130 -0.02677 0.01997  0.01320  87  TRP B O   
3527 C CB  . TRP B 110 ? 0.25595 0.28681 0.22475 -0.02148 0.01356  0.02040  87  TRP B CB  
3528 C CG  . TRP B 110 ? 0.30403 0.33973 0.27446 -0.02270 0.01277  0.01568  87  TRP B CG  
3529 C CD1 . TRP B 110 ? 0.29228 0.33936 0.26246 -0.02455 0.01323  0.01008  87  TRP B CD1 
3530 C CD2 . TRP B 110 ? 0.32214 0.35253 0.29515 -0.02284 0.01224  0.01542  87  TRP B CD2 
3531 N NE1 . TRP B 110 ? 0.30435 0.35235 0.27836 -0.02646 0.01367  0.00602  87  TRP B NE1 
3532 C CE2 . TRP B 110 ? 0.30838 0.34555 0.28344 -0.02497 0.01322  0.01011  87  TRP B CE2 
3533 C CE3 . TRP B 110 ? 0.33149 0.35364 0.30518 -0.02179 0.01138  0.01840  87  TRP B CE3 
3534 C CZ2 . TRP B 110 ? 0.33871 0.37270 0.31633 -0.02575 0.01414  0.00900  87  TRP B CZ2 
3535 C CZ3 . TRP B 110 ? 0.30867 0.32910 0.28326 -0.02197 0.01151  0.01741  87  TRP B CZ3 
3536 C CH2 . TRP B 110 ? 0.29191 0.31709 0.26844 -0.02382 0.01332  0.01339  87  TRP B CH2 
3537 N N   . ASP B 111 ? 0.32472 0.35242 0.30438 -0.02819 0.02076  0.00992  88  ASP B N   
3538 C CA  . ASP B 111 ? 0.35515 0.38502 0.33842 -0.03139 0.02568  0.00329  88  ASP B CA  
3539 C C   . ASP B 111 ? 0.37009 0.40910 0.35222 -0.03442 0.02609  -0.00362 88  ASP B C   
3540 O O   . ASP B 111 ? 0.31233 0.34860 0.29810 -0.03580 0.02742  -0.00585 88  ASP B O   
3541 C CB  . ASP B 111 ? 0.32532 0.34543 0.31612 -0.03088 0.02969  0.00390  88  ASP B CB  
3542 C CG  . ASP B 111 ? 0.38179 0.40066 0.37861 -0.03392 0.03709  -0.00308 88  ASP B CG  
3543 O OD1 . ASP B 111 ? 0.42030 0.44714 0.41570 -0.03819 0.03908  -0.01116 88  ASP B OD1 
3544 O OD2 . ASP B 111 ? 0.40679 0.41764 0.41025 -0.03172 0.04123  -0.00071 88  ASP B OD2 
3545 N N   . TYR B 112 ? 0.33428 0.38610 0.31147 -0.03553 0.02527  -0.00729 89  TYR B N   
3546 C CA  . TYR B 112 ? 0.39286 0.45891 0.36940 -0.03836 0.02457  -0.01492 89  TYR B CA  
3547 C C   . TYR B 112 ? 0.47561 0.54260 0.45988 -0.04524 0.03139  -0.02699 89  TYR B C   
3548 O O   . TYR B 112 ? 0.41734 0.49630 0.40394 -0.04929 0.03183  -0.03563 89  TYR B O   
3549 C CB  . TYR B 112 ? 0.36823 0.45189 0.33583 -0.03618 0.02101  -0.01438 89  TYR B CB  
3550 C CG  . TYR B 112 ? 0.34876 0.43282 0.30996 -0.02907 0.01578  -0.00306 89  TYR B CG  
3551 C CD1 . TYR B 112 ? 0.29329 0.36578 0.25155 -0.02541 0.01604  0.00635  89  TYR B CD1 
3552 C CD2 . TYR B 112 ? 0.33061 0.42594 0.29066 -0.02629 0.01178  -0.00248 89  TYR B CD2 
3553 C CE1 . TYR B 112 ? 0.35249 0.42284 0.30639 -0.01936 0.01352  0.01605  89  TYR B CE1 
3554 C CE2 . TYR B 112 ? 0.38699 0.48098 0.34251 -0.01894 0.00858  0.00815  89  TYR B CE2 
3555 C CZ  . TYR B 112 ? 0.39120 0.47130 0.34373 -0.01570 0.01004  0.01727  89  TYR B CZ  
3556 O OH  . TYR B 112 ? 0.38882 0.46538 0.33843 -0.00892 0.00897  0.02696  89  TYR B OH  
3557 N N   . LYS B 113 ? 0.40586 0.46155 0.39533 -0.04677 0.03749  -0.02855 90  LYS B N   
3558 C CA  . LYS B 113 ? 0.46254 0.51499 0.46141 -0.05315 0.04627  -0.03980 90  LYS B CA  
3559 C C   . LYS B 113 ? 0.40745 0.44608 0.41366 -0.05328 0.05009  -0.03746 90  LYS B C   
3560 O O   . LYS B 113 ? 0.40331 0.44107 0.41740 -0.05934 0.05736  -0.04714 90  LYS B O   
3561 C CB  . LYS B 113 ? 0.47254 0.51678 0.47591 -0.05384 0.05319  -0.04213 90  LYS B CB  
3562 C CG  . LYS B 113 ? 0.55827 0.61450 0.55416 -0.05366 0.05105  -0.04375 90  LYS B CG  
3563 C CD  . LYS B 113 ? 0.59636 0.66974 0.59129 -0.06066 0.05430  -0.05871 90  LYS B CD  
3564 C CE  . LYS B 113 ? 0.57693 0.66014 0.56463 -0.06041 0.05472  -0.06038 90  LYS B CE  
3565 N NZ  . LYS B 113 ? 0.51791 0.60891 0.49296 -0.05390 0.04612  -0.04800 90  LYS B NZ  
3566 N N   . ARG B 114 ? 0.33864 0.36683 0.34264 -0.04712 0.04634  -0.02534 91  ARG B N   
3567 C CA  . ARG B 114 ? 0.38295 0.39933 0.39131 -0.04594 0.04959  -0.02104 91  ARG B CA  
3568 C C   . ARG B 114 ? 0.40305 0.42559 0.40638 -0.04460 0.04301  -0.01781 91  ARG B C   
3569 O O   . ARG B 114 ? 0.42238 0.43708 0.42816 -0.04405 0.04577  -0.01475 91  ARG B O   
3570 C CB  . ARG B 114 ? 0.37427 0.37723 0.38356 -0.03932 0.05030  -0.00996 91  ARG B CB  
3571 C CG  . ARG B 114 ? 0.39509 0.38925 0.41229 -0.03887 0.05882  -0.01147 91  ARG B CG  
3572 C CD  . ARG B 114 ? 0.43039 0.41938 0.44740 -0.03088 0.05602  -0.00006 91  ARG B CD  
3573 N NE  . ARG B 114 ? 0.45830 0.44273 0.47284 -0.02600 0.05350  0.00925  91  ARG B NE  
3574 C CZ  . ARG B 114 ? 0.39496 0.38508 0.40252 -0.02283 0.04454  0.01522  91  ARG B CZ  
3575 N NH1 . ARG B 114 ? 0.39396 0.38101 0.39889 -0.01919 0.04352  0.02193  91  ARG B NH1 
3576 N NH2 . ARG B 114 ? 0.34836 0.34679 0.35166 -0.02345 0.03772  0.01432  91  ARG B NH2 
3577 N N   . ASP B 115 ? 0.35829 0.39439 0.35477 -0.04340 0.03534  -0.01776 92  ASP B N   
3578 C CA  . ASP B 115 ? 0.35455 0.39546 0.34683 -0.04044 0.02936  -0.01335 92  ASP B CA  
3579 C C   . ASP B 115 ? 0.32332 0.35133 0.31377 -0.03585 0.02800  -0.00379 92  ASP B C   
3580 O O   . ASP B 115 ? 0.32899 0.35422 0.32030 -0.03564 0.02875  -0.00247 92  ASP B O   
3581 C CB  . ASP B 115 ? 0.44560 0.49473 0.44297 -0.04501 0.03181  -0.02121 92  ASP B CB  
3582 C CG  . ASP B 115 ? 0.65243 0.72167 0.65069 -0.04915 0.03075  -0.03161 92  ASP B CG  
3583 O OD1 . ASP B 115 ? 0.74460 0.81786 0.75074 -0.05650 0.03729  -0.04305 92  ASP B OD1 
3584 O OD2 . ASP B 115 ? 0.74270 0.82421 0.73383 -0.04496 0.02401  -0.02837 92  ASP B OD2 
3585 N N   . ALA B 116 ? 0.27597 0.29816 0.26407 -0.03250 0.02617  0.00210  93  ALA B N   
3586 C CA  . ALA B 116 ? 0.30978 0.32347 0.29668 -0.02865 0.02485  0.00950  93  ALA B CA  
3587 C C   . ALA B 116 ? 0.30095 0.31457 0.28570 -0.02607 0.02122  0.01357  93  ALA B C   
3588 O O   . ALA B 116 ? 0.32562 0.34257 0.31065 -0.02722 0.02176  0.01145  93  ALA B O   
3589 C CB  . ALA B 116 ? 0.27686 0.28123 0.26883 -0.02827 0.03146  0.01111  93  ALA B CB  
3590 N N   . PRO B 117 ? 0.34887 0.36012 0.33177 -0.02322 0.01806  0.01845  94  PRO B N   
3591 C CA  . PRO B 117 ? 0.29741 0.30967 0.28074 -0.02207 0.01569  0.02068  94  PRO B CA  
3592 C C   . PRO B 117 ? 0.29445 0.30567 0.28311 -0.02153 0.01908  0.02081  94  PRO B C   
3593 O O   . PRO B 117 ? 0.28126 0.28866 0.27327 -0.02001 0.02285  0.02199  94  PRO B O   
3594 C CB  . PRO B 117 ? 0.33164 0.34407 0.31350 -0.02001 0.01255  0.02357  94  PRO B CB  
3595 C CG  . PRO B 117 ? 0.33412 0.34521 0.31242 -0.02003 0.01259  0.02315  94  PRO B CG  
3596 C CD  . PRO B 117 ? 0.30980 0.31878 0.29070 -0.02148 0.01731  0.02117  94  PRO B CD  
3597 N N   . ALA B 118 ? 0.29836 0.31218 0.28839 -0.02234 0.01890  0.02014  95  ALA B N   
3598 C CA  . ALA B 118 ? 0.32211 0.33576 0.31846 -0.02132 0.02244  0.02010  95  ALA B CA  
3599 C C   . ALA B 118 ? 0.34937 0.36464 0.34996 -0.01708 0.02092  0.02465  95  ALA B C   
3600 O O   . ALA B 118 ? 0.34090 0.35512 0.34760 -0.01395 0.02465  0.02647  95  ALA B O   
3601 C CB  . ALA B 118 ? 0.29911 0.31629 0.29595 -0.02328 0.02307  0.01845  95  ALA B CB  
3602 N N   . HIS B 119 ? 0.28434 0.33709 0.31757 -0.02995 0.00095  0.01294  96  HIS B N   
3603 C CA  . HIS B 119 ? 0.32007 0.37078 0.35778 -0.02480 -0.00064 0.01555  96  HIS B CA  
3604 C C   . HIS B 119 ? 0.38889 0.44115 0.42397 -0.02282 -0.00382 0.01621  96  HIS B C   
3605 O O   . HIS B 119 ? 0.41328 0.46881 0.44621 -0.02401 -0.00640 0.01492  96  HIS B O   
3606 C CB  . HIS B 119 ? 0.27775 0.33244 0.32146 -0.02363 -0.00401 0.01631  96  HIS B CB  
3607 C CG  . HIS B 119 ? 0.31437 0.36790 0.35989 -0.02593 -0.00018 0.01579  96  HIS B CG  
3608 N ND1 . HIS B 119 ? 0.32617 0.38146 0.37018 -0.02869 -0.00065 0.01567  96  HIS B ND1 
3609 C CD2 . HIS B 119 ? 0.30459 0.35458 0.35196 -0.02577 0.00572  0.01559  96  HIS B CD2 
3610 C CE1 . HIS B 119 ? 0.33513 0.38955 0.37939 -0.03100 0.00386  0.01492  96  HIS B CE1 
3611 N NE2 . HIS B 119 ? 0.31188 0.36253 0.35851 -0.02950 0.00813  0.01412  96  HIS B NE2 
3612 N N   . ILE B 120 ? 0.45139 0.50265 0.48697 -0.01885 -0.00327 0.01916  97  ILE B N   
3613 C CA  . ILE B 120 ? 0.53881 0.59149 0.56998 -0.01740 -0.00509 0.02004  97  ILE B CA  
3614 C C   . ILE B 120 ? 0.43738 0.49739 0.46930 -0.01707 -0.01137 0.01816  97  ILE B C   
3615 O O   . ILE B 120 ? 0.39574 0.45659 0.42375 -0.01784 -0.01248 0.01628  97  ILE B O   
3616 C CB  . ILE B 120 ? 0.67532 0.72532 0.70551 -0.01234 -0.00159 0.02574  97  ILE B CB  
3617 C CG1 . ILE B 120 ? 0.80997 0.86156 0.83386 -0.01132 -0.00273 0.02714  97  ILE B CG1 
3618 C CG2 . ILE B 120 ? 0.72215 0.78074 0.75872 -0.00730 -0.00457 0.02973  97  ILE B CG2 
3619 C CD1 . ILE B 120 ? 0.85676 0.90391 0.87606 -0.01683 0.00002  0.02271  97  ILE B CD1 
3620 N N   . SER B 121 ? 0.30579 0.37121 0.34290 -0.01672 -0.01433 0.01772  98  SER B N   
3621 C CA  . SER B 121 ? 0.32651 0.39759 0.36396 -0.01863 -0.01827 0.01383  98  SER B CA  
3622 C C   . SER B 121 ? 0.31805 0.38496 0.35928 -0.02179 -0.01745 0.01062  98  SER B C   
3623 O O   . SER B 121 ? 0.30159 0.36458 0.34503 -0.02201 -0.01517 0.01234  98  SER B O   
3624 C CB  . SER B 121 ? 0.33824 0.42202 0.37844 -0.01760 -0.02171 0.01491  98  SER B CB  
3625 O OG  . SER B 121 ? 0.35849 0.44594 0.39378 -0.01317 -0.02183 0.02001  98  SER B OG  
3626 N N   . THR B 122 ? 0.28194 0.34878 0.32310 -0.02452 -0.01804 0.00588  99  THR B N   
3627 C CA  . THR B 122 ? 0.28230 0.34192 0.32684 -0.02696 -0.01504 0.00377  99  THR B CA  
3628 C C   . THR B 122 ? 0.30383 0.36657 0.35126 -0.03266 -0.01493 -0.00271 99  THR B C   
3629 O O   . THR B 122 ? 0.31077 0.38433 0.35663 -0.03503 -0.01822 -0.00627 99  THR B O   
3630 C CB  . THR B 122 ? 0.31770 0.36893 0.35947 -0.02460 -0.01180 0.00427  99  THR B CB  
3631 O OG1 . THR B 122 ? 0.30450 0.35669 0.34223 -0.02484 -0.01202 0.00022  99  THR B OG1 
3632 C CG2 . THR B 122 ? 0.31770 0.37052 0.35750 -0.02110 -0.01196 0.00969  99  THR B CG2 
3633 N N   . ILE B 123 ? 0.30166 0.35565 0.35273 -0.03556 -0.01039 -0.00429 100 ILE B N   
3634 C CA  . ILE B 123 ? 0.29043 0.34402 0.34470 -0.04349 -0.00752 -0.01215 100 ILE B CA  
3635 C C   . ILE B 123 ? 0.34127 0.37584 0.39462 -0.04358 0.00089  -0.01337 100 ILE B C   
3636 O O   . ILE B 123 ? 0.33750 0.36271 0.39272 -0.04014 0.00480  -0.00703 100 ILE B O   
3637 C CB  . ILE B 123 ? 0.31243 0.37329 0.37407 -0.04756 -0.00781 -0.01215 100 ILE B CB  
3638 C CG1 . ILE B 123 ? 0.31497 0.39517 0.37914 -0.04493 -0.01476 -0.00904 100 ILE B CG1 
3639 C CG2 . ILE B 123 ? 0.30595 0.36586 0.37112 -0.05844 -0.00309 -0.02219 100 ILE B CG2 
3640 C CD1 . ILE B 123 ? 0.32242 0.41068 0.39544 -0.04629 -0.01432 -0.00696 100 ILE B CD1 
3641 N N   . GLY B 124 ? 0.33345 0.36240 0.38351 -0.04684 0.00462  -0.02076 101 GLY B N   
3642 C CA  . GLY B 124 ? 0.35533 0.36344 0.40531 -0.04597 0.01532  -0.02194 101 GLY B CA  
3643 C C   . GLY B 124 ? 0.45060 0.45086 0.49963 -0.03439 0.01750  -0.01145 101 GLY B C   
3644 O O   . GLY B 124 ? 0.41388 0.39844 0.46505 -0.03044 0.02638  -0.00684 101 GLY B O   
3645 N N   . VAL B 125 ? 0.33334 0.34529 0.37950 -0.02879 0.01036  -0.00700 102 VAL B N   
3646 C CA  . VAL B 125 ? 0.38063 0.39213 0.42668 -0.01914 0.01117  0.00232  102 VAL B CA  
3647 C C   . VAL B 125 ? 0.37835 0.39151 0.42162 -0.01569 0.01194  0.00010  102 VAL B C   
3648 O O   . VAL B 125 ? 0.37224 0.37891 0.41746 -0.00856 0.01818  0.00432  102 VAL B O   
3649 C CB  . VAL B 125 ? 0.38129 0.40581 0.42692 -0.01695 0.00390  0.00918  102 VAL B CB  
3650 C CG1 . VAL B 125 ? 0.35673 0.38739 0.40197 -0.00903 0.00382  0.01724  102 VAL B CG1 
3651 C CG2 . VAL B 125 ? 0.36250 0.38474 0.41084 -0.01945 0.00478  0.01205  102 VAL B CG2 
3652 N N   . CYS B 126 ? 0.35864 0.38171 0.39766 -0.01961 0.00617  -0.00515 103 CYS B N   
3653 C CA  . CYS B 126 ? 0.38608 0.41401 0.42188 -0.01610 0.00581  -0.00541 103 CYS B CA  
3654 C C   . CYS B 126 ? 0.38685 0.41975 0.41660 -0.02259 0.00338  -0.01410 103 CYS B C   
3655 O O   . CYS B 126 ? 0.36452 0.40678 0.39249 -0.02668 -0.00287 -0.01476 103 CYS B O   
3656 C CB  . CYS B 126 ? 0.34580 0.38563 0.38152 -0.01228 0.00030  0.00199  103 CYS B CB  
3657 S SG  . CYS B 126 ? 0.38511 0.43379 0.41625 -0.01103 -0.00090 0.00060  103 CYS B SG  
3658 N N   . SER B 127 ? 0.32134 0.34940 0.34792 -0.02299 0.00885  -0.02019 104 SER B N   
3659 C CA  . SER B 127 ? 0.38511 0.41964 0.40430 -0.03058 0.00712  -0.02949 104 SER B CA  
3660 C C   . SER B 127 ? 0.38772 0.43755 0.40141 -0.02967 -0.00085 -0.02541 104 SER B C   
3661 O O   . SER B 127 ? 0.37334 0.43398 0.38114 -0.03507 -0.00496 -0.02953 104 SER B O   
3662 C CB  . SER B 127 ? 0.44606 0.47107 0.46175 -0.03208 0.01640  -0.03830 104 SER B CB  
3663 O OG  . SER B 127 ? 0.57882 0.60621 0.59395 -0.02471 0.01764  -0.03353 104 SER B OG  
3664 N N   . MET B 128 ? 0.29926 0.35137 0.31452 -0.02339 -0.00243 -0.01724 105 MET B N   
3665 C CA  . MET B 128 ? 0.33820 0.40074 0.34802 -0.02305 -0.00745 -0.01315 105 MET B CA  
3666 C C   . MET B 128 ? 0.36205 0.42978 0.37375 -0.02333 -0.01292 -0.00784 105 MET B C   
3667 O O   . MET B 128 ? 0.36129 0.43709 0.36809 -0.02330 -0.01615 -0.00490 105 MET B O   
3668 C CB  . MET B 128 ? 0.33060 0.39387 0.34128 -0.01860 -0.00542 -0.00826 105 MET B CB  
3669 C CG  . MET B 128 ? 0.35046 0.41510 0.35595 -0.01841 -0.00117 -0.01232 105 MET B CG  
3670 S SD  . MET B 128 ? 0.39476 0.46782 0.38763 -0.02267 -0.00398 -0.01459 105 MET B SD  
3671 C CE  . MET B 128 ? 0.44370 0.52081 0.43583 -0.02075 -0.00822 -0.00436 105 MET B CE  
3672 N N   . THR B 129 ? 0.31261 0.37584 0.33125 -0.02265 -0.01303 -0.00550 106 THR B N   
3673 C CA  . THR B 129 ? 0.34400 0.41121 0.36531 -0.02235 -0.01657 -0.00069 106 THR B CA  
3674 C C   . THR B 129 ? 0.31810 0.38839 0.34353 -0.02601 -0.01835 -0.00376 106 THR B C   
3675 O O   . THR B 129 ? 0.30274 0.37893 0.33118 -0.02518 -0.02104 0.00020  106 THR B O   
3676 C CB  . THR B 129 ? 0.32348 0.38614 0.34885 -0.01994 -0.01509 0.00419  106 THR B CB  
3677 O OG1 . THR B 129 ? 0.33343 0.39025 0.36315 -0.01953 -0.01251 0.00317  106 THR B OG1 
3678 C CG2 . THR B 129 ? 0.30354 0.36722 0.32578 -0.01833 -0.01331 0.00646  106 THR B CG2 
3679 N N   . ASP B 130 ? 0.28342 0.34938 0.30983 -0.03034 -0.01554 -0.01095 107 ASP B N   
3680 C CA  . ASP B 130 ? 0.31876 0.38860 0.34962 -0.03614 -0.01617 -0.01541 107 ASP B CA  
3681 C C   . ASP B 130 ? 0.31163 0.40085 0.34050 -0.03891 -0.02211 -0.01645 107 ASP B C   
3682 O O   . ASP B 130 ? 0.35677 0.45407 0.37846 -0.04051 -0.02364 -0.01958 107 ASP B O   
3683 C CB  . ASP B 130 ? 0.32467 0.38421 0.35557 -0.04213 -0.00965 -0.02479 107 ASP B CB  
3684 C CG  . ASP B 130 ? 0.38452 0.42631 0.42026 -0.03878 -0.00284 -0.02163 107 ASP B CG  
3685 O OD1 . ASP B 130 ? 0.36710 0.40789 0.40569 -0.03297 -0.00447 -0.01289 107 ASP B OD1 
3686 O OD2 . ASP B 130 ? 0.41983 0.44873 0.45596 -0.04224 0.00515  -0.02798 107 ASP B OD2 
3687 N N   . ILE B 131 ? 0.29724 0.39626 0.33269 -0.03958 -0.02509 -0.01385 108 ILE B N   
3688 C CA  . ILE B 131 ? 0.34180 0.46438 0.37759 -0.04278 -0.03056 -0.01531 108 ILE B CA  
3689 C C   . ILE B 131 ? 0.35529 0.48467 0.39488 -0.05404 -0.02933 -0.02644 108 ILE B C   
3690 O O   . ILE B 131 ? 0.32239 0.47602 0.36162 -0.05957 -0.03401 -0.03051 108 ILE B O   
3691 C CB  . ILE B 131 ? 0.32964 0.46365 0.37179 -0.03570 -0.03405 -0.00493 108 ILE B CB  
3692 C CG1 . ILE B 131 ? 0.36189 0.48917 0.41378 -0.03705 -0.03129 -0.00489 108 ILE B CG1 
3693 C CG2 . ILE B 131 ? 0.32110 0.44643 0.35849 -0.02615 -0.03305 0.00492  108 ILE B CG2 
3694 C CD1 . ILE B 131 ? 0.41388 0.55334 0.47344 -0.03073 -0.03315 0.00367  108 ILE B CD1 
3695 N N   . ALA B 132 ? 0.33924 0.44900 0.38205 -0.05806 -0.02245 -0.03144 109 ALA B N   
3696 C CA  . ALA B 132 ? 0.35898 0.46927 0.40613 -0.06984 -0.01818 -0.04233 109 ALA B CA  
3697 C C   . ALA B 132 ? 0.41098 0.49159 0.45807 -0.07015 -0.00801 -0.04465 109 ALA B C   
3698 O O   . ALA B 132 ? 0.35204 0.41809 0.39837 -0.06045 -0.00650 -0.03578 109 ALA B O   
3699 C CB  . ALA B 132 ? 0.34385 0.46853 0.40150 -0.07161 -0.02100 -0.03955 109 ALA B CB  
3700 N N   . LYS B 133 ? 0.37015 0.44287 0.41814 -0.08148 -0.00022 -0.05638 110 LYS B N   
3701 C CA  . LYS B 133 ? 0.39857 0.44179 0.44820 -0.08054 0.01148  -0.05630 110 LYS B CA  
3702 C C   . LYS B 133 ? 0.39006 0.42837 0.44797 -0.08210 0.01446  -0.05235 110 LYS B C   
3703 O O   . LYS B 133 ? 0.40520 0.42293 0.46437 -0.07545 0.02104  -0.04474 110 LYS B O   
3704 C CB  . LYS B 133 ? 0.50461 0.53398 0.55051 -0.09167 0.02267  -0.07096 110 LYS B CB  
3705 C CG  . LYS B 133 ? 0.66241 0.69942 0.69914 -0.09289 0.02048  -0.07760 110 LYS B CG  
3706 C CD  . LYS B 133 ? 0.87630 0.88783 0.90941 -0.08429 0.02981  -0.07501 110 LYS B CD  
3707 C CE  . LYS B 133 ? 0.95528 0.96953 0.97907 -0.09029 0.03281  -0.08701 110 LYS B CE  
3708 N NZ  . LYS B 133 ? 1.00550 0.99061 1.02793 -0.08598 0.04765  -0.08951 110 LYS B NZ  
3709 N N   . LYS B 134 ? 0.35464 0.41330 0.41833 -0.09083 0.01029  -0.05714 111 LYS B N   
3710 C CA  . LYS B 134 ? 0.38017 0.43647 0.45223 -0.09340 0.01355  -0.05420 111 LYS B CA  
3711 C C   . LYS B 134 ? 0.34158 0.42578 0.41984 -0.09016 0.00282  -0.04838 111 LYS B C   
3712 O O   . LYS B 134 ? 0.35000 0.45945 0.42786 -0.09162 -0.00547 -0.05098 111 LYS B O   
3713 C CB  . LYS B 134 ? 0.43703 0.48868 0.51273 -0.11014 0.02339  -0.06826 111 LYS B CB  
3714 C CG  . LYS B 134 ? 0.54790 0.56913 0.61756 -0.11408 0.03714  -0.07567 111 LYS B CG  
3715 C CD  . LYS B 134 ? 0.59752 0.60956 0.67071 -0.13259 0.05009  -0.09081 111 LYS B CD  
3716 C CE  . LYS B 134 ? 0.67265 0.65591 0.73909 -0.13760 0.06485  -0.10085 111 LYS B CE  
3717 N NZ  . LYS B 134 ? 0.78158 0.75222 0.85074 -0.15777 0.08028  -0.11761 111 LYS B NZ  
3718 N N   . PRO B 135 ? 0.37112 0.45205 0.45512 -0.08537 0.00370  -0.04003 112 PRO B N   
3719 C CA  . PRO B 135 ? 0.42166 0.52691 0.51259 -0.08088 -0.00431 -0.03407 112 PRO B CA  
3720 C C   . PRO B 135 ? 0.47711 0.61041 0.57737 -0.09180 -0.00680 -0.04225 112 PRO B C   
3721 O O   . PRO B 135 ? 0.51042 0.66771 0.61791 -0.08702 -0.01320 -0.03683 112 PRO B O   
3722 C CB  . PRO B 135 ? 0.43739 0.52897 0.53113 -0.07527 0.00004  -0.02546 112 PRO B CB  
3723 C CG  . PRO B 135 ? 0.48608 0.54895 0.57397 -0.07577 0.00907  -0.02505 112 PRO B CG  
3724 C CD  . PRO B 135 ? 0.41084 0.46672 0.49526 -0.08404 0.01325  -0.03560 112 PRO B CD  
3725 N N   . THR B 136 ? 0.51539 0.64729 0.61622 -0.10637 -0.00103 -0.05516 113 THR B N   
3726 C CA  . THR B 136 ? 0.62016 0.78450 0.72985 -0.11899 -0.00403 -0.06467 113 THR B CA  
3727 C C   . THR B 136 ? 0.55202 0.74606 0.65793 -0.11994 -0.01386 -0.06810 113 THR B C   
3728 O O   . THR B 136 ? 0.44707 0.67667 0.56052 -0.12860 -0.01882 -0.07397 113 THR B O   
3729 C CB  . THR B 136 ? 0.57457 0.72708 0.68573 -0.13730 0.00736  -0.07959 113 THR B CB  
3730 O OG1 . THR B 136 ? 0.63237 0.75480 0.73207 -0.13876 0.01487  -0.08474 113 THR B OG1 
3731 C CG2 . THR B 136 ? 0.57300 0.70875 0.69141 -0.13858 0.01624  -0.07581 113 THR B CG2 
3732 N N   . GLU B 137 ? 0.42111 0.60402 0.51559 -0.11166 -0.01663 -0.06441 114 GLU B N   
3733 C CA  . GLU B 137 ? 0.41172 0.62301 0.50083 -0.11239 -0.02546 -0.06671 114 GLU B CA  
3734 C C   . GLU B 137 ? 0.43787 0.68069 0.53419 -0.10045 -0.03568 -0.05343 114 GLU B C   
3735 O O   . GLU B 137 ? 0.44002 0.67249 0.54102 -0.08764 -0.03545 -0.04093 114 GLU B O   
3736 C CB  . GLU B 137 ? 0.40882 0.59860 0.48399 -0.10625 -0.02445 -0.06555 114 GLU B CB  
3737 C CG  . GLU B 137 ? 0.45969 0.62438 0.52818 -0.11862 -0.01354 -0.08015 114 GLU B CG  
3738 C CD  . GLU B 137 ? 0.47677 0.61829 0.53376 -0.11071 -0.01094 -0.07773 114 GLU B CD  
3739 O OE1 . GLU B 137 ? 0.49142 0.59965 0.54711 -0.10785 -0.00126 -0.07697 114 GLU B OE1 
3740 O OE2 . GLU B 137 ? 0.49430 0.65229 0.54391 -0.10660 -0.01824 -0.07546 114 GLU B OE2 
3741 N N   . THR B 138 ? 0.40890 0.69107 0.50559 -0.10468 -0.04380 -0.05618 115 THR B N   
3742 C CA  . THR B 138 ? 0.40521 0.72365 0.51104 -0.09368 -0.05256 -0.04325 115 THR B CA  
3743 C C   . THR B 138 ? 0.37658 0.68062 0.47807 -0.07335 -0.05438 -0.02569 115 THR B C   
3744 O O   . THR B 138 ? 0.38102 0.69527 0.49231 -0.06099 -0.05581 -0.01283 115 THR B O   
3745 C CB  . THR B 138 ? 0.47498 0.83991 0.57889 -0.10172 -0.06118 -0.04879 115 THR B CB  
3746 O OG1 . THR B 138 ? 0.60097 0.98157 0.71037 -0.12298 -0.05838 -0.06682 115 THR B OG1 
3747 C CG2 . THR B 138 ? 0.49946 0.90492 0.61374 -0.08784 -0.06985 -0.03269 115 THR B CG2 
3748 N N   . ILE B 139 ? 0.32677 0.60667 0.41411 -0.07012 -0.05296 -0.02547 116 ILE B N   
3749 C CA  . ILE B 139 ? 0.36306 0.62672 0.44553 -0.05332 -0.05297 -0.01068 116 ILE B CA  
3750 C C   . ILE B 139 ? 0.38077 0.62066 0.47074 -0.04548 -0.04718 -0.00356 116 ILE B C   
3751 O O   . ILE B 139 ? 0.42544 0.65925 0.51583 -0.03208 -0.04638 0.00899  116 ILE B O   
3752 C CB  . ILE B 139 ? 0.42898 0.66832 0.49617 -0.05398 -0.05072 -0.01428 116 ILE B CB  
3753 C CG1 . ILE B 139 ? 0.51868 0.74864 0.58012 -0.03882 -0.05116 0.00008  116 ILE B CG1 
3754 C CG2 . ILE B 139 ? 0.37695 0.58016 0.44285 -0.05847 -0.04269 -0.02097 116 ILE B CG2 
3755 C CD1 . ILE B 139 ? 0.60705 0.86850 0.66875 -0.03001 -0.05740 0.01146  116 ILE B CD1 
3756 N N   . CYS B 140 ? 0.35637 0.58114 0.45130 -0.05407 -0.04178 -0.01156 117 CYS B N   
3757 C CA  . CYS B 140 ? 0.37420 0.57570 0.47328 -0.04784 -0.03592 -0.00568 117 CYS B CA  
3758 C C   . CYS B 140 ? 0.40804 0.62810 0.52143 -0.04386 -0.03574 -0.00006 117 CYS B C   
3759 O O   . CYS B 140 ? 0.38344 0.58723 0.49980 -0.03736 -0.03065 0.00577  117 CYS B O   
3760 C CB  . CYS B 140 ? 0.39657 0.57216 0.49344 -0.05697 -0.02910 -0.01419 117 CYS B CB  
3761 S SG  . CYS B 140 ? 0.42176 0.57109 0.50409 -0.05965 -0.02629 -0.01981 117 CYS B SG  
3762 N N   . ALA B 141 ? 0.37039 0.62583 0.49288 -0.04857 -0.04066 -0.00260 118 ALA B N   
3763 C CA  . ALA B 141 ? 0.38976 0.66758 0.52837 -0.04496 -0.04020 0.00245  118 ALA B CA  
3764 C C   . ALA B 141 ? 0.36354 0.63697 0.50608 -0.02718 -0.03777 0.01755  118 ALA B C   
3765 O O   . ALA B 141 ? 0.37796 0.64426 0.52932 -0.02423 -0.03177 0.02008  118 ALA B O   
3766 C CB  . ALA B 141 ? 0.40816 0.73269 0.55566 -0.05154 -0.04754 -0.00121 118 ALA B CB  
3767 N N   . PRO B 142 ? 0.44203 0.71730 0.57824 -0.01540 -0.04034 0.02760  119 PRO B N   
3768 C CA  . PRO B 142 ? 0.44451 0.71072 0.58483 0.00099  -0.03466 0.04139  119 PRO B CA  
3769 C C   . PRO B 142 ? 0.44096 0.66547 0.57301 0.00222  -0.02620 0.04042  119 PRO B C   
3770 O O   . PRO B 142 ? 0.39160 0.60522 0.52750 0.01257  -0.01888 0.04847  119 PRO B O   
3771 C CB  . PRO B 142 ? 0.48025 0.75911 0.61436 0.01163  -0.03885 0.05207  119 PRO B CB  
3772 C CG  . PRO B 142 ? 0.53616 0.83409 0.66259 0.00021  -0.04781 0.04317  119 PRO B CG  
3773 C CD  . PRO B 142 ? 0.48852 0.77156 0.61278 -0.01657 -0.04663 0.02689  119 PRO B CD  
3774 N N   . LEU B 143 ? 0.37126 0.57359 0.49235 -0.00786 -0.02617 0.03093  120 LEU B N   
3775 C CA  . LEU B 143 ? 0.34056 0.50963 0.45299 -0.00706 -0.01957 0.03041  120 LEU B CA  
3776 C C   . LEU B 143 ? 0.31731 0.47636 0.43456 -0.01282 -0.01421 0.02564  120 LEU B C   
3777 O O   . LEU B 143 ? 0.28691 0.45441 0.40890 -0.02193 -0.01579 0.01895  120 LEU B O   
3778 C CB  . LEU B 143 ? 0.31022 0.46366 0.40907 -0.01314 -0.02212 0.02456  120 LEU B CB  
3779 C CG  . LEU B 143 ? 0.38519 0.54800 0.47710 -0.00952 -0.02723 0.02774  120 LEU B CG  
3780 C CD1 . LEU B 143 ? 0.35376 0.49973 0.43359 -0.01572 -0.02805 0.02103  120 LEU B CD1 
3781 C CD2 . LEU B 143 ? 0.40587 0.56377 0.49681 0.00292  -0.02318 0.03913  120 LEU B CD2 
3782 N N   . THR B 144 ? 0.32662 0.46608 0.44097 -0.00896 -0.00689 0.02817  121 THR B N   
3783 C CA  . THR B 144 ? 0.32667 0.45519 0.44182 -0.01508 -0.00170 0.02373  121 THR B CA  
3784 C C   . THR B 144 ? 0.33653 0.44761 0.43969 -0.02242 -0.00280 0.01855  121 THR B C   
3785 O O   . THR B 144 ? 0.29180 0.38776 0.38496 -0.02081 -0.00121 0.01940  121 THR B O   
3786 C CB  . THR B 144 ? 0.35309 0.47113 0.46974 -0.00905 0.00733  0.02744  121 THR B CB  
3787 O OG1 . THR B 144 ? 0.31534 0.45147 0.44617 -0.00132 0.00954  0.03298  121 THR B OG1 
3788 C CG2 . THR B 144 ? 0.28704 0.39308 0.40061 -0.01590 0.01290  0.02287  121 THR B CG2 
3789 N N   . VAL B 145 ? 0.31980 0.43384 0.42477 -0.03048 -0.00452 0.01339  122 VAL B N   
3790 C CA  . VAL B 145 ? 0.32721 0.42612 0.42295 -0.03581 -0.00451 0.00996  122 VAL B CA  
3791 C C   . VAL B 145 ? 0.36072 0.44711 0.45373 -0.03826 0.00155  0.01079  122 VAL B C   
3792 O O   . VAL B 145 ? 0.31187 0.40331 0.41220 -0.04114 0.00532  0.01021  122 VAL B O   
3793 C CB  . VAL B 145 ? 0.32985 0.43560 0.42867 -0.04359 -0.00681 0.00362  122 VAL B CB  
3794 C CG1 . VAL B 145 ? 0.33185 0.41847 0.42233 -0.04747 -0.00389 0.00122  122 VAL B CG1 
3795 C CG2 . VAL B 145 ? 0.30461 0.42765 0.40472 -0.04207 -0.01341 0.00251  122 VAL B CG2 
3796 N N   . PHE B 146 ? 0.33379 0.40660 0.41633 -0.03722 0.00251  0.01256  123 PHE B N   
3797 C CA  . PHE B 146 ? 0.29358 0.35757 0.37125 -0.03921 0.00750  0.01472  123 PHE B CA  
3798 C C   . PHE B 146 ? 0.31786 0.37433 0.39495 -0.04334 0.00960  0.01433  123 PHE B C   
3799 O O   . PHE B 146 ? 0.33213 0.38321 0.40590 -0.04271 0.00766  0.01355  123 PHE B O   
3800 C CB  . PHE B 146 ? 0.32776 0.38620 0.39485 -0.03631 0.00727  0.01729  123 PHE B CB  
3801 C CG  . PHE B 146 ? 0.33445 0.38842 0.39448 -0.03797 0.01091  0.02072  123 PHE B CG  
3802 C CD1 . PHE B 146 ? 0.35961 0.41524 0.41878 -0.04026 0.01591  0.02106  123 PHE B CD1 
3803 C CD2 . PHE B 146 ? 0.35650 0.40592 0.41075 -0.03647 0.00997  0.02448  123 PHE B CD2 
3804 C CE1 . PHE B 146 ? 0.37908 0.43353 0.42992 -0.04178 0.01900  0.02529  123 PHE B CE1 
3805 C CE2 . PHE B 146 ? 0.41499 0.46364 0.46253 -0.03634 0.01318  0.03020  123 PHE B CE2 
3806 C CZ  . PHE B 146 ? 0.36936 0.42149 0.41435 -0.03937 0.01717  0.03062  123 PHE B CZ  
3807 N N   . PHE B 147 ? 0.30256 0.35709 0.38294 -0.04751 0.01520  0.01490  124 PHE B N   
3808 C CA  . PHE B 147 ? 0.31993 0.36383 0.40027 -0.05192 0.02053  0.01518  124 PHE B CA  
3809 C C   . PHE B 147 ? 0.40451 0.44005 0.47707 -0.05016 0.02598  0.02274  124 PHE B C   
3810 O O   . PHE B 147 ? 0.32343 0.36465 0.39418 -0.04982 0.02720  0.02457  124 PHE B O   
3811 C CB  . PHE B 147 ? 0.28614 0.33650 0.37776 -0.06012 0.02391  0.00926  124 PHE B CB  
3812 C CG  . PHE B 147 ? 0.30519 0.36937 0.40430 -0.06302 0.01823  0.00197  124 PHE B CG  
3813 C CD1 . PHE B 147 ? 0.30623 0.36467 0.40416 -0.06763 0.01849  -0.00353 124 PHE B CD1 
3814 C CD2 . PHE B 147 ? 0.27764 0.36128 0.38456 -0.06074 0.01353  0.00109  124 PHE B CD2 
3815 C CE1 . PHE B 147 ? 0.31483 0.38939 0.41777 -0.07139 0.01293  -0.01067 124 PHE B CE1 
3816 C CE2 . PHE B 147 ? 0.29423 0.39535 0.40753 -0.06265 0.00772  -0.00382 124 PHE B CE2 
3817 C CZ  . PHE B 147 ? 0.27566 0.37356 0.38615 -0.06871 0.00674  -0.01017 124 PHE B CZ  
3818 N N   . ASP B 148 ? 0.42008 0.44255 0.48788 -0.04883 0.03032  0.02750  125 ASP B N   
3819 C CA  . ASP B 148 ? 0.38482 0.40197 0.44383 -0.04500 0.03489  0.03755  125 ASP B CA  
3820 C C   . ASP B 148 ? 0.42321 0.42572 0.48429 -0.04871 0.04529  0.04059  125 ASP B C   
3821 O O   . ASP B 148 ? 0.45028 0.43835 0.51184 -0.04764 0.05014  0.04183  125 ASP B O   
3822 C CB  . ASP B 148 ? 0.40025 0.41709 0.45163 -0.03699 0.03125  0.04372  125 ASP B CB  
3823 C CG  . ASP B 148 ? 0.46667 0.48495 0.50858 -0.03172 0.03447  0.05587  125 ASP B CG  
3824 O OD1 . ASP B 148 ? 0.40476 0.42010 0.44463 -0.03413 0.04081  0.06035  125 ASP B OD1 
3825 O OD2 . ASP B 148 ? 0.43996 0.46490 0.47636 -0.02507 0.03059  0.06150  125 ASP B OD2 
3826 N N   . GLY B 149 ? 0.36513 0.36973 0.42729 -0.05327 0.05037  0.04167  126 GLY B N   
3827 C CA  . GLY B 149 ? 0.37016 0.36047 0.43433 -0.05824 0.06189  0.04446  126 GLY B CA  
3828 C C   . GLY B 149 ? 0.50549 0.47971 0.56078 -0.05114 0.06937  0.05758  126 GLY B C   
3829 O O   . GLY B 149 ? 0.49699 0.45350 0.55387 -0.05457 0.08121  0.06046  126 GLY B O   
3830 N N   . ARG B 150 ? 0.44168 0.42222 0.48828 -0.04121 0.06374  0.06610  127 ARG B N   
3831 C CA  . ARG B 150 ? 0.44786 0.41618 0.48789 -0.03180 0.07055  0.08042  127 ARG B CA  
3832 C C   . ARG B 150 ? 0.53353 0.48391 0.57882 -0.02944 0.07509  0.07794  127 ARG B C   
3833 O O   . ARG B 150 ? 0.60277 0.53857 0.64484 -0.02080 0.08381  0.08999  127 ARG B O   
3834 C CB  . ARG B 150 ? 0.43000 0.41719 0.46017 -0.02226 0.06238  0.09017  127 ARG B CB  
3835 C CG  . ARG B 150 ? 0.46410 0.46879 0.48627 -0.02538 0.05976  0.09241  127 ARG B CG  
3836 C CD  . ARG B 150 ? 0.45973 0.48806 0.47306 -0.02044 0.04991  0.09583  127 ARG B CD  
3837 N NE  . ARG B 150 ? 0.40908 0.44410 0.42753 -0.02227 0.04079  0.08408  127 ARG B NE  
3838 C CZ  . ARG B 150 ? 0.43611 0.49031 0.44885 -0.02070 0.03280  0.08331  127 ARG B CZ  
3839 N NH1 . ARG B 150 ? 0.34269 0.41486 0.34448 -0.01822 0.03168  0.09239  127 ARG B NH1 
3840 N NH2 . ARG B 150 ? 0.32813 0.38517 0.34556 -0.02259 0.02638  0.07324  127 ARG B NH2 
3841 N N   . VAL B 151 ? 0.46126 0.41320 0.51399 -0.03600 0.06999  0.06339  128 VAL B N   
3842 C CA  . VAL B 151 ? 0.50453 0.44033 0.56132 -0.03596 0.07482  0.05815  128 VAL B CA  
3843 C C   . VAL B 151 ? 0.54442 0.46619 0.60863 -0.04948 0.08434  0.04664  128 VAL B C   
3844 O O   . VAL B 151 ? 0.42136 0.35700 0.49123 -0.05957 0.07935  0.03636  128 VAL B O   
3845 C CB  . VAL B 151 ? 0.48529 0.43510 0.54366 -0.03502 0.06265  0.04934  128 VAL B CB  
3846 C CG1 . VAL B 151 ? 0.49671 0.43010 0.55815 -0.03599 0.06868  0.04276  128 VAL B CG1 
3847 C CG2 . VAL B 151 ? 0.50345 0.47005 0.55509 -0.02428 0.05339  0.05878  128 VAL B CG2 
3848 N N   . ASP B 152 ? 0.52271 0.41790 0.58760 -0.04992 0.09898  0.04804  129 ASP B N   
3849 C CA  . ASP B 152 ? 0.52941 0.40934 0.60081 -0.06508 0.11075  0.03586  129 ASP B CA  
3850 C C   . ASP B 152 ? 0.51883 0.41657 0.59723 -0.07754 0.10131  0.01675  129 ASP B C   
3851 O O   . ASP B 152 ? 0.49298 0.39770 0.57054 -0.07449 0.09339  0.01152  129 ASP B O   
3852 C CB  . ASP B 152 ? 0.66171 0.50769 0.73216 -0.06325 0.12886  0.03816  129 ASP B CB  
3853 C CG  . ASP B 152 ? 0.93362 0.75961 0.99855 -0.05233 0.14223  0.05817  129 ASP B CG  
3854 O OD1 . ASP B 152 ? 0.97693 0.81304 1.03935 -0.05235 0.14022  0.06614  129 ASP B OD1 
3855 O OD2 . ASP B 152 ? 1.03803 0.83834 1.10103 -0.04318 0.15568  0.06659  129 ASP B OD2 
3856 N N   . GLY B 153 ? 0.51018 0.41776 0.59569 -0.09134 0.10229  0.00706  130 GLY B N   
3857 C CA  . GLY B 153 ? 0.45827 0.38683 0.55131 -0.10330 0.09410  -0.00984 130 GLY B CA  
3858 C C   . GLY B 153 ? 0.41609 0.37703 0.51168 -0.09902 0.07659  -0.00978 130 GLY B C   
3859 O O   . GLY B 153 ? 0.42651 0.40943 0.52981 -0.10815 0.07005  -0.02131 130 GLY B O   
3860 N N   . GLN B 154 ? 0.38847 0.35433 0.47799 -0.08571 0.06951  0.00266  131 GLN B N   
3861 C CA  . GLN B 154 ? 0.36192 0.35396 0.45357 -0.08191 0.05518  0.00124  131 GLN B CA  
3862 C C   . GLN B 154 ? 0.38572 0.39577 0.48552 -0.08723 0.05373  -0.00077 131 GLN B C   
3863 O O   . GLN B 154 ? 0.37694 0.40956 0.48289 -0.08735 0.04457  -0.00538 131 GLN B O   
3864 C CB  . GLN B 154 ? 0.33561 0.32791 0.41807 -0.06826 0.04873  0.01216  131 GLN B CB  
3865 C CG  . GLN B 154 ? 0.43837 0.42049 0.51573 -0.06275 0.04774  0.01220  131 GLN B CG  
3866 C CD  . GLN B 154 ? 0.52476 0.51915 0.59731 -0.05367 0.03681  0.01571  131 GLN B CD  
3867 O OE1 . GLN B 154 ? 0.46436 0.47123 0.53538 -0.05038 0.03114  0.01952  131 GLN B OE1 
3868 N NE2 . GLN B 154 ? 0.54771 0.53721 0.61754 -0.05021 0.03535  0.01386  131 GLN B NE2 
3869 N N   . VAL B 155 ? 0.39198 0.39324 0.49248 -0.09093 0.06336  0.00329  132 VAL B N   
3870 C CA  . VAL B 155 ? 0.39996 0.41919 0.51033 -0.09750 0.06366  -0.00041 132 VAL B CA  
3871 C C   . VAL B 155 ? 0.41604 0.45260 0.53907 -0.10970 0.06203  -0.01408 132 VAL B C   
3872 O O   . VAL B 155 ? 0.34027 0.40379 0.47290 -0.11015 0.05455  -0.01764 132 VAL B O   
3873 C CB  . VAL B 155 ? 0.46016 0.46532 0.56863 -0.10114 0.07623  0.00563  132 VAL B CB  
3874 C CG1 . VAL B 155 ? 0.40589 0.43100 0.52680 -0.10955 0.07787  0.00003  132 VAL B CG1 
3875 C CG2 . VAL B 155 ? 0.44124 0.43794 0.53667 -0.08931 0.07614  0.01954  132 VAL B CG2 
3876 N N   . ASP B 156 ? 0.39984 0.42239 0.52328 -0.11998 0.07001  -0.02192 133 ASP B N   
3877 C CA  . ASP B 156 ? 0.43060 0.47279 0.56476 -0.13421 0.06859  -0.03688 133 ASP B CA  
3878 C C   . ASP B 156 ? 0.40163 0.46804 0.53685 -0.12901 0.05385  -0.04017 133 ASP B C   
3879 O O   . ASP B 156 ? 0.34969 0.44751 0.49562 -0.13532 0.04734  -0.04757 133 ASP B O   
3880 C CB  . ASP B 156 ? 0.52956 0.54821 0.66129 -0.14685 0.08144  -0.04625 133 ASP B CB  
3881 C CG  . ASP B 156 ? 0.73045 0.72433 0.86208 -0.15344 0.09837  -0.04318 133 ASP B CG  
3882 O OD1 . ASP B 156 ? 0.75701 0.76055 0.89358 -0.15309 0.09934  -0.03785 133 ASP B OD1 
3883 O OD2 . ASP B 156 ? 0.82786 0.79119 0.95421 -0.15864 0.11207  -0.04576 133 ASP B OD2 
3884 N N   . LEU B 157 ? 0.34127 0.39543 0.46573 -0.11726 0.04877  -0.03395 134 LEU B N   
3885 C CA  . LEU B 157 ? 0.38264 0.45746 0.50675 -0.11162 0.03591  -0.03554 134 LEU B CA  
3886 C C   . LEU B 157 ? 0.43508 0.53349 0.56550 -0.10295 0.02745  -0.02886 134 LEU B C   
3887 O O   . LEU B 157 ? 0.35316 0.47896 0.49007 -0.10225 0.01881  -0.03155 134 LEU B O   
3888 C CB  . LEU B 157 ? 0.30340 0.35869 0.41497 -0.10142 0.03395  -0.03018 134 LEU B CB  
3889 C CG  . LEU B 157 ? 0.40216 0.43525 0.50849 -0.10860 0.04295  -0.03753 134 LEU B CG  
3890 C CD1 . LEU B 157 ? 0.38808 0.40182 0.48343 -0.09558 0.04227  -0.02901 134 LEU B CD1 
3891 C CD2 . LEU B 157 ? 0.40506 0.45771 0.51499 -0.12024 0.03907  -0.05184 134 LEU B CD2 
3892 N N   . PHE B 158 ? 0.35385 0.44227 0.48212 -0.09601 0.03086  -0.01978 135 PHE B N   
3893 C CA  . PHE B 158 ? 0.32421 0.43130 0.45888 -0.08863 0.02624  -0.01464 135 PHE B CA  
3894 C C   . PHE B 158 ? 0.30597 0.44114 0.45689 -0.09657 0.02628  -0.02056 135 PHE B C   
3895 O O   . PHE B 158 ? 0.31692 0.47797 0.47631 -0.09112 0.01922  -0.01922 135 PHE B O   
3896 C CB  . PHE B 158 ? 0.32808 0.41896 0.45620 -0.08285 0.03195  -0.00619 135 PHE B CB  
3897 C CG  . PHE B 158 ? 0.28444 0.39072 0.41954 -0.07724 0.03126  -0.00266 135 PHE B CG  
3898 C CD1 . PHE B 158 ? 0.31259 0.42403 0.44524 -0.06670 0.02556  0.00146  135 PHE B CD1 
3899 C CD2 . PHE B 158 ? 0.32500 0.43848 0.46906 -0.08262 0.03818  -0.00361 135 PHE B CD2 
3900 C CE1 . PHE B 158 ? 0.25281 0.37456 0.39198 -0.06103 0.02776  0.00446  135 PHE B CE1 
3901 C CE2 . PHE B 158 ? 0.35736 0.48366 0.50832 -0.07678 0.03937  -0.00062 135 PHE B CE2 
3902 C CZ  . PHE B 158 ? 0.27651 0.40601 0.42506 -0.06571 0.03463  0.00335  135 PHE B CZ  
3903 N N   . ARG B 159 ? 0.28207 0.41378 0.43824 -0.10921 0.03497  -0.02647 136 ARG B N   
3904 C CA  . ARG B 159 ? 0.31466 0.47708 0.48764 -0.11859 0.03515  -0.03326 136 ARG B CA  
3905 C C   . ARG B 159 ? 0.35023 0.54216 0.52952 -0.12311 0.02590  -0.04090 136 ARG B C   
3906 O O   . ARG B 159 ? 0.29160 0.51976 0.48563 -0.12444 0.02137  -0.04249 136 ARG B O   
3907 C CB  . ARG B 159 ? 0.35603 0.50760 0.53262 -0.13429 0.04748  -0.04024 136 ARG B CB  
3908 C CG  . ARG B 159 ? 0.33738 0.46390 0.50793 -0.13097 0.05746  -0.03200 136 ARG B CG  
3909 C CD  . ARG B 159 ? 0.39548 0.51558 0.57196 -0.14793 0.07023  -0.03964 136 ARG B CD  
3910 N NE  . ARG B 159 ? 0.41521 0.51291 0.58647 -0.14756 0.08196  -0.03216 136 ARG B NE  
3911 C CZ  . ARG B 159 ? 0.43370 0.54468 0.61322 -0.14777 0.08567  -0.02943 136 ARG B CZ  
3912 N NH1 . ARG B 159 ? 0.35425 0.50110 0.54923 -0.14648 0.07858  -0.03259 136 ARG B NH1 
3913 N NH2 . ARG B 159 ? 0.38162 0.47072 0.55405 -0.14877 0.09735  -0.02279 136 ARG B NH2 
3914 N N   . ASN B 160 ? 0.33319 0.51302 0.50191 -0.12557 0.02341  -0.04549 137 ASN B N   
3915 C CA  . ASN B 160 ? 0.39956 0.60862 0.57168 -0.13055 0.01462  -0.05299 137 ASN B CA  
3916 C C   . ASN B 160 ? 0.41141 0.63368 0.58019 -0.11417 0.00320  -0.04345 137 ASN B C   
3917 O O   . ASN B 160 ? 0.38480 0.63947 0.55814 -0.11529 -0.00533 -0.04616 137 ASN B O   
3918 C CB  . ASN B 160 ? 0.46582 0.65653 0.62830 -0.14338 0.01941  -0.06480 137 ASN B CB  
3919 C CG  . ASN B 160 ? 0.72089 0.91411 0.89113 -0.16489 0.03002  -0.07897 137 ASN B CG  
3920 O OD1 . ASN B 160 ? 0.74920 0.98010 0.93099 -0.17685 0.02633  -0.08852 137 ASN B OD1 
3921 N ND2 . ASN B 160 ? 0.78941 0.94395 0.95358 -0.16976 0.04383  -0.07972 137 ASN B ND2 
3922 N N   . ALA B 161 ? 0.31908 0.51919 0.48014 -0.09971 0.00346  -0.03231 138 ALA B N   
3923 C CA  . ALA B 161 ? 0.31652 0.52278 0.47299 -0.08516 -0.00474 -0.02365 138 ALA B CA  
3924 C C   . ALA B 161 ? 0.35989 0.59573 0.53004 -0.07592 -0.00821 -0.01615 138 ALA B C   
3925 O O   . ALA B 161 ? 0.33571 0.57613 0.51598 -0.07635 -0.00283 -0.01461 138 ALA B O   
3926 C CB  . ALA B 161 ? 0.26189 0.43449 0.40525 -0.07530 -0.00189 -0.01621 138 ALA B CB  
3927 N N   . ARG B 162 ? 0.33963 0.59619 0.51045 -0.06694 -0.01626 -0.01074 139 ARG B N   
3928 C CA  . ARG B 162 ? 0.34968 0.63316 0.53400 -0.05489 -0.01816 -0.00092 139 ARG B CA  
3929 C C   . ARG B 162 ? 0.29064 0.54866 0.47155 -0.04127 -0.01194 0.00882  139 ARG B C   
3930 O O   . ARG B 162 ? 0.30865 0.57520 0.50131 -0.03517 -0.00696 0.01379  139 ARG B O   
3931 C CB  . ARG B 162 ? 0.39882 0.71235 0.58395 -0.04845 -0.02769 0.00382  139 ARG B CB  
3932 C CG  . ARG B 162 ? 0.51169 0.85541 0.71139 -0.03351 -0.02928 0.01650  139 ARG B CG  
3933 C CD  . ARG B 162 ? 0.60002 0.97883 0.80006 -0.02795 -0.03920 0.02215  139 ARG B CD  
3934 N NE  . ARG B 162 ? 0.69127 1.09292 0.90409 -0.00889 -0.03880 0.03847  139 ARG B NE  
3935 C CZ  . ARG B 162 ? 0.70339 1.14486 0.93637 -0.00600 -0.03957 0.04241  139 ARG B CZ  
3936 N NH1 . ARG B 162 ? 0.67969 1.14365 0.92203 -0.02311 -0.04120 0.02974  139 ARG B NH1 
3937 N NH2 . ARG B 162 ? 0.71158 1.17033 0.95614 0.01425  -0.03746 0.05934  139 ARG B NH2 
3938 N N   . ASN B 163 ? 0.25177 0.47977 0.41697 -0.03736 -0.01132 0.01063  140 ASN B N   
3939 C CA  . ASN B 163 ? 0.26191 0.46531 0.42128 -0.02743 -0.00506 0.01733  140 ASN B CA  
3940 C C   . ASN B 163 ? 0.30007 0.47164 0.44494 -0.03391 -0.00181 0.01268  140 ASN B C   
3941 O O   . ASN B 163 ? 0.30870 0.47206 0.44410 -0.03864 -0.00576 0.00877  140 ASN B O   
3942 C CB  . ASN B 163 ? 0.25826 0.46174 0.41332 -0.01459 -0.00750 0.02603  140 ASN B CB  
3943 C CG  . ASN B 163 ? 0.31247 0.54779 0.48258 -0.00446 -0.00919 0.03442  140 ASN B CG  
3944 O OD1 . ASN B 163 ? 0.32483 0.56312 0.50543 0.00319  -0.00222 0.03975  140 ASN B OD1 
3945 N ND2 . ASN B 163 ? 0.31732 0.57894 0.48898 -0.00445 -0.01801 0.03567  140 ASN B ND2 
3946 N N   . GLY B 164 ? 0.26404 0.41969 0.40718 -0.03396 0.00573  0.01338  141 GLY B N   
3947 C CA  . GLY B 164 ? 0.26201 0.39244 0.39124 -0.03876 0.00800  0.01103  141 GLY B CA  
3948 C C   . GLY B 164 ? 0.29894 0.41596 0.42455 -0.03813 0.01593  0.01268  141 GLY B C   
3949 O O   . GLY B 164 ? 0.29228 0.41739 0.42695 -0.03559 0.02107  0.01405  141 GLY B O   
3950 N N   . VAL B 165 ? 0.27232 0.37069 0.38439 -0.04028 0.01710  0.01269  142 VAL B N   
3951 C CA  . VAL B 165 ? 0.28134 0.36866 0.38630 -0.04175 0.02387  0.01375  142 VAL B CA  
3952 C C   . VAL B 165 ? 0.33307 0.41013 0.43033 -0.04756 0.02448  0.01402  142 VAL B C   
3953 O O   . VAL B 165 ? 0.32001 0.39086 0.41145 -0.04741 0.02021  0.01429  142 VAL B O   
3954 C CB  . VAL B 165 ? 0.30182 0.38001 0.39658 -0.03736 0.02539  0.01493  142 VAL B CB  
3955 C CG1 . VAL B 165 ? 0.30555 0.37517 0.38920 -0.04136 0.03076  0.01493  142 VAL B CG1 
3956 C CG2 . VAL B 165 ? 0.28093 0.36452 0.38393 -0.03096 0.02935  0.01565  142 VAL B CG2 
3957 N N   . LEU B 166 ? 0.30073 0.37559 0.39839 -0.05201 0.03096  0.01471  143 LEU B N   
3958 C CA  . LEU B 166 ? 0.28300 0.34672 0.37389 -0.05627 0.03390  0.01724  143 LEU B CA  
3959 C C   . LEU B 166 ? 0.34559 0.40344 0.42481 -0.05588 0.03878  0.02191  143 LEU B C   
3960 O O   . LEU B 166 ? 0.32909 0.39191 0.40956 -0.05671 0.04338  0.02076  143 LEU B O   
3961 C CB  . LEU B 166 ? 0.27137 0.33839 0.37312 -0.06370 0.03857  0.01423  143 LEU B CB  
3962 C CG  . LEU B 166 ? 0.28429 0.33684 0.38043 -0.06853 0.04583  0.01772  143 LEU B CG  
3963 C CD1 . LEU B 166 ? 0.30311 0.34286 0.39376 -0.06754 0.04398  0.01876  143 LEU B CD1 
3964 C CD2 . LEU B 166 ? 0.27711 0.33469 0.38536 -0.07785 0.05276  0.01328  143 LEU B CD2 
3965 N N   . ILE B 167 ? 0.31673 0.36585 0.38454 -0.05437 0.03831  0.02749  144 ILE B N   
3966 C CA  . ILE B 167 ? 0.30190 0.34934 0.35797 -0.05469 0.04297  0.03357  144 ILE B CA  
3967 C C   . ILE B 167 ? 0.33263 0.36967 0.38700 -0.05612 0.04879  0.04030  144 ILE B C   
3968 O O   . ILE B 167 ? 0.36466 0.39266 0.42236 -0.05520 0.04829  0.04110  144 ILE B O   
3969 C CB  . ILE B 167 ? 0.31348 0.36457 0.35688 -0.05081 0.03833  0.03659  144 ILE B CB  
3970 C CG1 . ILE B 167 ? 0.33531 0.38132 0.37679 -0.04601 0.03365  0.04104  144 ILE B CG1 
3971 C CG2 . ILE B 167 ? 0.27470 0.33234 0.31881 -0.05105 0.03604  0.02923  144 ILE B CG2 
3972 C CD1 . ILE B 167 ? 0.36649 0.42059 0.39560 -0.04251 0.03019  0.04641  144 ILE B CD1 
3973 N N   . THR B 168 ? 0.32611 0.36286 0.37488 -0.05865 0.05596  0.04506  145 THR B N   
3974 C CA  . THR B 168 ? 0.35854 0.38330 0.40340 -0.05886 0.06348  0.05404  145 THR B CA  
3975 C C   . THR B 168 ? 0.38082 0.41036 0.41057 -0.05670 0.06686  0.06386  145 THR B C   
3976 O O   . THR B 168 ? 0.37997 0.42211 0.40368 -0.05826 0.06496  0.06061  145 THR B O   
3977 C CB  . THR B 168 ? 0.39772 0.41657 0.45348 -0.06671 0.07199  0.05013  145 THR B CB  
3978 O OG1 . THR B 168 ? 0.41521 0.44503 0.47185 -0.07048 0.07495  0.04686  145 THR B OG1 
3979 C CG2 . THR B 168 ? 0.33993 0.35943 0.41062 -0.07073 0.06867  0.03975  145 THR B CG2 
3980 N N   . GLU B 169 ? 0.37217 0.39123 0.39565 -0.05357 0.07347  0.07598  146 GLU B N   
3981 C CA  . GLU B 169 ? 0.41894 0.44442 0.42766 -0.05157 0.07784  0.08743  146 GLU B CA  
3982 C C   . GLU B 169 ? 0.51897 0.53891 0.52832 -0.05834