data_6W4H
# 
_entry.id   6W4H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.337 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6W4H         
WWPDB D_1000247613 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
TargetTrack CSGID-IDP51000 unspecified . 
TargetTrack SCGID-IDP51000 unspecified . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6W4H 
_pdbx_database_status.recvd_initial_deposition_date   2020-03-10 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Minasov, G.'                                                   1  ? 
'Shuvalova, L.'                                                 2  ? 
'Rosas-Lemus, M.'                                               3  ? 
'Kiryukhina, O.'                                                4  ? 
'Wiersum, G.'                                                   5  ? 
'Godzik, A.'                                                    6  ? 
'Jaroszewski, L.'                                               7  ? 
'Stogios, P.J.'                                                 8  ? 
'Skarina, T.'                                                   9  ? 
'Satchell, K.J.F.'                                              10 ? 
'Center for Structural Genomics of Infectious Diseases (CSGID)' 11 ? 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? US ? ? primary Sci.Signal. ? ? 1937-9145 ? ? 13 ? ? ? 
;High-resolution structures of the SARS-CoV-2 2'- O -methyltransferase reveal strategies for structure-based inhibitor design.
;
2020 ? 10.1126/scisignal.abe1202 32994211 ? 
? ? ? ? ? ? ? US ? ? 1       Biorxiv     ? ? ?         ? ? ?  ? ? ? 
'The crystal structure of nsp10-nsp16 heterodimer from SARS-CoV-2 in complex with S-adenosylmethionine.'                        
2020 ? 10.1101/2020.04.17.047498 32511376 ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rosas-Lemus, M.'  1  0000-0002-6243-0271 
primary 'Minasov, G.'      2  0000-0001-5460-3462 
primary 'Shuvalova, L.'    3  0000-0003-1702-6998 
primary 'Inniss, N.L.'     4  0000-0002-1510-7412 
primary 'Kiryukhina, O.'   5  0000-0001-5962-8423 
primary 'Brunzelle, J.'    6  0000-0001-9197-0018 
primary 'Satchell, K.J.F.' 7  0000-0003-3274-7611 
1       'Rosas-Lemus, M.'  8  ?                   
1       'Minasov, G.'      9  ?                   
1       'Shuvalova, L.'    10 ?                   
1       'Inniss, N.L.'     11 ?                   
1       'Kiryukhina, O.'   12 ?                   
1       'Wiersum, G.'      13 ?                   
1       'Kim, Y.'          14 ?                   
1       'Jedrzejczak, R.'  15 ?                   
1       'Maltseva, N.I.'   16 ?                   
1       'Endres, M.'       17 ?                   
1       'Jaroszewski, L.'  18 ?                   
1       'Godzik, A.'       19 ?                   
1       'Joachimiak, A.'   20 ?                   
1       'Satchell, K.J.F.' 21 ?                   
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6W4H 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     167.740 
_cell.length_a_esd                 ? 
_cell.length_b                     167.740 
_cell.length_b_esd                 ? 
_cell.length_c                     51.942 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6W4H 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man "2'-O-methyltransferase"    33627.504 1   2.1.1.- ? 'UNP residues 6799-7096' ? 
2 polymer     man 'Non-structural protein 10' 15075.190 1   ?       ? 'UNP residues 4254-4392' ? 
3 non-polymer syn 'SULFITE ION'               80.063    1   ?       ? ?                        ? 
4 non-polymer syn S-ADENOSYLMETHIONINE        398.437   1   ?       ? ?                        ? 
5 non-polymer syn 'ACETATE ION'               59.044    2   ?       ? ?                        ? 
6 non-polymer man beta-D-fructopyranose       180.156   2   ?       ? ?                        ? 
7 non-polymer syn 'ZINC ION'                  65.409    2   ?       ? ?                        ? 
8 water       nat water                       18.015    442 ?       ? ?                        ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Non-structural protein 16,nsp16,SARS-CoV-2 NSP16'      
2 'nsp10,Growth factor-like peptide,GFL,SARS-CoV-2 NSP10' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SNASSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKG
VAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFI
QQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPI
QLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN
;
;SNASSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKG
VAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFI
QQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPI
QLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN
;
A SCGID-IDP51000 
2 'polypeptide(L)' no no 
;SNAAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC
RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQ
;
;SNAAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYC
RCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQ
;
B CSGID-IDP51000 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ALA n 
1 4   SER n 
1 5   SER n 
1 6   GLN n 
1 7   ALA n 
1 8   TRP n 
1 9   GLN n 
1 10  PRO n 
1 11  GLY n 
1 12  VAL n 
1 13  ALA n 
1 14  MET n 
1 15  PRO n 
1 16  ASN n 
1 17  LEU n 
1 18  TYR n 
1 19  LYS n 
1 20  MET n 
1 21  GLN n 
1 22  ARG n 
1 23  MET n 
1 24  LEU n 
1 25  LEU n 
1 26  GLU n 
1 27  LYS n 
1 28  CYS n 
1 29  ASP n 
1 30  LEU n 
1 31  GLN n 
1 32  ASN n 
1 33  TYR n 
1 34  GLY n 
1 35  ASP n 
1 36  SER n 
1 37  ALA n 
1 38  THR n 
1 39  LEU n 
1 40  PRO n 
1 41  LYS n 
1 42  GLY n 
1 43  ILE n 
1 44  MET n 
1 45  MET n 
1 46  ASN n 
1 47  VAL n 
1 48  ALA n 
1 49  LYS n 
1 50  TYR n 
1 51  THR n 
1 52  GLN n 
1 53  LEU n 
1 54  CYS n 
1 55  GLN n 
1 56  TYR n 
1 57  LEU n 
1 58  ASN n 
1 59  THR n 
1 60  LEU n 
1 61  THR n 
1 62  LEU n 
1 63  ALA n 
1 64  VAL n 
1 65  PRO n 
1 66  TYR n 
1 67  ASN n 
1 68  MET n 
1 69  ARG n 
1 70  VAL n 
1 71  ILE n 
1 72  HIS n 
1 73  PHE n 
1 74  GLY n 
1 75  ALA n 
1 76  GLY n 
1 77  SER n 
1 78  ASP n 
1 79  LYS n 
1 80  GLY n 
1 81  VAL n 
1 82  ALA n 
1 83  PRO n 
1 84  GLY n 
1 85  THR n 
1 86  ALA n 
1 87  VAL n 
1 88  LEU n 
1 89  ARG n 
1 90  GLN n 
1 91  TRP n 
1 92  LEU n 
1 93  PRO n 
1 94  THR n 
1 95  GLY n 
1 96  THR n 
1 97  LEU n 
1 98  LEU n 
1 99  VAL n 
1 100 ASP n 
1 101 SER n 
1 102 ASP n 
1 103 LEU n 
1 104 ASN n 
1 105 ASP n 
1 106 PHE n 
1 107 VAL n 
1 108 SER n 
1 109 ASP n 
1 110 ALA n 
1 111 ASP n 
1 112 SER n 
1 113 THR n 
1 114 LEU n 
1 115 ILE n 
1 116 GLY n 
1 117 ASP n 
1 118 CYS n 
1 119 ALA n 
1 120 THR n 
1 121 VAL n 
1 122 HIS n 
1 123 THR n 
1 124 ALA n 
1 125 ASN n 
1 126 LYS n 
1 127 TRP n 
1 128 ASP n 
1 129 LEU n 
1 130 ILE n 
1 131 ILE n 
1 132 SER n 
1 133 ASP n 
1 134 MET n 
1 135 TYR n 
1 136 ASP n 
1 137 PRO n 
1 138 LYS n 
1 139 THR n 
1 140 LYS n 
1 141 ASN n 
1 142 VAL n 
1 143 THR n 
1 144 LYS n 
1 145 GLU n 
1 146 ASN n 
1 147 ASP n 
1 148 SER n 
1 149 LYS n 
1 150 GLU n 
1 151 GLY n 
1 152 PHE n 
1 153 PHE n 
1 154 THR n 
1 155 TYR n 
1 156 ILE n 
1 157 CYS n 
1 158 GLY n 
1 159 PHE n 
1 160 ILE n 
1 161 GLN n 
1 162 GLN n 
1 163 LYS n 
1 164 LEU n 
1 165 ALA n 
1 166 LEU n 
1 167 GLY n 
1 168 GLY n 
1 169 SER n 
1 170 VAL n 
1 171 ALA n 
1 172 ILE n 
1 173 LYS n 
1 174 ILE n 
1 175 THR n 
1 176 GLU n 
1 177 HIS n 
1 178 SER n 
1 179 TRP n 
1 180 ASN n 
1 181 ALA n 
1 182 ASP n 
1 183 LEU n 
1 184 TYR n 
1 185 LYS n 
1 186 LEU n 
1 187 MET n 
1 188 GLY n 
1 189 HIS n 
1 190 PHE n 
1 191 ALA n 
1 192 TRP n 
1 193 TRP n 
1 194 THR n 
1 195 ALA n 
1 196 PHE n 
1 197 VAL n 
1 198 THR n 
1 199 ASN n 
1 200 VAL n 
1 201 ASN n 
1 202 ALA n 
1 203 SER n 
1 204 SER n 
1 205 SER n 
1 206 GLU n 
1 207 ALA n 
1 208 PHE n 
1 209 LEU n 
1 210 ILE n 
1 211 GLY n 
1 212 CYS n 
1 213 ASN n 
1 214 TYR n 
1 215 LEU n 
1 216 GLY n 
1 217 LYS n 
1 218 PRO n 
1 219 ARG n 
1 220 GLU n 
1 221 GLN n 
1 222 ILE n 
1 223 ASP n 
1 224 GLY n 
1 225 TYR n 
1 226 VAL n 
1 227 MET n 
1 228 HIS n 
1 229 ALA n 
1 230 ASN n 
1 231 TYR n 
1 232 ILE n 
1 233 PHE n 
1 234 TRP n 
1 235 ARG n 
1 236 ASN n 
1 237 THR n 
1 238 ASN n 
1 239 PRO n 
1 240 ILE n 
1 241 GLN n 
1 242 LEU n 
1 243 SER n 
1 244 SER n 
1 245 TYR n 
1 246 SER n 
1 247 LEU n 
1 248 PHE n 
1 249 ASP n 
1 250 MET n 
1 251 SER n 
1 252 LYS n 
1 253 PHE n 
1 254 PRO n 
1 255 LEU n 
1 256 LYS n 
1 257 LEU n 
1 258 ARG n 
1 259 GLY n 
1 260 THR n 
1 261 ALA n 
1 262 VAL n 
1 263 MET n 
1 264 SER n 
1 265 LEU n 
1 266 LYS n 
1 267 GLU n 
1 268 GLY n 
1 269 GLN n 
1 270 ILE n 
1 271 ASN n 
1 272 ASP n 
1 273 MET n 
1 274 ILE n 
1 275 LEU n 
1 276 SER n 
1 277 LEU n 
1 278 LEU n 
1 279 SER n 
1 280 LYS n 
1 281 GLY n 
1 282 ARG n 
1 283 LEU n 
1 284 ILE n 
1 285 ILE n 
1 286 ARG n 
1 287 GLU n 
1 288 ASN n 
1 289 ASN n 
1 290 ARG n 
1 291 VAL n 
1 292 VAL n 
1 293 ILE n 
1 294 SER n 
1 295 SER n 
1 296 ASP n 
1 297 VAL n 
1 298 LEU n 
1 299 VAL n 
1 300 ASN n 
1 301 ASN n 
2 1   SER n 
2 2   ASN n 
2 3   ALA n 
2 4   ALA n 
2 5   GLY n 
2 6   ASN n 
2 7   ALA n 
2 8   THR n 
2 9   GLU n 
2 10  VAL n 
2 11  PRO n 
2 12  ALA n 
2 13  ASN n 
2 14  SER n 
2 15  THR n 
2 16  VAL n 
2 17  LEU n 
2 18  SER n 
2 19  PHE n 
2 20  CYS n 
2 21  ALA n 
2 22  PHE n 
2 23  ALA n 
2 24  VAL n 
2 25  ASP n 
2 26  ALA n 
2 27  ALA n 
2 28  LYS n 
2 29  ALA n 
2 30  TYR n 
2 31  LYS n 
2 32  ASP n 
2 33  TYR n 
2 34  LEU n 
2 35  ALA n 
2 36  SER n 
2 37  GLY n 
2 38  GLY n 
2 39  GLN n 
2 40  PRO n 
2 41  ILE n 
2 42  THR n 
2 43  ASN n 
2 44  CYS n 
2 45  VAL n 
2 46  LYS n 
2 47  MET n 
2 48  LEU n 
2 49  CYS n 
2 50  THR n 
2 51  HIS n 
2 52  THR n 
2 53  GLY n 
2 54  THR n 
2 55  GLY n 
2 56  GLN n 
2 57  ALA n 
2 58  ILE n 
2 59  THR n 
2 60  VAL n 
2 61  THR n 
2 62  PRO n 
2 63  GLU n 
2 64  ALA n 
2 65  ASN n 
2 66  MET n 
2 67  ASP n 
2 68  GLN n 
2 69  GLU n 
2 70  SER n 
2 71  PHE n 
2 72  GLY n 
2 73  GLY n 
2 74  ALA n 
2 75  SER n 
2 76  CYS n 
2 77  CYS n 
2 78  LEU n 
2 79  TYR n 
2 80  CYS n 
2 81  ARG n 
2 82  CYS n 
2 83  HIS n 
2 84  ILE n 
2 85  ASP n 
2 86  HIS n 
2 87  PRO n 
2 88  ASN n 
2 89  PRO n 
2 90  LYS n 
2 91  GLY n 
2 92  PHE n 
2 93  CYS n 
2 94  ASP n 
2 95  LEU n 
2 96  LYS n 
2 97  GLY n 
2 98  LYS n 
2 99  TYR n 
2 100 VAL n 
2 101 GLN n 
2 102 ILE n 
2 103 PRO n 
2 104 THR n 
2 105 THR n 
2 106 CYS n 
2 107 ALA n 
2 108 ASN n 
2 109 ASP n 
2 110 PRO n 
2 111 VAL n 
2 112 GLY n 
2 113 PHE n 
2 114 THR n 
2 115 LEU n 
2 116 LYS n 
2 117 ASN n 
2 118 THR n 
2 119 VAL n 
2 120 CYS n 
2 121 THR n 
2 122 VAL n 
2 123 CYS n 
2 124 GLY n 
2 125 MET n 
2 126 TRP n 
2 127 LYS n 
2 128 GLY n 
2 129 TYR n 
2 130 GLY n 
2 131 CYS n 
2 132 SER n 
2 133 CYS n 
2 134 ASP n 
2 135 GLN n 
2 136 LEU n 
2 137 ARG n 
2 138 GLU n 
2 139 PRO n 
2 140 MET n 
2 141 LEU n 
2 142 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 301 2019-nCoV ? 'rep, 1a-1b' ? ? ? ? ? ? 'Severe acute respiratory syndrome coronavirus 2' 
2697049 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? magic ? ? ? ? ? ? plasmid ? ? ? pMCSG53 ? ? 
2 1 sample 'Biological sequence' 1 142 2019-nCoV ? 'rep, 1a-1b' ? ? ? ? ? ? 'Severe acute respiratory syndrome coronavirus 2' 
2697049 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? magic ? ? ? ? ? ? plasmid ? ? ? pMCSG53 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP R1AB_SARS2 P0DTD1 ? 1 
;SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAP
GTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQK
LALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLS
SYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN
;
6799 
2 UNP R1AB_SARS2 P0DTD1 ? 2 
;AGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCH
IDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQ
;
4254 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6W4H A 4 ? 301 ? P0DTD1 6799 ? 7096 ? 6799 7096 
2 2 6W4H B 4 ? 142 ? P0DTD1 4254 ? 4392 ? 4254 4392 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6W4H SER A 1 ? UNP P0DTD1 ? ? 'expression tag' 6796 1 
1 6W4H ASN A 2 ? UNP P0DTD1 ? ? 'expression tag' 6797 2 
1 6W4H ALA A 3 ? UNP P0DTD1 ? ? 'expression tag' 6798 3 
2 6W4H SER B 1 ? UNP P0DTD1 ? ? 'expression tag' 4251 4 
2 6W4H ASN B 2 ? UNP P0DTD1 ? ? 'expression tag' 4252 5 
2 6W4H ALA B 3 ? UNP P0DTD1 ? ? 'expression tag' 4253 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer                  . 'ACETATE ION'         ?                                       'C2 H3 O2 -1'     59.044  
ALA 'L-peptide linking'          y ALANINE               ?                                       'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'          y ARGININE              ?                                       'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'          y ASPARAGINE            ?                                       'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'       ?                                       'C4 H7 N O4'      133.103 
BDF 'D-saccharide, beta linking' . beta-D-fructopyranose 'beta-D-fructose; D-fructose; fructose' 'C6 H12 O6'       180.156 
CYS 'L-peptide linking'          y CYSTEINE              ?                                       'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking'          y GLUTAMINE             ?                                       'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'       ?                                       'C5 H9 N O4'      147.129 
GLY 'peptide linking'            y GLYCINE               ?                                       'C2 H5 N O2'      75.067  
HIS 'L-peptide linking'          y HISTIDINE             ?                                       'C6 H10 N3 O2 1'  156.162 
HOH non-polymer                  . WATER                 ?                                       'H2 O'            18.015  
ILE 'L-peptide linking'          y ISOLEUCINE            ?                                       'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'          y LEUCINE               ?                                       'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'          y LYSINE                ?                                       'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'          y METHIONINE            ?                                       'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking'          y PHENYLALANINE         ?                                       'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'          y PROLINE               ?                                       'C5 H9 N O2'      115.130 
SAM non-polymer                  . S-ADENOSYLMETHIONINE  ?                                       'C15 H22 N6 O5 S' 398.437 
SER 'L-peptide linking'          y SERINE                ?                                       'C3 H7 N O3'      105.093 
SO3 non-polymer                  . 'SULFITE ION'         ?                                       'O3 S -2'         80.063  
THR 'L-peptide linking'          y THREONINE             ?                                       'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN            ?                                       'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'          y TYROSINE              ?                                       'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'          y VALINE                ?                                       'C5 H11 N O2'     117.146 
ZN  non-polymer                  . 'ZINC ION'            ?                                       'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6W4H 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.33 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         71.6 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;5.3 mg/mL 1:1 nsp16/nsp10 in 0.15 M sodium chloride, 0.01 M Tris, pH 7.5, 2 mM SAM, 1 mM TCEP, 5% glycerol against ComPAS screen A7 (0.2 M calcium acetate, 0.1 M HEPES, pH 7.5, 18% w/v PEG 8000), cryoprotectant: 1:1 screen + 50% sucrose
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      'C(111)' 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2020-03-07 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'diamond(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97872 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97872 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            25.4 
_reflns.entry_id                         6W4H 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.80 
_reflns.d_resolution_low                 30.00 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       77886 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3.0 
_reflns.percent_possible_obs             100.0 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.3 
_reflns.pdbx_Rmerge_I_obs                0.060 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.060 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            29.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.007 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.065 
_reflns.pdbx_Rpim_I_all                  0.024 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.80 
_reflns_shell.d_res_low                   1.83 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.6 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           3873 
_reflns_shell.percent_possible_all        100.0 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.765 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             6.8 
_reflns_shell.pdbx_Rsym_value             0.765 
_reflns_shell.pdbx_chi_squared            0.992 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.828 
_reflns_shell.pdbx_Rpim_I_all             0.313 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.762 
_reflns_shell.pdbx_CC_star                0.930 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -0.0600 
_refine.aniso_B[1][2]                            -0.0300 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            -0.0600 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            0.1800 
_refine.B_iso_max                                115.280 
_refine.B_iso_mean                               31.5310 
_refine.B_iso_min                                15.700 
_refine.correlation_coeff_Fo_to_Fc               0.9720 
_refine.correlation_coeff_Fo_to_Fc_free          0.9660 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : WITH TLS ADDED' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6W4H 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.8000 
_refine.ls_d_res_low                             29.7600 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     73752 
_refine.ls_number_reflns_R_free                  3821 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.9700 
_refine.ls_percent_reflns_R_free                 4.9000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1497 
_refine.ls_R_factor_R_free                       0.1627 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1490 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 3R24' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.0730 
_refine.pdbx_overall_ESU_R_Free                  0.0700 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             2.9620 
_refine.overall_SU_ML                            0.0470 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.8000 
_refine_hist.d_res_low                        29.7600 
_refine_hist.number_atoms_solvent             486 
_refine_hist.number_atoms_total               3752 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       415 
_refine_hist.pdbx_B_iso_mean_ligand           39.56 
_refine_hist.pdbx_B_iso_mean_solvent          43.13 
_refine_hist.pdbx_number_atoms_protein        3201 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         65 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.004  0.013  3697 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.017  3336 ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 1.183  1.640  5072 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 0.321  1.578  7788 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 3.282  5.000  485  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 27.951 23.614 166  ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 8.695  15.000 617  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 6.592  15.000 14   ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.052  0.200  495  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.055  0.020  4271 ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.051  0.020  754  ? r_gen_planes_other     ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.8000 
_refine_ls_shell.d_res_low                        1.8470 
_refine_ls_shell.number_reflns_all                5714 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             282 
_refine_ls_shell.number_reflns_R_work             5432 
_refine_ls_shell.percent_reflns_obs               100.0000 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.2390 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.2290 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_R_complete                  ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6W4H 
_struct.title                        '1.80 Angstrom Resolution Crystal Structure of NSP16 - NSP10 Complex from SARS-CoV-2' 
_struct.pdbx_descriptor              'nsp16, nsp10' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6W4H 
_struct_keywords.text            
'Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, nsp16, nsp10, complex, VIRAL PROTEIN' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 7 ? 
J N N 6 ? 
K N N 8 ? 
L N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 4   ? GLN A 9   ? SER A 6799 GLN A 6804 5 ? 6  
HELX_P HELX_P2  AA2 PRO A 15  ? MET A 20  ? PRO A 6810 MET A 6815 1 ? 6  
HELX_P HELX_P3  AA3 MET A 44  ? ASN A 58  ? MET A 6839 ASN A 6853 1 ? 15 
HELX_P HELX_P4  AA4 ALA A 82  ? LEU A 92  ? ALA A 6877 LEU A 6887 1 ? 11 
HELX_P HELX_P5  AA5 ASP A 117 ? ALA A 119 ? ASP A 6912 ALA A 6914 5 ? 3  
HELX_P HELX_P6  AA6 ASP A 136 ? LYS A 140 ? ASP A 6931 LYS A 6935 5 ? 5  
HELX_P HELX_P7  AA7 GLY A 151 ? LYS A 163 ? GLY A 6946 LYS A 6958 1 ? 13 
HELX_P HELX_P8  AA8 ASN A 180 ? GLY A 188 ? ASN A 6975 GLY A 6983 1 ? 9  
HELX_P HELX_P9  AA9 ASP A 223 ? ASN A 238 ? ASP A 7018 ASN A 7033 1 ? 16 
HELX_P HELX_P10 AB1 SER A 244 ? ASP A 249 ? SER A 7039 ASP A 7044 5 ? 6  
HELX_P HELX_P11 AB2 LYS A 266 ? ILE A 270 ? LYS A 7061 ILE A 7065 5 ? 5  
HELX_P HELX_P12 AB3 ASN A 271 ? LYS A 280 ? ASN A 7066 LYS A 7075 1 ? 10 
HELX_P HELX_P13 AB4 ASP B 25  ? SER B 36  ? ASP B 4275 SER B 4286 1 ? 12 
HELX_P HELX_P14 AB5 ALA B 74  ? CYS B 76  ? ALA B 4324 CYS B 4326 5 ? 3  
HELX_P HELX_P15 AB6 CYS B 77  ? HIS B 83  ? CYS B 4327 HIS B 4333 1 ? 7  
HELX_P HELX_P16 AB7 ASN B 88  ? PHE B 92  ? ASN B 4338 PHE B 4342 5 ? 5  
HELX_P HELX_P17 AB8 THR B 105 ? ALA B 107 ? THR B 4355 ALA B 4357 5 ? 3  
HELX_P HELX_P18 AB9 ASP B 109 ? ASN B 117 ? ASP B 4359 ASN B 4367 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? B CYS 77  SG  ? ? ? 1_555 H ZN . ZN ? ? B CYS 4327 B ZN 4401 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc2 metalc ? ? B CYS 80  SG  ? ? ? 1_555 H ZN . ZN ? ? B CYS 4330 B ZN 4401 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc3 metalc ? ? B HIS 86  NE2 ? ? ? 1_555 H ZN . ZN ? ? B HIS 4336 B ZN 4401 1_555 ? ? ? ? ? ? ? 2.006 ? ? 
metalc4 metalc ? ? B CYS 93  SG  ? ? ? 1_555 H ZN . ZN ? ? B CYS 4343 B ZN 4401 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc5 metalc ? ? B CYS 120 SG  ? ? ? 1_555 I ZN . ZN ? ? B CYS 4370 B ZN 4402 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc6 metalc ? ? B CYS 123 SG  ? ? ? 1_555 I ZN . ZN ? ? B CYS 4373 B ZN 4402 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc7 metalc ? ? B CYS 131 SG  ? ? ? 1_555 I ZN . ZN ? ? B CYS 4381 B ZN 4402 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc8 metalc ? ? B CYS 133 SG  ? ? ? 1_555 I ZN . ZN ? ? B CYS 4383 B ZN 4402 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? parallel      
AA1 7 8 ? parallel      
AA2 1 2 ? anti-parallel 
AA3 1 2 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLY A 11  ? ALA A 13  ? GLY A 6806 ALA A 6808 
AA1 2 PHE A 190 ? THR A 198 ? PHE A 6985 THR A 6993 
AA1 3 ALA A 207 ? TYR A 214 ? ALA A 7002 TYR A 7009 
AA1 4 LEU A 164 ? ILE A 174 ? LEU A 6959 ILE A 6969 
AA1 5 TRP A 127 ? SER A 132 ? TRP A 6922 SER A 6927 
AA1 6 ARG A 69  ? PHE A 73  ? ARG A 6864 PHE A 6868 
AA1 7 LEU A 97  ? ASP A 102 ? LEU A 6892 ASP A 6897 
AA1 8 SER A 112 ? ILE A 115 ? SER A 6907 ILE A 6910 
AA2 1 VAL A 121 ? THR A 123 ? VAL A 6916 THR A 6918 
AA2 2 ILE A 293 ? SER A 295 ? ILE A 7088 SER A 7090 
AA3 1 ALA A 261 ? MET A 263 ? ALA A 7056 MET A 7058 
AA3 2 LEU A 283 ? ILE A 285 ? LEU A 7078 ILE A 7080 
AA4 1 ILE B 58  ? THR B 59  ? ILE B 4308 THR B 4309 
AA4 2 TYR B 99  ? PRO B 103 ? TYR B 4349 PRO B 4353 
AA4 3 GLN B 68  ? GLY B 72  ? GLN B 4318 GLY B 4322 
AA5 1 TRP B 126 ? LYS B 127 ? TRP B 4376 LYS B 4377 
AA5 2 GLY B 130 ? CYS B 131 ? GLY B 4380 CYS B 4381 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 12  ? N VAL A 6807 O VAL A 197 ? O VAL A 6992 
AA1 2 3 N TRP A 192 ? N TRP A 6987 O CYS A 212 ? O CYS A 7007 
AA1 3 4 O LEU A 209 ? O LEU A 7004 N ILE A 172 ? N ILE A 6967 
AA1 4 5 O ALA A 165 ? O ALA A 6960 N TRP A 127 ? N TRP A 6922 
AA1 5 6 O ILE A 131 ? O ILE A 6926 N PHE A 73  ? N PHE A 6868 
AA1 6 7 N VAL A 70  ? N VAL A 6865 O LEU A 97  ? O LEU A 6892 
AA1 7 8 N ASP A 100 ? N ASP A 6895 O LEU A 114 ? O LEU A 6909 
AA2 1 2 N HIS A 122 ? N HIS A 6917 O SER A 294 ? O SER A 7089 
AA3 1 2 N MET A 263 ? N MET A 7058 O ILE A 284 ? O ILE A 7079 
AA4 1 2 N THR B 59  ? N THR B 4309 O TYR B 99  ? O TYR B 4349 
AA4 2 3 O ILE B 102 ? O ILE B 4352 N GLU B 69  ? N GLU B 4319 
AA5 1 2 N TRP B 126 ? N TRP B 4376 O CYS B 131 ? O CYS B 4381 
# 
_atom_sites.entry_id                    6W4H 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.005962 
_atom_sites.fract_transf_matrix[1][2]   0.003442 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006884 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019252 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ALA A 1 3   ? 78.228  47.055  27.186  1.00 69.03  ? 6798 ALA A N     1 
ATOM   2    C  CA    . ALA A 1 3   ? 78.868  48.293  27.743  1.00 69.84  ? 6798 ALA A CA    1 
ATOM   3    C  C     . ALA A 1 3   ? 80.391  48.218  27.568  1.00 67.02  ? 6798 ALA A C     1 
ATOM   4    O  O     . ALA A 1 3   ? 80.957  49.127  26.929  1.00 70.05  ? 6798 ALA A O     1 
ATOM   5    C  CB    . ALA A 1 3   ? 78.486  48.468  29.194  1.00 70.45  ? 6798 ALA A CB    1 
ATOM   6    N  N     . SER A 1 4   ? 81.018  47.176  28.129  1.00 63.31  ? 6799 SER A N     1 
ATOM   7    C  CA    . SER A 1 4   ? 82.489  46.961  28.038  1.00 59.29  ? 6799 SER A CA    1 
ATOM   8    C  C     . SER A 1 4   ? 82.897  46.725  26.577  1.00 54.21  ? 6799 SER A C     1 
ATOM   9    O  O     . SER A 1 4   ? 82.172  45.996  25.887  1.00 49.75  ? 6799 SER A O     1 
ATOM   10   C  CB    . SER A 1 4   ? 82.902  45.798  28.915  1.00 61.81  ? 6799 SER A CB    1 
ATOM   11   O  OG    . SER A 1 4   ? 84.296  45.541  28.812  1.00 64.28  ? 6799 SER A OG    1 
ATOM   12   N  N     . SER A 1 5   ? 84.017  47.313  26.132  1.00 50.71  ? 6800 SER A N     1 
ATOM   13   C  CA    . SER A 1 5   ? 84.516  47.129  24.737  1.00 48.15  ? 6800 SER A CA    1 
ATOM   14   C  C     . SER A 1 5   ? 84.720  45.634  24.444  1.00 42.54  ? 6800 SER A C     1 
ATOM   15   O  O     . SER A 1 5   ? 84.446  45.178  23.293  1.00 41.45  ? 6800 SER A O     1 
ATOM   16   C  CB    . SER A 1 5   ? 85.790  47.903  24.516  1.00 52.04  ? 6800 SER A CB    1 
ATOM   17   O  OG    . SER A 1 5   ? 86.307  47.656  23.217  1.00 55.12  ? 6800 SER A OG    1 
ATOM   18   N  N     . GLN A 1 6   ? 85.170  44.892  25.453  1.00 36.35  ? 6801 GLN A N     1 
ATOM   19   C  CA    . GLN A 1 6   ? 85.385  43.429  25.326  1.00 32.80  ? 6801 GLN A CA    1 
ATOM   20   C  C     . GLN A 1 6   ? 84.056  42.712  25.061  1.00 28.48  ? 6801 GLN A C     1 
ATOM   21   O  O     . GLN A 1 6   ? 84.106  41.593  24.544  1.00 26.22  ? 6801 GLN A O     1 
ATOM   22   C  CB    . GLN A 1 6   ? 86.011  42.879  26.607  1.00 33.50  ? 6801 GLN A CB    1 
ATOM   23   C  CG    . GLN A 1 6   ? 87.392  43.439  26.883  1.00 37.89  ? 6801 GLN A CG    1 
ATOM   24   C  CD    . GLN A 1 6   ? 88.004  42.876  28.142  1.00 38.55  ? 6801 GLN A CD    1 
ATOM   25   O  OE1   . GLN A 1 6   ? 89.220  42.732  28.236  1.00 44.29  ? 6801 GLN A OE1   1 
ATOM   26   N  NE2   . GLN A 1 6   ? 87.165  42.540  29.112  1.00 38.88  ? 6801 GLN A NE2   1 
ATOM   27   N  N     . ALA A 1 7   ? 82.923  43.340  25.392  1.00 27.50  ? 6802 ALA A N     1 
ATOM   28   C  CA    . ALA A 1 7   ? 81.597  42.687  25.247  1.00 26.67  ? 6802 ALA A CA    1 
ATOM   29   C  C     . ALA A 1 7   ? 81.266  42.397  23.777  1.00 25.98  ? 6802 ALA A C     1 
ATOM   30   O  O     . ALA A 1 7   ? 80.425  41.505  23.540  1.00 25.04  ? 6802 ALA A O     1 
ATOM   31   C  CB    . ALA A 1 7   ? 80.525  43.540  25.877  1.00 27.48  ? 6802 ALA A CB    1 
ATOM   32   N  N     . TRP A 1 8   ? 81.892  43.111  22.836  1.00 26.34  ? 6803 TRP A N     1 
ATOM   33   C  CA    . TRP A 1 8   ? 81.601  42.899  21.391  1.00 27.40  ? 6803 TRP A CA    1 
ATOM   34   C  C     . TRP A 1 8   ? 82.545  41.848  20.796  1.00 26.04  ? 6803 TRP A C     1 
ATOM   35   O  O     . TRP A 1 8   ? 82.341  41.447  19.636  1.00 27.84  ? 6803 TRP A O     1 
ATOM   36   C  CB    . TRP A 1 8   ? 81.605  44.225  20.631  1.00 30.83  ? 6803 TRP A CB    1 
ATOM   37   C  CG    . TRP A 1 8   ? 80.385  45.028  20.960  1.00 32.47  ? 6803 TRP A CG    1 
ATOM   38   C  CD1   . TRP A 1 8   ? 79.173  44.933  20.352  1.00 33.93  ? 6803 TRP A CD1   1 
ATOM   39   C  CD2   . TRP A 1 8   ? 80.221  45.985  22.019  1.00 34.53  ? 6803 TRP A CD2   1 
ATOM   40   N  NE1   . TRP A 1 8   ? 78.271  45.773  20.939  1.00 35.18  ? 6803 TRP A NE1   1 
ATOM   41   C  CE2   . TRP A 1 8   ? 78.885  46.437  21.960  1.00 35.50  ? 6803 TRP A CE2   1 
ATOM   42   C  CE3   . TRP A 1 8   ? 81.063  46.508  23.005  1.00 35.56  ? 6803 TRP A CE3   1 
ATOM   43   C  CZ2   . TRP A 1 8   ? 78.378  47.388  22.840  1.00 37.40  ? 6803 TRP A CZ2   1 
ATOM   44   C  CZ3   . TRP A 1 8   ? 80.561  47.449  23.875  1.00 37.31  ? 6803 TRP A CZ3   1 
ATOM   45   C  CH2   . TRP A 1 8   ? 79.238  47.887  23.787  1.00 38.34  ? 6803 TRP A CH2   1 
ATOM   46   N  N     A GLN A 1 9   ? 83.534  41.407  21.571  0.60 24.33  ? 6804 GLN A N     1 
ATOM   47   N  N     B GLN A 1 9   ? 83.532  41.411  21.583  0.40 24.26  ? 6804 GLN A N     1 
ATOM   48   C  CA    A GLN A 1 9   ? 84.469  40.353  21.100  0.60 23.52  ? 6804 GLN A CA    1 
ATOM   49   C  CA    B GLN A 1 9   ? 84.483  40.351  21.158  0.40 23.16  ? 6804 GLN A CA    1 
ATOM   50   C  C     A GLN A 1 9   ? 83.845  38.998  21.430  0.60 21.57  ? 6804 GLN A C     1 
ATOM   51   C  C     B GLN A 1 9   ? 83.837  38.995  21.431  0.40 21.49  ? 6804 GLN A C     1 
ATOM   52   O  O     A GLN A 1 9   ? 82.866  38.928  22.170  0.60 20.54  ? 6804 GLN A O     1 
ATOM   53   O  O     B GLN A 1 9   ? 82.838  38.923  22.145  0.40 20.70  ? 6804 GLN A O     1 
ATOM   54   C  CB    A GLN A 1 9   ? 85.847  40.546  21.742  0.60 23.96  ? 6804 GLN A CB    1 
ATOM   55   C  CB    B GLN A 1 9   ? 85.787  40.458  21.953  0.40 22.98  ? 6804 GLN A CB    1 
ATOM   56   C  CG    A GLN A 1 9   ? 86.540  41.833  21.308  0.60 26.39  ? 6804 GLN A CG    1 
ATOM   57   C  CG    B GLN A 1 9   ? 86.437  41.834  21.902  0.40 24.64  ? 6804 GLN A CG    1 
ATOM   58   C  CD    A GLN A 1 9   ? 86.791  41.869  19.820  0.60 28.04  ? 6804 GLN A CD    1 
ATOM   59   C  CD    B GLN A 1 9   ? 87.676  41.910  22.760  0.40 24.63  ? 6804 GLN A CD    1 
ATOM   60   O  OE1   A GLN A 1 9   ? 87.231  40.889  19.221  0.60 29.55  ? 6804 GLN A OE1   1 
ATOM   61   O  OE1   B GLN A 1 9   ? 88.074  40.940  23.405  0.40 24.51  ? 6804 GLN A OE1   1 
ATOM   62   N  NE2   A GLN A 1 9   ? 86.524  43.011  19.211  0.60 30.67  ? 6804 GLN A NE2   1 
ATOM   63   N  NE2   B GLN A 1 9   ? 88.296  43.077  22.783  0.40 25.98  ? 6804 GLN A NE2   1 
ATOM   64   N  N     . PRO A 1 10  ? 84.343  37.886  20.845  1.00 20.76  ? 6805 PRO A N     1 
ATOM   65   C  CA    . PRO A 1 10  ? 83.818  36.558  21.176  1.00 19.92  ? 6805 PRO A CA    1 
ATOM   66   C  C     . PRO A 1 10  ? 84.213  36.140  22.603  1.00 18.67  ? 6805 PRO A C     1 
ATOM   67   O  O     . PRO A 1 10  ? 83.589  35.265  23.177  1.00 18.49  ? 6805 PRO A O     1 
ATOM   68   C  CB    . PRO A 1 10  ? 84.469  35.645  20.127  1.00 19.89  ? 6805 PRO A CB    1 
ATOM   69   C  CG    . PRO A 1 10  ? 85.723  36.390  19.697  1.00 20.99  ? 6805 PRO A CG    1 
ATOM   70   C  CD    . PRO A 1 10  ? 85.359  37.859  19.781  1.00 21.43  ? 6805 PRO A CD    1 
ATOM   71   N  N     . GLY A 1 11  ? 85.239  36.791  23.146  1.00 19.06  ? 6806 GLY A N     1 
ATOM   72   C  CA    . GLY A 1 11  ? 85.731  36.478  24.497  1.00 18.78  ? 6806 GLY A CA    1 
ATOM   73   C  C     . GLY A 1 11  ? 86.968  37.285  24.824  1.00 19.29  ? 6806 GLY A C     1 
ATOM   74   O  O     . GLY A 1 11  ? 87.266  38.236  24.081  1.00 19.97  ? 6806 GLY A O     1 
ATOM   75   N  N     . VAL A 1 12  ? 87.687  36.882  25.868  1.00 18.96  ? 6807 VAL A N     1 
ATOM   76   C  CA    . VAL A 1 12  ? 88.874  37.645  26.334  1.00 19.71  ? 6807 VAL A CA    1 
ATOM   77   C  C     . VAL A 1 12  ? 90.054  36.689  26.493  1.00 18.93  ? 6807 VAL A C     1 
ATOM   78   O  O     . VAL A 1 12  ? 89.888  35.622  27.120  1.00 18.99  ? 6807 VAL A O     1 
ATOM   79   C  CB    . VAL A 1 12  ? 88.552  38.376  27.652  1.00 20.61  ? 6807 VAL A CB    1 
ATOM   80   C  CG1   . VAL A 1 12  ? 89.703  39.257  28.104  1.00 21.69  ? 6807 VAL A CG1   1 
ATOM   81   C  CG2   . VAL A 1 12  ? 87.281  39.197  27.529  1.00 21.67  ? 6807 VAL A CG2   1 
ATOM   82   N  N     . ALA A 1 13  ? 91.188  37.064  25.910  1.00 19.13  ? 6808 ALA A N     1 
ATOM   83   C  CA    . ALA A 1 13  ? 92.444  36.298  26.028  1.00 19.52  ? 6808 ALA A CA    1 
ATOM   84   C  C     . ALA A 1 13  ? 93.264  36.865  27.193  1.00 19.69  ? 6808 ALA A C     1 
ATOM   85   O  O     . ALA A 1 13  ? 93.267  38.095  27.390  1.00 20.14  ? 6808 ALA A O     1 
ATOM   86   C  CB    . ALA A 1 13  ? 93.216  36.383  24.740  1.00 20.56  ? 6808 ALA A CB    1 
ATOM   87   N  N     . MET A 1 14  ? 93.939  35.989  27.924  1.00 19.72  ? 6809 MET A N     1 
ATOM   88   C  CA    . MET A 1 14  ? 94.798  36.388  29.066  1.00 20.39  ? 6809 MET A CA    1 
ATOM   89   C  C     . MET A 1 14  ? 95.847  37.394  28.586  1.00 22.04  ? 6809 MET A C     1 
ATOM   90   O  O     . MET A 1 14  ? 96.656  37.071  27.717  1.00 22.81  ? 6809 MET A O     1 
ATOM   91   C  CB    . MET A 1 14  ? 95.481  35.141  29.617  1.00 20.45  ? 6809 MET A CB    1 
ATOM   92   C  CG    . MET A 1 14  ? 96.320  35.367  30.840  1.00 20.96  ? 6809 MET A CG    1 
ATOM   93   S  SD    . MET A 1 14  ? 96.899  33.768  31.398  1.00 21.17  ? 6809 MET A SD    1 
ATOM   94   C  CE    . MET A 1 14  ? 97.969  34.279  32.746  1.00 22.55  ? 6809 MET A CE    1 
ATOM   95   N  N     . PRO A 1 15  ? 95.847  38.648  29.093  1.00 23.26  ? 6810 PRO A N     1 
ATOM   96   C  CA    . PRO A 1 15  ? 96.829  39.646  28.663  1.00 25.08  ? 6810 PRO A CA    1 
ATOM   97   C  C     . PRO A 1 15  ? 98.272  39.200  28.953  1.00 25.65  ? 6810 PRO A C     1 
ATOM   98   O  O     . PRO A 1 15  ? 98.508  38.567  29.963  1.00 25.31  ? 6810 PRO A O     1 
ATOM   99   C  CB    . PRO A 1 15  ? 96.436  40.908  29.438  1.00 26.12  ? 6810 PRO A CB    1 
ATOM   100  C  CG    . PRO A 1 15  ? 94.977  40.700  29.770  1.00 25.12  ? 6810 PRO A CG    1 
ATOM   101  C  CD    . PRO A 1 15  ? 94.853  39.213  30.020  1.00 23.69  ? 6810 PRO A CD    1 
ATOM   102  N  N     . ASN A 1 16  ? 99.189  39.553  28.052  1.00 27.02  ? 6811 ASN A N     1 
ATOM   103  C  CA    . ASN A 1 16  ? 100.618 39.144  28.128  1.00 27.46  ? 6811 ASN A CA    1 
ATOM   104  C  C     . ASN A 1 16  ? 101.230 39.483  29.494  1.00 26.80  ? 6811 ASN A C     1 
ATOM   105  O  O     . ASN A 1 16  ? 101.989 38.637  30.014  1.00 26.54  ? 6811 ASN A O     1 
ATOM   106  C  CB    . ASN A 1 16  ? 101.430 39.754  26.983  1.00 29.82  ? 6811 ASN A CB    1 
ATOM   107  C  CG    . ASN A 1 16  ? 101.146 39.102  25.645  1.00 30.61  ? 6811 ASN A CG    1 
ATOM   108  O  OD1   . ASN A 1 16  ? 100.514 38.049  25.587  1.00 30.82  ? 6811 ASN A OD1   1 
ATOM   109  N  ND2   . ASN A 1 16  ? 101.634 39.699  24.570  1.00 32.73  ? 6811 ASN A ND2   1 
ATOM   110  N  N     . LEU A 1 17  ? 100.913 40.641  30.079  1.00 26.48  ? 6812 LEU A N     1 
ATOM   111  C  CA    . LEU A 1 17  ? 101.612 40.982  31.350  1.00 26.74  ? 6812 LEU A CA    1 
ATOM   112  C  C     . LEU A 1 17  ? 101.239 39.976  32.447  1.00 25.66  ? 6812 LEU A C     1 
ATOM   113  O  O     . LEU A 1 17  ? 102.108 39.697  33.288  1.00 26.21  ? 6812 LEU A O     1 
ATOM   114  C  CB    . LEU A 1 17  ? 101.307 42.427  31.764  1.00 27.61  ? 6812 LEU A CB    1 
ATOM   115  C  CG    . LEU A 1 17  ? 102.124 42.947  32.945  1.00 28.84  ? 6812 LEU A CG    1 
ATOM   116  C  CD1   . LEU A 1 17  ? 103.624 42.820  32.690  1.00 29.67  ? 6812 LEU A CD1   1 
ATOM   117  C  CD2   . LEU A 1 17  ? 101.771 44.391  33.251  1.00 30.24  ? 6812 LEU A CD2   1 
ATOM   118  N  N     . TYR A 1 18  ? 100.020 39.419  32.420  1.00 24.69  ? 6813 TYR A N     1 
ATOM   119  C  CA    . TYR A 1 18  ? 99.616  38.418  33.448  1.00 24.20  ? 6813 TYR A CA    1 
ATOM   120  C  C     . TYR A 1 18  ? 100.439 37.134  33.277  1.00 23.91  ? 6813 TYR A C     1 
ATOM   121  O  O     . TYR A 1 18  ? 100.756 36.490  34.284  1.00 23.81  ? 6813 TYR A O     1 
ATOM   122  C  CB    . TYR A 1 18  ? 98.109  38.146  33.401  1.00 23.54  ? 6813 TYR A CB    1 
ATOM   123  C  CG    . TYR A 1 18  ? 97.280  39.289  33.925  1.00 23.99  ? 6813 TYR A CG    1 
ATOM   124  C  CD1   . TYR A 1 18  ? 97.102  39.467  35.286  1.00 25.14  ? 6813 TYR A CD1   1 
ATOM   125  C  CD2   . TYR A 1 18  ? 96.712  40.216  33.070  1.00 24.62  ? 6813 TYR A CD2   1 
ATOM   126  C  CE1   . TYR A 1 18  ? 96.367  40.530  35.785  1.00 25.74  ? 6813 TYR A CE1   1 
ATOM   127  C  CE2   . TYR A 1 18  ? 95.972  41.284  33.552  1.00 25.85  ? 6813 TYR A CE2   1 
ATOM   128  C  CZ    . TYR A 1 18  ? 95.796  41.439  34.916  1.00 26.15  ? 6813 TYR A CZ    1 
ATOM   129  O  OH    . TYR A 1 18  ? 95.075  42.491  35.407  1.00 27.44  ? 6813 TYR A OH    1 
ATOM   130  N  N     . LYS A 1 19  ? 100.790 36.790  32.039  1.00 24.50  ? 6814 LYS A N     1 
ATOM   131  C  CA    . LYS A 1 19  ? 101.601 35.570  31.771  1.00 25.19  ? 6814 LYS A CA    1 
ATOM   132  C  C     . LYS A 1 19  ? 103.017 35.714  32.335  1.00 26.87  ? 6814 LYS A C     1 
ATOM   133  O  O     . LYS A 1 19  ? 103.648 34.674  32.599  1.00 27.51  ? 6814 LYS A O     1 
ATOM   134  C  CB    . LYS A 1 19  ? 101.723 35.335  30.264  1.00 26.09  ? 6814 LYS A CB    1 
ATOM   135  C  CG    . LYS A 1 19  ? 100.407 35.178  29.519  1.00 25.36  ? 6814 LYS A CG    1 
ATOM   136  C  CD    . LYS A 1 19  ? 100.594 35.112  28.023  1.00 26.56  ? 6814 LYS A CD    1 
ATOM   137  C  CE    . LYS A 1 19  ? 99.285  35.029  27.271  1.00 26.55  ? 6814 LYS A CE    1 
ATOM   138  N  NZ    . LYS A 1 19  ? 99.487  35.191  25.813  1.00 28.08  ? 6814 LYS A NZ    1 
ATOM   139  N  N     . MET A 1 20  ? 103.483 36.951  32.540  1.00 27.14  ? 6815 MET A N     1 
ATOM   140  C  CA    . MET A 1 20  ? 104.887 37.221  32.953  1.00 28.78  ? 6815 MET A CA    1 
ATOM   141  C  C     . MET A 1 20  ? 105.011 37.347  34.475  1.00 28.81  ? 6815 MET A C     1 
ATOM   142  O  O     . MET A 1 20  ? 106.129 37.628  34.942  1.00 29.63  ? 6815 MET A O     1 
ATOM   143  C  CB    . MET A 1 20  ? 105.378 38.516  32.300  1.00 30.28  ? 6815 MET A CB    1 
ATOM   144  C  CG    . MET A 1 20  ? 105.257 38.500  30.789  1.00 30.56  ? 6815 MET A CG    1 
ATOM   145  S  SD    . MET A 1 20  ? 105.781 40.056  30.045  1.00 32.85  ? 6815 MET A SD    1 
ATOM   146  C  CE    . MET A 1 20  ? 107.537 40.005  30.388  1.00 34.55  ? 6815 MET A CE    1 
ATOM   147  N  N     . GLN A 1 21  ? 103.928 37.105  35.218  1.00 27.44  ? 6816 GLN A N     1 
ATOM   148  C  CA    . GLN A 1 21  ? 103.973 37.249  36.697  1.00 28.36  ? 6816 GLN A CA    1 
ATOM   149  C  C     . GLN A 1 21  ? 104.446 35.941  37.341  1.00 29.40  ? 6816 GLN A C     1 
ATOM   150  O  O     . GLN A 1 21  ? 104.695 34.955  36.611  1.00 28.42  ? 6816 GLN A O     1 
ATOM   151  C  CB    . GLN A 1 21  ? 102.604 37.678  37.233  1.00 27.22  ? 6816 GLN A CB    1 
ATOM   152  C  CG    . GLN A 1 21  ? 102.109 38.981  36.620  1.00 27.05  ? 6816 GLN A CG    1 
ATOM   153  C  CD    . GLN A 1 21  ? 103.145 40.072  36.740  1.00 28.19  ? 6816 GLN A CD    1 
ATOM   154  O  OE1   . GLN A 1 21  ? 103.623 40.383  37.830  1.00 29.32  ? 6816 GLN A OE1   1 
ATOM   155  N  NE2   . GLN A 1 21  ? 103.499 40.667  35.610  1.00 27.86  ? 6816 GLN A NE2   1 
ATOM   156  N  N     . ARG A 1 22  ? 104.605 35.964  38.663  1.00 31.22  ? 6817 ARG A N     1 
ATOM   157  C  CA    . ARG A 1 22  ? 104.999 34.760  39.434  1.00 33.76  ? 6817 ARG A CA    1 
ATOM   158  C  C     . ARG A 1 22  ? 104.085 34.714  40.658  1.00 33.42  ? 6817 ARG A C     1 
ATOM   159  O  O     . ARG A 1 22  ? 104.572 34.842  41.792  1.00 34.27  ? 6817 ARG A O     1 
ATOM   160  C  CB    . ARG A 1 22  ? 106.495 34.785  39.763  1.00 38.03  ? 6817 ARG A CB    1 
ATOM   161  C  CG    . ARG A 1 22  ? 107.000 33.467  40.327  1.00 42.16  ? 6817 ARG A CG    1 
ATOM   162  C  CD    . ARG A 1 22  ? 108.505 33.381  40.472  1.00 46.66  ? 6817 ARG A CD    1 
ATOM   163  N  NE    . ARG A 1 22  ? 108.860 32.058  40.966  1.00 50.95  ? 6817 ARG A NE    1 
ATOM   164  C  CZ    . ARG A 1 22  ? 109.011 30.973  40.208  1.00 52.23  ? 6817 ARG A CZ    1 
ATOM   165  N  NH1   . ARG A 1 22  ? 109.328 29.820  40.771  1.00 55.17  ? 6817 ARG A NH1   1 
ATOM   166  N  NH2   . ARG A 1 22  ? 108.847 31.034  38.896  1.00 51.89  ? 6817 ARG A NH2   1 
ATOM   167  N  N     . MET A 1 23  ? 102.785 34.567  40.401  1.00 31.83  ? 6818 MET A N     1 
ATOM   168  C  CA    . MET A 1 23  ? 101.754 34.579  41.464  1.00 32.35  ? 6818 MET A CA    1 
ATOM   169  C  C     . MET A 1 23  ? 101.684 33.221  42.163  1.00 32.84  ? 6818 MET A C     1 
ATOM   170  O  O     . MET A 1 23  ? 102.108 32.211  41.569  1.00 32.04  ? 6818 MET A O     1 
ATOM   171  C  CB    . MET A 1 23  ? 100.380 34.895  40.863  1.00 31.47  ? 6818 MET A CB    1 
ATOM   172  C  CG    . MET A 1 23  ? 100.351 36.179  40.051  1.00 31.43  ? 6818 MET A CG    1 
ATOM   173  S  SD    . MET A 1 23  ? 101.013 37.594  40.955  1.00 33.86  ? 6818 MET A SD    1 
ATOM   174  C  CE    . MET A 1 23  ? 99.817  37.730  42.283  1.00 35.06  ? 6818 MET A CE    1 
ATOM   175  N  N     . LEU A 1 24  ? 101.209 33.228  43.410  1.00 34.62  ? 6819 LEU A N     1 
ATOM   176  C  CA    . LEU A 1 24  ? 100.950 31.966  44.144  1.00 35.81  ? 6819 LEU A CA    1 
ATOM   177  C  C     . LEU A 1 24  ? 99.501  31.577  43.850  1.00 33.07  ? 6819 LEU A C     1 
ATOM   178  O  O     . LEU A 1 24  ? 98.687  32.493  43.596  1.00 30.85  ? 6819 LEU A O     1 
ATOM   179  C  CB    . LEU A 1 24  ? 101.187 32.163  45.642  1.00 38.79  ? 6819 LEU A CB    1 
ATOM   180  C  CG    . LEU A 1 24  ? 102.632 32.454  46.045  1.00 42.19  ? 6819 LEU A CG    1 
ATOM   181  C  CD1   . LEU A 1 24  ? 102.741 32.610  47.551  1.00 44.60  ? 6819 LEU A CD1   1 
ATOM   182  C  CD2   . LEU A 1 24  ? 103.573 31.361  45.556  1.00 43.18  ? 6819 LEU A CD2   1 
ATOM   183  N  N     . LEU A 1 25  ? 99.205  30.280  43.877  1.00 33.30  ? 6820 LEU A N     1 
ATOM   184  C  CA    . LEU A 1 25  ? 97.840  29.803  43.547  1.00 32.97  ? 6820 LEU A CA    1 
ATOM   185  C  C     . LEU A 1 25  ? 96.863  30.216  44.648  1.00 33.04  ? 6820 LEU A C     1 
ATOM   186  O  O     . LEU A 1 25  ? 97.136  29.953  45.829  1.00 34.26  ? 6820 LEU A O     1 
ATOM   187  C  CB    . LEU A 1 25  ? 97.850  28.280  43.376  1.00 34.42  ? 6820 LEU A CB    1 
ATOM   188  C  CG    . LEU A 1 25  ? 96.501  27.660  43.013  1.00 34.45  ? 6820 LEU A CG    1 
ATOM   189  C  CD1   . LEU A 1 25  ? 95.965  28.254  41.725  1.00 33.44  ? 6820 LEU A CD1   1 
ATOM   190  C  CD2   . LEU A 1 25  ? 96.602  26.148  42.888  1.00 36.15  ? 6820 LEU A CD2   1 
ATOM   191  N  N     A GLU A 1 26  ? 95.763  30.862  44.251  0.50 31.93  ? 6821 GLU A N     1 
ATOM   192  N  N     B GLU A 1 26  ? 95.756  30.847  44.254  0.50 31.98  ? 6821 GLU A N     1 
ATOM   193  C  CA    A GLU A 1 26  ? 94.686  31.288  45.182  0.50 32.92  ? 6821 GLU A CA    1 
ATOM   194  C  CA    B GLU A 1 26  ? 94.700  31.271  45.207  0.50 33.02  ? 6821 GLU A CA    1 
ATOM   195  C  C     A GLU A 1 26  ? 93.382  30.625  44.744  0.50 31.41  ? 6821 GLU A C     1 
ATOM   196  C  C     B GLU A 1 26  ? 93.367  30.699  44.724  0.50 31.49  ? 6821 GLU A C     1 
ATOM   197  O  O     A GLU A 1 26  ? 93.344  30.073  43.622  0.50 29.06  ? 6821 GLU A O     1 
ATOM   198  O  O     B GLU A 1 26  ? 93.299  30.248  43.560  0.50 29.06  ? 6821 GLU A O     1 
ATOM   199  C  CB    A GLU A 1 26  ? 94.450  32.800  45.146  0.50 33.92  ? 6821 GLU A CB    1 
ATOM   200  C  CB    B GLU A 1 26  ? 94.646  32.797  45.314  0.50 34.27  ? 6821 GLU A CB    1 
ATOM   201  C  CG    A GLU A 1 26  ? 95.672  33.645  45.440  0.50 35.94  ? 6821 GLU A CG    1 
ATOM   202  C  CG    B GLU A 1 26  ? 95.907  33.413  45.898  0.50 36.34  ? 6821 GLU A CG    1 
ATOM   203  C  CD    A GLU A 1 26  ? 95.352  35.126  45.545  0.50 37.17  ? 6821 GLU A CD    1 
ATOM   204  C  CD    B GLU A 1 26  ? 96.183  33.060  47.349  0.50 39.24  ? 6821 GLU A CD    1 
ATOM   205  O  OE1   A GLU A 1 26  ? 96.158  35.946  45.065  0.50 38.60  ? 6821 GLU A OE1   1 
ATOM   206  O  OE1   B GLU A 1 26  ? 95.271  32.524  48.008  0.50 41.35  ? 6821 GLU A OE1   1 
ATOM   207  O  OE2   A GLU A 1 26  ? 94.297  35.456  46.121  0.50 39.58  ? 6821 GLU A OE2   1 
ATOM   208  O  OE2   B GLU A 1 26  ? 97.313  33.321  47.819  0.50 41.15  ? 6821 GLU A OE2   1 
ATOM   209  N  N     A LYS A 1 27  ? 92.359  30.678  45.595  0.50 31.61  ? 6822 LYS A N     1 
ATOM   210  N  N     B LYS A 1 27  ? 92.364  30.690  45.600  0.50 31.75  ? 6822 LYS A N     1 
ATOM   211  C  CA    A LYS A 1 27  ? 91.038  30.152  45.180  0.50 31.31  ? 6822 LYS A CA    1 
ATOM   212  C  CA    B LYS A 1 27  ? 91.016  30.205  45.217  0.50 31.49  ? 6822 LYS A CA    1 
ATOM   213  C  C     A LYS A 1 27  ? 90.483  31.119  44.134  0.50 29.94  ? 6822 LYS A C     1 
ATOM   214  C  C     B LYS A 1 27  ? 90.456  31.144  44.146  0.50 30.05  ? 6822 LYS A C     1 
ATOM   215  O  O     A LYS A 1 27  ? 90.759  32.336  44.245  0.50 29.11  ? 6822 LYS A O     1 
ATOM   216  O  O     B LYS A 1 27  ? 90.704  32.368  44.247  0.50 29.18  ? 6822 LYS A O     1 
ATOM   217  C  CB    A LYS A 1 27  ? 90.077  30.037  46.367  0.50 33.31  ? 6822 LYS A CB    1 
ATOM   218  C  CB    B LYS A 1 27  ? 90.110  30.160  46.451  0.50 33.58  ? 6822 LYS A CB    1 
ATOM   219  C  CG    A LYS A 1 27  ? 90.535  29.122  47.493  0.50 35.68  ? 6822 LYS A CG    1 
ATOM   220  C  CG    B LYS A 1 27  ? 88.645  29.859  46.174  0.50 34.19  ? 6822 LYS A CG    1 
ATOM   221  C  CD    A LYS A 1 27  ? 89.510  28.987  48.598  0.50 37.89  ? 6822 LYS A CD    1 
ATOM   222  C  CD    B LYS A 1 27  ? 87.808  29.705  47.428  0.50 36.58  ? 6822 LYS A CD    1 
ATOM   223  C  CE    A LYS A 1 27  ? 89.095  30.319  49.188  0.50 39.21  ? 6822 LYS A CE    1 
ATOM   224  C  CE    B LYS A 1 27  ? 86.354  29.420  47.119  0.50 36.86  ? 6822 LYS A CE    1 
ATOM   225  N  NZ    A LYS A 1 27  ? 90.233  31.022  49.828  0.50 40.49  ? 6822 LYS A NZ    1 
ATOM   226  N  NZ    B LYS A 1 27  ? 86.209  28.232  46.245  0.50 36.19  ? 6822 LYS A NZ    1 
ATOM   227  N  N     . CYS A 1 28  ? 89.767  30.591  43.143  1.00 28.88  ? 6823 CYS A N     1 
ATOM   228  C  CA    . CYS A 1 28  ? 89.145  31.434  42.098  1.00 29.05  ? 6823 CYS A CA    1 
ATOM   229  C  C     . CYS A 1 28  ? 87.839  31.974  42.687  1.00 31.08  ? 6823 CYS A C     1 
ATOM   230  O  O     . CYS A 1 28  ? 87.043  31.164  43.217  1.00 32.73  ? 6823 CYS A O     1 
ATOM   231  C  CB    . CYS A 1 28  ? 88.909  30.658  40.808  1.00 28.83  ? 6823 CYS A CB    1 
ATOM   232  S  SG    . CYS A 1 28  ? 88.430  31.727  39.428  1.00 28.91  ? 6823 CYS A SG    1 
ATOM   233  N  N     . ASP A 1 29  ? 87.681  33.295  42.682  1.00 31.04  ? 6824 ASP A N     1 
ATOM   234  C  CA    . ASP A 1 29  ? 86.474  33.955  43.240  1.00 32.84  ? 6824 ASP A CA    1 
ATOM   235  C  C     . ASP A 1 29  ? 86.009  34.981  42.208  1.00 31.62  ? 6824 ASP A C     1 
ATOM   236  O  O     . ASP A 1 29  ? 86.494  36.124  42.252  1.00 31.80  ? 6824 ASP A O     1 
ATOM   237  C  CB    . ASP A 1 29  ? 86.795  34.586  44.598  1.00 35.74  ? 6824 ASP A CB    1 
ATOM   238  C  CG    . ASP A 1 29  ? 85.619  35.272  45.269  1.00 39.32  ? 6824 ASP A CG    1 
ATOM   239  O  OD1   . ASP A 1 29  ? 84.478  35.043  44.836  1.00 42.07  ? 6824 ASP A OD1   1 
ATOM   240  O  OD2   . ASP A 1 29  ? 85.859  36.031  46.226  1.00 44.21  ? 6824 ASP A OD2   1 
ATOM   241  N  N     . LEU A 1 30  ? 85.127  34.573  41.297  1.00 30.49  ? 6825 LEU A N     1 
ATOM   242  C  CA    . LEU A 1 30  ? 84.623  35.440  40.203  1.00 30.91  ? 6825 LEU A CA    1 
ATOM   243  C  C     . LEU A 1 30  ? 83.473  36.314  40.709  1.00 33.78  ? 6825 LEU A C     1 
ATOM   244  O  O     . LEU A 1 30  ? 82.498  35.773  41.254  1.00 33.59  ? 6825 LEU A O     1 
ATOM   245  C  CB    . LEU A 1 30  ? 84.191  34.558  39.030  1.00 29.20  ? 6825 LEU A CB    1 
ATOM   246  C  CG    . LEU A 1 30  ? 85.292  33.664  38.467  1.00 28.56  ? 6825 LEU A CG    1 
ATOM   247  C  CD1   . LEU A 1 30  ? 84.777  32.833  37.305  1.00 28.16  ? 6825 LEU A CD1   1 
ATOM   248  C  CD2   . LEU A 1 30  ? 86.492  34.496  38.039  1.00 28.43  ? 6825 LEU A CD2   1 
ATOM   249  N  N     A GLN A 1 31  ? 83.652  37.631  40.598  0.60 35.53  ? 6826 GLN A N     1 
ATOM   250  N  N     B GLN A 1 31  ? 83.547  37.616  40.417  0.40 36.02  ? 6826 GLN A N     1 
ATOM   251  C  CA    A GLN A 1 31  ? 82.643  38.639  41.020  0.60 39.11  ? 6826 GLN A CA    1 
ATOM   252  C  CA    B GLN A 1 31  ? 82.499  38.585  40.837  0.40 39.61  ? 6826 GLN A CA    1 
ATOM   253  C  C     A GLN A 1 31  ? 81.291  38.328  40.373  0.60 39.76  ? 6826 GLN A C     1 
ATOM   254  C  C     B GLN A 1 31  ? 81.172  38.302  40.120  0.40 40.12  ? 6826 GLN A C     1 
ATOM   255  O  O     A GLN A 1 31  ? 80.258  38.513  41.040  0.60 40.81  ? 6826 GLN A O     1 
ATOM   256  O  O     B GLN A 1 31  ? 80.123  38.554  40.741  0.40 40.97  ? 6826 GLN A O     1 
ATOM   257  C  CB    A GLN A 1 31  ? 83.119  40.031  40.595  0.60 40.15  ? 6826 GLN A CB    1 
ATOM   258  C  CB    B GLN A 1 31  ? 82.962  40.022  40.592  0.40 41.50  ? 6826 GLN A CB    1 
ATOM   259  C  CG    A GLN A 1 31  ? 82.032  41.097  40.619  0.60 41.78  ? 6826 GLN A CG    1 
ATOM   260  C  CG    B GLN A 1 31  ? 84.009  40.489  41.592  0.40 43.33  ? 6826 GLN A CG    1 
ATOM   261  C  CD    A GLN A 1 31  ? 82.548  42.430  40.138  0.60 41.81  ? 6826 GLN A CD    1 
ATOM   262  C  CD    B GLN A 1 31  ? 84.249  41.975  41.508  0.40 44.74  ? 6826 GLN A CD    1 
ATOM   263  O  OE1   A GLN A 1 31  ? 83.249  43.141  40.854  0.60 43.50  ? 6826 GLN A OE1   1 
ATOM   264  O  OE1   B GLN A 1 31  ? 84.132  42.584  40.447  0.40 45.96  ? 6826 GLN A OE1   1 
ATOM   265  N  NE2   A GLN A 1 31  ? 82.169  42.794  38.924  0.60 40.45  ? 6826 GLN A NE2   1 
ATOM   266  N  NE2   B GLN A 1 31  ? 84.587  42.573  42.638  0.40 46.92  ? 6826 GLN A NE2   1 
ATOM   267  N  N     A ASN A 1 32  ? 81.325  37.847  39.119  0.50 38.87  ? 6827 ASN A N     1 
ATOM   268  N  N     B ASN A 1 32  ? 81.192  37.799  38.878  0.50 38.97  ? 6827 ASN A N     1 
ATOM   269  C  CA    A ASN A 1 32  ? 80.117  37.580  38.286  0.50 39.84  ? 6827 ASN A CA    1 
ATOM   270  C  CA    B ASN A 1 32  ? 79.894  37.522  38.210  0.50 40.17  ? 6827 ASN A CA    1 
ATOM   271  C  C     A ASN A 1 32  ? 79.691  36.102  38.351  0.50 41.05  ? 6827 ASN A C     1 
ATOM   272  C  C     B ASN A 1 32  ? 79.540  36.042  38.393  0.50 41.20  ? 6827 ASN A C     1 
ATOM   273  O  O     A ASN A 1 32  ? 78.875  35.699  37.503  0.50 41.17  ? 6827 ASN A O     1 
ATOM   274  O  O     B ASN A 1 32  ? 78.631  35.576  37.682  0.50 41.10  ? 6827 ASN A O     1 
ATOM   275  C  CB    A ASN A 1 32  ? 80.369  37.997  36.832  0.50 38.17  ? 6827 ASN A CB    1 
ATOM   276  C  CB    B ASN A 1 32  ? 79.909  37.939  36.739  0.50 38.68  ? 6827 ASN A CB    1 
ATOM   277  C  CG    A ASN A 1 32  ? 80.787  39.448  36.694  0.50 38.01  ? 6827 ASN A CG    1 
ATOM   278  C  CG    B ASN A 1 32  ? 81.032  37.293  35.966  0.50 36.15  ? 6827 ASN A CG    1 
ATOM   279  O  OD1   A ASN A 1 32  ? 80.693  40.223  37.641  0.50 37.87  ? 6827 ASN A OD1   1 
ATOM   280  O  OD1   B ASN A 1 32  ? 81.882  36.624  36.550  0.50 35.47  ? 6827 ASN A OD1   1 
ATOM   281  N  ND2   A ASN A 1 32  ? 81.254  39.829  35.516  0.50 37.50  ? 6827 ASN A ND2   1 
ATOM   282  N  ND2   B ASN A 1 32  ? 81.043  37.491  34.658  0.50 35.30  ? 6827 ASN A ND2   1 
ATOM   283  N  N     . TYR A 1 33  ? 80.202  35.342  39.325  1.00 41.72  ? 6828 TYR A N     1 
ATOM   284  C  CA    . TYR A 1 33  ? 79.875  33.901  39.516  1.00 46.77  ? 6828 TYR A CA    1 
ATOM   285  C  C     . TYR A 1 33  ? 78.377  33.749  39.808  1.00 49.91  ? 6828 TYR A C     1 
ATOM   286  O  O     . TYR A 1 33  ? 77.831  34.562  40.579  1.00 51.95  ? 6828 TYR A O     1 
ATOM   287  C  CB    . TYR A 1 33  ? 80.699  33.289  40.653  1.00 51.63  ? 6828 TYR A CB    1 
ATOM   288  C  CG    . TYR A 1 33  ? 80.417  31.830  40.913  1.00 57.46  ? 6828 TYR A CG    1 
ATOM   289  C  CD1   . TYR A 1 33  ? 81.029  30.840  40.159  1.00 61.36  ? 6828 TYR A CD1   1 
ATOM   290  C  CD2   . TYR A 1 33  ? 79.540  31.433  41.911  1.00 62.30  ? 6828 TYR A CD2   1 
ATOM   291  C  CE1   . TYR A 1 33  ? 80.776  29.497  40.386  1.00 63.66  ? 6828 TYR A CE1   1 
ATOM   292  C  CE2   . TYR A 1 33  ? 79.277  30.093  42.153  1.00 64.37  ? 6828 TYR A CE2   1 
ATOM   293  C  CZ    . TYR A 1 33  ? 79.898  29.121  41.387  1.00 65.73  ? 6828 TYR A CZ    1 
ATOM   294  O  OH    . TYR A 1 33  ? 79.651  27.797  41.613  1.00 69.26  ? 6828 TYR A OH    1 
ATOM   295  N  N     . GLY A 1 34  ? 77.737  32.740  39.209  1.00 50.77  ? 6829 GLY A N     1 
ATOM   296  C  CA    . GLY A 1 34  ? 76.294  32.507  39.425  1.00 54.33  ? 6829 GLY A CA    1 
ATOM   297  C  C     . GLY A 1 34  ? 75.438  33.177  38.360  1.00 55.23  ? 6829 GLY A C     1 
ATOM   298  O  O     . GLY A 1 34  ? 74.300  32.705  38.144  1.00 59.05  ? 6829 GLY A O     1 
ATOM   299  N  N     . ASP A 1 35  ? 75.951  34.246  37.735  1.00 53.24  ? 6830 ASP A N     1 
ATOM   300  C  CA    . ASP A 1 35  ? 75.222  34.960  36.650  1.00 50.71  ? 6830 ASP A CA    1 
ATOM   301  C  C     . ASP A 1 35  ? 75.305  34.133  35.361  1.00 47.78  ? 6830 ASP A C     1 
ATOM   302  O  O     . ASP A 1 35  ? 76.327  33.449  35.159  1.00 42.76  ? 6830 ASP A O     1 
ATOM   303  C  CB    . ASP A 1 35  ? 75.792  36.359  36.406  1.00 50.68  ? 6830 ASP A CB    1 
ATOM   304  C  CG    . ASP A 1 35  ? 75.677  37.299  37.595  1.00 54.86  ? 6830 ASP A CG    1 
ATOM   305  O  OD1   . ASP A 1 35  ? 74.995  36.927  38.573  1.00 57.75  ? 6830 ASP A OD1   1 
ATOM   306  O  OD2   . ASP A 1 35  ? 76.270  38.398  37.531  1.00 51.65  ? 6830 ASP A OD2   1 
ATOM   307  N  N     . SER A 1 36  ? 74.261  34.200  34.532  1.00 47.10  ? 6831 SER A N     1 
ATOM   308  C  CA    . SER A 1 36  ? 74.207  33.465  33.241  1.00 46.79  ? 6831 SER A CA    1 
ATOM   309  C  C     . SER A 1 36  ? 73.925  34.455  32.107  1.00 43.69  ? 6831 SER A C     1 
ATOM   310  O  O     . SER A 1 36  ? 73.089  35.352  32.305  1.00 45.85  ? 6831 SER A O     1 
ATOM   311  C  CB    . SER A 1 36  ? 73.171  32.367  33.274  1.00 49.90  ? 6831 SER A CB    1 
ATOM   312  O  OG    . SER A 1 36  ? 73.531  31.352  34.200  1.00 53.52  ? 6831 SER A OG    1 
ATOM   313  N  N     . ALA A 1 37  ? 74.619  34.302  30.975  1.00 39.87  ? 6832 ALA A N     1 
ATOM   314  C  CA    . ALA A 1 37  ? 74.393  35.181  29.804  1.00 37.36  ? 6832 ALA A CA    1 
ATOM   315  C  C     . ALA A 1 37  ? 73.044  34.827  29.165  1.00 35.35  ? 6832 ALA A C     1 
ATOM   316  O  O     . ALA A 1 37  ? 72.595  33.667  29.300  1.00 36.45  ? 6832 ALA A O     1 
ATOM   317  C  CB    . ALA A 1 37  ? 75.510  35.017  28.801  1.00 37.31  ? 6832 ALA A CB    1 
ATOM   318  N  N     A THR A 1 38  ? 72.401  35.805  28.525  0.50 34.30  ? 6833 THR A N     1 
ATOM   319  N  N     B THR A 1 38  ? 72.427  35.808  28.504  0.50 35.25  ? 6833 THR A N     1 
ATOM   320  C  CA    A THR A 1 38  ? 71.115  35.545  27.823  0.50 34.63  ? 6833 THR A CA    1 
ATOM   321  C  CA    B THR A 1 38  ? 71.143  35.599  27.786  0.50 36.27  ? 6833 THR A CA    1 
ATOM   322  C  C     A THR A 1 38  ? 71.449  35.059  26.409  0.50 32.24  ? 6833 THR A C     1 
ATOM   323  C  C     B THR A 1 38  ? 71.473  35.060  26.390  0.50 33.03  ? 6833 THR A C     1 
ATOM   324  O  O     A THR A 1 38  ? 71.941  35.866  25.604  0.50 32.02  ? 6833 THR A O     1 
ATOM   325  O  O     B THR A 1 38  ? 71.986  35.837  25.568  0.50 32.66  ? 6833 THR A O     1 
ATOM   326  C  CB    A THR A 1 38  ? 70.200  36.774  27.844  0.50 35.95  ? 6833 THR A CB    1 
ATOM   327  C  CB    B THR A 1 38  ? 70.328  36.896  27.730  0.50 38.83  ? 6833 THR A CB    1 
ATOM   328  O  OG1   A THR A 1 38  ? 69.852  37.009  29.209  0.50 36.71  ? 6833 THR A OG1   1 
ATOM   329  O  OG1   B THR A 1 38  ? 71.074  37.853  26.976  0.50 40.59  ? 6833 THR A OG1   1 
ATOM   330  C  CG2   A THR A 1 38  ? 68.946  36.590  27.018  0.50 36.30  ? 6833 THR A CG2   1 
ATOM   331  C  CG2   B THR A 1 38  ? 70.019  37.454  29.102  0.50 39.92  ? 6833 THR A CG2   1 
ATOM   332  N  N     . LEU A 1 39  ? 71.205  33.777  26.145  1.00 31.03  ? 6834 LEU A N     1 
ATOM   333  C  CA    . LEU A 1 39  ? 71.529  33.166  24.828  1.00 28.75  ? 6834 LEU A CA    1 
ATOM   334  C  C     . LEU A 1 39  ? 70.422  33.459  23.823  1.00 27.56  ? 6834 LEU A C     1 
ATOM   335  O  O     . LEU A 1 39  ? 69.272  33.655  24.206  1.00 26.93  ? 6834 LEU A O     1 
ATOM   336  C  CB    . LEU A 1 39  ? 71.683  31.656  25.017  1.00 28.84  ? 6834 LEU A CB    1 
ATOM   337  C  CG    . LEU A 1 39  ? 72.783  31.225  25.984  1.00 29.23  ? 6834 LEU A CG    1 
ATOM   338  C  CD1   . LEU A 1 39  ? 72.795  29.717  26.162  1.00 30.14  ? 6834 LEU A CD1   1 
ATOM   339  C  CD2   . LEU A 1 39  ? 74.133  31.720  25.504  1.00 29.00  ? 6834 LEU A CD2   1 
ATOM   340  N  N     . PRO A 1 40  ? 70.745  33.509  22.511  1.00 25.67  ? 6835 PRO A N     1 
ATOM   341  C  CA    . PRO A 1 40  ? 69.721  33.625  21.479  1.00 26.06  ? 6835 PRO A CA    1 
ATOM   342  C  C     . PRO A 1 40  ? 68.718  32.484  21.698  1.00 25.89  ? 6835 PRO A C     1 
ATOM   343  O  O     . PRO A 1 40  ? 69.121  31.409  22.128  1.00 24.75  ? 6835 PRO A O     1 
ATOM   344  C  CB    . PRO A 1 40  ? 70.497  33.514  20.161  1.00 25.97  ? 6835 PRO A CB    1 
ATOM   345  C  CG    . PRO A 1 40  ? 71.909  33.937  20.524  1.00 25.06  ? 6835 PRO A CG    1 
ATOM   346  C  CD    . PRO A 1 40  ? 72.105  33.486  21.952  1.00 24.59  ? 6835 PRO A CD    1 
ATOM   347  N  N     . LYS A 1 41  ? 67.447  32.746  21.400  1.00 26.81  ? 6836 LYS A N     1 
ATOM   348  C  CA    . LYS A 1 41  ? 66.345  31.786  21.649  1.00 27.81  ? 6836 LYS A CA    1 
ATOM   349  C  C     . LYS A 1 41  ? 66.676  30.393  21.093  1.00 26.57  ? 6836 LYS A C     1 
ATOM   350  O  O     . LYS A 1 41  ? 67.024  30.285  19.898  1.00 25.33  ? 6836 LYS A O     1 
ATOM   351  C  CB    . LYS A 1 41  ? 65.056  32.334  21.030  1.00 30.65  ? 6836 LYS A CB    1 
ATOM   352  C  CG    . LYS A 1 41  ? 63.805  31.541  21.347  1.00 33.45  ? 6836 LYS A CG    1 
ATOM   353  C  CD    . LYS A 1 41  ? 62.546  32.179  20.799  1.00 36.73  ? 6836 LYS A CD    1 
ATOM   354  C  CE    . LYS A 1 41  ? 61.299  31.409  21.167  1.00 39.91  ? 6836 LYS A CE    1 
ATOM   355  N  NZ    . LYS A 1 41  ? 61.337  30.030  20.630  1.00 41.77  ? 6836 LYS A NZ    1 
ATOM   356  N  N     . GLY A 1 42  ? 66.582  29.372  21.954  1.00 25.74  ? 6837 GLY A N     1 
ATOM   357  C  CA    . GLY A 1 42  ? 66.761  27.961  21.558  1.00 25.37  ? 6837 GLY A CA    1 
ATOM   358  C  C     . GLY A 1 42  ? 68.200  27.561  21.280  1.00 24.14  ? 6837 GLY A C     1 
ATOM   359  O  O     . GLY A 1 42  ? 68.395  26.431  20.789  1.00 24.14  ? 6837 GLY A O     1 
ATOM   360  N  N     . ILE A 1 43  ? 69.174  28.432  21.561  1.00 22.54  ? 6838 ILE A N     1 
ATOM   361  C  CA    . ILE A 1 43  ? 70.604  28.082  21.319  1.00 21.57  ? 6838 ILE A CA    1 
ATOM   362  C  C     . ILE A 1 43  ? 71.200  27.482  22.598  1.00 21.28  ? 6838 ILE A C     1 
ATOM   363  O  O     . ILE A 1 43  ? 71.050  28.082  23.675  1.00 21.76  ? 6838 ILE A O     1 
ATOM   364  C  CB    . ILE A 1 43  ? 71.393  29.308  20.816  1.00 21.11  ? 6838 ILE A CB    1 
ATOM   365  C  CG1   . ILE A 1 43  ? 70.870  29.776  19.453  1.00 21.46  ? 6838 ILE A CG1   1 
ATOM   366  C  CG2   . ILE A 1 43  ? 72.888  29.028  20.779  1.00 20.48  ? 6838 ILE A CG2   1 
ATOM   367  C  CD1   . ILE A 1 43  ? 71.053  28.779  18.329  1.00 21.68  ? 6838 ILE A CD1   1 
ATOM   368  N  N     . MET A 1 44  ? 71.845  26.328  22.457  1.00 21.30  ? 6839 MET A N     1 
ATOM   369  C  CA    . MET A 1 44  ? 72.502  25.635  23.593  1.00 21.09  ? 6839 MET A CA    1 
ATOM   370  C  C     . MET A 1 44  ? 73.767  26.386  24.017  1.00 20.08  ? 6839 MET A C     1 
ATOM   371  O  O     . MET A 1 44  ? 74.470  26.934  23.148  1.00 17.93  ? 6839 MET A O     1 
ATOM   372  C  CB    . MET A 1 44  ? 72.914  24.221  23.186  1.00 21.63  ? 6839 MET A CB    1 
ATOM   373  C  CG    . MET A 1 44  ? 71.760  23.315  22.870  1.00 23.74  ? 6839 MET A CG    1 
ATOM   374  S  SD    . MET A 1 44  ? 72.384  21.769  22.169  1.00 24.55  ? 6839 MET A SD    1 
ATOM   375  C  CE    . MET A 1 44  ? 70.859  20.837  22.045  1.00 25.96  ? 6839 MET A CE    1 
ATOM   376  N  N     . MET A 1 45  ? 74.073  26.346  25.312  1.00 20.39  ? 6840 MET A N     1 
ATOM   377  C  CA    . MET A 1 45  ? 75.313  26.976  25.828  1.00 20.77  ? 6840 MET A CA    1 
ATOM   378  C  C     . MET A 1 45  ? 76.529  26.484  25.032  1.00 19.57  ? 6840 MET A C     1 
ATOM   379  O  O     . MET A 1 45  ? 77.369  27.323  24.675  1.00 18.72  ? 6840 MET A O     1 
ATOM   380  C  CB    . MET A 1 45  ? 75.516  26.623  27.306  1.00 22.69  ? 6840 MET A CB    1 
ATOM   381  C  CG    . MET A 1 45  ? 76.883  27.006  27.835  1.00 24.11  ? 6840 MET A CG    1 
ATOM   382  S  SD    . MET A 1 45  ? 77.235  28.784  27.674  1.00 28.52  ? 6840 MET A SD    1 
ATOM   383  C  CE    . MET A 1 45  ? 76.076  29.457  28.857  1.00 30.52  ? 6840 MET A CE    1 
ATOM   384  N  N     . ASN A 1 46  ? 76.633  25.176  24.768  1.00 19.06  ? 6841 ASN A N     1 
ATOM   385  C  CA    . ASN A 1 46  ? 77.863  24.668  24.100  1.00 19.61  ? 6841 ASN A CA    1 
ATOM   386  C  C     . ASN A 1 46  ? 77.904  25.083  22.625  1.00 18.51  ? 6841 ASN A C     1 
ATOM   387  O  O     . ASN A 1 46  ? 79.024  25.201  22.105  1.00 18.65  ? 6841 ASN A O     1 
ATOM   388  C  CB    . ASN A 1 46  ? 78.082  23.187  24.388  1.00 21.02  ? 6841 ASN A CB    1 
ATOM   389  C  CG    . ASN A 1 46  ? 78.549  22.999  25.819  1.00 23.52  ? 6841 ASN A CG    1 
ATOM   390  O  OD1   . ASN A 1 46  ? 78.923  23.970  26.479  1.00 27.38  ? 6841 ASN A OD1   1 
ATOM   391  N  ND2   . ASN A 1 46  ? 78.512  21.778  26.317  1.00 24.26  ? 6841 ASN A ND2   1 
ATOM   392  N  N     . VAL A 1 47  ? 76.758  25.297  21.974  1.00 17.90  ? 6842 VAL A N     1 
ATOM   393  C  CA    . VAL A 1 47  ? 76.830  25.853  20.589  1.00 17.91  ? 6842 VAL A CA    1 
ATOM   394  C  C     . VAL A 1 47  ? 77.390  27.281  20.694  1.00 17.61  ? 6842 VAL A C     1 
ATOM   395  O  O     . VAL A 1 47  ? 78.287  27.639  19.906  1.00 17.72  ? 6842 VAL A O     1 
ATOM   396  C  CB    . VAL A 1 47  ? 75.463  25.817  19.878  1.00 18.38  ? 6842 VAL A CB    1 
ATOM   397  C  CG1   . VAL A 1 47  ? 75.429  26.702  18.639  1.00 18.78  ? 6842 VAL A CG1   1 
ATOM   398  C  CG2   . VAL A 1 47  ? 75.065  24.390  19.537  1.00 18.46  ? 6842 VAL A CG2   1 
ATOM   399  N  N     . ALA A 1 48  ? 76.895  28.062  21.655  1.00 18.05  ? 6843 ALA A N     1 
ATOM   400  C  CA    . ALA A 1 48  ? 77.352  29.458  21.828  1.00 17.55  ? 6843 ALA A CA    1 
ATOM   401  C  C     . ALA A 1 48  ? 78.847  29.478  22.177  1.00 17.14  ? 6843 ALA A C     1 
ATOM   402  O  O     . ALA A 1 48  ? 79.594  30.278  21.588  1.00 16.99  ? 6843 ALA A O     1 
ATOM   403  C  CB    . ALA A 1 48  ? 76.522  30.130  22.893  1.00 18.03  ? 6843 ALA A CB    1 
ATOM   404  N  N     . LYS A 1 49  ? 79.262  28.595  23.084  1.00 16.97  ? 6844 LYS A N     1 
ATOM   405  C  CA    . LYS A 1 49  ? 80.664  28.525  23.571  1.00 16.68  ? 6844 LYS A CA    1 
ATOM   406  C  C     . LYS A 1 49  ? 81.612  28.143  22.428  1.00 16.46  ? 6844 LYS A C     1 
ATOM   407  O  O     . LYS A 1 49  ? 82.615  28.854  22.216  1.00 15.70  ? 6844 LYS A O     1 
ATOM   408  C  CB    . LYS A 1 49  ? 80.738  27.515  24.714  1.00 17.09  ? 6844 LYS A CB    1 
ATOM   409  C  CG    . LYS A 1 49  ? 82.113  27.325  25.327  1.00 17.87  ? 6844 LYS A CG    1 
ATOM   410  C  CD    . LYS A 1 49  ? 82.162  26.185  26.312  1.00 18.36  ? 6844 LYS A CD    1 
ATOM   411  C  CE    . LYS A 1 49  ? 81.163  26.322  27.437  1.00 18.93  ? 6844 LYS A CE    1 
ATOM   412  N  NZ    . LYS A 1 49  ? 81.359  25.259  28.446  1.00 18.68  ? 6844 LYS A NZ    1 
ATOM   413  N  N     . TYR A 1 50  ? 81.324  27.045  21.730  1.00 16.08  ? 6845 TYR A N     1 
ATOM   414  C  CA    . TYR A 1 50  ? 82.195  26.663  20.589  1.00 16.36  ? 6845 TYR A CA    1 
ATOM   415  C  C     . TYR A 1 50  ? 82.156  27.732  19.497  1.00 16.47  ? 6845 TYR A C     1 
ATOM   416  O  O     . TYR A 1 50  ? 83.182  27.934  18.846  1.00 16.75  ? 6845 TYR A O     1 
ATOM   417  C  CB    . TYR A 1 50  ? 81.787  25.311  20.020  1.00 16.74  ? 6845 TYR A CB    1 
ATOM   418  C  CG    . TYR A 1 50  ? 82.356  24.129  20.749  1.00 17.05  ? 6845 TYR A CG    1 
ATOM   419  C  CD1   . TYR A 1 50  ? 81.907  23.781  22.013  1.00 17.49  ? 6845 TYR A CD1   1 
ATOM   420  C  CD2   . TYR A 1 50  ? 83.309  23.322  20.151  1.00 17.83  ? 6845 TYR A CD2   1 
ATOM   421  C  CE1   . TYR A 1 50  ? 82.405  22.668  22.669  1.00 17.75  ? 6845 TYR A CE1   1 
ATOM   422  C  CE2   . TYR A 1 50  ? 83.816  22.205  20.793  1.00 17.67  ? 6845 TYR A CE2   1 
ATOM   423  C  CZ    . TYR A 1 50  ? 83.357  21.875  22.055  1.00 18.23  ? 6845 TYR A CZ    1 
ATOM   424  O  OH    . TYR A 1 50  ? 83.821  20.758  22.691  1.00 18.99  ? 6845 TYR A OH    1 
ATOM   425  N  N     . THR A 1 51  ? 81.007  28.379  19.282  1.00 16.59  ? 6846 THR A N     1 
ATOM   426  C  CA    . THR A 1 51  ? 80.965  29.435  18.235  1.00 17.14  ? 6846 THR A CA    1 
ATOM   427  C  C     . THR A 1 51  ? 81.959  30.543  18.612  1.00 16.91  ? 6846 THR A C     1 
ATOM   428  O  O     . THR A 1 51  ? 82.732  30.973  17.737  1.00 17.30  ? 6846 THR A O     1 
ATOM   429  C  CB    . THR A 1 51  ? 79.544  29.970  18.038  1.00 18.07  ? 6846 THR A CB    1 
ATOM   430  O  OG1   . THR A 1 51  ? 78.760  28.885  17.534  1.00 18.81  ? 6846 THR A OG1   1 
ATOM   431  C  CG2   . THR A 1 51  ? 79.479  31.151  17.093  1.00 19.14  ? 6846 THR A CG2   1 
ATOM   432  N  N     . GLN A 1 52  ? 81.968  30.956  19.879  1.00 16.42  ? 6847 GLN A N     1 
ATOM   433  C  CA    . GLN A 1 52  ? 82.888  32.043  20.313  1.00 16.52  ? 6847 GLN A CA    1 
ATOM   434  C  C     . GLN A 1 52  ? 84.340  31.551  20.258  1.00 16.74  ? 6847 GLN A C     1 
ATOM   435  O  O     . GLN A 1 52  ? 85.205  32.358  19.868  1.00 17.36  ? 6847 GLN A O     1 
ATOM   436  C  CB    . GLN A 1 52  ? 82.455  32.598  21.670  1.00 16.92  ? 6847 GLN A CB    1 
ATOM   437  C  CG    . GLN A 1 52  ? 81.231  33.490  21.550  1.00 17.31  ? 6847 GLN A CG    1 
ATOM   438  C  CD    . GLN A 1 52  ? 80.839  34.143  22.848  1.00 17.69  ? 6847 GLN A CD    1 
ATOM   439  O  OE1   . GLN A 1 52  ? 81.093  33.615  23.929  1.00 17.39  ? 6847 GLN A OE1   1 
ATOM   440  N  NE2   . GLN A 1 52  ? 80.210  35.306  22.742  1.00 17.62  ? 6847 GLN A NE2   1 
ATOM   441  N  N     . LEU A 1 53  ? 84.603  30.293  20.619  1.00 16.36  ? 6848 LEU A N     1 
ATOM   442  C  CA    . LEU A 1 53  ? 85.990  29.755  20.513  1.00 17.19  ? 6848 LEU A CA    1 
ATOM   443  C  C     . LEU A 1 53  ? 86.452  29.832  19.048  1.00 17.82  ? 6848 LEU A C     1 
ATOM   444  O  O     . LEU A 1 53  ? 87.575  30.317  18.803  1.00 18.66  ? 6848 LEU A O     1 
ATOM   445  C  CB    . LEU A 1 53  ? 86.024  28.315  21.031  1.00 16.99  ? 6848 LEU A CB    1 
ATOM   446  C  CG    . LEU A 1 53  ? 87.347  27.575  20.835  1.00 17.89  ? 6848 LEU A CG    1 
ATOM   447  C  CD1   . LEU A 1 53  ? 88.484  28.299  21.538  1.00 18.06  ? 6848 LEU A CD1   1 
ATOM   448  C  CD2   . LEU A 1 53  ? 87.244  26.138  21.324  1.00 17.66  ? 6848 LEU A CD2   1 
ATOM   449  N  N     . CYS A 1 54  ? 85.612  29.376  18.115  1.00 17.93  ? 6849 CYS A N     1 
ATOM   450  C  CA    . CYS A 1 54  ? 85.960  29.392  16.669  1.00 18.65  ? 6849 CYS A CA    1 
ATOM   451  C  C     . CYS A 1 54  ? 86.110  30.836  16.170  1.00 19.10  ? 6849 CYS A C     1 
ATOM   452  O  O     . CYS A 1 54  ? 87.032  31.096  15.371  1.00 19.48  ? 6849 CYS A O     1 
ATOM   453  C  CB    . CYS A 1 54  ? 84.922  28.618  15.871  1.00 19.31  ? 6849 CYS A CB    1 
ATOM   454  S  SG    . CYS A 1 54  ? 84.972  26.839  16.216  1.00 19.66  ? 6849 CYS A SG    1 
ATOM   455  N  N     . GLN A 1 55  ? 85.243  31.741  16.626  1.00 19.06  ? 6850 GLN A N     1 
ATOM   456  C  CA    . GLN A 1 55  ? 85.357  33.174  16.242  1.00 20.14  ? 6850 GLN A CA    1 
ATOM   457  C  C     . GLN A 1 55  ? 86.721  33.712  16.691  1.00 19.87  ? 6850 GLN A C     1 
ATOM   458  O  O     . GLN A 1 55  ? 87.322  34.512  15.949  1.00 20.41  ? 6850 GLN A O     1 
ATOM   459  C  CB    . GLN A 1 55  ? 84.211  33.990  16.837  1.00 20.43  ? 6850 GLN A CB    1 
ATOM   460  C  CG    . GLN A 1 55  ? 82.884  33.758  16.134  1.00 21.07  ? 6850 GLN A CG    1 
ATOM   461  C  CD    . GLN A 1 55  ? 81.751  34.489  16.808  1.00 21.86  ? 6850 GLN A CD    1 
ATOM   462  O  OE1   . GLN A 1 55  ? 81.731  34.653  18.031  1.00 21.62  ? 6850 GLN A OE1   1 
ATOM   463  N  NE2   . GLN A 1 55  ? 80.798  34.946  16.006  1.00 22.41  ? 6850 GLN A NE2   1 
ATOM   464  N  N     . TYR A 1 56  ? 87.196  33.276  17.856  1.00 19.63  ? 6851 TYR A N     1 
ATOM   465  C  CA    . TYR A 1 56  ? 88.520  33.734  18.342  1.00 19.96  ? 6851 TYR A CA    1 
ATOM   466  C  C     . TYR A 1 56  ? 89.636  33.056  17.530  1.00 20.17  ? 6851 TYR A C     1 
ATOM   467  O  O     . TYR A 1 56  ? 90.591  33.752  17.123  1.00 20.54  ? 6851 TYR A O     1 
ATOM   468  C  CB    . TYR A 1 56  ? 88.674  33.486  19.843  1.00 19.88  ? 6851 TYR A CB    1 
ATOM   469  C  CG    . TYR A 1 56  ? 90.013  33.942  20.353  1.00 20.04  ? 6851 TYR A CG    1 
ATOM   470  C  CD1   . TYR A 1 56  ? 90.311  35.292  20.434  1.00 21.34  ? 6851 TYR A CD1   1 
ATOM   471  C  CD2   . TYR A 1 56  ? 91.003  33.034  20.694  1.00 20.20  ? 6851 TYR A CD2   1 
ATOM   472  C  CE1   . TYR A 1 56  ? 91.552  35.732  20.862  1.00 21.96  ? 6851 TYR A CE1   1 
ATOM   473  C  CE2   . TYR A 1 56  ? 92.246  33.458  21.131  1.00 20.52  ? 6851 TYR A CE2   1 
ATOM   474  C  CZ    . TYR A 1 56  ? 92.522  34.809  21.208  1.00 21.79  ? 6851 TYR A CZ    1 
ATOM   475  O  OH    . TYR A 1 56  ? 93.744  35.233  21.638  1.00 22.89  ? 6851 TYR A OH    1 
ATOM   476  N  N     . LEU A 1 57  ? 89.518  31.748  17.287  1.00 19.76  ? 6852 LEU A N     1 
ATOM   477  C  CA    . LEU A 1 57  ? 90.558  31.026  16.501  1.00 20.55  ? 6852 LEU A CA    1 
ATOM   478  C  C     . LEU A 1 57  ? 90.690  31.656  15.105  1.00 21.38  ? 6852 LEU A C     1 
ATOM   479  O  O     . LEU A 1 57  ? 91.799  31.596  14.542  1.00 21.72  ? 6852 LEU A O     1 
ATOM   480  C  CB    . LEU A 1 57  ? 90.211  29.532  16.445  1.00 20.37  ? 6852 LEU A CB    1 
ATOM   481  C  CG    . LEU A 1 57  ? 90.299  28.785  17.778  1.00 20.18  ? 6852 LEU A CG    1 
ATOM   482  C  CD1   . LEU A 1 57  ? 89.861  27.340  17.625  1.00 19.98  ? 6852 LEU A CD1   1 
ATOM   483  C  CD2   . LEU A 1 57  ? 91.706  28.848  18.363  1.00 21.42  ? 6852 LEU A CD2   1 
ATOM   484  N  N     . ASN A 1 58  ? 89.619  32.273  14.589  1.00 21.69  ? 6853 ASN A N     1 
ATOM   485  C  CA    . ASN A 1 58  ? 89.657  32.948  13.261  1.00 23.00  ? 6853 ASN A CA    1 
ATOM   486  C  C     . ASN A 1 58  ? 90.669  34.104  13.263  1.00 24.54  ? 6853 ASN A C     1 
ATOM   487  O  O     . ASN A 1 58  ? 91.142  34.460  12.174  1.00 25.45  ? 6853 ASN A O     1 
ATOM   488  C  CB    . ASN A 1 58  ? 88.292  33.520  12.867  1.00 23.03  ? 6853 ASN A CB    1 
ATOM   489  C  CG    . ASN A 1 58  ? 87.348  32.488  12.296  1.00 23.35  ? 6853 ASN A CG    1 
ATOM   490  O  OD1   . ASN A 1 58  ? 87.787  31.437  11.840  1.00 23.08  ? 6853 ASN A OD1   1 
ATOM   491  N  ND2   . ASN A 1 58  ? 86.057  32.792  12.291  1.00 22.91  ? 6853 ASN A ND2   1 
ATOM   492  N  N     . THR A 1 59  ? 91.001  34.643  14.440  1.00 23.48  ? 6854 THR A N     1 
ATOM   493  C  CA    . THR A 1 59  ? 91.892  35.830  14.569  1.00 24.73  ? 6854 THR A CA    1 
ATOM   494  C  C     . THR A 1 59  ? 93.359  35.411  14.693  1.00 25.01  ? 6854 THR A C     1 
ATOM   495  O  O     . THR A 1 59  ? 94.219  36.316  14.672  1.00 25.49  ? 6854 THR A O     1 
ATOM   496  C  CB    . THR A 1 59  ? 91.494  36.703  15.768  1.00 25.02  ? 6854 THR A CB    1 
ATOM   497  O  OG1   . THR A 1 59  ? 91.873  36.058  16.987  1.00 23.53  ? 6854 THR A OG1   1 
ATOM   498  C  CG2   . THR A 1 59  ? 90.018  37.037  15.778  1.00 25.29  ? 6854 THR A CG2   1 
ATOM   499  N  N     . LEU A 1 60  ? 93.638  34.107  14.765  1.00 24.40  ? 6855 LEU A N     1 
ATOM   500  C  CA    . LEU A 1 60  ? 95.025  33.610  14.968  1.00 25.88  ? 6855 LEU A CA    1 
ATOM   501  C  C     . LEU A 1 60  ? 95.607  33.124  13.637  1.00 27.73  ? 6855 LEU A C     1 
ATOM   502  O  O     . LEU A 1 60  ? 94.849  33.036  12.650  1.00 31.33  ? 6855 LEU A O     1 
ATOM   503  C  CB    . LEU A 1 60  ? 95.005  32.477  16.000  1.00 25.15  ? 6855 LEU A CB    1 
ATOM   504  C  CG    . LEU A 1 60  ? 94.319  32.798  17.329  1.00 24.41  ? 6855 LEU A CG    1 
ATOM   505  C  CD1   . LEU A 1 60  ? 94.463  31.635  18.295  1.00 24.20  ? 6855 LEU A CD1   1 
ATOM   506  C  CD2   . LEU A 1 60  ? 94.873  34.073  17.949  1.00 25.38  ? 6855 LEU A CD2   1 
ATOM   507  N  N     . THR A 1 61  ? 96.900  32.802  13.628  1.00 27.92  ? 6856 THR A N     1 
ATOM   508  C  CA    . THR A 1 61  ? 97.584  32.318  12.400  1.00 28.83  ? 6856 THR A CA    1 
ATOM   509  C  C     . THR A 1 61  ? 97.461  30.792  12.317  1.00 27.79  ? 6856 THR A C     1 
ATOM   510  O  O     . THR A 1 61  ? 98.505  30.111  12.250  1.00 28.07  ? 6856 THR A O     1 
ATOM   511  C  CB    . THR A 1 61  ? 99.038  32.803  12.371  1.00 30.39  ? 6856 THR A CB    1 
ATOM   512  O  OG1   . THR A 1 61  ? 99.681  32.366  13.569  1.00 30.16  ? 6856 THR A OG1   1 
ATOM   513  C  CG2   . THR A 1 61  ? 99.138  34.308  12.263  1.00 31.93  ? 6856 THR A CG2   1 
ATOM   514  N  N     . LEU A 1 62  ? 96.234  30.267  12.337  1.00 26.97  ? 6857 LEU A N     1 
ATOM   515  C  CA    . LEU A 1 62  ? 96.075  28.796  12.202  1.00 27.15  ? 6857 LEU A CA    1 
ATOM   516  C  C     . LEU A 1 62  ? 96.503  28.360  10.801  1.00 27.48  ? 6857 LEU A C     1 
ATOM   517  O  O     . LEU A 1 62  ? 96.170  29.074  9.837   1.00 27.47  ? 6857 LEU A O     1 
ATOM   518  C  CB    . LEU A 1 62  ? 94.615  28.377  12.397  1.00 28.22  ? 6857 LEU A CB    1 
ATOM   519  C  CG    . LEU A 1 62  ? 94.005  28.584  13.778  1.00 29.71  ? 6857 LEU A CG    1 
ATOM   520  C  CD1   . LEU A 1 62  ? 92.658  27.880  13.848  1.00 29.92  ? 6857 LEU A CD1   1 
ATOM   521  C  CD2   . LEU A 1 62  ? 94.924  28.073  14.875  1.00 30.90  ? 6857 LEU A CD2   1 
ATOM   522  N  N     . ALA A 1 63  ? 97.220  27.238  10.719  1.00 26.80  ? 6858 ALA A N     1 
ATOM   523  C  CA    . ALA A 1 63  ? 97.533  26.604  9.423   1.00 27.72  ? 6858 ALA A CA    1 
ATOM   524  C  C     . ALA A 1 63  ? 96.247  25.908  8.968   1.00 27.08  ? 6858 ALA A C     1 
ATOM   525  O  O     . ALA A 1 63  ? 95.617  25.232  9.813   1.00 25.78  ? 6858 ALA A O     1 
ATOM   526  C  CB    . ALA A 1 63  ? 98.674  25.633  9.576   1.00 28.37  ? 6858 ALA A CB    1 
ATOM   527  N  N     . VAL A 1 64  ? 95.835  26.122  7.718   1.00 27.43  ? 6859 VAL A N     1 
ATOM   528  C  CA    . VAL A 1 64  ? 94.573  25.512  7.211   1.00 27.41  ? 6859 VAL A CA    1 
ATOM   529  C  C     . VAL A 1 64  ? 94.863  24.878  5.856   1.00 28.77  ? 6859 VAL A C     1 
ATOM   530  O  O     . VAL A 1 64  ? 94.625  25.479  4.809   1.00 29.48  ? 6859 VAL A O     1 
ATOM   531  C  CB    . VAL A 1 64  ? 93.435  26.546  7.138   1.00 27.44  ? 6859 VAL A CB    1 
ATOM   532  C  CG1   . VAL A 1 64  ? 92.115  25.891  6.770   1.00 27.45  ? 6859 VAL A CG1   1 
ATOM   533  C  CG2   . VAL A 1 64  ? 93.291  27.321  8.442   1.00 26.61  ? 6859 VAL A CG2   1 
ATOM   534  N  N     . PRO A 1 65  ? 95.440  23.660  5.846   1.00 29.38  ? 6860 PRO A N     1 
ATOM   535  C  CA    . PRO A 1 65  ? 95.738  22.971  4.597   1.00 31.44  ? 6860 PRO A CA    1 
ATOM   536  C  C     . PRO A 1 65  ? 94.486  22.342  3.982   1.00 31.71  ? 6860 PRO A C     1 
ATOM   537  O  O     . PRO A 1 65  ? 93.440  22.318  4.626   1.00 29.08  ? 6860 PRO A O     1 
ATOM   538  C  CB    . PRO A 1 65  ? 96.716  21.868  5.030   1.00 31.44  ? 6860 PRO A CB    1 
ATOM   539  C  CG    . PRO A 1 65  ? 96.338  21.571  6.464   1.00 30.07  ? 6860 PRO A CG    1 
ATOM   540  C  CD    . PRO A 1 65  ? 95.844  22.887  7.029   1.00 28.76  ? 6860 PRO A CD    1 
ATOM   541  N  N     . TYR A 1 66  ? 94.609  21.901  2.730   1.00 33.63  ? 6861 TYR A N     1 
ATOM   542  C  CA    . TYR A 1 66  ? 93.514  21.111  2.125   1.00 34.98  ? 6861 TYR A CA    1 
ATOM   543  C  C     . TYR A 1 66  ? 93.457  19.794  2.894   1.00 34.19  ? 6861 TYR A C     1 
ATOM   544  O  O     . TYR A 1 66  ? 94.522  19.366  3.373   1.00 34.13  ? 6861 TYR A O     1 
ATOM   545  C  CB    . TYR A 1 66  ? 93.774  20.851  0.641   1.00 37.26  ? 6861 TYR A CB    1 
ATOM   546  C  CG    . TYR A 1 66  ? 93.660  22.065  -0.237  1.00 38.87  ? 6861 TYR A CG    1 
ATOM   547  C  CD1   . TYR A 1 66  ? 92.423  22.504  -0.675  1.00 40.20  ? 6861 TYR A CD1   1 
ATOM   548  C  CD2   . TYR A 1 66  ? 94.783  22.757  -0.659  1.00 41.58  ? 6861 TYR A CD2   1 
ATOM   549  C  CE1   . TYR A 1 66  ? 92.300  23.611  -1.499  1.00 42.48  ? 6861 TYR A CE1   1 
ATOM   550  C  CE2   . TYR A 1 66  ? 94.679  23.864  -1.484  1.00 43.37  ? 6861 TYR A CE2   1 
ATOM   551  C  CZ    . TYR A 1 66  ? 93.432  24.296  -1.900  1.00 43.61  ? 6861 TYR A CZ    1 
ATOM   552  O  OH    . TYR A 1 66  ? 93.313  25.385  -2.713  1.00 46.81  ? 6861 TYR A OH    1 
ATOM   553  N  N     . ASN A 1 67  ? 92.275  19.184  3.002   1.00 35.43  ? 6862 ASN A N     1 
ATOM   554  C  CA    . ASN A 1 67  ? 92.137  17.891  3.726   1.00 36.09  ? 6862 ASN A CA    1 
ATOM   555  C  C     . ASN A 1 67  ? 92.735  18.043  5.123   1.00 33.26  ? 6862 ASN A C     1 
ATOM   556  O  O     . ASN A 1 67  ? 93.485  17.152  5.567   1.00 33.06  ? 6862 ASN A O     1 
ATOM   557  C  CB    . ASN A 1 67  ? 92.783  16.746  2.950   1.00 39.49  ? 6862 ASN A CB    1 
ATOM   558  C  CG    . ASN A 1 67  ? 92.192  16.611  1.567   1.00 44.15  ? 6862 ASN A CG    1 
ATOM   559  O  OD1   . ASN A 1 67  ? 90.980  16.724  1.396   1.00 49.93  ? 6862 ASN A OD1   1 
ATOM   560  N  ND2   . ASN A 1 67  ? 93.038  16.380  0.582   1.00 46.26  ? 6862 ASN A ND2   1 
ATOM   561  N  N     . MET A 1 68  ? 92.416  19.163  5.764   1.00 31.14  ? 6863 MET A N     1 
ATOM   562  C  CA    . MET A 1 68  ? 92.868  19.457  7.140   1.00 29.38  ? 6863 MET A CA    1 
ATOM   563  C  C     . MET A 1 68  ? 92.381  18.333  8.068   1.00 28.06  ? 6863 MET A C     1 
ATOM   564  O  O     . MET A 1 68  ? 91.290  17.792  7.826   1.00 29.50  ? 6863 MET A O     1 
ATOM   565  C  CB    . MET A 1 68  ? 92.288  20.801  7.570   1.00 28.85  ? 6863 MET A CB    1 
ATOM   566  C  CG    . MET A 1 68  ? 92.693  21.235  8.935   1.00 28.61  ? 6863 MET A CG    1 
ATOM   567  S  SD    . MET A 1 68  ? 92.015  22.871  9.228   1.00 29.23  ? 6863 MET A SD    1 
ATOM   568  C  CE    . MET A 1 68  ? 92.683  23.205  10.853  1.00 28.06  ? 6863 MET A CE    1 
ATOM   569  N  N     . ARG A 1 69  ? 93.183  17.988  9.071   1.00 27.06  ? 6864 ARG A N     1 
ATOM   570  C  CA    . ARG A 1 69  ? 92.866  16.881  10.008  1.00 25.86  ? 6864 ARG A CA    1 
ATOM   571  C  C     . ARG A 1 69  ? 92.580  17.468  11.387  1.00 23.52  ? 6864 ARG A C     1 
ATOM   572  O  O     . ARG A 1 69  ? 93.509  18.052  11.994  1.00 23.32  ? 6864 ARG A O     1 
ATOM   573  C  CB    . ARG A 1 69  ? 94.035  15.902  10.076  1.00 27.51  ? 6864 ARG A CB    1 
ATOM   574  C  CG    . ARG A 1 69  ? 94.403  15.300  8.731   1.00 29.88  ? 6864 ARG A CG    1 
ATOM   575  C  CD    . ARG A 1 69  ? 95.719  14.583  8.860   1.00 31.98  ? 6864 ARG A CD    1 
ATOM   576  N  NE    . ARG A 1 69  ? 96.052  13.842  7.662   1.00 33.92  ? 6864 ARG A NE    1 
ATOM   577  C  CZ    . ARG A 1 69  ? 97.126  13.081  7.542   1.00 35.74  ? 6864 ARG A CZ    1 
ATOM   578  N  NH1   . ARG A 1 69  ? 97.982  12.979  8.548   1.00 36.65  ? 6864 ARG A NH1   1 
ATOM   579  N  NH2   . ARG A 1 69  ? 97.345  12.436  6.414   1.00 36.87  ? 6864 ARG A NH2   1 
ATOM   580  N  N     . VAL A 1 70  ? 91.350  17.285  11.861  1.00 21.40  ? 6865 VAL A N     1 
ATOM   581  C  CA    . VAL A 1 70  ? 90.934  17.854  13.170  1.00 20.45  ? 6865 VAL A CA    1 
ATOM   582  C  C     . VAL A 1 70  ? 90.406  16.726  14.049  1.00 19.89  ? 6865 VAL A C     1 
ATOM   583  O  O     . VAL A 1 70  ? 89.571  15.936  13.568  1.00 19.97  ? 6865 VAL A O     1 
ATOM   584  C  CB    . VAL A 1 70  ? 89.873  18.952  12.984  1.00 19.93  ? 6865 VAL A CB    1 
ATOM   585  C  CG1   . VAL A 1 70  ? 89.430  19.537  14.317  1.00 19.07  ? 6865 VAL A CG1   1 
ATOM   586  C  CG2   . VAL A 1 70  ? 90.367  20.042  12.045  1.00 21.01  ? 6865 VAL A CG2   1 
ATOM   587  N  N     . ILE A 1 71  ? 90.895  16.657  15.287  1.00 19.35  ? 6866 ILE A N     1 
ATOM   588  C  CA    . ILE A 1 71  ? 90.375  15.642  16.244  1.00 18.92  ? 6866 ILE A CA    1 
ATOM   589  C  C     . ILE A 1 71  ? 89.802  16.395  17.450  1.00 18.15  ? 6866 ILE A C     1 
ATOM   590  O  O     . ILE A 1 71  ? 90.432  17.385  17.927  1.00 17.89  ? 6866 ILE A O     1 
ATOM   591  C  CB    . ILE A 1 71  ? 91.424  14.569  16.596  1.00 19.89  ? 6866 ILE A CB    1 
ATOM   592  C  CG1   . ILE A 1 71  ? 90.795  13.450  17.431  1.00 20.14  ? 6866 ILE A CG1   1 
ATOM   593  C  CG2   . ILE A 1 71  ? 92.644  15.175  17.265  1.00 20.13  ? 6866 ILE A CG2   1 
ATOM   594  C  CD1   . ILE A 1 71  ? 91.601  12.167  17.446  1.00 21.40  ? 6866 ILE A CD1   1 
ATOM   595  N  N     . HIS A 1 72  ? 88.615  15.963  17.866  1.00 17.35  ? 6867 HIS A N     1 
ATOM   596  C  CA    . HIS A 1 72  ? 87.835  16.616  18.940  1.00 17.37  ? 6867 HIS A CA    1 
ATOM   597  C  C     . HIS A 1 72  ? 87.554  15.630  20.080  1.00 17.12  ? 6867 HIS A C     1 
ATOM   598  O  O     . HIS A 1 72  ? 86.718  14.734  19.898  1.00 18.26  ? 6867 HIS A O     1 
ATOM   599  C  CB    . HIS A 1 72  ? 86.578  17.217  18.305  1.00 17.27  ? 6867 HIS A CB    1 
ATOM   600  C  CG    . HIS A 1 72  ? 85.669  17.890  19.274  1.00 17.12  ? 6867 HIS A CG    1 
ATOM   601  N  ND1   . HIS A 1 72  ? 84.299  17.914  19.102  1.00 17.44  ? 6867 HIS A ND1   1 
ATOM   602  C  CD2   . HIS A 1 72  ? 85.920  18.514  20.445  1.00 17.05  ? 6867 HIS A CD2   1 
ATOM   603  C  CE1   . HIS A 1 72  ? 83.752  18.561  20.113  1.00 17.34  ? 6867 HIS A CE1   1 
ATOM   604  N  NE2   . HIS A 1 72  ? 84.723  18.939  20.949  1.00 16.92  ? 6867 HIS A NE2   1 
ATOM   605  N  N     . PHE A 1 73  ? 88.226  15.830  21.216  1.00 17.43  ? 6868 PHE A N     1 
ATOM   606  C  CA    . PHE A 1 73  ? 88.064  14.982  22.423  1.00 17.69  ? 6868 PHE A CA    1 
ATOM   607  C  C     . PHE A 1 73  ? 87.019  15.605  23.350  1.00 17.19  ? 6868 PHE A C     1 
ATOM   608  O  O     . PHE A 1 73  ? 86.913  16.846  23.402  1.00 16.96  ? 6868 PHE A O     1 
ATOM   609  C  CB    . PHE A 1 73  ? 89.400  14.811  23.147  1.00 18.47  ? 6868 PHE A CB    1 
ATOM   610  C  CG    . PHE A 1 73  ? 90.435  14.039  22.370  1.00 19.53  ? 6868 PHE A CG    1 
ATOM   611  C  CD1   . PHE A 1 73  ? 90.387  12.656  22.310  1.00 20.51  ? 6868 PHE A CD1   1 
ATOM   612  C  CD2   . PHE A 1 73  ? 91.467  14.696  21.715  1.00 20.25  ? 6868 PHE A CD2   1 
ATOM   613  C  CE1   . PHE A 1 73  ? 91.345  11.943  21.603  1.00 21.17  ? 6868 PHE A CE1   1 
ATOM   614  C  CE2   . PHE A 1 73  ? 92.428  13.980  21.018  1.00 20.83  ? 6868 PHE A CE2   1 
ATOM   615  C  CZ    . PHE A 1 73  ? 92.363  12.609  20.961  1.00 21.07  ? 6868 PHE A CZ    1 
ATOM   616  N  N     . GLY A 1 74  ? 86.282  14.757  24.071  1.00 17.27  ? 6869 GLY A N     1 
ATOM   617  C  CA    . GLY A 1 74  ? 85.228  15.225  24.988  1.00 17.03  ? 6869 GLY A CA    1 
ATOM   618  C  C     . GLY A 1 74  ? 84.079  15.834  24.214  1.00 17.11  ? 6869 GLY A C     1 
ATOM   619  O  O     . GLY A 1 74  ? 83.538  16.858  24.666  1.00 17.06  ? 6869 GLY A O     1 
ATOM   620  N  N     . ALA A 1 75  ? 83.727  15.221  23.080  1.00 16.96  ? 6870 ALA A N     1 
ATOM   621  C  CA    . ALA A 1 75  ? 82.691  15.747  22.158  1.00 17.41  ? 6870 ALA A CA    1 
ATOM   622  C  C     . ALA A 1 75  ? 81.274  15.318  22.555  1.00 18.59  ? 6870 ALA A C     1 
ATOM   623  O  O     . ALA A 1 75  ? 80.317  15.863  21.976  1.00 19.03  ? 6870 ALA A O     1 
ATOM   624  C  CB    . ALA A 1 75  ? 83.007  15.279  20.762  1.00 17.83  ? 6870 ALA A CB    1 
ATOM   625  N  N     . GLY A 1 76  ? 81.140  14.357  23.467  1.00 19.17  ? 6871 GLY A N     1 
ATOM   626  C  CA    . GLY A 1 76  ? 79.809  13.886  23.882  1.00 20.90  ? 6871 GLY A CA    1 
ATOM   627  C  C     . GLY A 1 76  ? 79.178  14.813  24.907  1.00 22.87  ? 6871 GLY A C     1 
ATOM   628  O  O     . GLY A 1 76  ? 79.782  15.835  25.262  1.00 23.18  ? 6871 GLY A O     1 
ATOM   629  N  N     . SER A 1 77  ? 77.993  14.457  25.380  1.00 24.59  ? 6872 SER A N     1 
ATOM   630  C  CA    . SER A 1 77  ? 77.285  15.293  26.379  1.00 24.94  ? 6872 SER A CA    1 
ATOM   631  C  C     . SER A 1 77  ? 76.206  14.439  27.028  1.00 25.97  ? 6872 SER A C     1 
ATOM   632  O  O     . SER A 1 77  ? 75.895  13.362  26.473  1.00 24.25  ? 6872 SER A O     1 
ATOM   633  C  CB    . SER A 1 77  ? 76.678  16.523  25.753  1.00 25.14  ? 6872 SER A CB    1 
ATOM   634  O  OG    . SER A 1 77  ? 75.586  16.184  24.914  1.00 26.66  ? 6872 SER A OG    1 
ATOM   635  N  N     . ASP A 1 78  ? 75.651  14.928  28.135  1.00 28.20  ? 6873 ASP A N     1 
ATOM   636  C  CA    . ASP A 1 78  ? 74.555  14.211  28.834  1.00 31.81  ? 6873 ASP A CA    1 
ATOM   637  C  C     . ASP A 1 78  ? 73.314  14.215  27.932  1.00 31.88  ? 6873 ASP A C     1 
ATOM   638  O  O     . ASP A 1 78  ? 72.369  13.480  28.243  1.00 34.83  ? 6873 ASP A O     1 
ATOM   639  C  CB    . ASP A 1 78  ? 74.285  14.825  30.212  1.00 35.23  ? 6873 ASP A CB    1 
ATOM   640  C  CG    . ASP A 1 78  ? 73.908  16.298  30.206  1.00 39.11  ? 6873 ASP A CG    1 
ATOM   641  O  OD1   . ASP A 1 78  ? 73.724  16.870  29.108  1.00 40.95  ? 6873 ASP A OD1   1 
ATOM   642  O  OD2   . ASP A 1 78  ? 73.803  16.869  31.312  1.00 46.30  ? 6873 ASP A OD2   1 
ATOM   643  N  N     . LYS A 1 79  ? 73.342  14.996  26.845  1.00 30.73  ? 6874 LYS A N     1 
ATOM   644  C  CA    . LYS A 1 79  ? 72.203  15.095  25.888  1.00 31.23  ? 6874 LYS A CA    1 
ATOM   645  C  C     . LYS A 1 79  ? 72.276  13.956  24.857  1.00 29.40  ? 6874 LYS A C     1 
ATOM   646  O  O     . LYS A 1 79  ? 71.285  13.762  24.134  1.00 30.49  ? 6874 LYS A O     1 
ATOM   647  C  CB    . LYS A 1 79  ? 72.240  16.432  25.135  1.00 32.76  ? 6874 LYS A CB    1 
ATOM   648  C  CG    . LYS A 1 79  ? 72.205  17.702  25.980  1.00 35.20  ? 6874 LYS A CG    1 
ATOM   649  C  CD    . LYS A 1 79  ? 72.347  18.959  25.135  1.00 37.22  ? 6874 LYS A CD    1 
ATOM   650  C  CE    . LYS A 1 79  ? 72.430  20.242  25.938  1.00 39.23  ? 6874 LYS A CE    1 
ATOM   651  N  NZ    . LYS A 1 79  ? 71.192  20.494  26.711  1.00 42.29  ? 6874 LYS A NZ    1 
ATOM   652  N  N     . GLY A 1 80  ? 73.417  13.263  24.765  1.00 25.84  ? 6875 GLY A N     1 
ATOM   653  C  CA    . GLY A 1 80  ? 73.611  12.177  23.784  1.00 25.45  ? 6875 GLY A CA    1 
ATOM   654  C  C     . GLY A 1 80  ? 73.902  12.704  22.383  1.00 24.06  ? 6875 GLY A C     1 
ATOM   655  O  O     . GLY A 1 80  ? 73.891  11.891  21.433  1.00 24.20  ? 6875 GLY A O     1 
ATOM   656  N  N     . VAL A 1 81  ? 74.144  14.013  22.259  1.00 22.29  ? 6876 VAL A N     1 
ATOM   657  C  CA    . VAL A 1 81  ? 74.469  14.665  20.953  1.00 22.00  ? 6876 VAL A CA    1 
ATOM   658  C  C     . VAL A 1 81  ? 75.795  15.428  21.117  1.00 21.25  ? 6876 VAL A C     1 
ATOM   659  O  O     . VAL A 1 81  ? 76.322  15.467  22.243  1.00 21.59  ? 6876 VAL A O     1 
ATOM   660  C  CB    . VAL A 1 81  ? 73.312  15.562  20.468  1.00 22.18  ? 6876 VAL A CB    1 
ATOM   661  C  CG1   . VAL A 1 81  ? 72.070  14.739  20.154  1.00 24.01  ? 6876 VAL A CG1   1 
ATOM   662  C  CG2   . VAL A 1 81  ? 72.979  16.662  21.461  1.00 22.21  ? 6876 VAL A CG2   1 
ATOM   663  N  N     . ALA A 1 82  ? 76.315  16.008  20.034  1.00 20.51  ? 6877 ALA A N     1 
ATOM   664  C  CA    . ALA A 1 82  ? 77.632  16.685  20.053  1.00 19.64  ? 6877 ALA A CA    1 
ATOM   665  C  C     . ALA A 1 82  ? 77.495  18.103  19.508  1.00 19.52  ? 6877 ALA A C     1 
ATOM   666  O  O     . ALA A 1 82  ? 77.779  18.352  18.335  1.00 18.58  ? 6877 ALA A O     1 
ATOM   667  C  CB    . ALA A 1 82  ? 78.610  15.870  19.244  1.00 19.94  ? 6877 ALA A CB    1 
ATOM   668  N  N     . PRO A 1 83  ? 77.021  19.059  20.338  1.00 19.47  ? 6878 PRO A N     1 
ATOM   669  C  CA    . PRO A 1 83  ? 76.855  20.446  19.907  1.00 19.74  ? 6878 PRO A CA    1 
ATOM   670  C  C     . PRO A 1 83  ? 78.172  21.049  19.391  1.00 18.59  ? 6878 PRO A C     1 
ATOM   671  O  O     . PRO A 1 83  ? 78.173  21.657  18.325  1.00 18.18  ? 6878 PRO A O     1 
ATOM   672  C  CB    . PRO A 1 83  ? 76.361  21.169  21.172  1.00 20.54  ? 6878 PRO A CB    1 
ATOM   673  C  CG    . PRO A 1 83  ? 75.766  20.079  22.030  1.00 21.42  ? 6878 PRO A CG    1 
ATOM   674  C  CD    . PRO A 1 83  ? 76.579  18.840  21.725  1.00 20.49  ? 6878 PRO A CD    1 
ATOM   675  N  N     . GLY A 1 84  ? 79.266  20.846  20.135  1.00 17.78  ? 6879 GLY A N     1 
ATOM   676  C  CA    . GLY A 1 84  ? 80.577  21.373  19.718  1.00 17.47  ? 6879 GLY A CA    1 
ATOM   677  C  C     . GLY A 1 84  ? 81.008  20.808  18.376  1.00 17.52  ? 6879 GLY A C     1 
ATOM   678  O  O     . GLY A 1 84  ? 81.508  21.583  17.534  1.00 17.17  ? 6879 GLY A O     1 
ATOM   679  N  N     . THR A 1 85  ? 80.803  19.506  18.157  1.00 17.24  ? 6880 THR A N     1 
ATOM   680  C  CA    . THR A 1 85  ? 81.201  18.918  16.851  1.00 17.70  ? 6880 THR A CA    1 
ATOM   681  C  C     . THR A 1 85  ? 80.384  19.569  15.732  1.00 18.23  ? 6880 THR A C     1 
ATOM   682  O  O     . THR A 1 85  ? 80.954  19.823  14.668  1.00 18.83  ? 6880 THR A O     1 
ATOM   683  C  CB    . THR A 1 85  ? 81.022  17.397  16.829  1.00 18.19  ? 6880 THR A CB    1 
ATOM   684  O  OG1   . THR A 1 85  ? 81.972  16.827  17.727  1.00 18.63  ? 6880 THR A OG1   1 
ATOM   685  C  CG2   . THR A 1 85  ? 81.220  16.806  15.452  1.00 18.94  ? 6880 THR A CG2   1 
ATOM   686  N  N     . ALA A 1 86  ? 79.091  19.801  15.963  1.00 18.25  ? 6881 ALA A N     1 
ATOM   687  C  CA    . ALA A 1 86  ? 78.246  20.450  14.934  1.00 18.95  ? 6881 ALA A CA    1 
ATOM   688  C  C     . ALA A 1 86  ? 78.822  21.837  14.601  1.00 18.69  ? 6881 ALA A C     1 
ATOM   689  O  O     . ALA A 1 86  ? 78.852  22.207  13.401  1.00 19.15  ? 6881 ALA A O     1 
ATOM   690  C  CB    . ALA A 1 86  ? 76.820  20.519  15.422  1.00 19.28  ? 6881 ALA A CB    1 
ATOM   691  N  N     . VAL A 1 87  ? 79.282  22.579  15.611  1.00 18.16  ? 6882 VAL A N     1 
ATOM   692  C  CA    . VAL A 1 87  ? 79.879  23.923  15.350  1.00 18.19  ? 6882 VAL A CA    1 
ATOM   693  C  C     . VAL A 1 87  ? 81.208  23.747  14.599  1.00 18.37  ? 6882 VAL A C     1 
ATOM   694  O  O     . VAL A 1 87  ? 81.444  24.510  13.639  1.00 18.44  ? 6882 VAL A O     1 
ATOM   695  C  CB    . VAL A 1 87  ? 80.068  24.724  16.653  1.00 17.63  ? 6882 VAL A CB    1 
ATOM   696  C  CG1   . VAL A 1 87  ? 80.850  26.005  16.421  1.00 18.05  ? 6882 VAL A CG1   1 
ATOM   697  C  CG2   . VAL A 1 87  ? 78.734  25.020  17.323  1.00 17.40  ? 6882 VAL A CG2   1 
ATOM   698  N  N     . LEU A 1 88  ? 82.047  22.787  15.009  1.00 18.01  ? 6883 LEU A N     1 
ATOM   699  C  CA    . LEU A 1 88  ? 83.352  22.603  14.307  1.00 18.82  ? 6883 LEU A CA    1 
ATOM   700  C  C     . LEU A 1 88  ? 83.103  22.246  12.836  1.00 20.12  ? 6883 LEU A C     1 
ATOM   701  O  O     . LEU A 1 88  ? 83.843  22.742  11.968  1.00 20.68  ? 6883 LEU A O     1 
ATOM   702  C  CB    . LEU A 1 88  ? 84.189  21.522  15.001  1.00 18.60  ? 6883 LEU A CB    1 
ATOM   703  C  CG    . LEU A 1 88  ? 84.706  21.862  16.398  1.00 18.22  ? 6883 LEU A CG    1 
ATOM   704  C  CD1   . LEU A 1 88  ? 85.405  20.668  17.022  1.00 18.58  ? 6883 LEU A CD1   1 
ATOM   705  C  CD2   . LEU A 1 88  ? 85.644  23.055  16.361  1.00 18.80  ? 6883 LEU A CD2   1 
ATOM   706  N  N     A ARG A 1 89  ? 82.098  21.399  12.575  0.50 20.71  ? 6884 ARG A N     1 
ATOM   707  N  N     B ARG A 1 89  ? 82.088  21.413  12.586  0.50 20.87  ? 6884 ARG A N     1 
ATOM   708  C  CA    A ARG A 1 89  ? 81.745  20.967  11.191  0.50 22.17  ? 6884 ARG A CA    1 
ATOM   709  C  CA    B ARG A 1 89  ? 81.714  20.961  11.219  0.50 22.44  ? 6884 ARG A CA    1 
ATOM   710  C  C     A ARG A 1 89  ? 81.283  22.189  10.387  0.50 22.21  ? 6884 ARG A C     1 
ATOM   711  C  C     B ARG A 1 89  ? 81.272  22.177  10.395  0.50 22.37  ? 6884 ARG A C     1 
ATOM   712  O  O     A ARG A 1 89  ? 81.576  22.253  9.179   0.50 22.87  ? 6884 ARG A O     1 
ATOM   713  O  O     B ARG A 1 89  ? 81.570  22.226  9.187   0.50 23.04  ? 6884 ARG A O     1 
ATOM   714  C  CB    A ARG A 1 89  ? 80.652  19.893  11.240  0.50 23.26  ? 6884 ARG A CB    1 
ATOM   715  C  CB    B ARG A 1 89  ? 80.597  19.919  11.337  0.50 23.74  ? 6884 ARG A CB    1 
ATOM   716  C  CG    A ARG A 1 89  ? 80.138  19.433  9.882   0.50 25.71  ? 6884 ARG A CG    1 
ATOM   717  C  CG    B ARG A 1 89  ? 80.220  19.219  10.042  0.50 26.33  ? 6884 ARG A CG    1 
ATOM   718  C  CD    A ARG A 1 89  ? 81.020  18.383  9.238   0.50 27.09  ? 6884 ARG A CD    1 
ATOM   719  C  CD    B ARG A 1 89  ? 81.315  18.264  9.640   0.50 27.72  ? 6884 ARG A CD    1 
ATOM   720  N  NE    A ARG A 1 89  ? 82.369  18.877  9.020   0.50 27.90  ? 6884 ARG A NE    1 
ATOM   721  N  NE    B ARG A 1 89  ? 80.903  17.285  8.651   0.50 29.17  ? 6884 ARG A NE    1 
ATOM   722  C  CZ    A ARG A 1 89  ? 83.401  18.115  8.685   0.50 28.51  ? 6884 ARG A CZ    1 
ATOM   723  C  CZ    B ARG A 1 89  ? 81.698  16.321  8.220   0.50 31.06  ? 6884 ARG A CZ    1 
ATOM   724  N  NH1   A ARG A 1 89  ? 83.239  16.813  8.538   0.50 28.97  ? 6884 ARG A NH1   1 
ATOM   725  N  NH1   B ARG A 1 89  ? 81.274  15.450  7.320   0.50 32.24  ? 6884 ARG A NH1   1 
ATOM   726  N  NH2   A ARG A 1 89  ? 84.594  18.656  8.520   0.50 28.31  ? 6884 ARG A NH2   1 
ATOM   727  N  NH2   B ARG A 1 89  ? 82.925  16.238  8.704   0.50 31.26  ? 6884 ARG A NH2   1 
ATOM   728  N  N     . GLN A 1 90  ? 80.592  23.125  11.043  1.00 21.52  ? 6885 GLN A N     1 
ATOM   729  C  CA    . GLN A 1 90  ? 80.106  24.360  10.372  1.00 21.73  ? 6885 GLN A CA    1 
ATOM   730  C  C     . GLN A 1 90  ? 81.290  25.290  10.063  1.00 21.50  ? 6885 GLN A C     1 
ATOM   731  O  O     . GLN A 1 90  ? 81.332  25.889  8.979   1.00 21.36  ? 6885 GLN A O     1 
ATOM   732  C  CB    . GLN A 1 90  ? 79.116  25.060  11.303  1.00 21.30  ? 6885 GLN A CB    1 
ATOM   733  C  CG    . GLN A 1 90  ? 78.680  26.430  10.822  1.00 21.94  ? 6885 GLN A CG    1 
ATOM   734  C  CD    . GLN A 1 90  ? 77.811  27.137  11.832  1.00 21.87  ? 6885 GLN A CD    1 
ATOM   735  O  OE1   . GLN A 1 90  ? 77.687  26.712  12.977  1.00 22.09  ? 6885 GLN A OE1   1 
ATOM   736  N  NE2   . GLN A 1 90  ? 77.213  28.238  11.409  1.00 22.23  ? 6885 GLN A NE2   1 
ATOM   737  N  N     . TRP A 1 91  ? 82.220  25.380  11.007  1.00 20.18  ? 6886 TRP A N     1 
ATOM   738  C  CA    . TRP A 1 91  ? 83.390  26.296  10.959  1.00 20.38  ? 6886 TRP A CA    1 
ATOM   739  C  C     . TRP A 1 91  ? 84.458  25.844  9.956   1.00 21.04  ? 6886 TRP A C     1 
ATOM   740  O  O     . TRP A 1 91  ? 84.923  26.683  9.157   1.00 21.58  ? 6886 TRP A O     1 
ATOM   741  C  CB    . TRP A 1 91  ? 83.966  26.369  12.377  1.00 19.61  ? 6886 TRP A CB    1 
ATOM   742  C  CG    . TRP A 1 91  ? 85.172  27.236  12.527  1.00 19.56  ? 6886 TRP A CG    1 
ATOM   743  C  CD1   . TRP A 1 91  ? 85.258  28.572  12.268  1.00 20.38  ? 6886 TRP A CD1   1 
ATOM   744  C  CD2   . TRP A 1 91  ? 86.442  26.852  13.083  1.00 19.72  ? 6886 TRP A CD2   1 
ATOM   745  N  NE1   . TRP A 1 91  ? 86.507  29.033  12.578  1.00 20.33  ? 6886 TRP A NE1   1 
ATOM   746  C  CE2   . TRP A 1 91  ? 87.254  28.005  13.082  1.00 19.98  ? 6886 TRP A CE2   1 
ATOM   747  C  CE3   . TRP A 1 91  ? 86.974  25.654  13.571  1.00 19.47  ? 6886 TRP A CE3   1 
ATOM   748  C  CZ2   . TRP A 1 91  ? 88.566  27.992  13.552  1.00 20.32  ? 6886 TRP A CZ2   1 
ATOM   749  C  CZ3   . TRP A 1 91  ? 88.274  25.641  14.029  1.00 19.88  ? 6886 TRP A CZ3   1 
ATOM   750  C  CH2   . TRP A 1 91  ? 89.059  26.794  14.011  1.00 20.05  ? 6886 TRP A CH2   1 
ATOM   751  N  N     . LEU A 1 92  ? 84.833  24.567  10.013  1.00 21.58  ? 6887 LEU A N     1 
ATOM   752  C  CA    . LEU A 1 92  ? 85.955  24.038  9.194   1.00 22.27  ? 6887 LEU A CA    1 
ATOM   753  C  C     . LEU A 1 92  ? 85.600  23.992  7.713   1.00 24.27  ? 6887 LEU A C     1 
ATOM   754  O  O     . LEU A 1 92  ? 84.461  23.729  7.331   1.00 25.13  ? 6887 LEU A O     1 
ATOM   755  C  CB    . LEU A 1 92  ? 86.331  22.654  9.720   1.00 21.48  ? 6887 LEU A CB    1 
ATOM   756  C  CG    . LEU A 1 92  ? 86.872  22.637  11.148  1.00 20.89  ? 6887 LEU A CG    1 
ATOM   757  C  CD1   . LEU A 1 92  ? 86.837  21.230  11.716  1.00 20.84  ? 6887 LEU A CD1   1 
ATOM   758  C  CD2   . LEU A 1 92  ? 88.276  23.220  11.207  1.00 20.84  ? 6887 LEU A CD2   1 
ATOM   759  N  N     . PRO A 1 93  ? 86.592  24.235  6.834   1.00 26.01  ? 6888 PRO A N     1 
ATOM   760  C  CA    . PRO A 1 93  ? 86.362  24.185  5.393   1.00 27.82  ? 6888 PRO A CA    1 
ATOM   761  C  C     . PRO A 1 93  ? 85.821  22.821  4.937   1.00 29.10  ? 6888 PRO A C     1 
ATOM   762  O  O     . PRO A 1 93  ? 86.192  21.807  5.515   1.00 27.78  ? 6888 PRO A O     1 
ATOM   763  C  CB    . PRO A 1 93  ? 87.752  24.408  4.780   1.00 29.04  ? 6888 PRO A CB    1 
ATOM   764  C  CG    . PRO A 1 93  ? 88.582  25.033  5.871   1.00 28.03  ? 6888 PRO A CG    1 
ATOM   765  C  CD    . PRO A 1 93  ? 87.985  24.560  7.178   1.00 26.01  ? 6888 PRO A CD    1 
ATOM   766  N  N     . THR A 1 94  ? 84.961  22.822  3.915   1.00 32.00  ? 6889 THR A N     1 
ATOM   767  C  CA    . THR A 1 94  ? 84.442  21.544  3.360   1.00 33.56  ? 6889 THR A CA    1 
ATOM   768  C  C     . THR A 1 94  ? 85.661  20.705  2.955   1.00 32.90  ? 6889 THR A C     1 
ATOM   769  O  O     . THR A 1 94  ? 86.635  21.292  2.438   1.00 33.87  ? 6889 THR A O     1 
ATOM   770  C  CB    . THR A 1 94  ? 83.462  21.807  2.208   1.00 38.03  ? 6889 THR A CB    1 
ATOM   771  O  OG1   . THR A 1 94  ? 82.473  22.729  2.671   1.00 40.78  ? 6889 THR A OG1   1 
ATOM   772  C  CG2   . THR A 1 94  ? 82.787  20.551  1.703   1.00 39.02  ? 6889 THR A CG2   1 
ATOM   773  N  N     . GLY A 1 95  ? 85.635  19.399  3.226   1.00 32.22  ? 6890 GLY A N     1 
ATOM   774  C  CA    . GLY A 1 95  ? 86.781  18.527  2.900   1.00 32.21  ? 6890 GLY A CA    1 
ATOM   775  C  C     . GLY A 1 95  ? 87.644  18.268  4.124   1.00 30.51  ? 6890 GLY A C     1 
ATOM   776  O  O     . GLY A 1 95  ? 88.467  17.331  4.094   1.00 30.33  ? 6890 GLY A O     1 
ATOM   777  N  N     . THR A 1 96  ? 87.479  19.084  5.164   1.00 27.87  ? 6891 THR A N     1 
ATOM   778  C  CA    . THR A 1 96  ? 88.253  18.867  6.410   1.00 26.84  ? 6891 THR A CA    1 
ATOM   779  C  C     . THR A 1 96  ? 87.832  17.535  7.031   1.00 26.21  ? 6891 THR A C     1 
ATOM   780  O  O     . THR A 1 96  ? 86.616  17.271  7.120   1.00 25.54  ? 6891 THR A O     1 
ATOM   781  C  CB    . THR A 1 96  ? 88.033  20.001  7.416   1.00 25.64  ? 6891 THR A CB    1 
ATOM   782  O  OG1   . THR A 1 96  ? 88.498  21.218  6.833   1.00 25.97  ? 6891 THR A OG1   1 
ATOM   783  C  CG2   . THR A 1 96  ? 88.749  19.768  8.726   1.00 25.14  ? 6891 THR A CG2   1 
ATOM   784  N  N     A LEU A 1 97  ? 88.809  16.704  7.406   0.50 25.98  ? 6892 LEU A N     1 
ATOM   785  N  N     B LEU A 1 97  ? 88.812  16.731  7.444   0.50 26.74  ? 6892 LEU A N     1 
ATOM   786  C  CA    A LEU A 1 97  ? 88.501  15.422  8.092   0.50 25.51  ? 6892 LEU A CA    1 
ATOM   787  C  CA    B LEU A 1 97  ? 88.522  15.429  8.091   0.50 26.81  ? 6892 LEU A CA    1 
ATOM   788  C  C     A LEU A 1 97  ? 88.327  15.730  9.582   0.50 24.15  ? 6892 LEU A C     1 
ATOM   789  C  C     B LEU A 1 97  ? 88.342  15.696  9.590   0.50 24.90  ? 6892 LEU A C     1 
ATOM   790  O  O     A LEU A 1 97  ? 89.269  16.285  10.181  0.50 23.74  ? 6892 LEU A O     1 
ATOM   791  O  O     B LEU A 1 97  ? 89.308  16.175  10.216  0.50 24.57  ? 6892 LEU A O     1 
ATOM   792  C  CB    A LEU A 1 97  ? 89.621  14.408  7.844   0.50 26.65  ? 6892 LEU A CB    1 
ATOM   793  C  CB    B LEU A 1 97  ? 89.684  14.474  7.813   0.50 29.06  ? 6892 LEU A CB    1 
ATOM   794  C  CG    A LEU A 1 97  ? 89.800  13.983  6.387   0.50 28.21  ? 6892 LEU A CG    1 
ATOM   795  C  CG    B LEU A 1 97  ? 89.307  12.999  7.748   0.50 30.98  ? 6892 LEU A CG    1 
ATOM   796  C  CD1   A LEU A 1 97  ? 90.918  12.962  6.249   0.50 29.28  ? 6892 LEU A CD1   1 
ATOM   797  C  CD1   B LEU A 1 97  ? 88.293  12.761  6.637   0.50 32.21  ? 6892 LEU A CD1   1 
ATOM   798  C  CD2   A LEU A 1 97  ? 88.503  13.426  5.825   0.50 29.21  ? 6892 LEU A CD2   1 
ATOM   799  C  CD2   B LEU A 1 97  ? 90.539  12.135  7.533   0.50 32.38  ? 6892 LEU A CD2   1 
ATOM   800  N  N     . LEU A 1 98  ? 87.147  15.423  10.125  1.00 23.15  ? 6893 LEU A N     1 
ATOM   801  C  CA    . LEU A 1 98  ? 86.826  15.701  11.550  1.00 21.91  ? 6893 LEU A CA    1 
ATOM   802  C  C     . LEU A 1 98  ? 86.512  14.392  12.269  1.00 21.12  ? 6893 LEU A C     1 
ATOM   803  O  O     . LEU A 1 98  ? 85.567  13.681  11.860  1.00 21.77  ? 6893 LEU A O     1 
ATOM   804  C  CB    . LEU A 1 98  ? 85.639  16.668  11.609  1.00 21.93  ? 6893 LEU A CB    1 
ATOM   805  C  CG    . LEU A 1 98  ? 85.123  17.038  12.999  1.00 21.13  ? 6893 LEU A CG    1 
ATOM   806  C  CD1   . LEU A 1 98  ? 86.202  17.697  13.847  1.00 20.70  ? 6893 LEU A CD1   1 
ATOM   807  C  CD2   . LEU A 1 98  ? 83.911  17.953  12.873  1.00 21.60  ? 6893 LEU A CD2   1 
ATOM   808  N  N     . VAL A 1 99  ? 87.296  14.104  13.302  1.00 20.65  ? 6894 VAL A N     1 
ATOM   809  C  CA    . VAL A 1 99  ? 87.120  12.882  14.129  1.00 20.07  ? 6894 VAL A CA    1 
ATOM   810  C  C     . VAL A 1 99  ? 86.777  13.351  15.539  1.00 19.54  ? 6894 VAL A C     1 
ATOM   811  O  O     . VAL A 1 99  ? 87.395  14.333  15.999  1.00 18.49  ? 6894 VAL A O     1 
ATOM   812  C  CB    . VAL A 1 99  ? 88.388  12.008  14.108  1.00 20.74  ? 6894 VAL A CB    1 
ATOM   813  C  CG1   . VAL A 1 99  ? 88.346  10.923  15.174  1.00 21.35  ? 6894 VAL A CG1   1 
ATOM   814  C  CG2   . VAL A 1 99  ? 88.623  11.412  12.730  1.00 22.10  ? 6894 VAL A CG2   1 
ATOM   815  N  N     . ASP A 1 100 ? 85.815  12.701  16.185  1.00 19.32  ? 6895 ASP A N     1 
ATOM   816  C  CA    . ASP A 1 100 ? 85.513  13.116  17.574  1.00 18.96  ? 6895 ASP A CA    1 
ATOM   817  C  C     . ASP A 1 100 ? 85.477  11.876  18.464  1.00 19.41  ? 6895 ASP A C     1 
ATOM   818  O  O     . ASP A 1 100 ? 85.489  10.728  17.948  1.00 19.66  ? 6895 ASP A O     1 
ATOM   819  C  CB    . ASP A 1 100 ? 84.294  14.037  17.668  1.00 19.17  ? 6895 ASP A CB    1 
ATOM   820  C  CG    . ASP A 1 100 ? 82.969  13.412  17.306  1.00 19.89  ? 6895 ASP A CG    1 
ATOM   821  O  OD1   . ASP A 1 100 ? 82.941  12.189  17.015  1.00 20.82  ? 6895 ASP A OD1   1 
ATOM   822  O  OD2   . ASP A 1 100 ? 81.970  14.165  17.307  1.00 20.43  ? 6895 ASP A OD2   1 
ATOM   823  N  N     . SER A 1 101 ? 85.438  12.118  19.770  1.00 19.12  ? 6896 SER A N     1 
ATOM   824  C  CA    . SER A 1 101 ? 85.557  11.010  20.730  1.00 19.87  ? 6896 SER A CA    1 
ATOM   825  C  C     . SER A 1 101 ? 84.996  11.427  22.084  1.00 19.56  ? 6896 SER A C     1 
ATOM   826  O  O     . SER A 1 101 ? 84.954  12.647  22.377  1.00 19.22  ? 6896 SER A O     1 
ATOM   827  C  CB    . SER A 1 101 ? 87.003  10.614  20.843  1.00 21.32  ? 6896 SER A CB    1 
ATOM   828  O  OG    . SER A 1 101 ? 87.141  9.391   21.552  1.00 24.55  ? 6896 SER A OG    1 
ATOM   829  N  N     . ASP A 1 102 ? 84.568  10.435  22.850  1.00 19.74  ? 6897 ASP A N     1 
ATOM   830  C  CA    . ASP A 1 102 ? 84.070  10.663  24.227  1.00 20.52  ? 6897 ASP A CA    1 
ATOM   831  C  C     . ASP A 1 102 ? 84.036  9.316   24.937  1.00 21.00  ? 6897 ASP A C     1 
ATOM   832  O  O     . ASP A 1 102 ? 83.954  8.277   24.260  1.00 20.92  ? 6897 ASP A O     1 
ATOM   833  C  CB    . ASP A 1 102 ? 82.689  11.320  24.253  1.00 20.72  ? 6897 ASP A CB    1 
ATOM   834  C  CG    . ASP A 1 102 ? 82.355  11.967  25.587  1.00 21.70  ? 6897 ASP A CG    1 
ATOM   835  O  OD1   . ASP A 1 102 ? 81.967  11.236  26.536  1.00 22.99  ? 6897 ASP A OD1   1 
ATOM   836  O  OD2   . ASP A 1 102 ? 82.544  13.193  25.690  1.00 20.88  ? 6897 ASP A OD2   1 
ATOM   837  N  N     . LEU A 1 103 ? 84.094  9.364   26.259  1.00 21.96  ? 6898 LEU A N     1 
ATOM   838  C  CA    . LEU A 1 103 ? 84.006  8.159   27.114  1.00 23.73  ? 6898 LEU A CA    1 
ATOM   839  C  C     . LEU A 1 103 ? 82.629  7.509   26.923  1.00 23.71  ? 6898 LEU A C     1 
ATOM   840  O  O     . LEU A 1 103 ? 82.548  6.269   26.924  1.00 23.16  ? 6898 LEU A O     1 
ATOM   841  C  CB    . LEU A 1 103 ? 84.195  8.647   28.554  1.00 25.21  ? 6898 LEU A CB    1 
ATOM   842  C  CG    . LEU A 1 103 ? 84.152  7.599   29.657  1.00 28.52  ? 6898 LEU A CG    1 
ATOM   843  C  CD1   . LEU A 1 103 ? 85.289  6.600   29.506  1.00 30.21  ? 6898 LEU A CD1   1 
ATOM   844  C  CD2   . LEU A 1 103 ? 84.213  8.276   31.021  1.00 29.92  ? 6898 LEU A CD2   1 
ATOM   845  N  N     . ASN A 1 104 ? 81.600  8.336   26.726  1.00 23.38  ? 6899 ASN A N     1 
ATOM   846  C  CA    . ASN A 1 104 ? 80.185  7.886   26.659  1.00 24.93  ? 6899 ASN A CA    1 
ATOM   847  C  C     . ASN A 1 104 ? 79.637  7.985   25.234  1.00 25.09  ? 6899 ASN A C     1 
ATOM   848  O  O     . ASN A 1 104 ? 80.053  8.882   24.484  1.00 23.11  ? 6899 ASN A O     1 
ATOM   849  C  CB    . ASN A 1 104 ? 79.331  8.706   27.624  1.00 26.11  ? 6899 ASN A CB    1 
ATOM   850  C  CG    . ASN A 1 104 ? 79.841  8.616   29.044  1.00 27.08  ? 6899 ASN A CG    1 
ATOM   851  O  OD1   . ASN A 1 104 ? 80.112  7.523   29.535  1.00 27.27  ? 6899 ASN A OD1   1 
ATOM   852  N  ND2   . ASN A 1 104 ? 79.987  9.758   29.699  1.00 27.26  ? 6899 ASN A ND2   1 
ATOM   853  N  N     A ASP A 1 105 ? 78.714  7.082   24.893  0.60 25.80  ? 6900 ASP A N     1 
ATOM   854  N  N     B ASP A 1 105 ? 78.697  7.089   24.906  0.40 25.87  ? 6900 ASP A N     1 
ATOM   855  C  CA    A ASP A 1 105 ? 78.126  7.031   23.530  0.60 26.41  ? 6900 ASP A CA    1 
ATOM   856  C  CA    B ASP A 1 105 ? 78.028  7.030   23.578  0.40 26.46  ? 6900 ASP A CA    1 
ATOM   857  C  C     A ASP A 1 105 ? 77.364  8.334   23.243  0.60 25.34  ? 6900 ASP A C     1 
ATOM   858  C  C     B ASP A 1 105 ? 77.349  8.365   23.255  0.40 25.26  ? 6900 ASP A C     1 
ATOM   859  O  O     A ASP A 1 105 ? 76.789  8.922   24.181  0.60 25.47  ? 6900 ASP A O     1 
ATOM   860  O  O     B ASP A 1 105 ? 76.816  9.006   24.184  0.40 25.13  ? 6900 ASP A O     1 
ATOM   861  C  CB    A ASP A 1 105 ? 77.235  5.795   23.379  0.60 29.03  ? 6900 ASP A CB    1 
ATOM   862  C  CB    B ASP A 1 105 ? 76.965  5.926   23.540  0.40 28.85  ? 6900 ASP A CB    1 
ATOM   863  C  CG    A ASP A 1 105 ? 76.888  5.458   21.941  0.60 30.11  ? 6900 ASP A CG    1 
ATOM   864  C  CG    B ASP A 1 105 ? 77.524  4.516   23.543  0.40 30.46  ? 6900 ASP A CG    1 
ATOM   865  O  OD1   A ASP A 1 105 ? 77.591  5.947   21.039  0.60 30.06  ? 6900 ASP A OD1   1 
ATOM   866  O  OD1   B ASP A 1 105 ? 78.623  4.325   22.992  0.40 31.69  ? 6900 ASP A OD1   1 
ATOM   867  O  OD2   A ASP A 1 105 ? 75.915  4.707   21.736  0.60 34.61  ? 6900 ASP A OD2   1 
ATOM   868  O  OD2   B ASP A 1 105 ? 76.852  3.620   24.094  0.40 32.84  ? 6900 ASP A OD2   1 
ATOM   869  N  N     . PHE A 1 106 ? 77.395  8.773   21.985  1.00 24.18  ? 6901 PHE A N     1 
ATOM   870  C  CA    . PHE A 1 106 ? 76.693  10.001  21.542  1.00 23.15  ? 6901 PHE A CA    1 
ATOM   871  C  C     . PHE A 1 106 ? 76.542  9.945   20.023  1.00 23.76  ? 6901 PHE A C     1 
ATOM   872  O  O     . PHE A 1 106 ? 77.249  9.152   19.373  1.00 24.27  ? 6901 PHE A O     1 
ATOM   873  C  CB    . PHE A 1 106 ? 77.436  11.265  21.983  1.00 21.74  ? 6901 PHE A CB    1 
ATOM   874  C  CG    . PHE A 1 106 ? 78.788  11.468  21.348  1.00 20.78  ? 6901 PHE A CG    1 
ATOM   875  C  CD1   . PHE A 1 106 ? 79.896  10.776  21.805  1.00 20.89  ? 6901 PHE A CD1   1 
ATOM   876  C  CD2   . PHE A 1 106 ? 78.957  12.366  20.306  1.00 20.63  ? 6901 PHE A CD2   1 
ATOM   877  C  CE1   . PHE A 1 106 ? 81.142  10.965  21.230  1.00 20.24  ? 6901 PHE A CE1   1 
ATOM   878  C  CE2   . PHE A 1 106 ? 80.205  12.558  19.734  1.00 19.84  ? 6901 PHE A CE2   1 
ATOM   879  C  CZ    . PHE A 1 106 ? 81.295  11.860  20.198  1.00 20.18  ? 6901 PHE A CZ    1 
ATOM   880  N  N     A VAL A 1 107 ? 75.608  10.726  19.476  0.50 24.40  ? 6902 VAL A N     1 
ATOM   881  N  N     B VAL A 1 107 ? 75.640  10.789  19.511  0.50 23.94  ? 6902 VAL A N     1 
ATOM   882  C  CA    A VAL A 1 107 ? 75.421  10.774  17.995  0.50 25.24  ? 6902 VAL A CA    1 
ATOM   883  C  CA    B VAL A 1 107 ? 75.305  10.959  18.066  0.50 24.61  ? 6902 VAL A CA    1 
ATOM   884  C  C     A VAL A 1 107 ? 76.127  12.040  17.509  0.50 24.05  ? 6902 VAL A C     1 
ATOM   885  C  C     B VAL A 1 107 ? 76.165  12.106  17.533  0.50 23.67  ? 6902 VAL A C     1 
ATOM   886  O  O     A VAL A 1 107 ? 75.922  13.103  18.117  0.50 23.24  ? 6902 VAL A O     1 
ATOM   887  O  O     B VAL A 1 107 ? 76.132  13.178  18.162  0.50 23.01  ? 6902 VAL A O     1 
ATOM   888  C  CB    A VAL A 1 107 ? 73.937  10.712  17.586  0.50 26.58  ? 6902 VAL A CB    1 
ATOM   889  C  CB    B VAL A 1 107 ? 73.806  11.275  17.900  0.50 25.12  ? 6902 VAL A CB    1 
ATOM   890  C  CG1   A VAL A 1 107 ? 73.300  9.418   18.062  0.50 28.47  ? 6902 VAL A CG1   1 
ATOM   891  C  CG1   B VAL A 1 107 ? 73.461  11.659  16.475  0.50 25.52  ? 6902 VAL A CG1   1 
ATOM   892  C  CG2   A VAL A 1 107 ? 73.152  11.910  18.083  0.50 27.00  ? 6902 VAL A CG2   1 
ATOM   893  C  CG2   B VAL A 1 107 ? 72.921  10.145  18.390  0.50 26.48  ? 6902 VAL A CG2   1 
ATOM   894  N  N     . SER A 1 108 ? 76.897  11.902  16.431  1.00 23.90  ? 6903 SER A N     1 
ATOM   895  C  CA    . SER A 1 108 ? 77.794  12.972  15.935  1.00 23.59  ? 6903 SER A CA    1 
ATOM   896  C  C     . SER A 1 108 ? 77.689  13.247  14.436  1.00 23.43  ? 6903 SER A C     1 
ATOM   897  O  O     . SER A 1 108 ? 77.339  12.331  13.677  1.00 23.92  ? 6903 SER A O     1 
ATOM   898  C  CB    . SER A 1 108 ? 79.202  12.551  16.259  1.00 24.24  ? 6903 SER A CB    1 
ATOM   899  O  OG    . SER A 1 108 ? 80.141  13.449  15.712  1.00 24.16  ? 6903 SER A OG    1 
ATOM   900  N  N     . ASP A 1 109 ? 78.082  14.467  14.056  1.00 22.27  ? 6904 ASP A N     1 
ATOM   901  C  CA    . ASP A 1 109 ? 78.186  14.903  12.641  1.00 23.22  ? 6904 ASP A CA    1 
ATOM   902  C  C     . ASP A 1 109 ? 79.633  14.717  12.166  1.00 23.12  ? 6904 ASP A C     1 
ATOM   903  O  O     . ASP A 1 109 ? 79.917  15.062  11.011  1.00 24.65  ? 6904 ASP A O     1 
ATOM   904  C  CB    . ASP A 1 109 ? 77.708  16.347  12.488  1.00 23.16  ? 6904 ASP A CB    1 
ATOM   905  C  CG    . ASP A 1 109 ? 76.220  16.492  12.744  1.00 23.81  ? 6904 ASP A CG    1 
ATOM   906  O  OD1   . ASP A 1 109 ? 75.437  15.838  12.018  1.00 24.59  ? 6904 ASP A OD1   1 
ATOM   907  O  OD2   . ASP A 1 109 ? 75.859  17.208  13.704  1.00 23.43  ? 6904 ASP A OD2   1 
ATOM   908  N  N     . ALA A 1 110 ? 80.513  14.180  13.021  1.00 22.32  ? 6905 ALA A N     1 
ATOM   909  C  CA    . ALA A 1 110 ? 81.924  13.968  12.624  1.00 21.78  ? 6905 ALA A CA    1 
ATOM   910  C  C     . ALA A 1 110 ? 82.019  12.873  11.550  1.00 22.65  ? 6905 ALA A C     1 
ATOM   911  O  O     . ALA A 1 110 ? 81.085  12.052  11.428  1.00 23.07  ? 6905 ALA A O     1 
ATOM   912  C  CB    . ALA A 1 110 ? 82.749  13.605  13.836  1.00 21.30  ? 6905 ALA A CB    1 
ATOM   913  N  N     . ASP A 1 111 ? 83.122  12.873  10.801  1.00 23.08  ? 6906 ASP A N     1 
ATOM   914  C  CA    . ASP A 1 111 ? 83.404  11.834  9.775   1.00 24.49  ? 6906 ASP A CA    1 
ATOM   915  C  C     . ASP A 1 111 ? 83.540  10.473  10.466  1.00 24.33  ? 6906 ASP A C     1 
ATOM   916  O  O     . ASP A 1 111 ? 83.116  9.458   9.895   1.00 24.93  ? 6906 ASP A O     1 
ATOM   917  C  CB    . ASP A 1 111 ? 84.653  12.210  8.982   1.00 25.54  ? 6906 ASP A CB    1 
ATOM   918  C  CG    . ASP A 1 111 ? 84.430  13.462  8.156   1.00 26.93  ? 6906 ASP A CG    1 
ATOM   919  O  OD1   . ASP A 1 111 ? 83.514  13.436  7.311   1.00 28.32  ? 6906 ASP A OD1   1 
ATOM   920  O  OD2   . ASP A 1 111 ? 85.103  14.474  8.425   1.00 26.96  ? 6906 ASP A OD2   1 
ATOM   921  N  N     A SER A 1 112 ? 84.110  10.463  11.671  0.60 23.15  ? 6907 SER A N     1 
ATOM   922  N  N     B SER A 1 112 ? 84.132  10.466  11.663  0.40 23.22  ? 6907 SER A N     1 
ATOM   923  C  CA    A SER A 1 112 ? 84.257  9.199   12.433  0.60 23.35  ? 6907 SER A CA    1 
ATOM   924  C  CA    B SER A 1 112 ? 84.318  9.222   12.453  0.40 23.30  ? 6907 SER A CA    1 
ATOM   925  C  C     A SER A 1 112 ? 84.240  9.530   13.926  0.60 22.30  ? 6907 SER A C     1 
ATOM   926  C  C     B SER A 1 112 ? 84.228  9.553   13.941  0.40 22.29  ? 6907 SER A C     1 
ATOM   927  O  O     A SER A 1 112 ? 84.773  10.594  14.298  0.60 21.16  ? 6907 SER A O     1 
ATOM   928  O  O     B SER A 1 112 ? 84.703  10.638  14.329  0.40 21.33  ? 6907 SER A O     1 
ATOM   929  C  CB    A SER A 1 112 ? 85.503  8.456   12.024  0.60 24.41  ? 6907 SER A CB    1 
ATOM   930  C  CB    B SER A 1 112 ? 85.627  8.553   12.127  0.40 24.07  ? 6907 SER A CB    1 
ATOM   931  O  OG    A SER A 1 112 ? 85.435  7.098   12.430  0.60 25.06  ? 6907 SER A OG    1 
ATOM   932  O  OG    B SER A 1 112 ? 85.641  8.103   10.783  0.40 25.21  ? 6907 SER A OG    1 
ATOM   933  N  N     . THR A 1 113 ? 83.616  8.658   14.720  1.00 22.11  ? 6908 THR A N     1 
ATOM   934  C  CA    . THR A 1 113 ? 83.478  8.845   16.184  1.00 21.88  ? 6908 THR A CA    1 
ATOM   935  C  C     . THR A 1 113 ? 84.037  7.617   16.901  1.00 22.58  ? 6908 THR A C     1 
ATOM   936  O  O     . THR A 1 113 ? 83.722  6.487   16.466  1.00 22.87  ? 6908 THR A O     1 
ATOM   937  C  CB    . THR A 1 113 ? 82.008  9.079   16.556  1.00 22.03  ? 6908 THR A CB    1 
ATOM   938  O  OG1   . THR A 1 113 ? 81.581  10.258  15.877  1.00 21.36  ? 6908 THR A OG1   1 
ATOM   939  C  CG2   . THR A 1 113 ? 81.780  9.229   18.044  1.00 21.86  ? 6908 THR A CG2   1 
ATOM   940  N  N     . LEU A 1 114 ? 84.862  7.838   17.924  1.00 22.00  ? 6909 LEU A N     1 
ATOM   941  C  CA    . LEU A 1 114 ? 85.400  6.722   18.746  1.00 23.63  ? 6909 LEU A CA    1 
ATOM   942  C  C     . LEU A 1 114 ? 84.839  6.852   20.159  1.00 23.09  ? 6909 LEU A C     1 
ATOM   943  O  O     . LEU A 1 114 ? 84.954  7.946   20.734  1.00 21.52  ? 6909 LEU A O     1 
ATOM   944  C  CB    . LEU A 1 114 ? 86.926  6.765   18.770  1.00 24.81  ? 6909 LEU A CB    1 
ATOM   945  C  CG    . LEU A 1 114 ? 87.618  6.434   17.453  1.00 26.78  ? 6909 LEU A CG    1 
ATOM   946  C  CD1   . LEU A 1 114 ? 89.120  6.572   17.611  1.00 28.50  ? 6909 LEU A CD1   1 
ATOM   947  C  CD2   . LEU A 1 114 ? 87.259  5.039   16.980  1.00 28.78  ? 6909 LEU A CD2   1 
ATOM   948  N  N     . ILE A 1 115 ? 84.258  5.771   20.679  1.00 23.37  ? 6910 ILE A N     1 
ATOM   949  C  CA    . ILE A 1 115 ? 83.681  5.801   22.050  1.00 23.64  ? 6910 ILE A CA    1 
ATOM   950  C  C     . ILE A 1 115 ? 84.606  5.024   22.980  1.00 24.18  ? 6910 ILE A C     1 
ATOM   951  O  O     . ILE A 1 115 ? 84.899  3.856   22.685  1.00 24.32  ? 6910 ILE A O     1 
ATOM   952  C  CB    . ILE A 1 115 ? 82.248  5.240   22.083  1.00 24.55  ? 6910 ILE A CB    1 
ATOM   953  C  CG1   . ILE A 1 115 ? 81.334  5.957   21.086  1.00 24.24  ? 6910 ILE A CG1   1 
ATOM   954  C  CG2   . ILE A 1 115 ? 81.696  5.295   23.500  1.00 24.67  ? 6910 ILE A CG2   1 
ATOM   955  C  CD1   . ILE A 1 115 ? 81.269  7.454   21.275  1.00 23.57  ? 6910 ILE A CD1   1 
ATOM   956  N  N     . GLY A 1 116 ? 85.009  5.665   24.075  1.00 23.84  ? 6911 GLY A N     1 
ATOM   957  C  CA    . GLY A 1 116 ? 85.866  5.031   25.089  1.00 24.36  ? 6911 GLY A CA    1 
ATOM   958  C  C     . GLY A 1 116 ? 86.773  6.046   25.745  1.00 23.83  ? 6911 GLY A C     1 
ATOM   959  O  O     . GLY A 1 116 ? 86.793  7.217   25.302  1.00 22.05  ? 6911 GLY A O     1 
ATOM   960  N  N     A ASP A 1 117 ? 87.491  5.626   26.789  0.60 24.21  ? 6912 ASP A N     1 
ATOM   961  N  N     B ASP A 1 117 ? 87.489  5.624   26.789  0.40 24.05  ? 6912 ASP A N     1 
ATOM   962  C  CA    A ASP A 1 117 ? 88.441  6.543   27.470  0.60 24.41  ? 6912 ASP A CA    1 
ATOM   963  C  CA    B ASP A 1 117 ? 88.456  6.522   27.474  0.40 24.04  ? 6912 ASP A CA    1 
ATOM   964  C  C     A ASP A 1 117 ? 89.435  7.048   26.418  0.60 23.71  ? 6912 ASP A C     1 
ATOM   965  C  C     B ASP A 1 117 ? 89.435  7.047   26.417  0.40 23.54  ? 6912 ASP A C     1 
ATOM   966  O  O     A ASP A 1 117 ? 89.837  6.244   25.548  0.60 23.75  ? 6912 ASP A O     1 
ATOM   967  O  O     B ASP A 1 117 ? 89.830  6.249   25.539  0.40 23.68  ? 6912 ASP A O     1 
ATOM   968  C  CB    A ASP A 1 117 ? 89.124  5.847   28.647  0.60 25.80  ? 6912 ASP A CB    1 
ATOM   969  C  CB    B ASP A 1 117 ? 89.185  5.779   28.593  0.40 25.05  ? 6912 ASP A CB    1 
ATOM   970  C  CG    A ASP A 1 117 ? 89.936  6.785   29.519  0.60 26.22  ? 6912 ASP A CG    1 
ATOM   971  C  CG    B ASP A 1 117 ? 90.132  6.661   29.382  0.40 25.08  ? 6912 ASP A CG    1 
ATOM   972  O  OD1   A ASP A 1 117 ? 90.825  7.484   28.981  0.60 25.03  ? 6912 ASP A OD1   1 
ATOM   973  O  OD1   B ASP A 1 117 ? 89.709  7.763   29.788  0.40 24.71  ? 6912 ASP A OD1   1 
ATOM   974  O  OD2   A ASP A 1 117 ? 89.635  6.848   30.719  0.60 28.18  ? 6912 ASP A OD2   1 
ATOM   975  O  OD2   B ASP A 1 117 ? 91.292  6.255   29.549  0.40 25.64  ? 6912 ASP A OD2   1 
ATOM   976  N  N     . CYS A 1 118 ? 89.806  8.330   26.485  1.00 22.89  ? 6913 CYS A N     1 
ATOM   977  C  CA    . CYS A 1 118 ? 90.729  8.902   25.464  1.00 23.16  ? 6913 CYS A CA    1 
ATOM   978  C  C     . CYS A 1 118 ? 92.043  8.109   25.422  1.00 23.51  ? 6913 CYS A C     1 
ATOM   979  O  O     . CYS A 1 118 ? 92.644  8.047   24.335  1.00 23.79  ? 6913 CYS A O     1 
ATOM   980  C  CB    . CYS A 1 118 ? 90.997  10.383  25.696  1.00 23.60  ? 6913 CYS A CB    1 
ATOM   981  S  SG    . CYS A 1 118 ? 91.728  10.733  27.311  1.00 25.06  ? 6913 CYS A SG    1 
ATOM   982  N  N     . ALA A 1 119 ? 92.432  7.485   26.538  1.00 23.61  ? 6914 ALA A N     1 
ATOM   983  C  CA    . ALA A 1 119 ? 93.705  6.729   26.607  1.00 25.06  ? 6914 ALA A CA    1 
ATOM   984  C  C     . ALA A 1 119 ? 93.663  5.519   25.663  1.00 25.37  ? 6914 ALA A C     1 
ATOM   985  O  O     . ALA A 1 119 ? 94.741  4.989   25.354  1.00 26.94  ? 6914 ALA A O     1 
ATOM   986  C  CB    . ALA A 1 119 ? 93.982  6.296   28.026  1.00 26.57  ? 6914 ALA A CB    1 
ATOM   987  N  N     . THR A 1 120 ? 92.467  5.111   25.228  1.00 24.60  ? 6915 THR A N     1 
ATOM   988  C  CA    . THR A 1 120 ? 92.313  3.940   24.322  1.00 25.54  ? 6915 THR A CA    1 
ATOM   989  C  C     . THR A 1 120 ? 92.427  4.386   22.862  1.00 26.00  ? 6915 THR A C     1 
ATOM   990  O  O     . THR A 1 120 ? 92.518  3.499   21.984  1.00 26.61  ? 6915 THR A O     1 
ATOM   991  C  CB    . THR A 1 120 ? 90.962  3.234   24.506  1.00 25.32  ? 6915 THR A CB    1 
ATOM   992  O  OG1   . THR A 1 120 ? 89.923  4.106   24.053  1.00 24.61  ? 6915 THR A OG1   1 
ATOM   993  C  CG2   . THR A 1 120 ? 90.707  2.791   25.930  1.00 26.02  ? 6915 THR A CG2   1 
ATOM   994  N  N     . VAL A 1 121 ? 92.438  5.699   22.619  1.00 25.81  ? 6916 VAL A N     1 
ATOM   995  C  CA    . VAL A 1 121 ? 92.433  6.234   21.224  1.00 26.06  ? 6916 VAL A CA    1 
ATOM   996  C  C     . VAL A 1 121 ? 93.857  6.265   20.669  1.00 27.62  ? 6916 VAL A C     1 
ATOM   997  O  O     . VAL A 1 121 ? 94.739  6.888   21.293  1.00 27.32  ? 6916 VAL A O     1 
ATOM   998  C  CB    . VAL A 1 121 ? 91.766  7.618   21.144  1.00 25.18  ? 6916 VAL A CB    1 
ATOM   999  C  CG1   . VAL A 1 121 ? 91.887  8.222   19.751  1.00 25.00  ? 6916 VAL A CG1   1 
ATOM   1000 C  CG2   . VAL A 1 121 ? 90.309  7.553   21.580  1.00 24.57  ? 6916 VAL A CG2   1 
ATOM   1001 N  N     . HIS A 1 122 ? 94.046  5.607   19.524  1.00 28.55  ? 6917 HIS A N     1 
ATOM   1002 C  CA    . HIS A 1 122 ? 95.346  5.579   18.815  1.00 31.66  ? 6917 HIS A CA    1 
ATOM   1003 C  C     . HIS A 1 122 ? 95.117  6.042   17.376  1.00 31.68  ? 6917 HIS A C     1 
ATOM   1004 O  O     . HIS A 1 122 ? 94.024  5.805   16.829  1.00 29.90  ? 6917 HIS A O     1 
ATOM   1005 C  CB    . HIS A 1 122 ? 95.982  4.187   18.928  1.00 35.64  ? 6917 HIS A CB    1 
ATOM   1006 C  CG    . HIS A 1 122 ? 96.269  3.813   20.342  1.00 39.05  ? 6917 HIS A CG    1 
ATOM   1007 N  ND1   . HIS A 1 122 ? 97.468  4.114   20.957  1.00 43.98  ? 6917 HIS A ND1   1 
ATOM   1008 C  CD2   . HIS A 1 122 ? 95.502  3.219   21.280  1.00 41.70  ? 6917 HIS A CD2   1 
ATOM   1009 C  CE1   . HIS A 1 122 ? 97.435  3.700   22.209  1.00 44.49  ? 6917 HIS A CE1   1 
ATOM   1010 N  NE2   . HIS A 1 122 ? 96.241  3.145   22.430  1.00 44.72  ? 6917 HIS A NE2   1 
ATOM   1011 N  N     A THR A 1 123 ? 96.097  6.748   16.802  0.70 31.85  ? 6918 THR A N     1 
ATOM   1012 N  N     B THR A 1 123 ? 96.126  6.689   16.800  0.30 32.41  ? 6918 THR A N     1 
ATOM   1013 C  CA    A THR A 1 123 ? 96.006  7.223   15.394  0.70 32.54  ? 6918 THR A CA    1 
ATOM   1014 C  CA    B THR A 1 123 ? 96.039  7.188   15.408  0.30 33.31  ? 6918 THR A CA    1 
ATOM   1015 C  C     A THR A 1 123 ? 97.368  7.002   14.725  0.70 34.32  ? 6918 THR A C     1 
ATOM   1016 C  C     B THR A 1 123 ? 97.388  6.981   14.727  0.30 34.74  ? 6918 THR A C     1 
ATOM   1017 O  O     A THR A 1 123 ? 98.396  7.216   15.397  0.70 35.45  ? 6918 THR A O     1 
ATOM   1018 O  O     B THR A 1 123 ? 98.424  7.207   15.384  0.30 35.34  ? 6918 THR A O     1 
ATOM   1019 C  CB    A THR A 1 123 ? 95.547  8.688   15.299  0.70 32.15  ? 6918 THR A CB    1 
ATOM   1020 C  CB    B THR A 1 123 ? 95.640  8.664   15.373  0.30 32.94  ? 6918 THR A CB    1 
ATOM   1021 O  OG1   A THR A 1 123 ? 96.557  9.557   15.811  0.70 30.76  ? 6918 THR A OG1   1 
ATOM   1022 O  OG1   B THR A 1 123 ? 95.727  9.066   14.006  0.30 33.63  ? 6918 THR A OG1   1 
ATOM   1023 C  CG2   A THR A 1 123 ? 94.252  8.962   16.036  0.70 30.85  ? 6918 THR A CG2   1 
ATOM   1024 C  CG2   B THR A 1 123 ? 96.527  9.523   16.247  0.30 32.55  ? 6918 THR A CG2   1 
ATOM   1025 N  N     . ALA A 1 124 ? 97.361  6.546   13.470  1.00 35.76  ? 6919 ALA A N     1 
ATOM   1026 C  CA    . ALA A 1 124 ? 98.600  6.326   12.697  1.00 38.09  ? 6919 ALA A CA    1 
ATOM   1027 C  C     . ALA A 1 124 ? 99.105  7.680   12.181  1.00 39.39  ? 6919 ALA A C     1 
ATOM   1028 O  O     . ALA A 1 124 ? 100.327 7.831   12.006  1.00 42.47  ? 6919 ALA A O     1 
ATOM   1029 C  CB    . ALA A 1 124 ? 98.311  5.370   11.565  1.00 38.93  ? 6919 ALA A CB    1 
ATOM   1030 N  N     . ASN A 1 125 ? 98.188  8.641   12.023  1.00 38.44  ? 6920 ASN A N     1 
ATOM   1031 C  CA    . ASN A 1 125 ? 98.496  9.959   11.408  1.00 36.84  ? 6920 ASN A CA    1 
ATOM   1032 C  C     . ASN A 1 125 ? 98.678  11.070  12.444  1.00 34.49  ? 6920 ASN A C     1 
ATOM   1033 O  O     . ASN A 1 125 ? 98.318  10.879  13.630  1.00 32.22  ? 6920 ASN A O     1 
ATOM   1034 C  CB    . ASN A 1 125 ? 97.387  10.395  10.443  1.00 38.19  ? 6920 ASN A CB    1 
ATOM   1035 C  CG    . ASN A 1 125 ? 96.021  10.511  11.094  1.00 39.03  ? 6920 ASN A CG    1 
ATOM   1036 O  OD1   . ASN A 1 125 ? 95.418  9.505   11.470  1.00 39.31  ? 6920 ASN A OD1   1 
ATOM   1037 N  ND2   . ASN A 1 125 ? 95.500  11.727  11.182  1.00 37.18  ? 6920 ASN A ND2   1 
ATOM   1038 N  N     . LYS A 1 126 ? 99.253  12.186  11.983  1.00 32.26  ? 6921 LYS A N     1 
ATOM   1039 C  CA    . LYS A 1 126 ? 99.378  13.415  12.804  1.00 30.60  ? 6921 LYS A CA    1 
ATOM   1040 C  C     . LYS A 1 126 ? 98.176  14.302  12.481  1.00 27.94  ? 6921 LYS A C     1 
ATOM   1041 O  O     . LYS A 1 126 ? 97.535  14.080  11.431  1.00 27.52  ? 6921 LYS A O     1 
ATOM   1042 C  CB    . LYS A 1 126 ? 100.726 14.103  12.588  1.00 32.09  ? 6921 LYS A CB    1 
ATOM   1043 C  CG    . LYS A 1 126 ? 101.903 13.302  13.116  1.00 34.62  ? 6921 LYS A CG    1 
ATOM   1044 C  CD    . LYS A 1 126 ? 103.129 14.116  13.393  1.00 36.78  ? 6921 LYS A CD    1 
ATOM   1045 C  CE    . LYS A 1 126 ? 104.236 13.272  13.984  1.00 39.04  ? 6921 LYS A CE    1 
ATOM   1046 N  NZ    . LYS A 1 126 ? 105.308 14.118  14.550  1.00 41.35  ? 6921 LYS A NZ    1 
ATOM   1047 N  N     . TRP A 1 127 ? 97.903  15.269  13.358  1.00 26.02  ? 6922 TRP A N     1 
ATOM   1048 C  CA    . TRP A 1 127 ? 96.706  16.144  13.267  1.00 24.93  ? 6922 TRP A CA    1 
ATOM   1049 C  C     . TRP A 1 127 ? 97.133  17.602  13.125  1.00 24.23  ? 6922 TRP A C     1 
ATOM   1050 O  O     . TRP A 1 127 ? 98.245  17.939  13.557  1.00 24.94  ? 6922 TRP A O     1 
ATOM   1051 C  CB    . TRP A 1 127 ? 95.815  15.899  14.493  1.00 24.32  ? 6922 TRP A CB    1 
ATOM   1052 C  CG    . TRP A 1 127 ? 95.375  14.473  14.505  1.00 24.69  ? 6922 TRP A CG    1 
ATOM   1053 C  CD1   . TRP A 1 127 ? 96.078  13.402  14.971  1.00 26.18  ? 6922 TRP A CD1   1 
ATOM   1054 C  CD2   . TRP A 1 127 ? 94.188  13.945  13.895  1.00 24.63  ? 6922 TRP A CD2   1 
ATOM   1055 N  NE1   . TRP A 1 127 ? 95.394  12.245  14.715  1.00 26.81  ? 6922 TRP A NE1   1 
ATOM   1056 C  CE2   . TRP A 1 127 ? 94.231  12.543  14.057  1.00 25.60  ? 6922 TRP A CE2   1 
ATOM   1057 C  CE3   . TRP A 1 127 ? 93.091  14.515  13.243  1.00 24.50  ? 6922 TRP A CE3   1 
ATOM   1058 C  CZ2   . TRP A 1 127 ? 93.217  11.708  13.593  1.00 25.29  ? 6922 TRP A CZ2   1 
ATOM   1059 C  CZ3   . TRP A 1 127 ? 92.092  13.687  12.778  1.00 24.73  ? 6922 TRP A CZ3   1 
ATOM   1060 C  CH2   . TRP A 1 127 ? 92.153  12.306  12.959  1.00 24.73  ? 6922 TRP A CH2   1 
ATOM   1061 N  N     . ASP A 1 128 ? 96.268  18.408  12.521  1.00 23.47  ? 6923 ASP A N     1 
ATOM   1062 C  CA    . ASP A 1 128 ? 96.544  19.847  12.277  1.00 23.79  ? 6923 ASP A CA    1 
ATOM   1063 C  C     . ASP A 1 128 ? 95.911  20.682  13.389  1.00 22.34  ? 6923 ASP A C     1 
ATOM   1064 O  O     . ASP A 1 128 ? 96.365  21.811  13.607  1.00 22.40  ? 6923 ASP A O     1 
ATOM   1065 C  CB    . ASP A 1 128 ? 96.019  20.252  10.903  1.00 24.63  ? 6923 ASP A CB    1 
ATOM   1066 C  CG    . ASP A 1 128 ? 96.621  19.420  9.785   1.00 26.51  ? 6923 ASP A CG    1 
ATOM   1067 O  OD1   . ASP A 1 128 ? 97.833  19.114  9.871   1.00 27.12  ? 6923 ASP A OD1   1 
ATOM   1068 O  OD2   . ASP A 1 128 ? 95.861  19.033  8.871   1.00 27.12  ? 6923 ASP A OD2   1 
ATOM   1069 N  N     . LEU A 1 129 ? 94.875  20.149  14.036  1.00 21.51  ? 6924 LEU A N     1 
ATOM   1070 C  CA    . LEU A 1 129 ? 94.165  20.887  15.106  1.00 20.68  ? 6924 LEU A CA    1 
ATOM   1071 C  C     . LEU A 1 129 ? 93.584  19.874  16.086  1.00 20.48  ? 6924 LEU A C     1 
ATOM   1072 O  O     . LEU A 1 129 ? 92.956  18.903  15.634  1.00 19.74  ? 6924 LEU A O     1 
ATOM   1073 C  CB    . LEU A 1 129 ? 93.059  21.744  14.480  1.00 21.21  ? 6924 LEU A CB    1 
ATOM   1074 C  CG    . LEU A 1 129 ? 92.221  22.588  15.442  1.00 21.31  ? 6924 LEU A CG    1 
ATOM   1075 C  CD1   . LEU A 1 129 ? 93.074  23.629  16.162  1.00 21.99  ? 6924 LEU A CD1   1 
ATOM   1076 C  CD2   . LEU A 1 129 ? 91.071  23.264  14.705  1.00 21.46  ? 6924 LEU A CD2   1 
ATOM   1077 N  N     . ILE A 1 130 ? 93.848  20.085  17.371  1.00 19.90  ? 6925 ILE A N     1 
ATOM   1078 C  CA    . ILE A 1 130 ? 93.285  19.226  18.447  1.00 19.85  ? 6925 ILE A CA    1 
ATOM   1079 C  C     . ILE A 1 130 ? 92.405  20.111  19.321  1.00 19.13  ? 6925 ILE A C     1 
ATOM   1080 O  O     . ILE A 1 130 ? 92.919  21.127  19.827  1.00 18.95  ? 6925 ILE A O     1 
ATOM   1081 C  CB    . ILE A 1 130 ? 94.390  18.568  19.290  1.00 20.85  ? 6925 ILE A CB    1 
ATOM   1082 C  CG1   . ILE A 1 130 ? 95.323  17.708  18.441  1.00 21.80  ? 6925 ILE A CG1   1 
ATOM   1083 C  CG2   . ILE A 1 130 ? 93.772  17.781  20.438  1.00 20.67  ? 6925 ILE A CG2   1 
ATOM   1084 C  CD1   . ILE A 1 130 ? 96.594  17.314  19.150  1.00 23.49  ? 6925 ILE A CD1   1 
ATOM   1085 N  N     . ILE A 1 131 ? 91.130  19.748  19.446  1.00 18.62  ? 6926 ILE A N     1 
ATOM   1086 C  CA    . ILE A 1 131 ? 90.183  20.454  20.351  1.00 18.14  ? 6926 ILE A CA    1 
ATOM   1087 C  C     . ILE A 1 131 ? 89.830  19.473  21.471  1.00 17.71  ? 6926 ILE A C     1 
ATOM   1088 O  O     . ILE A 1 131 ? 89.538  18.306  21.160  1.00 17.71  ? 6926 ILE A O     1 
ATOM   1089 C  CB    . ILE A 1 131 ? 88.908  20.917  19.615  1.00 18.86  ? 6926 ILE A CB    1 
ATOM   1090 C  CG1   . ILE A 1 131 ? 89.203  21.727  18.348  1.00 20.03  ? 6926 ILE A CG1   1 
ATOM   1091 C  CG2   . ILE A 1 131 ? 87.988  21.662  20.572  1.00 18.69  ? 6926 ILE A CG2   1 
ATOM   1092 C  CD1   . ILE A 1 131 ? 89.922  23.017  18.587  1.00 20.77  ? 6926 ILE A CD1   1 
ATOM   1093 N  N     . SER A 1 132 ? 89.923  19.909  22.727  1.00 17.17  ? 6927 SER A N     1 
ATOM   1094 C  CA    . SER A 1 132 ? 89.472  19.050  23.846  1.00 17.31  ? 6927 SER A CA    1 
ATOM   1095 C  C     . SER A 1 132 ? 88.515  19.821  24.749  1.00 17.58  ? 6927 SER A C     1 
ATOM   1096 O  O     . SER A 1 132 ? 88.864  20.944  25.165  1.00 17.41  ? 6927 SER A O     1 
ATOM   1097 C  CB    . SER A 1 132 ? 90.613  18.510  24.664  1.00 18.25  ? 6927 SER A CB    1 
ATOM   1098 O  OG    . SER A 1 132 ? 90.110  17.885  25.841  1.00 18.30  ? 6927 SER A OG    1 
ATOM   1099 N  N     . ASP A 1 133 ? 87.347  19.232  25.011  1.00 16.92  ? 6928 ASP A N     1 
ATOM   1100 C  CA    . ASP A 1 133 ? 86.399  19.769  26.014  1.00 17.55  ? 6928 ASP A CA    1 
ATOM   1101 C  C     . ASP A 1 133 ? 86.266  18.717  27.123  1.00 17.09  ? 6928 ASP A C     1 
ATOM   1102 O  O     . ASP A 1 133 ? 85.275  18.766  27.871  1.00 17.09  ? 6928 ASP A O     1 
ATOM   1103 C  CB    . ASP A 1 133 ? 85.059  20.140  25.384  1.00 18.60  ? 6928 ASP A CB    1 
ATOM   1104 C  CG    . ASP A 1 133 ? 84.206  21.028  26.271  1.00 20.58  ? 6928 ASP A CG    1 
ATOM   1105 O  OD1   . ASP A 1 133 ? 84.800  21.824  27.031  1.00 21.26  ? 6928 ASP A OD1   1 
ATOM   1106 O  OD2   . ASP A 1 133 ? 82.955  20.915  26.197  1.00 21.49  ? 6928 ASP A OD2   1 
ATOM   1107 N  N     . MET A 1 134 ? 87.228  17.791  27.216  1.00 17.03  ? 6929 MET A N     1 
ATOM   1108 C  CA    . MET A 1 134 ? 87.165  16.758  28.283  1.00 17.48  ? 6929 MET A CA    1 
ATOM   1109 C  C     . MET A 1 134 ? 87.149  17.445  29.648  1.00 17.94  ? 6929 MET A C     1 
ATOM   1110 O  O     . MET A 1 134 ? 87.885  18.428  29.850  1.00 17.86  ? 6929 MET A O     1 
ATOM   1111 C  CB    . MET A 1 134 ? 88.312  15.749  28.194  1.00 18.39  ? 6929 MET A CB    1 
ATOM   1112 C  CG    . MET A 1 134 ? 88.156  14.838  26.987  1.00 18.77  ? 6929 MET A CG    1 
ATOM   1113 S  SD    . MET A 1 134 ? 89.370  13.517  26.914  1.00 20.43  ? 6929 MET A SD    1 
ATOM   1114 C  CE    . MET A 1 134 ? 90.861  14.445  26.560  1.00 20.27  ? 6929 MET A CE    1 
ATOM   1115 N  N     . TYR A 1 135 ? 86.318  16.914  30.536  1.00 18.42  ? 6930 TYR A N     1 
ATOM   1116 C  CA    . TYR A 1 135 ? 86.110  17.522  31.865  1.00 19.75  ? 6930 TYR A CA    1 
ATOM   1117 C  C     . TYR A 1 135 ? 85.313  16.557  32.731  1.00 22.12  ? 6930 TYR A C     1 
ATOM   1118 O  O     . TYR A 1 135 ? 84.437  15.859  32.205  1.00 21.90  ? 6930 TYR A O     1 
ATOM   1119 C  CB    . TYR A 1 135 ? 85.342  18.837  31.702  1.00 20.32  ? 6930 TYR A CB    1 
ATOM   1120 C  CG    . TYR A 1 135 ? 85.026  19.535  32.994  1.00 21.30  ? 6930 TYR A CG    1 
ATOM   1121 C  CD1   . TYR A 1 135 ? 86.035  20.114  33.740  1.00 21.40  ? 6930 TYR A CD1   1 
ATOM   1122 C  CD2   . TYR A 1 135 ? 83.725  19.644  33.460  1.00 22.78  ? 6930 TYR A CD2   1 
ATOM   1123 C  CE1   . TYR A 1 135 ? 85.770  20.752  34.942  1.00 23.04  ? 6930 TYR A CE1   1 
ATOM   1124 C  CE2   . TYR A 1 135 ? 83.438  20.300  34.649  1.00 24.55  ? 6930 TYR A CE2   1 
ATOM   1125 C  CZ    . TYR A 1 135 ? 84.466  20.856  35.393  1.00 24.48  ? 6930 TYR A CZ    1 
ATOM   1126 O  OH    . TYR A 1 135 ? 84.206  21.496  36.575  1.00 26.40  ? 6930 TYR A OH    1 
ATOM   1127 N  N     . ASP A 1 136 ? 85.631  16.540  34.019  1.00 24.29  ? 6931 ASP A N     1 
ATOM   1128 C  CA    . ASP A 1 136 ? 84.889  15.742  35.023  1.00 27.76  ? 6931 ASP A CA    1 
ATOM   1129 C  C     . ASP A 1 136 ? 84.519  16.724  36.128  1.00 28.04  ? 6931 ASP A C     1 
ATOM   1130 O  O     . ASP A 1 136 ? 85.410  17.242  36.787  1.00 27.07  ? 6931 ASP A O     1 
ATOM   1131 C  CB    . ASP A 1 136 ? 85.732  14.572  35.519  1.00 30.65  ? 6931 ASP A CB    1 
ATOM   1132 C  CG    . ASP A 1 136 ? 85.037  13.731  36.576  1.00 34.40  ? 6931 ASP A CG    1 
ATOM   1133 O  OD1   . ASP A 1 136 ? 83.892  14.074  36.953  1.00 36.68  ? 6931 ASP A OD1   1 
ATOM   1134 O  OD2   . ASP A 1 136 ? 85.652  12.755  37.017  1.00 38.58  ? 6931 ASP A OD2   1 
ATOM   1135 N  N     . PRO A 1 137 ? 83.225  17.077  36.309  1.00 29.63  ? 6932 PRO A N     1 
ATOM   1136 C  CA    . PRO A 1 137 ? 82.838  18.056  37.328  1.00 31.89  ? 6932 PRO A CA    1 
ATOM   1137 C  C     . PRO A 1 137 ? 83.245  17.640  38.749  1.00 34.61  ? 6932 PRO A C     1 
ATOM   1138 O  O     . PRO A 1 137 ? 83.251  18.501  39.618  1.00 35.32  ? 6932 PRO A O     1 
ATOM   1139 C  CB    . PRO A 1 137 ? 81.309  18.177  37.200  1.00 33.21  ? 6932 PRO A CB    1 
ATOM   1140 C  CG    . PRO A 1 137 ? 80.882  16.958  36.399  1.00 34.25  ? 6932 PRO A CG    1 
ATOM   1141 C  CD    . PRO A 1 137 ? 82.074  16.579  35.543  1.00 31.65  ? 6932 PRO A CD    1 
ATOM   1142 N  N     . LYS A 1 138 ? 83.600  16.365  38.938  1.00 39.58  ? 6933 LYS A N     1 
ATOM   1143 C  CA    . LYS A 1 138 ? 84.023  15.855  40.272  1.00 42.87  ? 6933 LYS A CA    1 
ATOM   1144 C  C     . LYS A 1 138 ? 85.444  16.341  40.588  1.00 41.81  ? 6933 LYS A C     1 
ATOM   1145 O  O     . LYS A 1 138 ? 85.861  16.237  41.757  1.00 40.99  ? 6933 LYS A O     1 
ATOM   1146 C  CB    . LYS A 1 138 ? 83.908  14.328  40.330  1.00 46.47  ? 6933 LYS A CB    1 
ATOM   1147 C  CG    . LYS A 1 138 ? 82.478  13.800  40.297  1.00 50.98  ? 6933 LYS A CG    1 
ATOM   1148 C  CD    . LYS A 1 138 ? 82.370  12.294  40.376  1.00 55.49  ? 6933 LYS A CD    1 
ATOM   1149 C  CE    . LYS A 1 138 ? 80.934  11.813  40.411  1.00 60.42  ? 6933 LYS A CE    1 
ATOM   1150 N  NZ    . LYS A 1 138 ? 80.846  10.337  40.522  1.00 64.63  ? 6933 LYS A NZ    1 
ATOM   1151 N  N     A THR A 1 139 ? 86.146  16.914  39.603  0.60 39.28  ? 6934 THR A N     1 
ATOM   1152 N  N     B THR A 1 139 ? 86.162  16.807  39.558  0.40 39.76  ? 6934 THR A N     1 
ATOM   1153 C  CA    A THR A 1 139 ? 87.517  17.448  39.851  0.60 39.01  ? 6934 THR A CA    1 
ATOM   1154 C  CA    B THR A 1 139 ? 87.547  17.324  39.715  0.40 39.50  ? 6934 THR A CA    1 
ATOM   1155 C  C     A THR A 1 139 ? 87.432  18.692  40.747  0.60 40.15  ? 6934 THR A C     1 
ATOM   1156 C  C     B THR A 1 139 ? 87.519  18.492  40.704  0.40 40.63  ? 6934 THR A C     1 
ATOM   1157 O  O     A THR A 1 139 ? 88.438  19.010  41.411  0.60 42.20  ? 6934 THR A O     1 
ATOM   1158 O  O     B THR A 1 139 ? 88.480  18.631  41.486  0.40 42.83  ? 6934 THR A O     1 
ATOM   1159 C  CB    A THR A 1 139 ? 88.249  17.794  38.548  0.60 37.60  ? 6934 THR A CB    1 
ATOM   1160 C  CB    B THR A 1 139 ? 88.121  17.776  38.366  0.40 38.10  ? 6934 THR A CB    1 
ATOM   1161 O  OG1   A THR A 1 139 ? 87.478  18.785  37.865  0.60 37.90  ? 6934 THR A OG1   1 
ATOM   1162 O  OG1   B THR A 1 139 ? 89.538  17.911  38.477  0.40 36.76  ? 6934 THR A OG1   1 
ATOM   1163 C  CG2   A THR A 1 139 ? 88.480  16.587  37.664  0.60 35.89  ? 6934 THR A CG2   1 
ATOM   1164 C  CG2   B THR A 1 139 ? 87.515  19.080  37.894  0.40 37.25  ? 6934 THR A CG2   1 
ATOM   1165 N  N     A LYS A 1 140 ? 86.280  19.369  40.757  0.60 41.61  ? 6935 LYS A N     1 
ATOM   1166 N  N     B LYS A 1 140 ? 86.451  19.294  40.654  0.40 41.71  ? 6935 LYS A N     1 
ATOM   1167 C  CA    A LYS A 1 140 ? 86.114  20.597  41.579  0.60 44.30  ? 6935 LYS A CA    1 
ATOM   1168 C  CA    B LYS A 1 140 ? 86.273  20.461  41.555  0.40 43.57  ? 6935 LYS A CA    1 
ATOM   1169 C  C     A LYS A 1 140 ? 85.927  20.200  43.048  0.60 47.31  ? 6935 LYS A C     1 
ATOM   1170 C  C     B LYS A 1 140 ? 86.087  19.956  42.989  0.40 46.38  ? 6935 LYS A C     1 
ATOM   1171 O  O     A LYS A 1 140 ? 84.777  19.905  43.440  0.60 47.87  ? 6935 LYS A O     1 
ATOM   1172 O  O     B LYS A 1 140 ? 85.058  19.304  43.264  0.40 46.48  ? 6935 LYS A O     1 
ATOM   1173 C  CB    A LYS A 1 140 ? 84.936  21.439  41.078  0.60 46.67  ? 6935 LYS A CB    1 
ATOM   1174 C  CB    B LYS A 1 140 ? 85.084  21.317  41.104  0.40 45.22  ? 6935 LYS A CB    1 
ATOM   1175 C  CG    A LYS A 1 140 ? 84.703  22.732  41.849  0.60 49.16  ? 6935 LYS A CG    1 
ATOM   1176 C  CG    B LYS A 1 140 ? 84.864  22.591  41.911  0.40 47.07  ? 6935 LYS A CG    1 
ATOM   1177 C  CD    A LYS A 1 140 ? 83.601  23.594  41.275  0.60 51.93  ? 6935 LYS A CD    1 
ATOM   1178 C  CD    B LYS A 1 140 ? 83.771  23.483  41.357  0.40 49.10  ? 6935 LYS A CD    1 
ATOM   1179 C  CE    A LYS A 1 140 ? 83.404  24.885  42.042  0.60 54.84  ? 6935 LYS A CE    1 
ATOM   1180 C  CE    B LYS A 1 140 ? 83.615  24.777  42.129  0.40 51.15  ? 6935 LYS A CE    1 
ATOM   1181 N  NZ    A LYS A 1 140 ? 82.334  25.716  41.442  0.60 57.09  ? 6935 LYS A NZ    1 
ATOM   1182 N  NZ    B LYS A 1 140 ? 82.572  25.646  41.534  0.40 53.10  ? 6935 LYS A NZ    1 
ATOM   1183 N  N     A ASN A 1 141 ? 87.027  20.188  43.809  0.60 48.06  ? 6936 ASN A N     1 
ATOM   1184 N  N     B ASN A 1 141 ? 87.073  20.227  43.846  0.40 47.32  ? 6936 ASN A N     1 
ATOM   1185 C  CA    A ASN A 1 141 ? 87.011  19.849  45.258  0.60 50.36  ? 6936 ASN A CA    1 
ATOM   1186 C  CA    B ASN A 1 141 ? 87.031  19.832  45.279  0.40 50.09  ? 6936 ASN A CA    1 
ATOM   1187 C  C     A ASN A 1 141 ? 87.704  20.986  46.018  0.60 50.06  ? 6936 ASN A C     1 
ATOM   1188 C  C     B ASN A 1 141 ? 87.710  20.944  46.083  0.40 50.31  ? 6936 ASN A C     1 
ATOM   1189 O  O     A ASN A 1 141 ? 88.948  21.064  45.966  0.60 48.92  ? 6936 ASN A O     1 
ATOM   1190 O  O     B ASN A 1 141 ? 88.956  20.960  46.129  0.40 49.71  ? 6936 ASN A O     1 
ATOM   1191 C  CB    A ASN A 1 141 ? 87.663  18.491  45.533  0.60 51.41  ? 6936 ASN A CB    1 
ATOM   1192 C  CB    B ASN A 1 141 ? 87.692  18.473  45.521  0.40 51.17  ? 6936 ASN A CB    1 
ATOM   1193 C  CG    A ASN A 1 141 ? 87.614  18.092  46.994  0.60 55.62  ? 6936 ASN A CG    1 
ATOM   1194 C  CG    B ASN A 1 141 ? 87.593  18.025  46.964  0.40 54.95  ? 6936 ASN A CG    1 
ATOM   1195 O  OD1   A ASN A 1 141 ? 87.038  18.798  47.820  0.60 56.09  ? 6936 ASN A OD1   1 
ATOM   1196 O  OD1   B ASN A 1 141 ? 86.929  18.670  47.773  0.40 56.02  ? 6936 ASN A OD1   1 
ATOM   1197 N  ND2   A ASN A 1 141 ? 88.215  16.959  47.322  0.60 57.58  ? 6936 ASN A ND2   1 
ATOM   1198 N  ND2   B ASN A 1 141 ? 88.247  16.923  47.294  0.40 56.69  ? 6936 ASN A ND2   1 
ATOM   1199 N  N     . VAL A 1 142 ? 86.913  21.832  46.685  1.00 52.62  ? 6937 VAL A N     1 
ATOM   1200 C  CA    . VAL A 1 142 ? 87.434  23.003  47.458  1.00 54.00  ? 6937 VAL A CA    1 
ATOM   1201 C  C     . VAL A 1 142 ? 87.880  22.559  48.858  1.00 55.48  ? 6937 VAL A C     1 
ATOM   1202 O  O     . VAL A 1 142 ? 88.337  23.433  49.619  1.00 59.37  ? 6937 VAL A O     1 
ATOM   1203 C  CB    . VAL A 1 142 ? 86.379  24.125  47.541  1.00 55.25  ? 6937 VAL A CB    1 
ATOM   1204 C  CG1   . VAL A 1 142 ? 85.941  24.591  46.160  1.00 54.47  ? 6937 VAL A CG1   1 
ATOM   1205 C  CG2   . VAL A 1 142 ? 85.169  23.717  48.373  1.00 57.71  ? 6937 VAL A CG2   1 
ATOM   1206 N  N     . THR A 1 143 ? 87.786  21.262  49.174  1.00 56.24  ? 6938 THR A N     1 
ATOM   1207 C  CA    . THR A 1 143 ? 88.147  20.750  50.528  1.00 58.14  ? 6938 THR A CA    1 
ATOM   1208 C  C     . THR A 1 143 ? 89.562  20.157  50.516  1.00 56.28  ? 6938 THR A C     1 
ATOM   1209 O  O     . THR A 1 143 ? 90.020  19.725  51.587  1.00 58.85  ? 6938 THR A O     1 
ATOM   1210 C  CB    . THR A 1 143 ? 87.145  19.699  51.028  1.00 61.24  ? 6938 THR A CB    1 
ATOM   1211 O  OG1   . THR A 1 143 ? 87.363  18.472  50.331  1.00 62.30  ? 6938 THR A OG1   1 
ATOM   1212 C  CG2   . THR A 1 143 ? 85.703  20.134  50.877  1.00 61.77  ? 6938 THR A CG2   1 
ATOM   1213 N  N     . LYS A 1 144 ? 90.223  20.133  49.356  1.00 51.52  ? 6939 LYS A N     1 
ATOM   1214 C  CA    . LYS A 1 144 ? 91.598  19.570  49.268  1.00 50.01  ? 6939 LYS A CA    1 
ATOM   1215 C  C     . LYS A 1 144 ? 92.443  20.510  48.400  1.00 43.53  ? 6939 LYS A C     1 
ATOM   1216 O  O     . LYS A 1 144 ? 91.853  21.331  47.674  1.00 39.25  ? 6939 LYS A O     1 
ATOM   1217 C  CB    . LYS A 1 144 ? 91.517  18.123  48.763  1.00 55.28  ? 6939 LYS A CB    1 
ATOM   1218 C  CG    . LYS A 1 144 ? 92.836  17.362  48.665  1.00 59.32  ? 6939 LYS A CG    1 
ATOM   1219 C  CD    . LYS A 1 144 ? 93.585  17.588  47.365  1.00 59.04  ? 6939 LYS A CD    1 
ATOM   1220 C  CE    . LYS A 1 144 ? 94.950  16.932  47.336  1.00 61.63  ? 6939 LYS A CE    1 
ATOM   1221 N  NZ    . LYS A 1 144 ? 95.662  17.225  46.070  1.00 58.63  ? 6939 LYS A NZ    1 
ATOM   1222 N  N     . GLU A 1 145 ? 93.770  20.408  48.502  1.00 41.37  ? 6940 GLU A N     1 
ATOM   1223 C  CA    . GLU A 1 145 ? 94.681  21.289  47.728  1.00 39.48  ? 6940 GLU A CA    1 
ATOM   1224 C  C     . GLU A 1 145 ? 94.380  21.162  46.229  1.00 34.20  ? 6940 GLU A C     1 
ATOM   1225 O  O     . GLU A 1 145 ? 94.059  20.049  45.766  1.00 32.54  ? 6940 GLU A O     1 
ATOM   1226 C  CB    . GLU A 1 145 ? 96.139  20.948  48.023  1.00 44.31  ? 6940 GLU A CB    1 
ATOM   1227 C  CG    . GLU A 1 145 ? 97.126  21.789  47.233  1.00 47.09  ? 6940 GLU A CG    1 
ATOM   1228 C  CD    . GLU A 1 145 ? 98.582  21.617  47.632  1.00 54.44  ? 6940 GLU A CD    1 
ATOM   1229 O  OE1   . GLU A 1 145 ? 99.456  21.827  46.763  1.00 59.23  ? 6940 GLU A OE1   1 
ATOM   1230 O  OE2   . GLU A 1 145 ? 98.842  21.299  48.814  1.00 59.30  ? 6940 GLU A OE2   1 
ATOM   1231 N  N     . ASN A 1 146 ? 94.485  22.276  45.508  1.00 30.20  ? 6941 ASN A N     1 
ATOM   1232 C  CA    . ASN A 1 146 ? 94.237  22.289  44.043  1.00 28.07  ? 6941 ASN A CA    1 
ATOM   1233 C  C     . ASN A 1 146 ? 95.567  21.976  43.347  1.00 28.25  ? 6941 ASN A C     1 
ATOM   1234 O  O     . ASN A 1 146 ? 96.298  22.917  42.992  1.00 28.85  ? 6941 ASN A O     1 
ATOM   1235 C  CB    . ASN A 1 146 ? 93.636  23.624  43.607  1.00 26.74  ? 6941 ASN A CB    1 
ATOM   1236 C  CG    . ASN A 1 146 ? 93.340  23.667  42.128  1.00 24.90  ? 6941 ASN A CG    1 
ATOM   1237 O  OD1   . ASN A 1 146 ? 93.376  22.631  41.460  1.00 23.04  ? 6941 ASN A OD1   1 
ATOM   1238 N  ND2   . ASN A 1 146 ? 93.040  24.852  41.619  1.00 24.07  ? 6941 ASN A ND2   1 
ATOM   1239 N  N     A ASP A 1 147 ? 95.861  20.684  43.171  0.70 29.26  ? 6942 ASP A N     1 
ATOM   1240 N  N     B ASP A 1 147 ? 95.867  20.686  43.177  0.30 28.69  ? 6942 ASP A N     1 
ATOM   1241 C  CA    A ASP A 1 147 ? 97.133  20.231  42.549  0.70 30.41  ? 6942 ASP A CA    1 
ATOM   1242 C  CA    B ASP A 1 147 ? 97.145  20.249  42.556  0.30 29.18  ? 6942 ASP A CA    1 
ATOM   1243 C  C     A ASP A 1 147 ? 96.930  19.944  41.060  0.70 27.43  ? 6942 ASP A C     1 
ATOM   1244 C  C     B ASP A 1 147 ? 96.935  19.973  41.065  0.30 26.88  ? 6942 ASP A C     1 
ATOM   1245 O  O     A ASP A 1 147 ? 95.766  19.807  40.622  0.70 25.85  ? 6942 ASP A O     1 
ATOM   1246 O  O     B ASP A 1 147 ? 95.768  19.875  40.633  0.30 25.57  ? 6942 ASP A O     1 
ATOM   1247 C  CB    A ASP A 1 147 ? 97.682  18.988  43.259  0.70 34.23  ? 6942 ASP A CB    1 
ATOM   1248 C  CB    B ASP A 1 147 ? 97.689  18.997  43.245  0.30 31.75  ? 6942 ASP A CB    1 
ATOM   1249 C  CG    A ASP A 1 147 ? 98.297  19.270  44.620  0.70 38.56  ? 6942 ASP A CG    1 
ATOM   1250 C  CG    B ASP A 1 147 ? 96.735  17.817  43.184  0.30 32.29  ? 6942 ASP A CG    1 
ATOM   1251 O  OD1   A ASP A 1 147 ? 98.890  20.356  44.783  0.70 41.62  ? 6942 ASP A OD1   1 
ATOM   1252 O  OD1   B ASP A 1 147 ? 95.545  18.042  42.887  0.30 31.42  ? 6942 ASP A OD1   1 
ATOM   1253 O  OD2   A ASP A 1 147 ? 98.176  18.404  45.508  0.70 42.92  ? 6942 ASP A OD2   1 
ATOM   1254 O  OD2   B ASP A 1 147 ? 97.190  16.683  43.430  0.30 35.17  ? 6942 ASP A OD2   1 
ATOM   1255 N  N     . SER A 1 148 ? 98.040  19.862  40.323  1.00 26.67  ? 6943 SER A N     1 
ATOM   1256 C  CA    . SER A 1 148 ? 98.011  19.534  38.880  1.00 24.73  ? 6943 SER A CA    1 
ATOM   1257 C  C     . SER A 1 148 ? 97.285  18.193  38.711  1.00 24.50  ? 6943 SER A C     1 
ATOM   1258 O  O     . SER A 1 148 ? 97.564  17.262  39.493  1.00 25.02  ? 6943 SER A O     1 
ATOM   1259 C  CB    . SER A 1 148 ? 99.412  19.501  38.327  1.00 25.62  ? 6943 SER A CB    1 
ATOM   1260 O  OG    . SER A 1 148 ? 99.412  19.087  36.978  1.00 23.71  ? 6943 SER A OG    1 
ATOM   1261 N  N     . LYS A 1 149 ? 96.383  18.099  37.736  1.00 22.88  ? 6944 LYS A N     1 
ATOM   1262 C  CA    . LYS A 1 149 ? 95.590  16.856  37.548  1.00 23.71  ? 6944 LYS A CA    1 
ATOM   1263 C  C     . LYS A 1 149 ? 96.224  16.004  36.445  1.00 25.02  ? 6944 LYS A C     1 
ATOM   1264 O  O     . LYS A 1 149 ? 96.784  16.566  35.485  1.00 25.36  ? 6944 LYS A O     1 
ATOM   1265 C  CB    . LYS A 1 149 ? 94.136  17.195  37.201  1.00 22.75  ? 6944 LYS A CB    1 
ATOM   1266 C  CG    . LYS A 1 149 ? 93.397  18.054  38.222  1.00 22.68  ? 6944 LYS A CG    1 
ATOM   1267 C  CD    . LYS A 1 149 ? 93.393  17.479  39.625  1.00 23.92  ? 6944 LYS A CD    1 
ATOM   1268 C  CE    . LYS A 1 149 ? 92.532  18.259  40.601  1.00 24.15  ? 6944 LYS A CE    1 
ATOM   1269 N  NZ    . LYS A 1 149 ? 92.972  19.667  40.718  1.00 23.40  ? 6944 LYS A NZ    1 
ATOM   1270 N  N     A GLU A 1 150 ? 96.120  14.684  36.585  0.70 26.27  ? 6945 GLU A N     1 
ATOM   1271 N  N     B GLU A 1 150 ? 96.146  14.679  36.589  0.30 26.30  ? 6945 GLU A N     1 
ATOM   1272 C  CA    A GLU A 1 150 ? 96.672  13.745  35.575  0.70 27.26  ? 6945 GLU A CA    1 
ATOM   1273 C  CA    B GLU A 1 150 ? 96.685  13.756  35.556  0.30 26.91  ? 6945 GLU A CA    1 
ATOM   1274 C  C     A GLU A 1 150 ? 95.498  13.273  34.713  0.70 26.14  ? 6945 GLU A C     1 
ATOM   1275 C  C     B GLU A 1 150 ? 95.504  13.274  34.705  0.30 25.98  ? 6945 GLU A C     1 
ATOM   1276 O  O     A GLU A 1 150 ? 94.954  14.111  33.968  0.70 24.95  ? 6945 GLU A O     1 
ATOM   1277 O  O     B GLU A 1 150 ? 94.964  14.105  33.948  0.30 24.67  ? 6945 GLU A O     1 
ATOM   1278 C  CB    A GLU A 1 150 ? 97.452  12.629  36.273  0.70 30.59  ? 6945 GLU A CB    1 
ATOM   1279 C  CB    B GLU A 1 150 ? 97.494  12.635  36.211  0.30 29.74  ? 6945 GLU A CB    1 
ATOM   1280 C  CG    A GLU A 1 150 ? 98.655  13.152  37.036  0.70 33.01  ? 6945 GLU A CG    1 
ATOM   1281 C  CG    B GLU A 1 150 ? 98.770  13.132  36.870  0.30 31.50  ? 6945 GLU A CG    1 
ATOM   1282 C  CD    A GLU A 1 150 ? 99.466  12.106  37.777  0.70 37.08  ? 6945 GLU A CD    1 
ATOM   1283 C  CD    B GLU A 1 150 ? 99.730  13.852  35.935  0.30 31.47  ? 6945 GLU A CD    1 
ATOM   1284 O  OE1   A GLU A 1 150 ? 99.311  10.911  37.476  0.70 40.69  ? 6945 GLU A OE1   1 
ATOM   1285 O  OE1   B GLU A 1 150 ? 99.444  13.915  34.724  0.30 31.80  ? 6945 GLU A OE1   1 
ATOM   1286 O  OE2   A GLU A 1 150 ? 100.240 12.495  38.667  0.70 41.44  ? 6945 GLU A OE2   1 
ATOM   1287 O  OE2   B GLU A 1 150 ? 100.765 14.349  36.420  0.30 33.56  ? 6945 GLU A OE2   1 
ATOM   1288 N  N     . GLY A 1 151 ? 95.101  12.007  34.842  1.00 27.02  ? 6946 GLY A N     1 
ATOM   1289 C  CA    . GLY A 1 151 ? 93.970  11.479  34.053  1.00 26.76  ? 6946 GLY A CA    1 
ATOM   1290 C  C     . GLY A 1 151 ? 94.101  11.812  32.577  1.00 24.93  ? 6946 GLY A C     1 
ATOM   1291 O  O     . GLY A 1 151 ? 95.193  11.602  32.022  1.00 24.73  ? 6946 GLY A O     1 
ATOM   1292 N  N     . PHE A 1 152 ? 93.052  12.382  31.970  1.00 23.35  ? 6947 PHE A N     1 
ATOM   1293 C  CA    . PHE A 1 152 ? 93.082  12.644  30.507  1.00 22.09  ? 6947 PHE A CA    1 
ATOM   1294 C  C     . PHE A 1 152 ? 94.156  13.681  30.147  1.00 20.82  ? 6947 PHE A C     1 
ATOM   1295 O  O     . PHE A 1 152 ? 94.573  13.693  28.986  1.00 20.38  ? 6947 PHE A O     1 
ATOM   1296 C  CB    . PHE A 1 152 ? 91.699  13.032  29.974  1.00 22.06  ? 6947 PHE A CB    1 
ATOM   1297 C  CG    . PHE A 1 152 ? 91.117  14.303  30.536  1.00 21.73  ? 6947 PHE A CG    1 
ATOM   1298 C  CD1   . PHE A 1 152 ? 91.617  15.539  30.155  1.00 21.20  ? 6947 PHE A CD1   1 
ATOM   1299 C  CD2   . PHE A 1 152 ? 90.039  14.265  31.406  1.00 23.12  ? 6947 PHE A CD2   1 
ATOM   1300 C  CE1   . PHE A 1 152 ? 91.073  16.711  30.662  1.00 21.14  ? 6947 PHE A CE1   1 
ATOM   1301 C  CE2   . PHE A 1 152 ? 89.497  15.439  31.911  1.00 23.40  ? 6947 PHE A CE2   1 
ATOM   1302 C  CZ    . PHE A 1 152 ? 90.023  16.655  31.547  1.00 21.71  ? 6947 PHE A CZ    1 
ATOM   1303 N  N     . PHE A 1 153 ? 94.602  14.522  31.089  1.00 20.82  ? 6948 PHE A N     1 
ATOM   1304 C  CA    . PHE A 1 153 ? 95.660  15.504  30.728  1.00 20.94  ? 6948 PHE A CA    1 
ATOM   1305 C  C     . PHE A 1 153 ? 96.967  14.788  30.374  1.00 22.37  ? 6948 PHE A C     1 
ATOM   1306 O  O     . PHE A 1 153 ? 97.689  15.294  29.505  1.00 22.43  ? 6948 PHE A O     1 
ATOM   1307 C  CB    . PHE A 1 153 ? 95.889  16.524  31.843  1.00 20.61  ? 6948 PHE A CB    1 
ATOM   1308 C  CG    . PHE A 1 153 ? 94.788  17.539  31.968  1.00 19.88  ? 6948 PHE A CG    1 
ATOM   1309 C  CD1   . PHE A 1 153 ? 94.626  18.510  30.994  1.00 19.52  ? 6948 PHE A CD1   1 
ATOM   1310 C  CD2   . PHE A 1 153 ? 93.940  17.551  33.065  1.00 19.90  ? 6948 PHE A CD2   1 
ATOM   1311 C  CE1   . PHE A 1 153 ? 93.628  19.463  31.103  1.00 19.53  ? 6948 PHE A CE1   1 
ATOM   1312 C  CE2   . PHE A 1 153 ? 92.938  18.503  33.167  1.00 19.61  ? 6948 PHE A CE2   1 
ATOM   1313 C  CZ    . PHE A 1 153 ? 92.789  19.461  32.194  1.00 19.34  ? 6948 PHE A CZ    1 
ATOM   1314 N  N     . THR A 1 154 ? 97.276  13.682  31.055  1.00 23.95  ? 6949 THR A N     1 
ATOM   1315 C  CA    . THR A 1 154 ? 98.505  12.909  30.742  1.00 26.56  ? 6949 THR A CA    1 
ATOM   1316 C  C     . THR A 1 154 ? 98.421  12.473  29.276  1.00 25.42  ? 6949 THR A C     1 
ATOM   1317 O  O     . THR A 1 154 ? 99.415  12.620  28.540  1.00 25.26  ? 6949 THR A O     1 
ATOM   1318 C  CB    . THR A 1 154 ? 98.647  11.699  31.673  1.00 29.23  ? 6949 THR A CB    1 
ATOM   1319 O  OG1   . THR A 1 154 ? 98.585  12.187  33.016  1.00 31.65  ? 6949 THR A OG1   1 
ATOM   1320 C  CG2   . THR A 1 154 ? 99.932  10.930  31.452  1.00 31.94  ? 6949 THR A CG2   1 
ATOM   1321 N  N     . TYR A 1 155 ? 97.244  11.998  28.874  1.00 24.05  ? 6950 TYR A N     1 
ATOM   1322 C  CA    . TYR A 1 155 ? 97.041  11.532  27.481  1.00 24.03  ? 6950 TYR A CA    1 
ATOM   1323 C  C     . TYR A 1 155 ? 97.201  12.700  26.501  1.00 22.99  ? 6950 TYR A C     1 
ATOM   1324 O  O     . TYR A 1 155 ? 97.918  12.557  25.493  1.00 22.41  ? 6950 TYR A O     1 
ATOM   1325 C  CB    . TYR A 1 155 ? 95.663  10.887  27.329  1.00 24.24  ? 6950 TYR A CB    1 
ATOM   1326 C  CG    . TYR A 1 155 ? 95.333  10.537  25.903  1.00 24.48  ? 6950 TYR A CG    1 
ATOM   1327 C  CD1   . TYR A 1 155 ? 95.804  9.367   25.328  1.00 26.24  ? 6950 TYR A CD1   1 
ATOM   1328 C  CD2   . TYR A 1 155 ? 94.582  11.395  25.118  1.00 23.81  ? 6950 TYR A CD2   1 
ATOM   1329 C  CE1   . TYR A 1 155 ? 95.524  9.053   24.006  1.00 26.69  ? 6950 TYR A CE1   1 
ATOM   1330 C  CE2   . TYR A 1 155 ? 94.291  11.093  23.798  1.00 24.75  ? 6950 TYR A CE2   1 
ATOM   1331 C  CZ    . TYR A 1 155 ? 94.761  9.918   23.242  1.00 26.14  ? 6950 TYR A CZ    1 
ATOM   1332 O  OH    . TYR A 1 155 ? 94.464  9.612   21.943  1.00 27.95  ? 6950 TYR A OH    1 
ATOM   1333 N  N     A ILE A 1 156 ? 96.548  13.832  26.784  0.70 22.39  ? 6951 ILE A N     1 
ATOM   1334 N  N     B ILE A 1 156 ? 96.542  13.821  26.818  0.30 21.95  ? 6951 ILE A N     1 
ATOM   1335 C  CA    A ILE A 1 156 ? 96.608  15.003  25.858  0.70 22.82  ? 6951 ILE A CA    1 
ATOM   1336 C  CA    B ILE A 1 156 ? 96.567  15.069  25.997  0.30 21.82  ? 6951 ILE A CA    1 
ATOM   1337 C  C     A ILE A 1 156 ? 98.053  15.488  25.705  0.70 22.80  ? 6951 ILE A C     1 
ATOM   1338 C  C     B ILE A 1 156 ? 98.016  15.487  25.734  0.30 22.41  ? 6951 ILE A C     1 
ATOM   1339 O  O     A ILE A 1 156 ? 98.431  15.810  24.564  0.70 22.70  ? 6951 ILE A O     1 
ATOM   1340 O  O     B ILE A 1 156 ? 98.351  15.746  24.563  0.30 22.68  ? 6951 ILE A O     1 
ATOM   1341 C  CB    A ILE A 1 156 ? 95.656  16.125  26.316  0.70 23.65  ? 6951 ILE A CB    1 
ATOM   1342 C  CB    B ILE A 1 156 ? 95.783  16.192  26.706  0.30 21.37  ? 6951 ILE A CB    1 
ATOM   1343 C  CG1   A ILE A 1 156 ? 94.193  15.734  26.094  0.70 24.42  ? 6951 ILE A CG1   1 
ATOM   1344 C  CG1   B ILE A 1 156 ? 94.274  15.937  26.672  0.30 21.36  ? 6951 ILE A CG1   1 
ATOM   1345 C  CG2   A ILE A 1 156 ? 95.987  17.439  25.619  0.70 24.73  ? 6951 ILE A CG2   1 
ATOM   1346 C  CG2   B ILE A 1 156 ? 96.131  17.550  26.116  0.30 21.75  ? 6951 ILE A CG2   1 
ATOM   1347 C  CD1   A ILE A 1 156 ? 93.794  15.589  24.631  0.70 25.87  ? 6951 ILE A CD1   1 
ATOM   1348 C  CD1   B ILE A 1 156 ? 93.455  17.002  27.367  0.30 20.93  ? 6951 ILE A CD1   1 
ATOM   1349 N  N     . CYS A 1 157 ? 98.827  15.552  26.793  1.00 22.99  ? 6952 CYS A N     1 
ATOM   1350 C  CA    . CYS A 1 157 ? 100.240 16.002  26.670  1.00 24.40  ? 6952 CYS A CA    1 
ATOM   1351 C  C     . CYS A 1 157 ? 101.008 15.060  25.736  1.00 24.79  ? 6952 CYS A C     1 
ATOM   1352 O  O     . CYS A 1 157 ? 101.734 15.557  24.853  1.00 25.10  ? 6952 CYS A O     1 
ATOM   1353 C  CB    . CYS A 1 157 ? 100.913 16.105  28.032  1.00 25.83  ? 6952 CYS A CB    1 
ATOM   1354 S  SG    . CYS A 1 157 ? 100.287 17.489  29.020  1.00 26.93  ? 6952 CYS A SG    1 
ATOM   1355 N  N     . GLY A 1 158 ? 100.822 13.750  25.899  1.00 24.65  ? 6953 GLY A N     1 
ATOM   1356 C  CA    . GLY A 1 158 ? 101.536 12.791  25.037  1.00 25.78  ? 6953 GLY A CA    1 
ATOM   1357 C  C     . GLY A 1 158 ? 101.023 12.849  23.608  1.00 25.69  ? 6953 GLY A C     1 
ATOM   1358 O  O     . GLY A 1 158 ? 101.837 12.711  22.677  1.00 27.09  ? 6953 GLY A O     1 
ATOM   1359 N  N     . PHE A 1 159 ? 99.716  13.069  23.446  1.00 24.89  ? 6954 PHE A N     1 
ATOM   1360 C  CA    . PHE A 1 159 ? 99.094  13.102  22.097  1.00 25.03  ? 6954 PHE A CA    1 
ATOM   1361 C  C     . PHE A 1 159 ? 99.622  14.316  21.326  1.00 26.04  ? 6954 PHE A C     1 
ATOM   1362 O  O     . PHE A 1 159 ? 99.924  14.179  20.127  1.00 27.38  ? 6954 PHE A O     1 
ATOM   1363 C  CB    . PHE A 1 159 ? 97.568  13.079  22.209  1.00 24.75  ? 6954 PHE A CB    1 
ATOM   1364 C  CG    . PHE A 1 159 ? 96.861  12.849  20.897  1.00 24.84  ? 6954 PHE A CG    1 
ATOM   1365 C  CD1   . PHE A 1 159 ? 96.525  13.913  20.077  1.00 25.85  ? 6954 PHE A CD1   1 
ATOM   1366 C  CD2   . PHE A 1 159 ? 96.549  11.569  20.475  1.00 26.05  ? 6954 PHE A CD2   1 
ATOM   1367 C  CE1   . PHE A 1 159 ? 95.889  13.703  18.864  1.00 26.66  ? 6954 PHE A CE1   1 
ATOM   1368 C  CE2   . PHE A 1 159 ? 95.907  11.360  19.263  1.00 27.25  ? 6954 PHE A CE2   1 
ATOM   1369 C  CZ    . PHE A 1 159 ? 95.578  12.427  18.461  1.00 27.05  ? 6954 PHE A CZ    1 
ATOM   1370 N  N     . ILE A 1 160 ? 99.752  15.463  21.999  1.00 26.24  ? 6955 ILE A N     1 
ATOM   1371 C  CA    . ILE A 1 160 ? 100.297 16.682  21.334  1.00 28.66  ? 6955 ILE A CA    1 
ATOM   1372 C  C     . ILE A 1 160 ? 101.740 16.408  20.888  1.00 30.83  ? 6955 ILE A C     1 
ATOM   1373 O  O     . ILE A 1 160 ? 102.058 16.660  19.710  1.00 32.93  ? 6955 ILE A O     1 
ATOM   1374 C  CB    . ILE A 1 160 ? 100.207 17.899  22.276  1.00 28.22  ? 6955 ILE A CB    1 
ATOM   1375 C  CG1   . ILE A 1 160 ? 98.752  18.318  22.506  1.00 27.39  ? 6955 ILE A CG1   1 
ATOM   1376 C  CG2   . ILE A 1 160 ? 101.047 19.053  21.745  1.00 30.81  ? 6955 ILE A CG2   1 
ATOM   1377 C  CD1   . ILE A 1 160 ? 98.558  19.355  23.592  1.00 27.34  ? 6955 ILE A CD1   1 
ATOM   1378 N  N     . GLN A 1 161 ? 102.561 15.867  21.789  1.00 31.45  ? 6956 GLN A N     1 
ATOM   1379 C  CA    . GLN A 1 161 ? 104.006 15.653  21.512  1.00 34.40  ? 6956 GLN A CA    1 
ATOM   1380 C  C     . GLN A 1 161 ? 104.224 14.566  20.449  1.00 34.74  ? 6956 GLN A C     1 
ATOM   1381 O  O     . GLN A 1 161 ? 105.222 14.666  19.717  1.00 36.64  ? 6956 GLN A O     1 
ATOM   1382 C  CB    . GLN A 1 161 ? 104.731 15.321  22.816  1.00 36.97  ? 6956 GLN A CB    1 
ATOM   1383 C  CG    . GLN A 1 161 ? 104.875 16.523  23.738  1.00 39.92  ? 6956 GLN A CG    1 
ATOM   1384 C  CD    . GLN A 1 161 ? 105.545 16.171  25.042  1.00 43.69  ? 6956 GLN A CD    1 
ATOM   1385 O  OE1   . GLN A 1 161 ? 105.003 15.431  25.861  1.00 47.59  ? 6956 GLN A OE1   1 
ATOM   1386 N  NE2   . GLN A 1 161 ? 106.715 16.742  25.263  1.00 47.52  ? 6956 GLN A NE2   1 
ATOM   1387 N  N     . GLN A 1 162 ? 103.325 13.587  20.348  1.00 31.85  ? 6957 GLN A N     1 
ATOM   1388 C  CA    . GLN A 1 162 ? 103.516 12.465  19.387  1.00 33.50  ? 6957 GLN A CA    1 
ATOM   1389 C  C     . GLN A 1 162 ? 102.662 12.615  18.121  1.00 31.21  ? 6957 GLN A C     1 
ATOM   1390 O  O     . GLN A 1 162 ? 103.119 12.133  17.069  1.00 30.76  ? 6957 GLN A O     1 
ATOM   1391 C  CB    . GLN A 1 162 ? 103.146 11.145  20.067  1.00 35.81  ? 6957 GLN A CB    1 
ATOM   1392 C  CG    . GLN A 1 162 ? 103.956 10.856  21.321  1.00 39.46  ? 6957 GLN A CG    1 
ATOM   1393 C  CD    . GLN A 1 162 ? 103.372 9.719   22.124  1.00 43.45  ? 6957 GLN A CD    1 
ATOM   1394 O  OE1   . GLN A 1 162 ? 102.757 8.801   21.583  1.00 47.84  ? 6957 GLN A OE1   1 
ATOM   1395 N  NE2   . GLN A 1 162 ? 103.563 9.773   23.434  1.00 45.88  ? 6957 GLN A NE2   1 
ATOM   1396 N  N     . LYS A 1 163 ? 101.498 13.270  18.195  1.00 28.72  ? 6958 LYS A N     1 
ATOM   1397 C  CA    . LYS A 1 163 ? 100.566 13.241  17.032  1.00 29.07  ? 6958 LYS A CA    1 
ATOM   1398 C  C     . LYS A 1 163 ? 100.162 14.630  16.525  1.00 27.75  ? 6958 LYS A C     1 
ATOM   1399 O  O     . LYS A 1 163 ? 99.306  14.675  15.618  1.00 28.67  ? 6958 LYS A O     1 
ATOM   1400 C  CB    . LYS A 1 163 ? 99.328  12.423  17.415  1.00 29.34  ? 6958 LYS A CB    1 
ATOM   1401 C  CG    . LYS A 1 163 ? 99.625  10.980  17.796  1.00 31.69  ? 6958 LYS A CG    1 
ATOM   1402 C  CD    . LYS A 1 163 ? 100.239 10.199  16.660  1.00 34.43  ? 6958 LYS A CD    1 
ATOM   1403 C  CE    . LYS A 1 163 ? 100.614 8.778   17.016  1.00 37.65  ? 6958 LYS A CE    1 
ATOM   1404 N  NZ    . LYS A 1 163 ? 101.073 8.048   15.813  1.00 39.23  ? 6958 LYS A NZ    1 
ATOM   1405 N  N     . LEU A 1 164 ? 100.723 15.716  17.059  1.00 26.22  ? 6959 LEU A N     1 
ATOM   1406 C  CA    . LEU A 1 164 ? 100.367 17.043  16.490  1.00 25.23  ? 6959 LEU A CA    1 
ATOM   1407 C  C     . LEU A 1 164 ? 101.408 17.420  15.429  1.00 25.41  ? 6959 LEU A C     1 
ATOM   1408 O  O     . LEU A 1 164 ? 102.612 17.370  15.728  1.00 26.32  ? 6959 LEU A O     1 
ATOM   1409 C  CB    . LEU A 1 164 ? 100.310 18.097  17.598  1.00 24.53  ? 6959 LEU A CB    1 
ATOM   1410 C  CG    . LEU A 1 164 ? 99.914  19.501  17.147  1.00 24.51  ? 6959 LEU A CG    1 
ATOM   1411 C  CD1   . LEU A 1 164 ? 98.506  19.517  16.571  1.00 24.22  ? 6959 LEU A CD1   1 
ATOM   1412 C  CD2   . LEU A 1 164 ? 100.022 20.478  18.305  1.00 24.31  ? 6959 LEU A CD2   1 
ATOM   1413 N  N     . ALA A 1 165 ? 100.949 17.777  14.232  1.00 25.02  ? 6960 ALA A N     1 
ATOM   1414 C  CA    . ALA A 1 165 ? 101.867 18.199  13.150  1.00 26.32  ? 6960 ALA A CA    1 
ATOM   1415 C  C     . ALA A 1 165 ? 102.570 19.496  13.552  1.00 26.58  ? 6960 ALA A C     1 
ATOM   1416 O  O     . ALA A 1 165 ? 101.931 20.324  14.239  1.00 25.66  ? 6960 ALA A O     1 
ATOM   1417 C  CB    . ALA A 1 165 ? 101.089 18.406  11.880  1.00 26.34  ? 6960 ALA A CB    1 
ATOM   1418 N  N     . LEU A 1 166 ? 103.840 19.654  13.172  1.00 27.66  ? 6961 LEU A N     1 
ATOM   1419 C  CA    . LEU A 1 166 ? 104.487 20.969  13.408  1.00 28.39  ? 6961 LEU A CA    1 
ATOM   1420 C  C     . LEU A 1 166 ? 103.659 21.990  12.625  1.00 27.29  ? 6961 LEU A C     1 
ATOM   1421 O  O     . LEU A 1 166 ? 103.252 21.672  11.485  1.00 27.66  ? 6961 LEU A O     1 
ATOM   1422 C  CB    . LEU A 1 166 ? 105.947 20.949  12.950  1.00 30.47  ? 6961 LEU A CB    1 
ATOM   1423 C  CG    . LEU A 1 166 ? 106.831 19.876  13.583  1.00 32.30  ? 6961 LEU A CG    1 
ATOM   1424 C  CD1   . LEU A 1 166 ? 108.255 19.985  13.062  1.00 34.86  ? 6961 LEU A CD1   1 
ATOM   1425 C  CD2   . LEU A 1 166 ? 106.818 19.967  15.100  1.00 31.99  ? 6961 LEU A CD2   1 
ATOM   1426 N  N     . GLY A 1 167 ? 103.406 23.154  13.220  1.00 26.63  ? 6962 GLY A N     1 
ATOM   1427 C  CA    . GLY A 1 167 ? 102.547 24.181  12.605  1.00 26.37  ? 6962 GLY A CA    1 
ATOM   1428 C  C     . GLY A 1 167 ? 101.107 24.036  13.062  1.00 25.26  ? 6962 GLY A C     1 
ATOM   1429 O  O     . GLY A 1 167 ? 100.333 24.993  12.875  1.00 25.58  ? 6962 GLY A O     1 
ATOM   1430 N  N     . GLY A 1 168 ? 100.763 22.880  13.644  1.00 24.66  ? 6963 GLY A N     1 
ATOM   1431 C  CA    . GLY A 1 168 ? 99.397  22.609  14.128  1.00 23.58  ? 6963 GLY A CA    1 
ATOM   1432 C  C     . GLY A 1 168 ? 99.060  23.415  15.372  1.00 22.60  ? 6963 GLY A C     1 
ATOM   1433 O  O     . GLY A 1 168 ? 99.974  24.025  15.967  1.00 22.97  ? 6963 GLY A O     1 
ATOM   1434 N  N     . SER A 1 169 ? 97.785  23.407  15.764  1.00 21.56  ? 6964 SER A N     1 
ATOM   1435 C  CA    . SER A 1 169 ? 97.331  24.200  16.933  1.00 20.84  ? 6964 SER A CA    1 
ATOM   1436 C  C     . SER A 1 169 ? 96.428  23.358  17.834  1.00 20.02  ? 6964 SER A C     1 
ATOM   1437 O  O     . SER A 1 169 ? 95.965  22.278  17.399  1.00 19.80  ? 6964 SER A O     1 
ATOM   1438 C  CB    . SER A 1 169 ? 96.646  25.469  16.485  1.00 20.90  ? 6964 SER A CB    1 
ATOM   1439 O  OG    . SER A 1 169 ? 97.570  26.342  15.838  1.00 21.73  ? 6964 SER A OG    1 
ATOM   1440 N  N     . VAL A 1 170 ? 96.225  23.828  19.062  1.00 19.16  ? 6965 VAL A N     1 
ATOM   1441 C  CA    . VAL A 1 170 ? 95.354  23.108  20.029  1.00 18.81  ? 6965 VAL A CA    1 
ATOM   1442 C  C     . VAL A 1 170 ? 94.494  24.119  20.788  1.00 17.96  ? 6965 VAL A C     1 
ATOM   1443 O  O     . VAL A 1 170 ? 94.886  25.295  20.904  1.00 18.25  ? 6965 VAL A O     1 
ATOM   1444 C  CB    . VAL A 1 170 ? 96.174  22.265  21.029  1.00 19.26  ? 6965 VAL A CB    1 
ATOM   1445 C  CG1   . VAL A 1 170 ? 97.152  21.336  20.328  1.00 20.31  ? 6965 VAL A CG1   1 
ATOM   1446 C  CG2   . VAL A 1 170 ? 96.903  23.132  22.046  1.00 20.01  ? 6965 VAL A CG2   1 
ATOM   1447 N  N     . ALA A 1 171 ? 93.345  23.650  21.254  1.00 17.06  ? 6966 ALA A N     1 
ATOM   1448 C  CA    . ALA A 1 171 ? 92.467  24.406  22.175  1.00 16.67  ? 6966 ALA A CA    1 
ATOM   1449 C  C     . ALA A 1 171 ? 91.987  23.369  23.192  1.00 16.90  ? 6966 ALA A C     1 
ATOM   1450 O  O     . ALA A 1 171 ? 91.206  22.469  22.801  1.00 17.15  ? 6966 ALA A O     1 
ATOM   1451 C  CB    . ALA A 1 171 ? 91.349  25.089  21.429  1.00 16.45  ? 6966 ALA A CB    1 
ATOM   1452 N  N     . ILE A 1 172 ? 92.504  23.453  24.422  1.00 17.36  ? 6967 ILE A N     1 
ATOM   1453 C  CA    . ILE A 1 172 ? 92.251  22.445  25.488  1.00 17.50  ? 6967 ILE A CA    1 
ATOM   1454 C  C     . ILE A 1 172 ? 91.501  23.116  26.635  1.00 17.36  ? 6967 ILE A C     1 
ATOM   1455 O  O     . ILE A 1 172 ? 92.054  24.059  27.233  1.00 16.70  ? 6967 ILE A O     1 
ATOM   1456 C  CB    . ILE A 1 172 ? 93.577  21.824  25.976  1.00 18.35  ? 6967 ILE A CB    1 
ATOM   1457 C  CG1   . ILE A 1 172 ? 94.460  21.346  24.820  1.00 19.02  ? 6967 ILE A CG1   1 
ATOM   1458 C  CG2   . ILE A 1 172 ? 93.303  20.713  26.980  1.00 18.44  ? 6967 ILE A CG2   1 
ATOM   1459 C  CD1   . ILE A 1 172 ? 93.840  20.256  23.970  1.00 19.09  ? 6967 ILE A CD1   1 
ATOM   1460 N  N     . LYS A 1 173 ? 90.315  22.608  26.949  1.00 17.16  ? 6968 LYS A N     1 
ATOM   1461 C  CA    . LYS A 1 173 ? 89.505  23.226  28.022  1.00 17.49  ? 6968 LYS A CA    1 
ATOM   1462 C  C     . LYS A 1 173 ? 90.105  22.909  29.392  1.00 17.84  ? 6968 LYS A C     1 
ATOM   1463 O  O     . LYS A 1 173 ? 90.461  21.738  29.657  1.00 17.10  ? 6968 LYS A O     1 
ATOM   1464 C  CB    . LYS A 1 173 ? 88.047  22.775  27.932  1.00 18.53  ? 6968 LYS A CB    1 
ATOM   1465 C  CG    . LYS A 1 173 ? 87.098  23.606  28.781  1.00 19.73  ? 6968 LYS A CG    1 
ATOM   1466 C  CD    . LYS A 1 173 ? 86.830  23.057  30.156  1.00 21.82  ? 6968 LYS A CD    1 
ATOM   1467 C  CE    . LYS A 1 173 ? 85.735  22.013  30.154  1.00 22.51  ? 6968 LYS A CE    1 
ATOM   1468 N  NZ    . LYS A 1 173 ? 84.443  22.577  29.678  1.00 22.95  ? 6968 LYS A NZ    1 
ATOM   1469 N  N     . ILE A 1 174 ? 90.214  23.953  30.211  1.00 17.39  ? 6969 ILE A N     1 
ATOM   1470 C  CA    . ILE A 1 174 ? 90.681  23.854  31.621  1.00 17.60  ? 6969 ILE A CA    1 
ATOM   1471 C  C     . ILE A 1 174 ? 89.697  24.634  32.491  1.00 17.17  ? 6969 ILE A C     1 
ATOM   1472 O  O     . ILE A 1 174 ? 88.854  25.359  31.940  1.00 16.38  ? 6969 ILE A O     1 
ATOM   1473 C  CB    . ILE A 1 174 ? 92.112  24.397  31.803  1.00 18.39  ? 6969 ILE A CB    1 
ATOM   1474 C  CG1   . ILE A 1 174 ? 92.198  25.891  31.474  1.00 19.26  ? 6969 ILE A CG1   1 
ATOM   1475 C  CG2   . ILE A 1 174 ? 93.109  23.572  31.005  1.00 18.70  ? 6969 ILE A CG2   1 
ATOM   1476 C  CD1   . ILE A 1 174 ? 93.446  26.556  31.984  1.00 21.12  ? 6969 ILE A CD1   1 
ATOM   1477 N  N     . THR A 1 175 ? 89.813  24.463  33.807  1.00 17.64  ? 6970 THR A N     1 
ATOM   1478 C  CA    . THR A 1 175 ? 89.020  25.227  34.799  1.00 17.62  ? 6970 THR A CA    1 
ATOM   1479 C  C     . THR A 1 175 ? 89.950  25.503  35.979  1.00 18.15  ? 6970 THR A C     1 
ATOM   1480 O  O     . THR A 1 175 ? 91.134  25.104  35.914  1.00 17.86  ? 6970 THR A O     1 
ATOM   1481 C  CB    . THR A 1 175 ? 87.771  24.469  35.272  1.00 18.19  ? 6970 THR A CB    1 
ATOM   1482 O  OG1   . THR A 1 175 ? 88.199  23.316  36.000  1.00 18.25  ? 6970 THR A OG1   1 
ATOM   1483 C  CG2   . THR A 1 175 ? 86.848  24.063  34.143  1.00 18.31  ? 6970 THR A CG2   1 
ATOM   1484 N  N     . GLU A 1 176 ? 89.434  26.128  37.029  1.00 18.91  ? 6971 GLU A N     1 
ATOM   1485 C  CA    . GLU A 1 176 ? 90.269  26.347  38.231  1.00 19.65  ? 6971 GLU A CA    1 
ATOM   1486 C  C     . GLU A 1 176 ? 90.856  25.010  38.704  1.00 19.93  ? 6971 GLU A C     1 
ATOM   1487 O  O     . GLU A 1 176 ? 92.067  24.963  38.999  1.00 21.05  ? 6971 GLU A O     1 
ATOM   1488 C  CB    . GLU A 1 176 ? 89.418  26.947  39.344  1.00 20.34  ? 6971 GLU A CB    1 
ATOM   1489 C  CG    . GLU A 1 176 ? 90.121  26.984  40.685  1.00 21.66  ? 6971 GLU A CG    1 
ATOM   1490 C  CD    . GLU A 1 176 ? 89.248  27.481  41.820  1.00 22.73  ? 6971 GLU A CD    1 
ATOM   1491 O  OE1   . GLU A 1 176 ? 88.011  27.552  41.628  1.00 23.18  ? 6971 GLU A OE1   1 
ATOM   1492 O  OE2   . GLU A 1 176 ? 89.803  27.800  42.887  1.00 23.66  ? 6971 GLU A OE2   1 
ATOM   1493 N  N     . HIS A 1 177 ? 90.027  23.960  38.744  1.00 19.90  ? 6972 HIS A N     1 
ATOM   1494 C  CA    . HIS A 1 177 ? 90.447  22.648  39.307  1.00 20.28  ? 6972 HIS A CA    1 
ATOM   1495 C  C     . HIS A 1 177 ? 90.823  21.637  38.220  1.00 20.00  ? 6972 HIS A C     1 
ATOM   1496 O  O     . HIS A 1 177 ? 91.541  20.681  38.557  1.00 20.31  ? 6972 HIS A O     1 
ATOM   1497 C  CB    . HIS A 1 177 ? 89.354  22.092  40.222  1.00 21.51  ? 6972 HIS A CB    1 
ATOM   1498 C  CG    . HIS A 1 177 ? 89.138  22.925  41.440  1.00 22.42  ? 6972 HIS A CG    1 
ATOM   1499 N  ND1   . HIS A 1 177 ? 89.834  22.706  42.612  1.00 25.26  ? 6972 HIS A ND1   1 
ATOM   1500 C  CD2   . HIS A 1 177 ? 88.324  23.976  41.670  1.00 22.51  ? 6972 HIS A CD2   1 
ATOM   1501 C  CE1   . HIS A 1 177 ? 89.463  23.597  43.513  1.00 24.87  ? 6972 HIS A CE1   1 
ATOM   1502 N  NE2   . HIS A 1 177 ? 88.528  24.381  42.961  1.00 24.19  ? 6972 HIS A NE2   1 
ATOM   1503 N  N     . SER A 1 178 ? 90.366  21.833  36.984  1.00 19.04  ? 6973 SER A N     1 
ATOM   1504 C  CA    . SER A 1 178 ? 90.701  20.866  35.907  1.00 18.82  ? 6973 SER A CA    1 
ATOM   1505 C  C     . SER A 1 178 ? 91.842  21.460  35.078  1.00 18.55  ? 6973 SER A C     1 
ATOM   1506 O  O     . SER A 1 178 ? 91.567  22.198  34.121  1.00 17.97  ? 6973 SER A O     1 
ATOM   1507 C  CB    . SER A 1 178 ? 89.494  20.537  35.067  1.00 18.62  ? 6973 SER A CB    1 
ATOM   1508 O  OG    . SER A 1 178 ? 89.789  19.494  34.146  1.00 18.19  ? 6973 SER A OG    1 
ATOM   1509 N  N     . TRP A 1 179 ? 93.078  21.150  35.464  1.00 18.91  ? 6974 TRP A N     1 
ATOM   1510 C  CA    . TRP A 1 179 ? 94.272  21.724  34.801  1.00 18.91  ? 6974 TRP A CA    1 
ATOM   1511 C  C     . TRP A 1 179 ? 95.463  20.799  35.019  1.00 19.66  ? 6974 TRP A C     1 
ATOM   1512 O  O     . TRP A 1 179 ? 95.387  19.919  35.912  1.00 20.03  ? 6974 TRP A O     1 
ATOM   1513 C  CB    . TRP A 1 179 ? 94.566  23.124  35.347  1.00 19.09  ? 6974 TRP A CB    1 
ATOM   1514 C  CG    . TRP A 1 179 ? 95.022  23.100  36.772  1.00 19.94  ? 6974 TRP A CG    1 
ATOM   1515 C  CD1   . TRP A 1 179 ? 94.237  22.961  37.879  1.00 20.61  ? 6974 TRP A CD1   1 
ATOM   1516 C  CD2   . TRP A 1 179 ? 96.375  23.194  37.249  1.00 20.75  ? 6974 TRP A CD2   1 
ATOM   1517 N  NE1   . TRP A 1 179 ? 95.005  22.973  39.011  1.00 21.15  ? 6974 TRP A NE1   1 
ATOM   1518 C  CE2   . TRP A 1 179 ? 96.321  23.119  38.657  1.00 21.52  ? 6974 TRP A CE2   1 
ATOM   1519 C  CE3   . TRP A 1 179 ? 97.620  23.352  36.631  1.00 21.05  ? 6974 TRP A CE3   1 
ATOM   1520 C  CZ2   . TRP A 1 179 ? 97.466  23.183  39.449  1.00 22.49  ? 6974 TRP A CZ2   1 
ATOM   1521 C  CZ3   . TRP A 1 179 ? 98.750  23.423  37.414  1.00 22.01  ? 6974 TRP A CZ3   1 
ATOM   1522 C  CH2   . TRP A 1 179 ? 98.672  23.343  38.805  1.00 23.11  ? 6974 TRP A CH2   1 
ATOM   1523 N  N     . ASN A 1 180 ? 96.527  21.045  34.260  1.00 19.89  ? 6975 ASN A N     1 
ATOM   1524 C  CA    . ASN A 1 180 ? 97.747  20.205  34.302  1.00 20.86  ? 6975 ASN A CA    1 
ATOM   1525 C  C     . ASN A 1 180 ? 98.967  21.098  34.064  1.00 21.24  ? 6975 ASN A C     1 
ATOM   1526 O  O     . ASN A 1 180 ? 98.963  21.879  33.090  1.00 20.50  ? 6975 ASN A O     1 
ATOM   1527 C  CB    . ASN A 1 180 ? 97.627  19.042  33.314  1.00 21.12  ? 6975 ASN A CB    1 
ATOM   1528 C  CG    . ASN A 1 180 ? 98.899  18.235  33.199  1.00 22.59  ? 6975 ASN A CG    1 
ATOM   1529 O  OD1   . ASN A 1 180 ? 99.817  18.620  32.479  1.00 23.78  ? 6975 ASN A OD1   1 
ATOM   1530 N  ND2   . ASN A 1 180 ? 98.944  17.095  33.866  1.00 24.81  ? 6975 ASN A ND2   1 
ATOM   1531 N  N     . ALA A 1 181 ? 99.979  20.959  34.918  1.00 22.28  ? 6976 ALA A N     1 
ATOM   1532 C  CA    . ALA A 1 181 ? 101.194 21.804  34.839  1.00 23.48  ? 6976 ALA A CA    1 
ATOM   1533 C  C     . ALA A 1 181 ? 101.969 21.511  33.551  1.00 24.06  ? 6976 ALA A C     1 
ATOM   1534 O  O     . ALA A 1 181 ? 102.476 22.472  32.944  1.00 24.18  ? 6976 ALA A O     1 
ATOM   1535 C  CB    . ALA A 1 181 ? 102.047 21.580  36.063  1.00 24.32  ? 6976 ALA A CB    1 
ATOM   1536 N  N     . ASP A 1 182 ? 102.054 20.237  33.153  1.00 24.83  ? 6977 ASP A N     1 
ATOM   1537 C  CA    . ASP A 1 182 ? 102.808 19.850  31.927  1.00 26.46  ? 6977 ASP A CA    1 
ATOM   1538 C  C     . ASP A 1 182 ? 102.134 20.455  30.687  1.00 24.90  ? 6977 ASP A C     1 
ATOM   1539 O  O     . ASP A 1 182 ? 102.860 20.809  29.741  1.00 24.75  ? 6977 ASP A O     1 
ATOM   1540 C  CB    . ASP A 1 182 ? 102.962 18.330  31.817  1.00 29.22  ? 6977 ASP A CB    1 
ATOM   1541 C  CG    . ASP A 1 182 ? 103.959 17.735  32.798  1.00 33.93  ? 6977 ASP A CG    1 
ATOM   1542 O  OD1   . ASP A 1 182 ? 104.875 18.470  33.231  1.00 36.02  ? 6977 ASP A OD1   1 
ATOM   1543 O  OD2   . ASP A 1 182 ? 103.818 16.538  33.119  1.00 39.77  ? 6977 ASP A OD2   1 
ATOM   1544 N  N     . LEU A 1 183 ? 100.804 20.577  30.692  1.00 23.25  ? 6978 LEU A N     1 
ATOM   1545 C  CA    . LEU A 1 183 ? 100.092 21.174  29.533  1.00 22.37  ? 6978 LEU A CA    1 
ATOM   1546 C  C     . LEU A 1 183 ? 100.480 22.655  29.410  1.00 21.69  ? 6978 LEU A C     1 
ATOM   1547 O  O     . LEU A 1 183 ? 100.726 23.107  28.281  1.00 21.58  ? 6978 LEU A O     1 
ATOM   1548 C  CB    . LEU A 1 183 ? 98.582  20.994  29.710  1.00 21.82  ? 6978 LEU A CB    1 
ATOM   1549 C  CG    . LEU A 1 183 ? 97.730  21.561  28.578  1.00 21.98  ? 6978 LEU A CG    1 
ATOM   1550 C  CD1   . LEU A 1 183 ? 98.102  20.936  27.247  1.00 22.80  ? 6978 LEU A CD1   1 
ATOM   1551 C  CD2   . LEU A 1 183 ? 96.253  21.374  28.864  1.00 21.72  ? 6978 LEU A CD2   1 
ATOM   1552 N  N     . TYR A 1 184 ? 100.512 23.394  30.523  1.00 21.63  ? 6979 TYR A N     1 
ATOM   1553 C  CA    . TYR A 1 184 ? 100.982 24.803  30.446  1.00 22.19  ? 6979 TYR A CA    1 
ATOM   1554 C  C     . TYR A 1 184 ? 102.428 24.848  29.937  1.00 23.34  ? 6979 TYR A C     1 
ATOM   1555 O  O     . TYR A 1 184 ? 102.746 25.720  29.111  1.00 24.00  ? 6979 TYR A O     1 
ATOM   1556 C  CB    . TYR A 1 184 ? 100.916 25.492  31.804  1.00 22.02  ? 6979 TYR A CB    1 
ATOM   1557 C  CG    . TYR A 1 184 ? 99.581  26.066  32.193  1.00 21.30  ? 6979 TYR A CG    1 
ATOM   1558 C  CD1   . TYR A 1 184 ? 99.155  27.273  31.665  1.00 21.15  ? 6979 TYR A CD1   1 
ATOM   1559 C  CD2   . TYR A 1 184 ? 98.786  25.459  33.152  1.00 21.08  ? 6979 TYR A CD2   1 
ATOM   1560 C  CE1   . TYR A 1 184 ? 97.959  27.852  32.055  1.00 20.70  ? 6979 TYR A CE1   1 
ATOM   1561 C  CE2   . TYR A 1 184 ? 97.582  26.019  33.546  1.00 20.89  ? 6979 TYR A CE2   1 
ATOM   1562 C  CZ    . TYR A 1 184 ? 97.173  27.227  33.005  1.00 20.17  ? 6979 TYR A CZ    1 
ATOM   1563 O  OH    . TYR A 1 184 ? 96.003  27.809  33.391  1.00 20.46  ? 6979 TYR A OH    1 
ATOM   1564 N  N     . LYS A 1 185 ? 103.284 23.956  30.445  1.00 24.93  ? 6980 LYS A N     1 
ATOM   1565 C  CA    . LYS A 1 185 ? 104.701 23.901  30.000  1.00 26.59  ? 6980 LYS A CA    1 
ATOM   1566 C  C     . LYS A 1 185 ? 104.748 23.684  28.479  1.00 25.94  ? 6980 LYS A C     1 
ATOM   1567 O  O     . LYS A 1 185 ? 105.563 24.348  27.800  1.00 25.83  ? 6980 LYS A O     1 
ATOM   1568 C  CB    . LYS A 1 185 ? 105.431 22.800  30.775  1.00 29.76  ? 6980 LYS A CB    1 
ATOM   1569 C  CG    . LYS A 1 185 ? 106.914 22.650  30.472  1.00 33.83  ? 6980 LYS A CG    1 
ATOM   1570 C  CD    . LYS A 1 185 ? 107.585 21.595  31.332  1.00 37.77  ? 6980 LYS A CD    1 
ATOM   1571 C  CE    . LYS A 1 185 ? 109.055 21.432  31.022  1.00 42.30  ? 6980 LYS A CE    1 
ATOM   1572 N  NZ    . LYS A 1 185 ? 109.677 20.377  31.859  1.00 47.06  ? 6980 LYS A NZ    1 
ATOM   1573 N  N     A LEU A 1 186 ? 103.893 22.793  27.959  0.50 25.01  ? 6981 LEU A N     1 
ATOM   1574 N  N     B LEU A 1 186 ? 103.870 22.815  27.972  0.50 25.17  ? 6981 LEU A N     1 
ATOM   1575 C  CA    A LEU A 1 186 ? 103.861 22.494  26.497  0.50 24.90  ? 6981 LEU A CA    1 
ATOM   1576 C  CA    B LEU A 1 186 ? 103.821 22.473  26.524  0.50 25.17  ? 6981 LEU A CA    1 
ATOM   1577 C  C     A LEU A 1 186 ? 103.407 23.723  25.701  0.50 24.44  ? 6981 LEU A C     1 
ATOM   1578 C  C     B LEU A 1 186 ? 103.374 23.692  25.703  0.50 24.60  ? 6981 LEU A C     1 
ATOM   1579 O  O     A LEU A 1 186 ? 103.749 23.796  24.507  0.50 24.87  ? 6981 LEU A O     1 
ATOM   1580 O  O     B LEU A 1 186 ? 103.686 23.728  24.499  0.50 25.04  ? 6981 LEU A O     1 
ATOM   1581 C  CB    A LEU A 1 186 ? 102.949 21.294  26.226  0.50 24.43  ? 6981 LEU A CB    1 
ATOM   1582 C  CB    B LEU A 1 186 ? 102.875 21.282  26.346  0.50 24.90  ? 6981 LEU A CB    1 
ATOM   1583 C  CG    A LEU A 1 186 ? 103.552 19.932  26.562  0.50 25.32  ? 6981 LEU A CG    1 
ATOM   1584 C  CG    B LEU A 1 186 ? 102.918 20.596  24.983  0.50 25.37  ? 6981 LEU A CG    1 
ATOM   1585 C  CD1   A LEU A 1 186 ? 102.552 18.816  26.314  0.50 24.77  ? 6981 LEU A CD1   1 
ATOM   1586 C  CD1   B LEU A 1 186 ? 104.346 20.262  24.582  0.50 26.68  ? 6981 LEU A CD1   1 
ATOM   1587 C  CD2   A LEU A 1 186 ? 104.824 19.693  25.762  0.50 26.60  ? 6981 LEU A CD2   1 
ATOM   1588 C  CD2   B LEU A 1 186 ? 102.061 19.342  24.993  0.50 25.40  ? 6981 LEU A CD2   1 
ATOM   1589 N  N     . MET A 1 187 ? 102.672 24.650  26.322  1.00 23.81  ? 6982 MET A N     1 
ATOM   1590 C  CA    . MET A 1 187 ? 102.252 25.879  25.593  1.00 23.89  ? 6982 MET A CA    1 
ATOM   1591 C  C     . MET A 1 187 ? 103.514 26.628  25.130  1.00 24.64  ? 6982 MET A C     1 
ATOM   1592 O  O     . MET A 1 187 ? 103.443 27.351  24.120  1.00 24.63  ? 6982 MET A O     1 
ATOM   1593 C  CB    . MET A 1 187 ? 101.397 26.810  26.460  1.00 24.03  ? 6982 MET A CB    1 
ATOM   1594 C  CG    . MET A 1 187 ? 99.988  26.307  26.771  1.00 23.91  ? 6982 MET A CG    1 
ATOM   1595 S  SD    . MET A 1 187 ? 98.960  25.980  25.303  1.00 24.85  ? 6982 MET A SD    1 
ATOM   1596 C  CE    . MET A 1 187 ? 99.209  24.217  25.127  1.00 25.69  ? 6982 MET A CE    1 
ATOM   1597 N  N     . GLY A 1 188 ? 104.638 26.430  25.828  1.00 25.26  ? 6983 GLY A N     1 
ATOM   1598 C  CA    . GLY A 1 188 ? 105.912 27.079  25.458  1.00 26.72  ? 6983 GLY A CA    1 
ATOM   1599 C  C     . GLY A 1 188 ? 106.559 26.436  24.238  1.00 27.37  ? 6983 GLY A C     1 
ATOM   1600 O  O     . GLY A 1 188 ? 107.611 26.941  23.801  1.00 28.98  ? 6983 GLY A O     1 
ATOM   1601 N  N     . HIS A 1 189 ? 105.953 25.367  23.705  1.00 26.97  ? 6984 HIS A N     1 
ATOM   1602 C  CA    . HIS A 1 189 ? 106.459 24.632  22.511  1.00 27.60  ? 6984 HIS A CA    1 
ATOM   1603 C  C     . HIS A 1 189 ? 105.709 25.105  21.262  1.00 26.86  ? 6984 HIS A C     1 
ATOM   1604 O  O     . HIS A 1 189 ? 105.881 24.487  20.195  1.00 27.33  ? 6984 HIS A O     1 
ATOM   1605 C  CB    . HIS A 1 189 ? 106.322 23.118  22.715  1.00 28.05  ? 6984 HIS A CB    1 
ATOM   1606 C  CG    . HIS A 1 189 ? 107.187 22.559  23.794  1.00 29.43  ? 6984 HIS A CG    1 
ATOM   1607 N  ND1   . HIS A 1 189 ? 107.959 21.427  23.602  1.00 31.44  ? 6984 HIS A ND1   1 
ATOM   1608 C  CD2   . HIS A 1 189 ? 107.428 22.972  25.057  1.00 30.13  ? 6984 HIS A CD2   1 
ATOM   1609 C  CE1   . HIS A 1 189 ? 108.620 21.155  24.709  1.00 32.18  ? 6984 HIS A CE1   1 
ATOM   1610 N  NE2   . HIS A 1 189 ? 108.318 22.093  25.616  1.00 31.46  ? 6984 HIS A NE2   1 
ATOM   1611 N  N     . PHE A 1 190 ? 104.895 26.152  21.412  1.00 25.78  ? 6985 PHE A N     1 
ATOM   1612 C  CA    . PHE A 1 190 ? 104.127 26.760  20.295  1.00 25.38  ? 6985 PHE A CA    1 
ATOM   1613 C  C     . PHE A 1 190 ? 104.691 28.154  20.021  1.00 26.12  ? 6985 PHE A C     1 
ATOM   1614 O  O     . PHE A 1 190 ? 105.331 28.721  20.927  1.00 27.08  ? 6985 PHE A O     1 
ATOM   1615 C  CB    . PHE A 1 190 ? 102.637 26.836  20.640  1.00 23.70  ? 6985 PHE A CB    1 
ATOM   1616 C  CG    . PHE A 1 190 ? 101.945 25.501  20.735  1.00 22.58  ? 6985 PHE A CG    1 
ATOM   1617 C  CD1   . PHE A 1 190 ? 102.034 24.732  21.884  1.00 22.35  ? 6985 PHE A CD1   1 
ATOM   1618 C  CD2   . PHE A 1 190 ? 101.204 25.011  19.672  1.00 22.46  ? 6985 PHE A CD2   1 
ATOM   1619 C  CE1   . PHE A 1 190 ? 101.398 23.504  21.967  1.00 21.91  ? 6985 PHE A CE1   1 
ATOM   1620 C  CE2   . PHE A 1 190 ? 100.563 23.785  19.761  1.00 21.61  ? 6985 PHE A CE2   1 
ATOM   1621 C  CZ    . PHE A 1 190 ? 100.664 23.032  20.905  1.00 21.21  ? 6985 PHE A CZ    1 
ATOM   1622 N  N     . ALA A 1 191 ? 104.444 28.689  18.823  1.00 26.44  ? 6986 ALA A N     1 
ATOM   1623 C  CA    . ALA A 1 191 ? 104.931 30.043  18.471  1.00 27.36  ? 6986 ALA A CA    1 
ATOM   1624 C  C     . ALA A 1 191 ? 104.223 31.076  19.353  1.00 26.77  ? 6986 ALA A C     1 
ATOM   1625 O  O     . ALA A 1 191 ? 104.816 32.133  19.635  1.00 26.75  ? 6986 ALA A O     1 
ATOM   1626 C  CB    . ALA A 1 191 ? 104.689 30.313  17.009  1.00 28.25  ? 6986 ALA A CB    1 
ATOM   1627 N  N     . TRP A 1 192 ? 103.000 30.758  19.783  1.00 25.53  ? 6987 TRP A N     1 
ATOM   1628 C  CA    . TRP A 1 192 ? 102.198 31.689  20.617  1.00 25.70  ? 6987 TRP A CA    1 
ATOM   1629 C  C     . TRP A 1 192 ? 101.163 30.881  21.400  1.00 23.97  ? 6987 TRP A C     1 
ATOM   1630 O  O     . TRP A 1 192 ? 100.798 29.782  20.937  1.00 22.70  ? 6987 TRP A O     1 
ATOM   1631 C  CB    . TRP A 1 192 ? 101.535 32.745  19.729  1.00 27.01  ? 6987 TRP A CB    1 
ATOM   1632 C  CG    . TRP A 1 192 ? 100.829 33.840  20.470  1.00 28.08  ? 6987 TRP A CG    1 
ATOM   1633 C  CD1   . TRP A 1 192 ? 101.378 34.995  20.949  1.00 30.16  ? 6987 TRP A CD1   1 
ATOM   1634 C  CD2   . TRP A 1 192 ? 99.428  33.907  20.780  1.00 28.21  ? 6987 TRP A CD2   1 
ATOM   1635 N  NE1   . TRP A 1 192 ? 100.418 35.767  21.547  1.00 30.11  ? 6987 TRP A NE1   1 
ATOM   1636 C  CE2   . TRP A 1 192 ? 99.213  35.127  21.458  1.00 29.22  ? 6987 TRP A CE2   1 
ATOM   1637 C  CE3   . TRP A 1 192 ? 98.339  33.057  20.557  1.00 28.86  ? 6987 TRP A CE3   1 
ATOM   1638 C  CZ2   . TRP A 1 192 ? 97.955  35.510  21.916  1.00 29.74  ? 6987 TRP A CZ2   1 
ATOM   1639 C  CZ3   . TRP A 1 192 ? 97.094  33.441  21.007  1.00 28.75  ? 6987 TRP A CZ3   1 
ATOM   1640 C  CH2   . TRP A 1 192 ? 96.909  34.655  21.666  1.00 28.62  ? 6987 TRP A CH2   1 
ATOM   1641 N  N     . TRP A 1 193 ? 100.727 31.404  22.545  1.00 22.62  ? 6988 TRP A N     1 
ATOM   1642 C  CA    . TRP A 1 193 ? 99.713  30.680  23.348  1.00 21.83  ? 6988 TRP A CA    1 
ATOM   1643 C  C     . TRP A 1 193 ? 98.907  31.687  24.163  1.00 21.44  ? 6988 TRP A C     1 
ATOM   1644 O  O     . TRP A 1 193 ? 99.375  32.841  24.359  1.00 21.57  ? 6988 TRP A O     1 
ATOM   1645 C  CB    . TRP A 1 193 ? 100.371 29.661  24.287  1.00 22.36  ? 6988 TRP A CB    1 
ATOM   1646 C  CG    . TRP A 1 193 ? 100.950 30.306  25.507  1.00 22.90  ? 6988 TRP A CG    1 
ATOM   1647 C  CD1   . TRP A 1 193 ? 102.168 30.910  25.620  1.00 24.22  ? 6988 TRP A CD1   1 
ATOM   1648 C  CD2   . TRP A 1 193 ? 100.305 30.460  26.786  1.00 22.53  ? 6988 TRP A CD2   1 
ATOM   1649 N  NE1   . TRP A 1 193 ? 102.327 31.424  26.880  1.00 24.35  ? 6988 TRP A NE1   1 
ATOM   1650 C  CE2   . TRP A 1 193 ? 101.203 31.161  27.618  1.00 23.39  ? 6988 TRP A CE2   1 
ATOM   1651 C  CE3   . TRP A 1 193 ? 99.063  30.075  27.307  1.00 21.76  ? 6988 TRP A CE3   1 
ATOM   1652 C  CZ2   . TRP A 1 193 ? 100.895 31.479  28.940  1.00 23.79  ? 6988 TRP A CZ2   1 
ATOM   1653 C  CZ3   . TRP A 1 193 ? 98.759  30.391  28.614  1.00 22.18  ? 6988 TRP A CZ3   1 
ATOM   1654 C  CH2   . TRP A 1 193 ? 99.665  31.083  29.418  1.00 22.68  ? 6988 TRP A CH2   1 
ATOM   1655 N  N     . THR A 1 194 ? 97.742  31.254  24.624  1.00 20.48  ? 6989 THR A N     1 
ATOM   1656 C  CA    . THR A 1 194 ? 96.940  32.091  25.540  1.00 20.24  ? 6989 THR A CA    1 
ATOM   1657 C  C     . THR A 1 194 ? 95.924  31.212  26.258  1.00 19.39  ? 6989 THR A C     1 
ATOM   1658 O  O     . THR A 1 194 ? 95.818  30.013  25.930  1.00 19.55  ? 6989 THR A O     1 
ATOM   1659 C  CB    . THR A 1 194 ? 96.202  33.218  24.807  1.00 20.96  ? 6989 THR A CB    1 
ATOM   1660 O  OG1   . THR A 1 194 ? 95.763  34.143  25.802  1.00 20.58  ? 6989 THR A OG1   1 
ATOM   1661 C  CG2   . THR A 1 194 ? 95.028  32.732  23.984  1.00 21.02  ? 6989 THR A CG2   1 
ATOM   1662 N  N     . ALA A 1 195 ? 95.265  31.804  27.244  1.00 18.72  ? 6990 ALA A N     1 
ATOM   1663 C  CA    . ALA A 1 195 ? 94.106  31.198  27.925  1.00 18.13  ? 6990 ALA A CA    1 
ATOM   1664 C  C     . ALA A 1 195 ? 92.929  32.067  27.489  1.00 17.88  ? 6990 ALA A C     1 
ATOM   1665 O  O     . ALA A 1 195 ? 92.967  33.287  27.761  1.00 18.21  ? 6990 ALA A O     1 
ATOM   1666 C  CB    . ALA A 1 195 ? 94.298  31.166  29.419  1.00 18.49  ? 6990 ALA A CB    1 
ATOM   1667 N  N     . PHE A 1 196 ? 91.969  31.476  26.778  1.00 17.74  ? 6991 PHE A N     1 
ATOM   1668 C  CA    . PHE A 1 196 ? 90.832  32.240  26.212  1.00 17.58  ? 6991 PHE A CA    1 
ATOM   1669 C  C     . PHE A 1 196 ? 89.539  31.915  26.959  1.00 17.20  ? 6991 PHE A C     1 
ATOM   1670 O  O     . PHE A 1 196 ? 89.186  30.731  27.110  1.00 16.77  ? 6991 PHE A O     1 
ATOM   1671 C  CB    . PHE A 1 196 ? 90.681  31.944  24.718  1.00 17.97  ? 6991 PHE A CB    1 
ATOM   1672 C  CG    . PHE A 1 196 ? 89.486  32.607  24.084  1.00 18.32  ? 6991 PHE A CG    1 
ATOM   1673 C  CD1   . PHE A 1 196 ? 89.500  33.961  23.794  1.00 19.44  ? 6991 PHE A CD1   1 
ATOM   1674 C  CD2   . PHE A 1 196 ? 88.349  31.876  23.777  1.00 18.80  ? 6991 PHE A CD2   1 
ATOM   1675 C  CE1   . PHE A 1 196 ? 88.395  34.574  23.221  1.00 19.69  ? 6991 PHE A CE1   1 
ATOM   1676 C  CE2   . PHE A 1 196 ? 87.248  32.489  23.198  1.00 19.35  ? 6991 PHE A CE2   1 
ATOM   1677 C  CZ    . PHE A 1 196 ? 87.271  33.835  22.929  1.00 19.66  ? 6991 PHE A CZ    1 
ATOM   1678 N  N     . VAL A 1 197 ? 88.840  32.971  27.369  1.00 17.53  ? 6992 VAL A N     1 
ATOM   1679 C  CA    . VAL A 1 197 ? 87.545  32.852  28.091  1.00 17.39  ? 6992 VAL A CA    1 
ATOM   1680 C  C     . VAL A 1 197 ? 86.422  33.285  27.150  1.00 17.44  ? 6992 VAL A C     1 
ATOM   1681 O  O     . VAL A 1 197 ? 86.473  34.433  26.676  1.00 17.92  ? 6992 VAL A O     1 
ATOM   1682 C  CB    . VAL A 1 197 ? 87.556  33.717  29.363  1.00 18.26  ? 6992 VAL A CB    1 
ATOM   1683 C  CG1   . VAL A 1 197 ? 86.208  33.709  30.061  1.00 18.87  ? 6992 VAL A CG1   1 
ATOM   1684 C  CG2   . VAL A 1 197 ? 88.667  33.288  30.308  1.00 18.81  ? 6992 VAL A CG2   1 
ATOM   1685 N  N     . THR A 1 198 ? 85.456  32.402  26.879  1.00 17.12  ? 6993 THR A N     1 
ATOM   1686 C  CA    . THR A 1 198 ? 84.315  32.826  26.026  1.00 17.17  ? 6993 THR A CA    1 
ATOM   1687 C  C     . THR A 1 198 ? 83.475  33.847  26.798  1.00 17.81  ? 6993 THR A C     1 
ATOM   1688 O  O     . THR A 1 198 ? 83.329  33.717  28.039  1.00 18.24  ? 6993 THR A O     1 
ATOM   1689 C  CB    . THR A 1 198 ? 83.459  31.643  25.556  1.00 17.43  ? 6993 THR A CB    1 
ATOM   1690 O  OG1   . THR A 1 198 ? 82.799  31.072  26.687  1.00 18.06  ? 6993 THR A OG1   1 
ATOM   1691 C  CG2   . THR A 1 198 ? 84.268  30.595  24.824  1.00 17.28  ? 6993 THR A CG2   1 
ATOM   1692 N  N     . ASN A 1 199 ? 82.940  34.836  26.091  1.00 18.42  ? 6994 ASN A N     1 
ATOM   1693 C  CA    . ASN A 1 199 ? 82.091  35.856  26.757  1.00 18.99  ? 6994 ASN A CA    1 
ATOM   1694 C  C     . ASN A 1 199 ? 80.780  35.240  27.265  1.00 19.03  ? 6994 ASN A C     1 
ATOM   1695 O  O     . ASN A 1 199 ? 80.241  35.758  28.259  1.00 19.65  ? 6994 ASN A O     1 
ATOM   1696 C  CB    . ASN A 1 199 ? 81.829  37.058  25.850  1.00 20.02  ? 6994 ASN A CB    1 
ATOM   1697 C  CG    . ASN A 1 199 ? 82.889  38.128  25.979  1.00 21.19  ? 6994 ASN A CG    1 
ATOM   1698 O  OD1   . ASN A 1 199 ? 83.593  38.194  26.990  1.00 21.07  ? 6994 ASN A OD1   1 
ATOM   1699 N  ND2   . ASN A 1 199 ? 82.965  39.005  24.990  1.00 21.42  ? 6994 ASN A ND2   1 
ATOM   1700 N  N     A VAL A 1 200 ? 80.274  34.173  26.629  0.60 18.23  ? 6995 VAL A N     1 
ATOM   1701 N  N     B VAL A 1 200 ? 80.327  34.158  26.628  0.40 18.89  ? 6995 VAL A N     1 
ATOM   1702 C  CA    A VAL A 1 200 ? 78.985  33.574  27.105  0.60 18.51  ? 6995 VAL A CA    1 
ATOM   1703 C  CA    B VAL A 1 200 ? 79.038  33.512  27.004  0.40 19.42  ? 6995 VAL A CA    1 
ATOM   1704 C  C     A VAL A 1 200 ? 79.216  32.805  28.409  0.60 18.67  ? 6995 VAL A C     1 
ATOM   1705 C  C     B VAL A 1 200 ? 79.209  32.719  28.307  0.40 19.22  ? 6995 VAL A C     1 
ATOM   1706 O  O     A VAL A 1 200 ? 78.242  32.660  29.172  0.60 18.70  ? 6995 VAL A O     1 
ATOM   1707 O  O     B VAL A 1 200 ? 78.183  32.465  28.970  0.40 19.42  ? 6995 VAL A O     1 
ATOM   1708 C  CB    A VAL A 1 200 ? 78.300  32.665  26.063  0.60 18.17  ? 6995 VAL A CB    1 
ATOM   1709 C  CB    B VAL A 1 200 ? 78.527  32.619  25.859  0.40 19.71  ? 6995 VAL A CB    1 
ATOM   1710 C  CG1   A VAL A 1 200 ? 77.723  33.458  24.905  0.60 18.30  ? 6995 VAL A CG1   1 
ATOM   1711 C  CG1   B VAL A 1 200 ? 79.308  31.316  25.768  0.40 19.15  ? 6995 VAL A CG1   1 
ATOM   1712 C  CG2   A VAL A 1 200 ? 79.208  31.547  25.571  0.60 17.60  ? 6995 VAL A CG2   1 
ATOM   1713 C  CG2   B VAL A 1 200 ? 77.045  32.340  25.991  0.40 20.59  ? 6995 VAL A CG2   1 
ATOM   1714 N  N     . ASN A 1 201 ? 80.443  32.341  28.664  1.00 18.51  ? 6996 ASN A N     1 
ATOM   1715 C  CA    . ASN A 1 201 ? 80.690  31.555  29.902  1.00 19.51  ? 6996 ASN A CA    1 
ATOM   1716 C  C     . ASN A 1 201 ? 81.681  32.285  30.818  1.00 20.33  ? 6996 ASN A C     1 
ATOM   1717 O  O     . ASN A 1 201 ? 82.346  31.614  31.620  1.00 22.14  ? 6996 ASN A O     1 
ATOM   1718 C  CB    . ASN A 1 201 ? 81.178  30.149  29.553  1.00 19.51  ? 6996 ASN A CB    1 
ATOM   1719 C  CG    . ASN A 1 201 ? 80.873  29.147  30.642  1.00 20.47  ? 6996 ASN A CG    1 
ATOM   1720 O  OD1   . ASN A 1 201 ? 79.922  29.335  31.404  1.00 21.20  ? 6996 ASN A OD1   1 
ATOM   1721 N  ND2   . ASN A 1 201 ? 81.648  28.075  30.704  1.00 18.95  ? 6996 ASN A ND2   1 
ATOM   1722 N  N     . ALA A 1 202 ? 81.706  33.616  30.754  1.00 20.89  ? 6997 ALA A N     1 
ATOM   1723 C  CA    . ALA A 1 202 ? 82.659  34.443  31.532  1.00 21.71  ? 6997 ALA A CA    1 
ATOM   1724 C  C     . ALA A 1 202 ? 82.450  34.298  33.051  1.00 21.79  ? 6997 ALA A C     1 
ATOM   1725 O  O     . ALA A 1 202 ? 83.372  34.682  33.794  1.00 22.25  ? 6997 ALA A O     1 
ATOM   1726 C  CB    . ALA A 1 202 ? 82.518  35.877  31.094  1.00 23.54  ? 6997 ALA A CB    1 
ATOM   1727 N  N     . SER A 1 203 ? 81.313  33.748  33.498  1.00 21.48  ? 6998 SER A N     1 
ATOM   1728 C  CA    . SER A 1 203 ? 81.056  33.590  34.957  1.00 22.52  ? 6998 SER A CA    1 
ATOM   1729 C  C     . SER A 1 203 ? 81.656  32.274  35.470  1.00 21.35  ? 6998 SER A C     1 
ATOM   1730 O  O     . SER A 1 203 ? 81.494  31.975  36.666  1.00 22.30  ? 6998 SER A O     1 
ATOM   1731 C  CB    . SER A 1 203 ? 79.580  33.689  35.273  1.00 24.57  ? 6998 SER A CB    1 
ATOM   1732 O  OG    . SER A 1 203 ? 78.889  32.526  34.849  1.00 26.44  ? 6998 SER A OG    1 
ATOM   1733 N  N     . SER A 1 204 ? 82.333  31.531  34.592  1.00 19.88  ? 6999 SER A N     1 
ATOM   1734 C  CA    . SER A 1 204 ? 82.984  30.243  34.943  1.00 19.56  ? 6999 SER A CA    1 
ATOM   1735 C  C     . SER A 1 204 ? 84.508  30.402  34.918  1.00 18.67  ? 6999 SER A C     1 
ATOM   1736 O  O     . SER A 1 204 ? 85.000  31.220  34.119  1.00 18.26  ? 6999 SER A O     1 
ATOM   1737 C  CB    . SER A 1 204 ? 82.554  29.157  33.980  1.00 19.50  ? 6999 SER A CB    1 
ATOM   1738 O  OG    . SER A 1 204 ? 83.317  27.975  34.178  1.00 19.43  ? 6999 SER A OG    1 
ATOM   1739 N  N     . SER A 1 205 ? 85.219  29.622  35.742  1.00 18.48  ? 7000 SER A N     1 
ATOM   1740 C  CA    . SER A 1 205 ? 86.707  29.605  35.746  1.00 18.54  ? 7000 SER A CA    1 
ATOM   1741 C  C     . SER A 1 205 ? 87.218  28.883  34.492  1.00 17.97  ? 7000 SER A C     1 
ATOM   1742 O  O     . SER A 1 205 ? 88.450  28.778  34.302  1.00 17.69  ? 7000 SER A O     1 
ATOM   1743 C  CB    . SER A 1 205 ? 87.236  28.962  36.996  1.00 19.23  ? 7000 SER A CB    1 
ATOM   1744 O  OG    . SER A 1 205 ? 86.875  27.590  37.044  1.00 19.11  ? 7000 SER A OG    1 
ATOM   1745 N  N     . GLU A 1 206 ? 86.298  28.361  33.681  1.00 18.22  ? 7001 GLU A N     1 
ATOM   1746 C  CA    . GLU A 1 206 ? 86.679  27.696  32.416  1.00 17.64  ? 7001 GLU A CA    1 
ATOM   1747 C  C     . GLU A 1 206 ? 87.502  28.630  31.528  1.00 17.50  ? 7001 GLU A C     1 
ATOM   1748 O  O     . GLU A 1 206 ? 87.251  29.853  31.516  1.00 16.79  ? 7001 GLU A O     1 
ATOM   1749 C  CB    . GLU A 1 206 ? 85.421  27.291  31.648  1.00 18.17  ? 7001 GLU A CB    1 
ATOM   1750 C  CG    . GLU A 1 206 ? 85.674  26.836  30.221  1.00 18.12  ? 7001 GLU A CG    1 
ATOM   1751 C  CD    . GLU A 1 206 ? 84.381  26.513  29.501  1.00 19.33  ? 7001 GLU A CD    1 
ATOM   1752 O  OE1   . GLU A 1 206 ? 83.881  25.377  29.664  1.00 19.30  ? 7001 GLU A OE1   1 
ATOM   1753 O  OE2   . GLU A 1 206 ? 83.824  27.437  28.861  1.00 20.03  ? 7001 GLU A OE2   1 
ATOM   1754 N  N     . ALA A 1 207 ? 88.469  28.046  30.829  1.00 16.91  ? 7002 ALA A N     1 
ATOM   1755 C  CA    . ALA A 1 207 ? 89.194  28.742  29.748  1.00 17.40  ? 7002 ALA A CA    1 
ATOM   1756 C  C     . ALA A 1 207 ? 89.654  27.685  28.751  1.00 16.84  ? 7002 ALA A C     1 
ATOM   1757 O  O     . ALA A 1 207 ? 89.659  26.490  29.104  1.00 16.71  ? 7002 ALA A O     1 
ATOM   1758 C  CB    . ALA A 1 207 ? 90.365  29.537  30.272  1.00 17.81  ? 7002 ALA A CB    1 
ATOM   1759 N  N     . PHE A 1 208 ? 89.941  28.119  27.531  1.00 16.98  ? 7003 PHE A N     1 
ATOM   1760 C  CA    . PHE A 1 208 ? 90.581  27.222  26.553  1.00 17.32  ? 7003 PHE A CA    1 
ATOM   1761 C  C     . PHE A 1 208 ? 92.055  27.602  26.469  1.00 17.21  ? 7003 PHE A C     1 
ATOM   1762 O  O     . PHE A 1 208 ? 92.370  28.774  26.167  1.00 17.40  ? 7003 PHE A O     1 
ATOM   1763 C  CB    . PHE A 1 208 ? 89.884  27.292  25.196  1.00 17.98  ? 7003 PHE A CB    1 
ATOM   1764 C  CG    . PHE A 1 208 ? 88.528  26.644  25.215  1.00 18.63  ? 7003 PHE A CG    1 
ATOM   1765 C  CD1   . PHE A 1 208 ? 88.394  25.292  24.941  1.00 19.29  ? 7003 PHE A CD1   1 
ATOM   1766 C  CD2   . PHE A 1 208 ? 87.401  27.369  25.560  1.00 18.91  ? 7003 PHE A CD2   1 
ATOM   1767 C  CE1   . PHE A 1 208 ? 87.149  24.688  24.976  1.00 19.40  ? 7003 PHE A CE1   1 
ATOM   1768 C  CE2   . PHE A 1 208 ? 86.159  26.758  25.611  1.00 19.90  ? 7003 PHE A CE2   1 
ATOM   1769 C  CZ    . PHE A 1 208 ? 86.035  25.420  25.316  1.00 19.86  ? 7003 PHE A CZ    1 
ATOM   1770 N  N     A LEU A 1 209 ? 92.933  26.660  26.834  0.50 16.92  ? 7004 LEU A N     1 
ATOM   1771 N  N     B LEU A 1 209 ? 92.928  26.649  26.783  0.50 17.77  ? 7004 LEU A N     1 
ATOM   1772 C  CA    A LEU A 1 209 ? 94.386  26.880  26.631  0.50 17.38  ? 7004 LEU A CA    1 
ATOM   1773 C  CA    B LEU A 1 209 ? 94.390  26.858  26.670  0.50 18.77  ? 7004 LEU A CA    1 
ATOM   1774 C  C     A LEU A 1 209 ? 94.641  26.657  25.148  0.50 17.97  ? 7004 LEU A C     1 
ATOM   1775 C  C     B LEU A 1 209 ? 94.739  26.635  25.193  0.50 18.91  ? 7004 LEU A C     1 
ATOM   1776 O  O     A LEU A 1 209 ? 94.385  25.532  24.658  0.50 17.53  ? 7004 LEU A O     1 
ATOM   1777 O  O     B LEU A 1 209 ? 94.645  25.470  24.736  0.50 18.77  ? 7004 LEU A O     1 
ATOM   1778 C  CB    A LEU A 1 209 ? 95.233  25.928  27.474  0.50 17.79  ? 7004 LEU A CB    1 
ATOM   1779 C  CB    B LEU A 1 209 ? 95.067  25.867  27.617  0.50 20.18  ? 7004 LEU A CB    1 
ATOM   1780 C  CG    A LEU A 1 209 ? 95.215  26.193  28.973  0.50 17.51  ? 7004 LEU A CG    1 
ATOM   1781 C  CG    B LEU A 1 209 ? 96.506  26.175  28.011  0.50 21.42  ? 7004 LEU A CG    1 
ATOM   1782 C  CD1   A LEU A 1 209 ? 96.211  25.291  29.678  0.50 18.14  ? 7004 LEU A CD1   1 
ATOM   1783 C  CD1   B LEU A 1 209 ? 96.649  27.605  28.511  0.50 21.56  ? 7004 LEU A CD1   1 
ATOM   1784 C  CD2   A LEU A 1 209 ? 95.512  27.655  29.261  0.50 17.86  ? 7004 LEU A CD2   1 
ATOM   1785 C  CD2   B LEU A 1 209 ? 96.977  25.192  29.069  0.50 21.96  ? 7004 LEU A CD2   1 
ATOM   1786 N  N     . ILE A 1 210 ? 95.078  27.714  24.475  1.00 18.72  ? 7005 ILE A N     1 
ATOM   1787 C  CA    . ILE A 1 210 ? 95.321  27.659  23.012  1.00 19.54  ? 7005 ILE A CA    1 
ATOM   1788 C  C     . ILE A 1 210 ? 96.817  27.728  22.726  1.00 20.67  ? 7005 ILE A C     1 
ATOM   1789 O  O     . ILE A 1 210 ? 97.470  28.678  23.176  1.00 20.65  ? 7005 ILE A O     1 
ATOM   1790 C  CB    . ILE A 1 210 ? 94.529  28.779  22.314  1.00 19.96  ? 7005 ILE A CB    1 
ATOM   1791 C  CG1   . ILE A 1 210 ? 93.024  28.598  22.537  1.00 20.34  ? 7005 ILE A CG1   1 
ATOM   1792 C  CG2   . ILE A 1 210 ? 94.874  28.860  20.833  1.00 20.36  ? 7005 ILE A CG2   1 
ATOM   1793 C  CD1   . ILE A 1 210 ? 92.189  29.776  22.102  1.00 20.92  ? 7005 ILE A CD1   1 
ATOM   1794 N  N     . GLY A 1 211 ? 97.312  26.697  22.046  1.00 21.11  ? 7006 GLY A N     1 
ATOM   1795 C  CA    . GLY A 1 211 ? 98.685  26.644  21.524  1.00 21.78  ? 7006 GLY A CA    1 
ATOM   1796 C  C     . GLY A 1 211 ? 98.608  26.898  20.033  1.00 22.29  ? 7006 GLY A C     1 
ATOM   1797 O  O     . GLY A 1 211 ? 97.916  26.117  19.347  1.00 21.44  ? 7006 GLY A O     1 
ATOM   1798 N  N     . CYS A 1 212 ? 99.237  27.972  19.555  1.00 23.33  ? 7007 CYS A N     1 
ATOM   1799 C  CA    . CYS A 1 212 ? 99.133  28.333  18.115  1.00 25.06  ? 7007 CYS A CA    1 
ATOM   1800 C  C     . CYS A 1 212 ? 100.473 28.105  17.399  1.00 25.30  ? 7007 CYS A C     1 
ATOM   1801 O  O     . CYS A 1 212 ? 101.459 28.788  17.752  1.00 24.93  ? 7007 CYS A O     1 
ATOM   1802 C  CB    . CYS A 1 212 ? 98.674  29.778  17.956  1.00 26.89  ? 7007 CYS A CB    1 
ATOM   1803 S  SG    . CYS A 1 212 ? 98.278  30.221  16.245  1.00 32.81  ? 7007 CYS A SG    1 
ATOM   1804 N  N     . ASN A 1 213 ? 100.490 27.163  16.445  1.00 25.21  ? 7008 ASN A N     1 
ATOM   1805 C  CA    . ASN A 1 213 ? 101.664 26.839  15.585  1.00 25.83  ? 7008 ASN A CA    1 
ATOM   1806 C  C     . ASN A 1 213 ? 102.720 26.076  16.394  1.00 25.67  ? 7008 ASN A C     1 
ATOM   1807 O  O     . ASN A 1 213 ? 103.662 26.705  16.905  1.00 25.34  ? 7008 ASN A O     1 
ATOM   1808 C  CB    . ASN A 1 213 ? 102.221 28.094  14.912  1.00 27.32  ? 7008 ASN A CB    1 
ATOM   1809 C  CG    . ASN A 1 213 ? 101.176 28.844  14.110  1.00 27.81  ? 7008 ASN A CG    1 
ATOM   1810 O  OD1   . ASN A 1 213 ? 101.063 30.061  14.231  1.00 29.50  ? 7008 ASN A OD1   1 
ATOM   1811 N  ND2   . ASN A 1 213 ? 100.387 28.130  13.320  1.00 27.02  ? 7008 ASN A ND2   1 
ATOM   1812 N  N     . TYR A 1 214 ? 102.585 24.749  16.431  1.00 24.73  ? 7009 TYR A N     1 
ATOM   1813 C  CA    . TYR A 1 214 ? 103.472 23.852  17.214  1.00 25.55  ? 7009 TYR A CA    1 
ATOM   1814 C  C     . TYR A 1 214 ? 104.876 23.819  16.594  1.00 26.96  ? 7009 TYR A C     1 
ATOM   1815 O  O     . TYR A 1 214 ? 104.988 23.597  15.369  1.00 27.25  ? 7009 TYR A O     1 
ATOM   1816 C  CB    . TYR A 1 214 ? 102.817 22.471  17.295  1.00 25.30  ? 7009 TYR A CB    1 
ATOM   1817 C  CG    . TYR A 1 214 ? 103.558 21.460  18.125  1.00 26.36  ? 7009 TYR A CG    1 
ATOM   1818 C  CD1   . TYR A 1 214 ? 103.886 21.724  19.445  1.00 26.71  ? 7009 TYR A CD1   1 
ATOM   1819 C  CD2   . TYR A 1 214 ? 103.864 20.210  17.615  1.00 27.39  ? 7009 TYR A CD2   1 
ATOM   1820 C  CE1   . TYR A 1 214 ? 104.557 20.792  20.218  1.00 27.77  ? 7009 TYR A CE1   1 
ATOM   1821 C  CE2   . TYR A 1 214 ? 104.521 19.262  18.379  1.00 28.39  ? 7009 TYR A CE2   1 
ATOM   1822 C  CZ    . TYR A 1 214 ? 104.866 19.554  19.685  1.00 28.45  ? 7009 TYR A CZ    1 
ATOM   1823 O  OH    . TYR A 1 214 ? 105.518 18.621  20.433  1.00 30.76  ? 7009 TYR A OH    1 
ATOM   1824 N  N     . LEU A 1 215 ? 105.909 23.995  17.428  1.00 28.11  ? 7010 LEU A N     1 
ATOM   1825 C  CA    . LEU A 1 215 ? 107.322 24.036  16.953  1.00 30.49  ? 7010 LEU A CA    1 
ATOM   1826 C  C     . LEU A 1 215 ? 108.057 22.737  17.310  1.00 32.17  ? 7010 LEU A C     1 
ATOM   1827 O  O     . LEU A 1 215 ? 109.193 22.565  16.827  1.00 33.10  ? 7010 LEU A O     1 
ATOM   1828 C  CB    . LEU A 1 215 ? 108.023 25.257  17.561  1.00 31.01  ? 7010 LEU A CB    1 
ATOM   1829 C  CG    . LEU A 1 215 ? 107.357 26.601  17.271  1.00 30.92  ? 7010 LEU A CG    1 
ATOM   1830 C  CD1   . LEU A 1 215 ? 108.119 27.736  17.929  1.00 32.12  ? 7010 LEU A CD1   1 
ATOM   1831 C  CD2   . LEU A 1 215 ? 107.224 26.842  15.776  1.00 31.54  ? 7010 LEU A CD2   1 
ATOM   1832 N  N     . GLY A 1 216 ? 107.445 21.868  18.125  1.00 32.71  ? 7011 GLY A N     1 
ATOM   1833 C  CA    . GLY A 1 216 ? 108.045 20.564  18.480  1.00 35.21  ? 7011 GLY A CA    1 
ATOM   1834 C  C     . GLY A 1 216 ? 109.241 20.687  19.408  1.00 37.69  ? 7011 GLY A C     1 
ATOM   1835 O  O     . GLY A 1 216 ? 109.962 19.685  19.574  1.00 39.74  ? 7011 GLY A O     1 
ATOM   1836 N  N     . LYS A 1 217 ? 109.460 21.876  19.968  1.00 38.13  ? 7012 LYS A N     1 
ATOM   1837 C  CA    . LYS A 1 217 ? 110.569 22.114  20.927  1.00 40.87  ? 7012 LYS A CA    1 
ATOM   1838 C  C     . LYS A 1 217 ? 110.214 23.353  21.738  1.00 39.84  ? 7012 LYS A C     1 
ATOM   1839 O  O     . LYS A 1 217 ? 109.409 24.170  21.295  1.00 37.31  ? 7012 LYS A O     1 
ATOM   1840 C  CB    . LYS A 1 217 ? 111.907 22.273  20.196  1.00 44.29  ? 7012 LYS A CB    1 
ATOM   1841 C  CG    . LYS A 1 217 ? 112.040 23.516  19.327  1.00 46.97  ? 7012 LYS A CG    1 
ATOM   1842 C  CD    . LYS A 1 217 ? 113.394 23.619  18.651  1.00 51.14  ? 7012 LYS A CD    1 
ATOM   1843 C  CE    . LYS A 1 217 ? 113.601 24.929  17.923  1.00 53.32  ? 7012 LYS A CE    1 
ATOM   1844 N  NZ    . LYS A 1 217 ? 114.948 25.000  17.308  1.00 57.20  ? 7012 LYS A NZ    1 
ATOM   1845 N  N     . PRO A 1 218 ? 110.795 23.535  22.945  1.00 40.79  ? 7013 PRO A N     1 
ATOM   1846 C  CA    . PRO A 1 218 ? 110.464 24.689  23.774  1.00 40.74  ? 7013 PRO A CA    1 
ATOM   1847 C  C     . PRO A 1 218 ? 111.046 26.013  23.264  1.00 41.70  ? 7013 PRO A C     1 
ATOM   1848 O  O     . PRO A 1 218 ? 112.254 26.122  23.150  1.00 45.12  ? 7013 PRO A O     1 
ATOM   1849 C  CB    . PRO A 1 218 ? 111.075 24.335  25.139  1.00 41.28  ? 7013 PRO A CB    1 
ATOM   1850 C  CG    . PRO A 1 218 ? 112.222 23.408  24.808  1.00 43.01  ? 7013 PRO A CG    1 
ATOM   1851 C  CD    . PRO A 1 218 ? 111.769 22.637  23.584  1.00 42.43  ? 7013 PRO A CD    1 
ATOM   1852 N  N     A ARG A 1 219 ? 110.178 26.979  22.940  0.60 40.73  ? 7014 ARG A N     1 
ATOM   1853 N  N     B ARG A 1 219 ? 110.156 26.955  22.942  0.40 40.18  ? 7014 ARG A N     1 
ATOM   1854 C  CA    A ARG A 1 219 ? 110.661 28.323  22.518  0.60 42.02  ? 7014 ARG A CA    1 
ATOM   1855 C  CA    B ARG A 1 219 ? 110.528 28.325  22.502  0.40 40.70  ? 7014 ARG A CA    1 
ATOM   1856 C  C     A ARG A 1 219 ? 110.790 29.177  23.785  0.60 41.86  ? 7014 ARG A C     1 
ATOM   1857 C  C     B ARG A 1 219 ? 110.754 29.169  23.760  0.40 41.07  ? 7014 ARG A C     1 
ATOM   1858 O  O     A ARG A 1 219 ? 111.575 30.144  23.772  0.60 42.09  ? 7014 ARG A O     1 
ATOM   1859 O  O     B ARG A 1 219 ? 111.575 30.107  23.717  0.40 41.66  ? 7014 ARG A O     1 
ATOM   1860 C  CB    A ARG A 1 219 ? 109.747 28.986  21.482  0.60 42.21  ? 7014 ARG A CB    1 
ATOM   1861 C  CB    B ARG A 1 219 ? 109.410 28.916  21.639  0.40 39.59  ? 7014 ARG A CB    1 
ATOM   1862 C  CG    A ARG A 1 219 ? 108.457 29.573  22.038  0.60 42.15  ? 7014 ARG A CG    1 
ATOM   1863 C  CG    B ARG A 1 219 ? 109.659 30.346  21.185  0.40 40.22  ? 7014 ARG A CG    1 
ATOM   1864 C  CD    A ARG A 1 219 ? 107.722 30.387  20.989  0.60 42.66  ? 7014 ARG A CD    1 
ATOM   1865 C  CD    B ARG A 1 219 ? 108.421 30.958  20.558  0.40 39.66  ? 7014 ARG A CD    1 
ATOM   1866 N  NE    A ARG A 1 219 ? 108.530 31.485  20.474  0.60 44.94  ? 7014 ARG A NE    1 
ATOM   1867 N  NE    B ARG A 1 219 ? 107.302 30.958  21.490  0.40 38.44  ? 7014 ARG A NE    1 
ATOM   1868 C  CZ    A ARG A 1 219 ? 108.651 32.681  21.046  0.60 45.37  ? 7014 ARG A CZ    1 
ATOM   1869 C  CZ    B ARG A 1 219 ? 107.111 31.874  22.431  0.40 39.08  ? 7014 ARG A CZ    1 
ATOM   1870 N  NH1   A ARG A 1 219 ? 109.416 33.605  20.488  0.60 46.69  ? 7014 ARG A NH1   1 
ATOM   1871 N  NH1   B ARG A 1 219 ? 106.064 31.791  23.234  0.40 38.43  ? 7014 ARG A NH1   1 
ATOM   1872 N  NH2   A ARG A 1 219 ? 108.016 32.951  22.174  0.60 45.03  ? 7014 ARG A NH2   1 
ATOM   1873 N  NH2   B ARG A 1 219 ? 107.974 32.864  22.571  0.40 40.62  ? 7014 ARG A NH2   1 
ATOM   1874 N  N     . GLU A 1 220 ? 110.021 28.836  24.827  1.00 40.05  ? 7015 GLU A N     1 
ATOM   1875 C  CA    . GLU A 1 220 ? 110.124 29.528  26.140  1.00 40.57  ? 7015 GLU A CA    1 
ATOM   1876 C  C     . GLU A 1 220 ? 109.865 28.485  27.231  1.00 38.25  ? 7015 GLU A C     1 
ATOM   1877 O  O     . GLU A 1 220 ? 109.075 27.540  26.995  1.00 36.69  ? 7015 GLU A O     1 
ATOM   1878 C  CB    . GLU A 1 220 ? 109.180 30.729  26.268  1.00 42.34  ? 7015 GLU A CB    1 
ATOM   1879 C  CG    . GLU A 1 220 ? 107.700 30.391  26.265  1.00 42.82  ? 7015 GLU A CG    1 
ATOM   1880 C  CD    . GLU A 1 220 ? 106.796 31.511  26.766  1.00 44.22  ? 7015 GLU A CD    1 
ATOM   1881 O  OE1   . GLU A 1 220 ? 105.650 31.608  26.285  1.00 46.16  ? 7015 GLU A OE1   1 
ATOM   1882 O  OE2   . GLU A 1 220 ? 107.221 32.257  27.666  1.00 46.15  ? 7015 GLU A OE2   1 
ATOM   1883 N  N     A GLN A 1 221 ? 110.525 28.657  28.379  0.50 37.87  ? 7016 GLN A N     1 
ATOM   1884 N  N     B GLN A 1 221 ? 110.540 28.629  28.374  0.50 37.82  ? 7016 GLN A N     1 
ATOM   1885 C  CA    A GLN A 1 221 ? 110.382 27.737  29.535  0.50 37.50  ? 7016 GLN A CA    1 
ATOM   1886 C  CA    B GLN A 1 221 ? 110.360 27.679  29.501  0.50 37.35  ? 7016 GLN A CA    1 
ATOM   1887 C  C     A GLN A 1 221 ? 109.213 28.223  30.395  0.50 35.80  ? 7016 GLN A C     1 
ATOM   1888 C  C     B GLN A 1 221 ? 109.228 28.201  30.391  0.50 35.77  ? 7016 GLN A C     1 
ATOM   1889 O  O     A GLN A 1 221 ? 109.302 29.351  30.920  0.50 35.55  ? 7016 GLN A O     1 
ATOM   1890 O  O     B GLN A 1 221 ? 109.361 29.318  30.927  0.50 35.68  ? 7016 GLN A O     1 
ATOM   1891 C  CB    A GLN A 1 221 ? 111.677 27.712  30.351  0.50 40.12  ? 7016 GLN A CB    1 
ATOM   1892 C  CB    B GLN A 1 221 ? 111.674 27.498  30.265  0.50 39.83  ? 7016 GLN A CB    1 
ATOM   1893 C  CG    A GLN A 1 221 ? 111.720 26.608  31.397  0.50 41.02  ? 7016 GLN A CG    1 
ATOM   1894 C  CG    B GLN A 1 221 ? 112.796 26.923  29.409  0.50 41.40  ? 7016 GLN A CG    1 
ATOM   1895 C  CD    A GLN A 1 221 ? 111.897 25.246  30.773  0.50 42.00  ? 7016 GLN A CD    1 
ATOM   1896 C  CD    B GLN A 1 221 ? 112.466 25.556  28.859  0.50 42.25  ? 7016 GLN A CD    1 
ATOM   1897 O  OE1   A GLN A 1 221 ? 112.470 25.106  29.694  0.50 43.39  ? 7016 GLN A OE1   1 
ATOM   1898 O  OE1   B GLN A 1 221 ? 111.474 24.932  29.234  0.50 43.63  ? 7016 GLN A OE1   1 
ATOM   1899 N  NE2   A GLN A 1 221 ? 111.428 24.221  31.467  0.50 42.60  ? 7016 GLN A NE2   1 
ATOM   1900 N  NE2   B GLN A 1 221 ? 113.307 25.073  27.959  0.50 43.51  ? 7016 GLN A NE2   1 
ATOM   1901 N  N     . ILE A 1 222 ? 108.147 27.425  30.502  1.00 33.29  ? 7017 ILE A N     1 
ATOM   1902 C  CA    . ILE A 1 222 ? 106.973 27.811  31.336  1.00 31.97  ? 7017 ILE A CA    1 
ATOM   1903 C  C     . ILE A 1 222 ? 106.857 26.851  32.521  1.00 31.30  ? 7017 ILE A C     1 
ATOM   1904 O  O     . ILE A 1 222 ? 106.920 25.623  32.304  1.00 31.08  ? 7017 ILE A O     1 
ATOM   1905 C  CB    . ILE A 1 222 ? 105.676 27.840  30.502  1.00 29.77  ? 7017 ILE A CB    1 
ATOM   1906 C  CG1   . ILE A 1 222 ? 105.702 28.967  29.468  1.00 30.08  ? 7017 ILE A CG1   1 
ATOM   1907 C  CG2   . ILE A 1 222 ? 104.448 27.933  31.400  1.00 29.00  ? 7017 ILE A CG2   1 
ATOM   1908 C  CD1   . ILE A 1 222 ? 104.512 28.980  28.536  1.00 29.21  ? 7017 ILE A CD1   1 
ATOM   1909 N  N     . ASP A 1 223 ? 106.732 27.419  33.719  1.00 30.55  ? 7018 ASP A N     1 
ATOM   1910 C  CA    . ASP A 1 223 ? 106.445 26.656  34.959  1.00 30.64  ? 7018 ASP A CA    1 
ATOM   1911 C  C     . ASP A 1 223 ? 104.917 26.586  35.050  1.00 28.45  ? 7018 ASP A C     1 
ATOM   1912 O  O     . ASP A 1 223 ? 104.296 27.649  35.260  1.00 26.72  ? 7018 ASP A O     1 
ATOM   1913 C  CB    . ASP A 1 223 ? 107.096 27.325  36.170  1.00 32.85  ? 7018 ASP A CB    1 
ATOM   1914 C  CG    . ASP A 1 223 ? 106.773 26.667  37.500  1.00 34.43  ? 7018 ASP A CG    1 
ATOM   1915 O  OD1   . ASP A 1 223 ? 105.646 26.155  37.653  1.00 33.38  ? 7018 ASP A OD1   1 
ATOM   1916 O  OD2   . ASP A 1 223 ? 107.658 26.667  38.373  1.00 37.86  ? 7018 ASP A OD2   1 
ATOM   1917 N  N     . GLY A 1 224 ? 104.349 25.392  34.868  1.00 27.34  ? 7019 GLY A N     1 
ATOM   1918 C  CA    . GLY A 1 224 ? 102.888 25.178  34.835  1.00 26.46  ? 7019 GLY A CA    1 
ATOM   1919 C  C     . GLY A 1 224 ? 102.169 25.556  36.118  1.00 26.17  ? 7019 GLY A C     1 
ATOM   1920 O  O     . GLY A 1 224 ? 101.039 26.066  36.032  1.00 25.29  ? 7019 GLY A O     1 
ATOM   1921 N  N     A TYR A 1 225 ? 102.759 25.255  37.280  0.50 27.29  ? 7020 TYR A N     1 
ATOM   1922 N  N     B TYR A 1 225 ? 102.786 25.285  37.270  0.50 27.33  ? 7020 TYR A N     1 
ATOM   1923 C  CA    A TYR A 1 225 ? 102.113 25.637  38.565  0.50 27.76  ? 7020 TYR A CA    1 
ATOM   1924 C  CA    B TYR A 1 225 ? 102.172 25.624  38.580  0.50 27.86  ? 7020 TYR A CA    1 
ATOM   1925 C  C     A TYR A 1 225 ? 102.028 27.164  38.649  0.50 27.53  ? 7020 TYR A C     1 
ATOM   1926 C  C     B TYR A 1 225 ? 102.053 27.149  38.686  0.50 27.63  ? 7020 TYR A C     1 
ATOM   1927 O  O     A TYR A 1 225 ? 100.960 27.686  39.022  0.50 27.53  ? 7020 TYR A O     1 
ATOM   1928 O  O     B TYR A 1 225 ? 101.000 27.652  39.121  0.50 27.80  ? 7020 TYR A O     1 
ATOM   1929 C  CB    A TYR A 1 225 ? 102.841 25.021  39.764  0.50 29.65  ? 7020 TYR A CB    1 
ATOM   1930 C  CB    B TYR A 1 225 ? 103.000 25.007  39.711  0.50 29.78  ? 7020 TYR A CB    1 
ATOM   1931 C  CG    A TYR A 1 225 ? 102.273 23.702  40.226  0.50 29.96  ? 7020 TYR A CG    1 
ATOM   1932 C  CG    B TYR A 1 225 ? 103.156 23.512  39.593  0.50 30.30  ? 7020 TYR A CG    1 
ATOM   1933 C  CD1   A TYR A 1 225 ? 102.649 22.503  39.646  0.50 30.46  ? 7020 TYR A CD1   1 
ATOM   1934 C  CD1   B TYR A 1 225 ? 104.181 22.959  38.845  0.50 31.08  ? 7020 TYR A CD1   1 
ATOM   1935 C  CD2   A TYR A 1 225 ? 101.348 23.659  41.256  0.50 30.40  ? 7020 TYR A CD2   1 
ATOM   1936 C  CD2   B TYR A 1 225 ? 102.261 22.648  40.203  0.50 30.56  ? 7020 TYR A CD2   1 
ATOM   1937 C  CE1   A TYR A 1 225 ? 102.121 21.295  40.077  0.50 30.81  ? 7020 TYR A CE1   1 
ATOM   1938 C  CE1   B TYR A 1 225 ? 104.323 21.587  38.716  0.50 31.67  ? 7020 TYR A CE1   1 
ATOM   1939 C  CE2   A TYR A 1 225 ? 100.808 22.462  41.697  0.50 30.81  ? 7020 TYR A CE2   1 
ATOM   1940 C  CE2   B TYR A 1 225 ? 102.391 21.273  40.089  0.50 31.11  ? 7020 TYR A CE2   1 
ATOM   1941 C  CZ    A TYR A 1 225 ? 101.194 21.275  41.105  0.50 30.78  ? 7020 TYR A CZ    1 
ATOM   1942 C  CZ    B TYR A 1 225 ? 103.424 20.741  39.340  0.50 31.61  ? 7020 TYR A CZ    1 
ATOM   1943 O  OH    A TYR A 1 225 ? 100.658 20.094  41.539  0.50 31.66  ? 7020 TYR A OH    1 
ATOM   1944 O  OH    B TYR A 1 225 ? 103.559 19.388  39.218  0.50 33.34  ? 7020 TYR A OH    1 
ATOM   1945 N  N     . VAL A 1 226 ? 103.104 27.854  38.267  1.00 27.30  ? 7021 VAL A N     1 
ATOM   1946 C  CA    . VAL A 1 226 ? 103.121 29.343  38.304  1.00 26.98  ? 7021 VAL A CA    1 
ATOM   1947 C  C     . VAL A 1 226 ? 102.129 29.883  37.264  1.00 24.88  ? 7021 VAL A C     1 
ATOM   1948 O  O     . VAL A 1 226 ? 101.367 30.805  37.595  1.00 23.80  ? 7021 VAL A O     1 
ATOM   1949 C  CB    . VAL A 1 226 ? 104.539 29.894  38.062  1.00 28.16  ? 7021 VAL A CB    1 
ATOM   1950 C  CG1   . VAL A 1 226 ? 104.521 31.400  37.851  1.00 28.75  ? 7021 VAL A CG1   1 
ATOM   1951 C  CG2   . VAL A 1 226 ? 105.494 29.521  39.188  1.00 29.55  ? 7021 VAL A CG2   1 
ATOM   1952 N  N     . MET A 1 227 ? 102.106 29.312  36.059  1.00 23.76  ? 7022 MET A N     1 
ATOM   1953 C  CA    . MET A 1 227 ? 101.221 29.896  35.019  1.00 22.76  ? 7022 MET A CA    1 
ATOM   1954 C  C     . MET A 1 227 ? 99.744  29.695  35.391  1.00 21.79  ? 7022 MET A C     1 
ATOM   1955 O  O     . MET A 1 227 ? 98.950  30.605  35.102  1.00 20.83  ? 7022 MET A O     1 
ATOM   1956 C  CB    . MET A 1 227 ? 101.512 29.317  33.633  1.00 22.58  ? 7022 MET A CB    1 
ATOM   1957 C  CG    . MET A 1 227 ? 100.916 30.162  32.527  1.00 22.43  ? 7022 MET A CG    1 
ATOM   1958 S  SD    . MET A 1 227 ? 101.577 31.855  32.504  1.00 23.79  ? 7022 MET A SD    1 
ATOM   1959 C  CE    . MET A 1 227 ? 103.238 31.534  31.917  1.00 25.10  ? 7022 MET A CE    1 
ATOM   1960 N  N     . HIS A 1 228 ? 99.372  28.562  36.000  1.00 21.70  ? 7023 HIS A N     1 
ATOM   1961 C  CA    . HIS A 1 228 ? 97.951  28.414  36.413  1.00 20.87  ? 7023 HIS A CA    1 
ATOM   1962 C  C     . HIS A 1 228 ? 97.639  29.454  37.498  1.00 21.34  ? 7023 HIS A C     1 
ATOM   1963 O  O     . HIS A 1 228 ? 96.521  30.011  37.482  1.00 20.77  ? 7023 HIS A O     1 
ATOM   1964 C  CB    . HIS A 1 228 ? 97.642  26.984  36.869  1.00 21.01  ? 7023 HIS A CB    1 
ATOM   1965 C  CG    . HIS A 1 228 ? 96.178  26.735  37.005  1.00 20.09  ? 7023 HIS A CG    1 
ATOM   1966 N  ND1   . HIS A 1 228 ? 95.312  26.868  35.933  1.00 19.73  ? 7023 HIS A ND1   1 
ATOM   1967 C  CD2   . HIS A 1 228 ? 95.432  26.332  38.055  1.00 20.38  ? 7023 HIS A CD2   1 
ATOM   1968 C  CE1   . HIS A 1 228 ? 94.087  26.574  36.329  1.00 19.66  ? 7023 HIS A CE1   1 
ATOM   1969 N  NE2   . HIS A 1 228 ? 94.135  26.245  37.632  1.00 19.28  ? 7023 HIS A NE2   1 
ATOM   1970 N  N     . ALA A 1 229 ? 98.592  29.710  38.402  1.00 21.94  ? 7024 ALA A N     1 
ATOM   1971 C  CA    . ALA A 1 229 ? 98.383  30.739  39.450  1.00 22.55  ? 7024 ALA A CA    1 
ATOM   1972 C  C     . ALA A 1 229 ? 98.190  32.100  38.774  1.00 22.26  ? 7024 ALA A C     1 
ATOM   1973 O  O     . ALA A 1 229 ? 97.316  32.877  39.226  1.00 22.39  ? 7024 ALA A O     1 
ATOM   1974 C  CB    . ALA A 1 229 ? 99.547  30.758  40.412  1.00 23.69  ? 7024 ALA A CB    1 
ATOM   1975 N  N     . ASN A 1 230 ? 98.978  32.366  37.727  1.00 21.94  ? 7025 ASN A N     1 
ATOM   1976 C  CA    . ASN A 1 230 ? 98.884  33.639  36.963  1.00 21.92  ? 7025 ASN A CA    1 
ATOM   1977 C  C     . ASN A 1 230 ? 97.498  33.723  36.313  1.00 21.02  ? 7025 ASN A C     1 
ATOM   1978 O  O     . ASN A 1 230 ? 96.903  34.817  36.319  1.00 21.16  ? 7025 ASN A O     1 
ATOM   1979 C  CB    . ASN A 1 230 ? 99.986  33.752  35.907  1.00 22.20  ? 7025 ASN A CB    1 
ATOM   1980 C  CG    . ASN A 1 230 ? 101.375 33.894  36.491  1.00 23.50  ? 7025 ASN A CG    1 
ATOM   1981 O  OD1   . ASN A 1 230 ? 101.539 34.266  37.656  1.00 24.43  ? 7025 ASN A OD1   1 
ATOM   1982 N  ND2   . ASN A 1 230 ? 102.384 33.630  35.676  1.00 24.20  ? 7025 ASN A ND2   1 
ATOM   1983 N  N     . TYR A 1 231 ? 97.021  32.597  35.774  1.00 20.15  ? 7026 TYR A N     1 
ATOM   1984 C  CA    . TYR A 1 231 ? 95.690  32.531  35.121  1.00 19.90  ? 7026 TYR A CA    1 
ATOM   1985 C  C     . TYR A 1 231 ? 94.587  32.884  36.134  1.00 20.01  ? 7026 TYR A C     1 
ATOM   1986 O  O     . TYR A 1 231 ? 93.732  33.749  35.847  1.00 20.23  ? 7026 TYR A O     1 
ATOM   1987 C  CB    . TYR A 1 231 ? 95.469  31.158  34.473  1.00 19.47  ? 7026 TYR A CB    1 
ATOM   1988 C  CG    . TYR A 1 231 ? 94.026  30.953  34.104  1.00 18.80  ? 7026 TYR A CG    1 
ATOM   1989 C  CD1   . TYR A 1 231 ? 93.461  31.644  33.048  1.00 18.23  ? 7026 TYR A CD1   1 
ATOM   1990 C  CD2   . TYR A 1 231 ? 93.208  30.131  34.858  1.00 19.19  ? 7026 TYR A CD2   1 
ATOM   1991 C  CE1   . TYR A 1 231 ? 92.117  31.519  32.744  1.00 17.94  ? 7026 TYR A CE1   1 
ATOM   1992 C  CE2   . TYR A 1 231 ? 91.864  29.989  34.563  1.00 18.79  ? 7026 TYR A CE2   1 
ATOM   1993 C  CZ    . TYR A 1 231 ? 91.317  30.685  33.501  1.00 18.13  ? 7026 TYR A CZ    1 
ATOM   1994 O  OH    . TYR A 1 231 ? 89.988  30.560  33.224  1.00 18.15  ? 7026 TYR A OH    1 
ATOM   1995 N  N     A ILE A 1 232 ? 94.616  32.238  37.302  0.60 20.60  ? 7027 ILE A N     1 
ATOM   1996 N  N     B ILE A 1 232 ? 94.610  32.247  37.306  0.40 20.77  ? 7027 ILE A N     1 
ATOM   1997 C  CA    A ILE A 1 232 ? 93.591  32.497  38.358  0.60 21.01  ? 7027 ILE A CA    1 
ATOM   1998 C  CA    B ILE A 1 232 ? 93.565  32.512  38.341  0.40 21.24  ? 7027 ILE A CA    1 
ATOM   1999 C  C     A ILE A 1 232 ? 93.683  33.959  38.812  0.60 21.41  ? 7027 ILE A C     1 
ATOM   2000 C  C     B ILE A 1 232 ? 93.678  33.959  38.839  0.40 21.64  ? 7027 ILE A C     1 
ATOM   2001 O  O     A ILE A 1 232 ? 92.623  34.584  39.000  0.60 21.07  ? 7027 ILE A O     1 
ATOM   2002 O  O     B ILE A 1 232 ? 92.625  34.571  39.096  0.40 21.44  ? 7027 ILE A O     1 
ATOM   2003 C  CB    A ILE A 1 232 ? 93.753  31.510  39.531  0.60 21.76  ? 7027 ILE A CB    1 
ATOM   2004 C  CB    B ILE A 1 232 ? 93.653  31.480  39.479  0.40 22.05  ? 7027 ILE A CB    1 
ATOM   2005 C  CG1   A ILE A 1 232 ? 93.554  30.061  39.075  0.60 21.57  ? 7027 ILE A CG1   1 
ATOM   2006 C  CG1   B ILE A 1 232 ? 93.347  30.076  38.954  0.40 21.91  ? 7027 ILE A CG1   1 
ATOM   2007 C  CG2   A ILE A 1 232 ? 92.821  31.870  40.675  0.60 22.35  ? 7027 ILE A CG2   1 
ATOM   2008 C  CG2   B ILE A 1 232 ? 92.742  31.861  40.634  0.40 22.61  ? 7027 ILE A CG2   1 
ATOM   2009 C  CD1   A ILE A 1 232 ? 92.187  29.774  38.479  0.60 20.91  ? 7027 ILE A CD1   1 
ATOM   2010 C  CD1   B ILE A 1 232 ? 93.260  29.028  40.027  0.40 22.68  ? 7027 ILE A CD1   1 
ATOM   2011 N  N     . PHE A 1 233 ? 94.900  34.486  38.961  1.00 22.36  ? 7028 PHE A N     1 
ATOM   2012 C  CA    . PHE A 1 233 ? 95.078  35.896  39.399  1.00 23.15  ? 7028 PHE A CA    1 
ATOM   2013 C  C     . PHE A 1 233 ? 94.396  36.820  38.384  1.00 21.72  ? 7028 PHE A C     1 
ATOM   2014 O  O     . PHE A 1 233 ? 93.678  37.751  38.784  1.00 21.90  ? 7028 PHE A O     1 
ATOM   2015 C  CB    . PHE A 1 233 ? 96.558  36.238  39.573  1.00 25.02  ? 7028 PHE A CB    1 
ATOM   2016 C  CG    . PHE A 1 233 ? 96.803  37.686  39.902  1.00 26.84  ? 7028 PHE A CG    1 
ATOM   2017 C  CD1   . PHE A 1 233 ? 96.434  38.201  41.133  1.00 28.78  ? 7028 PHE A CD1   1 
ATOM   2018 C  CD2   . PHE A 1 233 ? 97.418  38.530  38.990  1.00 28.52  ? 7028 PHE A CD2   1 
ATOM   2019 C  CE1   . PHE A 1 233 ? 96.662  39.533  41.443  1.00 30.23  ? 7028 PHE A CE1   1 
ATOM   2020 C  CE2   . PHE A 1 233 ? 97.643  39.863  39.302  1.00 29.42  ? 7028 PHE A CE2   1 
ATOM   2021 C  CZ    . PHE A 1 233 ? 97.258  40.362  40.522  1.00 30.35  ? 7028 PHE A CZ    1 
ATOM   2022 N  N     . TRP A 1 234 ? 94.652  36.586  37.101  1.00 20.98  ? 7029 TRP A N     1 
ATOM   2023 C  CA    . TRP A 1 234 ? 93.977  37.362  36.030  1.00 21.12  ? 7029 TRP A CA    1 
ATOM   2024 C  C     . TRP A 1 234 ? 92.450  37.258  36.187  1.00 20.40  ? 7029 TRP A C     1 
ATOM   2025 O  O     . TRP A 1 234 ? 91.780  38.309  36.245  1.00 20.76  ? 7029 TRP A O     1 
ATOM   2026 C  CB    . TRP A 1 234 ? 94.445  36.880  34.651  1.00 20.81  ? 7029 TRP A CB    1 
ATOM   2027 C  CG    . TRP A 1 234 ? 93.591  37.408  33.548  1.00 20.92  ? 7029 TRP A CG    1 
ATOM   2028 C  CD1   . TRP A 1 234 ? 93.284  38.716  33.304  1.00 22.15  ? 7029 TRP A CD1   1 
ATOM   2029 C  CD2   . TRP A 1 234 ? 92.934  36.640  32.528  1.00 20.49  ? 7029 TRP A CD2   1 
ATOM   2030 N  NE1   . TRP A 1 234 ? 92.462  38.810  32.215  1.00 21.60  ? 7029 TRP A NE1   1 
ATOM   2031 C  CE2   . TRP A 1 234 ? 92.234  37.555  31.716  1.00 20.73  ? 7029 TRP A CE2   1 
ATOM   2032 C  CE3   . TRP A 1 234 ? 92.880  35.274  32.220  1.00 20.27  ? 7029 TRP A CE3   1 
ATOM   2033 C  CZ2   . TRP A 1 234 ? 91.488  37.142  30.612  1.00 20.77  ? 7029 TRP A CZ2   1 
ATOM   2034 C  CZ3   . TRP A 1 234 ? 92.141  34.869  31.131  1.00 20.01  ? 7029 TRP A CZ3   1 
ATOM   2035 C  CH2   . TRP A 1 234 ? 91.456  35.794  30.341  1.00 20.06  ? 7029 TRP A CH2   1 
ATOM   2036 N  N     . ARG A 1 235 ? 91.912  36.038  36.259  1.00 20.27  ? 7030 ARG A N     1 
ATOM   2037 C  CA    . ARG A 1 235 ? 90.435  35.865  36.387  1.00 20.01  ? 7030 ARG A CA    1 
ATOM   2038 C  C     . ARG A 1 235 ? 89.902  36.551  37.654  1.00 20.86  ? 7030 ARG A C     1 
ATOM   2039 O  O     . ARG A 1 235 ? 88.806  37.146  37.583  1.00 21.03  ? 7030 ARG A O     1 
ATOM   2040 C  CB    . ARG A 1 235 ? 90.059  34.381  36.417  1.00 19.59  ? 7030 ARG A CB    1 
ATOM   2041 C  CG    . ARG A 1 235 ? 90.405  33.599  35.154  1.00 19.14  ? 7030 ARG A CG    1 
ATOM   2042 C  CD    . ARG A 1 235 ? 89.853  34.204  33.879  1.00 18.93  ? 7030 ARG A CD    1 
ATOM   2043 N  NE    . ARG A 1 235 ? 88.443  34.553  33.993  1.00 18.94  ? 7030 ARG A NE    1 
ATOM   2044 C  CZ    . ARG A 1 235 ? 87.431  33.704  33.852  1.00 19.42  ? 7030 ARG A CZ    1 
ATOM   2045 N  NH1   . ARG A 1 235 ? 87.648  32.427  33.583  1.00 19.11  ? 7030 ARG A NH1   1 
ATOM   2046 N  NH2   . ARG A 1 235 ? 86.193  34.141  33.990  1.00 20.75  ? 7030 ARG A NH2   1 
ATOM   2047 N  N     . ASN A 1 236 ? 90.624  36.446  38.774  1.00 21.40  ? 7031 ASN A N     1 
ATOM   2048 C  CA    . ASN A 1 236 ? 90.168  37.033  40.065  1.00 23.05  ? 7031 ASN A CA    1 
ATOM   2049 C  C     . ASN A 1 236 ? 90.144  38.561  40.036  1.00 23.73  ? 7031 ASN A C     1 
ATOM   2050 O  O     . ASN A 1 236 ? 89.327  39.140  40.793  1.00 24.20  ? 7031 ASN A O     1 
ATOM   2051 C  CB    . ASN A 1 236 ? 91.057  36.610  41.238  1.00 24.13  ? 7031 ASN A CB    1 
ATOM   2052 C  CG    . ASN A 1 236 ? 90.746  35.219  41.739  1.00 24.87  ? 7031 ASN A CG    1 
ATOM   2053 O  OD1   . ASN A 1 236 ? 89.708  34.655  41.401  1.00 26.80  ? 7031 ASN A OD1   1 
ATOM   2054 N  ND2   . ASN A 1 236 ? 91.629  34.667  42.552  1.00 25.54  ? 7031 ASN A ND2   1 
ATOM   2055 N  N     . THR A 1 237 ? 90.987  39.186  39.211  1.00 23.64  ? 7032 THR A N     1 
ATOM   2056 C  CA    . THR A 1 237 ? 91.118  40.665  39.243  1.00 24.44  ? 7032 THR A CA    1 
ATOM   2057 C  C     . THR A 1 237 ? 90.531  41.311  37.986  1.00 25.03  ? 7032 THR A C     1 
ATOM   2058 O  O     . THR A 1 237 ? 90.531  42.553  37.930  1.00 25.86  ? 7032 THR A O     1 
ATOM   2059 C  CB    . THR A 1 237 ? 92.585  41.056  39.454  1.00 25.03  ? 7032 THR A CB    1 
ATOM   2060 O  OG1   . THR A 1 237 ? 93.364  40.548  38.371  1.00 23.85  ? 7032 THR A OG1   1 
ATOM   2061 C  CG2   . THR A 1 237 ? 93.133  40.537  40.766  1.00 26.04  ? 7032 THR A CG2   1 
ATOM   2062 N  N     . ASN A 1 238 ? 90.040  40.512  37.038  1.00 24.20  ? 7033 ASN A N     1 
ATOM   2063 C  CA    . ASN A 1 238 ? 89.466  41.074  35.788  1.00 25.46  ? 7033 ASN A CA    1 
ATOM   2064 C  C     . ASN A 1 238 ? 88.094  40.478  35.525  1.00 25.55  ? 7033 ASN A C     1 
ATOM   2065 O  O     . ASN A 1 238 ? 87.974  39.512  34.770  1.00 24.31  ? 7033 ASN A O     1 
ATOM   2066 C  CB    . ASN A 1 238 ? 90.357  40.821  34.576  1.00 26.12  ? 7033 ASN A CB    1 
ATOM   2067 C  CG    . ASN A 1 238 ? 91.664  41.566  34.680  1.00 28.62  ? 7033 ASN A CG    1 
ATOM   2068 O  OD1   . ASN A 1 238 ? 92.496  41.262  35.538  1.00 29.86  ? 7033 ASN A OD1   1 
ATOM   2069 N  ND2   . ASN A 1 238 ? 91.847  42.536  33.802  1.00 29.85  ? 7033 ASN A ND2   1 
ATOM   2070 N  N     . PRO A 1 239 ? 87.031  41.026  36.141  1.00 27.26  ? 7034 PRO A N     1 
ATOM   2071 C  CA    . PRO A 1 239 ? 85.681  40.547  35.882  1.00 27.90  ? 7034 PRO A CA    1 
ATOM   2072 C  C     . PRO A 1 239 ? 85.404  40.692  34.384  1.00 27.10  ? 7034 PRO A C     1 
ATOM   2073 O  O     . PRO A 1 239 ? 85.720  41.719  33.818  1.00 28.26  ? 7034 PRO A O     1 
ATOM   2074 C  CB    . PRO A 1 239 ? 84.769  41.465  36.707  1.00 29.28  ? 7034 PRO A CB    1 
ATOM   2075 C  CG    . PRO A 1 239 ? 85.679  42.044  37.765  1.00 30.57  ? 7034 PRO A CG    1 
ATOM   2076 C  CD    . PRO A 1 239 ? 87.060  42.104  37.141  1.00 29.72  ? 7034 PRO A CD    1 
ATOM   2077 N  N     . ILE A 1 240 ? 84.846  39.652  33.784  1.00 26.61  ? 7035 ILE A N     1 
ATOM   2078 C  CA    . ILE A 1 240 ? 84.512  39.710  32.335  1.00 26.45  ? 7035 ILE A CA    1 
ATOM   2079 C  C     . ILE A 1 240 ? 82.993  39.795  32.238  1.00 27.08  ? 7035 ILE A C     1 
ATOM   2080 O  O     . ILE A 1 240 ? 82.313  38.962  32.874  1.00 27.87  ? 7035 ILE A O     1 
ATOM   2081 C  CB    . ILE A 1 240 ? 85.121  38.508  31.591  1.00 25.68  ? 7035 ILE A CB    1 
ATOM   2082 C  CG1   . ILE A 1 240 ? 86.649  38.524  31.693  1.00 25.79  ? 7035 ILE A CG1   1 
ATOM   2083 C  CG2   . ILE A 1 240 ? 84.647  38.475  30.148  1.00 25.34  ? 7035 ILE A CG2   1 
ATOM   2084 C  CD1   . ILE A 1 240 ? 87.317  37.242  31.233  1.00 26.11  ? 7035 ILE A CD1   1 
ATOM   2085 N  N     . GLN A 1 241 ? 82.498  40.801  31.513  1.00 27.52  ? 7036 GLN A N     1 
ATOM   2086 C  CA    . GLN A 1 241 ? 81.039  41.012  31.344  1.00 28.90  ? 7036 GLN A CA    1 
ATOM   2087 C  C     . GLN A 1 241 ? 80.478  39.862  30.504  1.00 26.37  ? 7036 GLN A C     1 
ATOM   2088 O  O     . GLN A 1 241 ? 81.008  39.621  29.406  1.00 26.04  ? 7036 GLN A O     1 
ATOM   2089 C  CB    . GLN A 1 241 ? 80.780  42.372  30.686  1.00 32.46  ? 7036 GLN A CB    1 
ATOM   2090 C  CG    . GLN A 1 241 ? 79.319  42.647  30.351  1.00 36.70  ? 7036 GLN A CG    1 
ATOM   2091 C  CD    . GLN A 1 241 ? 79.116  43.983  29.670  1.00 40.94  ? 7036 GLN A CD    1 
ATOM   2092 O  OE1   . GLN A 1 241 ? 79.957  44.876  29.739  1.00 46.12  ? 7036 GLN A OE1   1 
ATOM   2093 N  NE2   . GLN A 1 241 ? 77.981  44.135  29.006  1.00 43.91  ? 7036 GLN A NE2   1 
ATOM   2094 N  N     . LEU A 1 242 ? 79.476  39.156  31.028  1.00 24.64  ? 7037 LEU A N     1 
ATOM   2095 C  CA    . LEU A 1 242 ? 78.809  38.094  30.235  1.00 24.16  ? 7037 LEU A CA    1 
ATOM   2096 C  C     . LEU A 1 242 ? 78.267  38.729  28.955  1.00 23.65  ? 7037 LEU A C     1 
ATOM   2097 O  O     . LEU A 1 242 ? 77.643  39.819  29.048  1.00 23.51  ? 7037 LEU A O     1 
ATOM   2098 C  CB    . LEU A 1 242 ? 77.675  37.490  31.062  1.00 25.55  ? 7037 LEU A CB    1 
ATOM   2099 C  CG    . LEU A 1 242 ? 78.103  36.493  32.134  1.00 26.60  ? 7037 LEU A CG    1 
ATOM   2100 C  CD1   . LEU A 1 242 ? 77.006  36.318  33.170  1.00 29.17  ? 7037 LEU A CD1   1 
ATOM   2101 C  CD2   . LEU A 1 242 ? 78.468  35.163  31.504  1.00 25.95  ? 7037 LEU A CD2   1 
ATOM   2102 N  N     . SER A 1 243 ? 78.493  38.091  27.809  1.00 22.10  ? 7038 SER A N     1 
ATOM   2103 C  CA    . SER A 1 243 ? 77.997  38.688  26.546  1.00 22.49  ? 7038 SER A CA    1 
ATOM   2104 C  C     . SER A 1 243 ? 77.789  37.635  25.459  1.00 21.39  ? 7038 SER A C     1 
ATOM   2105 O  O     . SER A 1 243 ? 78.643  36.741  25.302  1.00 20.74  ? 7038 SER A O     1 
ATOM   2106 C  CB    . SER A 1 243 ? 78.932  39.748  26.051  1.00 22.94  ? 7038 SER A CB    1 
ATOM   2107 O  OG    . SER A 1 243 ? 78.504  40.220  24.784  1.00 24.31  ? 7038 SER A OG    1 
ATOM   2108 N  N     A SER A 1 244 ? 76.663  37.736  24.752  0.60 21.83  ? 7039 SER A N     1 
ATOM   2109 N  N     B SER A 1 244 ? 76.691  37.803  24.715  0.40 21.91  ? 7039 SER A N     1 
ATOM   2110 C  CA    A SER A 1 244 ? 76.285  36.841  23.628  0.60 21.67  ? 7039 SER A CA    1 
ATOM   2111 C  CA    B SER A 1 244 ? 76.331  36.968  23.543  0.40 21.70  ? 7039 SER A CA    1 
ATOM   2112 C  C     A SER A 1 244 ? 76.363  37.620  22.310  0.60 21.79  ? 7039 SER A C     1 
ATOM   2113 C  C     B SER A 1 244 ? 76.352  37.846  22.284  0.40 22.13  ? 7039 SER A C     1 
ATOM   2114 O  O     A SER A 1 244 ? 76.054  37.032  21.254  0.60 21.71  ? 7039 SER A O     1 
ATOM   2115 O  O     B SER A 1 244 ? 75.864  37.374  21.243  0.40 22.14  ? 7039 SER A O     1 
ATOM   2116 C  CB    A SER A 1 244 ? 74.893  36.322  23.840  0.60 22.67  ? 7039 SER A CB    1 
ATOM   2117 C  CB    B SER A 1 244 ? 74.972  36.326  23.720  0.40 22.31  ? 7039 SER A CB    1 
ATOM   2118 O  OG    A SER A 1 244 ? 73.983  37.410  23.938  0.60 24.54  ? 7039 SER A OG    1 
ATOM   2119 O  OG    B SER A 1 244 ? 74.946  35.453  24.841  0.40 22.22  ? 7039 SER A OG    1 
ATOM   2120 N  N     A TYR A 1 245 ? 76.790  38.895  22.382  0.50 21.97  ? 7040 TYR A N     1 
ATOM   2121 N  N     B TYR A 1 245 ? 76.899  39.070  22.367  0.50 22.42  ? 7040 TYR A N     1 
ATOM   2122 C  CA    A TYR A 1 245 ? 76.777  39.835  21.222  0.50 22.53  ? 7040 TYR A CA    1 
ATOM   2123 C  CA    B TYR A 1 245 ? 76.871  39.968  21.182  0.50 23.20  ? 7040 TYR A CA    1 
ATOM   2124 C  C     A TYR A 1 245 ? 77.397  39.231  19.948  0.50 22.33  ? 7040 TYR A C     1 
ATOM   2125 C  C     B TYR A 1 245 ? 77.440  39.303  19.924  0.50 22.71  ? 7040 TYR A C     1 
ATOM   2126 O  O     A TYR A 1 245 ? 76.753  39.345  18.884  0.50 22.67  ? 7040 TYR A O     1 
ATOM   2127 O  O     B TYR A 1 245 ? 76.808  39.432  18.855  0.50 22.94  ? 7040 TYR A O     1 
ATOM   2128 C  CB    A TYR A 1 245 ? 77.493  41.159  21.524  0.50 22.88  ? 7040 TYR A CB    1 
ATOM   2129 C  CB    B TYR A 1 245 ? 77.686  41.239  21.403  0.50 23.94  ? 7040 TYR A CB    1 
ATOM   2130 C  CG    A TYR A 1 245 ? 76.963  41.989  22.672  0.50 23.09  ? 7040 TYR A CG    1 
ATOM   2131 C  CG    B TYR A 1 245 ? 77.932  41.990  20.120  0.50 24.77  ? 7040 TYR A CG    1 
ATOM   2132 C  CD1   A TYR A 1 245 ? 75.693  41.799  23.193  0.50 23.34  ? 7040 TYR A CD1   1 
ATOM   2133 C  CD1   B TYR A 1 245 ? 76.975  42.843  19.595  0.50 26.14  ? 7040 TYR A CD1   1 
ATOM   2134 C  CD2   A TYR A 1 245 ? 77.688  43.074  23.142  0.50 23.53  ? 7040 TYR A CD2   1 
ATOM   2135 C  CD2   B TYR A 1 245 ? 79.103  41.810  19.402  0.50 24.68  ? 7040 TYR A CD2   1 
ATOM   2136 C  CE1   A TYR A 1 245 ? 75.212  42.583  24.231  0.50 23.96  ? 7040 TYR A CE1   1 
ATOM   2137 C  CE1   B TYR A 1 245 ? 77.191  43.525  18.409  0.50 26.87  ? 7040 TYR A CE1   1 
ATOM   2138 C  CE2   A TYR A 1 245 ? 77.213  43.885  24.160  0.50 23.90  ? 7040 TYR A CE2   1 
ATOM   2139 C  CE2   B TYR A 1 245 ? 79.334  42.481  18.212  0.50 25.70  ? 7040 TYR A CE2   1 
ATOM   2140 C  CZ    A TYR A 1 245 ? 75.971  43.635  24.713  0.50 24.45  ? 7040 TYR A CZ    1 
ATOM   2141 C  CZ    B TYR A 1 245 ? 78.372  43.342  17.713  0.50 26.87  ? 7040 TYR A CZ    1 
ATOM   2142 O  OH    A TYR A 1 245 ? 75.495  44.432  25.716  0.50 25.37  ? 7040 TYR A OH    1 
ATOM   2143 O  OH    B TYR A 1 245 ? 78.588  44.020  16.548  0.50 28.54  ? 7040 TYR A OH    1 
ATOM   2144 N  N     . SER A 1 246 ? 78.594  38.638  20.038  1.00 21.64  ? 7041 SER A N     1 
ATOM   2145 C  CA    . SER A 1 246 ? 79.293  38.094  18.837  1.00 21.89  ? 7041 SER A CA    1 
ATOM   2146 C  C     . SER A 1 246 ? 78.495  36.984  18.136  1.00 22.50  ? 7041 SER A C     1 
ATOM   2147 O  O     . SER A 1 246 ? 78.771  36.726  16.946  1.00 22.82  ? 7041 SER A O     1 
ATOM   2148 C  CB    . SER A 1 246 ? 80.682  37.622  19.192  1.00 21.13  ? 7041 SER A CB    1 
ATOM   2149 O  OG    . SER A 1 246 ? 80.641  36.361  19.844  1.00 19.84  ? 7041 SER A OG    1 
ATOM   2150 N  N     . LEU A 1 247 ? 77.530  36.377  18.825  1.00 22.58  ? 7042 LEU A N     1 
ATOM   2151 C  CA    . LEU A 1 247 ? 76.761  35.241  18.246  1.00 23.33  ? 7042 LEU A CA    1 
ATOM   2152 C  C     . LEU A 1 247 ? 75.805  35.731  17.154  1.00 24.80  ? 7042 LEU A C     1 
ATOM   2153 O  O     . LEU A 1 247 ? 75.399  34.902  16.323  1.00 25.83  ? 7042 LEU A O     1 
ATOM   2154 C  CB    . LEU A 1 247 ? 75.953  34.557  19.352  1.00 22.96  ? 7042 LEU A CB    1 
ATOM   2155 C  CG    . LEU A 1 247 ? 76.715  34.041  20.570  1.00 22.99  ? 7042 LEU A CG    1 
ATOM   2156 C  CD1   . LEU A 1 247 ? 75.745  33.349  21.513  1.00 23.43  ? 7042 LEU A CD1   1 
ATOM   2157 C  CD2   . LEU A 1 247 ? 77.841  33.095  20.175  1.00 22.93  ? 7042 LEU A CD2   1 
ATOM   2158 N  N     . PHE A 1 248 ? 75.453  37.021  17.155  1.00 24.99  ? 7043 PHE A N     1 
ATOM   2159 C  CA    . PHE A 1 248 ? 74.447  37.594  16.223  1.00 26.38  ? 7043 PHE A CA    1 
ATOM   2160 C  C     . PHE A 1 248 ? 75.043  37.929  14.850  1.00 28.35  ? 7043 PHE A C     1 
ATOM   2161 O  O     . PHE A 1 248 ? 74.239  38.216  13.952  1.00 33.02  ? 7043 PHE A O     1 
ATOM   2162 C  CB    . PHE A 1 248 ? 73.756  38.784  16.891  1.00 26.55  ? 7043 PHE A CB    1 
ATOM   2163 C  CG    . PHE A 1 248 ? 72.818  38.382  18.000  1.00 26.11  ? 7043 PHE A CG    1 
ATOM   2164 C  CD1   . PHE A 1 248 ? 73.288  38.154  19.283  1.00 25.24  ? 7043 PHE A CD1   1 
ATOM   2165 C  CD2   . PHE A 1 248 ? 71.467  38.198  17.750  1.00 26.77  ? 7043 PHE A CD2   1 
ATOM   2166 C  CE1   . PHE A 1 248 ? 72.423  37.764  20.295  1.00 25.46  ? 7043 PHE A CE1   1 
ATOM   2167 C  CE2   . PHE A 1 248 ? 70.604  37.813  18.765  1.00 26.76  ? 7043 PHE A CE2   1 
ATOM   2168 C  CZ    . PHE A 1 248 ? 71.083  37.596  20.034  1.00 25.97  ? 7043 PHE A CZ    1 
ATOM   2169 N  N     . ASP A 1 249 ? 76.370  37.927  14.689  1.00 28.17  ? 7044 ASP A N     1 
ATOM   2170 C  CA    . ASP A 1 249 ? 76.954  38.200  13.345  1.00 29.47  ? 7044 ASP A CA    1 
ATOM   2171 C  C     . ASP A 1 249 ? 77.824  37.010  12.948  1.00 27.55  ? 7044 ASP A C     1 
ATOM   2172 O  O     . ASP A 1 249 ? 78.977  36.931  13.428  1.00 27.22  ? 7044 ASP A O     1 
ATOM   2173 C  CB    . ASP A 1 249 ? 77.762  39.500  13.292  1.00 31.71  ? 7044 ASP A CB    1 
ATOM   2174 C  CG    . ASP A 1 249 ? 78.271  39.824  11.896  1.00 34.37  ? 7044 ASP A CG    1 
ATOM   2175 O  OD1   . ASP A 1 249 ? 78.005  39.028  10.960  1.00 34.00  ? 7044 ASP A OD1   1 
ATOM   2176 O  OD2   . ASP A 1 249 ? 78.907  40.880  11.744  1.00 40.65  ? 7044 ASP A OD2   1 
ATOM   2177 N  N     . MET A 1 250 ? 77.276  36.130  12.107  1.00 26.80  ? 7045 MET A N     1 
ATOM   2178 C  CA    . MET A 1 250 ? 77.970  34.901  11.650  1.00 26.29  ? 7045 MET A CA    1 
ATOM   2179 C  C     . MET A 1 250 ? 78.429  35.062  10.198  1.00 27.14  ? 7045 MET A C     1 
ATOM   2180 O  O     . MET A 1 250 ? 78.884  34.061  9.625   1.00 26.79  ? 7045 MET A O     1 
ATOM   2181 C  CB    . MET A 1 250 ? 77.019  33.705  11.763  1.00 25.97  ? 7045 MET A CB    1 
ATOM   2182 C  CG    . MET A 1 250 ? 76.627  33.405  13.191  1.00 25.40  ? 7045 MET A CG    1 
ATOM   2183 S  SD    . MET A 1 250 ? 78.030  32.799  14.154  1.00 23.87  ? 7045 MET A SD    1 
ATOM   2184 C  CE    . MET A 1 250 ? 78.199  31.154  13.464  1.00 23.23  ? 7045 MET A CE    1 
ATOM   2185 N  N     . SER A 1 251 ? 78.362  36.285  9.652   1.00 29.11  ? 7046 SER A N     1 
ATOM   2186 C  CA    . SER A 1 251 ? 78.721  36.520  8.228   1.00 30.57  ? 7046 SER A CA    1 
ATOM   2187 C  C     . SER A 1 251 ? 80.180  36.134  7.938   1.00 31.41  ? 7046 SER A C     1 
ATOM   2188 O  O     . SER A 1 251 ? 80.442  35.703  6.800   1.00 34.06  ? 7046 SER A O     1 
ATOM   2189 C  CB    . SER A 1 251 ? 78.443  37.949  7.811   1.00 31.93  ? 7046 SER A CB    1 
ATOM   2190 O  OG    . SER A 1 251 ? 79.259  38.858  8.529   1.00 31.52  ? 7046 SER A OG    1 
ATOM   2191 N  N     . LYS A 1 252 ? 81.096  36.309  8.894   1.00 30.16  ? 7047 LYS A N     1 
ATOM   2192 C  CA    . LYS A 1 252 ? 82.530  35.979  8.653   1.00 31.75  ? 7047 LYS A CA    1 
ATOM   2193 C  C     . LYS A 1 252 ? 82.953  34.786  9.518   1.00 28.87  ? 7047 LYS A C     1 
ATOM   2194 O  O     . LYS A 1 252 ? 84.149  34.675  9.837   1.00 29.34  ? 7047 LYS A O     1 
ATOM   2195 C  CB    . LYS A 1 252 ? 83.387  37.214  8.944   1.00 34.88  ? 7047 LYS A CB    1 
ATOM   2196 C  CG    . LYS A 1 252 ? 83.071  38.425  8.075   1.00 39.29  ? 7047 LYS A CG    1 
ATOM   2197 C  CD    . LYS A 1 252 ? 83.946  39.620  8.371   1.00 43.42  ? 7047 LYS A CD    1 
ATOM   2198 C  CE    . LYS A 1 252 ? 83.647  40.804  7.475   1.00 47.58  ? 7047 LYS A CE    1 
ATOM   2199 N  NZ    . LYS A 1 252 ? 84.555  41.942  7.753   1.00 51.56  ? 7047 LYS A NZ    1 
ATOM   2200 N  N     . PHE A 1 253 ? 82.021  33.882  9.817   1.00 26.98  ? 7048 PHE A N     1 
ATOM   2201 C  CA    . PHE A 1 253 ? 82.329  32.774  10.753  1.00 24.81  ? 7048 PHE A CA    1 
ATOM   2202 C  C     . PHE A 1 253 ? 83.232  31.707  10.140  1.00 25.33  ? 7048 PHE A C     1 
ATOM   2203 O  O     . PHE A 1 253 ? 84.188  31.288  10.786  1.00 23.53  ? 7048 PHE A O     1 
ATOM   2204 C  CB    . PHE A 1 253 ? 81.046  32.127  11.270  1.00 23.57  ? 7048 PHE A CB    1 
ATOM   2205 C  CG    . PHE A 1 253 ? 81.301  31.001  12.237  1.00 21.70  ? 7048 PHE A CG    1 
ATOM   2206 C  CD1   . PHE A 1 253 ? 81.790  31.267  13.505  1.00 21.05  ? 7048 PHE A CD1   1 
ATOM   2207 C  CD2   . PHE A 1 253 ? 81.042  29.686  11.888  1.00 21.28  ? 7048 PHE A CD2   1 
ATOM   2208 C  CE1   . PHE A 1 253 ? 82.033  30.237  14.400  1.00 19.89  ? 7048 PHE A CE1   1 
ATOM   2209 C  CE2   . PHE A 1 253 ? 81.281  28.657  12.784  1.00 20.70  ? 7048 PHE A CE2   1 
ATOM   2210 C  CZ    . PHE A 1 253 ? 81.770  28.934  14.041  1.00 19.72  ? 7048 PHE A CZ    1 
ATOM   2211 N  N     . PRO A 1 254 ? 82.957  31.197  8.919   1.00 24.85  ? 7049 PRO A N     1 
ATOM   2212 C  CA    . PRO A 1 254 ? 83.741  30.087  8.374   1.00 25.16  ? 7049 PRO A CA    1 
ATOM   2213 C  C     . PRO A 1 254 ? 85.256  30.327  8.340   1.00 25.47  ? 7049 PRO A C     1 
ATOM   2214 O  O     . PRO A 1 254 ? 85.688  31.404  7.945   1.00 26.85  ? 7049 PRO A O     1 
ATOM   2215 C  CB    . PRO A 1 254 ? 83.188  29.894  6.947   1.00 26.83  ? 7049 PRO A CB    1 
ATOM   2216 C  CG    . PRO A 1 254 ? 81.806  30.516  6.989   1.00 27.69  ? 7049 PRO A CG    1 
ATOM   2217 C  CD    . PRO A 1 254 ? 81.890  31.636  8.007   1.00 26.98  ? 7049 PRO A CD    1 
ATOM   2218 N  N     . LEU A 1 255 ? 86.018  29.322  8.781   1.00 24.28  ? 7050 LEU A N     1 
ATOM   2219 C  CA    . LEU A 1 255 ? 87.499  29.363  8.737   1.00 25.00  ? 7050 LEU A CA    1 
ATOM   2220 C  C     . LEU A 1 255 ? 87.926  29.384  7.266   1.00 27.89  ? 7050 LEU A C     1 
ATOM   2221 O  O     . LEU A 1 255 ? 87.508  28.485  6.521   1.00 27.82  ? 7050 LEU A O     1 
ATOM   2222 C  CB    . LEU A 1 255 ? 88.053  28.129  9.446   1.00 23.59  ? 7050 LEU A CB    1 
ATOM   2223 C  CG    . LEU A 1 255 ? 89.571  28.004  9.481   1.00 23.49  ? 7050 LEU A CG    1 
ATOM   2224 C  CD1   . LEU A 1 255 ? 90.205  29.174  10.221  1.00 25.40  ? 7050 LEU A CD1   1 
ATOM   2225 C  CD2   . LEU A 1 255 ? 89.980  26.679  10.105  1.00 23.37  ? 7050 LEU A CD2   1 
ATOM   2226 N  N     . LYS A 1 256 ? 88.729  30.367  6.871   1.00 31.19  ? 7051 LYS A N     1 
ATOM   2227 C  CA    . LYS A 1 256 ? 89.138  30.447  5.444   1.00 35.35  ? 7051 LYS A CA    1 
ATOM   2228 C  C     . LYS A 1 256 ? 90.135  29.333  5.115   1.00 33.45  ? 7051 LYS A C     1 
ATOM   2229 O  O     . LYS A 1 256 ? 91.092  29.131  5.880   1.00 31.14  ? 7051 LYS A O     1 
ATOM   2230 C  CB    . LYS A 1 256 ? 89.677  31.842  5.127   1.00 40.85  ? 7051 LYS A CB    1 
ATOM   2231 C  CG    . LYS A 1 256 ? 88.609  32.925  5.179   1.00 46.53  ? 7051 LYS A CG    1 
ATOM   2232 C  CD    . LYS A 1 256 ? 89.058  34.283  4.689   1.00 51.94  ? 7051 LYS A CD    1 
ATOM   2233 C  CE    . LYS A 1 256 ? 87.919  35.282  4.648   1.00 55.72  ? 7051 LYS A CE    1 
ATOM   2234 N  NZ    . LYS A 1 256 ? 87.266  35.423  5.972   1.00 57.48  ? 7051 LYS A NZ    1 
ATOM   2235 N  N     . LEU A 1 257 ? 89.872  28.616  4.021   1.00 36.13  ? 7052 LEU A N     1 
ATOM   2236 C  CA    . LEU A 1 257 ? 90.779  27.550  3.526   1.00 37.35  ? 7052 LEU A CA    1 
ATOM   2237 C  C     . LEU A 1 257 ? 91.993  28.261  2.924   1.00 39.58  ? 7052 LEU A C     1 
ATOM   2238 O  O     . LEU A 1 257 ? 91.838  28.907  1.874   1.00 42.99  ? 7052 LEU A O     1 
ATOM   2239 C  CB    . LEU A 1 257 ? 90.020  26.703  2.497   1.00 39.29  ? 7052 LEU A CB    1 
ATOM   2240 C  CG    . LEU A 1 257 ? 90.803  25.569  1.838   1.00 41.02  ? 7052 LEU A CG    1 
ATOM   2241 C  CD1   . LEU A 1 257 ? 91.407  24.635  2.873   1.00 39.35  ? 7052 LEU A CD1   1 
ATOM   2242 C  CD2   . LEU A 1 257 ? 89.908  24.795  0.880   1.00 43.84  ? 7052 LEU A CD2   1 
ATOM   2243 N  N     A ARG A 1 258 ? 93.156  28.148  3.574   0.50 38.56  ? 7053 ARG A N     1 
ATOM   2244 N  N     B ARG A 1 258 ? 93.149  28.148  3.584   0.50 38.07  ? 7053 ARG A N     1 
ATOM   2245 C  CA    A ARG A 1 258 ? 94.380  28.853  3.102   0.50 40.00  ? 7053 ARG A CA    1 
ATOM   2246 C  CA    B ARG A 1 258 ? 94.393  28.832  3.141   0.50 39.16  ? 7053 ARG A CA    1 
ATOM   2247 C  C     A ARG A 1 258 ? 95.216  27.937  2.198   0.50 39.46  ? 7053 ARG A C     1 
ATOM   2248 C  C     B ARG A 1 258 ? 95.194  27.940  2.185   0.50 38.99  ? 7053 ARG A C     1 
ATOM   2249 O  O     A ARG A 1 258 ? 96.122  28.463  1.521   0.50 40.28  ? 7053 ARG A O     1 
ATOM   2250 O  O     B ARG A 1 258 ? 96.046  28.487  1.458   0.50 39.84  ? 7053 ARG A O     1 
ATOM   2251 C  CB    A ARG A 1 258 ? 95.199  29.355  4.296   0.50 40.12  ? 7053 ARG A CB    1 
ATOM   2252 C  CB    B ARG A 1 258 ? 95.251  29.189  4.359   0.50 38.59  ? 7053 ARG A CB    1 
ATOM   2253 C  CG    A ARG A 1 258 ? 94.381  30.159  5.298   0.50 40.95  ? 7053 ARG A CG    1 
ATOM   2254 C  CG    B ARG A 1 258 ? 94.557  30.101  5.360   0.50 39.20  ? 7053 ARG A CG    1 
ATOM   2255 C  CD    A ARG A 1 258 ? 95.184  31.122  6.154   0.50 42.88  ? 7053 ARG A CD    1 
ATOM   2256 C  CD    B ARG A 1 258 ? 94.125  31.412  4.729   0.50 41.94  ? 7053 ARG A CD    1 
ATOM   2257 N  NE    A ARG A 1 258 ? 96.260  30.523  6.926   0.50 43.74  ? 7053 ARG A NE    1 
ATOM   2258 N  NE    B ARG A 1 258 ? 93.422  32.273  5.670   0.50 42.43  ? 7053 ARG A NE    1 
ATOM   2259 C  CZ    A ARG A 1 258 ? 96.969  31.177  7.841   0.50 45.04  ? 7053 ARG A CZ    1 
ATOM   2260 C  CZ    B ARG A 1 258 ? 92.969  33.485  5.383   0.50 45.08  ? 7053 ARG A CZ    1 
ATOM   2261 N  NH1   A ARG A 1 258 ? 97.935  30.562  8.500   0.50 44.36  ? 7053 ARG A NH1   1 
ATOM   2262 N  NH1   B ARG A 1 258 ? 92.342  34.190  6.307   0.50 46.17  ? 7053 ARG A NH1   1 
ATOM   2263 N  NH2   A ARG A 1 258 ? 96.698  32.443  8.107   0.50 47.30  ? 7053 ARG A NH2   1 
ATOM   2264 N  NH2   B ARG A 1 258 ? 93.148  33.989  4.174   0.50 47.49  ? 7053 ARG A NH2   1 
ATOM   2265 N  N     . GLY A 1 259 ? 94.926  26.631  2.185   1.00 37.02  ? 7054 GLY A N     1 
ATOM   2266 C  CA    . GLY A 1 259 ? 95.692  25.683  1.353   1.00 37.62  ? 7054 GLY A CA    1 
ATOM   2267 C  C     . GLY A 1 259 ? 97.142  25.641  1.805   1.00 37.05  ? 7054 GLY A C     1 
ATOM   2268 O  O     . GLY A 1 259 ? 98.038  25.501  0.948   1.00 36.17  ? 7054 GLY A O     1 
ATOM   2269 N  N     . THR A 1 260 ? 97.357  25.806  3.115   1.00 32.30  ? 7055 THR A N     1 
ATOM   2270 C  CA    . THR A 1 260 ? 98.702  25.814  3.744   1.00 31.95  ? 7055 THR A CA    1 
ATOM   2271 C  C     . THR A 1 260 ? 99.510  24.599  3.279   1.00 33.47  ? 7055 THR A C     1 
ATOM   2272 O  O     . THR A 1 260 ? 98.966  23.472  3.316   1.00 32.26  ? 7055 THR A O     1 
ATOM   2273 C  CB    . THR A 1 260 ? 98.587  25.819  5.275   1.00 29.86  ? 7055 THR A CB    1 
ATOM   2274 O  OG1   . THR A 1 260 ? 97.736  26.908  5.637   1.00 28.55  ? 7055 THR A OG1   1 
ATOM   2275 C  CG2   . THR A 1 260 ? 99.930  25.944  5.957   1.00 29.87  ? 7055 THR A CG2   1 
ATOM   2276 N  N     . ALA A 1 261 ? 100.772 24.830  2.910   1.00 34.08  ? 7056 ALA A N     1 
ATOM   2277 C  CA    . ALA A 1 261 ? 101.655 23.750  2.415   1.00 34.79  ? 7056 ALA A CA    1 
ATOM   2278 C  C     . ALA A 1 261 ? 101.885 22.694  3.501   1.00 34.06  ? 7056 ALA A C     1 
ATOM   2279 O  O     . ALA A 1 261 ? 102.084 23.065  4.682   1.00 31.12  ? 7056 ALA A O     1 
ATOM   2280 C  CB    . ALA A 1 261 ? 102.965 24.331  1.945   1.00 37.13  ? 7056 ALA A CB    1 
ATOM   2281 N  N     . VAL A 1 262 ? 101.830 21.423  3.093   1.00 33.33  ? 7057 VAL A N     1 
ATOM   2282 C  CA    . VAL A 1 262 ? 102.127 20.254  3.967   1.00 34.54  ? 7057 VAL A CA    1 
ATOM   2283 C  C     . VAL A 1 262 ? 103.397 19.597  3.419   1.00 37.40  ? 7057 VAL A C     1 
ATOM   2284 O  O     . VAL A 1 262 ? 103.390 19.235  2.233   1.00 37.66  ? 7057 VAL A O     1 
ATOM   2285 C  CB    . VAL A 1 262 ? 100.955 19.255  4.006   1.00 34.82  ? 7057 VAL A CB    1 
ATOM   2286 C  CG1   . VAL A 1 262 ? 101.304 18.017  4.817   1.00 35.11  ? 7057 VAL A CG1   1 
ATOM   2287 C  CG2   . VAL A 1 262 ? 99.679  19.900  4.529   1.00 34.68  ? 7057 VAL A CG2   1 
ATOM   2288 N  N     . MET A 1 263 ? 104.441 19.477  4.242   1.00 38.70  ? 7058 MET A N     1 
ATOM   2289 C  CA    . MET A 1 263 ? 105.716 18.846  3.809   1.00 43.56  ? 7058 MET A CA    1 
ATOM   2290 C  C     . MET A 1 263 ? 106.125 17.770  4.814   1.00 43.98  ? 7058 MET A C     1 
ATOM   2291 O  O     . MET A 1 263 ? 105.811 17.926  6.007   1.00 40.13  ? 7058 MET A O     1 
ATOM   2292 C  CB    . MET A 1 263 ? 106.843 19.878  3.726   1.00 45.08  ? 7058 MET A CB    1 
ATOM   2293 C  CG    . MET A 1 263 ? 106.564 21.000  2.759   1.00 49.09  ? 7058 MET A CG    1 
ATOM   2294 S  SD    . MET A 1 263 ? 107.918 22.198  2.717   1.00 54.21  ? 7058 MET A SD    1 
ATOM   2295 C  CE    . MET A 1 263 ? 107.270 23.366  1.522   1.00 55.71  ? 7058 MET A CE    1 
ATOM   2296 N  N     . SER A 1 264 ? 106.808 16.730  4.334   1.00 45.87  ? 7059 SER A N     1 
ATOM   2297 C  CA    . SER A 1 264 ? 107.318 15.638  5.202   1.00 51.36  ? 7059 SER A CA    1 
ATOM   2298 C  C     . SER A 1 264 ? 108.833 15.805  5.365   1.00 55.04  ? 7059 SER A C     1 
ATOM   2299 O  O     . SER A 1 264 ? 109.586 15.152  4.616   1.00 61.47  ? 7059 SER A O     1 
ATOM   2300 C  CB    . SER A 1 264 ? 106.960 14.290  4.638   1.00 54.23  ? 7059 SER A CB    1 
ATOM   2301 O  OG    . SER A 1 264 ? 107.445 13.254  5.477   1.00 59.65  ? 7059 SER A OG    1 
ATOM   2302 N  N     . LEU A 1 265 ? 109.252 16.662  6.300   1.00 56.01  ? 7060 LEU A N     1 
ATOM   2303 C  CA    . LEU A 1 265 ? 110.689 16.955  6.556   1.00 59.73  ? 7060 LEU A CA    1 
ATOM   2304 C  C     . LEU A 1 265 ? 111.172 16.160  7.773   1.00 65.27  ? 7060 LEU A C     1 
ATOM   2305 O  O     . LEU A 1 265 ? 110.346 15.899  8.672   1.00 66.31  ? 7060 LEU A O     1 
ATOM   2306 C  CB    . LEU A 1 265 ? 110.848 18.460  6.795   1.00 58.49  ? 7060 LEU A CB    1 
ATOM   2307 C  CG    . LEU A 1 265 ? 110.368 19.368  5.663   1.00 58.18  ? 7060 LEU A CG    1 
ATOM   2308 C  CD1   . LEU A 1 265 ? 110.455 20.831  6.069   1.00 58.82  ? 7060 LEU A CD1   1 
ATOM   2309 C  CD2   . LEU A 1 265 ? 111.160 19.123  4.386   1.00 59.53  ? 7060 LEU A CD2   1 
ATOM   2310 N  N     . LYS A 1 266 ? 112.460 15.792  7.789   1.00 71.85  ? 7061 LYS A N     1 
ATOM   2311 C  CA    . LYS A 1 266 ? 113.056 15.060  8.941   1.00 77.70  ? 7061 LYS A CA    1 
ATOM   2312 C  C     . LYS A 1 266 ? 113.462 16.097  9.995   1.00 80.97  ? 7061 LYS A C     1 
ATOM   2313 O  O     . LYS A 1 266 ? 113.525 17.293  9.645   1.00 81.29  ? 7061 LYS A O     1 
ATOM   2314 C  CB    . LYS A 1 266 ? 114.270 14.217  8.531   1.00 81.79  ? 7061 LYS A CB    1 
ATOM   2315 C  CG    . LYS A 1 266 ? 114.064 13.262  7.362   1.00 83.79  ? 7061 LYS A CG    1 
ATOM   2316 C  CD    . LYS A 1 266 ? 115.109 12.162  7.308   1.00 86.57  ? 7061 LYS A CD    1 
ATOM   2317 C  CE    . LYS A 1 266 ? 115.178 11.446  5.975   1.00 88.25  ? 7061 LYS A CE    1 
ATOM   2318 N  NZ    . LYS A 1 266 ? 115.821 12.287  4.937   1.00 89.10  ? 7061 LYS A NZ    1 
ATOM   2319 N  N     . GLU A 1 267 ? 113.747 15.649  11.222  1.00 84.66  ? 7062 GLU A N     1 
ATOM   2320 C  CA    . GLU A 1 267 ? 114.122 16.563  12.339  1.00 87.91  ? 7062 GLU A CA    1 
ATOM   2321 C  C     . GLU A 1 267 ? 115.384 17.361  11.979  1.00 86.50  ? 7062 GLU A C     1 
ATOM   2322 O  O     . GLU A 1 267 ? 115.497 18.516  12.437  1.00 87.47  ? 7062 GLU A O     1 
ATOM   2323 C  CB    . GLU A 1 267 ? 114.333 15.764  13.627  1.00 93.32  ? 7062 GLU A CB    1 
ATOM   2324 C  CG    . GLU A 1 267 ? 113.108 14.976  14.058  1.00 96.49  ? 7062 GLU A CG    1 
ATOM   2325 C  CD    . GLU A 1 267 ? 113.257 14.229  15.374  1.00 101.79 ? 7062 GLU A CD    1 
ATOM   2326 O  OE1   . GLU A 1 267 ? 114.374 14.228  15.932  1.00 105.37 ? 7062 GLU A OE1   1 
ATOM   2327 O  OE2   . GLU A 1 267 ? 112.253 13.654  15.841  1.00 104.00 ? 7062 GLU A OE2   1 
ATOM   2328 N  N     . GLY A 1 268 ? 116.283 16.772  11.184  1.00 83.41  ? 7063 GLY A N     1 
ATOM   2329 C  CA    . GLY A 1 268 ? 117.542 17.439  10.796  1.00 82.06  ? 7063 GLY A CA    1 
ATOM   2330 C  C     . GLY A 1 268 ? 117.344 18.514  9.738   1.00 79.07  ? 7063 GLY A C     1 
ATOM   2331 O  O     . GLY A 1 268 ? 118.316 19.246  9.464   1.00 81.55  ? 7063 GLY A O     1 
ATOM   2332 N  N     . GLN A 1 269 ? 116.135 18.624  9.173   1.00 73.91  ? 7064 GLN A N     1 
ATOM   2333 C  CA    . GLN A 1 269 ? 115.842 19.622  8.105   1.00 71.31  ? 7064 GLN A CA    1 
ATOM   2334 C  C     . GLN A 1 269 ? 115.033 20.798  8.674   1.00 67.99  ? 7064 GLN A C     1 
ATOM   2335 O  O     . GLN A 1 269 ? 114.723 21.734  7.910   1.00 67.80  ? 7064 GLN A O     1 
ATOM   2336 C  CB    . GLN A 1 269 ? 115.081 18.961  6.953   1.00 72.33  ? 7064 GLN A CB    1 
ATOM   2337 C  CG    . GLN A 1 269 ? 115.793 17.752  6.361   1.00 74.62  ? 7064 GLN A CG    1 
ATOM   2338 C  CD    . GLN A 1 269 ? 115.016 17.120  5.231   1.00 76.24  ? 7064 GLN A CD    1 
ATOM   2339 O  OE1   . GLN A 1 269 ? 114.296 17.788  4.492   1.00 78.67  ? 7064 GLN A OE1   1 
ATOM   2340 N  NE2   . GLN A 1 269 ? 115.174 15.816  5.077   1.00 79.83  ? 7064 GLN A NE2   1 
ATOM   2341 N  N     A ILE A 1 270 ? 114.704 20.747  9.970   0.50 66.19  ? 7065 ILE A N     1 
ATOM   2342 N  N     B ILE A 1 270 ? 114.709 20.746  9.972   0.50 65.69  ? 7065 ILE A N     1 
ATOM   2343 C  CA    A ILE A 1 270 ? 113.919 21.836  10.627  0.50 64.96  ? 7065 ILE A CA    1 
ATOM   2344 C  CA    B ILE A 1 270 ? 113.929 21.831  10.641  0.50 64.17  ? 7065 ILE A CA    1 
ATOM   2345 C  C     A ILE A 1 270 ? 114.878 22.959  11.037  0.50 64.88  ? 7065 ILE A C     1 
ATOM   2346 C  C     B ILE A 1 270 ? 114.891 22.956  11.039  0.50 64.46  ? 7065 ILE A C     1 
ATOM   2347 O  O     A ILE A 1 270 ? 115.289 22.983  12.215  0.50 68.34  ? 7065 ILE A O     1 
ATOM   2348 O  O     B ILE A 1 270 ? 115.317 22.978  12.211  0.50 68.00  ? 7065 ILE A O     1 
ATOM   2349 C  CB    A ILE A 1 270 ? 113.130 21.283  11.830  0.50 65.36  ? 7065 ILE A CB    1 
ATOM   2350 C  CB    B ILE A 1 270 ? 113.163 21.279  11.860  0.50 63.97  ? 7065 ILE A CB    1 
ATOM   2351 C  CG1   A ILE A 1 270 ? 112.278 20.073  11.437  0.50 64.00  ? 7065 ILE A CG1   1 
ATOM   2352 C  CG1   B ILE A 1 270 ? 112.323 20.053  11.494  0.50 62.06  ? 7065 ILE A CG1   1 
ATOM   2353 C  CG2   A ILE A 1 270 ? 112.294 22.376  12.478  0.50 65.91  ? 7065 ILE A CG2   1 
ATOM   2354 C  CG2   B ILE A 1 270 ? 112.321 22.367  12.507  0.50 64.56  ? 7065 ILE A CG2   1 
ATOM   2355 C  CD1   A ILE A 1 270 ? 111.526 19.454  12.590  0.50 64.38  ? 7065 ILE A CD1   1 
ATOM   2356 C  CD1   B ILE A 1 270 ? 111.279 20.320  10.439  0.50 59.92  ? 7065 ILE A CD1   1 
ATOM   2357 N  N     . ASN A 1 271 ? 115.207 23.851  10.096  1.00 74.92  ? 7066 ASN A N     1 
ATOM   2358 C  CA    . ASN A 1 271 ? 116.137 24.989  10.349  1.00 72.42  ? 7066 ASN A CA    1 
ATOM   2359 C  C     . ASN A 1 271 ? 115.334 26.207  10.830  1.00 67.11  ? 7066 ASN A C     1 
ATOM   2360 O  O     . ASN A 1 271 ? 114.100 26.088  10.966  1.00 62.11  ? 7066 ASN A O     1 
ATOM   2361 C  CB    . ASN A 1 271 ? 116.994 25.291  9.114   1.00 73.33  ? 7066 ASN A CB    1 
ATOM   2362 C  CG    . ASN A 1 271 ? 116.183 25.649  7.886   1.00 72.09  ? 7066 ASN A CG    1 
ATOM   2363 O  OD1   . ASN A 1 271 ? 115.100 26.217  7.992   1.00 67.52  ? 7066 ASN A OD1   1 
ATOM   2364 N  ND2   . ASN A 1 271 ? 116.711 25.339  6.713   1.00 73.70  ? 7066 ASN A ND2   1 
ATOM   2365 N  N     . ASP A 1 272 ? 116.018 27.331  11.072  1.00 65.16  ? 7067 ASP A N     1 
ATOM   2366 C  CA    . ASP A 1 272 ? 115.373 28.578  11.571  1.00 62.14  ? 7067 ASP A CA    1 
ATOM   2367 C  C     . ASP A 1 272 ? 114.383 29.114  10.529  1.00 58.89  ? 7067 ASP A C     1 
ATOM   2368 O  O     . ASP A 1 272 ? 113.360 29.702  10.940  1.00 55.12  ? 7067 ASP A O     1 
ATOM   2369 C  CB    . ASP A 1 272 ? 116.417 29.641  11.931  1.00 64.57  ? 7067 ASP A CB    1 
ATOM   2370 C  CG    . ASP A 1 272 ? 117.277 29.286  13.134  1.00 67.03  ? 7067 ASP A CG    1 
ATOM   2371 O  OD1   . ASP A 1 272 ? 116.875 28.383  13.900  1.00 66.56  ? 7067 ASP A OD1   1 
ATOM   2372 O  OD2   . ASP A 1 272 ? 118.347 29.911  13.290  1.00 70.02  ? 7067 ASP A OD2   1 
ATOM   2373 N  N     . MET A 1 273 ? 114.679 28.923  9.239   1.00 57.88  ? 7068 MET A N     1 
ATOM   2374 C  CA    . MET A 1 273 ? 113.777 29.405  8.157   1.00 56.97  ? 7068 MET A CA    1 
ATOM   2375 C  C     . MET A 1 273 ? 112.460 28.616  8.218   1.00 52.60  ? 7068 MET A C     1 
ATOM   2376 O  O     . MET A 1 273 ? 111.389 29.236  8.058   1.00 49.90  ? 7068 MET A O     1 
ATOM   2377 C  CB    . MET A 1 273 ? 114.445 29.244  6.786   1.00 62.22  ? 7068 MET A CB    1 
ATOM   2378 C  CG    . MET A 1 273 ? 113.639 29.803  5.625   1.00 64.17  ? 7068 MET A CG    1 
ATOM   2379 S  SD    . MET A 1 273 ? 112.328 28.698  5.046   1.00 69.46  ? 7068 MET A SD    1 
ATOM   2380 C  CE    . MET A 1 273 ? 113.294 27.340  4.385   1.00 70.76  ? 7068 MET A CE    1 
ATOM   2381 N  N     . ILE A 1 274 ? 112.542 27.305  8.465   1.00 50.37  ? 7069 ILE A N     1 
ATOM   2382 C  CA    . ILE A 1 274 ? 111.325 26.442  8.568   1.00 47.96  ? 7069 ILE A CA    1 
ATOM   2383 C  C     . ILE A 1 274 ? 110.544 26.851  9.824   1.00 45.02  ? 7069 ILE A C     1 
ATOM   2384 O  O     . ILE A 1 274 ? 109.308 26.978  9.731   1.00 41.07  ? 7069 ILE A O     1 
ATOM   2385 C  CB    . ILE A 1 274 ? 111.698 24.944  8.578   1.00 49.02  ? 7069 ILE A CB    1 
ATOM   2386 C  CG1   . ILE A 1 274 ? 112.335 24.495  7.258   1.00 51.61  ? 7069 ILE A CG1   1 
ATOM   2387 C  CG2   . ILE A 1 274 ? 110.490 24.088  8.922   1.00 47.14  ? 7069 ILE A CG2   1 
ATOM   2388 C  CD1   . ILE A 1 274 ? 111.435 24.635  6.049   1.00 51.40  ? 7069 ILE A CD1   1 
ATOM   2389 N  N     . LEU A 1 275 ? 111.246 27.059  10.945  1.00 45.03  ? 7070 LEU A N     1 
ATOM   2390 C  CA    . LEU A 1 275 ? 110.589 27.464  12.218  1.00 43.71  ? 7070 LEU A CA    1 
ATOM   2391 C  C     . LEU A 1 275 ? 109.848 28.791  12.020  1.00 41.33  ? 7070 LEU A C     1 
ATOM   2392 O  O     . LEU A 1 275 ? 108.784 28.973  12.636  1.00 39.05  ? 7070 LEU A O     1 
ATOM   2393 C  CB    . LEU A 1 275 ? 111.644 27.564  13.325  1.00 46.38  ? 7070 LEU A CB    1 
ATOM   2394 C  CG    . LEU A 1 275 ? 112.210 26.230  13.809  1.00 48.20  ? 7070 LEU A CG    1 
ATOM   2395 C  CD1   . LEU A 1 275 ? 113.403 26.445  14.727  1.00 51.11  ? 7070 LEU A CD1   1 
ATOM   2396 C  CD2   . LEU A 1 275 ? 111.138 25.407  14.510  1.00 47.02  ? 7070 LEU A CD2   1 
ATOM   2397 N  N     A SER A 1 276 ? 110.399 29.675  11.181  0.60 41.82  ? 7071 SER A N     1 
ATOM   2398 N  N     B SER A 1 276 ? 110.393 29.678  11.180  0.40 41.59  ? 7071 SER A N     1 
ATOM   2399 C  CA    A SER A 1 276 ? 109.770 30.991  10.888  0.60 41.13  ? 7071 SER A CA    1 
ATOM   2400 C  CA    B SER A 1 276 ? 109.758 30.994  10.903  0.40 40.66  ? 7071 SER A CA    1 
ATOM   2401 C  C     A SER A 1 276 ? 108.450 30.773  10.138  0.60 39.03  ? 7071 SER A C     1 
ATOM   2402 C  C     B SER A 1 276 ? 108.450 30.787  10.127  0.40 38.79  ? 7071 SER A C     1 
ATOM   2403 O  O     A SER A 1 276 ? 107.447 31.423  10.498  0.60 38.29  ? 7071 SER A O     1 
ATOM   2404 O  O     B SER A 1 276 ? 107.455 31.462  10.458  0.40 38.01  ? 7071 SER A O     1 
ATOM   2405 C  CB    A SER A 1 276 ? 110.706 31.878  10.106  0.60 43.22  ? 7071 SER A CB    1 
ATOM   2406 C  CB    B SER A 1 276 ? 110.705 31.908  10.168  0.40 42.34  ? 7071 SER A CB    1 
ATOM   2407 O  OG    A SER A 1 276 ? 110.103 33.133  9.827   0.60 43.11  ? 7071 SER A OG    1 
ATOM   2408 O  OG    B SER A 1 276 ? 111.854 32.182  10.958  0.40 43.65  ? 7071 SER A OG    1 
ATOM   2409 N  N     . LEU A 1 277 ? 108.457 29.886  9.138   1.00 38.45  ? 7072 LEU A N     1 
ATOM   2410 C  CA    . LEU A 1 277 ? 107.234 29.588  8.342   1.00 37.04  ? 7072 LEU A CA    1 
ATOM   2411 C  C     . LEU A 1 277 ? 106.180 28.953  9.259   1.00 34.45  ? 7072 LEU A C     1 
ATOM   2412 O  O     . LEU A 1 277 ? 105.002 29.333  9.152   1.00 33.79  ? 7072 LEU A O     1 
ATOM   2413 C  CB    . LEU A 1 277 ? 107.581 28.648  7.183   1.00 38.27  ? 7072 LEU A CB    1 
ATOM   2414 C  CG    . LEU A 1 277 ? 108.388 29.267  6.042   1.00 41.30  ? 7072 LEU A CG    1 
ATOM   2415 C  CD1   . LEU A 1 277 ? 108.795 28.203  5.034   1.00 42.99  ? 7072 LEU A CD1   1 
ATOM   2416 C  CD2   . LEU A 1 277 ? 107.600 30.377  5.360   1.00 41.49  ? 7072 LEU A CD2   1 
ATOM   2417 N  N     . LEU A 1 278 ? 106.599 28.025  10.122  1.00 34.05  ? 7073 LEU A N     1 
ATOM   2418 C  CA    . LEU A 1 278 ? 105.687 27.339  11.079  1.00 33.31  ? 7073 LEU A CA    1 
ATOM   2419 C  C     . LEU A 1 278 ? 105.055 28.383  12.007  1.00 33.42  ? 7073 LEU A C     1 
ATOM   2420 O  O     . LEU A 1 278 ? 103.834 28.304  12.242  1.00 32.40  ? 7073 LEU A O     1 
ATOM   2421 C  CB    . LEU A 1 278 ? 106.476 26.315  11.901  1.00 34.01  ? 7073 LEU A CB    1 
ATOM   2422 C  CG    . LEU A 1 278 ? 106.994 25.092  11.147  1.00 34.82  ? 7073 LEU A CG    1 
ATOM   2423 C  CD1   . LEU A 1 278 ? 107.897 24.257  12.042  1.00 35.88  ? 7073 LEU A CD1   1 
ATOM   2424 C  CD2   . LEU A 1 278 ? 105.845 24.250  10.613  1.00 33.94  ? 7073 LEU A CD2   1 
ATOM   2425 N  N     . SER A 1 279 ? 105.871 29.328  12.484  1.00 34.27  ? 7074 SER A N     1 
ATOM   2426 C  CA    . SER A 1 279 ? 105.442 30.374  13.451  1.00 35.69  ? 7074 SER A CA    1 
ATOM   2427 C  C     . SER A 1 279 ? 104.446 31.355  12.825  1.00 36.24  ? 7074 SER A C     1 
ATOM   2428 O  O     . SER A 1 279 ? 103.765 32.055  13.599  1.00 35.86  ? 7074 SER A O     1 
ATOM   2429 C  CB    . SER A 1 279 ? 106.642 31.106  13.994  1.00 37.27  ? 7074 SER A CB    1 
ATOM   2430 O  OG    . SER A 1 279 ? 107.485 30.219  14.711  1.00 38.20  ? 7074 SER A OG    1 
ATOM   2431 N  N     . LYS A 1 280 ? 104.372 31.408  11.491  1.00 37.46  ? 7075 LYS A N     1 
ATOM   2432 C  CA    . LYS A 1 280 ? 103.469 32.361  10.785  1.00 38.89  ? 7075 LYS A CA    1 
ATOM   2433 C  C     . LYS A 1 280 ? 102.228 31.636  10.253  1.00 36.07  ? 7075 LYS A C     1 
ATOM   2434 O  O     . LYS A 1 280 ? 101.413 32.296  9.584   1.00 36.23  ? 7075 LYS A O     1 
ATOM   2435 C  CB    . LYS A 1 280 ? 104.216 33.050  9.636   1.00 42.83  ? 7075 LYS A CB    1 
ATOM   2436 C  CG    . LYS A 1 280 ? 105.305 34.026  10.058  1.00 46.73  ? 7075 LYS A CG    1 
ATOM   2437 C  CD    . LYS A 1 280 ? 106.066 34.617  8.885   1.00 50.11  ? 7075 LYS A CD    1 
ATOM   2438 C  CE    . LYS A 1 280 ? 107.014 35.727  9.285   1.00 54.35  ? 7075 LYS A CE    1 
ATOM   2439 N  NZ    . LYS A 1 280 ? 108.044 35.264  10.246  1.00 57.18  ? 7075 LYS A NZ    1 
ATOM   2440 N  N     . GLY A 1 281 ? 102.076 30.344  10.560  1.00 34.01  ? 7076 GLY A N     1 
ATOM   2441 C  CA    . GLY A 1 281 ? 100.925 29.565  10.062  1.00 33.63  ? 7076 GLY A CA    1 
ATOM   2442 C  C     . GLY A 1 281 ? 101.000 29.332  8.558   1.00 34.00  ? 7076 GLY A C     1 
ATOM   2443 O  O     . GLY A 1 281 ? 99.938  29.130  7.930   1.00 34.52  ? 7076 GLY A O     1 
ATOM   2444 N  N     A ARG A 1 282 ? 102.216 29.343  8.000   0.50 33.97  ? 7077 ARG A N     1 
ATOM   2445 N  N     B ARG A 1 282 ? 102.215 29.344  7.996   0.50 34.40  ? 7077 ARG A N     1 
ATOM   2446 C  CA    A ARG A 1 282 ? 102.432 29.164  6.537   0.50 35.07  ? 7077 ARG A CA    1 
ATOM   2447 C  CA    B ARG A 1 282 ? 102.417 29.159  6.531   0.50 35.76  ? 7077 ARG A CA    1 
ATOM   2448 C  C     A ARG A 1 282 ? 102.953 27.754  6.215   0.50 34.88  ? 7077 ARG A C     1 
ATOM   2449 C  C     B ARG A 1 282 ? 102.949 27.753  6.214   0.50 35.26  ? 7077 ARG A C     1 
ATOM   2450 O  O     A ARG A 1 282 ? 103.268 27.514  5.031   0.50 35.03  ? 7077 ARG A O     1 
ATOM   2451 O  O     B ARG A 1 282 ? 103.269 27.513  5.031   0.50 35.38  ? 7077 ARG A O     1 
ATOM   2452 C  CB    A ARG A 1 282 ? 103.418 30.224  6.037   0.50 36.76  ? 7077 ARG A CB    1 
ATOM   2453 C  CB    B ARG A 1 282 ? 103.380 30.229  6.006   0.50 38.02  ? 7077 ARG A CB    1 
ATOM   2454 C  CG    A ARG A 1 282 ? 102.906 31.652  6.159   0.50 37.43  ? 7077 ARG A CG    1 
ATOM   2455 C  CG    B ARG A 1 282 ? 102.873 31.652  6.190   0.50 39.21  ? 7077 ARG A CG    1 
ATOM   2456 C  CD    A ARG A 1 282 ? 103.965 32.678  5.804   0.50 39.42  ? 7077 ARG A CD    1 
ATOM   2457 C  CD    B ARG A 1 282 ? 103.875 32.709  5.763   0.50 41.83  ? 7077 ARG A CD    1 
ATOM   2458 N  NE    A ARG A 1 282 ? 104.520 32.469  4.476   0.50 41.39  ? 7077 ARG A NE    1 
ATOM   2459 N  NE    B ARG A 1 282 ? 103.387 34.052  6.048   0.50 43.11  ? 7077 ARG A NE    1 
ATOM   2460 C  CZ    A ARG A 1 282 ? 105.502 33.192  3.949   0.50 42.66  ? 7077 ARG A CZ    1 
ATOM   2461 C  CZ    B ARG A 1 282 ? 104.099 35.163  5.897   0.50 44.82  ? 7077 ARG A CZ    1 
ATOM   2462 N  NH1   A ARG A 1 282 ? 106.044 34.179  4.641   0.50 43.19  ? 7077 ARG A NH1   1 
ATOM   2463 N  NH1   B ARG A 1 282 ? 105.347 35.098  5.467   0.50 46.60  ? 7077 ARG A NH1   1 
ATOM   2464 N  NH2   A ARG A 1 282 ? 105.942 32.923  2.735   0.50 43.94  ? 7077 ARG A NH2   1 
ATOM   2465 N  NH2   B ARG A 1 282 ? 103.565 36.335  6.189   0.50 45.00  ? 7077 ARG A NH2   1 
ATOM   2466 N  N     . LEU A 1 283 ? 103.022 26.852  7.202   1.00 34.03  ? 7078 LEU A N     1 
ATOM   2467 C  CA    . LEU A 1 283 ? 103.553 25.487  6.930   1.00 34.19  ? 7078 LEU A CA    1 
ATOM   2468 C  C     . LEU A 1 283 ? 103.059 24.456  7.952   1.00 32.58  ? 7078 LEU A C     1 
ATOM   2469 O  O     . LEU A 1 283 ? 102.939 24.784  9.145   1.00 30.45  ? 7078 LEU A O     1 
ATOM   2470 C  CB    . LEU A 1 283 ? 105.084 25.559  6.947   1.00 35.93  ? 7078 LEU A CB    1 
ATOM   2471 C  CG    . LEU A 1 283 ? 105.820 24.258  6.623   1.00 37.29  ? 7078 LEU A CG    1 
ATOM   2472 C  CD1   . LEU A 1 283 ? 105.508 23.793  5.210   1.00 38.83  ? 7078 LEU A CD1   1 
ATOM   2473 C  CD2   . LEU A 1 283 ? 107.321 24.427  6.802   1.00 38.62  ? 7078 LEU A CD2   1 
ATOM   2474 N  N     . ILE A 1 284 ? 102.795 23.247  7.454   1.00 32.53  ? 7079 ILE A N     1 
ATOM   2475 C  CA    . ILE A 1 284 ? 102.414 22.051  8.257   1.00 31.36  ? 7079 ILE A CA    1 
ATOM   2476 C  C     . ILE A 1 284 ? 103.444 20.963  7.931   1.00 32.61  ? 7079 ILE A C     1 
ATOM   2477 O  O     . ILE A 1 284 ? 103.698 20.734  6.725   1.00 32.67  ? 7079 ILE A O     1 
ATOM   2478 C  CB    . ILE A 1 284 ? 100.969 21.595  7.956   1.00 31.25  ? 7079 ILE A CB    1 
ATOM   2479 C  CG1   . ILE A 1 284 ? 99.925  22.489  8.628   1.00 30.56  ? 7079 ILE A CG1   1 
ATOM   2480 C  CG2   . ILE A 1 284 ? 100.772 20.140  8.356   1.00 31.23  ? 7079 ILE A CG2   1 
ATOM   2481 C  CD1   . ILE A 1 284 ? 99.835  22.315  10.131  1.00 30.53  ? 7079 ILE A CD1   1 
ATOM   2482 N  N     . ILE A 1 285 ? 104.045 20.358  8.957   1.00 32.40  ? 7080 ILE A N     1 
ATOM   2483 C  CA    . ILE A 1 285 ? 105.043 19.273  8.736   1.00 34.29  ? 7080 ILE A CA    1 
ATOM   2484 C  C     . ILE A 1 285 ? 104.477 17.970  9.299   1.00 33.54  ? 7080 ILE A C     1 
ATOM   2485 O  O     . ILE A 1 285 ? 104.311 17.864  10.534  1.00 31.48  ? 7080 ILE A O     1 
ATOM   2486 C  CB    . ILE A 1 285 ? 106.417 19.618  9.336   1.00 36.28  ? 7080 ILE A CB    1 
ATOM   2487 C  CG1   . ILE A 1 285 ? 106.998 20.872  8.678   1.00 37.78  ? 7080 ILE A CG1   1 
ATOM   2488 C  CG2   . ILE A 1 285 ? 107.363 18.428  9.226   1.00 37.84  ? 7080 ILE A CG2   1 
ATOM   2489 C  CD1   . ILE A 1 285 ? 108.312 21.324  9.261   1.00 40.42  ? 7080 ILE A CD1   1 
ATOM   2490 N  N     . ARG A 1 286 ? 104.191 17.032  8.396   1.00 33.68  ? 7081 ARG A N     1 
ATOM   2491 C  CA    . ARG A 1 286 ? 103.669 15.689  8.743   1.00 33.59  ? 7081 ARG A CA    1 
ATOM   2492 C  C     . ARG A 1 286 ? 103.528 14.872  7.458   1.00 36.03  ? 7081 ARG A C     1 
ATOM   2493 O  O     . ARG A 1 286 ? 103.559 15.476  6.360   1.00 34.98  ? 7081 ARG A O     1 
ATOM   2494 C  CB    . ARG A 1 286 ? 102.296 15.761  9.423   1.00 30.67  ? 7081 ARG A CB    1 
ATOM   2495 C  CG    . ARG A 1 286 ? 101.225 16.494  8.624   1.00 29.38  ? 7081 ARG A CG    1 
ATOM   2496 C  CD    . ARG A 1 286 ? 99.825  16.104  9.061   1.00 28.24  ? 7081 ARG A CD    1 
ATOM   2497 N  NE    . ARG A 1 286 ? 98.766  16.920  8.475   1.00 27.83  ? 7081 ARG A NE    1 
ATOM   2498 C  CZ    . ARG A 1 286 ? 98.224  16.742  7.271   1.00 29.38  ? 7081 ARG A CZ    1 
ATOM   2499 N  NH1   . ARG A 1 286 ? 97.258  17.547  6.860   1.00 28.64  ? 7081 ARG A NH1   1 
ATOM   2500 N  NH2   . ARG A 1 286 ? 98.647  15.770  6.477   1.00 31.15  ? 7081 ARG A NH2   1 
ATOM   2501 N  N     . GLU A 1 287 ? 103.406 13.552  7.598   1.00 39.07  ? 7082 GLU A N     1 
ATOM   2502 C  CA    . GLU A 1 287 ? 103.110 12.699  6.424   1.00 43.34  ? 7082 GLU A CA    1 
ATOM   2503 C  C     . GLU A 1 287 ? 101.696 13.065  5.968   1.00 41.42  ? 7082 GLU A C     1 
ATOM   2504 O  O     . GLU A 1 287 ? 100.929 13.591  6.803   1.00 37.25  ? 7082 GLU A O     1 
ATOM   2505 C  CB    . GLU A 1 287 ? 103.239 11.217  6.781   1.00 48.18  ? 7082 GLU A CB    1 
ATOM   2506 C  CG    . GLU A 1 287 ? 104.673 10.773  7.024   1.00 53.71  ? 7082 GLU A CG    1 
ATOM   2507 C  CD    . GLU A 1 287 ? 105.571 10.771  5.796   1.00 60.92  ? 7082 GLU A CD    1 
ATOM   2508 O  OE1   . GLU A 1 287 ? 106.805 10.687  5.969   1.00 65.93  ? 7082 GLU A OE1   1 
ATOM   2509 O  OE2   . GLU A 1 287 ? 105.038 10.836  4.664   1.00 65.84  ? 7082 GLU A OE2   1 
ATOM   2510 N  N     . ASN A 1 288 ? 101.380 12.836  4.695   1.00 42.79  ? 7083 ASN A N     1 
ATOM   2511 C  CA    . ASN A 1 288 ? 100.029 13.160  4.168   1.00 44.69  ? 7083 ASN A CA    1 
ATOM   2512 C  C     . ASN A 1 288 ? 99.385  11.842  3.719   1.00 46.22  ? 7083 ASN A C     1 
ATOM   2513 O  O     . ASN A 1 288 ? 98.655  11.838  2.711   1.00 48.03  ? 7083 ASN A O     1 
ATOM   2514 C  CB    . ASN A 1 288 ? 100.103 14.224  3.069   1.00 47.93  ? 7083 ASN A CB    1 
ATOM   2515 C  CG    . ASN A 1 288 ? 98.783  14.926  2.826   1.00 49.60  ? 7083 ASN A CG    1 
ATOM   2516 O  OD1   . ASN A 1 288 ? 97.953  15.037  3.728   1.00 46.78  ? 7083 ASN A OD1   1 
ATOM   2517 N  ND2   . ASN A 1 288 ? 98.595  15.432  1.617   1.00 52.58  ? 7083 ASN A ND2   1 
ATOM   2518 N  N     . ASN A 1 289 ? 99.667  10.770  4.464   1.00 45.95  ? 7084 ASN A N     1 
ATOM   2519 C  CA    . ASN A 1 289 ? 99.126  9.414   4.190   1.00 48.92  ? 7084 ASN A CA    1 
ATOM   2520 C  C     . ASN A 1 289 ? 97.663  9.334   4.651   1.00 46.43  ? 7084 ASN A C     1 
ATOM   2521 O  O     . ASN A 1 289 ? 97.125  10.342  5.155   1.00 45.03  ? 7084 ASN A O     1 
ATOM   2522 C  CB    . ASN A 1 289 ? 99.969  8.334   4.878   1.00 50.77  ? 7084 ASN A CB    1 
ATOM   2523 C  CG    . ASN A 1 289 ? 101.403 8.293   4.390   1.00 54.15  ? 7084 ASN A CG    1 
ATOM   2524 O  OD1   . ASN A 1 289 ? 101.694 8.673   3.257   1.00 55.11  ? 7084 ASN A OD1   1 
ATOM   2525 N  ND2   . ASN A 1 289 ? 102.304 7.815   5.234   1.00 55.94  ? 7084 ASN A ND2   1 
ATOM   2526 N  N     . ARG A 1 290 ? 97.059  8.162   4.470   1.00 44.80  ? 7085 ARG A N     1 
ATOM   2527 C  CA    . ARG A 1 290 ? 95.651  7.888   4.864   1.00 44.42  ? 7085 ARG A CA    1 
ATOM   2528 C  C     . ARG A 1 290 ? 95.477  8.082   6.377   1.00 39.56  ? 7085 ARG A C     1 
ATOM   2529 O  O     . ARG A 1 290 ? 96.411  7.761   7.140   1.00 39.58  ? 7085 ARG A O     1 
ATOM   2530 C  CB    . ARG A 1 290 ? 95.283  6.471   4.405   1.00 49.85  ? 7085 ARG A CB    1 
ATOM   2531 C  CG    . ARG A 1 290 ? 96.356  5.434   4.714   1.00 54.81  ? 7085 ARG A CG    1 
ATOM   2532 C  CD    . ARG A 1 290 ? 96.294  4.191   3.844   1.00 59.70  ? 7085 ARG A CD    1 
ATOM   2533 N  NE    . ARG A 1 290 ? 95.359  3.171   4.296   1.00 63.42  ? 7085 ARG A NE    1 
ATOM   2534 C  CZ    . ARG A 1 290 ? 95.630  2.256   5.227   1.00 65.90  ? 7085 ARG A CZ    1 
ATOM   2535 N  NH1   . ARG A 1 290 ? 94.717  1.357   5.557   1.00 67.19  ? 7085 ARG A NH1   1 
ATOM   2536 N  NH2   . ARG A 1 290 ? 96.806  2.246   5.836   1.00 66.17  ? 7085 ARG A NH2   1 
ATOM   2537 N  N     . VAL A 1 291 ? 94.320  8.610   6.779   1.00 34.52  ? 7086 VAL A N     1 
ATOM   2538 C  CA    . VAL A 1 291 ? 94.004  8.817   8.222   1.00 31.87  ? 7086 VAL A CA    1 
ATOM   2539 C  C     . VAL A 1 291 ? 93.388  7.523   8.764   1.00 29.84  ? 7086 VAL A C     1 
ATOM   2540 O  O     . VAL A 1 291 ? 92.331  7.104   8.253   1.00 29.48  ? 7086 VAL A O     1 
ATOM   2541 C  CB    . VAL A 1 291 ? 93.087  10.036  8.413   1.00 31.55  ? 7086 VAL A CB    1 
ATOM   2542 C  CG1   . VAL A 1 291 ? 92.559  10.142  9.839   1.00 31.17  ? 7086 VAL A CG1   1 
ATOM   2543 C  CG2   . VAL A 1 291 ? 93.806  11.310  7.995   1.00 31.70  ? 7086 VAL A CG2   1 
ATOM   2544 N  N     . VAL A 1 292 ? 94.062  6.916   9.741   1.00 28.39  ? 7087 VAL A N     1 
ATOM   2545 C  CA    . VAL A 1 292 ? 93.626  5.631   10.357  1.00 28.19  ? 7087 VAL A CA    1 
ATOM   2546 C  C     . VAL A 1 292 ? 93.560  5.835   11.868  1.00 26.53  ? 7087 VAL A C     1 
ATOM   2547 O  O     . VAL A 1 292 ? 94.561  6.310   12.456  1.00 25.88  ? 7087 VAL A O     1 
ATOM   2548 C  CB    . VAL A 1 292 ? 94.577  4.479   9.983   1.00 29.51  ? 7087 VAL A CB    1 
ATOM   2549 C  CG1   . VAL A 1 292 ? 94.141  3.166   10.617  1.00 29.95  ? 7087 VAL A CG1   1 
ATOM   2550 C  CG2   . VAL A 1 292 ? 94.704  4.334   8.476   1.00 31.30  ? 7087 VAL A CG2   1 
ATOM   2551 N  N     . ILE A 1 293 ? 92.422  5.480   12.458  1.00 25.03  ? 7088 ILE A N     1 
ATOM   2552 C  CA    . ILE A 1 293 ? 92.201  5.670   13.918  1.00 23.89  ? 7088 ILE A CA    1 
ATOM   2553 C  C     . ILE A 1 293 ? 91.689  4.362   14.510  1.00 23.25  ? 7088 ILE A C     1 
ATOM   2554 O  O     . ILE A 1 293 ? 91.160  3.523   13.759  1.00 23.08  ? 7088 ILE A O     1 
ATOM   2555 C  CB    . ILE A 1 293 ? 91.200  6.817   14.174  1.00 24.09  ? 7088 ILE A CB    1 
ATOM   2556 C  CG1   . ILE A 1 293 ? 89.775  6.438   13.756  1.00 25.10  ? 7088 ILE A CG1   1 
ATOM   2557 C  CG2   . ILE A 1 293 ? 91.671  8.092   13.499  1.00 24.81  ? 7088 ILE A CG2   1 
ATOM   2558 C  CD1   . ILE A 1 293 ? 88.733  7.508   14.018  1.00 26.02  ? 7088 ILE A CD1   1 
ATOM   2559 N  N     . SER A 1 294 ? 91.830  4.216   15.820  1.00 22.82  ? 7089 SER A N     1 
ATOM   2560 C  CA    . SER A 1 294 ? 91.279  3.011   16.476  1.00 23.53  ? 7089 SER A CA    1 
ATOM   2561 C  C     . SER A 1 294 ? 91.114  3.268   17.968  1.00 23.54  ? 7089 SER A C     1 
ATOM   2562 O  O     . SER A 1 294 ? 91.770  4.177   18.510  1.00 23.30  ? 7089 SER A O     1 
ATOM   2563 C  CB    . SER A 1 294 ? 92.159  1.809   16.246  1.00 23.87  ? 7089 SER A CB    1 
ATOM   2564 O  OG    . SER A 1 294 ? 93.428  2.006   16.844  1.00 24.61  ? 7089 SER A OG    1 
ATOM   2565 N  N     A SER A 1 295 ? 90.239  2.480   18.586  0.60 24.29  ? 7090 SER A N     1 
ATOM   2566 N  N     B SER A 1 295 ? 90.254  2.478   18.608  0.40 24.84  ? 7090 SER A N     1 
ATOM   2567 C  CA    A SER A 1 295 ? 90.032  2.517   20.053  0.60 25.18  ? 7090 SER A CA    1 
ATOM   2568 C  CA    B SER A 1 295 ? 90.032  2.569   20.073  0.40 25.99  ? 7090 SER A CA    1 
ATOM   2569 C  C     A SER A 1 295 ? 90.349  1.125   20.597  0.60 25.61  ? 7090 SER A C     1 
ATOM   2570 C  C     B SER A 1 295 ? 90.270  1.183   20.679  0.40 26.24  ? 7090 SER A C     1 
ATOM   2571 O  O     A SER A 1 295 ? 89.778  0.136   20.086  0.60 26.16  ? 7090 SER A O     1 
ATOM   2572 O  O     B SER A 1 295 ? 89.528  0.248   20.320  0.40 27.32  ? 7090 SER A O     1 
ATOM   2573 C  CB    A SER A 1 295 ? 88.644  2.964   20.428  0.60 26.05  ? 7090 SER A CB    1 
ATOM   2574 C  CB    B SER A 1 295 ? 88.661  3.117   20.388  0.40 27.19  ? 7090 SER A CB    1 
ATOM   2575 O  OG    A SER A 1 295 ? 88.487  2.957   21.843  0.60 26.41  ? 7090 SER A OG    1 
ATOM   2576 O  OG    B SER A 1 295 ? 87.645  2.344   19.768  0.40 28.93  ? 7090 SER A OG    1 
ATOM   2577 N  N     . ASP A 1 296 ? 91.298  1.059   21.527  1.00 26.08  ? 7091 ASP A N     1 
ATOM   2578 C  CA    . ASP A 1 296 ? 91.668  -0.221  22.175  1.00 26.76  ? 7091 ASP A CA    1 
ATOM   2579 C  C     . ASP A 1 296 ? 90.492  -0.725  23.004  1.00 27.66  ? 7091 ASP A C     1 
ATOM   2580 O  O     . ASP A 1 296 ? 89.893  0.081   23.751  1.00 27.86  ? 7091 ASP A O     1 
ATOM   2581 C  CB    . ASP A 1 296 ? 92.899  -0.067  23.065  1.00 27.96  ? 7091 ASP A CB    1 
ATOM   2582 C  CG    . ASP A 1 296 ? 94.208  -0.041  22.304  1.00 29.40  ? 7091 ASP A CG    1 
ATOM   2583 O  OD1   . ASP A 1 296 ? 94.200  -0.374  21.105  1.00 29.65  ? 7091 ASP A OD1   1 
ATOM   2584 O  OD2   . ASP A 1 296 ? 95.227  0.290   22.929  1.00 33.39  ? 7091 ASP A OD2   1 
ATOM   2585 N  N     . VAL A 1 297 ? 90.187  -2.012  22.868  1.00 27.08  ? 7092 VAL A N     1 
ATOM   2586 C  CA    . VAL A 1 297 ? 89.087  -2.645  23.644  1.00 28.56  ? 7092 VAL A CA    1 
ATOM   2587 C  C     . VAL A 1 297 ? 89.700  -3.646  24.622  1.00 29.89  ? 7092 VAL A C     1 
ATOM   2588 O  O     . VAL A 1 297 ? 90.425  -4.565  24.170  1.00 27.85  ? 7092 VAL A O     1 
ATOM   2589 C  CB    . VAL A 1 297 ? 88.068  -3.333  22.719  1.00 29.38  ? 7092 VAL A CB    1 
ATOM   2590 C  CG1   . VAL A 1 297 ? 87.035  -4.128  23.508  1.00 30.99  ? 7092 VAL A CG1   1 
ATOM   2591 C  CG2   . VAL A 1 297 ? 87.393  -2.338  21.793  1.00 29.56  ? 7092 VAL A CG2   1 
ATOM   2592 N  N     A LEU A 1 298 ? 89.452  -3.448  25.919  0.70 30.82  ? 7093 LEU A N     1 
ATOM   2593 N  N     B LEU A 1 298 ? 89.413  -3.466  25.916  0.30 31.18  ? 7093 LEU A N     1 
ATOM   2594 C  CA    A LEU A 1 298 ? 89.940  -4.407  26.942  0.70 33.03  ? 7093 LEU A CA    1 
ATOM   2595 C  CA    B LEU A 1 298 ? 89.892  -4.398  26.971  0.30 33.20  ? 7093 LEU A CA    1 
ATOM   2596 C  C     A LEU A 1 298 ? 88.968  -5.587  26.970  0.70 34.46  ? 7093 LEU A C     1 
ATOM   2597 C  C     B LEU A 1 298 ? 88.950  -5.601  27.011  0.30 34.50  ? 7093 LEU A C     1 
ATOM   2598 O  O     A LEU A 1 298 ? 87.757  -5.344  27.116  0.70 35.56  ? 7093 LEU A O     1 
ATOM   2599 O  O     B LEU A 1 298 ? 87.742  -5.390  27.237  0.30 35.31  ? 7093 LEU A O     1 
ATOM   2600 C  CB    A LEU A 1 298 ? 90.014  -3.714  28.307  0.70 34.59  ? 7093 LEU A CB    1 
ATOM   2601 C  CB    B LEU A 1 298 ? 89.910  -3.680  28.324  0.30 34.61  ? 7093 LEU A CB    1 
ATOM   2602 C  CG    A LEU A 1 298 ? 90.392  -4.611  29.486  0.70 36.38  ? 7093 LEU A CG    1 
ATOM   2603 C  CG    B LEU A 1 298 ? 90.829  -2.466  28.406  0.30 34.58  ? 7093 LEU A CG    1 
ATOM   2604 C  CD1   A LEU A 1 298 ? 91.766  -5.234  29.284  0.70 36.34  ? 7093 LEU A CD1   1 
ATOM   2605 C  CD1   B LEU A 1 298 ? 90.885  -1.923  29.826  0.30 36.32  ? 7093 LEU A CD1   1 
ATOM   2606 C  CD2   A LEU A 1 298 ? 90.350  -3.828  30.792  0.70 37.95  ? 7093 LEU A CD2   1 
ATOM   2607 C  CD2   B LEU A 1 298 ? 92.219  -2.823  27.917  0.30 34.39  ? 7093 LEU A CD2   1 
ATOM   2608 N  N     . VAL A 1 299 ? 89.480  -6.805  26.789  1.00 34.94  ? 7094 VAL A N     1 
ATOM   2609 C  CA    . VAL A 1 299 ? 88.627  -8.027  26.809  1.00 37.84  ? 7094 VAL A CA    1 
ATOM   2610 C  C     . VAL A 1 299 ? 88.795  -8.695  28.176  1.00 42.15  ? 7094 VAL A C     1 
ATOM   2611 O  O     . VAL A 1 299 ? 89.944  -9.004  28.539  1.00 41.43  ? 7094 VAL A O     1 
ATOM   2612 C  CB    . VAL A 1 299 ? 88.990  -8.981  25.660  1.00 36.86  ? 7094 VAL A CB    1 
ATOM   2613 C  CG1   . VAL A 1 299 ? 88.026  -10.154 25.591  1.00 37.91  ? 7094 VAL A CG1   1 
ATOM   2614 C  CG2   . VAL A 1 299 ? 89.040  -8.253  24.326  1.00 35.66  ? 7094 VAL A CG2   1 
ATOM   2615 N  N     . ASN A 1 300 ? 87.687  -8.895  28.893  1.00 49.53  ? 7095 ASN A N     1 
ATOM   2616 C  CA    . ASN A 1 300 ? 87.724  -9.538  30.235  1.00 57.95  ? 7095 ASN A CA    1 
ATOM   2617 C  C     . ASN A 1 300 ? 86.416  -10.307 30.466  1.00 63.02  ? 7095 ASN A C     1 
ATOM   2618 O  O     . ASN A 1 300 ? 85.580  -10.352 29.536  1.00 63.52  ? 7095 ASN A O     1 
ATOM   2619 C  CB    . ASN A 1 300 ? 88.023  -8.505  31.328  1.00 61.81  ? 7095 ASN A CB    1 
ATOM   2620 C  CG    . ASN A 1 300 ? 87.134  -7.281  31.255  1.00 64.87  ? 7095 ASN A CG    1 
ATOM   2621 O  OD1   . ASN A 1 300 ? 86.044  -7.327  30.687  1.00 70.38  ? 7095 ASN A OD1   1 
ATOM   2622 N  ND2   . ASN A 1 300 ? 87.589  -6.178  31.828  1.00 67.11  ? 7095 ASN A ND2   1 
ATOM   2623 N  N     . ASN A 1 301 ? 86.265  -10.906 31.651  1.00 70.77  ? 7096 ASN A N     1 
ATOM   2624 C  CA    . ASN A 1 301 ? 85.045  -11.685 32.003  1.00 75.79  ? 7096 ASN A CA    1 
ATOM   2625 C  C     . ASN A 1 301 ? 84.925  -11.760 33.531  1.00 80.56  ? 7096 ASN A C     1 
ATOM   2626 O  O     . ASN A 1 301 ? 85.521  -10.956 34.251  1.00 83.29  ? 7096 ASN A O     1 
ATOM   2627 C  CB    . ASN A 1 301 ? 85.054  -13.073 31.354  1.00 76.50  ? 7096 ASN A CB    1 
ATOM   2628 C  CG    . ASN A 1 301 ? 86.235  -13.930 31.766  1.00 77.55  ? 7096 ASN A CG    1 
ATOM   2629 O  OD1   . ASN A 1 301 ? 87.084  -13.503 32.546  1.00 79.22  ? 7096 ASN A OD1   1 
ATOM   2630 N  ND2   . ASN A 1 301 ? 86.299  -15.142 31.242  1.00 77.31  ? 7096 ASN A ND2   1 
ATOM   2631 O  OXT   . ASN A 1 301 ? 84.233  -12.620 34.082  1.00 84.77  ? 7096 ASN A OXT   1 
ATOM   2632 N  N     . ALA B 2 21  ? 60.598  -11.480 8.293   1.00 62.99  ? 4271 ALA B N     1 
ATOM   2633 C  CA    . ALA B 2 21  ? 59.606  -10.468 7.810   1.00 63.62  ? 4271 ALA B CA    1 
ATOM   2634 C  C     . ALA B 2 21  ? 59.403  -9.373  8.866   1.00 60.53  ? 4271 ALA B C     1 
ATOM   2635 O  O     . ALA B 2 21  ? 59.002  -8.254  8.479   1.00 62.01  ? 4271 ALA B O     1 
ATOM   2636 C  CB    . ALA B 2 21  ? 58.302  -11.146 7.463   1.00 66.33  ? 4271 ALA B CB    1 
ATOM   2637 N  N     . PHE B 2 22  ? 59.658  -9.682  10.144  1.00 56.47  ? 4272 PHE B N     1 
ATOM   2638 C  CA    . PHE B 2 22  ? 59.498  -8.672  11.225  1.00 53.37  ? 4272 PHE B CA    1 
ATOM   2639 C  C     . PHE B 2 22  ? 60.552  -7.572  11.073  1.00 54.04  ? 4272 PHE B C     1 
ATOM   2640 O  O     . PHE B 2 22  ? 61.719  -7.883  10.758  1.00 56.06  ? 4272 PHE B O     1 
ATOM   2641 C  CB    . PHE B 2 22  ? 59.619  -9.295  12.618  1.00 49.81  ? 4272 PHE B CB    1 
ATOM   2642 C  CG    . PHE B 2 22  ? 59.627  -8.287  13.742  1.00 46.74  ? 4272 PHE B CG    1 
ATOM   2643 C  CD1   . PHE B 2 22  ? 58.466  -7.621  14.109  1.00 46.10  ? 4272 PHE B CD1   1 
ATOM   2644 C  CD2   . PHE B 2 22  ? 60.792  -8.002  14.437  1.00 44.46  ? 4272 PHE B CD2   1 
ATOM   2645 C  CE1   . PHE B 2 22  ? 58.473  -6.691  15.139  1.00 44.79  ? 4272 PHE B CE1   1 
ATOM   2646 C  CE2   . PHE B 2 22  ? 60.797  -7.075  15.468  1.00 43.99  ? 4272 PHE B CE2   1 
ATOM   2647 C  CZ    . PHE B 2 22  ? 59.638  -6.420  15.817  1.00 43.75  ? 4272 PHE B CZ    1 
ATOM   2648 N  N     . ALA B 2 23  ? 60.132  -6.328  11.313  1.00 53.52  ? 4273 ALA B N     1 
ATOM   2649 C  CA    . ALA B 2 23  ? 61.022  -5.148  11.252  1.00 54.80  ? 4273 ALA B CA    1 
ATOM   2650 C  C     . ALA B 2 23  ? 60.430  -4.045  12.132  1.00 53.54  ? 4273 ALA B C     1 
ATOM   2651 O  O     . ALA B 2 23  ? 59.255  -3.688  11.918  1.00 53.66  ? 4273 ALA B O     1 
ATOM   2652 C  CB    . ALA B 2 23  ? 61.184  -4.688  9.823   1.00 56.75  ? 4273 ALA B CB    1 
ATOM   2653 N  N     . VAL B 2 24  ? 61.205  -3.562  13.106  1.00 53.15  ? 4274 VAL B N     1 
ATOM   2654 C  CA    . VAL B 2 24  ? 60.742  -2.464  14.004  1.00 53.39  ? 4274 VAL B CA    1 
ATOM   2655 C  C     . VAL B 2 24  ? 60.440  -1.241  13.128  1.00 53.02  ? 4274 VAL B C     1 
ATOM   2656 O  O     . VAL B 2 24  ? 61.296  -0.899  12.285  1.00 55.59  ? 4274 VAL B O     1 
ATOM   2657 C  CB    . VAL B 2 24  ? 61.795  -2.151  15.085  1.00 55.38  ? 4274 VAL B CB    1 
ATOM   2658 C  CG1   . VAL B 2 24  ? 61.369  -0.998  15.981  1.00 56.66  ? 4274 VAL B CG1   1 
ATOM   2659 C  CG2   . VAL B 2 24  ? 62.126  -3.380  15.919  1.00 56.32  ? 4274 VAL B CG2   1 
ATOM   2660 N  N     . ASP B 2 25  ? 59.261  -0.635  13.300  1.00 49.55  ? 4275 ASP B N     1 
ATOM   2661 C  CA    . ASP B 2 25  ? 58.866  0.557   12.500  1.00 49.16  ? 4275 ASP B CA    1 
ATOM   2662 C  C     . ASP B 2 25  ? 58.912  1.787   13.418  1.00 45.57  ? 4275 ASP B C     1 
ATOM   2663 O  O     . ASP B 2 25  ? 57.845  2.221   13.898  1.00 45.30  ? 4275 ASP B O     1 
ATOM   2664 C  CB    . ASP B 2 25  ? 57.501  0.348   11.838  1.00 50.39  ? 4275 ASP B CB    1 
ATOM   2665 C  CG    . ASP B 2 25  ? 57.110  1.450   10.866  1.00 53.55  ? 4275 ASP B CG    1 
ATOM   2666 O  OD1   . ASP B 2 25  ? 57.870  2.440   10.754  1.00 52.69  ? 4275 ASP B OD1   1 
ATOM   2667 O  OD2   . ASP B 2 25  ? 56.049  1.308   10.223  1.00 56.29  ? 4275 ASP B OD2   1 
ATOM   2668 N  N     . ALA B 2 26  ? 60.116  2.317   13.645  1.00 43.77  ? 4276 ALA B N     1 
ATOM   2669 C  CA    . ALA B 2 26  ? 60.319  3.485   14.535  1.00 41.46  ? 4276 ALA B CA    1 
ATOM   2670 C  C     . ALA B 2 26  ? 59.580  4.712   13.985  1.00 39.58  ? 4276 ALA B C     1 
ATOM   2671 O  O     . ALA B 2 26  ? 59.012  5.465   14.799  1.00 38.78  ? 4276 ALA B O     1 
ATOM   2672 C  CB    . ALA B 2 26  ? 61.796  3.752   14.686  1.00 41.74  ? 4276 ALA B CB    1 
ATOM   2673 N  N     . ALA B 2 27  ? 59.597  4.897   12.661  1.00 40.19  ? 4277 ALA B N     1 
ATOM   2674 C  CA    . ALA B 2 27  ? 58.925  6.050   12.014  1.00 40.74  ? 4277 ALA B CA    1 
ATOM   2675 C  C     . ALA B 2 27  ? 57.446  6.087   12.415  1.00 41.57  ? 4277 ALA B C     1 
ATOM   2676 O  O     . ALA B 2 27  ? 56.989  7.137   12.910  1.00 40.19  ? 4277 ALA B O     1 
ATOM   2677 C  CB    . ALA B 2 27  ? 59.087  5.965   10.517  1.00 43.23  ? 4277 ALA B CB    1 
ATOM   2678 N  N     . LYS B 2 28  ? 56.732  4.975   12.208  1.00 42.45  ? 4278 LYS B N     1 
ATOM   2679 C  CA    . LYS B 2 28  ? 55.290  4.892   12.563  1.00 43.63  ? 4278 LYS B CA    1 
ATOM   2680 C  C     . LYS B 2 28  ? 55.118  5.083   14.074  1.00 41.14  ? 4278 LYS B C     1 
ATOM   2681 O  O     . LYS B 2 28  ? 54.180  5.794   14.470  1.00 41.16  ? 4278 LYS B O     1 
ATOM   2682 C  CB    . LYS B 2 28  ? 54.702  3.545   12.124  1.00 46.78  ? 4278 LYS B CB    1 
ATOM   2683 C  CG    . LYS B 2 28  ? 53.275  3.285   12.589  1.00 50.40  ? 4278 LYS B CG    1 
ATOM   2684 C  CD    . LYS B 2 28  ? 52.695  1.979   12.089  1.00 53.87  ? 4278 LYS B CD    1 
ATOM   2685 C  CE    . LYS B 2 28  ? 51.362  1.645   12.728  1.00 57.35  ? 4278 LYS B CE    1 
ATOM   2686 N  NZ    . LYS B 2 28  ? 50.371  2.732   12.536  1.00 60.39  ? 4278 LYS B NZ    1 
ATOM   2687 N  N     . ALA B 2 29  ? 56.006  4.484   14.873  1.00 40.23  ? 4279 ALA B N     1 
ATOM   2688 C  CA    . ALA B 2 29  ? 55.917  4.564   16.351  1.00 39.73  ? 4279 ALA B CA    1 
ATOM   2689 C  C     . ALA B 2 29  ? 56.028  6.022   16.819  1.00 39.31  ? 4279 ALA B C     1 
ATOM   2690 O  O     . ALA B 2 29  ? 55.276  6.410   17.737  1.00 40.27  ? 4279 ALA B O     1 
ATOM   2691 C  CB    . ALA B 2 29  ? 56.988  3.703   16.974  1.00 39.55  ? 4279 ALA B CB    1 
ATOM   2692 N  N     . TYR B 2 30  ? 56.923  6.804   16.208  1.00 39.31  ? 4280 TYR B N     1 
ATOM   2693 C  CA    . TYR B 2 30  ? 57.096  8.218   16.641  1.00 39.05  ? 4280 TYR B CA    1 
ATOM   2694 C  C     . TYR B 2 30  ? 55.879  9.045   16.204  1.00 40.09  ? 4280 TYR B C     1 
ATOM   2695 O  O     . TYR B 2 30  ? 55.375  9.838   17.023  1.00 39.93  ? 4280 TYR B O     1 
ATOM   2696 C  CB    . TYR B 2 30  ? 58.419  8.788   16.127  1.00 38.13  ? 4280 TYR B CB    1 
ATOM   2697 C  CG    . TYR B 2 30  ? 58.707  10.189  16.603  1.00 36.69  ? 4280 TYR B CG    1 
ATOM   2698 C  CD1   . TYR B 2 30  ? 58.796  10.476  17.957  1.00 36.77  ? 4280 TYR B CD1   1 
ATOM   2699 C  CD2   . TYR B 2 30  ? 58.928  11.222  15.708  1.00 37.24  ? 4280 TYR B CD2   1 
ATOM   2700 C  CE1   . TYR B 2 30  ? 59.073  11.758  18.408  1.00 36.08  ? 4280 TYR B CE1   1 
ATOM   2701 C  CE2   . TYR B 2 30  ? 59.208  12.508  16.142  1.00 36.32  ? 4280 TYR B CE2   1 
ATOM   2702 C  CZ    . TYR B 2 30  ? 59.278  12.779  17.497  1.00 36.04  ? 4280 TYR B CZ    1 
ATOM   2703 O  OH    . TYR B 2 30  ? 59.557  14.046  17.931  1.00 34.60  ? 4280 TYR B OH    1 
ATOM   2704 N  N     . LYS B 2 31  ? 55.413  8.849   14.965  1.00 43.21  ? 4281 LYS B N     1 
ATOM   2705 C  CA    . LYS B 2 31  ? 54.218  9.578   14.448  1.00 46.17  ? 4281 LYS B CA    1 
ATOM   2706 C  C     . LYS B 2 31  ? 53.009  9.291   15.349  1.00 46.99  ? 4281 LYS B C     1 
ATOM   2707 O  O     . LYS B 2 31  ? 52.282  10.249  15.680  1.00 46.95  ? 4281 LYS B O     1 
ATOM   2708 C  CB    . LYS B 2 31  ? 53.939  9.185   12.994  1.00 49.20  ? 4281 LYS B CB    1 
ATOM   2709 C  CG    . LYS B 2 31  ? 55.014  9.613   12.004  1.00 51.04  ? 4281 LYS B CG    1 
ATOM   2710 C  CD    . LYS B 2 31  ? 54.777  9.129   10.591  1.00 54.74  ? 4281 LYS B CD    1 
ATOM   2711 C  CE    . LYS B 2 31  ? 55.917  9.478   9.659   1.00 56.19  ? 4281 LYS B CE    1 
ATOM   2712 N  NZ    . LYS B 2 31  ? 55.671  8.992   8.281   1.00 60.10  ? 4281 LYS B NZ    1 
ATOM   2713 N  N     . ASP B 2 32  ? 52.803  8.022   15.725  1.00 48.47  ? 4282 ASP B N     1 
ATOM   2714 C  CA    . ASP B 2 32  ? 51.672  7.626   16.611  1.00 50.55  ? 4282 ASP B CA    1 
ATOM   2715 C  C     . ASP B 2 32  ? 51.860  8.270   17.992  1.00 49.00  ? 4282 ASP B C     1 
ATOM   2716 O  O     . ASP B 2 32  ? 50.854  8.707   18.581  1.00 49.19  ? 4282 ASP B O     1 
ATOM   2717 C  CB    . ASP B 2 32  ? 51.547  6.101   16.702  1.00 52.98  ? 4282 ASP B CB    1 
ATOM   2718 C  CG    . ASP B 2 32  ? 51.156  5.430   15.393  1.00 55.46  ? 4282 ASP B CG    1 
ATOM   2719 O  OD1   . ASP B 2 32  ? 50.709  6.146   14.473  1.00 57.78  ? 4282 ASP B OD1   1 
ATOM   2720 O  OD2   . ASP B 2 32  ? 51.311  4.194   15.299  1.00 55.80  ? 4282 ASP B OD2   1 
ATOM   2721 N  N     . TYR B 2 33  ? 53.105  8.321   18.477  1.00 47.38  ? 4283 TYR B N     1 
ATOM   2722 C  CA    . TYR B 2 33  ? 53.451  8.942   19.785  1.00 46.65  ? 4283 TYR B CA    1 
ATOM   2723 C  C     . TYR B 2 33  ? 53.071  10.430  19.774  1.00 46.39  ? 4283 TYR B C     1 
ATOM   2724 O  O     . TYR B 2 33  ? 52.448  10.895  20.751  1.00 47.46  ? 4283 TYR B O     1 
ATOM   2725 C  CB    . TYR B 2 33  ? 54.937  8.710   20.080  1.00 45.64  ? 4283 TYR B CB    1 
ATOM   2726 C  CG    . TYR B 2 33  ? 55.540  9.597   21.139  1.00 45.41  ? 4283 TYR B CG    1 
ATOM   2727 C  CD1   . TYR B 2 33  ? 55.488  9.260   22.482  1.00 46.09  ? 4283 TYR B CD1   1 
ATOM   2728 C  CD2   . TYR B 2 33  ? 56.199  10.765  20.789  1.00 44.96  ? 4283 TYR B CD2   1 
ATOM   2729 C  CE1   . TYR B 2 33  ? 56.059  10.070  23.452  1.00 46.99  ? 4283 TYR B CE1   1 
ATOM   2730 C  CE2   . TYR B 2 33  ? 56.773  11.586  21.744  1.00 44.36  ? 4283 TYR B CE2   1 
ATOM   2731 C  CZ    . TYR B 2 33  ? 56.706  11.238  23.081  1.00 46.17  ? 4283 TYR B CZ    1 
ATOM   2732 O  OH    . TYR B 2 33  ? 57.272  12.047  24.022  1.00 46.36  ? 4283 TYR B OH    1 
ATOM   2733 N  N     . LEU B 2 34  ? 53.446  11.151  18.710  1.00 44.86  ? 4284 LEU B N     1 
ATOM   2734 C  CA    . LEU B 2 34  ? 53.110  12.598  18.587  1.00 44.72  ? 4284 LEU B CA    1 
ATOM   2735 C  C     . LEU B 2 34  ? 51.584  12.766  18.542  1.00 47.11  ? 4284 LEU B C     1 
ATOM   2736 O  O     . LEU B 2 34  ? 51.074  13.676  19.222  1.00 47.73  ? 4284 LEU B O     1 
ATOM   2737 C  CB    . LEU B 2 34  ? 53.765  13.169  17.325  1.00 42.91  ? 4284 LEU B CB    1 
ATOM   2738 C  CG    . LEU B 2 34  ? 55.294  13.228  17.338  1.00 41.10  ? 4284 LEU B CG    1 
ATOM   2739 C  CD1   . LEU B 2 34  ? 55.827  13.647  15.977  1.00 40.96  ? 4284 LEU B CD1   1 
ATOM   2740 C  CD2   . LEU B 2 34  ? 55.797  14.168  18.423  1.00 40.38  ? 4284 LEU B CD2   1 
ATOM   2741 N  N     . ALA B 2 35  ? 50.895  11.912  17.779  1.00 49.67  ? 4285 ALA B N     1 
ATOM   2742 C  CA    . ALA B 2 35  ? 49.416  11.949  17.637  1.00 53.65  ? 4285 ALA B CA    1 
ATOM   2743 C  C     . ALA B 2 35  ? 48.729  11.754  18.998  1.00 56.47  ? 4285 ALA B C     1 
ATOM   2744 O  O     . ALA B 2 35  ? 47.625  12.297  19.191  1.00 59.33  ? 4285 ALA B O     1 
ATOM   2745 C  CB    . ALA B 2 35  ? 48.977  10.898  16.647  1.00 54.25  ? 4285 ALA B CB    1 
ATOM   2746 N  N     A SER B 2 36  ? 49.370  11.006  19.905  0.50 56.39  ? 4286 SER B N     1 
ATOM   2747 N  N     B SER B 2 36  ? 49.368  11.006  19.906  0.50 56.40  ? 4286 SER B N     1 
ATOM   2748 C  CA    A SER B 2 36  ? 48.812  10.737  21.259  0.50 58.54  ? 4286 SER B CA    1 
ATOM   2749 C  CA    B SER B 2 36  ? 48.805  10.739  21.258  0.50 58.57  ? 4286 SER B CA    1 
ATOM   2750 C  C     A SER B 2 36  ? 49.152  11.881  22.224  0.50 58.52  ? 4286 SER B C     1 
ATOM   2751 C  C     B SER B 2 36  ? 49.138  11.888  22.221  0.50 58.54  ? 4286 SER B C     1 
ATOM   2752 O  O     A SER B 2 36  ? 48.858  11.735  23.428  0.50 60.79  ? 4286 SER B O     1 
ATOM   2753 O  O     B SER B 2 36  ? 48.823  11.752  23.421  0.50 60.84  ? 4286 SER B O     1 
ATOM   2754 C  CB    A SER B 2 36  ? 49.308  9.416   21.786  0.50 59.00  ? 4286 SER B CB    1 
ATOM   2755 C  CB    B SER B 2 36  ? 49.306  9.426   21.797  0.50 59.04  ? 4286 SER B CB    1 
ATOM   2756 O  OG    A SER B 2 36  ? 48.916  8.351   20.932  0.50 60.17  ? 4286 SER B OG    1 
ATOM   2757 O  OG    B SER B 2 36  ? 50.716  9.450   21.957  0.50 56.93  ? 4286 SER B OG    1 
ATOM   2758 N  N     . GLY B 2 37  ? 49.754  12.965  21.716  1.00 55.91  ? 4287 GLY B N     1 
ATOM   2759 C  CA    . GLY B 2 37  ? 50.115  14.136  22.544  1.00 54.88  ? 4287 GLY B CA    1 
ATOM   2760 C  C     . GLY B 2 37  ? 51.511  14.035  23.149  1.00 52.92  ? 4287 GLY B C     1 
ATOM   2761 O  O     . GLY B 2 37  ? 51.807  14.829  24.068  1.00 53.72  ? 4287 GLY B O     1 
ATOM   2762 N  N     . GLY B 2 38  ? 52.346  13.120  22.646  1.00 49.59  ? 4288 GLY B N     1 
ATOM   2763 C  CA    . GLY B 2 38  ? 53.718  12.942  23.165  1.00 48.56  ? 4288 GLY B CA    1 
ATOM   2764 C  C     . GLY B 2 38  ? 54.599  14.151  22.881  1.00 46.22  ? 4288 GLY B C     1 
ATOM   2765 O  O     . GLY B 2 38  ? 54.433  14.768  21.808  1.00 45.37  ? 4288 GLY B O     1 
ATOM   2766 N  N     . GLN B 2 39  ? 55.503  14.476  23.810  1.00 53.10  ? 4289 GLN B N     1 
ATOM   2767 C  CA    . GLN B 2 39  ? 56.425  15.635  23.658  1.00 50.75  ? 4289 GLN B CA    1 
ATOM   2768 C  C     . GLN B 2 39  ? 57.506  15.294  22.634  1.00 45.24  ? 4289 GLN B C     1 
ATOM   2769 O  O     . GLN B 2 39  ? 58.142  14.246  22.725  1.00 43.67  ? 4289 GLN B O     1 
ATOM   2770 C  CB    . GLN B 2 39  ? 57.046  16.003  25.009  1.00 53.80  ? 4289 GLN B CB    1 
ATOM   2771 C  CG    . GLN B 2 39  ? 56.028  16.451  26.052  1.00 59.45  ? 4289 GLN B CG    1 
ATOM   2772 C  CD    . GLN B 2 39  ? 55.319  17.733  25.684  1.00 62.17  ? 4289 GLN B CD    1 
ATOM   2773 O  OE1   . GLN B 2 39  ? 55.783  18.514  24.855  1.00 64.88  ? 4289 GLN B OE1   1 
ATOM   2774 N  NE2   . GLN B 2 39  ? 54.182  17.969  26.319  1.00 67.79  ? 4289 GLN B NE2   1 
ATOM   2775 N  N     . PRO B 2 40  ? 57.740  16.161  21.622  1.00 41.28  ? 4290 PRO B N     1 
ATOM   2776 C  CA    . PRO B 2 40  ? 58.767  15.912  20.610  1.00 38.20  ? 4290 PRO B CA    1 
ATOM   2777 C  C     . PRO B 2 40  ? 60.176  15.635  21.162  1.00 35.09  ? 4290 PRO B C     1 
ATOM   2778 O  O     . PRO B 2 40  ? 60.489  16.086  22.254  1.00 34.16  ? 4290 PRO B O     1 
ATOM   2779 C  CB    . PRO B 2 40  ? 58.814  17.225  19.813  1.00 38.37  ? 4290 PRO B CB    1 
ATOM   2780 C  CG    . PRO B 2 40  ? 57.429  17.816  19.981  1.00 40.89  ? 4290 PRO B CG    1 
ATOM   2781 C  CD    . PRO B 2 40  ? 57.001  17.409  21.375  1.00 42.22  ? 4290 PRO B CD    1 
ATOM   2782 N  N     . ILE B 2 41  ? 60.975  14.896  20.388  1.00 32.34  ? 4291 ILE B N     1 
ATOM   2783 C  CA    . ILE B 2 41  ? 62.392  14.595  20.748  1.00 31.01  ? 4291 ILE B CA    1 
ATOM   2784 C  C     . ILE B 2 41  ? 63.123  15.928  20.955  1.00 29.61  ? 4291 ILE B C     1 
ATOM   2785 O  O     . ILE B 2 41  ? 63.011  16.819  20.083  1.00 28.64  ? 4291 ILE B O     1 
ATOM   2786 C  CB    . ILE B 2 41  ? 63.040  13.705  19.670  1.00 30.66  ? 4291 ILE B CB    1 
ATOM   2787 C  CG1   . ILE B 2 41  ? 62.459  12.289  19.730  1.00 31.98  ? 4291 ILE B CG1   1 
ATOM   2788 C  CG2   . ILE B 2 41  ? 64.559  13.700  19.796  1.00 29.71  ? 4291 ILE B CG2   1 
ATOM   2789 C  CD1   . ILE B 2 41  ? 62.879  11.392  18.596  1.00 32.48  ? 4291 ILE B CD1   1 
ATOM   2790 N  N     . THR B 2 42  ? 63.814  16.055  22.087  1.00 28.91  ? 4292 THR B N     1 
ATOM   2791 C  CA    . THR B 2 42  ? 64.532  17.305  22.444  1.00 28.55  ? 4292 THR B CA    1 
ATOM   2792 C  C     . THR B 2 42  ? 66.015  17.205  22.078  1.00 26.62  ? 4292 THR B C     1 
ATOM   2793 O  O     . THR B 2 42  ? 66.443  16.164  21.540  1.00 25.46  ? 4292 THR B O     1 
ATOM   2794 C  CB    . THR B 2 42  ? 64.388  17.588  23.945  1.00 30.29  ? 4292 THR B CB    1 
ATOM   2795 O  OG1   . THR B 2 42  ? 64.933  16.469  24.646  1.00 30.90  ? 4292 THR B OG1   1 
ATOM   2796 C  CG2   . THR B 2 42  ? 62.954  17.815  24.368  1.00 32.69  ? 4292 THR B CG2   1 
ATOM   2797 N  N     . ASN B 2 43  ? 66.746  18.291  22.333  1.00 26.21  ? 4293 ASN B N     1 
ATOM   2798 C  CA    . ASN B 2 43  ? 68.221  18.372  22.162  1.00 25.44  ? 4293 ASN B CA    1 
ATOM   2799 C  C     . ASN B 2 43  ? 68.633  18.291  20.691  1.00 23.63  ? 4293 ASN B C     1 
ATOM   2800 O  O     . ASN B 2 43  ? 69.794  17.936  20.432  1.00 23.49  ? 4293 ASN B O     1 
ATOM   2801 C  CB    . ASN B 2 43  ? 68.919  17.372  23.081  1.00 26.95  ? 4293 ASN B CB    1 
ATOM   2802 C  CG    . ASN B 2 43  ? 68.757  17.780  24.527  1.00 29.38  ? 4293 ASN B CG    1 
ATOM   2803 O  OD1   . ASN B 2 43  ? 68.826  18.965  24.838  1.00 33.22  ? 4293 ASN B OD1   1 
ATOM   2804 N  ND2   . ASN B 2 43  ? 68.525  16.823  25.406  1.00 32.17  ? 4293 ASN B ND2   1 
ATOM   2805 N  N     . CYS B 2 44  ? 67.725  18.602  19.763  1.00 23.56  ? 4294 CYS B N     1 
ATOM   2806 C  CA    . CYS B 2 44  ? 68.182  18.797  18.365  1.00 22.90  ? 4294 CYS B CA    1 
ATOM   2807 C  C     . CYS B 2 44  ? 69.103  20.026  18.422  1.00 21.94  ? 4294 CYS B C     1 
ATOM   2808 O  O     . CYS B 2 44  ? 68.733  21.004  19.104  1.00 22.93  ? 4294 CYS B O     1 
ATOM   2809 C  CB    . CYS B 2 44  ? 67.013  18.981  17.408  1.00 24.12  ? 4294 CYS B CB    1 
ATOM   2810 S  SG    . CYS B 2 44  ? 65.937  17.523  17.343  1.00 26.26  ? 4294 CYS B SG    1 
ATOM   2811 N  N     . VAL B 2 45  ? 70.269  19.957  17.781  1.00 20.93  ? 4295 VAL B N     1 
ATOM   2812 C  CA    . VAL B 2 45  ? 71.309  21.020  17.916  1.00 20.30  ? 4295 VAL B CA    1 
ATOM   2813 C  C     . VAL B 2 45  ? 71.050  22.166  16.932  1.00 20.32  ? 4295 VAL B C     1 
ATOM   2814 O  O     . VAL B 2 45  ? 71.385  22.027  15.741  1.00 20.72  ? 4295 VAL B O     1 
ATOM   2815 C  CB    . VAL B 2 45  ? 72.711  20.413  17.742  1.00 19.84  ? 4295 VAL B CB    1 
ATOM   2816 C  CG1   . VAL B 2 45  ? 73.805  21.465  17.852  1.00 20.03  ? 4295 VAL B CG1   1 
ATOM   2817 C  CG2   . VAL B 2 45  ? 72.946  19.288  18.741  1.00 19.71  ? 4295 VAL B CG2   1 
ATOM   2818 N  N     . LYS B 2 46  ? 70.500  23.269  17.435  1.00 20.44  ? 4296 LYS B N     1 
ATOM   2819 C  CA    . LYS B 2 46  ? 70.234  24.443  16.569  1.00 20.95  ? 4296 LYS B CA    1 
ATOM   2820 C  C     . LYS B 2 46  ? 71.532  25.240  16.396  1.00 20.03  ? 4296 LYS B C     1 
ATOM   2821 O  O     . LYS B 2 46  ? 72.216  25.505  17.397  1.00 20.06  ? 4296 LYS B O     1 
ATOM   2822 C  CB    . LYS B 2 46  ? 69.116  25.312  17.141  1.00 22.18  ? 4296 LYS B CB    1 
ATOM   2823 C  CG    . LYS B 2 46  ? 68.590  26.332  16.147  1.00 23.42  ? 4296 LYS B CG    1 
ATOM   2824 C  CD    . LYS B 2 46  ? 67.257  26.925  16.529  1.00 25.99  ? 4296 LYS B CD    1 
ATOM   2825 C  CE    . LYS B 2 46  ? 67.321  27.851  17.715  1.00 26.30  ? 4296 LYS B CE    1 
ATOM   2826 N  NZ    . LYS B 2 46  ? 66.021  28.525  17.935  1.00 27.77  ? 4296 LYS B NZ    1 
ATOM   2827 N  N     . MET B 2 47  ? 71.834  25.620  15.157  1.00 20.48  ? 4297 MET B N     1 
ATOM   2828 C  CA    . MET B 2 47  ? 73.094  26.335  14.858  1.00 20.21  ? 4297 MET B CA    1 
ATOM   2829 C  C     . MET B 2 47  ? 72.859  27.845  14.797  1.00 21.19  ? 4297 MET B C     1 
ATOM   2830 O  O     . MET B 2 47  ? 71.720  28.290  14.464  1.00 21.28  ? 4297 MET B O     1 
ATOM   2831 C  CB    . MET B 2 47  ? 73.652  25.900  13.497  1.00 21.16  ? 4297 MET B CB    1 
ATOM   2832 C  CG    . MET B 2 47  ? 73.684  24.394  13.286  1.00 21.17  ? 4297 MET B CG    1 
ATOM   2833 S  SD    . MET B 2 47  ? 74.517  23.495  14.611  1.00 20.98  ? 4297 MET B SD    1 
ATOM   2834 C  CE    . MET B 2 47  ? 76.149  24.232  14.559  1.00 20.81  ? 4297 MET B CE    1 
ATOM   2835 N  N     . LEU B 2 48  ? 73.913  28.597  15.109  1.00 21.28  ? 4298 LEU B N     1 
ATOM   2836 C  CA    . LEU B 2 48  ? 73.903  30.056  14.865  1.00 21.98  ? 4298 LEU B CA    1 
ATOM   2837 C  C     . LEU B 2 48  ? 74.218  30.245  13.379  1.00 22.60  ? 4298 LEU B C     1 
ATOM   2838 O  O     . LEU B 2 48  ? 75.126  29.556  12.873  1.00 22.97  ? 4298 LEU B O     1 
ATOM   2839 C  CB    . LEU B 2 48  ? 74.945  30.727  15.756  1.00 21.91  ? 4298 LEU B CB    1 
ATOM   2840 C  CG    . LEU B 2 48  ? 74.556  30.782  17.229  1.00 22.31  ? 4298 LEU B CG    1 
ATOM   2841 C  CD1   . LEU B 2 48  ? 75.767  31.002  18.106  1.00 23.13  ? 4298 LEU B CD1   1 
ATOM   2842 C  CD2   . LEU B 2 48  ? 73.504  31.853  17.463  1.00 22.43  ? 4298 LEU B CD2   1 
ATOM   2843 N  N     . CYS B 2 49  ? 73.469  31.105  12.701  1.00 23.27  ? 4299 CYS B N     1 
ATOM   2844 C  CA    . CYS B 2 49  ? 73.730  31.340  11.260  1.00 24.78  ? 4299 CYS B CA    1 
ATOM   2845 C  C     . CYS B 2 49  ? 73.168  32.712  10.875  1.00 25.46  ? 4299 CYS B C     1 
ATOM   2846 O  O     . CYS B 2 49  ? 72.546  33.364  11.742  1.00 25.16  ? 4299 CYS B O     1 
ATOM   2847 C  CB    . CYS B 2 49  ? 73.176  30.197  10.414  1.00 25.52  ? 4299 CYS B CB    1 
ATOM   2848 S  SG    . CYS B 2 49  ? 71.405  29.899  10.641  1.00 28.37  ? 4299 CYS B SG    1 
ATOM   2849 N  N     . THR B 2 50  ? 73.428  33.139  9.641   1.00 26.33  ? 4300 THR B N     1 
ATOM   2850 C  CA    . THR B 2 50  ? 72.994  34.469  9.137   1.00 27.80  ? 4300 THR B CA    1 
ATOM   2851 C  C     . THR B 2 50  ? 71.491  34.507  8.839   1.00 28.06  ? 4300 THR B C     1 
ATOM   2852 O  O     . THR B 2 50  ? 70.929  35.613  8.842   1.00 28.37  ? 4300 THR B O     1 
ATOM   2853 C  CB    . THR B 2 50  ? 73.754  34.814  7.852   1.00 29.19  ? 4300 THR B CB    1 
ATOM   2854 O  OG1   . THR B 2 50  ? 73.433  33.801  6.898   1.00 29.07  ? 4300 THR B OG1   1 
ATOM   2855 C  CG2   . THR B 2 50  ? 75.252  34.880  8.051   1.00 29.34  ? 4300 THR B CG2   1 
ATOM   2856 N  N     . HIS B 2 51  ? 70.873  33.350  8.584   1.00 27.42  ? 4301 HIS B N     1 
ATOM   2857 C  CA    . HIS B 2 51  ? 69.444  33.295  8.162   1.00 28.43  ? 4301 HIS B CA    1 
ATOM   2858 C  C     . HIS B 2 51  ? 69.275  34.023  6.818   1.00 30.36  ? 4301 HIS B C     1 
ATOM   2859 O  O     . HIS B 2 51  ? 68.185  34.570  6.574   1.00 31.94  ? 4301 HIS B O     1 
ATOM   2860 C  CB    . HIS B 2 51  ? 68.509  33.790  9.273   1.00 28.16  ? 4301 HIS B CB    1 
ATOM   2861 C  CG    . HIS B 2 51  ? 68.521  32.882  10.453  1.00 27.38  ? 4301 HIS B CG    1 
ATOM   2862 N  ND1   . HIS B 2 51  ? 67.611  31.850  10.601  1.00 27.47  ? 4301 HIS B ND1   1 
ATOM   2863 C  CD2   . HIS B 2 51  ? 69.366  32.804  11.503  1.00 26.22  ? 4301 HIS B CD2   1 
ATOM   2864 C  CE1   . HIS B 2 51  ? 67.883  31.190  11.712  1.00 26.58  ? 4301 HIS B CE1   1 
ATOM   2865 N  NE2   . HIS B 2 51  ? 68.962  31.750  12.279  1.00 26.25  ? 4301 HIS B NE2   1 
ATOM   2866 N  N     . THR B 2 52  ? 70.328  34.026  5.993   1.00 31.04  ? 4302 THR B N     1 
ATOM   2867 C  CA    . THR B 2 52  ? 70.308  34.592  4.615   1.00 33.61  ? 4302 THR B CA    1 
ATOM   2868 C  C     . THR B 2 52  ? 70.783  33.505  3.639   1.00 34.34  ? 4302 THR B C     1 
ATOM   2869 O  O     . THR B 2 52  ? 71.328  33.861  2.571   1.00 35.80  ? 4302 THR B O     1 
ATOM   2870 C  CB    . THR B 2 52  ? 71.153  35.872  4.516   1.00 34.82  ? 4302 THR B CB    1 
ATOM   2871 O  OG1   . THR B 2 52  ? 72.513  35.546  4.801   1.00 34.33  ? 4302 THR B OG1   1 
ATOM   2872 C  CG2   . THR B 2 52  ? 70.687  36.960  5.457   1.00 35.13  ? 4302 THR B CG2   1 
ATOM   2873 N  N     . GLY B 2 53  ? 70.549  32.233  3.992   1.00 33.07  ? 4303 GLY B N     1 
ATOM   2874 C  CA    . GLY B 2 53  ? 70.984  31.073  3.189   1.00 33.48  ? 4303 GLY B CA    1 
ATOM   2875 C  C     . GLY B 2 53  ? 70.033  30.740  2.048   1.00 35.41  ? 4303 GLY B C     1 
ATOM   2876 O  O     . GLY B 2 53  ? 69.007  31.436  1.893   1.00 36.12  ? 4303 GLY B O     1 
ATOM   2877 N  N     . THR B 2 54  ? 70.365  29.690  1.291   1.00 35.94  ? 4304 THR B N     1 
ATOM   2878 C  CA    . THR B 2 54  ? 69.585  29.247  0.102   1.00 38.47  ? 4304 THR B CA    1 
ATOM   2879 C  C     . THR B 2 54  ? 68.199  28.732  0.510   1.00 38.03  ? 4304 THR B C     1 
ATOM   2880 O  O     . THR B 2 54  ? 67.284  28.787  -0.331  1.00 39.16  ? 4304 THR B O     1 
ATOM   2881 C  CB    . THR B 2 54  ? 70.335  28.152  -0.666  1.00 39.74  ? 4304 THR B CB    1 
ATOM   2882 O  OG1   . THR B 2 54  ? 70.401  26.994  0.166   1.00 38.39  ? 4304 THR B OG1   1 
ATOM   2883 C  CG2   . THR B 2 54  ? 71.729  28.568  -1.083  1.00 40.50  ? 4304 THR B CG2   1 
ATOM   2884 N  N     . GLY B 2 55  ? 68.055  28.242  1.742   1.00 36.10  ? 4305 GLY B N     1 
ATOM   2885 C  CA    . GLY B 2 55  ? 66.765  27.694  2.202   1.00 36.28  ? 4305 GLY B CA    1 
ATOM   2886 C  C     . GLY B 2 55  ? 66.572  26.241  1.785   1.00 36.55  ? 4305 GLY B C     1 
ATOM   2887 O  O     . GLY B 2 55  ? 65.481  25.703  2.046   1.00 37.41  ? 4305 GLY B O     1 
ATOM   2888 N  N     . GLN B 2 56  ? 67.579  25.625  1.151   1.00 36.72  ? 4306 GLN B N     1 
ATOM   2889 C  CA    . GLN B 2 56  ? 67.484  24.190  0.761   1.00 37.60  ? 4306 GLN B CA    1 
ATOM   2890 C  C     . GLN B 2 56  ? 67.350  23.334  2.031   1.00 34.86  ? 4306 GLN B C     1 
ATOM   2891 O  O     . GLN B 2 56  ? 67.787  23.793  3.110   1.00 32.00  ? 4306 GLN B O     1 
ATOM   2892 C  CB    . GLN B 2 56  ? 68.668  23.793  -0.122  1.00 39.97  ? 4306 GLN B CB    1 
ATOM   2893 C  CG    . GLN B 2 56  ? 68.602  24.408  -1.515  1.00 44.35  ? 4306 GLN B CG    1 
ATOM   2894 C  CD    . GLN B 2 56  ? 69.753  23.987  -2.394  1.00 47.33  ? 4306 GLN B CD    1 
ATOM   2895 O  OE1   . GLN B 2 56  ? 70.834  23.654  -1.917  1.00 51.90  ? 4306 GLN B OE1   1 
ATOM   2896 N  NE2   . GLN B 2 56  ? 69.535  24.023  -3.696  1.00 51.68  ? 4306 GLN B NE2   1 
ATOM   2897 N  N     . ALA B 2 57  ? 66.787  22.128  1.887   1.00 34.44  ? 4307 ALA B N     1 
ATOM   2898 C  CA    . ALA B 2 57  ? 66.439  21.222  3.010   1.00 33.24  ? 4307 ALA B CA    1 
ATOM   2899 C  C     . ALA B 2 57  ? 67.664  20.671  3.753   1.00 31.45  ? 4307 ALA B C     1 
ATOM   2900 O  O     . ALA B 2 57  ? 67.696  20.796  4.990   1.00 30.17  ? 4307 ALA B O     1 
ATOM   2901 C  CB    . ALA B 2 57  ? 65.593  20.091  2.483   1.00 34.84  ? 4307 ALA B CB    1 
ATOM   2902 N  N     . ILE B 2 58  ? 68.594  20.034  3.037   1.00 32.05  ? 4308 ILE B N     1 
ATOM   2903 C  CA    . ILE B 2 58  ? 69.779  19.365  3.659   1.00 31.43  ? 4308 ILE B CA    1 
ATOM   2904 C  C     . ILE B 2 58  ? 71.019  19.881  2.934   1.00 31.89  ? 4308 ILE B C     1 
ATOM   2905 O  O     . ILE B 2 58  ? 71.113  19.662  1.710   1.00 33.15  ? 4308 ILE B O     1 
ATOM   2906 C  CB    . ILE B 2 58  ? 69.630  17.832  3.583   1.00 32.54  ? 4308 ILE B CB    1 
ATOM   2907 C  CG1   . ILE B 2 58  ? 68.315  17.374  4.220   1.00 33.27  ? 4308 ILE B CG1   1 
ATOM   2908 C  CG2   . ILE B 2 58  ? 70.833  17.133  4.204   1.00 31.83  ? 4308 ILE B CG2   1 
ATOM   2909 C  CD1   . ILE B 2 58  ? 68.011  15.902  4.031   1.00 34.76  ? 4308 ILE B CD1   1 
ATOM   2910 N  N     . THR B 2 59  ? 71.936  20.511  3.674   1.00 30.10  ? 4309 THR B N     1 
ATOM   2911 C  CA    . THR B 2 59  ? 73.091  21.211  3.055   1.00 30.66  ? 4309 THR B CA    1 
ATOM   2912 C  C     . THR B 2 59  ? 74.398  20.898  3.793   1.00 29.78  ? 4309 THR B C     1 
ATOM   2913 O  O     . THR B 2 59  ? 74.345  20.419  4.940   1.00 28.08  ? 4309 THR B O     1 
ATOM   2914 C  CB    . THR B 2 59  ? 72.779  22.711  3.026   1.00 30.88  ? 4309 THR B CB    1 
ATOM   2915 O  OG1   . THR B 2 59  ? 72.426  23.081  4.359   1.00 29.08  ? 4309 THR B OG1   1 
ATOM   2916 C  CG2   . THR B 2 59  ? 71.635  23.051  2.096   1.00 32.96  ? 4309 THR B CG2   1 
ATOM   2917 N  N     A VAL B 2 60  ? 75.532  21.237  3.169   0.50 30.49  ? 4310 VAL B N     1 
ATOM   2918 N  N     B VAL B 2 60  ? 75.531  21.148  3.128   0.50 30.67  ? 4310 VAL B N     1 
ATOM   2919 C  CA    A VAL B 2 60  ? 76.875  20.982  3.774   0.50 30.51  ? 4310 VAL B CA    1 
ATOM   2920 C  CA    B VAL B 2 60  ? 76.890  20.852  3.675   0.50 30.77  ? 4310 VAL B CA    1 
ATOM   2921 C  C     A VAL B 2 60  ? 77.127  21.991  4.903   0.50 28.94  ? 4310 VAL B C     1 
ATOM   2922 C  C     B VAL B 2 60  ? 77.190  21.787  4.854   0.50 29.07  ? 4310 VAL B C     1 
ATOM   2923 O  O     A VAL B 2 60  ? 77.854  21.630  5.845   0.50 27.39  ? 4310 VAL B O     1 
ATOM   2924 O  O     B VAL B 2 60  ? 78.076  21.456  5.663   0.50 27.58  ? 4310 VAL B O     1 
ATOM   2925 C  CB    A VAL B 2 60  ? 77.992  21.017  2.715   0.50 32.41  ? 4310 VAL B CB    1 
ATOM   2926 C  CB    B VAL B 2 60  ? 77.954  20.990  2.570   0.50 32.85  ? 4310 VAL B CB    1 
ATOM   2927 C  CG1   A VAL B 2 60  ? 77.835  19.890  1.706   0.50 34.45  ? 4310 VAL B CG1   1 
ATOM   2928 C  CG1   B VAL B 2 60  ? 79.360  20.779  3.108   0.50 32.77  ? 4310 VAL B CG1   1 
ATOM   2929 C  CG2   A VAL B 2 60  ? 78.075  22.363  2.015   0.50 33.31  ? 4310 VAL B CG2   1 
ATOM   2930 C  CG2   B VAL B 2 60  ? 77.675  20.049  1.407   0.50 35.12  ? 4310 VAL B CG2   1 
ATOM   2931 N  N     A THR B 2 61  ? 76.572  23.206  4.797   0.60 29.21  ? 4311 THR B N     1 
ATOM   2932 N  N     B THR B 2 61  ? 76.487  22.930  4.913   0.40 29.03  ? 4311 THR B N     1 
ATOM   2933 C  CA    A THR B 2 61  ? 76.706  24.226  5.867   0.60 28.71  ? 4311 THR B CA    1 
ATOM   2934 C  CA    B THR B 2 61  ? 76.649  23.964  5.978   0.40 28.36  ? 4311 THR B CA    1 
ATOM   2935 C  C     A THR B 2 61  ? 75.309  24.759  6.137   0.60 27.89  ? 4311 THR B C     1 
ATOM   2936 C  C     B THR B 2 61  ? 75.286  24.627  6.194   0.40 27.79  ? 4311 THR B C     1 
ATOM   2937 O  O     A THR B 2 61  ? 74.425  24.607  5.296   0.60 29.12  ? 4311 THR B O     1 
ATOM   2938 O  O     B THR B 2 61  ? 74.406  24.479  5.349   0.40 28.84  ? 4311 THR B O     1 
ATOM   2939 C  CB    A THR B 2 61  ? 77.680  25.344  5.471   0.60 30.10  ? 4311 THR B CB    1 
ATOM   2940 C  CB    B THR B 2 61  ? 77.764  24.951  5.600   0.40 29.56  ? 4311 THR B CB    1 
ATOM   2941 O  OG1   A THR B 2 61  ? 77.157  25.984  4.307   0.60 32.59  ? 4311 THR B OG1   1 
ATOM   2942 O  OG1   B THR B 2 61  ? 78.155  25.703  6.749   0.40 29.05  ? 4311 THR B OG1   1 
ATOM   2943 C  CG2   A THR B 2 61  ? 79.083  24.840  5.208   0.60 31.00  ? 4311 THR B CG2   1 
ATOM   2944 C  CG2   B THR B 2 61  ? 77.360  25.893  4.488   0.40 31.18  ? 4311 THR B CG2   1 
ATOM   2945 N  N     . PRO B 2 62  ? 75.042  25.345  7.321   1.00 26.86  ? 4312 PRO B N     1 
ATOM   2946 C  CA    . PRO B 2 62  ? 73.732  25.940  7.581   1.00 26.49  ? 4312 PRO B CA    1 
ATOM   2947 C  C     . PRO B 2 62  ? 73.292  26.861  6.433   1.00 27.70  ? 4312 PRO B C     1 
ATOM   2948 O  O     . PRO B 2 62  ? 74.079  27.689  6.003   1.00 28.04  ? 4312 PRO B O     1 
ATOM   2949 C  CB    . PRO B 2 62  ? 73.949  26.700  8.895   1.00 25.34  ? 4312 PRO B CB    1 
ATOM   2950 C  CG    . PRO B 2 62  ? 75.042  25.910  9.577   1.00 24.83  ? 4312 PRO B CG    1 
ATOM   2951 C  CD    . PRO B 2 62  ? 75.974  25.513  8.450   1.00 26.08  ? 4312 PRO B CD    1 
ATOM   2952 N  N     . GLU B 2 63  ? 72.063  26.661  5.953   1.00 28.19  ? 4313 GLU B N     1 
ATOM   2953 C  CA    . GLU B 2 63  ? 71.508  27.455  4.823   1.00 29.75  ? 4313 GLU B CA    1 
ATOM   2954 C  C     . GLU B 2 63  ? 70.119  27.994  5.174   1.00 29.37  ? 4313 GLU B C     1 
ATOM   2955 O  O     . GLU B 2 63  ? 69.367  28.326  4.243   1.00 30.66  ? 4313 GLU B O     1 
ATOM   2956 C  CB    . GLU B 2 63  ? 71.479  26.599  3.558   1.00 31.59  ? 4313 GLU B CB    1 
ATOM   2957 C  CG    . GLU B 2 63  ? 72.851  26.365  2.960   1.00 32.56  ? 4313 GLU B CG    1 
ATOM   2958 C  CD    . GLU B 2 63  ? 73.527  27.585  2.361   1.00 34.42  ? 4313 GLU B CD    1 
ATOM   2959 O  OE1   . GLU B 2 63  ? 72.894  28.662  2.311   1.00 35.65  ? 4313 GLU B OE1   1 
ATOM   2960 O  OE2   . GLU B 2 63  ? 74.686  27.449  1.926   1.00 36.56  ? 4313 GLU B OE2   1 
ATOM   2961 N  N     . ALA B 2 64  ? 69.813  28.121  6.466   1.00 27.92  ? 4314 ALA B N     1 
ATOM   2962 C  CA    . ALA B 2 64  ? 68.497  28.657  6.880   1.00 27.86  ? 4314 ALA B CA    1 
ATOM   2963 C  C     . ALA B 2 64  ? 68.256  30.028  6.240   1.00 29.75  ? 4314 ALA B C     1 
ATOM   2964 O  O     . ALA B 2 64  ? 69.213  30.843  6.167   1.00 28.80  ? 4314 ALA B O     1 
ATOM   2965 C  CB    . ALA B 2 64  ? 68.424  28.767  8.383   1.00 26.94  ? 4314 ALA B CB    1 
ATOM   2966 N  N     . ASN B 2 65  ? 67.029  30.244  5.763   1.00 30.79  ? 4315 ASN B N     1 
ATOM   2967 C  CA    . ASN B 2 65  ? 66.613  31.573  5.257   1.00 32.88  ? 4315 ASN B CA    1 
ATOM   2968 C  C     . ASN B 2 65  ? 65.938  32.272  6.444   1.00 33.29  ? 4315 ASN B C     1 
ATOM   2969 O  O     . ASN B 2 65  ? 66.018  31.730  7.568   1.00 31.34  ? 4315 ASN B O     1 
ATOM   2970 C  CB    . ASN B 2 65  ? 65.755  31.475  3.990   1.00 35.28  ? 4315 ASN B CB    1 
ATOM   2971 C  CG    . ASN B 2 65  ? 64.453  30.728  4.190   1.00 35.72  ? 4315 ASN B CG    1 
ATOM   2972 O  OD1   . ASN B 2 65  ? 63.953  30.624  5.307   1.00 34.80  ? 4315 ASN B OD1   1 
ATOM   2973 N  ND2   . ASN B 2 65  ? 63.887  30.227  3.104   1.00 37.25  ? 4315 ASN B ND2   1 
ATOM   2974 N  N     . MET B 2 66  ? 65.286  33.408  6.210   1.00 34.84  ? 4316 MET B N     1 
ATOM   2975 C  CA    . MET B 2 66  ? 64.662  34.174  7.322   1.00 36.69  ? 4316 MET B CA    1 
ATOM   2976 C  C     . MET B 2 66  ? 63.483  33.409  7.937   1.00 36.06  ? 4316 MET B C     1 
ATOM   2977 O  O     . MET B 2 66  ? 63.081  33.772  9.060   1.00 36.08  ? 4316 MET B O     1 
ATOM   2978 C  CB    . MET B 2 66  ? 64.170  35.529  6.809   1.00 40.27  ? 4316 MET B CB    1 
ATOM   2979 C  CG    . MET B 2 66  ? 63.190  35.412  5.662   1.00 44.69  ? 4316 MET B CG    1 
ATOM   2980 S  SD    . MET B 2 66  ? 62.866  37.021  4.913   1.00 50.90  ? 4316 MET B SD    1 
ATOM   2981 C  CE    . MET B 2 66  ? 61.631  36.596  3.686   1.00 51.89  ? 4316 MET B CE    1 
ATOM   2982 N  N     . ASP B 2 67  ? 62.980  32.378  7.248   1.00 36.31  ? 4317 ASP B N     1 
ATOM   2983 C  CA    . ASP B 2 67  ? 61.784  31.615  7.697   1.00 37.12  ? 4317 ASP B CA    1 
ATOM   2984 C  C     . ASP B 2 67  ? 62.184  30.246  8.251   1.00 34.58  ? 4317 ASP B C     1 
ATOM   2985 O  O     . ASP B 2 67  ? 61.272  29.418  8.466   1.00 34.55  ? 4317 ASP B O     1 
ATOM   2986 C  CB    . ASP B 2 67  ? 60.826  31.378  6.527   1.00 40.77  ? 4317 ASP B CB    1 
ATOM   2987 C  CG    . ASP B 2 67  ? 60.387  32.645  5.818   1.00 44.31  ? 4317 ASP B CG    1 
ATOM   2988 O  OD1   . ASP B 2 67  ? 60.230  33.675  6.505   1.00 46.04  ? 4317 ASP B OD1   1 
ATOM   2989 O  OD2   . ASP B 2 67  ? 60.225  32.594  4.579   1.00 46.72  ? 4317 ASP B OD2   1 
ATOM   2990 N  N     . GLN B 2 68  ? 63.479  30.026  8.494   1.00 31.14  ? 4318 GLN B N     1 
ATOM   2991 C  CA    . GLN B 2 68  ? 63.937  28.683  8.931   1.00 29.67  ? 4318 GLN B CA    1 
ATOM   2992 C  C     . GLN B 2 68  ? 64.982  28.762  10.042  1.00 27.82  ? 4318 GLN B C     1 
ATOM   2993 O  O     . GLN B 2 68  ? 65.550  29.846  10.277  1.00 26.67  ? 4318 GLN B O     1 
ATOM   2994 C  CB    . GLN B 2 68  ? 64.621  27.965  7.768   1.00 29.59  ? 4318 GLN B CB    1 
ATOM   2995 C  CG    . GLN B 2 68  ? 63.734  27.701  6.560   1.00 31.12  ? 4318 GLN B CG    1 
ATOM   2996 C  CD    . GLN B 2 68  ? 64.555  27.263  5.370   1.00 31.79  ? 4318 GLN B CD    1 
ATOM   2997 O  OE1   . GLN B 2 68  ? 65.717  27.633  5.225   1.00 30.52  ? 4318 GLN B OE1   1 
ATOM   2998 N  NE2   . GLN B 2 68  ? 63.948  26.483  4.490   1.00 33.16  ? 4318 GLN B NE2   1 
ATOM   2999 N  N     . GLU B 2 69  ? 65.199  27.616  10.685  1.00 26.65  ? 4319 GLU B N     1 
ATOM   3000 C  CA    . GLU B 2 69  ? 66.282  27.376  11.666  1.00 25.77  ? 4319 GLU B CA    1 
ATOM   3001 C  C     . GLU B 2 69  ? 67.147  26.263  11.066  1.00 25.81  ? 4319 GLU B C     1 
ATOM   3002 O  O     . GLU B 2 69  ? 66.575  25.403  10.353  1.00 27.30  ? 4319 GLU B O     1 
ATOM   3003 C  CB    . GLU B 2 69  ? 65.706  26.956  13.017  1.00 25.94  ? 4319 GLU B CB    1 
ATOM   3004 C  CG    . GLU B 2 69  ? 64.864  28.017  13.703  1.00 27.28  ? 4319 GLU B CG    1 
ATOM   3005 C  CD    . GLU B 2 69  ? 65.638  29.069  14.479  1.00 28.27  ? 4319 GLU B CD    1 
ATOM   3006 O  OE1   . GLU B 2 69  ? 65.081  29.582  15.465  1.00 29.13  ? 4319 GLU B OE1   1 
ATOM   3007 O  OE2   . GLU B 2 69  ? 66.802  29.353  14.117  1.00 28.96  ? 4319 GLU B OE2   1 
ATOM   3008 N  N     . SER B 2 70  ? 68.462  26.315  11.284  1.00 24.55  ? 4320 SER B N     1 
ATOM   3009 C  CA    . SER B 2 70  ? 69.394  25.260  10.814  1.00 24.13  ? 4320 SER B CA    1 
ATOM   3010 C  C     . SER B 2 70  ? 69.787  24.405  12.017  1.00 23.57  ? 4320 SER B C     1 
ATOM   3011 O  O     . SER B 2 70  ? 70.070  24.984  13.080  1.00 22.77  ? 4320 SER B O     1 
ATOM   3012 C  CB    . SER B 2 70  ? 70.623  25.827  10.143  1.00 24.58  ? 4320 SER B CB    1 
ATOM   3013 O  OG    . SER B 2 70  ? 70.312  26.398  8.884   1.00 25.59  ? 4320 SER B OG    1 
ATOM   3014 N  N     . PHE B 2 71  ? 69.803  23.085  11.837  1.00 23.27  ? 4321 PHE B N     1 
ATOM   3015 C  CA    . PHE B 2 71  ? 70.171  22.148  12.924  1.00 22.07  ? 4321 PHE B CA    1 
ATOM   3016 C  C     . PHE B 2 71  ? 71.241  21.166  12.450  1.00 22.10  ? 4321 PHE B C     1 
ATOM   3017 O  O     . PHE B 2 71  ? 71.270  20.840  11.239  1.00 22.42  ? 4321 PHE B O     1 
ATOM   3018 C  CB    . PHE B 2 71  ? 68.962  21.310  13.360  1.00 22.31  ? 4321 PHE B CB    1 
ATOM   3019 C  CG    . PHE B 2 71  ? 67.861  22.072  14.049  1.00 22.12  ? 4321 PHE B CG    1 
ATOM   3020 C  CD1   . PHE B 2 71  ? 66.881  22.727  13.316  1.00 23.51  ? 4321 PHE B CD1   1 
ATOM   3021 C  CD2   . PHE B 2 71  ? 67.785  22.104  15.433  1.00 21.86  ? 4321 PHE B CD2   1 
ATOM   3022 C  CE1   . PHE B 2 71  ? 65.862  23.414  13.957  1.00 23.79  ? 4321 PHE B CE1   1 
ATOM   3023 C  CE2   . PHE B 2 71  ? 66.765  22.793  16.070  1.00 22.54  ? 4321 PHE B CE2   1 
ATOM   3024 C  CZ    . PHE B 2 71  ? 65.804  23.441  15.330  1.00 23.23  ? 4321 PHE B CZ    1 
ATOM   3025 N  N     . GLY B 2 72  ? 72.106  20.738  13.375  1.00 21.01  ? 4322 GLY B N     1 
ATOM   3026 C  CA    . GLY B 2 72  ? 73.047  19.643  13.072  1.00 21.28  ? 4322 GLY B CA    1 
ATOM   3027 C  C     . GLY B 2 72  ? 72.231  18.429  12.650  1.00 22.27  ? 4322 GLY B C     1 
ATOM   3028 O  O     . GLY B 2 72  ? 71.281  18.081  13.380  1.00 23.11  ? 4322 GLY B O     1 
ATOM   3029 N  N     . GLY B 2 73  ? 72.561  17.832  11.505  1.00 23.44  ? 4323 GLY B N     1 
ATOM   3030 C  CA    . GLY B 2 73  ? 71.776  16.730  10.913  1.00 24.27  ? 4323 GLY B CA    1 
ATOM   3031 C  C     . GLY B 2 73  ? 71.612  15.514  11.813  1.00 24.69  ? 4323 GLY B C     1 
ATOM   3032 O  O     . GLY B 2 73  ? 70.460  15.056  11.987  1.00 25.88  ? 4323 GLY B O     1 
ATOM   3033 N  N     . ALA B 2 74  ? 72.710  14.981  12.347  1.00 24.34  ? 4324 ALA B N     1 
ATOM   3034 C  CA    . ALA B 2 74  ? 72.624  13.746  13.165  1.00 24.98  ? 4324 ALA B CA    1 
ATOM   3035 C  C     . ALA B 2 74  ? 71.617  13.914  14.311  1.00 24.68  ? 4324 ALA B C     1 
ATOM   3036 O  O     . ALA B 2 74  ? 70.866  12.948  14.589  1.00 24.26  ? 4324 ALA B O     1 
ATOM   3037 C  CB    . ALA B 2 74  ? 73.995  13.382  13.678  1.00 25.14  ? 4324 ALA B CB    1 
ATOM   3038 N  N     . SER B 2 75  ? 71.569  15.100  14.931  1.00 23.29  ? 4325 SER B N     1 
ATOM   3039 C  CA    . SER B 2 75  ? 70.675  15.324  16.102  1.00 23.09  ? 4325 SER B CA    1 
ATOM   3040 C  C     . SER B 2 75  ? 69.195  15.365  15.686  1.00 24.06  ? 4325 SER B C     1 
ATOM   3041 O  O     . SER B 2 75  ? 68.341  15.288  16.590  1.00 23.82  ? 4325 SER B O     1 
ATOM   3042 C  CB    . SER B 2 75  ? 71.056  16.580  16.855  1.00 23.03  ? 4325 SER B CB    1 
ATOM   3043 O  OG    . SER B 2 75  ? 70.779  17.740  16.082  1.00 23.21  ? 4325 SER B OG    1 
ATOM   3044 N  N     . CYS B 2 76  ? 68.907  15.471  14.384  1.00 24.58  ? 4326 CYS B N     1 
ATOM   3045 C  CA    . CYS B 2 76  ? 67.504  15.552  13.887  1.00 26.28  ? 4326 CYS B CA    1 
ATOM   3046 C  C     . CYS B 2 76  ? 67.088  14.240  13.219  1.00 27.14  ? 4326 CYS B C     1 
ATOM   3047 O  O     . CYS B 2 76  ? 65.988  14.189  12.650  1.00 28.18  ? 4326 CYS B O     1 
ATOM   3048 C  CB    . CYS B 2 76  ? 67.351  16.676  12.873  1.00 27.83  ? 4326 CYS B CB    1 
ATOM   3049 S  SG    . CYS B 2 76  ? 67.700  18.300  13.586  1.00 29.08  ? 4326 CYS B SG    1 
ATOM   3050 N  N     . CYS B 2 77  ? 67.951  13.232  13.280  1.00 27.06  ? 4327 CYS B N     1 
ATOM   3051 C  CA    . CYS B 2 77  ? 67.650  11.938  12.621  1.00 28.27  ? 4327 CYS B CA    1 
ATOM   3052 C  C     . CYS B 2 77  ? 67.068  10.952  13.637  1.00 27.96  ? 4327 CYS B C     1 
ATOM   3053 O  O     . CYS B 2 77  ? 67.768  10.623  14.607  1.00 26.13  ? 4327 CYS B O     1 
ATOM   3054 C  CB    . CYS B 2 77  ? 68.911  11.375  11.992  1.00 28.76  ? 4327 CYS B CB    1 
ATOM   3055 S  SG    . CYS B 2 77  ? 68.664  9.731   11.283  1.00 30.70  ? 4327 CYS B SG    1 
ATOM   3056 N  N     . LEU B 2 78  ? 65.842  10.480  13.395  1.00 29.64  ? 4328 LEU B N     1 
ATOM   3057 C  CA    . LEU B 2 78  ? 65.194  9.517   14.327  1.00 30.22  ? 4328 LEU B CA    1 
ATOM   3058 C  C     . LEU B 2 78  ? 66.096  8.297   14.545  1.00 29.68  ? 4328 LEU B C     1 
ATOM   3059 O  O     . LEU B 2 78  ? 66.222  7.855   15.699  1.00 28.91  ? 4328 LEU B O     1 
ATOM   3060 C  CB    . LEU B 2 78  ? 63.848  9.070   13.750  1.00 32.39  ? 4328 LEU B CB    1 
ATOM   3061 C  CG    . LEU B 2 78  ? 63.064  8.094   14.628  1.00 34.41  ? 4328 LEU B CG    1 
ATOM   3062 C  CD1   . LEU B 2 78  ? 62.529  8.793   15.864  1.00 34.34  ? 4328 LEU B CD1   1 
ATOM   3063 C  CD2   . LEU B 2 78  ? 61.929  7.441   13.857  1.00 36.54  ? 4328 LEU B CD2   1 
ATOM   3064 N  N     . TYR B 2 79  ? 66.679  7.775   13.465  1.00 30.86  ? 4329 TYR B N     1 
ATOM   3065 C  CA    . TYR B 2 79  ? 67.491  6.531   13.517  1.00 31.92  ? 4329 TYR B CA    1 
ATOM   3066 C  C     . TYR B 2 79  ? 68.780  6.785   14.302  1.00 30.90  ? 4329 TYR B C     1 
ATOM   3067 O  O     . TYR B 2 79  ? 69.113  5.958   15.169  1.00 31.90  ? 4329 TYR B O     1 
ATOM   3068 C  CB    . TYR B 2 79  ? 67.668  6.009   12.091  1.00 33.84  ? 4329 TYR B CB    1 
ATOM   3069 C  CG    . TYR B 2 79  ? 66.342  5.925   11.381  1.00 35.50  ? 4329 TYR B CG    1 
ATOM   3070 C  CD1   . TYR B 2 79  ? 65.449  4.903   11.661  1.00 37.87  ? 4329 TYR B CD1   1 
ATOM   3071 C  CD2   . TYR B 2 79  ? 65.939  6.914   10.498  1.00 35.89  ? 4329 TYR B CD2   1 
ATOM   3072 C  CE1   . TYR B 2 79  ? 64.210  4.838   11.044  1.00 39.92  ? 4329 TYR B CE1   1 
ATOM   3073 C  CE2   . TYR B 2 79  ? 64.705  6.862   9.870   1.00 38.11  ? 4329 TYR B CE2   1 
ATOM   3074 C  CZ    . TYR B 2 79  ? 63.835  5.824   10.149  1.00 39.81  ? 4329 TYR B CZ    1 
ATOM   3075 O  OH    . TYR B 2 79  ? 62.616  5.765   9.542   1.00 42.19  ? 4329 TYR B OH    1 
ATOM   3076 N  N     . CYS B 2 80  ? 69.473  7.887   14.012  1.00 30.05  ? 4330 CYS B N     1 
ATOM   3077 C  CA    . CYS B 2 80  ? 70.686  8.235   14.796  1.00 29.52  ? 4330 CYS B CA    1 
ATOM   3078 C  C     . CYS B 2 80  ? 70.315  8.394   16.278  1.00 28.65  ? 4330 CYS B C     1 
ATOM   3079 O  O     . CYS B 2 80  ? 70.969  7.757   17.124  1.00 29.44  ? 4330 CYS B O     1 
ATOM   3080 C  CB    . CYS B 2 80  ? 71.319  9.533   14.306  1.00 29.22  ? 4330 CYS B CB    1 
ATOM   3081 S  SG    . CYS B 2 80  ? 72.247  9.393   12.755  1.00 30.23  ? 4330 CYS B SG    1 
ATOM   3082 N  N     . ARG B 2 81  ? 69.268  9.175   16.564  1.00 28.22  ? 4331 ARG B N     1 
ATOM   3083 C  CA    . ARG B 2 81  ? 68.870  9.524   17.957  1.00 27.73  ? 4331 ARG B CA    1 
ATOM   3084 C  C     . ARG B 2 81  ? 68.377  8.302   18.740  1.00 29.91  ? 4331 ARG B C     1 
ATOM   3085 O  O     . ARG B 2 81  ? 68.672  8.238   19.949  1.00 29.37  ? 4331 ARG B O     1 
ATOM   3086 C  CB    . ARG B 2 81  ? 67.797  10.620  17.948  1.00 27.13  ? 4331 ARG B CB    1 
ATOM   3087 C  CG    . ARG B 2 81  ? 68.302  11.987  17.507  1.00 25.58  ? 4331 ARG B CG    1 
ATOM   3088 C  CD    . ARG B 2 81  ? 69.375  12.552  18.416  1.00 24.48  ? 4331 ARG B CD    1 
ATOM   3089 N  NE    . ARG B 2 81  ? 68.934  12.704  19.796  1.00 24.65  ? 4331 ARG B NE    1 
ATOM   3090 C  CZ    . ARG B 2 81  ? 68.253  13.743  20.270  1.00 24.65  ? 4331 ARG B CZ    1 
ATOM   3091 N  NH1   . ARG B 2 81  ? 67.914  14.746  19.474  1.00 24.72  ? 4331 ARG B NH1   1 
ATOM   3092 N  NH2   . ARG B 2 81  ? 67.912  13.776  21.545  1.00 24.75  ? 4331 ARG B NH2   1 
ATOM   3093 N  N     . CYS B 2 82  ? 67.663  7.378   18.090  1.00 31.88  ? 4332 CYS B N     1 
ATOM   3094 C  CA    . CYS B 2 82  ? 67.101  6.201   18.810  1.00 34.71  ? 4332 CYS B CA    1 
ATOM   3095 C  C     . CYS B 2 82  ? 68.077  5.016   18.778  1.00 35.42  ? 4332 CYS B C     1 
ATOM   3096 O  O     . CYS B 2 82  ? 67.746  3.976   19.372  1.00 35.69  ? 4332 CYS B O     1 
ATOM   3097 C  CB    . CYS B 2 82  ? 65.750  5.807   18.225  1.00 37.17  ? 4332 CYS B CB    1 
ATOM   3098 S  SG    . CYS B 2 82  ? 64.485  7.080   18.467  1.00 40.03  ? 4332 CYS B SG    1 
ATOM   3099 N  N     . HIS B 2 83  ? 69.237  5.185   18.136  1.00 35.55  ? 4333 HIS B N     1 
ATOM   3100 C  CA    . HIS B 2 83  ? 70.264  4.112   18.028  1.00 38.10  ? 4333 HIS B CA    1 
ATOM   3101 C  C     . HIS B 2 83  ? 69.635  2.879   17.368  1.00 39.91  ? 4333 HIS B C     1 
ATOM   3102 O  O     . HIS B 2 83  ? 69.655  1.783   17.975  1.00 41.60  ? 4333 HIS B O     1 
ATOM   3103 C  CB    . HIS B 2 83  ? 70.888  3.794   19.396  1.00 40.73  ? 4333 HIS B CB    1 
ATOM   3104 C  CG    . HIS B 2 83  ? 71.289  5.005   20.166  1.00 41.66  ? 4333 HIS B CG    1 
ATOM   3105 N  ND1   . HIS B 2 83  ? 70.854  5.233   21.458  1.00 44.97  ? 4333 HIS B ND1   1 
ATOM   3106 C  CD2   . HIS B 2 83  ? 72.016  6.088   19.813  1.00 42.54  ? 4333 HIS B CD2   1 
ATOM   3107 C  CE1   . HIS B 2 83  ? 71.334  6.389   21.881  1.00 44.76  ? 4333 HIS B CE1   1 
ATOM   3108 N  NE2   . HIS B 2 83  ? 72.044  6.935   20.888  1.00 41.83  ? 4333 HIS B NE2   1 
ATOM   3109 N  N     . ILE B 2 84  ? 69.083  3.066   16.170  1.00 39.06  ? 4334 ILE B N     1 
ATOM   3110 C  CA    . ILE B 2 84  ? 68.444  1.965   15.395  1.00 41.38  ? 4334 ILE B CA    1 
ATOM   3111 C  C     . ILE B 2 84  ? 68.960  2.046   13.957  1.00 40.86  ? 4334 ILE B C     1 
ATOM   3112 O  O     . ILE B 2 84  ? 69.482  3.114   13.570  1.00 40.03  ? 4334 ILE B O     1 
ATOM   3113 C  CB    . ILE B 2 84  ? 66.905  2.022   15.486  1.00 43.11  ? 4334 ILE B CB    1 
ATOM   3114 C  CG1   . ILE B 2 84  ? 66.337  3.313   14.900  1.00 42.47  ? 4334 ILE B CG1   1 
ATOM   3115 C  CG2   . ILE B 2 84  ? 66.443  1.813   16.921  1.00 44.13  ? 4334 ILE B CG2   1 
ATOM   3116 C  CD1   . ILE B 2 84  ? 64.833  3.361   14.889  1.00 44.31  ? 4334 ILE B CD1   1 
ATOM   3117 N  N     . ASP B 2 85  ? 68.834  0.949   13.209  1.00 41.03  ? 4335 ASP B N     1 
ATOM   3118 C  CA    . ASP B 2 85  ? 69.349  0.888   11.816  1.00 42.16  ? 4335 ASP B CA    1 
ATOM   3119 C  C     . ASP B 2 85  ? 68.592  1.888   10.937  1.00 41.39  ? 4335 ASP B C     1 
ATOM   3120 O  O     . ASP B 2 85  ? 67.397  2.128   11.193  1.00 40.67  ? 4335 ASP B O     1 
ATOM   3121 C  CB    . ASP B 2 85  ? 69.235  -0.529  11.242  1.00 44.90  ? 4335 ASP B CB    1 
ATOM   3122 C  CG    . ASP B 2 85  ? 70.086  -1.568  11.957  1.00 46.37  ? 4335 ASP B CG    1 
ATOM   3123 O  OD1   . ASP B 2 85  ? 70.968  -1.169  12.741  1.00 46.50  ? 4335 ASP B OD1   1 
ATOM   3124 O  OD2   . ASP B 2 85  ? 69.859  -2.769  11.723  1.00 50.19  ? 4335 ASP B OD2   1 
ATOM   3125 N  N     . HIS B 2 86  ? 69.286  2.461   9.953   1.00 41.18  ? 4336 HIS B N     1 
ATOM   3126 C  CA    . HIS B 2 86  ? 68.654  3.391   8.982   1.00 41.98  ? 4336 HIS B CA    1 
ATOM   3127 C  C     . HIS B 2 86  ? 67.855  2.539   8.000   1.00 46.94  ? 4336 HIS B C     1 
ATOM   3128 O  O     . HIS B 2 86  ? 68.343  1.506   7.549   1.00 48.04  ? 4336 HIS B O     1 
ATOM   3129 C  CB    . HIS B 2 86  ? 69.716  4.294   8.344   1.00 39.77  ? 4336 HIS B CB    1 
ATOM   3130 C  CG    . HIS B 2 86  ? 70.235  5.330   9.285   1.00 36.41  ? 4336 HIS B CG    1 
ATOM   3131 N  ND1   . HIS B 2 86  ? 71.099  5.026   10.322  1.00 35.33  ? 4336 HIS B ND1   1 
ATOM   3132 C  CD2   . HIS B 2 86  ? 70.011  6.659   9.355   1.00 34.92  ? 4336 HIS B CD2   1 
ATOM   3133 C  CE1   . HIS B 2 86  ? 71.381  6.131   10.992  1.00 33.32  ? 4336 HIS B CE1   1 
ATOM   3134 N  NE2   . HIS B 2 86  ? 70.728  7.146   10.414  1.00 32.28  ? 4336 HIS B NE2   1 
ATOM   3135 N  N     . PRO B 2 87  ? 66.612  2.940   7.646   1.00 51.81  ? 4337 PRO B N     1 
ATOM   3136 C  CA    . PRO B 2 87  ? 65.744  2.124   6.795   1.00 58.88  ? 4337 PRO B CA    1 
ATOM   3137 C  C     . PRO B 2 87  ? 66.115  2.140   5.305   1.00 65.45  ? 4337 PRO B C     1 
ATOM   3138 O  O     . PRO B 2 87  ? 65.444  2.809   4.538   1.00 70.35  ? 4337 PRO B O     1 
ATOM   3139 C  CB    . PRO B 2 87  ? 64.372  2.773   7.031   1.00 58.22  ? 4337 PRO B CB    1 
ATOM   3140 C  CG    . PRO B 2 87  ? 64.704  4.234   7.210   1.00 54.78  ? 4337 PRO B CG    1 
ATOM   3141 C  CD    . PRO B 2 87  ? 65.993  4.225   8.006   1.00 52.18  ? 4337 PRO B CD    1 
ATOM   3142 N  N     . ASN B 2 88  ? 67.157  1.388   4.939   1.00 70.40  ? 4338 ASN B N     1 
ATOM   3143 C  CA    . ASN B 2 88  ? 67.638  1.271   3.536   1.00 75.24  ? 4338 ASN B CA    1 
ATOM   3144 C  C     . ASN B 2 88  ? 68.848  0.342   3.512   1.00 77.99  ? 4338 ASN B C     1 
ATOM   3145 O  O     . ASN B 2 88  ? 69.531  0.195   4.524   1.00 76.96  ? 4338 ASN B O     1 
ATOM   3146 C  CB    . ASN B 2 88  ? 67.982  2.637   2.928   1.00 74.88  ? 4338 ASN B CB    1 
ATOM   3147 C  CG    . ASN B 2 88  ? 69.192  3.287   3.564   1.00 72.74  ? 4338 ASN B CG    1 
ATOM   3148 O  OD1   . ASN B 2 88  ? 70.253  2.675   3.661   1.00 73.83  ? 4338 ASN B OD1   1 
ATOM   3149 N  ND2   . ASN B 2 88  ? 69.055  4.542   3.961   1.00 71.72  ? 4338 ASN B ND2   1 
ATOM   3150 N  N     . PRO B 2 89  ? 69.140  -0.331  2.373   1.00 81.82  ? 4339 PRO B N     1 
ATOM   3151 C  CA    . PRO B 2 89  ? 70.318  -1.192  2.274   1.00 82.79  ? 4339 PRO B CA    1 
ATOM   3152 C  C     . PRO B 2 89  ? 71.597  -0.363  2.485   1.00 81.29  ? 4339 PRO B C     1 
ATOM   3153 O  O     . PRO B 2 89  ? 71.661  0.747   1.982   1.00 81.04  ? 4339 PRO B O     1 
ATOM   3154 C  CB    . PRO B 2 89  ? 70.240  -1.786  0.857   1.00 86.68  ? 4339 PRO B CB    1 
ATOM   3155 C  CG    . PRO B 2 89  ? 68.789  -1.597  0.443   1.00 87.76  ? 4339 PRO B CG    1 
ATOM   3156 C  CD    . PRO B 2 89  ? 68.342  -0.327  1.138   1.00 84.75  ? 4339 PRO B CD    1 
ATOM   3157 N  N     . LYS B 2 90  ? 72.555  -0.916  3.239   1.00 80.02  ? 4340 LYS B N     1 
ATOM   3158 C  CA    . LYS B 2 90  ? 73.851  -0.265  3.597   1.00 77.40  ? 4340 LYS B CA    1 
ATOM   3159 C  C     . LYS B 2 90  ? 73.648  0.639   4.822   1.00 71.02  ? 4340 LYS B C     1 
ATOM   3160 O  O     . LYS B 2 90  ? 74.663  1.032   5.428   1.00 69.27  ? 4340 LYS B O     1 
ATOM   3161 C  CB    . LYS B 2 90  ? 74.469  0.518   2.432   1.00 79.85  ? 4340 LYS B CB    1 
ATOM   3162 C  CG    . LYS B 2 90  ? 74.850  -0.319  1.216   1.00 85.70  ? 4340 LYS B CG    1 
ATOM   3163 C  CD    . LYS B 2 90  ? 75.779  0.385   0.243   1.00 87.71  ? 4340 LYS B CD    1 
ATOM   3164 C  CE    . LYS B 2 90  ? 77.151  0.662   0.827   1.00 88.17  ? 4340 LYS B CE    1 
ATOM   3165 N  NZ    . LYS B 2 90  ? 78.060  1.283   -0.166  1.00 90.38  ? 4340 LYS B NZ    1 
ATOM   3166 N  N     . GLY B 2 91  ? 72.391  0.950   5.163   1.00 67.07  ? 4341 GLY B N     1 
ATOM   3167 C  CA    . GLY B 2 91  ? 72.072  1.775   6.346   1.00 63.98  ? 4341 GLY B CA    1 
ATOM   3168 C  C     . GLY B 2 91  ? 72.723  3.147   6.292   1.00 60.14  ? 4341 GLY B C     1 
ATOM   3169 O  O     . GLY B 2 91  ? 73.263  3.583   7.330   1.00 59.97  ? 4341 GLY B O     1 
ATOM   3170 N  N     . PHE B 2 92  ? 72.665  3.808   5.132   1.00 58.54  ? 4342 PHE B N     1 
ATOM   3171 C  CA    . PHE B 2 92  ? 73.261  5.160   4.961   1.00 56.73  ? 4342 PHE B CA    1 
ATOM   3172 C  C     . PHE B 2 92  ? 72.339  6.210   5.594   1.00 50.63  ? 4342 PHE B C     1 
ATOM   3173 O  O     . PHE B 2 92  ? 71.105  6.013   5.617   1.00 50.61  ? 4342 PHE B O     1 
ATOM   3174 C  CB    . PHE B 2 92  ? 73.518  5.443   3.478   1.00 61.18  ? 4342 PHE B CB    1 
ATOM   3175 C  CG    . PHE B 2 92  ? 73.978  6.846   3.165   1.00 63.27  ? 4342 PHE B CG    1 
ATOM   3176 C  CD1   . PHE B 2 92  ? 75.310  7.208   3.308   1.00 64.80  ? 4342 PHE B CD1   1 
ATOM   3177 C  CD2   . PHE B 2 92  ? 73.081  7.803   2.712   1.00 65.21  ? 4342 PHE B CD2   1 
ATOM   3178 C  CE1   . PHE B 2 92  ? 75.730  8.499   3.020   1.00 64.37  ? 4342 PHE B CE1   1 
ATOM   3179 C  CE2   . PHE B 2 92  ? 73.504  9.091   2.421   1.00 64.77  ? 4342 PHE B CE2   1 
ATOM   3180 C  CZ    . PHE B 2 92  ? 74.826  9.437   2.575   1.00 64.39  ? 4342 PHE B CZ    1 
ATOM   3181 N  N     . CYS B 2 93  ? 72.929  7.294   6.102   1.00 45.68  ? 4343 CYS B N     1 
ATOM   3182 C  CA    . CYS B 2 93  ? 72.144  8.398   6.719   1.00 41.09  ? 4343 CYS B CA    1 
ATOM   3183 C  C     . CYS B 2 93  ? 72.275  9.649   5.847   1.00 40.04  ? 4343 CYS B C     1 
ATOM   3184 O  O     . CYS B 2 93  ? 73.416  10.025  5.532   1.00 40.35  ? 4343 CYS B O     1 
ATOM   3185 C  CB    . CYS B 2 93  ? 72.620  8.691   8.134   1.00 38.47  ? 4343 CYS B CB    1 
ATOM   3186 S  SG    . CYS B 2 93  ? 71.650  9.984   8.952   1.00 35.19  ? 4343 CYS B SG    1 
ATOM   3187 N  N     . ASP B 2 94  ? 71.146  10.267  5.489   1.00 39.91  ? 4344 ASP B N     1 
ATOM   3188 C  CA    . ASP B 2 94  ? 71.139  11.477  4.623   1.00 41.47  ? 4344 ASP B CA    1 
ATOM   3189 C  C     . ASP B 2 94  ? 71.334  12.747  5.460   1.00 36.86  ? 4344 ASP B C     1 
ATOM   3190 O  O     . ASP B 2 94  ? 71.542  13.804  4.851   1.00 37.23  ? 4344 ASP B O     1 
ATOM   3191 C  CB    . ASP B 2 94  ? 69.821  11.613  3.853   1.00 45.04  ? 4344 ASP B CB    1 
ATOM   3192 C  CG    . ASP B 2 94  ? 69.555  10.513  2.841   1.00 50.99  ? 4344 ASP B CG    1 
ATOM   3193 O  OD1   . ASP B 2 94  ? 70.449  9.666   2.637   1.00 55.31  ? 4344 ASP B OD1   1 
ATOM   3194 O  OD2   . ASP B 2 94  ? 68.451  10.513  2.264   1.00 55.67  ? 4344 ASP B OD2   1 
ATOM   3195 N  N     . LEU B 2 95  ? 71.278  12.644  6.794   1.00 35.12  ? 4345 LEU B N     1 
ATOM   3196 C  CA    . LEU B 2 95  ? 71.353  13.856  7.663   1.00 33.03  ? 4345 LEU B CA    1 
ATOM   3197 C  C     . LEU B 2 95  ? 72.710  13.987  8.371   1.00 31.38  ? 4345 LEU B C     1 
ATOM   3198 O  O     . LEU B 2 95  ? 73.210  15.122  8.475   1.00 29.61  ? 4345 LEU B O     1 
ATOM   3199 C  CB    . LEU B 2 95  ? 70.215  13.775  8.684   1.00 33.09  ? 4345 LEU B CB    1 
ATOM   3200 C  CG    . LEU B 2 95  ? 68.812  13.974  8.112   1.00 34.49  ? 4345 LEU B CG    1 
ATOM   3201 C  CD1   . LEU B 2 95  ? 67.747  13.550  9.107   1.00 35.27  ? 4345 LEU B CD1   1 
ATOM   3202 C  CD2   . LEU B 2 95  ? 68.606  15.422  7.697   1.00 34.98  ? 4345 LEU B CD2   1 
ATOM   3203 N  N     . LYS B 2 96  ? 73.257  12.878  8.863   1.00 31.39  ? 4346 LYS B N     1 
ATOM   3204 C  CA    . LYS B 2 96  ? 74.536  12.890  9.624   1.00 31.81  ? 4346 LYS B CA    1 
ATOM   3205 C  C     . LYS B 2 96  ? 75.636  13.625  8.842   1.00 30.46  ? 4346 LYS B C     1 
ATOM   3206 O  O     . LYS B 2 96  ? 75.842  13.309  7.658   1.00 30.49  ? 4346 LYS B O     1 
ATOM   3207 C  CB    . LYS B 2 96  ? 74.932  11.444  9.929   1.00 35.01  ? 4346 LYS B CB    1 
ATOM   3208 C  CG    . LYS B 2 96  ? 76.234  11.257  10.683  1.00 37.51  ? 4346 LYS B CG    1 
ATOM   3209 C  CD    . LYS B 2 96  ? 76.616  9.802   10.812  1.00 40.48  ? 4346 LYS B CD    1 
ATOM   3210 C  CE    . LYS B 2 96  ? 77.962  9.596   11.471  1.00 43.24  ? 4346 LYS B CE    1 
ATOM   3211 N  NZ    . LYS B 2 96  ? 77.928  9.966   12.904  1.00 44.49  ? 4346 LYS B NZ    1 
ATOM   3212 N  N     . GLY B 2 97  ? 76.312  14.579  9.489   1.00 28.46  ? 4347 GLY B N     1 
ATOM   3213 C  CA    . GLY B 2 97  ? 77.429  15.322  8.869   1.00 28.66  ? 4347 GLY B CA    1 
ATOM   3214 C  C     . GLY B 2 97  ? 76.953  16.480  8.012   1.00 28.34  ? 4347 GLY B C     1 
ATOM   3215 O  O     . GLY B 2 97  ? 77.810  17.172  7.424   1.00 29.26  ? 4347 GLY B O     1 
ATOM   3216 N  N     . LYS B 2 98  ? 75.636  16.686  7.957   1.00 27.95  ? 4348 LYS B N     1 
ATOM   3217 C  CA    . LYS B 2 98  ? 75.018  17.782  7.174   1.00 29.31  ? 4348 LYS B CA    1 
ATOM   3218 C  C     . LYS B 2 98  ? 74.204  18.668  8.120   1.00 27.15  ? 4348 LYS B C     1 
ATOM   3219 O  O     . LYS B 2 98  ? 74.222  18.409  9.346   1.00 26.27  ? 4348 LYS B O     1 
ATOM   3220 C  CB    . LYS B 2 98  ? 74.089  17.217  6.093   1.00 32.14  ? 4348 LYS B CB    1 
ATOM   3221 C  CG    . LYS B 2 98  ? 74.715  16.247  5.099   1.00 36.91  ? 4348 LYS B CG    1 
ATOM   3222 C  CD    . LYS B 2 98  ? 75.746  16.871  4.193   1.00 40.05  ? 4348 LYS B CD    1 
ATOM   3223 C  CE    . LYS B 2 98  ? 75.971  16.077  2.921   1.00 43.98  ? 4348 LYS B CE    1 
ATOM   3224 N  NZ    . LYS B 2 98  ? 76.388  14.682  3.198   1.00 47.48  ? 4348 LYS B NZ    1 
ATOM   3225 N  N     . TYR B 2 99  ? 73.529  19.672  7.555   1.00 26.08  ? 4349 TYR B N     1 
ATOM   3226 C  CA    . TYR B 2 99  ? 72.646  20.596  8.307   1.00 25.28  ? 4349 TYR B CA    1 
ATOM   3227 C  C     . TYR B 2 99  ? 71.257  20.523  7.687   1.00 26.17  ? 4349 TYR B C     1 
ATOM   3228 O  O     . TYR B 2 99  ? 71.142  20.474  6.442   1.00 28.56  ? 4349 TYR B O     1 
ATOM   3229 C  CB    . TYR B 2 99  ? 73.242  22.007  8.342   1.00 24.99  ? 4349 TYR B CB    1 
ATOM   3230 C  CG    . TYR B 2 99  ? 74.558  21.983  9.059   1.00 23.76  ? 4349 TYR B CG    1 
ATOM   3231 C  CD1   . TYR B 2 99  ? 75.726  21.694  8.379   1.00 23.89  ? 4349 TYR B CD1   1 
ATOM   3232 C  CD2   . TYR B 2 99  ? 74.614  22.107  10.438  1.00 22.70  ? 4349 TYR B CD2   1 
ATOM   3233 C  CE1   . TYR B 2 99  ? 76.932  21.583  9.044   1.00 23.62  ? 4349 TYR B CE1   1 
ATOM   3234 C  CE2   . TYR B 2 99  ? 75.811  21.999  11.118  1.00 22.02  ? 4349 TYR B CE2   1 
ATOM   3235 C  CZ    . TYR B 2 99  ? 76.972  21.735  10.418  1.00 22.53  ? 4349 TYR B CZ    1 
ATOM   3236 O  OH    . TYR B 2 99  ? 78.152  21.614  11.081  1.00 22.67  ? 4349 TYR B OH    1 
ATOM   3237 N  N     . VAL B 2 100 ? 70.246  20.432  8.543   1.00 26.41  ? 4350 VAL B N     1 
ATOM   3238 C  CA    . VAL B 2 100 ? 68.845  20.376  8.050   1.00 27.00  ? 4350 VAL B CA    1 
ATOM   3239 C  C     . VAL B 2 100 ? 68.171  21.712  8.374   1.00 26.84  ? 4350 VAL B C     1 
ATOM   3240 O  O     . VAL B 2 100 ? 68.302  22.203  9.518   1.00 26.34  ? 4350 VAL B O     1 
ATOM   3241 C  CB    . VAL B 2 100 ? 68.068  19.176  8.621   1.00 28.39  ? 4350 VAL B CB    1 
ATOM   3242 C  CG1   . VAL B 2 100 ? 67.967  19.209  10.138  1.00 28.72  ? 4350 VAL B CG1   1 
ATOM   3243 C  CG2   . VAL B 2 100 ? 66.685  19.073  8.000   1.00 29.80  ? 4350 VAL B CG2   1 
ATOM   3244 N  N     . GLN B 2 101 ? 67.530  22.291  7.363   1.00 27.19  ? 4351 GLN B N     1 
ATOM   3245 C  CA    . GLN B 2 101 ? 66.764  23.548  7.510   1.00 27.31  ? 4351 GLN B CA    1 
ATOM   3246 C  C     . GLN B 2 101 ? 65.328  23.173  7.878   1.00 28.67  ? 4351 GLN B C     1 
ATOM   3247 O  O     . GLN B 2 101 ? 64.722  22.342  7.170   1.00 30.17  ? 4351 GLN B O     1 
ATOM   3248 C  CB    . GLN B 2 101 ? 66.873  24.379  6.231   1.00 28.21  ? 4351 GLN B CB    1 
ATOM   3249 C  CG    . GLN B 2 101 ? 68.155  25.198  6.146   1.00 28.19  ? 4351 GLN B CG    1 
ATOM   3250 C  CD    . GLN B 2 101 ? 69.423  24.379  6.175   1.00 28.04  ? 4351 GLN B CD    1 
ATOM   3251 O  OE1   . GLN B 2 101 ? 70.291  24.578  7.028   1.00 27.24  ? 4351 GLN B OE1   1 
ATOM   3252 N  NE2   . GLN B 2 101 ? 69.535  23.437  5.252   1.00 28.33  ? 4351 GLN B NE2   1 
ATOM   3253 N  N     . ILE B 2 102 ? 64.820  23.744  8.965   1.00 28.39  ? 4352 ILE B N     1 
ATOM   3254 C  CA    . ILE B 2 102 ? 63.439  23.443  9.439   1.00 29.49  ? 4352 ILE B CA    1 
ATOM   3255 C  C     . ILE B 2 102 ? 62.666  24.752  9.478   1.00 29.89  ? 4352 ILE B C     1 
ATOM   3256 O  O     . ILE B 2 102 ? 63.163  25.742  10.014  1.00 28.66  ? 4352 ILE B O     1 
ATOM   3257 C  CB    . ILE B 2 102 ? 63.459  22.776  10.830  1.00 28.99  ? 4352 ILE B CB    1 
ATOM   3258 C  CG1   . ILE B 2 102 ? 64.375  21.547  10.889  1.00 28.63  ? 4352 ILE B CG1   1 
ATOM   3259 C  CG2   . ILE B 2 102 ? 62.042  22.450  11.281  1.00 30.29  ? 4352 ILE B CG2   1 
ATOM   3260 C  CD1   . ILE B 2 102 ? 63.921  20.378  10.041  1.00 29.51  ? 4352 ILE B CD1   1 
ATOM   3261 N  N     . PRO B 2 103 ? 61.444  24.813  8.902   1.00 31.50  ? 4353 PRO B N     1 
ATOM   3262 C  CA    . PRO B 2 103 ? 60.627  26.019  8.991   1.00 32.61  ? 4353 PRO B CA    1 
ATOM   3263 C  C     . PRO B 2 103 ? 60.509  26.410  10.470  1.00 32.38  ? 4353 PRO B C     1 
ATOM   3264 O  O     . PRO B 2 103 ? 60.297  25.533  11.290  1.00 31.96  ? 4353 PRO B O     1 
ATOM   3265 C  CB    . PRO B 2 103 ? 59.278  25.606  8.381   1.00 34.49  ? 4353 PRO B CB    1 
ATOM   3266 C  CG    . PRO B 2 103 ? 59.627  24.454  7.457   1.00 34.26  ? 4353 PRO B CG    1 
ATOM   3267 C  CD    . PRO B 2 103 ? 60.803  23.754  8.106   1.00 32.94  ? 4353 PRO B CD    1 
ATOM   3268 N  N     . THR B 2 104 ? 60.653  27.703  10.774  1.00 32.55  ? 4354 THR B N     1 
ATOM   3269 C  CA    . THR B 2 104 ? 60.615  28.170  12.186  1.00 33.50  ? 4354 THR B CA    1 
ATOM   3270 C  C     . THR B 2 104 ? 59.329  27.686  12.870  1.00 35.07  ? 4354 THR B C     1 
ATOM   3271 O  O     . THR B 2 104 ? 59.408  27.299  14.053  1.00 34.52  ? 4354 THR B O     1 
ATOM   3272 C  CB    . THR B 2 104 ? 60.788  29.692  12.253  1.00 35.07  ? 4354 THR B CB    1 
ATOM   3273 O  OG1   . THR B 2 104 ? 62.007  29.995  11.573  1.00 34.65  ? 4354 THR B OG1   1 
ATOM   3274 C  CG2   . THR B 2 104 ? 60.833  30.228  13.668  1.00 36.21  ? 4354 THR B CG2   1 
ATOM   3275 N  N     . THR B 2 105 ? 58.205  27.681  12.148  1.00 36.66  ? 4355 THR B N     1 
ATOM   3276 C  CA    . THR B 2 105 ? 56.892  27.257  12.708  1.00 39.24  ? 4355 THR B CA    1 
ATOM   3277 C  C     . THR B 2 105 ? 56.903  25.768  13.092  1.00 39.14  ? 4355 THR B C     1 
ATOM   3278 O  O     . THR B 2 105 ? 56.024  25.375  13.879  1.00 40.88  ? 4355 THR B O     1 
ATOM   3279 C  CB    . THR B 2 105 ? 55.760  27.541  11.711  1.00 41.25  ? 4355 THR B CB    1 
ATOM   3280 O  OG1   . THR B 2 105 ? 56.066  26.861  10.494  1.00 41.08  ? 4355 THR B OG1   1 
ATOM   3281 C  CG2   . THR B 2 105 ? 55.573  29.015  11.431  1.00 43.06  ? 4355 THR B CG2   1 
ATOM   3282 N  N     . CYS B 2 106 ? 57.852  24.983  12.566  1.00 37.79  ? 4356 CYS B N     1 
ATOM   3283 C  CA    . CYS B 2 106 ? 57.925  23.520  12.852  1.00 37.72  ? 4356 CYS B CA    1 
ATOM   3284 C  C     . CYS B 2 106 ? 59.210  23.165  13.613  1.00 36.32  ? 4356 CYS B C     1 
ATOM   3285 O  O     . CYS B 2 106 ? 59.437  21.961  13.835  1.00 35.64  ? 4356 CYS B O     1 
ATOM   3286 C  CB    . CYS B 2 106 ? 57.913  22.715  11.558  1.00 38.55  ? 4356 CYS B CB    1 
ATOM   3287 S  SG    . CYS B 2 106 ? 56.434  22.981  10.549  1.00 42.61  ? 4356 CYS B SG    1 
ATOM   3288 N  N     . ALA B 2 107 ? 59.994  24.172  14.014  1.00 35.17  ? 4357 ALA B N     1 
ATOM   3289 C  CA    . ALA B 2 107 ? 61.309  23.959  14.671  1.00 33.52  ? 4357 ALA B CA    1 
ATOM   3290 C  C     . ALA B 2 107 ? 61.165  23.335  16.066  1.00 33.52  ? 4357 ALA B C     1 
ATOM   3291 O  O     . ALA B 2 107 ? 62.203  22.948  16.634  1.00 31.19  ? 4357 ALA B O     1 
ATOM   3292 C  CB    . ALA B 2 107 ? 62.060  25.266  14.736  1.00 33.92  ? 4357 ALA B CB    1 
ATOM   3293 N  N     . ASN B 2 108 ? 59.943  23.224  16.596  1.00 34.81  ? 4358 ASN B N     1 
ATOM   3294 C  CA    . ASN B 2 108 ? 59.758  22.579  17.926  1.00 35.67  ? 4358 ASN B CA    1 
ATOM   3295 C  C     . ASN B 2 108 ? 59.922  21.056  17.800  1.00 34.33  ? 4358 ASN B C     1 
ATOM   3296 O  O     . ASN B 2 108 ? 60.060  20.398  18.846  1.00 33.70  ? 4358 ASN B O     1 
ATOM   3297 C  CB    . ASN B 2 108 ? 58.389  22.880  18.537  1.00 39.22  ? 4358 ASN B CB    1 
ATOM   3298 C  CG    . ASN B 2 108 ? 57.249  22.401  17.665  1.00 42.31  ? 4358 ASN B CG    1 
ATOM   3299 O  OD1   . ASN B 2 108 ? 57.235  22.653  16.461  1.00 44.52  ? 4358 ASN B OD1   1 
ATOM   3300 N  ND2   . ASN B 2 108 ? 56.283  21.724  18.266  1.00 45.22  ? 4358 ASN B ND2   1 
ATOM   3301 N  N     . ASP B 2 109 ? 59.892  20.520  16.574  1.00 32.65  ? 4359 ASP B N     1 
ATOM   3302 C  CA    . ASP B 2 109 ? 60.004  19.049  16.368  1.00 31.70  ? 4359 ASP B CA    1 
ATOM   3303 C  C     . ASP B 2 109 ? 60.746  18.774  15.063  1.00 30.17  ? 4359 ASP B C     1 
ATOM   3304 O  O     . ASP B 2 109 ? 60.143  18.349  14.079  1.00 30.35  ? 4359 ASP B O     1 
ATOM   3305 C  CB    . ASP B 2 109 ? 58.616  18.401  16.373  1.00 33.10  ? 4359 ASP B CB    1 
ATOM   3306 C  CG    . ASP B 2 109 ? 58.616  16.884  16.256  1.00 34.25  ? 4359 ASP B CG    1 
ATOM   3307 O  OD1   . ASP B 2 109 ? 59.698  16.271  16.422  1.00 33.32  ? 4359 ASP B OD1   1 
ATOM   3308 O  OD2   . ASP B 2 109 ? 57.525  16.321  16.004  1.00 35.87  ? 4359 ASP B OD2   1 
ATOM   3309 N  N     . PRO B 2 110 ? 62.071  19.034  14.998  1.00 28.12  ? 4360 PRO B N     1 
ATOM   3310 C  CA    . PRO B 2 110 ? 62.843  18.769  13.783  1.00 27.82  ? 4360 PRO B CA    1 
ATOM   3311 C  C     . PRO B 2 110 ? 62.820  17.290  13.357  1.00 28.21  ? 4360 PRO B C     1 
ATOM   3312 O  O     . PRO B 2 110 ? 62.755  17.023  12.170  1.00 29.03  ? 4360 PRO B O     1 
ATOM   3313 C  CB    . PRO B 2 110 ? 64.265  19.216  14.162  1.00 26.55  ? 4360 PRO B CB    1 
ATOM   3314 C  CG    . PRO B 2 110 ? 64.046  20.220  15.272  1.00 26.90  ? 4360 PRO B CG    1 
ATOM   3315 C  CD    . PRO B 2 110 ? 62.882  19.657  16.056  1.00 27.90  ? 4360 PRO B CD    1 
ATOM   3316 N  N     . VAL B 2 111 ? 62.863  16.364  14.319  1.00 28.47  ? 4361 VAL B N     1 
ATOM   3317 C  CA    . VAL B 2 111 ? 62.855  14.911  13.968  1.00 29.29  ? 4361 VAL B CA    1 
ATOM   3318 C  C     . VAL B 2 111 ? 61.549  14.585  13.237  1.00 31.03  ? 4361 VAL B C     1 
ATOM   3319 O  O     . VAL B 2 111 ? 61.614  13.953  12.162  1.00 32.24  ? 4361 VAL B O     1 
ATOM   3320 C  CB    . VAL B 2 111 ? 63.040  14.021  15.209  1.00 29.63  ? 4361 VAL B CB    1 
ATOM   3321 C  CG1   . VAL B 2 111 ? 62.920  12.544  14.858  1.00 30.49  ? 4361 VAL B CG1   1 
ATOM   3322 C  CG2   . VAL B 2 111 ? 64.364  14.302  15.905  1.00 28.54  ? 4361 VAL B CG2   1 
ATOM   3323 N  N     . GLY B 2 112 ? 60.415  15.010  13.800  1.00 32.09  ? 4362 GLY B N     1 
ATOM   3324 C  CA    . GLY B 2 112 ? 59.097  14.751  13.190  1.00 34.15  ? 4362 GLY B CA    1 
ATOM   3325 C  C     . GLY B 2 112 ? 58.987  15.406  11.825  1.00 34.87  ? 4362 GLY B C     1 
ATOM   3326 O  O     . GLY B 2 112 ? 58.426  14.778  10.906  1.00 36.62  ? 4362 GLY B O     1 
ATOM   3327 N  N     . PHE B 2 113 ? 59.525  16.619  11.688  1.00 33.77  ? 4363 PHE B N     1 
ATOM   3328 C  CA    . PHE B 2 113 ? 59.452  17.323  10.384  1.00 34.68  ? 4363 PHE B CA    1 
ATOM   3329 C  C     . PHE B 2 113 ? 60.221  16.539  9.311   1.00 35.72  ? 4363 PHE B C     1 
ATOM   3330 O  O     . PHE B 2 113 ? 59.667  16.362  8.214   1.00 37.85  ? 4363 PHE B O     1 
ATOM   3331 C  CB    . PHE B 2 113 ? 59.989  18.753  10.486  1.00 32.86  ? 4363 PHE B CB    1 
ATOM   3332 C  CG    . PHE B 2 113 ? 59.814  19.532  9.210   1.00 33.37  ? 4363 PHE B CG    1 
ATOM   3333 C  CD1   . PHE B 2 113 ? 58.648  20.243  8.974   1.00 34.66  ? 4363 PHE B CD1   1 
ATOM   3334 C  CD2   . PHE B 2 113 ? 60.786  19.507  8.221   1.00 33.07  ? 4363 PHE B CD2   1 
ATOM   3335 C  CE1   . PHE B 2 113 ? 58.472  20.940  7.789   1.00 35.33  ? 4363 PHE B CE1   1 
ATOM   3336 C  CE2   . PHE B 2 113 ? 60.604  20.204  7.035   1.00 34.15  ? 4363 PHE B CE2   1 
ATOM   3337 C  CZ    . PHE B 2 113 ? 59.450  20.918  6.822   1.00 34.70  ? 4363 PHE B CZ    1 
ATOM   3338 N  N     . THR B 2 114 ? 61.444  16.087  9.615   1.00 35.89  ? 4364 THR B N     1 
ATOM   3339 C  CA    . THR B 2 114 ? 62.271  15.357  8.611   1.00 38.19  ? 4364 THR B CA    1 
ATOM   3340 C  C     . THR B 2 114 ? 61.606  14.029  8.226   1.00 40.90  ? 4364 THR B C     1 
ATOM   3341 O  O     . THR B 2 114 ? 61.710  13.632  7.048   1.00 43.24  ? 4364 THR B O     1 
ATOM   3342 C  CB    . THR B 2 114 ? 63.707  15.140  9.110   1.00 37.92  ? 4364 THR B CB    1 
ATOM   3343 O  OG1   . THR B 2 114 ? 63.687  14.318  10.278  1.00 40.28  ? 4364 THR B OG1   1 
ATOM   3344 C  CG2   . THR B 2 114 ? 64.413  16.441  9.417   1.00 36.18  ? 4364 THR B CG2   1 
ATOM   3345 N  N     A LEU B 2 115 ? 60.947  13.360  9.181   0.60 41.24  ? 4365 LEU B N     1 
ATOM   3346 N  N     B LEU B 2 115 ? 60.919  13.409  9.187   0.40 41.88  ? 4365 LEU B N     1 
ATOM   3347 C  CA    A LEU B 2 115 ? 60.255  12.066  8.913   0.60 43.84  ? 4365 LEU B CA    1 
ATOM   3348 C  CA    B LEU B 2 115 ? 60.256  12.091  9.007   0.40 44.62  ? 4365 LEU B CA    1 
ATOM   3349 C  C     A LEU B 2 115 ? 59.004  12.281  8.055   0.60 46.18  ? 4365 LEU B C     1 
ATOM   3350 C  C     B LEU B 2 115 ? 58.973  12.229  8.172   0.40 46.60  ? 4365 LEU B C     1 
ATOM   3351 O  O     A LEU B 2 115 ? 58.777  11.468  7.136   0.60 48.90  ? 4365 LEU B O     1 
ATOM   3352 O  O     B LEU B 2 115 ? 58.694  11.311  7.374   0.40 48.93  ? 4365 LEU B O     1 
ATOM   3353 C  CB    A LEU B 2 115 ? 59.850  11.416  10.240  0.60 43.49  ? 4365 LEU B CB    1 
ATOM   3354 C  CB    B LEU B 2 115 ? 59.950  11.544  10.403  0.40 44.82  ? 4365 LEU B CB    1 
ATOM   3355 C  CG    A LEU B 2 115 ? 60.983  10.852  11.091  0.60 41.67  ? 4365 LEU B CG    1 
ATOM   3356 C  CG    B LEU B 2 115 ? 59.576  10.068  10.472  0.40 46.99  ? 4365 LEU B CG    1 
ATOM   3357 C  CD1   A LEU B 2 115 ? 60.465  10.463  12.465  0.60 41.50  ? 4365 LEU B CD1   1 
ATOM   3358 C  CD1   B LEU B 2 115 ? 60.734  9.201   10.001  0.40 47.13  ? 4365 LEU B CD1   1 
ATOM   3359 C  CD2   A LEU B 2 115 ? 61.641  9.663   10.407  0.60 42.85  ? 4365 LEU B CD2   1 
ATOM   3360 C  CD2   B LEU B 2 115 ? 59.163  9.690   11.884  0.40 47.22  ? 4365 LEU B CD2   1 
ATOM   3361 N  N     . LYS B 2 116 ? 58.223  13.323  8.359   1.00 46.20  ? 4366 LYS B N     1 
ATOM   3362 C  CA    . LYS B 2 116 ? 56.932  13.574  7.658   1.00 48.28  ? 4366 LYS B CA    1 
ATOM   3363 C  C     . LYS B 2 116 ? 57.092  14.338  6.336   1.00 48.35  ? 4366 LYS B C     1 
ATOM   3364 O  O     . LYS B 2 116 ? 56.072  14.471  5.631   1.00 50.72  ? 4366 LYS B O     1 
ATOM   3365 C  CB    . LYS B 2 116 ? 56.014  14.405  8.560   1.00 49.08  ? 4366 LYS B CB    1 
ATOM   3366 C  CG    . LYS B 2 116 ? 55.604  13.753  9.873   1.00 50.57  ? 4366 LYS B CG    1 
ATOM   3367 C  CD    . LYS B 2 116 ? 54.862  14.707  10.786  1.00 51.64  ? 4366 LYS B CD    1 
ATOM   3368 C  CE    . LYS B 2 116 ? 54.463  14.094  12.112  1.00 53.15  ? 4366 LYS B CE    1 
ATOM   3369 N  NZ    . LYS B 2 116 ? 53.858  15.105  13.013  1.00 53.36  ? 4366 LYS B NZ    1 
ATOM   3370 N  N     . ASN B 2 117 ? 58.293  14.809  5.990   1.00 45.72  ? 4367 ASN B N     1 
ATOM   3371 C  CA    . ASN B 2 117 ? 58.421  15.645  4.763   1.00 45.50  ? 4367 ASN B CA    1 
ATOM   3372 C  C     . ASN B 2 117 ? 59.403  15.020  3.769   1.00 45.70  ? 4367 ASN B C     1 
ATOM   3373 O  O     . ASN B 2 117 ? 60.196  14.145  4.164   1.00 44.63  ? 4367 ASN B O     1 
ATOM   3374 C  CB    . ASN B 2 117 ? 58.754  17.089  5.140   1.00 43.00  ? 4367 ASN B CB    1 
ATOM   3375 C  CG    . ASN B 2 117 ? 57.556  17.784  5.751   1.00 43.31  ? 4367 ASN B CG    1 
ATOM   3376 O  OD1   . ASN B 2 117 ? 56.630  18.168  5.040   1.00 45.26  ? 4367 ASN B OD1   1 
ATOM   3377 N  ND2   . ASN B 2 117 ? 57.558  17.947  7.062   1.00 41.30  ? 4367 ASN B ND2   1 
ATOM   3378 N  N     A THR B 2 118 ? 59.342  15.491  2.517   0.60 47.05  ? 4368 THR B N     1 
ATOM   3379 N  N     B THR B 2 118 ? 59.336  15.462  2.508   0.40 46.86  ? 4368 THR B N     1 
ATOM   3380 C  CA    A THR B 2 118 ? 60.162  14.973  1.388   0.60 48.27  ? 4368 THR B CA    1 
ATOM   3381 C  CA    B THR B 2 118 ? 60.217  14.932  1.433   0.40 47.76  ? 4368 THR B CA    1 
ATOM   3382 C  C     A THR B 2 118 ? 60.938  16.123  0.739   0.60 46.96  ? 4368 THR B C     1 
ATOM   3383 C  C     B THR B 2 118 ? 60.934  16.096  0.742   0.40 46.78  ? 4368 THR B C     1 
ATOM   3384 O  O     A THR B 2 118 ? 60.374  17.231  0.637   0.60 46.64  ? 4368 THR B O     1 
ATOM   3385 O  O     B THR B 2 118 ? 60.330  17.180  0.621   0.40 46.63  ? 4368 THR B O     1 
ATOM   3386 C  CB    A THR B 2 118 ? 59.270  14.288  0.345   0.60 52.17  ? 4368 THR B CB    1 
ATOM   3387 C  CB    B THR B 2 118 ? 59.422  14.065  0.446   0.40 51.19  ? 4368 THR B CB    1 
ATOM   3388 O  OG1   A THR B 2 118 ? 58.443  13.342  1.024   0.60 53.64  ? 4368 THR B OG1   1 
ATOM   3389 O  OG1   B THR B 2 118 ? 58.362  14.844  -0.109  0.40 52.27  ? 4368 THR B OG1   1 
ATOM   3390 C  CG2   A THR B 2 118 ? 60.053  13.605  -0.755  0.60 53.93  ? 4368 THR B CG2   1 
ATOM   3391 C  CG2   B THR B 2 118 ? 58.848  12.824  1.094   0.40 52.48  ? 4368 THR B CG2   1 
ATOM   3392 N  N     . VAL B 2 119 ? 62.177  15.856  0.316   1.00 46.33  ? 4369 VAL B N     1 
ATOM   3393 C  CA    . VAL B 2 119 ? 63.022  16.878  -0.365  1.00 45.67  ? 4369 VAL B CA    1 
ATOM   3394 C  C     . VAL B 2 119 ? 62.827  16.747  -1.878  1.00 49.03  ? 4369 VAL B C     1 
ATOM   3395 O  O     . VAL B 2 119 ? 62.814  15.604  -2.382  1.00 50.25  ? 4369 VAL B O     1 
ATOM   3396 C  CB    . VAL B 2 119 ? 64.506  16.711  0.013   1.00 44.53  ? 4369 VAL B CB    1 
ATOM   3397 C  CG1   . VAL B 2 119 ? 65.390  17.724  -0.700  1.00 44.23  ? 4369 VAL B CG1   1 
ATOM   3398 C  CG2   . VAL B 2 119 ? 64.707  16.784  1.518   1.00 42.04  ? 4369 VAL B CG2   1 
ATOM   3399 N  N     . CYS B 2 120 ? 62.666  17.879  -2.563  1.00 49.59  ? 4370 CYS B N     1 
ATOM   3400 C  CA    . CYS B 2 120 ? 62.532  17.879  -4.040  1.00 52.87  ? 4370 CYS B CA    1 
ATOM   3401 C  C     . CYS B 2 120 ? 63.897  17.540  -4.645  1.00 54.18  ? 4370 CYS B C     1 
ATOM   3402 O  O     . CYS B 2 120 ? 64.877  18.236  -4.314  1.00 52.00  ? 4370 CYS B O     1 
ATOM   3403 C  CB    . CYS B 2 120 ? 62.034  19.229  -4.531  1.00 52.87  ? 4370 CYS B CB    1 
ATOM   3404 S  SG    . CYS B 2 120 ? 61.932  19.366  -6.332  1.00 55.68  ? 4370 CYS B SG    1 
ATOM   3405 N  N     . THR B 2 121 ? 63.948  16.500  -5.482  1.00 58.10  ? 4371 THR B N     1 
ATOM   3406 C  CA    . THR B 2 121 ? 65.216  16.039  -6.109  1.00 60.06  ? 4371 THR B CA    1 
ATOM   3407 C  C     . THR B 2 121 ? 65.700  17.043  -7.164  1.00 61.41  ? 4371 THR B C     1 
ATOM   3408 O  O     . THR B 2 121 ? 66.858  16.905  -7.604  1.00 63.67  ? 4371 THR B O     1 
ATOM   3409 C  CB    . THR B 2 121 ? 65.038  14.644  -6.720  1.00 63.72  ? 4371 THR B CB    1 
ATOM   3410 O  OG1   . THR B 2 121 ? 63.992  14.714  -7.690  1.00 67.33  ? 4371 THR B OG1   1 
ATOM   3411 C  CG2   . THR B 2 121 ? 64.700  13.589  -5.690  1.00 63.51  ? 4371 THR B CG2   1 
ATOM   3412 N  N     . VAL B 2 122 ? 64.869  18.027  -7.527  1.00 60.99  ? 4372 VAL B N     1 
ATOM   3413 C  CA    . VAL B 2 122 ? 65.242  19.010  -8.589  1.00 61.81  ? 4372 VAL B CA    1 
ATOM   3414 C  C     . VAL B 2 122 ? 65.841  20.277  -7.962  1.00 58.91  ? 4372 VAL B C     1 
ATOM   3415 O  O     . VAL B 2 122 ? 66.976  20.630  -8.344  1.00 59.42  ? 4372 VAL B O     1 
ATOM   3416 C  CB    . VAL B 2 122 ? 64.036  19.353  -9.488  1.00 65.05  ? 4372 VAL B CB    1 
ATOM   3417 C  CG1   . VAL B 2 122 ? 64.362  20.458  -10.484 1.00 66.33  ? 4372 VAL B CG1   1 
ATOM   3418 C  CG2   . VAL B 2 122 ? 63.504  18.126  -10.215 1.00 68.46  ? 4372 VAL B CG2   1 
ATOM   3419 N  N     . CYS B 2 123 ? 65.121  20.925  -7.035  1.00 55.32  ? 4373 CYS B N     1 
ATOM   3420 C  CA    . CYS B 2 123 ? 65.586  22.222  -6.467  1.00 52.22  ? 4373 CYS B CA    1 
ATOM   3421 C  C     . CYS B 2 123 ? 66.217  22.053  -5.075  1.00 48.70  ? 4373 CYS B C     1 
ATOM   3422 O  O     . CYS B 2 123 ? 66.841  23.023  -4.608  1.00 48.08  ? 4373 CYS B O     1 
ATOM   3423 C  CB    . CYS B 2 123 ? 64.441  23.229  -6.407  1.00 52.31  ? 4373 CYS B CB    1 
ATOM   3424 S  SG    . CYS B 2 123 ? 63.081  22.738  -5.311  1.00 50.77  ? 4373 CYS B SG    1 
ATOM   3425 N  N     . GLY B 2 124 ? 66.051  20.888  -4.436  1.00 47.55  ? 4374 GLY B N     1 
ATOM   3426 C  CA    . GLY B 2 124 ? 66.645  20.633  -3.106  1.00 44.26  ? 4374 GLY B CA    1 
ATOM   3427 C  C     . GLY B 2 124 ? 65.865  21.289  -1.976  1.00 42.41  ? 4374 GLY B C     1 
ATOM   3428 O  O     . GLY B 2 124 ? 66.354  21.261  -0.823  1.00 39.81  ? 4374 GLY B O     1 
ATOM   3429 N  N     . MET B 2 125 ? 64.694  21.850  -2.282  1.00 43.43  ? 4375 MET B N     1 
ATOM   3430 C  CA    . MET B 2 125 ? 63.842  22.514  -1.259  1.00 42.43  ? 4375 MET B CA    1 
ATOM   3431 C  C     . MET B 2 125 ? 62.832  21.492  -0.733  1.00 42.24  ? 4375 MET B C     1 
ATOM   3432 O  O     . MET B 2 125 ? 62.564  20.504  -1.452  1.00 43.81  ? 4375 MET B O     1 
ATOM   3433 C  CB    . MET B 2 125 ? 63.060  23.689  -1.859  1.00 45.08  ? 4375 MET B CB    1 
ATOM   3434 C  CG    . MET B 2 125 ? 63.919  24.719  -2.577  1.00 46.49  ? 4375 MET B CG    1 
ATOM   3435 S  SD    . MET B 2 125 ? 65.000  25.659  -1.476  1.00 45.69  ? 4375 MET B SD    1 
ATOM   3436 C  CE    . MET B 2 125 ? 63.797  26.607  -0.545  1.00 46.32  ? 4375 MET B CE    1 
ATOM   3437 N  N     . TRP B 2 126 ? 62.298  21.723  0.469   1.00 40.50  ? 4376 TRP B N     1 
ATOM   3438 C  CA    . TRP B 2 126 ? 61.241  20.840  1.025   1.00 41.17  ? 4376 TRP B CA    1 
ATOM   3439 C  C     . TRP B 2 126 ? 59.973  20.995  0.184   1.00 44.47  ? 4376 TRP B C     1 
ATOM   3440 O  O     . TRP B 2 126 ? 59.610  22.151  -0.116  1.00 44.06  ? 4376 TRP B O     1 
ATOM   3441 C  CB    . TRP B 2 126 ? 60.930  21.181  2.485   1.00 39.49  ? 4376 TRP B CB    1 
ATOM   3442 C  CG    . TRP B 2 126 ? 61.990  20.813  3.473   1.00 36.56  ? 4376 TRP B CG    1 
ATOM   3443 C  CD1   . TRP B 2 126 ? 62.833  21.662  4.129   1.00 35.27  ? 4376 TRP B CD1   1 
ATOM   3444 C  CD2   . TRP B 2 126 ? 62.307  19.490  3.938   1.00 36.29  ? 4376 TRP B CD2   1 
ATOM   3445 N  NE1   . TRP B 2 126 ? 63.647  20.959  4.976   1.00 33.60  ? 4376 TRP B NE1   1 
ATOM   3446 C  CE2   . TRP B 2 126 ? 63.351  19.625  4.880   1.00 34.37  ? 4376 TRP B CE2   1 
ATOM   3447 C  CE3   . TRP B 2 126 ? 61.810  18.211  3.662   1.00 37.97  ? 4376 TRP B CE3   1 
ATOM   3448 C  CZ2   . TRP B 2 126 ? 63.913  18.528  5.529   1.00 34.18  ? 4376 TRP B CZ2   1 
ATOM   3449 C  CZ3   . TRP B 2 126 ? 62.365  17.127  4.306   1.00 37.66  ? 4376 TRP B CZ3   1 
ATOM   3450 C  CH2   . TRP B 2 126 ? 63.401  17.286  5.228   1.00 35.50  ? 4376 TRP B CH2   1 
ATOM   3451 N  N     . LYS B 2 127 ? 59.326  19.884  -0.174  1.00 47.20  ? 4377 LYS B N     1 
ATOM   3452 C  CA    . LYS B 2 127 ? 58.043  19.989  -0.917  1.00 51.67  ? 4377 LYS B CA    1 
ATOM   3453 C  C     . LYS B 2 127 ? 57.025  20.558  0.077   1.00 51.14  ? 4377 LYS B C     1 
ATOM   3454 O  O     . LYS B 2 127 ? 56.968  20.044  1.214   1.00 50.02  ? 4377 LYS B O     1 
ATOM   3455 C  CB    . LYS B 2 127 ? 57.632  18.642  -1.526  1.00 55.20  ? 4377 LYS B CB    1 
ATOM   3456 C  CG    . LYS B 2 127 ? 58.645  18.041  -2.496  1.00 57.57  ? 4377 LYS B CG    1 
ATOM   3457 C  CD    . LYS B 2 127 ? 58.109  16.913  -3.356  1.00 62.35  ? 4377 LYS B CD    1 
ATOM   3458 C  CE    . LYS B 2 127 ? 57.198  17.371  -4.480  1.00 66.72  ? 4377 LYS B CE    1 
ATOM   3459 N  NZ    . LYS B 2 127 ? 57.936  18.112  -5.534  1.00 67.83  ? 4377 LYS B NZ    1 
ATOM   3460 N  N     . GLY B 2 128 ? 56.332  21.635  -0.305  1.00 51.94  ? 4378 GLY B N     1 
ATOM   3461 C  CA    . GLY B 2 128 ? 55.337  22.288  0.571   1.00 51.98  ? 4378 GLY B CA    1 
ATOM   3462 C  C     . GLY B 2 128 ? 55.961  23.349  1.467   1.00 49.74  ? 4378 GLY B C     1 
ATOM   3463 O  O     . GLY B 2 128 ? 55.199  24.057  2.155   1.00 50.12  ? 4378 GLY B O     1 
ATOM   3464 N  N     . TYR B 2 129 ? 57.295  23.462  1.469   1.00 47.40  ? 4379 TYR B N     1 
ATOM   3465 C  CA    . TYR B 2 129 ? 57.990  24.468  2.318   1.00 45.27  ? 4379 TYR B CA    1 
ATOM   3466 C  C     . TYR B 2 129 ? 59.181  25.076  1.565   1.00 44.83  ? 4379 TYR B C     1 
ATOM   3467 O  O     . TYR B 2 129 ? 60.275  25.171  2.164   1.00 43.42  ? 4379 TYR B O     1 
ATOM   3468 C  CB    . TYR B 2 129 ? 58.450  23.833  3.632   1.00 43.15  ? 4379 TYR B CB    1 
ATOM   3469 C  CG    . TYR B 2 129 ? 57.349  23.294  4.510   1.00 43.64  ? 4379 TYR B CG    1 
ATOM   3470 C  CD1   . TYR B 2 129 ? 56.706  24.108  5.429   1.00 43.65  ? 4379 TYR B CD1   1 
ATOM   3471 C  CD2   . TYR B 2 129 ? 56.958  21.966  4.437   1.00 44.68  ? 4379 TYR B CD2   1 
ATOM   3472 C  CE1   . TYR B 2 129 ? 55.703  23.620  6.251   1.00 44.05  ? 4379 TYR B CE1   1 
ATOM   3473 C  CE2   . TYR B 2 129 ? 55.957  21.462  5.252   1.00 45.11  ? 4379 TYR B CE2   1 
ATOM   3474 C  CZ    . TYR B 2 129 ? 55.328  22.292  6.163   1.00 45.18  ? 4379 TYR B CZ    1 
ATOM   3475 O  OH    . TYR B 2 129 ? 54.341  21.805  6.970   1.00 47.14  ? 4379 TYR B OH    1 
ATOM   3476 N  N     . GLY B 2 130 ? 58.982  25.469  0.300   1.00 45.72  ? 4380 GLY B N     1 
ATOM   3477 C  CA    . GLY B 2 130 ? 60.065  26.101  -0.481  1.00 45.89  ? 4380 GLY B CA    1 
ATOM   3478 C  C     . GLY B 2 130 ? 60.084  25.667  -1.935  1.00 47.52  ? 4380 GLY B C     1 
ATOM   3479 O  O     . GLY B 2 130 ? 60.429  26.505  -2.790  1.00 49.44  ? 4380 GLY B O     1 
ATOM   3480 N  N     . CYS B 2 131 ? 59.755  24.402  -2.212  1.00 48.31  ? 4381 CYS B N     1 
ATOM   3481 C  CA    . CYS B 2 131 ? 59.753  23.902  -3.613  1.00 50.60  ? 4381 CYS B CA    1 
ATOM   3482 C  C     . CYS B 2 131 ? 58.608  24.555  -4.398  1.00 54.39  ? 4381 CYS B C     1 
ATOM   3483 O  O     . CYS B 2 131 ? 57.443  24.393  -3.986  1.00 55.26  ? 4381 CYS B O     1 
ATOM   3484 C  CB    . CYS B 2 131 ? 59.636  22.384  -3.664  1.00 50.41  ? 4381 CYS B CB    1 
ATOM   3485 S  SG    . CYS B 2 131 ? 59.361  21.743  -5.337  1.00 53.35  ? 4381 CYS B SG    1 
ATOM   3486 N  N     . SER B 2 132 ? 58.944  25.250  -5.489  1.00 57.36  ? 4382 SER B N     1 
ATOM   3487 C  CA    . SER B 2 132 ? 57.946  25.945  -6.348  1.00 62.14  ? 4382 SER B CA    1 
ATOM   3488 C  C     . SER B 2 132 ? 57.932  25.330  -7.755  1.00 66.49  ? 4382 SER B C     1 
ATOM   3489 O  O     . SER B 2 132 ? 57.416  25.988  -8.689  1.00 68.98  ? 4382 SER B O     1 
ATOM   3490 C  CB    . SER B 2 132 ? 58.236  27.425  -6.394  1.00 62.31  ? 4382 SER B CB    1 
ATOM   3491 O  OG    . SER B 2 132 ? 59.557  27.665  -6.860  1.00 62.15  ? 4382 SER B OG    1 
ATOM   3492 N  N     . CYS B 2 133 ? 58.445  24.101  -7.891  1.00 67.57  ? 4383 CYS B N     1 
ATOM   3493 C  CA    . CYS B 2 133 ? 58.522  23.407  -9.210  1.00 72.77  ? 4383 CYS B CA    1 
ATOM   3494 C  C     . CYS B 2 133 ? 57.126  23.158  -9.802  1.00 78.09  ? 4383 CYS B C     1 
ATOM   3495 O  O     . CYS B 2 133 ? 57.023  23.121  -11.042 1.00 82.19  ? 4383 CYS B O     1 
ATOM   3496 C  CB    . CYS B 2 133 ? 59.262  22.078  -9.085  1.00 71.22  ? 4383 CYS B CB    1 
ATOM   3497 S  SG    . CYS B 2 133 ? 61.023  22.253  -8.673  1.00 66.83  ? 4383 CYS B SG    1 
ATOM   3498 N  N     . ASP B 2 134 ? 56.100  23.003  -8.955  1.00 80.79  ? 4384 ASP B N     1 
ATOM   3499 C  CA    . ASP B 2 134 ? 54.717  22.703  -9.426  1.00 86.40  ? 4384 ASP B CA    1 
ATOM   3500 C  C     . ASP B 2 134 ? 53.998  23.978  -9.891  1.00 89.40  ? 4384 ASP B C     1 
ATOM   3501 O  O     . ASP B 2 134 ? 52.908  23.840  -10.486 1.00 93.95  ? 4384 ASP B O     1 
ATOM   3502 C  CB    . ASP B 2 134 ? 53.908  21.988  -8.338  1.00 87.04  ? 4384 ASP B CB    1 
ATOM   3503 C  CG    . ASP B 2 134 ? 54.425  20.599  -8.001  1.00 87.64  ? 4384 ASP B CG    1 
ATOM   3504 O  OD1   . ASP B 2 134 ? 54.960  19.934  -8.914  1.00 90.16  ? 4384 ASP B OD1   1 
ATOM   3505 O  OD2   . ASP B 2 134 ? 54.308  20.200  -6.824  1.00 85.84  ? 4384 ASP B OD2   1 
ATOM   3506 N  N     . GLN B 2 135 ? 54.573  25.162  -9.646  1.00 88.80  ? 4385 GLN B N     1 
ATOM   3507 C  CA    . GLN B 2 135 ? 53.927  26.436  -10.072 1.00 92.36  ? 4385 GLN B CA    1 
ATOM   3508 C  C     . GLN B 2 135 ? 54.017  26.579  -11.597 1.00 96.47  ? 4385 GLN B C     1 
ATOM   3509 O  O     . GLN B 2 135 ? 54.888  25.924  -12.205 1.00 96.26  ? 4385 GLN B O     1 
ATOM   3510 C  CB    . GLN B 2 135 ? 54.576  27.638  -9.383  1.00 89.84  ? 4385 GLN B CB    1 
ATOM   3511 C  CG    . GLN B 2 135 ? 54.388  27.651  -7.874  1.00 87.88  ? 4385 GLN B CG    1 
ATOM   3512 C  CD    . GLN B 2 135 ? 54.957  28.894  -7.233  1.00 86.49  ? 4385 GLN B CD    1 
ATOM   3513 O  OE1   . GLN B 2 135 ? 55.392  29.824  -7.909  1.00 87.73  ? 4385 GLN B OE1   1 
ATOM   3514 N  NE2   . GLN B 2 135 ? 54.951  28.920  -5.910  1.00 83.95  ? 4385 GLN B NE2   1 
ATOM   3515 N  N     . LEU B 2 136 ? 53.145  27.414  -12.176 1.00 101.48 ? 4386 LEU B N     1 
ATOM   3516 C  CA    . LEU B 2 136 ? 53.108  27.655  -13.646 1.00 105.56 ? 4386 LEU B CA    1 
ATOM   3517 C  C     . LEU B 2 136 ? 54.475  28.168  -14.114 1.00 105.03 ? 4386 LEU B C     1 
ATOM   3518 O  O     . LEU B 2 136 ? 54.705  28.344  -15.310 1.00 108.29 ? 4386 LEU B O     1 
ATOM   3519 C  CB    . LEU B 2 136 ? 52.006  28.673  -13.962 1.00 109.55 ? 4386 LEU B CB    1 
ATOM   3520 C  CG    . LEU B 2 136 ? 50.590  28.277  -13.544 1.00 111.96 ? 4386 LEU B CG    1 
ATOM   3521 C  CD1   . LEU B 2 136 ? 49.620  29.430  -13.763 1.00 114.51 ? 4386 LEU B CD1   1 
ATOM   3522 C  CD2   . LEU B 2 136 ? 50.121  27.038  -14.293 1.00 115.28 ? 4386 LEU B CD2   1 
HETATM 3523 S  S     . SO3 C 3 .   ? 82.292  47.945  18.254  0.50 69.41  ? 7101 SO3 A S     1 
HETATM 3524 O  O1    . SO3 C 3 .   ? 80.916  48.145  18.806  0.50 67.83  ? 7101 SO3 A O1    1 
HETATM 3525 O  O2    . SO3 C 3 .   ? 83.139  47.685  19.460  0.50 66.52  ? 7101 SO3 A O2    1 
HETATM 3526 O  O3    . SO3 C 3 .   ? 82.222  46.619  17.562  0.50 67.92  ? 7101 SO3 A O3    1 
HETATM 3527 N  N     . SAM D 4 .   ? 81.976  19.248  24.241  1.00 22.37  ? 7102 SAM A N     1 
HETATM 3528 C  CA    . SAM D 4 .   ? 80.645  18.721  24.638  1.00 21.65  ? 7102 SAM A CA    1 
HETATM 3529 C  C     . SAM D 4 .   ? 79.549  19.545  23.944  1.00 23.13  ? 7102 SAM A C     1 
HETATM 3530 O  O     . SAM D 4 .   ? 79.816  19.973  22.801  1.00 22.10  ? 7102 SAM A O     1 
HETATM 3531 O  OXT   . SAM D 4 .   ? 78.464  19.699  24.538  1.00 23.14  ? 7102 SAM A OXT   1 
HETATM 3532 C  CB    . SAM D 4 .   ? 80.504  18.746  26.166  1.00 23.79  ? 7102 SAM A CB    1 
HETATM 3533 C  CG    . SAM D 4 .   ? 81.590  17.912  26.848  1.00 24.12  ? 7102 SAM A CG    1 
HETATM 3534 S  SD    . SAM D 4 .   ? 81.319  17.667  28.619  1.00 27.21  ? 7102 SAM A SD    1 
HETATM 3535 C  CE    . SAM D 4 .   ? 81.617  19.312  29.244  1.00 28.09  ? 7102 SAM A CE    1 
HETATM 3536 C  "C5'" . SAM D 4 .   ? 82.878  16.831  29.024  1.00 24.97  ? 7102 SAM A "C5'" 1 
HETATM 3537 C  "C4'" . SAM D 4 .   ? 83.014  15.458  28.389  1.00 24.22  ? 7102 SAM A "C4'" 1 
HETATM 3538 O  "O4'" . SAM D 4 .   ? 84.322  14.915  28.684  1.00 25.28  ? 7102 SAM A "O4'" 1 
HETATM 3539 C  "C3'" . SAM D 4 .   ? 82.007  14.407  28.874  1.00 24.27  ? 7102 SAM A "C3'" 1 
HETATM 3540 O  "O3'" . SAM D 4 .   ? 81.163  13.996  27.802  1.00 22.55  ? 7102 SAM A "O3'" 1 
HETATM 3541 C  "C2'" . SAM D 4 .   ? 82.884  13.261  29.404  1.00 24.60  ? 7102 SAM A "C2'" 1 
HETATM 3542 O  "O2'" . SAM D 4 .   ? 82.361  11.982  29.117  1.00 25.16  ? 7102 SAM A "O2'" 1 
HETATM 3543 C  "C1'" . SAM D 4 .   ? 84.200  13.514  28.678  1.00 24.37  ? 7102 SAM A "C1'" 1 
HETATM 3544 N  N9    . SAM D 4 .   ? 85.364  12.902  29.315  1.00 23.32  ? 7102 SAM A N9    1 
HETATM 3545 C  C8    . SAM D 4 .   ? 85.790  13.079  30.610  1.00 24.25  ? 7102 SAM A C8    1 
HETATM 3546 N  N7    . SAM D 4 .   ? 86.853  12.373  30.912  1.00 23.26  ? 7102 SAM A N7    1 
HETATM 3547 C  C5    . SAM D 4 .   ? 87.147  11.674  29.749  1.00 22.72  ? 7102 SAM A C5    1 
HETATM 3548 C  C6    . SAM D 4 .   ? 88.161  10.747  29.429  1.00 23.65  ? 7102 SAM A C6    1 
HETATM 3549 N  N6    . SAM D 4 .   ? 89.094  10.341  30.288  1.00 24.41  ? 7102 SAM A N6    1 
HETATM 3550 N  N1    . SAM D 4 .   ? 88.165  10.230  28.177  1.00 22.53  ? 7102 SAM A N1    1 
HETATM 3551 C  C2    . SAM D 4 .   ? 87.221  10.637  27.318  1.00 22.92  ? 7102 SAM A C2    1 
HETATM 3552 N  N3    . SAM D 4 .   ? 86.222  11.497  27.507  1.00 22.69  ? 7102 SAM A N3    1 
HETATM 3553 C  C4    . SAM D 4 .   ? 86.236  11.990  28.758  1.00 22.82  ? 7102 SAM A C4    1 
HETATM 3554 C  C     . ACT E 5 .   ? 81.982  24.910  32.710  1.00 34.71  ? 7103 ACT A C     1 
HETATM 3555 O  O     . ACT E 5 .   ? 81.123  24.208  32.143  1.00 35.46  ? 7103 ACT A O     1 
HETATM 3556 O  OXT   . ACT E 5 .   ? 81.853  26.134  32.919  1.00 28.86  ? 7103 ACT A OXT   1 
HETATM 3557 C  CH3   . ACT E 5 .   ? 83.267  24.227  33.180  1.00 33.83  ? 7103 ACT A CH3   1 
HETATM 3558 C  C     . ACT F 5 .   ? 90.633  14.108  34.606  1.00 41.49  ? 7104 ACT A C     1 
HETATM 3559 O  O     . ACT F 5 .   ? 90.898  12.981  34.132  1.00 39.39  ? 7104 ACT A O     1 
HETATM 3560 O  OXT   . ACT F 5 .   ? 89.487  14.467  34.963  1.00 39.02  ? 7104 ACT A OXT   1 
HETATM 3561 C  CH3   . ACT F 5 .   ? 91.778  15.112  34.744  1.00 36.45  ? 7104 ACT A CH3   1 
HETATM 3562 C  C1    . BDF G 6 .   ? 99.835  38.691  16.378  1.00 76.73  ? 7105 BDF A C1    1 
HETATM 3563 C  C2    . BDF G 6 .   ? 100.223 37.463  17.192  1.00 74.22  ? 7105 BDF A C2    1 
HETATM 3564 C  C3    . BDF G 6 .   ? 100.680 36.298  16.299  1.00 72.18  ? 7105 BDF A C3    1 
HETATM 3565 C  C4    . BDF G 6 .   ? 100.432 34.967  16.998  1.00 68.97  ? 7105 BDF A C4    1 
HETATM 3566 C  C5    . BDF G 6 .   ? 98.941  34.747  17.189  1.00 66.01  ? 7105 BDF A C5    1 
HETATM 3567 C  C6    . BDF G 6 .   ? 98.234  36.085  17.324  1.00 67.78  ? 7105 BDF A C6    1 
HETATM 3568 O  O1    . BDF G 6 .   ? 98.724  38.431  15.531  1.00 79.07  ? 7105 BDF A O1    1 
HETATM 3569 O  O2    . BDF G 6 .   ? 101.279 37.794  18.057  1.00 75.75  ? 7105 BDF A O2    1 
HETATM 3570 O  O3    . BDF G 6 .   ? 102.063 36.445  16.000  1.00 73.12  ? 7105 BDF A O3    1 
HETATM 3571 O  O4    . BDF G 6 .   ? 101.003 33.906  16.233  1.00 68.57  ? 7105 BDF A O4    1 
HETATM 3572 O  O5    . BDF G 6 .   ? 98.396  34.029  16.076  1.00 55.17  ? 7105 BDF A O5    1 
HETATM 3573 O  O6    . BDF G 6 .   ? 99.066  37.082  17.946  1.00 72.02  ? 7105 BDF A O6    1 
HETATM 3574 ZN ZN    . ZN  H 7 .   ? 70.844  9.080   10.932  1.00 32.30  ? 4401 ZN  B ZN    1 
HETATM 3575 ZN ZN    . ZN  I 7 .   ? 61.397  21.623  -6.466  1.00 55.54  ? 4402 ZN  B ZN    1 
HETATM 3576 C  C1    . BDF J 6 .   ? 64.071  20.367  19.693  1.00 41.13  ? 4403 BDF B C1    1 
HETATM 3577 C  C2    . BDF J 6 .   ? 64.420  21.323  20.825  1.00 41.53  ? 4403 BDF B C2    1 
HETATM 3578 C  C3    . BDF J 6 .   ? 65.931  21.594  20.912  1.00 39.42  ? 4403 BDF B C3    1 
HETATM 3579 C  C4    . BDF J 6 .   ? 66.244  22.457  22.129  1.00 40.78  ? 4403 BDF B C4    1 
HETATM 3580 C  C5    . BDF J 6 .   ? 65.700  21.808  23.391  1.00 41.96  ? 4403 BDF B C5    1 
HETATM 3581 C  C6    . BDF J 6 .   ? 64.229  21.476  23.215  1.00 42.82  ? 4403 BDF B C6    1 
HETATM 3582 O  O1    . BDF J 6 .   ? 64.854  19.184  19.763  1.00 36.18  ? 4403 BDF B O1    1 
HETATM 3583 O  O2    . BDF J 6 .   ? 63.752  22.545  20.635  1.00 43.11  ? 4403 BDF B O2    1 
HETATM 3584 O  O3    . BDF J 6 .   ? 66.366  22.237  19.721  1.00 35.21  ? 4403 BDF B O3    1 
HETATM 3585 O  O4    . BDF J 6 .   ? 67.655  22.648  22.237  1.00 39.48  ? 4403 BDF B O4    1 
HETATM 3586 O  O5    . BDF J 6 .   ? 66.418  20.607  23.683  1.00 41.68  ? 4403 BDF B O5    1 
HETATM 3587 O  O6    . BDF J 6 .   ? 63.993  20.691  22.032  1.00 42.69  ? 4403 BDF B O6    1 
HETATM 3588 O  O     . HOH K 8 .   ? 76.668  39.615  35.466  1.00 50.31  ? 7201 HOH A O     1 
HETATM 3589 O  O     . HOH K 8 .   ? 101.426 31.500  16.428  1.00 41.77  ? 7202 HOH A O     1 
HETATM 3590 O  O     . HOH K 8 .   ? 79.107  31.567  32.600  1.00 43.94  ? 7203 HOH A O     1 
HETATM 3591 O  O     . HOH K 8 .   ? 71.325  37.010  23.473  1.00 44.31  ? 7204 HOH A O     1 
HETATM 3592 O  O     A HOH K 8 .   ? 82.503  40.053  17.577  0.50 29.40  ? 7205 HOH A O     1 
HETATM 3593 O  O     B HOH K 8 .   ? 84.042  40.141  17.249  0.50 38.69  ? 7205 HOH A O     1 
HETATM 3594 O  O     . HOH K 8 .   ? 100.369 16.774  36.979  1.00 34.58  ? 7206 HOH A O     1 
HETATM 3595 O  O     . HOH K 8 .   ? 90.005  10.923  33.020  1.00 37.15  ? 7207 HOH A O     1 
HETATM 3596 O  O     . HOH K 8 .   ? 105.483 20.338  34.785  1.00 45.49  ? 7208 HOH A O     1 
HETATM 3597 O  O     B HOH K 8 .   ? 102.029 18.119  40.779  0.40 34.86  ? 7209 HOH A O     1 
HETATM 3598 O  O     . HOH K 8 .   ? 83.272  3.882   27.412  1.00 50.92  ? 7210 HOH A O     1 
HETATM 3599 O  O     . HOH K 8 .   ? 82.719  11.507  5.857   1.00 43.73  ? 7211 HOH A O     1 
HETATM 3600 O  O     . HOH K 8 .   ? 79.488  5.102   29.058  1.00 50.18  ? 7212 HOH A O     1 
HETATM 3601 O  O     . HOH K 8 .   ? 85.376  27.092  6.415   1.00 33.18  ? 7213 HOH A O     1 
HETATM 3602 O  O     . HOH K 8 .   ? 86.544  1.633   22.876  1.00 38.61  ? 7214 HOH A O     1 
HETATM 3603 O  O     . HOH K 8 .   ? 106.731 16.677  19.182  1.00 41.43  ? 7215 HOH A O     1 
HETATM 3604 O  O     . HOH K 8 .   ? 93.785  44.088  33.110  1.00 38.63  ? 7216 HOH A O     1 
HETATM 3605 O  O     . HOH K 8 .   ? 94.335  37.723  21.318  1.00 35.63  ? 7217 HOH A O     1 
HETATM 3606 O  O     . HOH K 8 .   ? 73.728  17.008  15.150  1.00 24.94  ? 7218 HOH A O     1 
HETATM 3607 O  O     . HOH K 8 .   ? 79.389  25.230  30.524  1.00 25.82  ? 7219 HOH A O     1 
HETATM 3608 O  O     . HOH K 8 .   ? 87.362  40.746  40.251  0.50 31.17  ? 7220 HOH A O     1 
HETATM 3609 O  O     . HOH K 8 .   ? 91.752  42.238  28.527  1.00 38.62  ? 7221 HOH A O     1 
HETATM 3610 O  O     . HOH K 8 .   ? 104.289 29.725  23.091  1.00 34.38  ? 7222 HOH A O     1 
HETATM 3611 O  O     . HOH K 8 .   ? 78.097  31.978  8.275   1.00 29.41  ? 7223 HOH A O     1 
HETATM 3612 O  O     . HOH K 8 .   ? 107.416 19.162  22.137  1.00 38.66  ? 7224 HOH A O     1 
HETATM 3613 O  O     . HOH K 8 .   ? 92.785  31.745  48.119  1.00 37.20  ? 7225 HOH A O     1 
HETATM 3614 O  O     . HOH K 8 .   ? 86.338  36.758  15.061  1.00 47.39  ? 7226 HOH A O     1 
HETATM 3615 O  O     . HOH K 8 .   ? 98.833  29.275  5.529   1.00 37.29  ? 7227 HOH A O     1 
HETATM 3616 O  O     . HOH K 8 .   ? 86.400  22.371  37.692  1.00 28.61  ? 7228 HOH A O     1 
HETATM 3617 O  O     . HOH K 8 .   ? 105.139 16.722  14.696  1.00 44.78  ? 7229 HOH A O     1 
HETATM 3618 O  O     . HOH K 8 .   ? 97.052  36.510  25.194  1.00 28.43  ? 7230 HOH A O     1 
HETATM 3619 O  O     . HOH K 8 .   ? 81.545  22.501  27.727  1.00 23.20  ? 7231 HOH A O     1 
HETATM 3620 O  O     . HOH K 8 .   ? 106.872 33.108  18.341  1.00 39.66  ? 7232 HOH A O     1 
HETATM 3621 O  O     . HOH K 8 .   ? 106.718 26.179  40.768  1.00 50.12  ? 7233 HOH A O     1 
HETATM 3622 O  O     . HOH K 8 .   ? 76.389  32.092  30.934  1.00 35.01  ? 7234 HOH A O     1 
HETATM 3623 O  O     A HOH K 8 .   ? 105.847 31.695  23.674  0.40 39.18  ? 7235 HOH A O     1 
HETATM 3624 O  O     . HOH K 8 .   ? 80.546  18.191  20.793  1.00 18.61  ? 7236 HOH A O     1 
HETATM 3625 O  O     . HOH K 8 .   ? 102.282 26.998  10.398  1.00 32.21  ? 7237 HOH A O     1 
HETATM 3626 O  O     . HOH K 8 .   ? 86.455  28.621  43.555  1.00 39.82  ? 7238 HOH A O     1 
HETATM 3627 O  O     . HOH K 8 .   ? 91.043  23.448  46.336  1.00 43.31  ? 7239 HOH A O     1 
HETATM 3628 O  O     A HOH K 8 .   ? 73.668  31.276  29.582  0.60 31.91  ? 7240 HOH A O     1 
HETATM 3629 O  O     B HOH K 8 .   ? 72.422  29.781  30.237  0.40 40.25  ? 7240 HOH A O     1 
HETATM 3630 O  O     . HOH K 8 .   ? 103.941 15.879  17.450  1.00 42.92  ? 7241 HOH A O     1 
HETATM 3631 O  O     . HOH K 8 .   ? 86.365  11.138  35.059  1.00 55.55  ? 7242 HOH A O     1 
HETATM 3632 O  O     . HOH K 8 .   ? 81.690  21.981  37.214  1.00 44.98  ? 7243 HOH A O     1 
HETATM 3633 O  O     A HOH K 8 .   ? 102.070 34.083  13.660  0.50 36.22  ? 7244 HOH A O     1 
HETATM 3634 O  O     B HOH K 8 .   ? 102.530 35.885  12.470  0.50 40.66  ? 7244 HOH A O     1 
HETATM 3635 O  O     . HOH K 8 .   ? 82.747  18.392  42.356  0.50 39.48  ? 7245 HOH A O     1 
HETATM 3636 O  O     A HOH K 8 .   ? 76.535  39.747  39.802  0.70 59.49  ? 7246 HOH A O     1 
HETATM 3637 O  O     B HOH K 8 .   ? 75.978  40.115  41.631  0.30 41.46  ? 7246 HOH A O     1 
HETATM 3638 O  O     . HOH K 8 .   ? 100.252 11.883  9.389   1.00 37.92  ? 7247 HOH A O     1 
HETATM 3639 O  O     . HOH K 8 .   ? 84.676  33.416  6.534   1.00 53.46  ? 7248 HOH A O     1 
HETATM 3640 O  O     . HOH K 8 .   ? 98.468  23.794  44.255  1.00 45.25  ? 7249 HOH A O     1 
HETATM 3641 O  O     . HOH K 8 .   ? 89.983  20.437  54.150  1.00 39.71  ? 7250 HOH A O     1 
HETATM 3642 O  O     A HOH K 8 .   ? 88.941  40.285  23.803  0.50 35.16  ? 7251 HOH A O     1 
HETATM 3643 O  O     A HOH K 8 .   ? 78.561  41.227  38.878  0.70 51.05  ? 7252 HOH A O     1 
HETATM 3644 O  O     B HOH K 8 .   ? 77.397  41.813  37.234  0.30 34.35  ? 7252 HOH A O     1 
HETATM 3645 O  O     . HOH K 8 .   ? 82.105  24.695  6.546   1.00 37.14  ? 7253 HOH A O     1 
HETATM 3646 O  O     . HOH K 8 .   ? 87.751  9.533   24.142  1.00 26.78  ? 7254 HOH A O     1 
HETATM 3647 O  O     . HOH K 8 .   ? 83.460  21.108  7.676   1.00 26.49  ? 7255 HOH A O     1 
HETATM 3648 O  O     . HOH K 8 .   ? 90.581  34.217  46.164  1.00 38.37  ? 7256 HOH A O     1 
HETATM 3649 O  O     A HOH K 8 .   ? 68.763  14.194  24.888  0.60 39.00  ? 7257 HOH A O     1 
HETATM 3650 O  O     B HOH K 8 .   ? 66.836  14.120  24.252  0.40 29.28  ? 7257 HOH A O     1 
HETATM 3651 O  O     . HOH K 8 .   ? 76.992  42.304  27.332  0.50 31.52  ? 7258 HOH A O     1 
HETATM 3652 O  O     . HOH K 8 .   ? 68.935  29.070  24.973  1.00 48.75  ? 7259 HOH A O     1 
HETATM 3653 O  O     A HOH K 8 .   ? 88.464  12.337  36.209  0.60 50.03  ? 7260 HOH A O     1 
HETATM 3654 O  O     B HOH K 8 .   ? 88.075  13.512  37.890  0.40 45.21  ? 7260 HOH A O     1 
HETATM 3655 O  O     A HOH K 8 .   ? 94.889  1.425   25.324  0.60 43.56  ? 7261 HOH A O     1 
HETATM 3656 O  O     B HOH K 8 .   ? 94.418  -0.137  26.608  0.40 36.69  ? 7261 HOH A O     1 
HETATM 3657 O  O     . HOH K 8 .   ? 113.549 30.203  21.919  0.50 47.21  ? 7262 HOH A O     1 
HETATM 3658 O  O     . HOH K 8 .   ? 84.765  30.662  30.959  1.00 20.44  ? 7263 HOH A O     1 
HETATM 3659 O  O     . HOH K 8 .   ? 97.229  5.934   25.604  1.00 46.80  ? 7264 HOH A O     1 
HETATM 3660 O  O     . HOH K 8 .   ? 92.785  40.583  26.538  1.00 36.90  ? 7265 HOH A O     1 
HETATM 3661 O  O     . HOH K 8 .   ? 111.568 32.974  19.027  0.50 42.17  ? 7266 HOH A O     1 
HETATM 3662 O  O     . HOH K 8 .   ? 97.802  25.815  13.169  1.00 22.11  ? 7267 HOH A O     1 
HETATM 3663 O  O     . HOH K 8 .   ? 103.625 36.246  18.166  0.50 46.67  ? 7268 HOH A O     1 
HETATM 3664 O  O     . HOH K 8 .   ? 92.334  -9.230  29.729  1.00 41.95  ? 7269 HOH A O     1 
HETATM 3665 O  O     . HOH K 8 .   ? 103.136 11.754  2.982   1.00 57.62  ? 7270 HOH A O     1 
HETATM 3666 O  O     . HOH K 8 .   ? 92.195  30.986  7.678   1.00 39.73  ? 7271 HOH A O     1 
HETATM 3667 O  O     . HOH K 8 .   ? 81.893  21.979  30.861  1.00 31.18  ? 7272 HOH A O     1 
HETATM 3668 O  O     . HOH K 8 .   ? 96.830  36.766  14.232  1.00 51.91  ? 7273 HOH A O     1 
HETATM 3669 O  O     . HOH K 8 .   ? 88.421  37.767  43.149  1.00 39.53  ? 7274 HOH A O     1 
HETATM 3670 O  O     . HOH K 8 .   ? 108.494 37.314  33.698  1.00 40.27  ? 7275 HOH A O     1 
HETATM 3671 O  O     . HOH K 8 .   ? 93.938  38.922  14.061  1.00 51.37  ? 7276 HOH A O     1 
HETATM 3672 O  O     . HOH K 8 .   ? 84.566  15.996  44.111  0.50 40.16  ? 7277 HOH A O     1 
HETATM 3673 O  O     . HOH K 8 .   ? 91.738  3.599   29.393  1.00 45.63  ? 7278 HOH A O     1 
HETATM 3674 O  O     . HOH K 8 .   ? 89.117  20.289  31.657  1.00 16.60  ? 7279 HOH A O     1 
HETATM 3675 O  O     . HOH K 8 .   ? 99.008  24.103  -1.146  1.00 64.75  ? 7280 HOH A O     1 
HETATM 3676 O  O     . HOH K 8 .   ? 74.847  36.656  11.055  1.00 35.94  ? 7281 HOH A O     1 
HETATM 3677 O  O     . HOH K 8 .   ? 88.508  -1.145  18.078  1.00 25.62  ? 7282 HOH A O     1 
HETATM 3678 O  O     . HOH K 8 .   ? 97.402  21.962  1.705   1.00 35.89  ? 7283 HOH A O     1 
HETATM 3679 O  O     . HOH K 8 .   ? 88.533  26.625  44.968  1.00 33.07  ? 7284 HOH A O     1 
HETATM 3680 O  O     . HOH K 8 .   ? 81.884  14.979  32.405  1.00 46.62  ? 7285 HOH A O     1 
HETATM 3681 O  O     . HOH K 8 .   ? 80.622  38.095  15.237  1.00 35.21  ? 7286 HOH A O     1 
HETATM 3682 O  O     A HOH K 8 .   ? 101.592 15.501  34.266  0.60 43.89  ? 7287 HOH A O     1 
HETATM 3683 O  O     B HOH K 8 .   ? 100.961 15.202  32.562  0.40 42.34  ? 7287 HOH A O     1 
HETATM 3684 O  O     . HOH K 8 .   ? 79.624  26.401  34.440  1.00 56.57  ? 7288 HOH A O     1 
HETATM 3685 O  O     A HOH K 8 .   ? 88.794  38.686  19.498  0.60 42.46  ? 7289 HOH A O     1 
HETATM 3686 O  O     B HOH K 8 .   ? 88.940  38.424  21.689  0.40 26.93  ? 7289 HOH A O     1 
HETATM 3687 O  O     . HOH K 8 .   ? 108.014 25.359  28.388  1.00 28.99  ? 7290 HOH A O     1 
HETATM 3688 O  O     . HOH K 8 .   ? 84.009  37.971  37.570  1.00 36.00  ? 7291 HOH A O     1 
HETATM 3689 O  O     . HOH K 8 .   ? 67.612  31.869  25.404  0.50 45.65  ? 7292 HOH A O     1 
HETATM 3690 O  O     . HOH K 8 .   ? 84.079  5.835   10.443  1.00 48.74  ? 7293 HOH A O     1 
HETATM 3691 O  O     . HOH K 8 .   ? 82.980  40.761  27.919  1.00 21.14  ? 7294 HOH A O     1 
HETATM 3692 O  O     . HOH K 8 .   ? 67.229  35.448  24.101  1.00 39.06  ? 7295 HOH A O     1 
HETATM 3693 O  O     . HOH K 8 .   ? 96.637  17.391  4.090   1.00 43.02  ? 7296 HOH A O     1 
HETATM 3694 O  O     . HOH K 8 .   ? 93.598  35.090  11.186  1.00 46.67  ? 7297 HOH A O     1 
HETATM 3695 O  O     . HOH K 8 .   ? 85.042  5.212   14.352  1.00 43.34  ? 7298 HOH A O     1 
HETATM 3696 O  O     . HOH K 8 .   ? 94.619  14.630  5.486   1.00 48.51  ? 7299 HOH A O     1 
HETATM 3697 O  O     . HOH K 8 .   ? 105.165 11.722  24.457  1.00 53.09  ? 7300 HOH A O     1 
HETATM 3698 O  O     . HOH K 8 .   ? 105.771 16.268  12.188  1.00 41.60  ? 7301 HOH A O     1 
HETATM 3699 O  O     . HOH K 8 .   ? 84.710  29.960  28.340  1.00 18.75  ? 7302 HOH A O     1 
HETATM 3700 O  O     . HOH K 8 .   ? 104.480 33.074  28.266  1.00 44.51  ? 7303 HOH A O     1 
HETATM 3701 O  O     . HOH K 8 .   ? 85.987  27.007  39.881  1.00 37.25  ? 7304 HOH A O     1 
HETATM 3702 O  O     . HOH K 8 .   ? 77.346  16.797  15.955  1.00 21.64  ? 7305 HOH A O     1 
HETATM 3703 O  O     . HOH K 8 .   ? 106.896 33.938  35.357  1.00 55.88  ? 7306 HOH A O     1 
HETATM 3704 O  O     . HOH K 8 .   ? 87.254  36.921  35.241  1.00 22.29  ? 7307 HOH A O     1 
HETATM 3705 O  O     . HOH K 8 .   ? 92.749  31.462  11.897  1.00 31.63  ? 7308 HOH A O     1 
HETATM 3706 O  O     . HOH K 8 .   ? 100.983 35.598  44.755  1.00 50.64  ? 7309 HOH A O     1 
HETATM 3707 O  O     . HOH K 8 .   ? 76.308  41.083  31.073  1.00 47.51  ? 7310 HOH A O     1 
HETATM 3708 O  O     . HOH K 8 .   ? 108.355 31.201  17.111  0.50 34.48  ? 7311 HOH A O     1 
HETATM 3709 O  O     . HOH K 8 .   ? 104.925 10.081  16.956  1.00 55.87  ? 7312 HOH A O     1 
HETATM 3710 O  O     . HOH K 8 .   ? 92.588  8.768   30.633  1.00 40.99  ? 7313 HOH A O     1 
HETATM 3711 O  O     . HOH K 8 .   ? 96.385  15.323  41.023  1.00 56.36  ? 7314 HOH A O     1 
HETATM 3712 O  O     . HOH K 8 .   ? 111.271 20.935  16.105  1.00 49.49  ? 7315 HOH A O     1 
HETATM 3713 O  O     . HOH K 8 .   ? 85.196  45.091  20.398  1.00 56.18  ? 7316 HOH A O     1 
HETATM 3714 O  O     . HOH K 8 .   ? 80.866  7.163   32.143  0.50 33.18  ? 7317 HOH A O     1 
HETATM 3715 O  O     . HOH K 8 .   ? 109.746 28.610  37.992  1.00 62.00  ? 7318 HOH A O     1 
HETATM 3716 O  O     . HOH K 8 .   ? 72.416  9.601   21.722  1.00 35.35  ? 7319 HOH A O     1 
HETATM 3717 O  O     . HOH K 8 .   ? 84.101  37.141  35.027  1.00 28.49  ? 7320 HOH A O     1 
HETATM 3718 O  O     . HOH K 8 .   ? 92.508  27.448  43.189  1.00 25.04  ? 7321 HOH A O     1 
HETATM 3719 O  O     . HOH K 8 .   ? 101.723 27.533  2.762   1.00 43.48  ? 7322 HOH A O     1 
HETATM 3720 O  O     . HOH K 8 .   ? 67.406  32.290  18.062  1.00 28.05  ? 7323 HOH A O     1 
HETATM 3721 O  O     . HOH K 8 .   ? 81.045  37.055  11.538  1.00 32.70  ? 7324 HOH A O     1 
HETATM 3722 O  O     . HOH K 8 .   ? 95.836  24.261  12.480  1.00 25.05  ? 7325 HOH A O     1 
HETATM 3723 O  O     . HOH K 8 .   ? 77.314  40.408  16.335  1.00 33.07  ? 7326 HOH A O     1 
HETATM 3724 O  O     . HOH K 8 .   ? 91.201  19.570  45.354  0.50 37.89  ? 7327 HOH A O     1 
HETATM 3725 O  O     . HOH K 8 .   ? 101.196 28.377  43.908  1.00 53.51  ? 7328 HOH A O     1 
HETATM 3726 O  O     . HOH K 8 .   ? 87.794  12.648  33.489  1.00 50.50  ? 7329 HOH A O     1 
HETATM 3727 O  O     A HOH K 8 .   ? 109.792 17.349  18.117  0.60 55.84  ? 7330 HOH A O     1 
HETATM 3728 O  O     B HOH K 8 .   ? 109.889 17.941  16.471  0.40 46.67  ? 7330 HOH A O     1 
HETATM 3729 O  O     . HOH K 8 .   ? 105.257 15.809  35.358  0.50 51.05  ? 7331 HOH A O     1 
HETATM 3730 O  O     . HOH K 8 .   ? 88.373  17.191  34.708  1.00 22.18  ? 7332 HOH A O     1 
HETATM 3731 O  O     . HOH K 8 .   ? 96.429  32.673  41.833  1.00 24.93  ? 7333 HOH A O     1 
HETATM 3732 O  O     . HOH K 8 .   ? 75.222  15.666  17.364  1.00 23.13  ? 7334 HOH A O     1 
HETATM 3733 O  O     . HOH K 8 .   ? 80.135  38.520  22.545  1.00 21.08  ? 7335 HOH A O     1 
HETATM 3734 O  O     . HOH K 8 .   ? 103.683 15.234  3.604   1.00 44.11  ? 7336 HOH A O     1 
HETATM 3735 O  O     . HOH K 8 .   ? 112.148 30.891  28.598  1.00 40.87  ? 7337 HOH A O     1 
HETATM 3736 O  O     . HOH K 8 .   ? 81.504  20.652  39.603  0.50 46.26  ? 7338 HOH A O     1 
HETATM 3737 O  O     . HOH K 8 .   ? 96.658  23.042  32.077  1.00 24.66  ? 7339 HOH A O     1 
HETATM 3738 O  O     . HOH K 8 .   ? 84.785  15.771  5.664   1.00 42.60  ? 7340 HOH A O     1 
HETATM 3739 O  O     . HOH K 8 .   ? 93.988  30.784  9.634   1.00 33.65  ? 7341 HOH A O     1 
HETATM 3740 O  O     . HOH K 8 .   ? 105.668 22.949  35.048  1.00 31.79  ? 7342 HOH A O     1 
HETATM 3741 O  O     . HOH K 8 .   ? 113.318 30.916  13.444  0.50 39.64  ? 7343 HOH A O     1 
HETATM 3742 O  O     . HOH K 8 .   ? 99.015  36.891  36.423  0.50 25.37  ? 7344 HOH A O     1 
HETATM 3743 O  O     . HOH K 8 .   ? 114.411 24.917  21.859  0.50 39.48  ? 7345 HOH A O     1 
HETATM 3744 O  O     . HOH K 8 .   ? 78.117  27.253  31.855  1.00 35.24  ? 7346 HOH A O     1 
HETATM 3745 O  O     . HOH K 8 .   ? 109.624 23.084  28.252  1.00 49.59  ? 7347 HOH A O     1 
HETATM 3746 O  O     . HOH K 8 .   ? 89.983  19.368  28.205  1.00 17.50  ? 7348 HOH A O     1 
HETATM 3747 O  O     A HOH K 8 .   ? 102.173 12.715  28.978  0.70 41.34  ? 7349 HOH A O     1 
HETATM 3748 O  O     B HOH K 8 .   ? 103.754 13.564  27.856  0.30 27.09  ? 7349 HOH A O     1 
HETATM 3749 O  O     . HOH K 8 .   ? 81.455  4.975   17.107  0.50 39.01  ? 7350 HOH A O     1 
HETATM 3750 O  O     . HOH K 8 .   ? 94.842  24.802  46.662  1.00 36.45  ? 7351 HOH A O     1 
HETATM 3751 O  O     . HOH K 8 .   ? 99.203  10.134  24.910  1.00 35.79  ? 7352 HOH A O     1 
HETATM 3752 O  O     . HOH K 8 .   ? 99.900  10.667  7.258   1.00 46.81  ? 7353 HOH A O     1 
HETATM 3753 O  O     . HOH K 8 .   ? 76.740  27.739  15.411  1.00 19.72  ? 7354 HOH A O     1 
HETATM 3754 O  O     . HOH K 8 .   ? 83.792  43.690  33.280  1.00 63.70  ? 7355 HOH A O     1 
HETATM 3755 O  O     . HOH K 8 .   ? 83.616  17.933  4.521   1.00 40.91  ? 7356 HOH A O     1 
HETATM 3756 O  O     . HOH K 8 .   ? 95.625  9.683   36.335  1.00 40.13  ? 7357 HOH A O     1 
HETATM 3757 O  O     . HOH K 8 .   ? 78.969  12.260  28.089  1.00 24.99  ? 7358 HOH A O     1 
HETATM 3758 O  O     . HOH K 8 .   ? 101.642 38.738  21.923  1.00 49.68  ? 7359 HOH A O     1 
HETATM 3759 O  O     . HOH K 8 .   ? 66.187  29.683  24.725  1.00 50.31  ? 7360 HOH A O     1 
HETATM 3760 O  O     . HOH K 8 .   ? 86.551  38.453  38.651  1.00 26.84  ? 7361 HOH A O     1 
HETATM 3761 O  O     . HOH K 8 .   ? 75.900  20.158  25.612  1.00 32.47  ? 7362 HOH A O     1 
HETATM 3762 O  O     . HOH K 8 .   ? 95.240  9.251   30.467  1.00 40.26  ? 7363 HOH A O     1 
HETATM 3763 O  O     A HOH K 8 .   ? 99.604  42.713  28.684  0.60 24.51  ? 7364 HOH A O     1 
HETATM 3764 O  O     B HOH K 8 .   ? 98.873  43.051  29.807  0.40 21.04  ? 7364 HOH A O     1 
HETATM 3765 O  O     A HOH K 8 .   ? 83.911  28.106  37.728  0.60 22.58  ? 7365 HOH A O     1 
HETATM 3766 O  O     B HOH K 8 .   ? 82.697  26.817  37.278  0.40 49.50  ? 7365 HOH A O     1 
HETATM 3767 O  O     . HOH K 8 .   ? 87.429  2.845   27.288  1.00 31.29  ? 7366 HOH A O     1 
HETATM 3768 O  O     . HOH K 8 .   ? 91.117  20.001  42.824  1.00 37.92  ? 7367 HOH A O     1 
HETATM 3769 O  O     . HOH K 8 .   ? 104.602 38.335  40.204  1.00 30.30  ? 7368 HOH A O     1 
HETATM 3770 O  O     . HOH K 8 .   ? 69.557  32.387  27.977  1.00 46.20  ? 7369 HOH A O     1 
HETATM 3771 O  O     . HOH K 8 .   ? 95.175  42.720  38.279  1.00 28.74  ? 7370 HOH A O     1 
HETATM 3772 O  O     . HOH K 8 .   ? 94.862  13.560  38.864  1.00 39.09  ? 7371 HOH A O     1 
HETATM 3773 O  O     . HOH K 8 .   ? 104.061 12.574  10.178  1.00 54.80  ? 7372 HOH A O     1 
HETATM 3774 O  O     . HOH K 8 .   ? 93.662  37.665  18.490  1.00 44.21  ? 7373 HOH A O     1 
HETATM 3775 O  O     . HOH K 8 .   ? 87.580  0.862   25.197  1.00 42.29  ? 7374 HOH A O     1 
HETATM 3776 O  O     . HOH K 8 .   ? 73.462  38.051  31.506  0.50 49.31  ? 7375 HOH A O     1 
HETATM 3777 O  O     B HOH K 8 .   ? 100.272 20.235  42.043  0.50 43.42  ? 7376 HOH A O     1 
HETATM 3778 O  O     . HOH K 8 .   ? 85.370  0.725   20.300  1.00 56.00  ? 7377 HOH A O     1 
HETATM 3779 O  O     . HOH K 8 .   ? 84.983  35.329  12.993  1.00 41.12  ? 7378 HOH A O     1 
HETATM 3780 O  O     A HOH K 8 .   ? 75.154  10.629  26.733  0.60 43.55  ? 7379 HOH A O     1 
HETATM 3781 O  O     B HOH K 8 .   ? 73.276  10.307  26.853  0.40 41.78  ? 7379 HOH A O     1 
HETATM 3782 O  O     . HOH K 8 .   ? 74.424  39.274  26.047  1.00 34.03  ? 7380 HOH A O     1 
HETATM 3783 O  O     . HOH K 8 .   ? 73.683  38.369  28.381  1.00 62.73  ? 7381 HOH A O     1 
HETATM 3784 O  O     . HOH K 8 .   ? 71.776  18.966  29.151  1.00 57.78  ? 7382 HOH A O     1 
HETATM 3785 O  O     . HOH K 8 .   ? 87.439  12.153  24.413  1.00 20.36  ? 7383 HOH A O     1 
HETATM 3786 O  O     . HOH K 8 .   ? 102.749 29.435  41.937  1.00 45.85  ? 7384 HOH A O     1 
HETATM 3787 O  O     . HOH K 8 .   ? 69.159  11.958  23.431  1.00 56.93  ? 7385 HOH A O     1 
HETATM 3788 O  O     . HOH K 8 .   ? 69.409  23.799  20.214  1.00 24.09  ? 7386 HOH A O     1 
HETATM 3789 O  O     A HOH K 8 .   ? 99.988  16.571  40.886  0.60 37.27  ? 7387 HOH A O     1 
HETATM 3790 O  O     B HOH K 8 .   ? 100.505 15.416  39.285  0.40 39.73  ? 7387 HOH A O     1 
HETATM 3791 O  O     A HOH K 8 .   ? 83.225  43.955  17.108  0.50 39.50  ? 7388 HOH A O     1 
HETATM 3792 O  O     B HOH K 8 .   ? 81.399  44.817  16.401  0.50 45.85  ? 7388 HOH A O     1 
HETATM 3793 O  O     . HOH K 8 .   ? 87.803  -1.259  26.837  1.00 40.90  ? 7389 HOH A O     1 
HETATM 3794 O  O     A HOH K 8 .   ? 77.108  17.132  29.291  0.70 31.20  ? 7390 HOH A O     1 
HETATM 3795 O  O     B HOH K 8 .   ? 78.167  16.222  30.541  0.30 27.60  ? 7390 HOH A O     1 
HETATM 3796 O  O     . HOH K 8 .   ? 72.035  25.492  27.170  1.00 31.75  ? 7391 HOH A O     1 
HETATM 3797 O  O     . HOH K 8 .   ? 87.478  29.045  2.465   0.50 40.30  ? 7392 HOH A O     1 
HETATM 3798 O  O     . HOH K 8 .   ? 78.650  39.850  33.709  1.00 34.55  ? 7393 HOH A O     1 
HETATM 3799 O  O     . HOH K 8 .   ? 91.384  39.507  24.375  1.00 27.29  ? 7394 HOH A O     1 
HETATM 3800 O  O     . HOH K 8 .   ? 77.844  23.614  29.145  1.00 40.50  ? 7395 HOH A O     1 
HETATM 3801 O  O     . HOH K 8 .   ? 90.594  21.241  4.825   1.00 31.47  ? 7396 HOH A O     1 
HETATM 3802 O  O     A HOH K 8 .   ? 94.182  18.327  43.432  0.70 27.37  ? 7397 HOH A O     1 
HETATM 3803 O  O     . HOH K 8 .   ? 91.397  41.223  30.997  1.00 33.55  ? 7398 HOH A O     1 
HETATM 3804 O  O     . HOH K 8 .   ? 75.030  23.017  25.871  1.00 22.78  ? 7399 HOH A O     1 
HETATM 3805 O  O     . HOH K 8 .   ? 84.486  25.469  2.804   1.00 37.00  ? 7400 HOH A O     1 
HETATM 3806 O  O     . HOH K 8 .   ? 84.153  42.313  29.650  1.00 31.24  ? 7401 HOH A O     1 
HETATM 3807 O  O     . HOH K 8 .   ? 78.301  4.890   26.778  1.00 41.76  ? 7402 HOH A O     1 
HETATM 3808 O  O     . HOH K 8 .   ? 70.125  23.203  26.510  0.50 41.63  ? 7403 HOH A O     1 
HETATM 3809 O  O     . HOH K 8 .   ? 84.079  31.862  41.571  1.00 42.52  ? 7404 HOH A O     1 
HETATM 3810 O  O     . HOH K 8 .   ? 111.744 32.928  24.637  1.00 60.58  ? 7405 HOH A O     1 
HETATM 3811 O  O     . HOH K 8 .   ? 99.049  9.797   34.637  0.50 40.60  ? 7406 HOH A O     1 
HETATM 3812 O  O     B HOH K 8 .   ? 97.844  31.347  9.052   0.50 30.95  ? 7407 HOH A O     1 
HETATM 3813 O  O     . HOH K 8 .   ? 81.822  6.803   13.327  1.00 39.53  ? 7408 HOH A O     1 
HETATM 3814 O  O     . HOH K 8 .   ? 86.857  33.983  8.945   1.00 58.27  ? 7409 HOH A O     1 
HETATM 3815 O  O     . HOH K 8 .   ? 79.502  12.447  8.988   0.50 36.92  ? 7410 HOH A O     1 
HETATM 3816 O  O     . HOH K 8 .   ? 87.235  39.081  16.896  0.50 36.98  ? 7411 HOH A O     1 
HETATM 3817 O  O     . HOH K 8 .   ? 81.123  13.080  37.099  0.50 43.28  ? 7412 HOH A O     1 
HETATM 3818 O  O     . HOH K 8 .   ? 98.160  40.777  25.575  1.00 31.52  ? 7413 HOH A O     1 
HETATM 3819 O  O     . HOH K 8 .   ? 95.108  3.165   14.708  1.00 44.20  ? 7414 HOH A O     1 
HETATM 3820 O  O     . HOH K 8 .   ? 109.822 29.652  33.826  0.50 50.28  ? 7415 HOH A O     1 
HETATM 3821 O  O     . HOH K 8 .   ? 81.641  6.998   10.608  0.50 43.19  ? 7416 HOH A O     1 
HETATM 3822 O  O     . HOH K 8 .   ? 79.007  30.577  37.443  1.00 49.27  ? 7417 HOH A O     1 
HETATM 3823 O  O     . HOH K 8 .   ? 76.639  30.703  36.213  0.50 44.42  ? 7418 HOH A O     1 
HETATM 3824 O  O     . HOH K 8 .   ? 102.646 9.681   13.893  0.50 40.54  ? 7419 HOH A O     1 
HETATM 3825 O  O     . HOH K 8 .   ? 97.609  7.668   21.244  1.00 54.07  ? 7420 HOH A O     1 
HETATM 3826 O  O     . HOH K 8 .   ? 102.218 16.588  1.520   1.00 55.82  ? 7421 HOH A O     1 
HETATM 3827 O  O     A HOH K 8 .   ? 84.959  3.336   19.108  0.50 28.94  ? 7422 HOH A O     1 
HETATM 3828 O  O     B HOH K 8 .   ? 83.457  3.552   19.193  0.50 25.13  ? 7422 HOH A O     1 
HETATM 3829 O  O     . HOH K 8 .   ? 88.022  41.961  31.938  1.00 53.37  ? 7423 HOH A O     1 
HETATM 3830 O  O     A HOH K 8 .   ? 105.387 19.253  29.429  0.70 36.36  ? 7424 HOH A O     1 
HETATM 3831 O  O     B HOH K 8 .   ? 107.416 19.625  28.449  0.30 34.00  ? 7424 HOH A O     1 
HETATM 3832 O  O     . HOH K 8 .   ? 106.495 30.404  33.823  1.00 39.86  ? 7425 HOH A O     1 
HETATM 3833 O  O     . HOH K 8 .   ? 98.347  6.922   18.803  1.00 42.44  ? 7426 HOH A O     1 
HETATM 3834 O  O     . HOH K 8 .   ? 78.888  21.180  29.233  1.00 46.83  ? 7427 HOH A O     1 
HETATM 3835 O  O     . HOH K 8 .   ? 78.085  29.240  8.708   1.00 31.11  ? 7428 HOH A O     1 
HETATM 3836 O  O     A HOH K 8 .   ? 100.823 21.014  0.284   0.60 31.47  ? 7429 HOH A O     1 
HETATM 3837 O  O     B HOH K 8 .   ? 99.055  21.552  -0.337  0.40 35.21  ? 7429 HOH A O     1 
HETATM 3838 O  O     . HOH K 8 .   ? 80.175  12.715  6.646   0.50 53.91  ? 7430 HOH A O     1 
HETATM 3839 O  O     B HOH K 8 .   ? 78.059  6.353   20.296  0.40 32.77  ? 7431 HOH A O     1 
HETATM 3840 O  O     . HOH K 8 .   ? 86.394  45.785  30.978  1.00 57.91  ? 7432 HOH A O     1 
HETATM 3841 O  O     A HOH K 8 .   ? 94.821  35.069  42.492  0.60 28.68  ? 7433 HOH A O     1 
HETATM 3842 O  O     B HOH K 8 .   ? 93.672  36.155  43.912  0.40 29.51  ? 7433 HOH A O     1 
HETATM 3843 O  O     . HOH K 8 .   ? 89.101  32.669  8.813   1.00 44.67  ? 7434 HOH A O     1 
HETATM 3844 O  O     A HOH K 8 .   ? 72.969  43.557  27.198  0.60 43.99  ? 7435 HOH A O     1 
HETATM 3845 O  O     B HOH K 8 .   ? 73.438  41.806  26.989  0.40 44.42  ? 7435 HOH A O     1 
HETATM 3846 O  O     . HOH K 8 .   ? 102.806 14.847  30.777  1.00 52.81  ? 7436 HOH A O     1 
HETATM 3847 O  O     . HOH K 8 .   ? 77.905  43.370  13.229  1.00 54.55  ? 7437 HOH A O     1 
HETATM 3848 O  O     . HOH K 8 .   ? 97.370  -1.704  21.968  1.00 64.39  ? 7438 HOH A O     1 
HETATM 3849 O  O     . HOH K 8 .   ? 78.331  11.340  25.551  1.00 25.56  ? 7439 HOH A O     1 
HETATM 3850 O  O     . HOH K 8 .   ? 81.714  10.799  32.059  1.00 55.35  ? 7440 HOH A O     1 
HETATM 3851 O  O     . HOH K 8 .   ? 113.355 27.536  26.064  0.50 37.39  ? 7441 HOH A O     1 
HETATM 3852 O  O     . HOH K 8 .   ? 72.738  23.146  27.208  1.00 64.05  ? 7442 HOH A O     1 
HETATM 3853 O  O     . HOH K 8 .   ? 107.326 31.691  31.461  1.00 54.99  ? 7443 HOH A O     1 
HETATM 3854 O  O     . HOH K 8 .   ? 86.938  24.348  38.890  1.00 24.86  ? 7444 HOH A O     1 
HETATM 3855 O  O     . HOH K 8 .   ? 91.310  38.697  18.589  1.00 57.50  ? 7445 HOH A O     1 
HETATM 3856 O  O     . HOH K 8 .   ? 102.022 17.815  35.413  0.50 33.73  ? 7446 HOH A O     1 
HETATM 3857 O  O     . HOH K 8 .   ? 99.714  39.512  20.242  0.50 49.65  ? 7447 HOH A O     1 
HETATM 3858 O  O     . HOH K 8 .   ? 82.158  35.214  13.127  1.00 33.06  ? 7448 HOH A O     1 
HETATM 3859 O  O     A HOH K 8 .   ? 88.901  43.787  33.930  0.60 43.69  ? 7449 HOH A O     1 
HETATM 3860 O  O     B HOH K 8 .   ? 87.267  43.954  34.454  0.40 32.24  ? 7449 HOH A O     1 
HETATM 3861 O  O     . HOH K 8 .   ? 81.774  42.908  34.786  1.00 51.27  ? 7450 HOH A O     1 
HETATM 3862 O  O     . HOH K 8 .   ? 96.235  37.846  19.253  0.50 47.66  ? 7451 HOH A O     1 
HETATM 3863 O  O     . HOH K 8 .   ? 107.332 14.558  8.428   1.00 53.88  ? 7452 HOH A O     1 
HETATM 3864 O  O     . HOH K 8 .   ? 90.313  16.156  42.472  1.00 51.51  ? 7453 HOH A O     1 
HETATM 3865 O  O     . HOH K 8 .   ? 74.553  41.360  13.246  0.50 34.19  ? 7454 HOH A O     1 
HETATM 3866 O  O     . HOH K 8 .   ? 106.323 16.551  1.109   0.50 42.84  ? 7455 HOH A O     1 
HETATM 3867 O  O     A HOH K 8 .   ? 89.642  35.377  9.419   0.60 54.89  ? 7456 HOH A O     1 
HETATM 3868 O  O     B HOH K 8 .   ? 89.536  37.135  6.724   0.40 47.60  ? 7456 HOH A O     1 
HETATM 3869 O  O     . HOH K 8 .   ? 86.715  36.382  10.939  0.50 49.57  ? 7457 HOH A O     1 
HETATM 3870 O  O     A HOH K 8 .   ? 98.373  28.202  -0.891  0.50 47.16  ? 7458 HOH A O     1 
HETATM 3871 O  O     B HOH K 8 .   ? 99.807  29.087  0.044   0.50 59.22  ? 7458 HOH A O     1 
HETATM 3872 O  O     A HOH K 8 .   ? 75.738  19.345  28.202  0.70 35.89  ? 7459 HOH A O     1 
HETATM 3873 O  O     B HOH K 8 .   ? 77.592  18.894  28.742  0.30 26.90  ? 7459 HOH A O     1 
HETATM 3874 O  O     A HOH K 8 .   ? 96.025  18.796  50.346  0.50 38.46  ? 7460 HOH A O     1 
HETATM 3875 O  O     B HOH K 8 .   ? 97.761  19.133  50.027  0.50 46.28  ? 7460 HOH A O     1 
HETATM 3876 O  O     . HOH K 8 .   ? 81.885  19.582  5.795   1.00 35.49  ? 7461 HOH A O     1 
HETATM 3877 O  O     . HOH K 8 .   ? 97.453  19.043  1.794   1.00 54.86  ? 7462 HOH A O     1 
HETATM 3878 O  O     . HOH K 8 .   ? 101.146 40.718  40.073  1.00 44.82  ? 7463 HOH A O     1 
HETATM 3879 O  O     . HOH K 8 .   ? 100.030 18.260  0.426   1.00 63.69  ? 7464 HOH A O     1 
HETATM 3880 O  O     . HOH K 8 .   ? 73.212  38.216  34.172  1.00 60.53  ? 7465 HOH A O     1 
HETATM 3881 O  O     A HOH K 8 .   ? 83.514  28.638  42.811  0.60 48.00  ? 7466 HOH A O     1 
HETATM 3882 O  O     B HOH K 8 .   ? 82.154  29.072  43.999  0.40 53.88  ? 7466 HOH A O     1 
HETATM 3883 O  O     A HOH K 8 .   ? 78.968  6.164   17.898  0.60 40.23  ? 7467 HOH A O     1 
HETATM 3884 O  O     B HOH K 8 .   ? 78.357  7.734   17.314  0.40 27.39  ? 7467 HOH A O     1 
HETATM 3885 O  O     . HOH K 8 .   ? 104.786 8.229   18.853  1.00 69.21  ? 7468 HOH A O     1 
HETATM 3886 O  O     . HOH K 8 .   ? 98.393  4.745   7.647   1.00 63.45  ? 7469 HOH A O     1 
HETATM 3887 O  O     . HOH K 8 .   ? 99.443  9.578   22.271  0.50 41.66  ? 7470 HOH A O     1 
HETATM 3888 O  O     . HOH K 8 .   ? 113.949 22.214  15.429  0.50 46.30  ? 7471 HOH A O     1 
HETATM 3889 O  O     . HOH K 8 .   ? 102.913 35.190  25.010  1.00 52.48  ? 7472 HOH A O     1 
HETATM 3890 O  O     A HOH K 8 .   ? 94.372  28.405  47.442  0.50 38.90  ? 7473 HOH A O     1 
HETATM 3891 O  O     B HOH K 8 .   ? 96.310  28.861  48.334  0.50 52.34  ? 7473 HOH A O     1 
HETATM 3892 O  O     A HOH K 8 .   ? 79.329  44.618  16.886  0.50 48.36  ? 7474 HOH A O     1 
HETATM 3893 O  O     A HOH K 8 .   ? 85.870  41.242  42.411  0.60 41.22  ? 7475 HOH A O     1 
HETATM 3894 O  O     . HOH K 8 .   ? 110.885 30.667  17.878  1.00 58.25  ? 7476 HOH A O     1 
HETATM 3895 O  O     . HOH K 8 .   ? 105.170 35.252  29.389  0.50 36.15  ? 7477 HOH A O     1 
HETATM 3896 O  O     A HOH K 8 .   ? 94.330  2.365   27.818  0.60 39.73  ? 7478 HOH A O     1 
HETATM 3897 O  O     B HOH K 8 .   ? 96.026  2.542   27.032  0.40 34.10  ? 7478 HOH A O     1 
HETATM 3898 O  O     . HOH K 8 .   ? 100.815 9.620   27.029  1.00 60.81  ? 7479 HOH A O     1 
HETATM 3899 O  O     . HOH K 8 .   ? 77.230  12.272  30.071  0.50 40.29  ? 7480 HOH A O     1 
HETATM 3900 O  O     B HOH K 8 .   ? 94.862  33.568  9.036   0.50 38.64  ? 7481 HOH A O     1 
HETATM 3901 O  O     B HOH K 8 .   ? 73.399  39.813  23.127  0.50 24.32  ? 7482 HOH A O     1 
HETATM 3902 O  O     . HOH K 8 .   ? 83.376  12.498  33.265  1.00 54.92  ? 7483 HOH A O     1 
HETATM 3903 O  O     . HOH K 8 .   ? 93.501  29.319  49.769  1.00 72.77  ? 7484 HOH A O     1 
HETATM 3904 O  O     A HOH K 8 .   ? 90.528  37.378  44.829  0.50 44.71  ? 7485 HOH A O     1 
HETATM 3905 O  O     B HOH K 8 .   ? 89.524  36.627  45.527  0.50 52.70  ? 7485 HOH A O     1 
HETATM 3906 O  O     . HOH K 8 .   ? 79.188  42.680  34.312  0.50 42.14  ? 7486 HOH A O     1 
HETATM 3907 O  O     A HOH K 8 .   ? 80.533  28.382  37.107  0.50 47.77  ? 7487 HOH A O     1 
HETATM 3908 O  O     B HOH K 8 .   ? 79.245  28.337  36.180  0.50 48.41  ? 7487 HOH A O     1 
HETATM 3909 O  O     . HOH K 8 .   ? 83.354  37.670  16.398  1.00 50.89  ? 7488 HOH A O     1 
HETATM 3910 O  O     . HOH K 8 .   ? 91.736  8.902   33.071  1.00 50.49  ? 7489 HOH A O     1 
HETATM 3911 O  O     . HOH K 8 .   ? 98.083  2.548   9.367   0.50 44.81  ? 7490 HOH A O     1 
HETATM 3912 O  O     . HOH K 8 .   ? 93.032  26.685  -6.246  1.00 35.05  ? 7491 HOH A O     1 
HETATM 3913 O  O     . HOH K 8 .   ? 81.004  17.383  31.787  1.00 46.86  ? 7492 HOH A O     1 
HETATM 3914 O  O     . HOH K 8 .   ? 98.122  39.728  23.065  1.00 50.29  ? 7493 HOH A O     1 
HETATM 3915 O  O     . HOH K 8 .   ? 74.709  40.977  10.904  0.50 44.19  ? 7494 HOH A O     1 
HETATM 3916 O  O     . HOH K 8 .   ? 106.354 13.947  10.857  1.00 59.16  ? 7495 HOH A O     1 
HETATM 3917 O  O     . HOH K 8 .   ? 81.563  13.562  3.964   0.50 52.96  ? 7496 HOH A O     1 
HETATM 3918 O  O     . HOH K 8 .   ? 80.172  40.584  15.734  1.00 44.40  ? 7497 HOH A O     1 
HETATM 3919 O  O     . HOH K 8 .   ? 103.112 37.311  44.410  1.00 74.95  ? 7498 HOH A O     1 
HETATM 3920 O  O     . HOH K 8 .   ? 69.154  25.595  26.000  1.00 64.78  ? 7499 HOH A O     1 
HETATM 3921 O  O     . HOH K 8 .   ? 82.456  39.301  12.213  0.50 38.94  ? 7500 HOH A O     1 
HETATM 3922 O  O     . HOH K 8 .   ? 97.478  8.075   29.013  1.00 57.90  ? 7501 HOH A O     1 
HETATM 3923 O  O     A HOH K 8 .   ? 92.849  38.447  44.018  0.60 44.10  ? 7502 HOH A O     1 
HETATM 3924 O  O     B HOH K 8 .   ? 94.574  38.574  44.670  0.40 40.18  ? 7502 HOH A O     1 
HETATM 3925 O  O     . HOH K 8 .   ? 78.590  32.346  5.704   1.00 48.53  ? 7503 HOH A O     1 
HETATM 3926 O  O     . HOH K 8 .   ? 84.896  29.869  40.100  1.00 52.30  ? 7504 HOH A O     1 
HETATM 3927 O  O     . HOH K 8 .   ? 97.926  3.231   15.760  1.00 50.63  ? 7505 HOH A O     1 
HETATM 3928 O  O     A HOH K 8 .   ? 82.768  31.508  43.842  0.50 53.41  ? 7506 HOH A O     1 
HETATM 3929 O  O     B HOH K 8 .   ? 82.565  33.487  43.692  0.50 45.01  ? 7506 HOH A O     1 
HETATM 3930 O  O     . HOH K 8 .   ? 80.855  2.141   20.352  1.00 55.62  ? 7507 HOH A O     1 
HETATM 3931 O  O     . HOH K 8 .   ? 109.306 33.827  13.894  0.50 47.80  ? 7508 HOH A O     1 
HETATM 3932 O  O     . HOH K 8 .   ? 86.242  8.762   36.170  0.50 54.20  ? 7509 HOH A O     1 
HETATM 3933 O  O     . HOH K 8 .   ? 107.571 16.843  16.673  0.50 39.57  ? 7510 HOH A O     1 
HETATM 3934 O  O     . HOH K 8 .   ? 80.319  20.168  32.466  1.00 53.99  ? 7511 HOH A O     1 
HETATM 3935 O  O     . HOH K 8 .   ? 92.380  13.578  37.961  0.50 54.67  ? 7512 HOH A O     1 
HETATM 3936 O  O     . HOH K 8 .   ? 94.751  7.943   33.937  0.50 45.70  ? 7513 HOH A O     1 
HETATM 3937 O  O     . HOH K 8 .   ? 97.343  1.118   17.934  0.50 35.62  ? 7514 HOH A O     1 
HETATM 3938 O  O     . HOH K 8 .   ? 100.285 29.746  3.170   1.00 54.46  ? 7515 HOH A O     1 
HETATM 3939 O  O     . HOH K 8 .   ? 74.629  38.485  8.572   0.50 39.15  ? 7516 HOH A O     1 
HETATM 3940 O  O     . HOH K 8 .   ? 96.050  38.334  23.295  1.00 32.82  ? 7517 HOH A O     1 
HETATM 3941 O  O     . HOH K 8 .   ? 85.848  1.633   15.995  1.00 47.57  ? 7518 HOH A O     1 
HETATM 3942 O  O     . HOH K 8 .   ? 107.030 38.333  41.620  0.50 42.28  ? 7519 HOH A O     1 
HETATM 3943 O  O     . HOH K 8 .   ? 88.373  9.520   34.620  0.50 52.52  ? 7520 HOH A O     1 
HETATM 3944 O  O     . HOH K 8 .   ? 93.241  12.010  4.031   0.50 43.22  ? 7521 HOH A O     1 
HETATM 3945 O  O     . HOH K 8 .   ? 84.193  2.749   14.202  0.50 36.71  ? 7522 HOH A O     1 
HETATM 3946 O  O     A HOH K 8 .   ? 68.483  10.768  25.720  0.50 47.52  ? 7523 HOH A O     1 
HETATM 3947 O  O     B HOH K 8 .   ? 68.609  12.059  26.583  0.50 61.87  ? 7523 HOH A O     1 
HETATM 3948 O  O     . HOH K 8 .   ? 73.029  41.128  29.210  0.50 40.06  ? 7524 HOH A O     1 
HETATM 3949 O  O     . HOH K 8 .   ? 89.360  2.290   29.234  1.00 41.00  ? 7525 HOH A O     1 
HETATM 3950 O  O     . HOH K 8 .   ? 79.870  21.195  35.136  1.00 53.10  ? 7526 HOH A O     1 
HETATM 3951 O  O     . HOH K 8 .   ? 100.938 37.420  11.734  0.50 48.52  ? 7527 HOH A O     1 
HETATM 3952 O  O     . HOH K 8 .   ? 108.065 35.816  31.278  1.00 45.98  ? 7528 HOH A O     1 
HETATM 3953 O  O     . HOH K 8 .   ? 95.407  41.840  25.901  1.00 48.00  ? 7529 HOH A O     1 
HETATM 3954 O  O     . HOH K 8 .   ? 98.718  7.498   23.742  0.50 39.56  ? 7530 HOH A O     1 
HETATM 3955 O  O     . HOH K 8 .   ? 75.173  23.467  29.034  1.00 60.53  ? 7531 HOH A O     1 
HETATM 3956 O  O     . HOH K 8 .   ? 74.976  39.737  33.001  1.00 58.07  ? 7532 HOH A O     1 
HETATM 3957 O  O     . HOH K 8 .   ? 87.021  -1.132  29.413  0.50 35.90  ? 7533 HOH A O     1 
HETATM 3958 O  O     . HOH K 8 .   ? 83.690  2.606   11.564  0.50 48.68  ? 7534 HOH A O     1 
HETATM 3959 O  O     . HOH K 8 .   ? 81.908  8.871   34.138  0.50 46.63  ? 7535 HOH A O     1 
HETATM 3960 O  O     . HOH K 8 .   ? 108.158 15.092  35.042  0.50 48.32  ? 7536 HOH A O     1 
HETATM 3961 O  O     . HOH K 8 .   ? 99.585  1.858   14.151  0.50 54.39  ? 7537 HOH A O     1 
HETATM 3962 O  O     . HOH L 8 .   ? 74.885  12.196  5.602   1.00 42.59  ? 4501 HOH B O     1 
HETATM 3963 O  O     . HOH L 8 .   ? 79.807  27.508  7.509   1.00 38.59  ? 4502 HOH B O     1 
HETATM 3964 O  O     . HOH L 8 .   ? 78.985  19.067  5.938   1.00 32.81  ? 4503 HOH B O     1 
HETATM 3965 O  O     . HOH L 8 .   ? 52.550  15.650  20.110  0.50 38.12  ? 4504 HOH B O     1 
HETATM 3966 O  O     . HOH L 8 .   ? 66.150  24.847  19.866  1.00 38.22  ? 4505 HOH B O     1 
HETATM 3967 O  O     . HOH L 8 .   ? 52.837  2.565   16.681  1.00 60.78  ? 4506 HOH B O     1 
HETATM 3968 O  O     . HOH L 8 .   ? 67.410  29.807  -2.757  0.50 39.36  ? 4507 HOH B O     1 
HETATM 3969 O  O     . HOH L 8 .   ? 72.434  25.345  -0.673  1.00 52.27  ? 4508 HOH B O     1 
HETATM 3970 O  O     A HOH L 8 .   ? 56.761  25.083  -1.525  0.60 39.48  ? 4509 HOH B O     1 
HETATM 3971 O  O     B HOH L 8 .   ? 55.788  25.885  -0.605  0.40 44.37  ? 4509 HOH B O     1 
HETATM 3972 O  O     . HOH L 8 .   ? 72.000  14.323  2.297   0.50 36.22  ? 4510 HOH B O     1 
HETATM 3973 O  O     . HOH L 8 .   ? 57.351  17.676  2.339   1.00 42.48  ? 4511 HOH B O     1 
HETATM 3974 O  O     . HOH L 8 .   ? 68.386  19.799  0.072   1.00 34.81  ? 4512 HOH B O     1 
HETATM 3975 O  O     . HOH L 8 .   ? 74.078  30.753  1.157   1.00 50.00  ? 4513 HOH B O     1 
HETATM 3976 O  O     . HOH L 8 .   ? 69.814  10.298  21.199  1.00 33.54  ? 4514 HOH B O     1 
HETATM 3977 O  O     . HOH L 8 .   ? 67.233  25.473  -5.601  0.50 37.40  ? 4515 HOH B O     1 
HETATM 3978 O  O     . HOH L 8 .   ? 61.726  32.611  11.051  1.00 48.38  ? 4516 HOH B O     1 
HETATM 3979 O  O     . HOH L 8 .   ? 71.331  0.205   19.337  1.00 41.54  ? 4517 HOH B O     1 
HETATM 3980 O  O     . HOH L 8 .   ? 54.264  4.944   19.735  0.50 41.48  ? 4518 HOH B O     1 
HETATM 3981 O  O     . HOH L 8 .   ? 62.348  1.490   11.663  1.00 52.40  ? 4519 HOH B O     1 
HETATM 3982 O  O     . HOH L 8 .   ? 72.932  6.108   16.330  1.00 40.80  ? 4520 HOH B O     1 
HETATM 3983 O  O     . HOH L 8 .   ? 56.024  21.046  14.682  0.50 39.64  ? 4521 HOH B O     1 
HETATM 3984 O  O     . HOH L 8 .   ? 76.580  28.560  6.452   1.00 35.71  ? 4522 HOH B O     1 
HETATM 3985 O  O     . HOH L 8 .   ? 76.950  9.285   15.314  1.00 43.96  ? 4523 HOH B O     1 
HETATM 3986 O  O     . HOH L 8 .   ? 71.810  25.020  20.014  1.00 21.54  ? 4524 HOH B O     1 
HETATM 3987 O  O     . HOH L 8 .   ? 61.226  25.998  4.548   1.00 45.02  ? 4525 HOH B O     1 
HETATM 3988 O  O     . HOH L 8 .   ? 67.358  -3.708  12.093  0.50 47.23  ? 4526 HOH B O     1 
HETATM 3989 O  O     . HOH L 8 .   ? 53.175  23.366  8.835   0.50 45.10  ? 4527 HOH B O     1 
HETATM 3990 O  O     . HOH L 8 .   ? 70.273  2.527   0.505   1.00 85.98  ? 4528 HOH B O     1 
HETATM 3991 O  O     . HOH L 8 .   ? 56.185  22.227  -2.981  0.50 37.80  ? 4529 HOH B O     1 
HETATM 3992 O  O     . HOH L 8 .   ? 55.257  17.572  16.773  1.00 47.25  ? 4530 HOH B O     1 
HETATM 3993 O  O     . HOH L 8 .   ? 76.545  29.393  2.221   1.00 56.74  ? 4531 HOH B O     1 
HETATM 3994 O  O     . HOH L 8 .   ? 71.972  38.115  8.964   1.00 46.47  ? 4532 HOH B O     1 
HETATM 3995 O  O     A HOH L 8 .   ? 72.917  35.996  12.320  0.60 33.04  ? 4533 HOH B O     1 
HETATM 3996 O  O     B HOH L 8 .   ? 73.684  35.095  13.737  0.40 24.90  ? 4533 HOH B O     1 
HETATM 3997 O  O     . HOH L 8 .   ? 80.620  9.946   13.343  1.00 28.34  ? 4534 HOH B O     1 
HETATM 3998 O  O     . HOH L 8 .   ? 58.343  25.270  -12.090 0.50 51.65  ? 4535 HOH B O     1 
HETATM 3999 O  O     . HOH L 8 .   ? 64.751  31.740  17.108  1.00 36.83  ? 4536 HOH B O     1 
HETATM 4000 O  O     . HOH L 8 .   ? 59.582  18.271  23.621  0.50 34.40  ? 4537 HOH B O     1 
HETATM 4001 O  O     A HOH L 8 .   ? 64.123  26.671  18.677  0.60 34.22  ? 4538 HOH B O     1 
HETATM 4002 O  O     B HOH L 8 .   ? 63.420  28.260  19.919  0.40 39.97  ? 4538 HOH B O     1 
HETATM 4003 O  O     . HOH L 8 .   ? 71.800  32.661  0.135   0.50 33.30  ? 4539 HOH B O     1 
HETATM 4004 O  O     . HOH L 8 .   ? 58.975  8.562   7.329   0.50 46.31  ? 4540 HOH B O     1 
HETATM 4005 O  O     . HOH L 8 .   ? 67.633  1.398   20.396  1.00 45.56  ? 4541 HOH B O     1 
HETATM 4006 O  O     . HOH L 8 .   ? 68.394  30.702  15.963  1.00 31.54  ? 4542 HOH B O     1 
HETATM 4007 O  O     B HOH L 8 .   ? 79.844  23.106  7.059   0.40 24.65  ? 4543 HOH B O     1 
HETATM 4008 O  O     . HOH L 8 .   ? 76.795  18.549  10.425  1.00 36.96  ? 4544 HOH B O     1 
HETATM 4009 O  O     . HOH L 8 .   ? 69.282  28.307  13.092  1.00 24.86  ? 4545 HOH B O     1 
HETATM 4010 O  O     . HOH L 8 .   ? 56.230  16.500  13.518  1.00 49.30  ? 4546 HOH B O     1 
HETATM 4011 O  O     . HOH L 8 .   ? 63.088  24.096  1.729   1.00 39.42  ? 4547 HOH B O     1 
HETATM 4012 O  O     . HOH L 8 .   ? 62.326  16.625  17.347  1.00 29.93  ? 4548 HOH B O     1 
HETATM 4013 O  O     . HOH L 8 .   ? 64.471  11.776  11.181  1.00 39.71  ? 4549 HOH B O     1 
HETATM 4014 O  O     . HOH L 8 .   ? 70.548  30.931  14.453  1.00 25.54  ? 4550 HOH B O     1 
HETATM 4015 O  O     . HOH L 8 .   ? 52.218  12.516  14.014  1.00 56.30  ? 4551 HOH B O     1 
HETATM 4016 O  O     . HOH L 8 .   ? 71.748  30.807  7.406   1.00 28.38  ? 4552 HOH B O     1 
HETATM 4017 O  O     . HOH L 8 .   ? 71.924  4.312   14.326  1.00 45.92  ? 4553 HOH B O     1 
HETATM 4018 O  O     A HOH L 8 .   ? 65.177  30.545  0.345   0.50 32.32  ? 4554 HOH B O     1 
HETATM 4019 O  O     B HOH L 8 .   ? 65.824  32.908  0.184   0.50 37.66  ? 4554 HOH B O     1 
HETATM 4020 O  O     . HOH L 8 .   ? 75.828  24.862  1.899   1.00 46.34  ? 4555 HOH B O     1 
HETATM 4021 O  O     . HOH L 8 .   ? 56.419  21.078  21.024  1.00 53.33  ? 4556 HOH B O     1 
HETATM 4022 O  O     . HOH L 8 .   ? 73.909  30.521  5.746   1.00 33.06  ? 4557 HOH B O     1 
HETATM 4023 O  O     . HOH L 8 .   ? 60.963  3.475   10.599  1.00 47.97  ? 4558 HOH B O     1 
HETATM 4024 O  O     . HOH L 8 .   ? 67.792  34.008  2.321   1.00 45.79  ? 4559 HOH B O     1 
HETATM 4025 O  O     . HOH L 8 .   ? 55.226  18.997  8.394   1.00 50.16  ? 4560 HOH B O     1 
HETATM 4026 O  O     . HOH L 8 .   ? 70.636  20.900  -1.062  1.00 47.32  ? 4561 HOH B O     1 
HETATM 4027 O  O     . HOH L 8 .   ? 63.330  13.344  1.163   1.00 55.75  ? 4562 HOH B O     1 
HETATM 4028 O  O     . HOH L 8 .   ? 67.823  25.053  23.840  1.00 66.43  ? 4563 HOH B O     1 
HETATM 4029 O  O     . HOH L 8 .   ? 72.178  2.191   9.977   1.00 50.82  ? 4564 HOH B O     1 
HETATM 4030 O  O     . HOH L 8 .   ? 58.479  29.384  9.369   1.00 42.90  ? 4565 HOH B O     1 
HETATM 4031 O  O     . HOH L 8 .   ? 75.261  31.378  8.169   1.00 30.81  ? 4566 HOH B O     1 
HETATM 4032 O  O     . HOH L 8 .   ? 65.952  35.050  3.865   1.00 44.74  ? 4567 HOH B O     1 
HETATM 4033 O  O     . HOH L 8 .   ? 61.830  25.438  -6.098  0.50 39.02  ? 4568 HOH B O     1 
HETATM 4034 O  O     . HOH L 8 .   ? 52.574  23.191  3.246   1.00 72.81  ? 4569 HOH B O     1 
HETATM 4035 O  O     . HOH L 8 .   ? 64.110  13.509  23.606  1.00 49.65  ? 4570 HOH B O     1 
HETATM 4036 O  O     . HOH L 8 .   ? 57.592  19.545  13.086  1.00 43.26  ? 4571 HOH B O     1 
HETATM 4037 O  O     A HOH L 8 .   ? 60.904  29.795  3.299   0.60 45.93  ? 4572 HOH B O     1 
HETATM 4038 O  O     B HOH L 8 .   ? 61.826  28.443  2.695   0.40 33.69  ? 4572 HOH B O     1 
HETATM 4039 O  O     . HOH L 8 .   ? 64.462  36.181  10.300  1.00 60.91  ? 4573 HOH B O     1 
HETATM 4040 O  O     . HOH L 8 .   ? 75.042  22.178  0.300   1.00 41.75  ? 4574 HOH B O     1 
HETATM 4041 O  O     . HOH L 8 .   ? 63.715  13.481  4.735   1.00 65.21  ? 4575 HOH B O     1 
HETATM 4042 O  O     . HOH L 8 .   ? 53.656  11.269  7.822   1.00 64.23  ? 4576 HOH B O     1 
HETATM 4043 O  O     . HOH L 8 .   ? 60.573  12.425  23.256  1.00 42.69  ? 4577 HOH B O     1 
HETATM 4044 O  O     . HOH L 8 .   ? 73.803  18.181  0.855   0.50 41.90  ? 4578 HOH B O     1 
HETATM 4045 O  O     . HOH L 8 .   ? 64.051  25.573  21.632  1.00 50.47  ? 4579 HOH B O     1 
HETATM 4046 O  O     . HOH L 8 .   ? 78.961  14.608  5.180   1.00 66.99  ? 4580 HOH B O     1 
HETATM 4047 O  O     A HOH L 8 .   ? 74.489  37.861  5.958   0.60 45.61  ? 4581 HOH B O     1 
HETATM 4048 O  O     B HOH L 8 .   ? 76.311  36.649  4.926   0.40 35.80  ? 4581 HOH B O     1 
HETATM 4049 O  O     . HOH L 8 .   ? 60.959  14.988  -5.572  0.50 53.09  ? 4582 HOH B O     1 
HETATM 4050 O  O     . HOH L 8 .   ? 73.040  3.106   12.275  1.00 74.04  ? 4583 HOH B O     1 
HETATM 4051 O  O     . HOH L 8 .   ? 61.689  25.130  -8.767  0.50 42.46  ? 4584 HOH B O     1 
HETATM 4052 O  O     . HOH L 8 .   ? 68.800  36.442  1.728   1.00 55.57  ? 4585 HOH B O     1 
HETATM 4053 O  O     . HOH L 8 .   ? 79.063  17.227  3.803   1.00 52.26  ? 4586 HOH B O     1 
HETATM 4054 O  O     A HOH L 8 .   ? 65.684  9.769   21.637  0.60 56.09  ? 4587 HOH B O     1 
HETATM 4055 O  O     B HOH L 8 .   ? 64.927  10.939  22.831  0.40 39.78  ? 4587 HOH B O     1 
HETATM 4056 O  O     . HOH L 8 .   ? 69.329  32.732  -1.670  1.00 71.69  ? 4588 HOH B O     1 
HETATM 4057 O  O     . HOH L 8 .   ? 65.222  12.104  6.552   0.50 42.71  ? 4589 HOH B O     1 
HETATM 4058 O  O     . HOH L 8 .   ? 74.896  31.738  3.553   1.00 59.95  ? 4590 HOH B O     1 
HETATM 4059 O  O     . HOH L 8 .   ? 65.572  13.189  2.613   1.00 65.57  ? 4591 HOH B O     1 
HETATM 4060 O  O     . HOH L 8 .   ? 80.574  28.153  4.732   1.00 44.38  ? 4592 HOH B O     1 
HETATM 4061 O  O     . HOH L 8 .   ? 68.925  17.163  -0.531  1.00 55.47  ? 4593 HOH B O     1 
HETATM 4062 O  O     . HOH L 8 .   ? 77.593  30.027  4.502   1.00 57.19  ? 4594 HOH B O     1 
HETATM 4063 O  O     . HOH L 8 .   ? 74.659  7.691   14.000  0.50 39.34  ? 4595 HOH B O     1 
HETATM 4064 O  O     . HOH L 8 .   ? 54.084  19.612  21.054  0.50 46.64  ? 4596 HOH B O     1 
HETATM 4065 O  O     . HOH L 8 .   ? 67.869  9.755   7.993   1.00 54.17  ? 4597 HOH B O     1 
HETATM 4066 O  O     . HOH L 8 .   ? 55.832  18.793  11.143  0.50 49.62  ? 4598 HOH B O     1 
HETATM 4067 O  O     . HOH L 8 .   ? 65.214  10.574  8.755   1.00 62.18  ? 4599 HOH B O     1 
HETATM 4068 O  O     . HOH L 8 .   ? 52.687  20.568  2.885   1.00 69.69  ? 4600 HOH B O     1 
HETATM 4069 O  O     . HOH L 8 .   ? 67.930  14.476  0.504   0.50 42.53  ? 4601 HOH B O     1 
HETATM 4070 O  O     . HOH L 8 .   ? 64.824  25.457  24.211  0.50 45.15  ? 4602 HOH B O     1 
HETATM 4071 O  O     . HOH L 8 .   ? 52.231  11.907  10.054  1.00 60.51  ? 4603 HOH B O     1 
HETATM 4072 O  O     . HOH L 8 .   ? 63.772  9.434   6.772   0.50 53.65  ? 4604 HOH B O     1 
HETATM 4073 O  O     . HOH L 8 .   ? 77.236  22.356  -1.544  0.50 37.68  ? 4605 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . ALA A 3   ? 0.8734 0.7385 1.0105 0.0700  -0.0466 -0.0340 6798 ALA A N   
2    C  CA  . ALA A 3   ? 0.8891 0.7246 1.0398 0.0730  -0.0514 -0.0417 6798 ALA A CA  
3    C  C   . ALA A 3   ? 0.8622 0.6818 1.0024 0.0566  -0.0488 -0.0339 6798 ALA A C   
4    O  O   . ALA A 3   ? 0.9073 0.7001 1.0541 0.0526  -0.0552 -0.0212 6798 ALA A O   
5    C  CB  . ALA A 3   ? 0.8907 0.7356 1.0503 0.0826  -0.0482 -0.0677 6798 ALA A CB  
6    N  N   . SER A 4   ? 0.8145 0.6508 0.9401 0.0472  -0.0400 -0.0407 6799 SER A N   
7    C  CA  . SER A 4   ? 0.7692 0.5971 0.8862 0.0323  -0.0368 -0.0354 6799 SER A CA  
8    C  C   . SER A 4   ? 0.7088 0.5344 0.8165 0.0229  -0.0370 -0.0120 6799 SER A C   
9    O  O   . SER A 4   ? 0.6499 0.4921 0.7482 0.0249  -0.0357 -0.0043 6799 SER A O   
10   C  CB  . SER A 4   ? 0.7987 0.6474 0.9023 0.0272  -0.0287 -0.0468 6799 SER A CB  
11   O  OG  . SER A 4   ? 0.8336 0.6778 0.9308 0.0145  -0.0262 -0.0423 6799 SER A OG  
12   N  N   . SER A 5   ? 0.6696 0.4773 0.7797 0.0123  -0.0385 -0.0018 6800 SER A N   
13   C  CA  . SER A 5   ? 0.6404 0.4489 0.7402 0.0021  -0.0373 0.0205  6800 SER A CA  
14   C  C   . SER A 5   ? 0.5666 0.4022 0.6473 -0.0030 -0.0288 0.0206  6800 SER A C   
15   O  O   . SER A 5   ? 0.5535 0.3990 0.6223 -0.0052 -0.0281 0.0347  6800 SER A O   
16   C  CB  . SER A 5   ? 0.6934 0.4837 0.7999 -0.0104 -0.0381 0.0290  6800 SER A CB  
17   O  OG  . SER A 5   ? 0.7342 0.5309 0.8290 -0.0210 -0.0350 0.0499  6800 SER A OG  
18   N  N   . GLN A 6   ? 0.4857 0.3321 0.5631 -0.0044 -0.0235 0.0051  6801 GLN A N   
19   C  CA  . GLN A 6   ? 0.4390 0.3072 0.5000 -0.0083 -0.0165 0.0033  6801 GLN A CA  
20   C  C   . GLN A 6   ? 0.3820 0.2644 0.4357 -0.0010 -0.0169 0.0031  6801 GLN A C   
21   O  O   . GLN A 6   ? 0.3531 0.2499 0.3931 -0.0048 -0.0130 0.0058  6801 GLN A O   
22   C  CB  . GLN A 6   ? 0.4460 0.3202 0.5064 -0.0094 -0.0130 -0.0126 6801 GLN A CB  
23   C  CG  . GLN A 6   ? 0.5022 0.3672 0.5703 -0.0178 -0.0129 -0.0137 6801 GLN A CG  
24   C  CD  . GLN A 6   ? 0.5083 0.3813 0.5750 -0.0182 -0.0110 -0.0291 6801 GLN A CD  
25   O  OE1 . GLN A 6   ? 0.5794 0.4554 0.6477 -0.0257 -0.0093 -0.0296 6801 GLN A OE1 
26   N  NE2 . GLN A 6   ? 0.5116 0.3906 0.5750 -0.0102 -0.0112 -0.0411 6801 GLN A NE2 
27   N  N   . ALA A 7   ? 0.3671 0.2464 0.4313 0.0092  -0.0218 -0.0009 6802 ALA A N   
28   C  CA  . ALA A 7   ? 0.3519 0.2486 0.4128 0.0158  -0.0223 -0.0026 6802 ALA A CA  
29   C  C   . ALA A 7   ? 0.3441 0.2469 0.3957 0.0132  -0.0248 0.0132  6802 ALA A C   
30   O  O   . ALA A 7   ? 0.3285 0.2491 0.3735 0.0145  -0.0242 0.0117  6802 ALA A O   
31   C  CB  . ALA A 7   ? 0.3574 0.2519 0.4347 0.0283  -0.0271 -0.0109 6802 ALA A CB  
32   N  N   . TRP A 8   ? 0.3535 0.2432 0.4039 0.0087  -0.0276 0.0280  6803 TRP A N   
33   C  CA  . TRP A 8   ? 0.3683 0.2656 0.4070 0.0061  -0.0304 0.0440  6803 TRP A CA  
34   C  C   . TRP A 8   ? 0.3532 0.2619 0.3739 -0.0045 -0.0232 0.0463  6803 TRP A C   
35   O  O   . TRP A 8   ? 0.3770 0.2964 0.3844 -0.0072 -0.0242 0.0561  6803 TRP A O   
36   C  CB  . TRP A 8   ? 0.4155 0.2947 0.4610 0.0076  -0.0380 0.0611  6803 TRP A CB  
37   C  CG  . TRP A 8   ? 0.4329 0.3057 0.4950 0.0213  -0.0468 0.0587  6803 TRP A CG  
38   C  CD1 . TRP A 8   ? 0.4471 0.3325 0.5094 0.0295  -0.0534 0.0639  6803 TRP A CD1 
39   C  CD2 . TRP A 8   ? 0.4580 0.3135 0.5402 0.0299  -0.0501 0.0479  6803 TRP A CD2 
40   N  NE1 . TRP A 8   ? 0.4587 0.3368 0.5412 0.0432  -0.0604 0.0578  6803 TRP A NE1 
41   C  CE2 . TRP A 8   ? 0.4652 0.3240 0.5597 0.0441  -0.0583 0.0473  6803 TRP A CE2 
42   C  CE3 . TRP A 8   ? 0.4736 0.3124 0.5652 0.0273  -0.0475 0.0374  6803 TRP A CE3 
43   C  CZ2 . TRP A 8   ? 0.4864 0.3321 0.6023 0.0568  -0.0633 0.0358  6803 TRP A CZ2 
44   C  CZ3 . TRP A 8   ? 0.4940 0.3186 0.6050 0.0388  -0.0529 0.0257  6803 TRP A CZ3 
45   C  CH2 . TRP A 8   ? 0.5020 0.3296 0.6251 0.0538  -0.0603 0.0246  6803 TRP A CH2 
46   N  N   A GLN A 9   ? 0.3321 0.2398 0.3526 -0.0095 -0.0166 0.0364  6804 GLN A N   
47   N  N   B GLN A 9   ? 0.3311 0.2387 0.3517 -0.0094 -0.0166 0.0362  6804 GLN A N   
48   C  CA  A GLN A 9   ? 0.3227 0.2421 0.3289 -0.0175 -0.0098 0.0357  6804 GLN A CA  
49   C  CA  B GLN A 9   ? 0.3181 0.2372 0.3247 -0.0174 -0.0097 0.0352  6804 GLN A CA  
50   C  C   A GLN A 9   ? 0.2962 0.2291 0.2943 -0.0152 -0.0080 0.0244  6804 GLN A C   
51   C  C   B GLN A 9   ? 0.2951 0.2281 0.2933 -0.0151 -0.0081 0.0244  6804 GLN A C   
52   O  O   A GLN A 9   ? 0.2804 0.2148 0.2850 -0.0093 -0.0106 0.0172  6804 GLN A O   
53   O  O   B GLN A 9   ? 0.2825 0.2171 0.2869 -0.0093 -0.0107 0.0174  6804 GLN A O   
54   C  CB  A GLN A 9   ? 0.3284 0.2414 0.3404 -0.0232 -0.0050 0.0312  6804 GLN A CB  
55   C  CB  B GLN A 9   ? 0.3157 0.2288 0.3285 -0.0223 -0.0050 0.0287  6804 GLN A CB  
56   C  CG  A GLN A 9   ? 0.3607 0.2605 0.3811 -0.0288 -0.0066 0.0439  6804 GLN A CG  
57   C  CG  B GLN A 9   ? 0.3381 0.2352 0.3630 -0.0263 -0.0072 0.0373  6804 GLN A CG  
58   C  CD  A GLN A 9   ? 0.3832 0.2909 0.3913 -0.0351 -0.0051 0.0605  6804 GLN A CD  
59   C  CD  B GLN A 9   ? 0.3363 0.2303 0.3692 -0.0317 -0.0036 0.0289  6804 GLN A CD  
60   O  OE1 A GLN A 9   ? 0.4010 0.3259 0.3956 -0.0386 0.0006  0.0591  6804 GLN A OE1 
61   O  OE1 B GLN A 9   ? 0.3327 0.2367 0.3617 -0.0312 0.0001  0.0173  6804 GLN A OE1 
62   N  NE2 A GLN A 9   ? 0.4193 0.3144 0.4316 -0.0362 -0.0105 0.0764  6804 GLN A NE2 
63   N  NE2 B GLN A 9   ? 0.3540 0.2336 0.3993 -0.0371 -0.0057 0.0352  6804 GLN A NE2 
64   N  N   . PRO A 10  ? 0.2868 0.2304 0.2713 -0.0198 -0.0039 0.0226  6805 PRO A N   
65   C  CA  . PRO A 10  ? 0.2756 0.2277 0.2533 -0.0190 -0.0030 0.0122  6805 PRO A CA  
66   C  C   . PRO A 10  ? 0.2595 0.2067 0.2429 -0.0182 -0.0003 0.0009  6805 PRO A C   
67   O  O   . PRO A 10  ? 0.2567 0.2079 0.2379 -0.0174 -0.0005 -0.0060 6805 PRO A O   
68   C  CB  . PRO A 10  ? 0.2771 0.2383 0.2400 -0.0235 0.0001  0.0125  6805 PRO A CB  
69   C  CG  . PRO A 10  ? 0.2914 0.2507 0.2554 -0.0274 0.0041  0.0199  6805 PRO A CG  
70   C  CD  . PRO A 10  ? 0.2968 0.2455 0.2718 -0.0261 0.0000  0.0304  6805 PRO A CD  
71   N  N   . GLY A 11  ? 0.2645 0.2041 0.2552 -0.0193 0.0017  0.0003  6806 GLY A N   
72   C  CA  . GLY A 11  ? 0.2608 0.1971 0.2557 -0.0185 0.0033  -0.0097 6806 GLY A CA  
73   C  C   . GLY A 11  ? 0.2665 0.1965 0.2700 -0.0210 0.0045  -0.0096 6806 GLY A C   
74   O  O   . GLY A 11  ? 0.2749 0.2008 0.2831 -0.0238 0.0040  -0.0006 6806 GLY A O   
75   N  N   . VAL A 12  ? 0.2617 0.1917 0.2670 -0.0211 0.0055  -0.0182 6807 VAL A N   
76   C  CA  . VAL A 12  ? 0.2690 0.1950 0.2846 -0.0241 0.0055  -0.0201 6807 VAL A CA  
77   C  C   . VAL A 12  ? 0.2574 0.1917 0.2701 -0.0259 0.0080  -0.0245 6807 VAL A C   
78   O  O   . VAL A 12  ? 0.2598 0.1966 0.2651 -0.0226 0.0074  -0.0305 6807 VAL A O   
79   C  CB  . VAL A 12  ? 0.2801 0.1988 0.3040 -0.0209 0.0021  -0.0286 6807 VAL A CB  
80   C  CG1 . VAL A 12  ? 0.2915 0.2051 0.3275 -0.0250 0.0007  -0.0317 6807 VAL A CG1 
81   C  CG2 . VAL A 12  ? 0.2943 0.2065 0.3225 -0.0164 -0.0005 -0.0265 6807 VAL A CG2 
82   N  N   . ALA A 13  ? 0.2561 0.1953 0.2753 -0.0309 0.0105  -0.0208 6808 ALA A N   
83   C  CA  . ALA A 13  ? 0.2568 0.2071 0.2777 -0.0316 0.0127  -0.0257 6808 ALA A CA  
84   C  C   . ALA A 13  ? 0.2551 0.2043 0.2884 -0.0331 0.0095  -0.0324 6808 ALA A C   
85   O  O   . ALA A 13  ? 0.2601 0.2014 0.3035 -0.0372 0.0075  -0.0307 6808 ALA A O   
86   C  CB  . ALA A 13  ? 0.2656 0.2275 0.2878 -0.0366 0.0182  -0.0188 6808 ALA A CB  
87   N  N   . MET A 14  ? 0.2534 0.2095 0.2861 -0.0296 0.0078  -0.0399 6809 MET A N   
88   C  CA  . MET A 14  ? 0.2576 0.2163 0.3008 -0.0306 0.0035  -0.0473 6809 MET A CA  
89   C  C   . MET A 14  ? 0.2708 0.2360 0.3307 -0.0391 0.0052  -0.0445 6809 MET A C   
90   O  O   . MET A 14  ? 0.2745 0.2536 0.3386 -0.0417 0.0100  -0.0410 6809 MET A O   
91   C  CB  . MET A 14  ? 0.2565 0.2243 0.2961 -0.0249 0.0012  -0.0529 6809 MET A CB  
92   C  CG  . MET A 14  ? 0.2584 0.2315 0.3063 -0.0247 -0.0048 -0.0606 6809 MET A CG  
93   S  SD  . MET A 14  ? 0.2609 0.2414 0.3019 -0.0157 -0.0090 -0.0641 6809 MET A SD  
94   C  CE  . MET A 14  ? 0.2713 0.2618 0.3236 -0.0166 -0.0174 -0.0724 6809 MET A CE  
95   N  N   . PRO A 15  ? 0.2858 0.2415 0.3563 -0.0443 0.0017  -0.0461 6810 PRO A N   
96   C  CA  . PRO A 15  ? 0.3016 0.2614 0.3896 -0.0549 0.0028  -0.0422 6810 PRO A CA  
97   C  C   . PRO A 15  ? 0.2980 0.2788 0.3975 -0.0573 0.0025  -0.0479 6810 PRO A C   
98   O  O   . PRO A 15  ? 0.2929 0.2787 0.3901 -0.0509 -0.0023 -0.0574 6810 PRO A O   
99   C  CB  . PRO A 15  ? 0.3182 0.2597 0.4145 -0.0579 -0.0033 -0.0468 6810 PRO A CB  
100  C  CG  . PRO A 15  ? 0.3146 0.2433 0.3963 -0.0485 -0.0047 -0.0488 6810 PRO A CG  
101  C  CD  . PRO A 15  ? 0.2975 0.2380 0.3646 -0.0408 -0.0030 -0.0517 6810 PRO A CD  
102  N  N   . ASN A 16  ? 0.3067 0.3013 0.4187 -0.0664 0.0078  -0.0411 6811 ASN A N   
103  C  CA  . ASN A 16  ? 0.2987 0.3193 0.4253 -0.0688 0.0089  -0.0460 6811 ASN A CA  
104  C  C   . ASN A 16  ? 0.2857 0.3079 0.4246 -0.0698 -0.0003 -0.0577 6811 ASN A C   
105  O  O   . ASN A 16  ? 0.2751 0.3152 0.4177 -0.0635 -0.0032 -0.0654 6811 ASN A O   
106  C  CB  . ASN A 16  ? 0.3187 0.3550 0.4590 -0.0816 0.0168  -0.0359 6811 ASN A CB  
107  C  CG  . ASN A 16  ? 0.3300 0.3758 0.4571 -0.0789 0.0263  -0.0273 6811 ASN A CG  
108  O  OD1 . ASN A 16  ? 0.3392 0.3820 0.4497 -0.0671 0.0264  -0.0310 6811 ASN A OD1 
109  N  ND2 . ASN A 16  ? 0.3504 0.4087 0.4844 -0.0907 0.0340  -0.0160 6811 ASN A ND2 
110  N  N   . LEU A 17  ? 0.2855 0.2899 0.4305 -0.0762 -0.0057 -0.0600 6812 LEU A N   
111  C  CA  . LEU A 17  ? 0.2833 0.2925 0.4402 -0.0782 -0.0151 -0.0731 6812 LEU A CA  
112  C  C   . LEU A 17  ? 0.2746 0.2849 0.4153 -0.0644 -0.0210 -0.0827 6812 LEU A C   
113  O  O   . LEU A 17  ? 0.2739 0.2998 0.4221 -0.0630 -0.0277 -0.0916 6812 LEU A O   
114  C  CB  . LEU A 17  ? 0.2983 0.2859 0.4647 -0.0872 -0.0205 -0.0762 6812 LEU A CB  
115  C  CG  . LEU A 17  ? 0.3070 0.3006 0.4881 -0.0920 -0.0305 -0.0907 6812 LEU A CG  
116  C  CD1 . LEU A 17  ? 0.3006 0.3234 0.5032 -0.1011 -0.0298 -0.0904 6812 LEU A CD1 
117  C  CD2 . LEU A 17  ? 0.3299 0.2982 0.5208 -0.1007 -0.0359 -0.0951 6812 LEU A CD2 
118  N  N   . TYR A 18  ? 0.2741 0.2702 0.3938 -0.0553 -0.0189 -0.0798 6813 TYR A N   
119  C  CA  . TYR A 18  ? 0.2733 0.2700 0.3761 -0.0440 -0.0239 -0.0861 6813 TYR A CA  
120  C  C   . TYR A 18  ? 0.2634 0.2787 0.3662 -0.0375 -0.0237 -0.0849 6813 TYR A C   
121  O  O   . TYR A 18  ? 0.2616 0.2835 0.3594 -0.0310 -0.0311 -0.0908 6813 TYR A O   
122  C  CB  . TYR A 18  ? 0.2773 0.2566 0.3602 -0.0379 -0.0209 -0.0824 6813 TYR A CB  
123  C  CG  . TYR A 18  ? 0.2884 0.2516 0.3712 -0.0401 -0.0233 -0.0876 6813 TYR A CG  
124  C  CD1 . TYR A 18  ? 0.3051 0.2679 0.3821 -0.0369 -0.0301 -0.0994 6813 TYR A CD1 
125  C  CD2 . TYR A 18  ? 0.2991 0.2483 0.3878 -0.0448 -0.0195 -0.0813 6813 TYR A CD2 
126  C  CE1 . TYR A 18  ? 0.3169 0.2661 0.3950 -0.0374 -0.0323 -0.1072 6813 TYR A CE1 
127  C  CE2 . TYR A 18  ? 0.3193 0.2523 0.4104 -0.0449 -0.0227 -0.0875 6813 TYR A CE2 
128  C  CZ  . TYR A 18  ? 0.3246 0.2579 0.4109 -0.0408 -0.0288 -0.1017 6813 TYR A CZ  
129  O  OH  . TYR A 18  ? 0.3448 0.2634 0.4344 -0.0394 -0.0318 -0.1107 6813 TYR A OH  
130  N  N   . LYS A 19  ? 0.2661 0.2901 0.3744 -0.0387 -0.0160 -0.0778 6814 LYS A N   
131  C  CA  . LYS A 19  ? 0.2680 0.3101 0.3788 -0.0308 -0.0154 -0.0787 6814 LYS A CA  
132  C  C   . LYS A 19  ? 0.2747 0.3399 0.4062 -0.0326 -0.0214 -0.0859 6814 LYS A C   
133  O  O   . LYS A 19  ? 0.2778 0.3563 0.4111 -0.0228 -0.0254 -0.0892 6814 LYS A O   
134  C  CB  . LYS A 19  ? 0.2759 0.3261 0.3893 -0.0326 -0.0049 -0.0719 6814 LYS A CB  
135  C  CG  . LYS A 19  ? 0.2791 0.3106 0.3738 -0.0314 0.0006  -0.0647 6814 LYS A CG  
136  C  CD  . LYS A 19  ? 0.2900 0.3325 0.3864 -0.0347 0.0105  -0.0585 6814 LYS A CD  
137  C  CE  . LYS A 19  ? 0.3016 0.3273 0.3797 -0.0341 0.0145  -0.0514 6814 LYS A CE  
138  N  NZ  . LYS A 19  ? 0.3167 0.3547 0.3952 -0.0392 0.0239  -0.0445 6814 LYS A NZ  
139  N  N   . MET A 20  ? 0.2715 0.3405 0.4192 -0.0446 -0.0231 -0.0884 6815 MET A N   
140  C  CA  . MET A 20  ? 0.2756 0.3704 0.4474 -0.0493 -0.0284 -0.0953 6815 MET A CA  
141  C  C   . MET A 20  ? 0.2774 0.3706 0.4466 -0.0465 -0.0416 -0.1055 6815 MET A C   
142  O  O   . MET A 20  ? 0.2739 0.3886 0.4630 -0.0508 -0.0482 -0.1125 6815 MET A O   
143  C  CB  . MET A 20  ? 0.2859 0.3860 0.4784 -0.0665 -0.0235 -0.0920 6815 MET A CB  
144  C  CG  . MET A 20  ? 0.2881 0.3918 0.4809 -0.0709 -0.0103 -0.0805 6815 MET A CG  
145  S  SD  . MET A 20  ? 0.3086 0.4157 0.5238 -0.0932 -0.0048 -0.0726 6815 MET A SD  
146  C  CE  . MET A 20  ? 0.3058 0.4542 0.5528 -0.0991 -0.0081 -0.0810 6815 MET A CE  
147  N  N   . GLN A 21  ? 0.2748 0.3471 0.4204 -0.0398 -0.0453 -0.1065 6816 GLN A N   
148  C  CA  . GLN A 21  ? 0.2886 0.3611 0.4277 -0.0373 -0.0574 -0.1163 6816 GLN A CA  
149  C  C   . GLN A 21  ? 0.2999 0.3856 0.4314 -0.0245 -0.0651 -0.1166 6816 GLN A C   
150  O  O   . GLN A 21  ? 0.2850 0.3767 0.4178 -0.0171 -0.0609 -0.1104 6816 GLN A O   
151  C  CB  . GLN A 21  ? 0.2894 0.3372 0.4074 -0.0367 -0.0571 -0.1178 6816 GLN A CB  
152  C  CG  . GLN A 21  ? 0.2897 0.3215 0.4164 -0.0474 -0.0513 -0.1174 6816 GLN A CG  
153  C  CD  . GLN A 21  ? 0.2926 0.3338 0.4445 -0.0596 -0.0561 -0.1247 6816 GLN A CD  
154  O  OE1 . GLN A 21  ? 0.3031 0.3521 0.4586 -0.0608 -0.0663 -0.1368 6816 GLN A OE1 
155  N  NE2 . GLN A 21  ? 0.2826 0.3240 0.4520 -0.0699 -0.0489 -0.1171 6816 GLN A NE2 
156  N  N   . ARG A 22  ? 0.3239 0.4142 0.4480 -0.0219 -0.0768 -0.1241 6817 ARG A N   
157  C  CA  . ARG A 22  ? 0.3561 0.4564 0.4702 -0.0095 -0.0866 -0.1226 6817 ARG A CA  
158  C  C   . ARG A 22  ? 0.3652 0.4529 0.4515 -0.0067 -0.0926 -0.1244 6817 ARG A C   
159  O  O   . ARG A 22  ? 0.3727 0.4731 0.4561 -0.0057 -0.1045 -0.1317 6817 ARG A O   
160  C  CB  . ARG A 22  ? 0.3922 0.5222 0.5303 -0.0092 -0.0965 -0.1295 6817 ARG A CB  
161  C  CG  . ARG A 22  ? 0.4431 0.5836 0.5749 0.0055  -0.1068 -0.1257 6817 ARG A CG  
162  C  CD  . ARG A 22  ? 0.4800 0.6533 0.6394 0.0080  -0.1162 -0.1319 6817 ARG A CD  
163  N  NE  . ARG A 22  ? 0.5351 0.7136 0.6869 0.0246  -0.1267 -0.1266 6817 ARG A NE  
164  C  CZ  . ARG A 22  ? 0.5506 0.7273 0.7064 0.0363  -0.1229 -0.1200 6817 ARG A CZ  
165  N  NH1 . ARG A 22  ? 0.5898 0.7675 0.7389 0.0516  -0.1348 -0.1151 6817 ARG A NH1 
166  N  NH2 . ARG A 22  ? 0.5442 0.7172 0.7100 0.0332  -0.1081 -0.1185 6817 ARG A NH2 
167  N  N   . MET A 23  ? 0.3587 0.4248 0.4258 -0.0061 -0.0841 -0.1182 6818 MET A N   
168  C  CA  . MET A 23  ? 0.3774 0.4336 0.4179 -0.0046 -0.0866 -0.1196 6818 MET A CA  
169  C  C   . MET A 23  ? 0.3901 0.4473 0.4102 0.0051  -0.0935 -0.1105 6818 MET A C   
170  O  O   . MET A 23  ? 0.3785 0.4353 0.4036 0.0118  -0.0937 -0.1020 6818 MET A O   
171  C  CB  . MET A 23  ? 0.3764 0.4123 0.4070 -0.0075 -0.0747 -0.1158 6818 MET A CB  
172  C  CG  . MET A 23  ? 0.3714 0.4016 0.4212 -0.0165 -0.0682 -0.1212 6818 MET A CG  
173  S  SD  . MET A 23  ? 0.3947 0.4336 0.4579 -0.0243 -0.0771 -0.1388 6818 MET A SD  
174  C  CE  . MET A 23  ? 0.4215 0.4544 0.4563 -0.0202 -0.0794 -0.1466 6818 MET A CE  
175  N  N   . LEU A 24  ? 0.4195 0.4785 0.4174 0.0059  -0.0995 -0.1129 6819 LEU A N   
176  C  CA  . LEU A 24  ? 0.4432 0.5000 0.4171 0.0134  -0.1056 -0.1010 6819 LEU A CA  
177  C  C   . LEU A 24  ? 0.4209 0.4589 0.3764 0.0119  -0.0947 -0.0920 6819 LEU A C   
178  O  O   . LEU A 24  ? 0.3943 0.4271 0.3507 0.0060  -0.0856 -0.0988 6819 LEU A O   
179  C  CB  . LEU A 24  ? 0.4814 0.5534 0.4387 0.0139  -0.1174 -0.1070 6819 LEU A CB  
180  C  CG  . LEU A 24  ? 0.5114 0.6050 0.4864 0.0155  -0.1306 -0.1159 6819 LEU A CG  
181  C  CD1 . LEU A 24  ? 0.5439 0.6529 0.4978 0.0160  -0.1428 -0.1217 6819 LEU A CD1 
182  C  CD2 . LEU A 24  ? 0.5182 0.6155 0.5066 0.0246  -0.1368 -0.1056 6819 LEU A CD2 
183  N  N   . LEU A 25  ? 0.4319 0.4601 0.3731 0.0169  -0.0962 -0.0774 6820 LEU A N   
184  C  CA  . LEU A 25  ? 0.4384 0.4498 0.3642 0.0141  -0.0863 -0.0679 6820 LEU A CA  
185  C  C   . LEU A 25  ? 0.4451 0.4623 0.3479 0.0095  -0.0843 -0.0701 6820 LEU A C   
186  O  O   . LEU A 25  ? 0.4626 0.4905 0.3484 0.0111  -0.0934 -0.0681 6820 LEU A O   
187  C  CB  . LEU A 25  ? 0.4641 0.4620 0.3816 0.0197  -0.0904 -0.0520 6820 LEU A CB  
188  C  CG  . LEU A 25  ? 0.4749 0.4555 0.3783 0.0154  -0.0814 -0.0415 6820 LEU A CG  
189  C  CD1 . LEU A 25  ? 0.4592 0.4335 0.3778 0.0117  -0.0694 -0.0475 6820 LEU A CD1 
190  C  CD2 . LEU A 25  ? 0.5043 0.4681 0.4010 0.0203  -0.0875 -0.0265 6820 LEU A CD2 
191  N  N   A GLU A 26  ? 0.4327 0.4451 0.3353 0.0045  -0.0727 -0.0744 6821 GLU A N   
192  N  N   B GLU A 26  ? 0.4334 0.4457 0.3358 0.0045  -0.0728 -0.0742 6821 GLU A N   
193  C  CA  A GLU A 26  ? 0.4490 0.4695 0.3321 0.0008  -0.0682 -0.0784 6821 GLU A CA  
194  C  CA  B GLU A 26  ? 0.4504 0.4711 0.3330 0.0008  -0.0684 -0.0782 6821 GLU A CA  
195  C  C   A GLU A 26  ? 0.4366 0.4466 0.3101 -0.0024 -0.0584 -0.0667 6821 GLU A C   
196  C  C   B GLU A 26  ? 0.4373 0.4475 0.3115 -0.0024 -0.0580 -0.0676 6821 GLU A C   
197  O  O   A GLU A 26  ? 0.4081 0.4033 0.2927 -0.0020 -0.0552 -0.0591 6821 GLU A O   
198  O  O   B GLU A 26  ? 0.4073 0.4030 0.2937 -0.0022 -0.0543 -0.0609 6821 GLU A O   
199  C  CB  A GLU A 26  ? 0.4559 0.4821 0.3507 -0.0013 -0.0635 -0.0970 6821 GLU A CB  
200  C  CB  B GLU A 26  ? 0.4598 0.4883 0.3538 -0.0009 -0.0656 -0.0978 6821 GLU A CB  
201  C  CG  A GLU A 26  ? 0.4737 0.5089 0.3827 -0.0006 -0.0725 -0.1109 6821 GLU A CG  
202  C  CG  B GLU A 26  ? 0.4793 0.5197 0.3815 0.0002  -0.0767 -0.1099 6821 GLU A CG  
203  C  CD  A GLU A 26  ? 0.4853 0.5225 0.4043 -0.0032 -0.0691 -0.1297 6821 GLU A CD  
204  C  CD  B GLU A 26  ? 0.5184 0.5755 0.3971 0.0019  -0.0864 -0.1102 6821 GLU A CD  
205  O  OE1 A GLU A 26  ? 0.4967 0.5315 0.4382 -0.0053 -0.0722 -0.1387 6821 GLU A OE1 
206  O  OE1 B GLU A 26  ? 0.5520 0.6128 0.4061 0.0010  -0.0827 -0.1025 6821 GLU A OE1 
207  O  OE2 A GLU A 26  ? 0.5190 0.5607 0.4241 -0.0032 -0.0636 -0.1354 6821 GLU A OE2 
208  O  OE2 B GLU A 26  ? 0.5367 0.6050 0.4217 0.0034  -0.0977 -0.1178 6821 GLU A OE2 
209  N  N   A LYS A 27  ? 0.4423 0.4622 0.2963 -0.0058 -0.0536 -0.0662 6822 LYS A N   
210  N  N   B LYS A 27  ? 0.4440 0.4640 0.2981 -0.0058 -0.0536 -0.0664 6822 LYS A N   
211  C  CA  A LYS A 27  ? 0.4425 0.4564 0.2906 -0.0105 -0.0435 -0.0564 6822 LYS A CA  
212  C  CA  B LYS A 27  ? 0.4445 0.4593 0.2923 -0.0105 -0.0433 -0.0571 6822 LYS A CA  
213  C  C   A LYS A 27  ? 0.4199 0.4293 0.2884 -0.0104 -0.0348 -0.0669 6822 LYS A C   
214  C  C   B LYS A 27  ? 0.4211 0.4308 0.2895 -0.0105 -0.0346 -0.0672 6822 LYS A C   
215  O  O   A LYS A 27  ? 0.4038 0.4193 0.2828 -0.0081 -0.0351 -0.0828 6822 LYS A O   
216  O  O   B LYS A 27  ? 0.4045 0.4204 0.2835 -0.0082 -0.0346 -0.0832 6822 LYS A O   
217  C  CB  A LYS A 27  ? 0.4702 0.5013 0.2940 -0.0148 -0.0393 -0.0540 6822 LYS A CB  
218  C  CB  B LYS A 27  ? 0.4730 0.5060 0.2967 -0.0145 -0.0395 -0.0559 6822 LYS A CB  
219  C  CG  A LYS A 27  ? 0.5064 0.5433 0.3059 -0.0159 -0.0481 -0.0412 6822 LYS A CG  
220  C  CG  B LYS A 27  ? 0.4815 0.5162 0.3012 -0.0204 -0.0279 -0.0491 6822 LYS A CG  
221  C  CD  A LYS A 27  ? 0.5362 0.5931 0.3103 -0.0219 -0.0420 -0.0371 6822 LYS A CD  
222  C  CD  B LYS A 27  ? 0.5124 0.5696 0.3076 -0.0254 -0.0232 -0.0463 6822 LYS A CD  
223  C  CE  A LYS A 27  ? 0.5455 0.6251 0.3190 -0.0200 -0.0360 -0.0592 6822 LYS A CE  
224  C  CE  B LYS A 27  ? 0.5141 0.5771 0.3092 -0.0322 -0.0112 -0.0400 6822 LYS A CE  
225  N  NZ  A LYS A 27  ? 0.5591 0.6470 0.3320 -0.0144 -0.0465 -0.0737 6822 LYS A NZ  
226  N  NZ  B LYS A 27  ? 0.5116 0.5524 0.3110 -0.0374 -0.0124 -0.0215 6822 LYS A NZ  
227  N  N   . CYS A 28  ? 0.4084 0.4062 0.2826 -0.0129 -0.0287 -0.0580 6823 CYS A N   
228  C  CA  . CYS A 28  ? 0.4060 0.3997 0.2979 -0.0127 -0.0213 -0.0653 6823 CYS A CA  
229  C  C   . CYS A 28  ? 0.4288 0.4376 0.3141 -0.0144 -0.0134 -0.0713 6823 CYS A C   
230  O  O   . CYS A 28  ? 0.4525 0.4688 0.3222 -0.0191 -0.0100 -0.0617 6823 CYS A O   
231  C  CB  . CYS A 28  ? 0.4058 0.3842 0.3055 -0.0144 -0.0189 -0.0548 6823 CYS A CB  
232  S  SG  . CYS A 28  ? 0.4012 0.3746 0.3223 -0.0133 -0.0125 -0.0620 6823 CYS A SG  
233  N  N   . ASP A 29  ? 0.4227 0.4366 0.3197 -0.0107 -0.0112 -0.0868 6824 ASP A N   
234  C  CA  . ASP A 29  ? 0.4410 0.4713 0.3353 -0.0096 -0.0038 -0.0965 6824 ASP A CA  
235  C  C   . ASP A 29  ? 0.4209 0.4430 0.3374 -0.0057 -0.0004 -0.1042 6824 ASP A C   
236  O  O   . ASP A 29  ? 0.4207 0.4386 0.3488 -0.0014 -0.0036 -0.1179 6824 ASP A O   
237  C  CB  . ASP A 29  ? 0.4761 0.5224 0.3592 -0.0069 -0.0066 -0.1108 6824 ASP A CB  
238  C  CG  . ASP A 29  ? 0.5157 0.5825 0.3956 -0.0041 0.0012  -0.1238 6824 ASP A CG  
239  O  OD1 . ASP A 29  ? 0.5474 0.6197 0.4312 -0.0054 0.0092  -0.1186 6824 ASP A OD1 
240  O  OD2 . ASP A 29  ? 0.5755 0.6543 0.4499 -0.0003 -0.0009 -0.1405 6824 ASP A OD2 
241  N  N   . LEU A 30  ? 0.4057 0.4245 0.3282 -0.0076 0.0046  -0.0950 6825 LEU A N   
242  C  CA  . LEU A 30  ? 0.4070 0.4178 0.3494 -0.0038 0.0068  -0.0988 6825 LEU A CA  
243  C  C   . LEU A 30  ? 0.4363 0.4632 0.3839 0.0015  0.0121  -0.1116 6825 LEU A C   
244  O  O   . LEU A 30  ? 0.4307 0.4766 0.3690 -0.0006 0.0182  -0.1094 6825 LEU A O   
245  C  CB  . LEU A 30  ? 0.3870 0.3900 0.3321 -0.0081 0.0087  -0.0842 6825 LEU A CB  
246  C  CG  . LEU A 30  ? 0.3852 0.3731 0.3266 -0.0117 0.0038  -0.0738 6825 LEU A CG  
247  C  CD1 . LEU A 30  ? 0.3818 0.3626 0.3254 -0.0154 0.0056  -0.0626 6825 LEU A CD1 
248  C  CD2 . LEU A 30  ? 0.3835 0.3600 0.3367 -0.0087 -0.0008 -0.0794 6825 LEU A CD2 
249  N  N   A GLN A 31  ? 0.4559 0.4755 0.4183 0.0083  0.0096  -0.1252 6826 GLN A N   
250  N  N   B GLN A 31  ? 0.4619 0.4805 0.4261 0.0083  0.0099  -0.1237 6826 GLN A N   
251  C  CA  A GLN A 31  ? 0.4941 0.5260 0.4658 0.0167  0.0132  -0.1408 6826 GLN A CA  
252  C  CA  B GLN A 31  ? 0.4999 0.5315 0.4732 0.0166  0.0138  -0.1388 6826 GLN A CA  
253  C  C   A GLN A 31  ? 0.4965 0.5391 0.4751 0.0176  0.0193  -0.1337 6826 GLN A C   
254  C  C   B GLN A 31  ? 0.5007 0.5418 0.4818 0.0176  0.0195  -0.1315 6826 GLN A C   
255  O  O   A GLN A 31  ? 0.5021 0.5678 0.4807 0.0219  0.0254  -0.1428 6826 GLN A O   
256  O  O   B GLN A 31  ? 0.5035 0.5669 0.4861 0.0224  0.0252  -0.1410 6826 GLN A O   
257  C  CB  A GLN A 31  ? 0.5075 0.5197 0.4983 0.0230  0.0074  -0.1520 6826 GLN A CB  
258  C  CB  B GLN A 31  ? 0.5238 0.5379 0.5149 0.0235  0.0081  -0.1521 6826 GLN A CB  
259  C  CG  A GLN A 31  ? 0.5211 0.5386 0.5277 0.0338  0.0095  -0.1658 6826 GLN A CG  
260  C  CG  B GLN A 31  ? 0.5497 0.5618 0.5348 0.0234  0.0029  -0.1656 6826 GLN A CG  
261  C  CD  A GLN A 31  ? 0.5235 0.5156 0.5494 0.0389  0.0022  -0.1741 6826 GLN A CD  
262  C  CD  B GLN A 31  ? 0.5667 0.5625 0.5708 0.0300  -0.0025 -0.1816 6826 GLN A CD  
263  O  OE1 A GLN A 31  ? 0.5466 0.5323 0.5737 0.0404  -0.0023 -0.1890 6826 GLN A OE1 
264  O  OE1 B GLN A 31  ? 0.5824 0.5595 0.6042 0.0320  -0.0047 -0.1765 6826 GLN A OE1 
265  N  NE2 A GLN A 31  ? 0.5059 0.4835 0.5473 0.0412  0.0006  -0.1644 6826 GLN A NE2 
266  N  NE2 B GLN A 31  ? 0.5936 0.5956 0.5934 0.0331  -0.0054 -0.2011 6826 GLN A NE2 
267  N  N   A ASN A 32  ? 0.4879 0.5168 0.4722 0.0136  0.0178  -0.1186 6827 ASN A N   
268  N  N   B ASN A 32  ? 0.4887 0.5168 0.4750 0.0134  0.0180  -0.1165 6827 ASN A N   
269  C  CA  A ASN A 32  ? 0.4945 0.5316 0.4876 0.0139  0.0214  -0.1113 6827 ASN A CA  
270  C  CA  B ASN A 32  ? 0.4974 0.5371 0.4915 0.0139  0.0222  -0.1104 6827 ASN A CA  
271  C  C   A ASN A 32  ? 0.5105 0.5594 0.4896 0.0037  0.0255  -0.0980 6827 ASN A C   
272  C  C   B ASN A 32  ? 0.5116 0.5634 0.4905 0.0034  0.0263  -0.0978 6827 ASN A C   
273  O  O   A ASN A 32  ? 0.5085 0.5613 0.4943 0.0013  0.0269  -0.0899 6827 ASN A O   
274  O  O   B ASN A 32  ? 0.5060 0.5649 0.4907 0.0005  0.0285  -0.0901 6827 ASN A O   
275  C  CB  A ASN A 32  ? 0.4759 0.4917 0.4825 0.0154  0.0164  -0.1035 6827 ASN A CB  
276  C  CB  B ASN A 32  ? 0.4798 0.5013 0.4885 0.0161  0.0177  -0.1029 6827 ASN A CB  
277  C  CG  A ASN A 32  ? 0.4741 0.4743 0.4955 0.0237  0.0115  -0.1136 6827 ASN A CG  
278  C  CG  B ASN A 32  ? 0.4565 0.4586 0.4582 0.0087  0.0139  -0.0907 6827 ASN A CG  
279  O  OD1 A ASN A 32  ? 0.4694 0.4752 0.4941 0.0301  0.0117  -0.1293 6827 ASN A OD1 
280  O  OD1 B ASN A 32  ? 0.4531 0.4529 0.4416 0.0035  0.0134  -0.0889 6827 ASN A OD1 
281  N  ND2 A ASN A 32  ? 0.4715 0.4517 0.5017 0.0230  0.0068  -0.1049 6827 ASN A ND2 
282  N  ND2 B ASN A 32  ? 0.4470 0.4369 0.4573 0.0089  0.0110  -0.0825 6827 ASN A ND2 
283  N  N   . TYR A 33  ? 0.5681 0.5270 0.4900 0.0392  0.0335  -0.0738 6828 TYR A N   
284  C  CA  . TYR A 33  ? 0.6356 0.5964 0.5450 0.0370  0.0378  -0.0649 6828 TYR A CA  
285  C  C   . TYR A 33  ? 0.6716 0.6385 0.5860 0.0375  0.0496  -0.0627 6828 TYR A C   
286  O  O   . TYR A 33  ? 0.6969 0.6654 0.6112 0.0416  0.0557  -0.0705 6828 TYR A O   
287  C  CB  . TYR A 33  ? 0.7076 0.6633 0.5907 0.0391  0.0355  -0.0671 6828 TYR A CB  
288  C  CG  . TYR A 33  ? 0.7865 0.7414 0.6551 0.0370  0.0396  -0.0576 6828 TYR A CG  
289  C  CD1 . TYR A 33  ? 0.8361 0.7894 0.7057 0.0335  0.0335  -0.0499 6828 TYR A CD1 
290  C  CD2 . TYR A 33  ? 0.8525 0.8079 0.7066 0.0383  0.0503  -0.0564 6828 TYR A CD2 
291  C  CE1 . TYR A 33  ? 0.8701 0.8212 0.7274 0.0315  0.0368  -0.0412 6828 TYR A CE1 
292  C  CE2 . TYR A 33  ? 0.8837 0.8370 0.7247 0.0357  0.0544  -0.0469 6828 TYR A CE2 
293  C  CZ  . TYR A 33  ? 0.9013 0.8519 0.7442 0.0324  0.0471  -0.0392 6828 TYR A CZ  
294  O  OH  . TYR A 33  ? 0.9512 0.8983 0.7821 0.0298  0.0506  -0.0299 6828 TYR A OH  
295  N  N   . GLY A 34  ? 0.6794 0.6500 0.5996 0.0334  0.0528  -0.0529 6829 GLY A N   
296  C  CA  . GLY A 34  ? 0.7190 0.6969 0.6480 0.0330  0.0642  -0.0504 6829 GLY A CA  
297  C  C   . GLY A 34  ? 0.7189 0.7029 0.6766 0.0324  0.0633  -0.0499 6829 GLY A C   
298  O  O   . GLY A 34  ? 0.7605 0.7517 0.7312 0.0305  0.0699  -0.0454 6829 GLY A O   
299  N  N   . ASP A 35  ? 0.6914 0.6721 0.6593 0.0340  0.0552  -0.0543 6830 ASP A N   
300  C  CA  . ASP A 35  ? 0.6498 0.6337 0.6433 0.0340  0.0521  -0.0532 6830 ASP A CA  
301  C  C   . ASP A 35  ? 0.6110 0.5942 0.6100 0.0286  0.0456  -0.0433 6830 ASP A C   
302  O  O   . ASP A 35  ? 0.5539 0.5319 0.5389 0.0258  0.0409  -0.0399 6830 ASP A O   
303  C  CB  . ASP A 35  ? 0.6490 0.6270 0.6494 0.0370  0.0457  -0.0601 6830 ASP A CB  
304  C  CG  . ASP A 35  ? 0.7032 0.6811 0.7001 0.0427  0.0511  -0.0714 6830 ASP A CG  
305  O  OD1 . ASP A 35  ? 0.7402 0.7234 0.7303 0.0446  0.0612  -0.0738 6830 ASP A OD1 
306  O  OD2 . ASP A 35  ? 0.6633 0.6350 0.6639 0.0449  0.0456  -0.0779 6830 ASP A OD2 
307  N  N   . SER A 36  ? 0.5941 0.5823 0.6132 0.0277  0.0450  -0.0396 6831 SER A N   
308  C  CA  . SER A 36  ? 0.5887 0.5758 0.6132 0.0229  0.0381  -0.0310 6831 SER A CA  
309  C  C   . SER A 36  ? 0.5448 0.5291 0.5860 0.0239  0.0301  -0.0304 6831 SER A C   
310  O  O   . SER A 36  ? 0.5655 0.5537 0.6228 0.0281  0.0321  -0.0347 6831 SER A O   
311  C  CB  . SER A 36  ? 0.6233 0.6181 0.6544 0.0200  0.0435  -0.0258 6831 SER A CB  
312  O  OG  . SER A 36  ? 0.6754 0.6698 0.6882 0.0183  0.0500  -0.0243 6831 SER A OG  
313  N  N   . ALA A 37  ? 0.5004 0.4774 0.5370 0.0205  0.0216  -0.0254 6832 ALA A N   
314  C  CA  . ALA A 37  ? 0.4663 0.4381 0.5148 0.0209  0.0134  -0.0232 6832 ALA A CA  
315  C  C   . ALA A 37  ? 0.4331 0.4113 0.4986 0.0206  0.0111  -0.0189 6832 ALA A C   
316  O  O   . ALA A 37  ? 0.4451 0.4297 0.5102 0.0177  0.0144  -0.0159 6832 ALA A O   
317  C  CB  . ALA A 37  ? 0.4731 0.4352 0.5091 0.0168  0.0068  -0.0188 6832 ALA A CB  
318  N  N   A THR A 38  ? 0.4152 0.3914 0.4965 0.0236  0.0051  -0.0189 6833 THR A N   
319  N  N   B THR A 38  ? 0.4276 0.4034 0.5084 0.0235  0.0050  -0.0188 6833 THR A N   
320  C  CA  A THR A 38  ? 0.4112 0.3933 0.5111 0.0238  0.0004  -0.0152 6833 THR A CA  
321  C  CA  B THR A 38  ? 0.4322 0.4137 0.5319 0.0239  0.0000  -0.0152 6833 THR A CA  
322  C  C   A THR A 38  ? 0.3869 0.3604 0.4776 0.0193  -0.0098 -0.0076 6833 THR A C   
323  C  C   B THR A 38  ? 0.3971 0.3704 0.4874 0.0193  -0.0100 -0.0075 6833 THR A C   
324  O  O   A THR A 38  ? 0.3895 0.3518 0.4750 0.0198  -0.0171 -0.0054 6833 THR A O   
325  O  O   B THR A 38  ? 0.3981 0.3600 0.4827 0.0195  -0.0172 -0.0052 6833 THR A O   
326  C  CB  A THR A 38  ? 0.4197 0.4039 0.5421 0.0301  -0.0020 -0.0191 6833 THR A CB  
327  C  CB  B THR A 38  ? 0.4574 0.4395 0.5782 0.0301  -0.0032 -0.0188 6833 THR A CB  
328  O  OG1 A THR A 38  ? 0.4240 0.4173 0.5532 0.0338  0.0094  -0.0269 6833 THR A OG1 
329  O  OG1 B THR A 38  ? 0.4871 0.4549 0.6003 0.0306  -0.0112 -0.0168 6833 THR A OG1 
330  C  CG2 A THR A 38  ? 0.4153 0.4050 0.5586 0.0308  -0.0095 -0.0155 6833 THR A CG2 
331  C  CG2 B THR A 38  ? 0.4659 0.4556 0.5951 0.0350  0.0074  -0.0277 6833 THR A CG2 
332  N  N   . LEU A 39  ? 0.3711 0.3490 0.4589 0.0150  -0.0098 -0.0039 6834 LEU A N   
333  C  CA  . LEU A 39  ? 0.3486 0.3183 0.4252 0.0106  -0.0190 0.0022  6834 LEU A CA  
334  C  C   . LEU A 39  ? 0.3283 0.2980 0.4208 0.0120  -0.0298 0.0052  6834 LEU A C   
335  O  O   . LEU A 39  ? 0.3092 0.2893 0.4247 0.0151  -0.0291 0.0028  6834 LEU A O   
336  C  CB  . LEU A 39  ? 0.3512 0.3250 0.4194 0.0057  -0.0150 0.0040  6834 LEU A CB  
337  C  CG  . LEU A 39  ? 0.3619 0.3350 0.4135 0.0046  -0.0060 0.0017  6834 LEU A CG  
338  C  CD1 . LEU A 39  ? 0.3745 0.3506 0.4198 0.0003  -0.0029 0.0042  6834 LEU A CD1 
339  C  CD2 . LEU A 39  ? 0.3684 0.3303 0.4029 0.0040  -0.0089 0.0019  6834 LEU A CD2 
340  N  N   . PRO A 40  ? 0.3122 0.2702 0.3929 0.0099  -0.0402 0.0103  6835 PRO A N   
341  C  CA  . PRO A 40  ? 0.3138 0.2704 0.4060 0.0111  -0.0527 0.0137  6835 PRO A CA  
342  C  C   . PRO A 40  ? 0.3018 0.2717 0.4100 0.0090  -0.0520 0.0127  6835 PRO A C   
343  O  O   . PRO A 40  ? 0.2891 0.2625 0.3886 0.0047  -0.0448 0.0124  6835 PRO A O   
344  C  CB  . PRO A 40  ? 0.3259 0.2668 0.3938 0.0076  -0.0610 0.0193  6835 PRO A CB  
345  C  CG  . PRO A 40  ? 0.3231 0.2564 0.3726 0.0063  -0.0528 0.0184  6835 PRO A CG  
346  C  CD  . PRO A 40  ? 0.3112 0.2565 0.3666 0.0066  -0.0405 0.0129  6835 PRO A CD  
347  N  N   . LYS A 41  ? 0.3031 0.2798 0.4355 0.0119  -0.0597 0.0124  6836 LYS A N   
348  C  CA  . LYS A 41  ? 0.3037 0.2948 0.4580 0.0099  -0.0589 0.0108  6836 LYS A CA  
349  C  C   . LYS A 41  ? 0.2942 0.2819 0.4333 0.0031  -0.0612 0.0137  6836 LYS A C   
350  O  O   . LYS A 41  ? 0.2880 0.2636 0.4105 0.0014  -0.0725 0.0173  6836 LYS A O   
351  C  CB  . LYS A 41  ? 0.3291 0.3250 0.5103 0.0141  -0.0715 0.0105  6836 LYS A CB  
352  C  CG  . LYS A 41  ? 0.3489 0.3619 0.5600 0.0125  -0.0703 0.0078  6836 LYS A CG  
353  C  CD  . LYS A 41  ? 0.3782 0.3974 0.6197 0.0176  -0.0833 0.0065  6836 LYS A CD  
354  C  CE  . LYS A 41  ? 0.4007 0.4390 0.6764 0.0155  -0.0809 0.0030  6836 LYS A CE  
355  N  NZ  . LYS A 41  ? 0.4277 0.4647 0.6947 0.0078  -0.0849 0.0055  6836 LYS A NZ  
356  N  N   . GLY A 42  ? 0.2790 0.2763 0.4227 -0.0006 -0.0503 0.0121  6837 GLY A N   
357  C  CA  . GLY A 42  ? 0.2783 0.2733 0.4121 -0.0070 -0.0517 0.0141  6837 GLY A CA  
358  C  C   . GLY A 42  ? 0.2779 0.2598 0.3793 -0.0096 -0.0498 0.0161  6837 GLY A C   
359  O  O   . GLY A 42  ? 0.2824 0.2603 0.3745 -0.0144 -0.0526 0.0175  6837 GLY A O   
360  N  N   . ILE A 43  ? 0.2649 0.2402 0.3512 -0.0067 -0.0454 0.0158  6838 ILE A N   
361  C  CA  . ILE A 43  ? 0.2656 0.2298 0.3240 -0.0092 -0.0429 0.0170  6838 ILE A CA  
362  C  C   . ILE A 43  ? 0.2620 0.2311 0.3155 -0.0102 -0.0300 0.0151  6838 ILE A C   
363  O  O   . ILE A 43  ? 0.2630 0.2389 0.3248 -0.0070 -0.0221 0.0125  6838 ILE A O   
364  C  CB  . ILE A 43  ? 0.2677 0.2212 0.3129 -0.0064 -0.0460 0.0178  6838 ILE A CB  
365  C  CG1 . ILE A 43  ? 0.2752 0.2205 0.3196 -0.0058 -0.0598 0.0211  6838 ILE A CG1 
366  C  CG2 . ILE A 43  ? 0.2705 0.2156 0.2919 -0.0088 -0.0409 0.0179  6838 ILE A CG2 
367  C  CD1 . ILE A 43  ? 0.2858 0.2232 0.3147 -0.0102 -0.0672 0.0233  6838 ILE A CD1 
368  N  N   . MET A 44  ? 0.2683 0.2330 0.3078 -0.0141 -0.0286 0.0161  6839 MET A N   
369  C  CA  . MET A 44  ? 0.2675 0.2344 0.2994 -0.0150 -0.0182 0.0152  6839 MET A CA  
370  C  C   . MET A 44  ? 0.2613 0.2233 0.2783 -0.0122 -0.0140 0.0132  6839 MET A C   
371  O  O   . MET A 44  ? 0.2403 0.1941 0.2469 -0.0120 -0.0190 0.0135  6839 MET A O   
372  C  CB  . MET A 44  ? 0.2796 0.2412 0.3009 -0.0194 -0.0197 0.0168  6839 MET A CB  
373  C  CG  . MET A 44  ? 0.2999 0.2658 0.3360 -0.0231 -0.0233 0.0182  6839 MET A CG  
374  S  SD  . MET A 44  ? 0.3183 0.2746 0.3399 -0.0279 -0.0270 0.0191  6839 MET A SD  
375  C  CE  . MET A 44  ? 0.3261 0.2893 0.3707 -0.0325 -0.0304 0.0202  6839 MET A CE  
376  N  N   . MET A 45  ? 0.2645 0.2307 0.2795 -0.0106 -0.0051 0.0113  6840 MET A N   
377  C  CA  . MET A 45  ? 0.2749 0.2371 0.2770 -0.0081 -0.0019 0.0084  6840 MET A CA  
378  C  C   . MET A 45  ? 0.2678 0.2212 0.2543 -0.0103 -0.0054 0.0091  6840 MET A C   
379  O  O   . MET A 45  ? 0.2607 0.2093 0.2411 -0.0093 -0.0068 0.0075  6840 MET A O   
380  C  CB  . MET A 45  ? 0.2993 0.2656 0.2972 -0.0065 0.0067  0.0067  6840 MET A CB  
381  C  CG  . MET A 45  ? 0.3233 0.2853 0.3074 -0.0043 0.0082  0.0033  6840 MET A CG  
382  S  SD  . MET A 45  ? 0.3783 0.3386 0.3665 -0.0009 0.0062  -0.0009 6840 MET A SD  
383  C  CE  . MET A 45  ? 0.3966 0.3656 0.3972 0.0029  0.0128  -0.0040 6840 MET A CE  
384  N  N   . ASN A 46  ? 0.2639 0.2151 0.2450 -0.0134 -0.0063 0.0111  6841 ASN A N   
385  C  CA  . ASN A 46  ? 0.2781 0.2216 0.2452 -0.0149 -0.0083 0.0105  6841 ASN A CA  
386  C  C   . ASN A 46  ? 0.2675 0.2047 0.2310 -0.0166 -0.0147 0.0114  6841 ASN A C   
387  O  O   . ASN A 46  ? 0.2748 0.2062 0.2274 -0.0171 -0.0145 0.0100  6841 ASN A O   
388  C  CB  . ASN A 46  ? 0.2982 0.2401 0.2602 -0.0168 -0.0069 0.0115  6841 ASN A CB  
389  C  CG  . ASN A 46  ? 0.3301 0.2747 0.2886 -0.0142 -0.0009 0.0105  6841 ASN A CG  
390  O  OD1 . ASN A 46  ? 0.3784 0.3255 0.3363 -0.0112 0.0015  0.0079  6841 ASN A OD1 
391  N  ND2 . ASN A 46  ? 0.3411 0.2840 0.2964 -0.0154 0.0007  0.0126  6841 ASN A ND2 
392  N  N   . VAL A 47  ? 0.2567 0.1947 0.2286 -0.0174 -0.0202 0.0136  6842 VAL A N   
393  C  CA  . VAL A 47  ? 0.2619 0.1917 0.2266 -0.0185 -0.0270 0.0151  6842 VAL A CA  
394  C  C   . VAL A 47  ? 0.2595 0.1869 0.2227 -0.0161 -0.0251 0.0145  6842 VAL A C   
395  O  O   . VAL A 47  ? 0.2677 0.1869 0.2184 -0.0175 -0.0254 0.0148  6842 VAL A O   
396  C  CB  . VAL A 47  ? 0.2644 0.1950 0.2388 -0.0192 -0.0354 0.0174  6842 VAL A CB  
397  C  CG1 . VAL A 47  ? 0.2752 0.1966 0.2417 -0.0190 -0.0431 0.0197  6842 VAL A CG1 
398  C  CG2 . VAL A 47  ? 0.2654 0.1959 0.2397 -0.0226 -0.0384 0.0175  6842 VAL A CG2 
399  N  N   . ALA A 48  ? 0.2587 0.1927 0.2344 -0.0129 -0.0224 0.0133  6843 ALA A N   
400  C  CA  . ALA A 48  ? 0.2529 0.1842 0.2294 -0.0105 -0.0210 0.0120  6843 ALA A CA  
401  C  C   . ALA A 48  ? 0.2521 0.1809 0.2182 -0.0112 -0.0154 0.0091  6843 ALA A C   
402  O  O   . ALA A 48  ? 0.2545 0.1762 0.2146 -0.0121 -0.0156 0.0094  6843 ALA A O   
403  C  CB  . ALA A 48  ? 0.2511 0.1906 0.2434 -0.0066 -0.0184 0.0099  6843 ALA A CB  
404  N  N   . LYS A 49  ? 0.2487 0.1827 0.2132 -0.0109 -0.0109 0.0066  6844 LYS A N   
405  C  CA  . LYS A 49  ? 0.2476 0.1809 0.2051 -0.0108 -0.0067 0.0030  6844 LYS A CA  
406  C  C   . LYS A 49  ? 0.2506 0.1770 0.1976 -0.0141 -0.0075 0.0036  6844 LYS A C   
407  O  O   . LYS A 49  ? 0.2429 0.1661 0.1875 -0.0148 -0.0053 0.0017  6844 LYS A O   
408  C  CB  . LYS A 49  ? 0.2511 0.1901 0.2078 -0.0094 -0.0035 0.0014  6844 LYS A CB  
409  C  CG  . LYS A 49  ? 0.2630 0.2019 0.2139 -0.0083 -0.0011 -0.0026 6844 LYS A CG  
410  C  CD  . LYS A 49  ? 0.2696 0.2113 0.2167 -0.0069 0.0005  -0.0027 6844 LYS A CD  
411  C  CE  . LYS A 49  ? 0.2739 0.2206 0.2247 -0.0047 0.0033  -0.0022 6844 LYS A CE  
412  N  NZ  . LYS A 49  ? 0.2730 0.2201 0.2166 -0.0035 0.0053  -0.0016 6844 LYS A NZ  
413  N  N   . TYR A 50  ? 0.2484 0.1726 0.1900 -0.0163 -0.0098 0.0057  6845 TYR A N   
414  C  CA  . TYR A 50  ? 0.2580 0.1752 0.1882 -0.0193 -0.0097 0.0055  6845 TYR A CA  
415  C  C   . TYR A 50  ? 0.2638 0.1732 0.1888 -0.0211 -0.0115 0.0083  6845 TYR A C   
416  O  O   . TYR A 50  ? 0.2717 0.1759 0.1886 -0.0233 -0.0081 0.0073  6845 TYR A O   
417  C  CB  . TYR A 50  ? 0.2652 0.1803 0.1903 -0.0210 -0.0126 0.0065  6845 TYR A CB  
418  C  CG  . TYR A 50  ? 0.2680 0.1864 0.1933 -0.0201 -0.0099 0.0038  6845 TYR A CG  
419  C  CD1 . TYR A 50  ? 0.2691 0.1936 0.2018 -0.0179 -0.0088 0.0041  6845 TYR A CD1 
420  C  CD2 . TYR A 50  ? 0.2818 0.1961 0.1993 -0.0213 -0.0084 0.0012  6845 TYR A CD2 
421  C  CE1 . TYR A 50  ? 0.2726 0.1979 0.2037 -0.0169 -0.0073 0.0027  6845 TYR A CE1 
422  C  CE2 . TYR A 50  ? 0.2789 0.1949 0.1974 -0.0199 -0.0072 -0.0010 6845 TYR A CE2 
423  C  CZ  . TYR A 50  ? 0.2824 0.2032 0.2070 -0.0177 -0.0072 0.0002  6845 TYR A CZ  
424  O  OH  . TYR A 50  ? 0.2923 0.2127 0.2162 -0.0161 -0.0068 -0.0008 6845 TYR A OH  
425  N  N   . THR A 51  ? 0.2641 0.1722 0.1938 -0.0202 -0.0167 0.0118  6846 THR A N   
426  C  CA  . THR A 51  ? 0.2767 0.1750 0.1995 -0.0215 -0.0195 0.0154  6846 THR A CA  
427  C  C   . THR A 51  ? 0.2735 0.1703 0.1986 -0.0216 -0.0140 0.0137  6846 THR A C   
428  O  O   . THR A 51  ? 0.2848 0.1730 0.1995 -0.0247 -0.0115 0.0152  6846 THR A O   
429  C  CB  . THR A 51  ? 0.2861 0.1837 0.2165 -0.0195 -0.0274 0.0191  6846 THR A CB  
430  O  OG1 . THR A 51  ? 0.2960 0.1943 0.2241 -0.0205 -0.0329 0.0202  6846 THR A OG1 
431  C  CG2 . THR A 51  ? 0.3059 0.1919 0.2293 -0.0201 -0.0313 0.0236  6846 THR A CG2 
432  N  N   . GLN A 52  ? 0.2604 0.1650 0.1982 -0.0185 -0.0116 0.0102  6847 GLN A N   
433  C  CA  . GLN A 52  ? 0.2608 0.1641 0.2028 -0.0185 -0.0073 0.0074  6847 GLN A CA  
434  C  C   . GLN A 52  ? 0.2647 0.1690 0.2020 -0.0212 -0.0015 0.0037  6847 GLN A C   
435  O  O   . GLN A 52  ? 0.2746 0.1737 0.2111 -0.0239 0.0019  0.0034  6847 GLN A O   
436  C  CB  . GLN A 52  ? 0.2588 0.1696 0.2141 -0.0142 -0.0071 0.0037  6847 GLN A CB  
437  C  CG  . GLN A 52  ? 0.2622 0.1704 0.2250 -0.0117 -0.0119 0.0067  6847 GLN A CG  
438  C  CD  . GLN A 52  ? 0.2605 0.1754 0.2361 -0.0073 -0.0104 0.0019  6847 GLN A CD  
439  O  OE1 . GLN A 52  ? 0.2535 0.1764 0.2307 -0.0056 -0.0068 -0.0026 6847 GLN A OE1 
440  N  NE2 . GLN A 52  ? 0.2584 0.1689 0.2420 -0.0050 -0.0134 0.0030  6847 GLN A NE2 
441  N  N   . LEU A 53  ? 0.2586 0.1689 0.1941 -0.0205 -0.0005 0.0011  6848 LEU A N   
442  C  CA  . LEU A 53  ? 0.2693 0.1810 0.2026 -0.0224 0.0044  -0.0029 6848 LEU A CA  
443  C  C   . LEU A 53  ? 0.2840 0.1868 0.2060 -0.0270 0.0072  -0.0002 6848 LEU A C   
444  O  O   . LEU A 53  ? 0.2946 0.1961 0.2182 -0.0296 0.0129  -0.0026 6848 LEU A O   
445  C  CB  . LEU A 53  ? 0.2652 0.1827 0.1976 -0.0204 0.0036  -0.0051 6848 LEU A CB  
446  C  CG  . LEU A 53  ? 0.2764 0.1954 0.2077 -0.0214 0.0076  -0.0095 6848 LEU A CG  
447  C  CD1 . LEU A 53  ? 0.2737 0.1973 0.2149 -0.0208 0.0105  -0.0148 6848 LEU A CD1 
448  C  CD2 . LEU A 53  ? 0.2727 0.1951 0.2028 -0.0190 0.0055  -0.0108 6848 LEU A CD2 
449  N  N   . CYS A 54  ? 0.2911 0.1878 0.2022 -0.0281 0.0034  0.0042  6849 CYS A N   
450  C  CA  . CYS A 54  ? 0.3088 0.1952 0.2044 -0.0323 0.0058  0.0069  6849 CYS A CA  
451  C  C   . CYS A 54  ? 0.3183 0.1960 0.2113 -0.0348 0.0076  0.0110  6849 CYS A C   
452  O  O   . CYS A 54  ? 0.3280 0.1994 0.2126 -0.0390 0.0144  0.0113  6849 CYS A O   
453  C  CB  . CYS A 54  ? 0.3228 0.2040 0.2068 -0.0323 -0.0006 0.0103  6849 CYS A CB  
454  S  SG  . CYS A 54  ? 0.3245 0.2126 0.2097 -0.0308 -0.0012 0.0056  6849 CYS A SG  
455  N  N   . GLN A 55  ? 0.3155 0.1924 0.2161 -0.0324 0.0022  0.0139  6850 GLN A N   
456  C  CA  . GLN A 55  ? 0.3327 0.1999 0.2324 -0.0343 0.0031  0.0180  6850 GLN A CA  
457  C  C   . GLN A 55  ? 0.3253 0.1955 0.2340 -0.0368 0.0117  0.0134  6850 GLN A C   
458  O  O   . GLN A 55  ? 0.3373 0.1977 0.2402 -0.0413 0.0166  0.0165  6850 GLN A O   
459  C  CB  . GLN A 55  ? 0.3328 0.2003 0.2432 -0.0301 -0.0041 0.0201  6850 GLN A CB  
460  C  CG  . GLN A 55  ? 0.3451 0.2073 0.2480 -0.0284 -0.0132 0.0256  6850 GLN A CG  
461  C  CD  . GLN A 55  ? 0.3493 0.2143 0.2669 -0.0236 -0.0198 0.0264  6850 GLN A CD  
462  O  OE1 . GLN A 55  ? 0.3377 0.2128 0.2707 -0.0206 -0.0176 0.0213  6850 GLN A OE1 
463  N  NE2 . GLN A 55  ? 0.3609 0.2168 0.2737 -0.0226 -0.0281 0.0325  6850 GLN A NE2 
464  N  N   . TYR A 56  ? 0.3136 0.1962 0.2358 -0.0343 0.0132  0.0064  6851 TYR A N   
465  C  CA  . TYR A 56  ? 0.3126 0.1996 0.2460 -0.0363 0.0198  0.0008  6851 TYR A CA  
466  C  C   . TYR A 56  ? 0.3174 0.2042 0.2445 -0.0406 0.0276  -0.0009 6851 TYR A C   
467  O  O   . TYR A 56  ? 0.3223 0.2056 0.2525 -0.0453 0.0349  -0.0015 6851 TYR A O   
468  C  CB  . TYR A 56  ? 0.3027 0.2020 0.2506 -0.0317 0.0174  -0.0062 6851 TYR A CB  
469  C  CG  . TYR A 56  ? 0.2988 0.2030 0.2596 -0.0335 0.0221  -0.0127 6851 TYR A CG  
470  C  CD1 . TYR A 56  ? 0.3141 0.2132 0.2832 -0.0359 0.0236  -0.0130 6851 TYR A CD1 
471  C  CD2 . TYR A 56  ? 0.2961 0.2092 0.2621 -0.0330 0.0246  -0.0188 6851 TYR A CD2 
472  C  CE1 . TYR A 56  ? 0.3157 0.2195 0.2990 -0.0383 0.0276  -0.0195 6851 TYR A CE1 
473  C  CE2 . TYR A 56  ? 0.2935 0.2120 0.2742 -0.0347 0.0280  -0.0254 6851 TYR A CE2 
474  C  CZ  . TYR A 56  ? 0.3079 0.2221 0.2975 -0.0376 0.0296  -0.0259 6851 TYR A CZ  
475  O  OH  . TYR A 56  ? 0.3145 0.2344 0.3208 -0.0397 0.0323  -0.0330 6851 TYR A OH  
476  N  N   . LEU A 57  ? 0.3137 0.2039 0.2332 -0.0392 0.0269  -0.0021 6852 LEU A N   
477  C  CA  . LEU A 57  ? 0.3254 0.2158 0.2395 -0.0425 0.0348  -0.0050 6852 LEU A CA  
478  C  C   . LEU A 57  ? 0.3457 0.2228 0.2439 -0.0483 0.0406  0.0007  6852 LEU A C   
479  O  O   . LEU A 57  ? 0.3501 0.2270 0.2479 -0.0525 0.0505  -0.0019 6852 LEU A O   
480  C  CB  . LEU A 57  ? 0.3241 0.2180 0.2316 -0.0396 0.0315  -0.0070 6852 LEU A CB  
481  C  CG  . LEU A 57  ? 0.3133 0.2190 0.2344 -0.0344 0.0274  -0.0123 6852 LEU A CG  
482  C  CD1 . LEU A 57  ? 0.3129 0.2193 0.2267 -0.0321 0.0241  -0.0129 6852 LEU A CD1 
483  C  CD2 . LEU A 57  ? 0.3210 0.2352 0.2576 -0.0344 0.0325  -0.0196 6852 LEU A CD2 
484  N  N   . ASN A 58  ? 0.3573 0.2233 0.2433 -0.0485 0.0348  0.0084  6853 ASN A N   
485  C  CA  . ASN A 58  ? 0.3855 0.2358 0.2526 -0.0538 0.0390  0.0155  6853 ASN A CA  
486  C  C   . ASN A 58  ? 0.4030 0.2503 0.2790 -0.0588 0.0481  0.0157  6853 ASN A C   
487  O  O   . ASN A 58  ? 0.4232 0.2592 0.2844 -0.0645 0.0561  0.0200  6853 ASN A O   
488  C  CB  . ASN A 58  ? 0.3935 0.2324 0.2492 -0.0520 0.0287  0.0237  6853 ASN A CB  
489  C  CG  . ASN A 58  ? 0.4034 0.2399 0.2439 -0.0496 0.0211  0.0253  6853 ASN A CG  
490  O  OD1 . ASN A 58  ? 0.4022 0.2407 0.2340 -0.0507 0.0251  0.0216  6853 ASN A OD1 
491  N  ND2 . ASN A 58  ? 0.3998 0.2320 0.2385 -0.0464 0.0098  0.0303  6853 ASN A ND2 
492  N  N   . THR A 59  ? 0.3789 0.2356 0.2777 -0.0570 0.0471  0.0109  6854 THR A N   
493  C  CA  . THR A 59  ? 0.3914 0.2454 0.3027 -0.0618 0.0542  0.0105  6854 THR A CA  
494  C  C   . THR A 59  ? 0.3869 0.2517 0.3117 -0.0651 0.0647  0.0024  6854 THR A C   
495  O  O   . THR A 59  ? 0.3897 0.2528 0.3261 -0.0704 0.0722  0.0016  6854 THR A O   
496  C  CB  . THR A 59  ? 0.3878 0.2455 0.3171 -0.0581 0.0469  0.0083  6854 THR A CB  
497  O  OG1 . THR A 59  ? 0.3578 0.2319 0.3041 -0.0537 0.0445  -0.0009 6854 THR A OG1 
498  C  CG2 . THR A 59  ? 0.3965 0.2467 0.3174 -0.0537 0.0363  0.0146  6854 THR A CG2 
499  N  N   . LEU A 60  ? 0.3760 0.2507 0.3004 -0.0624 0.0655  -0.0030 6855 LEU A N   
500  C  CA  . LEU A 60  ? 0.3851 0.2720 0.3260 -0.0641 0.0742  -0.0119 6855 LEU A CA  
501  C  C   . LEU A 60  ? 0.4154 0.2968 0.3413 -0.0692 0.0860  -0.0108 6855 LEU A C   
502  O  O   . LEU A 60  ? 0.4739 0.3421 0.3742 -0.0705 0.0854  -0.0034 6855 LEU A O   
503  C  CB  . LEU A 60  ? 0.3677 0.2685 0.3192 -0.0570 0.0668  -0.0192 6855 LEU A CB  
504  C  CG  . LEU A 60  ? 0.3535 0.2591 0.3149 -0.0514 0.0555  -0.0203 6855 LEU A CG  
505  C  CD1 . LEU A 60  ? 0.3439 0.2617 0.3137 -0.0451 0.0498  -0.0270 6855 LEU A CD1 
506  C  CD2 . LEU A 60  ? 0.3593 0.2663 0.3386 -0.0538 0.0565  -0.0229 6855 LEU A CD2 
507  N  N   . THR A 61  ? 0.4091 0.3006 0.3509 -0.0717 0.0961  -0.0185 6856 THR A N   
508  C  CA  . THR A 61  ? 0.4259 0.3138 0.3556 -0.0766 0.1098  -0.0192 6856 THR A CA  
509  C  C   . THR A 61  ? 0.4128 0.3067 0.3361 -0.0710 0.1069  -0.0245 6856 THR A C   
510  O  O   . THR A 61  ? 0.4086 0.3128 0.3451 -0.0711 0.1151  -0.0330 6856 THR A O   
511  C  CB  . THR A 61  ? 0.4352 0.3313 0.3879 -0.0825 0.1234  -0.0251 6856 THR A CB  
512  O  OG1 . THR A 61  ? 0.4164 0.3305 0.3988 -0.0776 0.1181  -0.0353 6856 THR A OG1 
513  C  CG2 . THR A 61  ? 0.4566 0.3435 0.4129 -0.0893 0.1276  -0.0189 6856 THR A CG2 
514  N  N   . LEU A 62  ? 0.4103 0.2982 0.3161 -0.0664 0.0954  -0.0202 6857 LEU A N   
515  C  CA  . LEU A 62  ? 0.4135 0.3052 0.3127 -0.0616 0.0925  -0.0250 6857 LEU A CA  
516  C  C   . LEU A 62  ? 0.4268 0.3106 0.3064 -0.0659 0.1046  -0.0257 6857 LEU A C   
517  O  O   . LEU A 62  ? 0.4389 0.3083 0.2965 -0.0710 0.1089  -0.0181 6857 LEU A O   
518  C  CB  . LEU A 62  ? 0.4340 0.3197 0.3186 -0.0571 0.0785  -0.0198 6857 LEU A CB  
519  C  CG  . LEU A 62  ? 0.4452 0.3382 0.3453 -0.0520 0.0667  -0.0194 6857 LEU A CG  
520  C  CD1 . LEU A 62  ? 0.4534 0.3423 0.3408 -0.0479 0.0554  -0.0157 6857 LEU A CD1 
521  C  CD2 . LEU A 62  ? 0.4470 0.3551 0.3718 -0.0483 0.0665  -0.0282 6857 LEU A CD2 
522  N  N   . ALA A 63  ? 0.4131 0.3052 0.2999 -0.0635 0.1095  -0.0347 6858 ALA A N   
523  C  CA  . ALA A 63  ? 0.4340 0.3188 0.3004 -0.0662 0.1203  -0.0370 6858 ALA A CA  
524  C  C   . ALA A 63  ? 0.4386 0.3119 0.2783 -0.0631 0.1092  -0.0328 6858 ALA A C   
525  O  O   . ALA A 63  ? 0.4175 0.2962 0.2657 -0.0572 0.0965  -0.0341 6858 ALA A O   
526  C  CB  . ALA A 63  ? 0.4313 0.3293 0.3173 -0.0635 0.1281  -0.0489 6858 ALA A CB  
527  N  N   . VAL A 64  ? 0.4586 0.3162 0.2673 -0.0673 0.1132  -0.0275 6859 VAL A N   
528  C  CA  . VAL A 64  ? 0.4707 0.3167 0.2539 -0.0648 0.1012  -0.0238 6859 VAL A CA  
529  C  C   . VAL A 64  ? 0.5004 0.3360 0.2565 -0.0673 0.1107  -0.0273 6859 VAL A C   
530  O  O   . VAL A 64  ? 0.5240 0.3443 0.2518 -0.0720 0.1148  -0.0209 6859 VAL A O   
531  C  CB  . VAL A 64  ? 0.4793 0.3140 0.2490 -0.0662 0.0910  -0.0122 6859 VAL A CB  
532  C  CG1 . VAL A 64  ? 0.4890 0.3148 0.2392 -0.0630 0.0767  -0.0094 6859 VAL A CG1 
533  C  CG2 . VAL A 64  ? 0.4566 0.3012 0.2530 -0.0642 0.0845  -0.0097 6859 VAL A CG2 
534  N  N   . PRO A 65  ? 0.5031 0.3460 0.2669 -0.0640 0.1148  -0.0380 6860 PRO A N   
535  C  CA  . PRO A 65  ? 0.5408 0.3743 0.2793 -0.0657 0.1242  -0.0433 6860 PRO A CA  
536  C  C   . PRO A 65  ? 0.5583 0.3780 0.2685 -0.0637 0.1108  -0.0409 6860 PRO A C   
537  O  O   . PRO A 65  ? 0.5230 0.3432 0.2386 -0.0607 0.0946  -0.0360 6860 PRO A O   
538  C  CB  . PRO A 65  ? 0.5279 0.3757 0.2910 -0.0614 0.1305  -0.0562 6860 PRO A CB  
539  C  CG  . PRO A 65  ? 0.4971 0.3569 0.2885 -0.0556 0.1161  -0.0561 6860 PRO A CG  
540  C  CD  . PRO A 65  ? 0.4791 0.3386 0.2750 -0.0582 0.1105  -0.0456 6860 PRO A CD  
541  N  N   . TYR A 66  ? 0.5967 0.4040 0.2770 -0.0658 0.1180  -0.0444 6861 TYR A N   
542  C  CA  . TYR A 66  ? 0.6264 0.4212 0.2814 -0.0635 0.1046  -0.0448 6861 TYR A CA  
543  C  C   . TYR A 66  ? 0.6050 0.4107 0.2831 -0.0574 0.0971  -0.0540 6861 TYR A C   
544  O  O   . TYR A 66  ? 0.5920 0.4104 0.2941 -0.0554 0.1071  -0.0621 6861 TYR A O   
545  C  CB  . TYR A 66  ? 0.6732 0.4523 0.2903 -0.0667 0.1147  -0.0485 6861 TYR A CB  
546  C  CG  . TYR A 66  ? 0.7088 0.4725 0.2955 -0.0728 0.1202  -0.0380 6861 TYR A CG  
547  C  CD1 . TYR A 66  ? 0.7392 0.4877 0.3004 -0.0732 0.1045  -0.0284 6861 TYR A CD1 
548  C  CD2 . TYR A 66  ? 0.7442 0.5078 0.3278 -0.0782 0.1409  -0.0376 6861 TYR A CD2 
549  C  CE1 . TYR A 66  ? 0.7835 0.5155 0.3149 -0.0784 0.1082  -0.0179 6861 TYR A CE1 
550  C  CE2 . TYR A 66  ? 0.7823 0.5294 0.3360 -0.0843 0.1464  -0.0269 6861 TYR A CE2 
551  C  CZ  . TYR A 66  ? 0.7999 0.5305 0.3264 -0.0841 0.1295  -0.0167 6861 TYR A CZ  
552  O  OH  . TYR A 66  ? 0.8568 0.5692 0.3525 -0.0895 0.1336  -0.0053 6861 TYR A OH  
553  N  N   . ASN A 67  ? 0.6243 0.4249 0.2967 -0.0545 0.0800  -0.0526 6862 ASN A N   
554  C  CA  . ASN A 67  ? 0.6231 0.4317 0.3163 -0.0492 0.0723  -0.0602 6862 ASN A CA  
555  C  C   . ASN A 67  ? 0.5690 0.3951 0.2994 -0.0464 0.0740  -0.0603 6862 ASN A C   
556  O  O   . ASN A 67  ? 0.5573 0.3919 0.3067 -0.0427 0.0781  -0.0691 6862 ASN A O   
557  C  CB  . ASN A 67  ? 0.6710 0.4753 0.3540 -0.0477 0.0804  -0.0726 6862 ASN A CB  
558  C  CG  . ASN A 67  ? 0.7496 0.5353 0.3925 -0.0504 0.0780  -0.0732 6862 ASN A CG  
559  O  OD1 . ASN A 67  ? 0.8302 0.6072 0.4596 -0.0509 0.0627  -0.0669 6862 ASN A OD1 
560  N  ND2 . ASN A 67  ? 0.7845 0.5642 0.4087 -0.0519 0.0929  -0.0810 6862 ASN A ND2 
561  N  N   . MET A 68  ? 0.5377 0.3681 0.2772 -0.0480 0.0705  -0.0509 6863 MET A N   
562  C  CA  . MET A 68  ? 0.4994 0.3452 0.2716 -0.0454 0.0703  -0.0502 6863 MET A CA  
563  C  C   . MET A 68  ? 0.4753 0.3267 0.2641 -0.0401 0.0589  -0.0532 6863 MET A C   
564  O  O   . MET A 68  ? 0.5001 0.3436 0.2772 -0.0396 0.0479  -0.0512 6863 MET A O   
565  C  CB  . MET A 68  ? 0.4921 0.3380 0.2660 -0.0478 0.0656  -0.0396 6863 MET A CB  
566  C  CG  . MET A 68  ? 0.4745 0.3345 0.2781 -0.0455 0.0649  -0.0389 6863 MET A CG  
567  S  SD  . MET A 68  ? 0.4836 0.3410 0.2859 -0.0485 0.0606  -0.0275 6863 MET A SD  
568  C  CE  . MET A 68  ? 0.4515 0.3259 0.2884 -0.0454 0.0607  -0.0299 6863 MET A CE  
569  N  N   . ARG A 69  ? 0.4498 0.3135 0.2648 -0.0364 0.0613  -0.0577 6864 ARG A N   
570  C  CA  . ARG A 69  ? 0.4280 0.2959 0.2586 -0.0313 0.0516  -0.0601 6864 ARG A CA  
571  C  C   . ARG A 69  ? 0.3890 0.2661 0.2383 -0.0295 0.0450  -0.0539 6864 ARG A C   
572  O  O   . ARG A 69  ? 0.3777 0.2646 0.2436 -0.0287 0.0507  -0.0554 6864 ARG A O   
573  C  CB  . ARG A 69  ? 0.4425 0.3156 0.2868 -0.0273 0.0583  -0.0708 6864 ARG A CB  
574  C  CG  . ARG A 69  ? 0.4816 0.3459 0.3078 -0.0286 0.0665  -0.0787 6864 ARG A CG  
575  C  CD  . ARG A 69  ? 0.4993 0.3715 0.3442 -0.0245 0.0753  -0.0896 6864 ARG A CD  
576  N  NE  . ARG A 69  ? 0.5319 0.3959 0.3610 -0.0247 0.0832  -0.0987 6864 ARG A NE  
577  C  CZ  . ARG A 69  ? 0.5487 0.4176 0.3916 -0.0208 0.0915  -0.1099 6864 ARG A CZ  
578  N  NH1 . ARG A 69  ? 0.5457 0.4278 0.4190 -0.0163 0.0919  -0.1129 6864 ARG A NH1 
579  N  NH2 . ARG A 69  ? 0.5715 0.4319 0.3975 -0.0210 0.0989  -0.1186 6864 ARG A NH2 
580  N  N   . VAL A 70  ? 0.3638 0.2381 0.2112 -0.0289 0.0335  -0.0479 6865 VAL A N   
581  C  CA  . VAL A 70  ? 0.3442 0.2263 0.2066 -0.0273 0.0276  -0.0419 6865 VAL A CA  
582  C  C   . VAL A 70  ? 0.3338 0.2166 0.2052 -0.0236 0.0191  -0.0418 6865 VAL A C   
583  O  O   . VAL A 70  ? 0.3405 0.2155 0.2026 -0.0245 0.0135  -0.0415 6865 VAL A O   
584  C  CB  . VAL A 70  ? 0.3420 0.2205 0.1948 -0.0306 0.0233  -0.0334 6865 VAL A CB  
585  C  CG1 . VAL A 70  ? 0.3235 0.2098 0.1911 -0.0287 0.0183  -0.0284 6865 VAL A CG1 
586  C  CG2 . VAL A 70  ? 0.3607 0.2354 0.2018 -0.0347 0.0316  -0.0323 6865 VAL A CG2 
587  N  N   . ILE A 71  ? 0.3185 0.2096 0.2069 -0.0199 0.0180  -0.0421 6866 ILE A N   
588  C  CA  . ILE A 71  ? 0.3110 0.2014 0.2064 -0.0166 0.0102  -0.0404 6866 ILE A CA  
589  C  C   . ILE A 71  ? 0.2969 0.1932 0.1992 -0.0160 0.0063  -0.0336 6866 ILE A C   
590  O  O   . ILE A 71  ? 0.2890 0.1925 0.1982 -0.0154 0.0096  -0.0338 6866 ILE A O   
591  C  CB  . ILE A 71  ? 0.3193 0.2110 0.2254 -0.0118 0.0112  -0.0471 6866 ILE A CB  
592  C  CG1 . ILE A 71  ? 0.3227 0.2100 0.2324 -0.0092 0.0031  -0.0442 6866 ILE A CG1 
593  C  CG2 . ILE A 71  ? 0.3143 0.2159 0.2345 -0.0089 0.0152  -0.0504 6866 ILE A CG2 
594  C  CD1 . ILE A 71  ? 0.3376 0.2213 0.2541 -0.0047 0.0025  -0.0508 6866 ILE A CD1 
595  N  N   . HIS A 72  ? 0.2885 0.1817 0.1891 -0.0166 0.0000  -0.0283 6867 HIS A N   
596  C  CA  . HIS A 72  ? 0.2855 0.1835 0.1909 -0.0164 -0.0030 -0.0219 6867 HIS A CA  
597  C  C   . HIS A 72  ? 0.2808 0.1780 0.1917 -0.0136 -0.0071 -0.0195 6867 HIS A C   
598  O  O   . HIS A 72  ? 0.2978 0.1892 0.2066 -0.0152 -0.0107 -0.0174 6867 HIS A O   
599  C  CB  . HIS A 72  ? 0.2873 0.1827 0.1859 -0.0204 -0.0055 -0.0172 6867 HIS A CB  
600  C  CG  . HIS A 72  ? 0.2817 0.1823 0.1862 -0.0202 -0.0077 -0.0115 6867 HIS A CG  
601  N  ND1 . HIS A 72  ? 0.2863 0.1855 0.1905 -0.0227 -0.0121 -0.0070 6867 HIS A ND1 
602  C  CD2 . HIS A 72  ? 0.2764 0.1835 0.1877 -0.0177 -0.0063 -0.0103 6867 HIS A CD2 
603  C  CE1 . HIS A 72  ? 0.2807 0.1859 0.1920 -0.0216 -0.0119 -0.0033 6867 HIS A CE1 
604  N  NE2 . HIS A 72  ? 0.2729 0.1825 0.1872 -0.0186 -0.0084 -0.0053 6867 HIS A NE2 
605  N  N   . PHE A 73  ? 0.2808 0.1831 0.1982 -0.0097 -0.0069 -0.0198 6868 PHE A N   
606  C  CA  . PHE A 73  ? 0.2839 0.1842 0.2038 -0.0066 -0.0107 -0.0166 6868 PHE A CA  
607  C  C   . PHE A 73  ? 0.2768 0.1803 0.1959 -0.0077 -0.0112 -0.0101 6868 PHE A C   
608  O  O   . PHE A 73  ? 0.2716 0.1810 0.1915 -0.0085 -0.0091 -0.0099 6868 PHE A O   
609  C  CB  . PHE A 73  ? 0.2910 0.1940 0.2167 -0.0012 -0.0114 -0.0208 6868 PHE A CB  
610  C  CG  . PHE A 73  ? 0.3039 0.2044 0.2335 0.0007  -0.0106 -0.0278 6868 PHE A CG  
611  C  CD1 . PHE A 73  ? 0.3193 0.2113 0.2485 0.0023  -0.0139 -0.0281 6868 PHE A CD1 
612  C  CD2 . PHE A 73  ? 0.3093 0.2157 0.2441 0.0008  -0.0058 -0.0344 6868 PHE A CD2 
613  C  CE1 . PHE A 73  ? 0.3269 0.2166 0.2608 0.0048  -0.0128 -0.0356 6868 PHE A CE1 
614  C  CE2 . PHE A 73  ? 0.3155 0.2205 0.2553 0.0028  -0.0037 -0.0416 6868 PHE A CE2 
615  C  CZ  . PHE A 73  ? 0.3214 0.2182 0.2608 0.0052  -0.0073 -0.0426 6868 PHE A CZ  
616  N  N   . GLY A 74  ? 0.2797 0.1789 0.1976 -0.0078 -0.0134 -0.0051 6869 GLY A N   
617  C  CA  . GLY A 74  ? 0.2758 0.1780 0.1932 -0.0090 -0.0123 0.0008  6869 GLY A CA  
618  C  C   . GLY A 74  ? 0.2751 0.1800 0.1947 -0.0136 -0.0114 0.0026  6869 GLY A C   
619  O  O   . GLY A 74  ? 0.2719 0.1828 0.1935 -0.0138 -0.0094 0.0045  6869 GLY A O   
620  N  N   . ALA A 75  ? 0.2749 0.1749 0.1942 -0.0167 -0.0135 0.0015  6870 ALA A N   
621  C  CA  . ALA A 75  ? 0.2797 0.1811 0.2006 -0.0208 -0.0149 0.0026  6870 ALA A CA  
622  C  C   . ALA A 75  ? 0.2923 0.1943 0.2197 -0.0239 -0.0161 0.0078  6870 ALA A C   
623  O  O   . ALA A 75  ? 0.2955 0.2004 0.2271 -0.0266 -0.0181 0.0089  6870 ALA A O   
624  C  CB  . ALA A 75  ? 0.2889 0.1841 0.2044 -0.0225 -0.0173 -0.0016 6870 ALA A CB  
625  N  N   . GLY A 76  ? 0.3002 0.1990 0.2290 -0.0237 -0.0151 0.0109  6871 GLY A N   
626  C  CA  . GLY A 76  ? 0.3193 0.2188 0.2561 -0.0276 -0.0146 0.0160  6871 GLY A CA  
627  C  C   . GLY A 76  ? 0.3398 0.2480 0.2809 -0.0268 -0.0097 0.0195  6871 GLY A C   
628  O  O   . GLY A 76  ? 0.3436 0.2564 0.2807 -0.0233 -0.0077 0.0176  6871 GLY A O   
629  N  N   . SER A 77  ? 0.3580 0.2684 0.3079 -0.0304 -0.0073 0.0240  6872 SER A N   
630  C  CA  . SER A 77  ? 0.3577 0.2768 0.3127 -0.0298 -0.0011 0.0267  6872 SER A CA  
631  C  C   . SER A 77  ? 0.3682 0.2870 0.3314 -0.0342 0.0032  0.0321  6872 SER A C   
632  O  O   . SER A 77  ? 0.3470 0.2596 0.3148 -0.0382 -0.0001 0.0332  6872 SER A O   
633  C  CB  . SER A 77  ? 0.3545 0.2822 0.3182 -0.0297 -0.0027 0.0243  6872 SER A CB  
634  O  OG  . SER A 77  ? 0.3691 0.2982 0.3455 -0.0342 -0.0068 0.0248  6872 SER A OG  
635  N  N   . ASP A 78  ? 0.3936 0.3187 0.3589 -0.0337 0.0110  0.0350  6873 ASP A N   
636  C  CA  . ASP A 78  ? 0.4362 0.3621 0.4103 -0.0385 0.0178  0.0405  6873 ASP A CA  
637  C  C   . ASP A 78  ? 0.4275 0.3604 0.4233 -0.0436 0.0149  0.0395  6873 ASP A C   
638  O  O   . ASP A 78  ? 0.4606 0.3943 0.4683 -0.0490 0.0193  0.0435  6873 ASP A O   
639  C  CB  . ASP A 78  ? 0.4793 0.4105 0.4488 -0.0365 0.0280  0.0429  6873 ASP A CB  
640  C  CG  . ASP A 78  ? 0.5218 0.4650 0.4990 -0.0334 0.0298  0.0385  6873 ASP A CG  
641  O  OD1 . ASP A 78  ? 0.5402 0.4879 0.5279 -0.0334 0.0229  0.0346  6873 ASP A OD1 
642  O  OD2 . ASP A 78  ? 0.6135 0.5605 0.5850 -0.0309 0.0378  0.0389  6873 ASP A OD2 
643  N  N   . LYS A 79  ? 0.4100 0.3470 0.4105 -0.0420 0.0074  0.0346  6874 LYS A N   
644  C  CA  . LYS A 79  ? 0.4076 0.3509 0.4279 -0.0458 0.0018  0.0330  6874 LYS A CA  
645  C  C   . LYS A 79  ? 0.3874 0.3215 0.4079 -0.0497 -0.0066 0.0320  6874 LYS A C   
646  O  O   . LYS A 79  ? 0.3945 0.3322 0.4315 -0.0538 -0.0121 0.0309  6874 LYS A O   
647  C  CB  . LYS A 79  ? 0.4246 0.3736 0.4465 -0.0420 -0.0037 0.0288  6874 LYS A CB  
648  C  CG  . LYS A 79  ? 0.4525 0.4098 0.4751 -0.0375 0.0028  0.0282  6874 LYS A CG  
649  C  CD  . LYS A 79  ? 0.4771 0.4368 0.5001 -0.0339 -0.0037 0.0246  6874 LYS A CD  
650  C  CE  . LYS A 79  ? 0.5004 0.4665 0.5236 -0.0291 0.0020  0.0230  6874 LYS A CE  
651  N  NZ  . LYS A 79  ? 0.5291 0.5062 0.5712 -0.0298 0.0090  0.0238  6874 LYS A NZ  
652  N  N   . GLY A 80  ? 0.3518 0.2746 0.3553 -0.0482 -0.0083 0.0316  6875 GLY A N   
653  C  CA  . GLY A 80  ? 0.3508 0.2634 0.3525 -0.0511 -0.0160 0.0293  6875 GLY A CA  
654  C  C   . GLY A 80  ? 0.3353 0.2468 0.3319 -0.0495 -0.0253 0.0235  6875 GLY A C   
655  O  O   . GLY A 80  ? 0.3399 0.2437 0.3356 -0.0521 -0.0325 0.0205  6875 GLY A O   
656  N  N   . VAL A 81  ? 0.3121 0.2298 0.3047 -0.0455 -0.0251 0.0221  6876 VAL A N   
657  C  CA  . VAL A 81  ? 0.3119 0.2274 0.2966 -0.0440 -0.0329 0.0177  6876 VAL A CA  
658  C  C   . VAL A 81  ? 0.3082 0.2221 0.2770 -0.0389 -0.0291 0.0162  6876 VAL A C   
659  O  O   . VAL A 81  ? 0.3128 0.2284 0.2788 -0.0365 -0.0220 0.0181  6876 VAL A O   
660  C  CB  . VAL A 81  ? 0.3069 0.2305 0.3051 -0.0448 -0.0380 0.0178  6876 VAL A CB  
661  C  CG1 . VAL A 81  ? 0.3237 0.2490 0.3396 -0.0501 -0.0433 0.0180  6876 VAL A CG1 
662  C  CG2 . VAL A 81  ? 0.3009 0.2351 0.3075 -0.0420 -0.0310 0.0202  6876 VAL A CG2 
663  N  N   . ALA A 82  ? 0.3035 0.2138 0.2619 -0.0376 -0.0336 0.0129  6877 ALA A N   
664  C  CA  . ALA A 82  ? 0.2975 0.2060 0.2426 -0.0338 -0.0298 0.0109  6877 ALA A CA  
665  C  C   . ALA A 82  ? 0.2956 0.2071 0.2390 -0.0324 -0.0317 0.0109  6877 ALA A C   
666  O  O   . ALA A 82  ? 0.2892 0.1947 0.2222 -0.0330 -0.0360 0.0089  6877 ALA A O   
667  C  CB  . ALA A 82  ? 0.3087 0.2078 0.2411 -0.0339 -0.0314 0.0067  6877 ALA A CB  
668  N  N   . PRO A 83  ? 0.2890 0.2087 0.2418 -0.0306 -0.0285 0.0132  6878 PRO A N   
669  C  CA  . PRO A 83  ? 0.2918 0.2133 0.2447 -0.0289 -0.0305 0.0136  6878 PRO A CA  
670  C  C   . PRO A 83  ? 0.2841 0.2000 0.2220 -0.0274 -0.0285 0.0115  6878 PRO A C   
671  O  O   . PRO A 83  ? 0.2832 0.1938 0.2136 -0.0280 -0.0328 0.0116  6878 PRO A O   
672  C  CB  . PRO A 83  ? 0.2946 0.2257 0.2600 -0.0265 -0.0252 0.0151  6878 PRO A CB  
673  C  CG  . PRO A 83  ? 0.3017 0.2364 0.2758 -0.0284 -0.0219 0.0167  6878 PRO A CG  
674  C  CD  . PRO A 83  ? 0.2962 0.2228 0.2594 -0.0300 -0.0225 0.0156  6878 PRO A CD  
675  N  N   . GLY A 84  ? 0.2751 0.1916 0.2088 -0.0256 -0.0223 0.0096  6879 GLY A N   
676  C  CA  . GLY A 84  ? 0.2759 0.1887 0.1992 -0.0247 -0.0193 0.0069  6879 GLY A CA  
677  C  C   . GLY A 84  ? 0.2835 0.1876 0.1944 -0.0270 -0.0218 0.0048  6879 GLY A C   
678  O  O   . GLY A 84  ? 0.2835 0.1832 0.1854 -0.0276 -0.0212 0.0044  6879 GLY A O   
679  N  N   . THR A 85  ? 0.2814 0.1823 0.1912 -0.0284 -0.0243 0.0036  6880 THR A N   
680  C  CA  . THR A 85  ? 0.2947 0.1866 0.1913 -0.0303 -0.0265 0.0004  6880 THR A CA  
681  C  C   . THR A 85  ? 0.3052 0.1924 0.1950 -0.0323 -0.0330 0.0024  6880 THR A C   
682  O  O   . THR A 85  ? 0.3204 0.2001 0.1949 -0.0333 -0.0326 0.0007  6880 THR A O   
683  C  CB  . THR A 85  ? 0.3016 0.1898 0.1995 -0.0314 -0.0290 -0.0017 6880 THR A CB  
684  O  OG1 . THR A 85  ? 0.3055 0.1957 0.2067 -0.0289 -0.0236 -0.0036 6880 THR A OG1 
685  C  CG2 . THR A 85  ? 0.3190 0.1975 0.2031 -0.0334 -0.0323 -0.0059 6880 THR A CG2 
686  N  N   . ALA A 86  ? 0.3005 0.1917 0.2013 -0.0328 -0.0389 0.0059  6881 ALA A N   
687  C  CA  . ALA A 86  ? 0.3125 0.1992 0.2084 -0.0339 -0.0473 0.0080  6881 ALA A CA  
688  C  C   . ALA A 86  ? 0.3131 0.1969 0.2000 -0.0327 -0.0444 0.0101  6881 ALA A C   
689  O  O   . ALA A 86  ? 0.3276 0.2016 0.1982 -0.0339 -0.0487 0.0109  6881 ALA A O   
690  C  CB  . ALA A 86  ? 0.3079 0.2020 0.2226 -0.0339 -0.0532 0.0108  6881 ALA A CB  
691  N  N   . VAL A 87  ? 0.3012 0.1917 0.1968 -0.0305 -0.0376 0.0109  6882 VAL A N   
692  C  CA  . VAL A 87  ? 0.3050 0.1921 0.1940 -0.0298 -0.0344 0.0127  6882 VAL A CA  
693  C  C   . VAL A 87  ? 0.3153 0.1952 0.1874 -0.0316 -0.0283 0.0099  6882 VAL A C   
694  O  O   . VAL A 87  ? 0.3238 0.1948 0.1820 -0.0331 -0.0286 0.0121  6882 VAL A O   
695  C  CB  . VAL A 87  ? 0.2902 0.1862 0.1935 -0.0272 -0.0290 0.0129  6882 VAL A CB  
696  C  CG1 . VAL A 87  ? 0.2986 0.1905 0.1965 -0.0271 -0.0250 0.0139  6882 VAL A CG1 
697  C  CG2 . VAL A 87  ? 0.2793 0.1825 0.1991 -0.0253 -0.0335 0.0152  6882 VAL A CG2 
698  N  N   . LEU A 88  ? 0.3093 0.1921 0.1826 -0.0314 -0.0228 0.0054  6883 LEU A N   
699  C  CA  . LEU A 88  ? 0.3257 0.2032 0.1860 -0.0329 -0.0158 0.0017  6883 LEU A CA  
700  C  C   . LEU A 88  ? 0.3525 0.2185 0.1932 -0.0355 -0.0197 0.0015  6883 LEU A C   
701  O  O   . LEU A 88  ? 0.3671 0.2258 0.1927 -0.0374 -0.0146 0.0012  6883 LEU A O   
702  C  CB  . LEU A 88  ? 0.3188 0.2016 0.1861 -0.0313 -0.0110 -0.0035 6883 LEU A CB  
703  C  CG  . LEU A 88  ? 0.3058 0.1982 0.1882 -0.0285 -0.0069 -0.0041 6883 LEU A CG  
704  C  CD1 . LEU A 88  ? 0.3075 0.2031 0.1953 -0.0264 -0.0047 -0.0086 6883 LEU A CD1 
705  C  CD2 . LEU A 88  ? 0.3128 0.2062 0.1953 -0.0290 -0.0007 -0.0046 6883 LEU A CD2 
706  N  N   A ARG A 89  ? 0.3608 0.2248 0.2013 -0.0358 -0.0283 0.0013  6884 ARG A N   
707  N  N   B ARG A 89  ? 0.3627 0.2268 0.2033 -0.0358 -0.0283 0.0014  6884 ARG A N   
708  C  CA  A ARG A 89  ? 0.3897 0.2421 0.2104 -0.0380 -0.0342 0.0002  6884 ARG A CA  
709  C  CA  B ARG A 89  ? 0.3928 0.2454 0.2141 -0.0379 -0.0344 0.0003  6884 ARG A CA  
710  C  C   A ARG A 89  ? 0.3971 0.2416 0.2052 -0.0389 -0.0389 0.0059  6884 ARG A C   
711  C  C   B ARG A 89  ? 0.3990 0.2436 0.2073 -0.0389 -0.0390 0.0059  6884 ARG A C   
712  O  O   A ARG A 89  ? 0.4172 0.2498 0.2019 -0.0408 -0.0390 0.0055  6884 ARG A O   
713  O  O   B ARG A 89  ? 0.4192 0.2519 0.2041 -0.0408 -0.0391 0.0054  6884 ARG A O   
714  C  CB  A ARG A 89  ? 0.4007 0.2539 0.2289 -0.0382 -0.0439 -0.0011 6884 ARG A CB  
715  C  CB  B ARG A 89  ? 0.4059 0.2600 0.2359 -0.0381 -0.0441 -0.0008 6884 ARG A CB  
716  C  CG  A ARG A 89  ? 0.4421 0.2834 0.2512 -0.0402 -0.0527 -0.0030 6884 ARG A CG  
717  C  CG  B ARG A 89  ? 0.4486 0.2912 0.2603 -0.0401 -0.0517 -0.0038 6884 ARG A CG  
718  C  CD  A ARG A 89  ? 0.4668 0.3011 0.2613 -0.0412 -0.0478 -0.0102 6884 ARG A CD  
719  C  CD  B ARG A 89  ? 0.4717 0.3095 0.2721 -0.0406 -0.0443 -0.0109 6884 ARG A CD  
720  N  NE  A ARG A 89  ? 0.4812 0.3138 0.2649 -0.0411 -0.0354 -0.0116 6884 ARG A NE  
721  N  NE  B ARG A 89  ? 0.4977 0.3257 0.2846 -0.0421 -0.0517 -0.0157 6884 ARG A NE  
722  C  CZ  A ARG A 89  ? 0.4925 0.3221 0.2684 -0.0411 -0.0274 -0.0185 6884 ARG A CZ  
723  C  CZ  B ARG A 89  ? 0.5267 0.3494 0.3041 -0.0422 -0.0467 -0.0231 6884 ARG A CZ  
724  N  NH1 A ARG A 89  ? 0.4991 0.3260 0.2756 -0.0408 -0.0311 -0.0244 6884 ARG A NH1 
725  N  NH1 B ARG A 89  ? 0.5490 0.3620 0.3137 -0.0435 -0.0542 -0.0283 6884 ARG A NH1 
726  N  NH2 A ARG A 89  ? 0.4921 0.3218 0.2617 -0.0413 -0.0156 -0.0197 6884 ARG A NH2 
727  N  NH2 B ARG A 89  ? 0.5262 0.3535 0.3081 -0.0407 -0.0346 -0.0259 6884 ARG A NH2 
728  N  N   . GLN A 90  ? 0.3817 0.2319 0.2041 -0.0373 -0.0425 0.0109  6885 GLN A N   
729  C  CA  . GLN A 90  ? 0.3902 0.2322 0.2030 -0.0373 -0.0481 0.0170  6885 GLN A CA  
730  C  C   . GLN A 90  ? 0.3934 0.2294 0.1938 -0.0388 -0.0377 0.0186  6885 GLN A C   
731  O  O   . GLN A 90  ? 0.4031 0.2260 0.1823 -0.0406 -0.0396 0.0225  6885 GLN A O   
732  C  CB  . GLN A 90  ? 0.3742 0.2253 0.2097 -0.0345 -0.0534 0.0206  6885 GLN A CB  
733  C  CG  . GLN A 90  ? 0.3866 0.2301 0.2169 -0.0336 -0.0589 0.0268  6885 GLN A CG  
734  C  CD  . GLN A 90  ? 0.3740 0.2276 0.2293 -0.0302 -0.0623 0.0289  6885 GLN A CD  
735  O  OE1 . GLN A 90  ? 0.3660 0.2324 0.2406 -0.0289 -0.0582 0.0259  6885 GLN A OE1 
736  N  NE2 . GLN A 90  ? 0.3812 0.2282 0.2351 -0.0285 -0.0696 0.0342  6885 GLN A NE2 
737  N  N   . TRP A 91  ? 0.3693 0.2144 0.1828 -0.0383 -0.0273 0.0159  6886 TRP A N   
738  C  CA  . TRP A 91  ? 0.3740 0.2168 0.1834 -0.0400 -0.0166 0.0166  6886 TRP A CA  
739  C  C   . TRP A 91  ? 0.3917 0.2266 0.1811 -0.0433 -0.0079 0.0134  6886 TRP A C   
740  O  O   . TRP A 91  ? 0.4072 0.2318 0.1807 -0.0462 -0.0031 0.0170  6886 TRP A O   
741  C  CB  . TRP A 91  ? 0.3521 0.2085 0.1844 -0.0380 -0.0103 0.0133  6886 TRP A CB  
742  C  CG  . TRP A 91  ? 0.3506 0.2074 0.1850 -0.0397 0.0000  0.0126  6886 TRP A CG  
743  C  CD1 . TRP A 91  ? 0.3643 0.2144 0.1956 -0.0413 0.0014  0.0176  6886 TRP A CD1 
744  C  CD2 . TRP A 91  ? 0.3470 0.2117 0.1905 -0.0398 0.0094  0.0064  6886 TRP A CD2 
745  N  NE1 . TRP A 91  ? 0.3603 0.2137 0.1982 -0.0432 0.0119  0.0147  6886 TRP A NE1 
746  C  CE2 . TRP A 91  ? 0.3498 0.2129 0.1960 -0.0422 0.0167  0.0076  6886 TRP A CE2 
747  C  CE3 . TRP A 91  ? 0.3387 0.2113 0.1894 -0.0381 0.0119  0.0001  6886 TRP A CE3 
748  C  CZ2 . TRP A 91  ? 0.3480 0.2186 0.2055 -0.0430 0.0260  0.0020  6886 TRP A CZ2 
749  C  CZ3 . TRP A 91  ? 0.3383 0.2176 0.1991 -0.0381 0.0205  -0.0051 6886 TRP A CZ3 
750  C  CH2 . TRP A 91  ? 0.3392 0.2183 0.2040 -0.0406 0.0274  -0.0045 6886 TRP A CH2 
751  N  N   . LEU A 92  ? 0.3968 0.2359 0.1872 -0.0428 -0.0055 0.0067  6887 LEU A N   
752  C  CA  . LEU A 92  ? 0.4123 0.2463 0.1875 -0.0452 0.0045  0.0016  6887 LEU A CA  
753  C  C   . LEU A 92  ? 0.4529 0.2709 0.1981 -0.0478 0.0012  0.0035  6887 LEU A C   
754  O  O   . LEU A 92  ? 0.4681 0.2807 0.2059 -0.0470 -0.0111 0.0058  6887 LEU A O   
755  C  CB  . LEU A 92  ? 0.3957 0.2379 0.1822 -0.0430 0.0061  -0.0062 6887 LEU A CB  
756  C  CG  . LEU A 92  ? 0.3750 0.2312 0.1873 -0.0403 0.0098  -0.0084 6887 LEU A CG  
757  C  CD1 . LEU A 92  ? 0.3693 0.2310 0.1915 -0.0375 0.0071  -0.0138 6887 LEU A CD1 
758  C  CD2 . LEU A 92  ? 0.3718 0.2316 0.1884 -0.0417 0.0223  -0.0112 6887 LEU A CD2 
759  N  N   . PRO A 93  ? 0.4837 0.2939 0.2106 -0.0511 0.0126  0.0023  6888 PRO A N   
760  C  CA  . PRO A 93  ? 0.5233 0.3167 0.2169 -0.0537 0.0108  0.0039  6888 PRO A CA  
761  C  C   . PRO A 93  ? 0.5435 0.3339 0.2280 -0.0521 0.0028  -0.0023 6888 PRO A C   
762  O  O   . PRO A 93  ? 0.5183 0.3183 0.2186 -0.0502 0.0056  -0.0097 6888 PRO A O   
763  C  CB  . PRO A 93  ? 0.5441 0.3336 0.2254 -0.0574 0.0285  0.0012  6888 PRO A CB  
764  C  CG  . PRO A 93  ? 0.5174 0.3205 0.2269 -0.0574 0.0375  0.0009  6888 PRO A CG  
765  C  CD  . PRO A 93  ? 0.4779 0.2949 0.2152 -0.0527 0.0278  -0.0009 6888 PRO A CD  
766  N  N   . THR A 94  ? 0.5933 0.3696 0.2527 -0.0529 -0.0076 0.0005  6889 THR A N   
767  C  CA  . THR A 94  ? 0.6182 0.3897 0.2668 -0.0519 -0.0160 -0.0062 6889 THR A CA  
768  C  C   . THR A 94  ? 0.6131 0.3839 0.2529 -0.0529 -0.0017 -0.0157 6889 THR A C   
769  O  O   . THR A 94  ? 0.6318 0.3977 0.2573 -0.0556 0.0121  -0.0150 6889 THR A O   
770  C  CB  . THR A 94  ? 0.6903 0.4450 0.3096 -0.0528 -0.0296 -0.0018 6889 THR A CB  
771  O  OG1 . THR A 94  ? 0.7201 0.4771 0.3522 -0.0513 -0.0412 0.0069  6889 THR A OG1 
772  C  CG2 . THR A 94  ? 0.7071 0.4572 0.3182 -0.0518 -0.0409 -0.0091 6889 THR A CG2 
773  N  N   . GLY A 95  ? 0.5993 0.3752 0.2497 -0.0508 -0.0041 -0.0243 6890 GLY A N   
774  C  CA  . GLY A 95  ? 0.6006 0.3767 0.2464 -0.0507 0.0089  -0.0345 6890 GLY A CA  
775  C  C   . GLY A 95  ? 0.5625 0.3553 0.2411 -0.0484 0.0179  -0.0379 6890 GLY A C   
776  O  O   . GLY A 95  ? 0.5578 0.3533 0.2410 -0.0469 0.0258  -0.0473 6890 GLY A O   
777  N  N   . THR A 96  ? 0.5185 0.3215 0.2188 -0.0478 0.0162  -0.0309 6891 THR A N   
778  C  CA  . THR A 96  ? 0.4902 0.3085 0.2208 -0.0452 0.0227  -0.0339 6891 THR A CA  
779  C  C   . THR A 96  ? 0.4759 0.2986 0.2214 -0.0419 0.0147  -0.0390 6891 THR A C   
780  O  O   . THR A 96  ? 0.4683 0.2882 0.2139 -0.0417 0.0018  -0.0357 6891 THR A O   
781  C  CB  . THR A 96  ? 0.4661 0.2931 0.2147 -0.0450 0.0209  -0.0259 6891 THR A CB  
782  O  OG1 . THR A 96  ? 0.4764 0.2982 0.2122 -0.0484 0.0289  -0.0212 6891 THR A OG1 
783  C  CG2 . THR A 96  ? 0.4454 0.2871 0.2227 -0.0420 0.0253  -0.0290 6891 THR A CG2 
784  N  N   A LEU A 97  ? 0.4666 0.2953 0.2249 -0.0393 0.0221  -0.0468 6892 LEU A N   
785  N  N   B LEU A 97  ? 0.4759 0.3050 0.2349 -0.0393 0.0222  -0.0466 6892 LEU A N   
786  C  CA  A LEU A 97  ? 0.4546 0.2862 0.2283 -0.0360 0.0151  -0.0510 6892 LEU A CA  
787  C  CA  B LEU A 97  ? 0.4710 0.3027 0.2448 -0.0360 0.0153  -0.0510 6892 LEU A CA  
788  C  C   A LEU A 97  ? 0.4249 0.2686 0.2239 -0.0339 0.0117  -0.0454 6892 LEU A C   
789  C  C   B LEU A 97  ? 0.4344 0.2780 0.2336 -0.0338 0.0118  -0.0456 6892 LEU A C   
790  O  O   A LEU A 97  ? 0.4127 0.2651 0.2241 -0.0327 0.0197  -0.0456 6892 LEU A O   
791  O  O   B LEU A 97  ? 0.4228 0.2754 0.2352 -0.0324 0.0197  -0.0462 6892 LEU A O   
792  C  CB  A LEU A 97  ? 0.4681 0.2996 0.2446 -0.0335 0.0236  -0.0617 6892 LEU A CB  
793  C  CB  B LEU A 97  ? 0.4988 0.3305 0.2748 -0.0336 0.0245  -0.0617 6892 LEU A CB  
794  C  CG  A LEU A 97  ? 0.5008 0.3199 0.2510 -0.0353 0.0278  -0.0688 6892 LEU A CG  
795  C  CG  B LEU A 97  ? 0.5244 0.3504 0.3021 -0.0314 0.0173  -0.0681 6892 LEU A CG  
796  C  CD1 A LEU A 97  ? 0.5116 0.3321 0.2688 -0.0319 0.0367  -0.0804 6892 LEU A CD1 
797  C  CD1 B LEU A 97  ? 0.5526 0.3652 0.3061 -0.0344 0.0090  -0.0685 6892 LEU A CD1 
798  C  CD2 A LEU A 97  ? 0.5221 0.3301 0.2574 -0.0367 0.0141  -0.0680 6892 LEU A CD2 
799  C  CD2 B LEU A 97  ? 0.5403 0.3669 0.3231 -0.0281 0.0269  -0.0792 6892 LEU A CD2 
800  N  N   . LEU A 98  ? 0.4100 0.2538 0.2157 -0.0337 0.0006  -0.0408 6893 LEU A N   
801  C  CA  . LEU A 98  ? 0.3839 0.2379 0.2106 -0.0318 -0.0024 -0.0353 6893 LEU A CA  
802  C  C   . LEU A 98  ? 0.3697 0.2240 0.2087 -0.0297 -0.0078 -0.0372 6893 LEU A C   
803  O  O   . LEU A 98  ? 0.3816 0.2293 0.2162 -0.0313 -0.0157 -0.0374 6893 LEU A O   
804  C  CB  . LEU A 98  ? 0.3847 0.2390 0.2095 -0.0340 -0.0094 -0.0271 6893 LEU A CB  
805  C  CG  . LEU A 98  ? 0.3649 0.2290 0.2088 -0.0324 -0.0122 -0.0214 6893 LEU A CG  
806  C  CD1 . LEU A 98  ? 0.3531 0.2257 0.2074 -0.0302 -0.0042 -0.0218 6893 LEU A CD1 
807  C  CD2 . LEU A 98  ? 0.3714 0.2353 0.2140 -0.0342 -0.0190 -0.0147 6893 LEU A CD2 
808  N  N   . VAL A 99  ? 0.3563 0.2176 0.2105 -0.0261 -0.0041 -0.0385 6894 VAL A N   
809  C  CA  . VAL A 99  ? 0.3454 0.2058 0.2112 -0.0237 -0.0087 -0.0391 6894 VAL A CA  
810  C  C   . VAL A 99  ? 0.3315 0.2003 0.2106 -0.0224 -0.0105 -0.0321 6894 VAL A C   
811  O  O   . VAL A 99  ? 0.3144 0.1906 0.1974 -0.0211 -0.0059 -0.0309 6894 VAL A O   
812  C  CB  . VAL A 99  ? 0.3527 0.2121 0.2233 -0.0198 -0.0038 -0.0472 6894 VAL A CB  
813  C  CG1 . VAL A 99  ? 0.3564 0.2147 0.2399 -0.0164 -0.0085 -0.0463 6894 VAL A CG1 
814  C  CG2 . VAL A 99  ? 0.3775 0.2277 0.2342 -0.0209 -0.0017 -0.0552 6894 VAL A CG2 
815  N  N   . ASP A 100 ? 0.3272 0.1943 0.2124 -0.0230 -0.0165 -0.0278 6895 ASP A N   
816  C  CA  . ASP A 100 ? 0.3168 0.1912 0.2123 -0.0216 -0.0168 -0.0214 6895 ASP A CA  
817  C  C   . ASP A 100 ? 0.3214 0.1919 0.2241 -0.0196 -0.0195 -0.0202 6895 ASP A C   
818  O  O   . ASP A 100 ? 0.3279 0.1899 0.2292 -0.0200 -0.0220 -0.0239 6895 ASP A O   
819  C  CB  . ASP A 100 ? 0.3179 0.1963 0.2141 -0.0247 -0.0194 -0.0152 6895 ASP A CB  
820  C  CG  . ASP A 100 ? 0.3282 0.2021 0.2255 -0.0284 -0.0258 -0.0129 6895 ASP A CG  
821  O  OD1 . ASP A 100 ? 0.3425 0.2089 0.2394 -0.0290 -0.0285 -0.0158 6895 ASP A OD1 
822  O  OD2 . ASP A 100 ? 0.3327 0.2106 0.2328 -0.0305 -0.0283 -0.0086 6895 ASP A OD2 
823  N  N   . SER A 101 ? 0.3139 0.1895 0.2230 -0.0176 -0.0189 -0.0152 6896 SER A N   
824  C  CA  . SER A 101 ? 0.3236 0.1942 0.2372 -0.0152 -0.0210 -0.0129 6896 SER A CA  
825  C  C   . SER A 101 ? 0.3170 0.1924 0.2335 -0.0149 -0.0204 -0.0055 6896 SER A C   
826  O  O   . SER A 101 ? 0.3099 0.1937 0.2264 -0.0146 -0.0178 -0.0043 6896 SER A O   
827  C  CB  . SER A 101 ? 0.3417 0.2112 0.2570 -0.0098 -0.0199 -0.0186 6896 SER A CB  
828  O  OG  . SER A 101 ? 0.3843 0.2459 0.3026 -0.0072 -0.0233 -0.0168 6896 SER A OG  
829  N  N   . ASP A 102 ? 0.3208 0.1898 0.2391 -0.0151 -0.0222 -0.0008 6897 ASP A N   
830  C  CA  . ASP A 102 ? 0.3299 0.2014 0.2482 -0.0147 -0.0205 0.0065  6897 ASP A CA  
831  C  C   . ASP A 102 ? 0.3398 0.2004 0.2575 -0.0140 -0.0226 0.0108  6897 ASP A C   
832  O  O   . ASP A 102 ? 0.3410 0.1928 0.2609 -0.0156 -0.0255 0.0088  6897 ASP A O   
833  C  CB  . ASP A 102 ? 0.3292 0.2067 0.2511 -0.0196 -0.0184 0.0109  6897 ASP A CB  
834  C  CG  . ASP A 102 ? 0.3402 0.2233 0.2608 -0.0184 -0.0146 0.0162  6897 ASP A CG  
835  O  OD1 . ASP A 102 ? 0.3588 0.2367 0.2779 -0.0189 -0.0132 0.0221  6897 ASP A OD1 
836  O  OD2 . ASP A 102 ? 0.3272 0.2188 0.2474 -0.0167 -0.0126 0.0144  6897 ASP A OD2 
837  N  N   . LEU A 103 ? 0.3536 0.2136 0.2670 -0.0116 -0.0213 0.0164  6898 LEU A N   
838  C  CA  . LEU A 103 ? 0.3812 0.2291 0.2911 -0.0110 -0.0229 0.0227  6898 LEU A CA  
839  C  C   . LEU A 103 ? 0.3807 0.2241 0.2959 -0.0183 -0.0211 0.0280  6898 LEU A C   
840  O  O   . LEU A 103 ? 0.3776 0.2085 0.2938 -0.0196 -0.0236 0.0304  6898 LEU A O   
841  C  CB  . LEU A 103 ? 0.4023 0.2520 0.3033 -0.0075 -0.0210 0.0279  6898 LEU A CB  
842  C  CG  . LEU A 103 ? 0.4515 0.2879 0.3442 -0.0063 -0.0222 0.0361  6898 LEU A CG  
843  C  CD1 . LEU A 103 ? 0.4766 0.3021 0.3690 -0.0009 -0.0293 0.0332  6898 LEU A CD1 
844  C  CD2 . LEU A 103 ? 0.4723 0.3113 0.3529 -0.0033 -0.0197 0.0407  6898 LEU A CD2 
845  N  N   . ASN A 104 ? 0.3717 0.2249 0.2918 -0.0228 -0.0173 0.0290  6899 ASN A N   
846  C  CA  . ASN A 104 ? 0.3887 0.2409 0.3174 -0.0301 -0.0151 0.0340  6899 ASN A CA  
847  C  C   . ASN A 104 ? 0.3866 0.2422 0.3245 -0.0341 -0.0187 0.0282  6899 ASN A C   
848  O  O   . ASN A 104 ? 0.3597 0.2223 0.2958 -0.0320 -0.0202 0.0223  6899 ASN A O   
849  C  CB  . ASN A 104 ? 0.4005 0.2617 0.3299 -0.0319 -0.0080 0.0395  6899 ASN A CB  
850  C  CG  . ASN A 104 ? 0.4186 0.2750 0.3351 -0.0279 -0.0047 0.0451  6899 ASN A CG  
851  O  OD1 . ASN A 104 ? 0.4272 0.2707 0.3380 -0.0276 -0.0060 0.0497  6899 ASN A OD1 
852  N  ND2 . ASN A 104 ? 0.4197 0.2853 0.3307 -0.0247 -0.0012 0.0445  6899 ASN A ND2 
853  N  N   A ASP A 105 ? 0.3945 0.2444 0.3413 -0.0401 -0.0203 0.0302  6900 ASP A N   
854  N  N   B ASP A 105 ? 0.3953 0.2453 0.3422 -0.0402 -0.0202 0.0303  6900 ASP A N   
855  C  CA  A ASP A 105 ? 0.3991 0.2503 0.3538 -0.0441 -0.0257 0.0244  6900 ASP A CA  
856  C  CA  B ASP A 105 ? 0.3994 0.2509 0.3549 -0.0445 -0.0254 0.0249  6900 ASP A CA  
857  C  C   A ASP A 105 ? 0.3790 0.2443 0.3393 -0.0455 -0.0245 0.0238  6900 ASP A C   
858  C  C   B ASP A 105 ? 0.3779 0.2435 0.3383 -0.0455 -0.0244 0.0239  6900 ASP A C   
859  O  O   A ASP A 105 ? 0.3767 0.2498 0.3412 -0.0462 -0.0186 0.0291  6900 ASP A O   
860  O  O   B ASP A 105 ? 0.3722 0.2460 0.3364 -0.0459 -0.0185 0.0289  6900 ASP A O   
861  C  CB  A ASP A 105 ? 0.4317 0.2741 0.3971 -0.0506 -0.0280 0.0267  6900 ASP A CB  
862  C  CB  B ASP A 105 ? 0.4279 0.2726 0.3956 -0.0516 -0.0268 0.0282  6900 ASP A CB  
863  C  CG  A ASP A 105 ? 0.4447 0.2842 0.4150 -0.0537 -0.0359 0.0193  6900 ASP A CG  
864  C  CG  B ASP A 105 ? 0.4548 0.2830 0.4195 -0.0513 -0.0298 0.0280  6900 ASP A CG  
865  O  OD1 A ASP A 105 ? 0.4467 0.2874 0.4081 -0.0501 -0.0392 0.0122  6900 ASP A OD1 
866  O  OD1 B ASP A 105 ? 0.4750 0.2978 0.4310 -0.0462 -0.0335 0.0218  6900 ASP A OD1 
867  O  OD2 A ASP A 105 ? 0.4988 0.3344 0.4815 -0.0601 -0.0385 0.0204  6900 ASP A OD2 
868  O  OD2 B ASP A 105 ? 0.4849 0.3058 0.4571 -0.0563 -0.0280 0.0341  6900 ASP A OD2 
869  N  N   . PHE A 106 ? 0.3640 0.2314 0.3232 -0.0456 -0.0300 0.0174  6901 PHE A N   
870  C  CA  . PHE A 106 ? 0.3455 0.2241 0.3096 -0.0465 -0.0310 0.0166  6901 PHE A CA  
871  C  C   . PHE A 106 ? 0.3552 0.2303 0.3170 -0.0481 -0.0394 0.0103  6901 PHE A C   
872  O  O   . PHE A 106 ? 0.3678 0.2329 0.3212 -0.0474 -0.0425 0.0055  6901 PHE A O   
873  C  CB  . PHE A 106 ? 0.3280 0.2139 0.2839 -0.0412 -0.0265 0.0166  6901 PHE A CB  
874  C  CG  . PHE A 106 ? 0.3217 0.2035 0.2642 -0.0369 -0.0278 0.0110  6901 PHE A CG  
875  C  CD1 . PHE A 106 ? 0.3274 0.2027 0.2633 -0.0334 -0.0260 0.0100  6901 PHE A CD1 
876  C  CD2 . PHE A 106 ? 0.3208 0.2051 0.2579 -0.0363 -0.0304 0.0070  6901 PHE A CD2 
877  C  CE1 . PHE A 106 ? 0.3229 0.1961 0.2499 -0.0295 -0.0262 0.0042  6901 PHE A CE1 
878  C  CE2 . PHE A 106 ? 0.3156 0.1967 0.2414 -0.0330 -0.0296 0.0020  6901 PHE A CE2 
879  C  CZ  . PHE A 106 ? 0.3227 0.1991 0.2448 -0.0297 -0.0271 0.0001  6901 PHE A CZ  
880  N  N   A VAL A 107 ? 0.3586 0.2409 0.3274 -0.0502 -0.0433 0.0100  6902 VAL A N   
881  N  N   B VAL A 107 ? 0.3528 0.2355 0.3213 -0.0499 -0.0429 0.0101  6902 VAL A N   
882  C  CA  A VAL A 107 ? 0.3726 0.2505 0.3358 -0.0515 -0.0525 0.0043  6902 VAL A CA  
883  C  CA  B VAL A 107 ? 0.3634 0.2433 0.3281 -0.0515 -0.0522 0.0049  6902 VAL A CA  
884  C  C   A VAL A 107 ? 0.3611 0.2418 0.3107 -0.0473 -0.0516 0.0026  6902 VAL A C   
885  C  C   B VAL A 107 ? 0.3563 0.2373 0.3055 -0.0471 -0.0513 0.0027  6902 VAL A C   
886  O  O   A VAL A 107 ? 0.3462 0.2361 0.3004 -0.0455 -0.0478 0.0063  6902 VAL A O   
887  O  O   B VAL A 107 ? 0.3441 0.2338 0.2962 -0.0448 -0.0468 0.0061  6902 VAL A O   
888  C  CB  A VAL A 107 ? 0.3826 0.2648 0.3625 -0.0564 -0.0599 0.0047  6902 VAL A CB  
889  C  CB  B VAL A 107 ? 0.3614 0.2490 0.3439 -0.0554 -0.0576 0.0068  6902 VAL A CB  
890  C  CG1 A VAL A 107 ? 0.4028 0.2816 0.3974 -0.0615 -0.0598 0.0064  6902 VAL A CG1 
891  C  CG1 B VAL A 107 ? 0.3694 0.2542 0.3459 -0.0560 -0.0685 0.0021  6902 VAL A CG1 
892  C  CG2 A VAL A 107 ? 0.3794 0.2748 0.3713 -0.0557 -0.0578 0.0089  6902 VAL A CG2 
893  C  CG2 B VAL A 107 ? 0.3729 0.2598 0.3733 -0.0609 -0.0578 0.0089  6902 VAL A CG2 
894  N  N   . SER A 108 ? 0.3674 0.2398 0.3009 -0.0461 -0.0546 -0.0029 6903 SER A N   
895  C  CA  . SER A 108 ? 0.3683 0.2411 0.2868 -0.0427 -0.0519 -0.0045 6903 SER A CA  
896  C  C   . SER A 108 ? 0.3734 0.2392 0.2774 -0.0438 -0.0590 -0.0085 6903 SER A C   
897  O  O   . SER A 108 ? 0.3831 0.2412 0.2842 -0.0463 -0.0657 -0.0127 6903 SER A O   
898  C  CB  . SER A 108 ? 0.3805 0.2496 0.2908 -0.0394 -0.0449 -0.0073 6903 SER A CB  
899  O  OG  . SER A 108 ? 0.3838 0.2528 0.2811 -0.0370 -0.0414 -0.0096 6903 SER A OG  
900  N  N   . ASP A 109 ? 0.3616 0.2290 0.2555 -0.0418 -0.0571 -0.0074 6904 ASP A N   
901  C  CA  . ASP A 109 ? 0.3828 0.2419 0.2574 -0.0424 -0.0621 -0.0102 6904 ASP A CA  
902  C  C   . ASP A 109 ? 0.3895 0.2421 0.2468 -0.0408 -0.0544 -0.0152 6904 ASP A C   
903  O  O   . ASP A 109 ? 0.4180 0.2627 0.2558 -0.0413 -0.0558 -0.0176 6904 ASP A O   
904  C  CB  . ASP A 109 ? 0.3810 0.2440 0.2549 -0.0416 -0.0645 -0.0053 6904 ASP A CB  
905  C  CG  . ASP A 109 ? 0.3811 0.2504 0.2732 -0.0430 -0.0732 -0.0018 6904 ASP A CG  
906  O  OD1 . ASP A 109 ? 0.3924 0.2569 0.2846 -0.0454 -0.0833 -0.0043 6904 ASP A OD1 
907  O  OD2 . ASP A 109 ? 0.3678 0.2470 0.2752 -0.0415 -0.0698 0.0024  6904 ASP A OD2 
908  N  N   . ALA A 110 ? 0.3761 0.2317 0.2401 -0.0387 -0.0466 -0.0167 6905 ALA A N   
909  C  CA  . ALA A 110 ? 0.3746 0.2260 0.2268 -0.0368 -0.0389 -0.0223 6905 ALA A CA  
910  C  C   . ALA A 110 ? 0.3935 0.2336 0.2334 -0.0380 -0.0424 -0.0296 6905 ALA A C   
911  O  O   . ALA A 110 ? 0.3984 0.2348 0.2434 -0.0401 -0.0507 -0.0304 6905 ALA A O   
912  C  CB  . ALA A 110 ? 0.3624 0.2198 0.2270 -0.0337 -0.0321 -0.0223 6905 ALA A CB  
913  N  N   . ASP A 111 ? 0.4056 0.2407 0.2306 -0.0368 -0.0357 -0.0354 6906 ASP A N   
914  C  CA  . ASP A 111 ? 0.4316 0.2556 0.2431 -0.0372 -0.0370 -0.0442 6906 ASP A CA  
915  C  C   . ASP A 111 ? 0.4250 0.2480 0.2514 -0.0356 -0.0380 -0.0477 6906 ASP A C   
916  O  O   . ASP A 111 ? 0.4369 0.2508 0.2595 -0.0370 -0.0442 -0.0529 6906 ASP A O   
917  C  CB  . ASP A 111 ? 0.4515 0.2724 0.2465 -0.0360 -0.0267 -0.0495 6906 ASP A CB  
918  C  CG  . ASP A 111 ? 0.4762 0.2942 0.2528 -0.0384 -0.0266 -0.0454 6906 ASP A CG  
919  O  OD1 . ASP A 111 ? 0.5012 0.3109 0.2639 -0.0407 -0.0360 -0.0451 6906 ASP A OD1 
920  O  OD2 . ASP A 111 ? 0.4743 0.2981 0.2520 -0.0379 -0.0183 -0.0419 6906 ASP A OD2 
921  N  N   A SER A 112 ? 0.4021 0.2331 0.2443 -0.0328 -0.0327 -0.0447 6907 SER A N   
922  N  N   B SER A 112 ? 0.4031 0.2341 0.2451 -0.0327 -0.0325 -0.0448 6907 SER A N   
923  C  CA  A SER A 112 ? 0.4010 0.2296 0.2567 -0.0309 -0.0340 -0.0465 6907 SER A CA  
924  C  CA  B SER A 112 ? 0.4002 0.2291 0.2560 -0.0307 -0.0335 -0.0465 6907 SER A CA  
925  C  C   A SER A 112 ? 0.3791 0.2172 0.2508 -0.0292 -0.0320 -0.0387 6907 SER A C   
926  C  C   B SER A 112 ? 0.3789 0.2172 0.2508 -0.0292 -0.0320 -0.0385 6907 SER A C   
927  O  O   A SER A 112 ? 0.3618 0.2082 0.2339 -0.0275 -0.0265 -0.0360 6907 SER A O   
928  O  O   B SER A 112 ? 0.3638 0.2105 0.2361 -0.0277 -0.0267 -0.0355 6907 SER A O   
929  C  CB  A SER A 112 ? 0.4173 0.2408 0.2692 -0.0272 -0.0283 -0.0557 6907 SER A CB  
930  C  CB  B SER A 112 ? 0.4123 0.2371 0.2651 -0.0268 -0.0273 -0.0554 6907 SER A CB  
931  O  OG  A SER A 112 ? 0.4246 0.2412 0.2863 -0.0259 -0.0322 -0.0583 6907 SER A OG  
932  O  OG  B SER A 112 ? 0.4354 0.2502 0.2722 -0.0282 -0.0284 -0.0636 6907 SER A OG  
933  N  N   . THR A 113 ? 0.3735 0.2093 0.2570 -0.0299 -0.0363 -0.0352 6908 THR A N   
934  C  CA  . THR A 113 ? 0.3642 0.2070 0.2601 -0.0286 -0.0346 -0.0274 6908 THR A CA  
935  C  C   . THR A 113 ? 0.3727 0.2092 0.2757 -0.0256 -0.0346 -0.0284 6908 THR A C   
936  O  O   . THR A 113 ? 0.3796 0.2059 0.2835 -0.0272 -0.0390 -0.0317 6908 THR A O   
937  C  CB  . THR A 113 ? 0.3624 0.2086 0.2658 -0.0331 -0.0390 -0.0203 6908 THR A CB  
938  O  OG1 . THR A 113 ? 0.3543 0.2056 0.2514 -0.0348 -0.0399 -0.0197 6908 THR A OG1 
939  C  CG2 . THR A 113 ? 0.3548 0.2071 0.2685 -0.0322 -0.0361 -0.0126 6908 THR A CG2 
940  N  N   . LEU A 114 ? 0.3623 0.2036 0.2697 -0.0211 -0.0308 -0.0260 6909 LEU A N   
941  C  CA  . LEU A 114 ? 0.3832 0.2177 0.2969 -0.0174 -0.0320 -0.0254 6909 LEU A CA  
942  C  C   . LEU A 114 ? 0.3737 0.2110 0.2924 -0.0178 -0.0321 -0.0154 6909 LEU A C   
943  O  O   . LEU A 114 ? 0.3507 0.1980 0.2687 -0.0167 -0.0289 -0.0122 6909 LEU A O   
944  C  CB  . LEU A 114 ? 0.3972 0.2338 0.3115 -0.0110 -0.0286 -0.0317 6909 LEU A CB  
945  C  CG  . LEU A 114 ? 0.4251 0.2576 0.3347 -0.0099 -0.0267 -0.0425 6909 LEU A CG  
946  C  CD1 . LEU A 114 ? 0.4435 0.2811 0.3582 -0.0036 -0.0223 -0.0485 6909 LEU A CD1 
947  C  CD2 . LEU A 114 ? 0.4547 0.2737 0.3649 -0.0109 -0.0315 -0.0462 6909 LEU A CD2 
948  N  N   . ILE A 115 ? 0.3790 0.2070 0.3020 -0.0196 -0.0351 -0.0109 6910 ILE A N   
949  C  CA  . ILE A 115 ? 0.3811 0.2102 0.3067 -0.0205 -0.0339 -0.0008 6910 ILE A CA  
950  C  C   . ILE A 115 ? 0.3908 0.2120 0.3157 -0.0148 -0.0352 0.0010  6910 ILE A C   
951  O  O   . ILE A 115 ? 0.3959 0.2050 0.3230 -0.0136 -0.0387 -0.0017 6910 ILE A O   
952  C  CB  . ILE A 115 ? 0.3921 0.2168 0.3236 -0.0277 -0.0353 0.0045  6910 ILE A CB  
953  C  CG1 . ILE A 115 ? 0.3851 0.2172 0.3187 -0.0326 -0.0363 0.0018  6910 ILE A CG1 
954  C  CG2 . ILE A 115 ? 0.3928 0.2187 0.3257 -0.0288 -0.0318 0.0148  6910 ILE A CG2 
955  C  CD1 . ILE A 115 ? 0.3728 0.2186 0.3041 -0.0316 -0.0327 0.0034  6910 ILE A CD1 
956  N  N   . GLY A 116 ? 0.3857 0.2126 0.3073 -0.0112 -0.0331 0.0055  6911 GLY A N   
957  C  CA  . GLY A 116 ? 0.3957 0.2149 0.3150 -0.0051 -0.0358 0.0083  6911 GLY A CA  
958  C  C   . GLY A 116 ? 0.3866 0.2159 0.3028 0.0003  -0.0349 0.0070  6911 GLY A C   
959  O  O   . GLY A 116 ? 0.3598 0.2014 0.2766 -0.0007 -0.0315 0.0033  6911 GLY A O   
960  N  N   A ASP A 117 ? 0.3945 0.2178 0.3073 0.0062  -0.0385 0.0101  6912 ASP A N   
961  N  N   B ASP A 117 ? 0.3925 0.2158 0.3053 0.0062  -0.0385 0.0102  6912 ASP A N   
962  C  CA  A ASP A 117 ? 0.3947 0.2271 0.3055 0.0120  -0.0394 0.0079  6912 ASP A CA  
963  C  CA  B ASP A 117 ? 0.3901 0.2223 0.3009 0.0121  -0.0395 0.0079  6912 ASP A CA  
964  C  C   A ASP A 117 ? 0.3798 0.2215 0.2995 0.0144  -0.0386 -0.0032 6912 ASP A C   
965  C  C   B ASP A 117 ? 0.3776 0.2192 0.2973 0.0144  -0.0386 -0.0032 6912 ASP A C   
966  O  O   A ASP A 117 ? 0.3801 0.2163 0.3058 0.0154  -0.0400 -0.0091 6912 ASP A O   
967  O  O   B ASP A 117 ? 0.3792 0.2154 0.3049 0.0154  -0.0399 -0.0091 6912 ASP A O   
968  C  CB  A ASP A 117 ? 0.4174 0.2399 0.3230 0.0186  -0.0458 0.0123  6912 ASP A CB  
969  C  CB  B ASP A 117 ? 0.4078 0.2298 0.3140 0.0188  -0.0461 0.0118  6912 ASP A CB  
970  C  CG  A ASP A 117 ? 0.4210 0.2520 0.3231 0.0241  -0.0481 0.0108  6912 ASP A CG  
971  C  CG  B ASP A 117 ? 0.4060 0.2366 0.3102 0.0249  -0.0489 0.0093  6912 ASP A CG  
972  O  OD1 A ASP A 117 ? 0.3991 0.2412 0.3104 0.0267  -0.0480 0.0018  6912 ASP A OD1 
973  O  OD1 B ASP A 117 ? 0.3999 0.2398 0.2990 0.0226  -0.0449 0.0111  6912 ASP A OD1 
974  O  OD2 A ASP A 117 ? 0.4514 0.2779 0.3414 0.0251  -0.0493 0.0186  6912 ASP A OD2 
975  O  OD2 B ASP A 117 ? 0.4121 0.2402 0.3216 0.0321  -0.0554 0.0049  6912 ASP A OD2 
976  N  N   . CYS A 118 ? 0.3648 0.2194 0.2855 0.0150  -0.0359 -0.0064 6913 CYS A N   
977  C  CA  . CYS A 118 ? 0.3622 0.2260 0.2915 0.0162  -0.0333 -0.0165 6913 CYS A CA  
978  C  C   . CYS A 118 ? 0.3648 0.2253 0.3030 0.0232  -0.0376 -0.0232 6913 CYS A C   
979  O  O   . CYS A 118 ? 0.3648 0.2285 0.3105 0.0234  -0.0344 -0.0318 6913 CYS A O   
980  C  CB  . CYS A 118 ? 0.3632 0.2400 0.2933 0.0159  -0.0301 -0.0182 6913 CYS A CB  
981  S  SG  . CYS A 118 ? 0.3813 0.2605 0.3100 0.0225  -0.0359 -0.0161 6913 CYS A SG  
982  N  N   . ALA A 119 ? 0.3688 0.2225 0.3058 0.0289  -0.0445 -0.0193 6914 ALA A N   
983  C  CA  . ALA A 119 ? 0.3845 0.2352 0.3323 0.0368  -0.0504 -0.0256 6914 ALA A CA  
984  C  C   . ALA A 119 ? 0.3902 0.2308 0.3426 0.0366  -0.0502 -0.0294 6914 ALA A C   
985  O  O   . ALA A 119 ? 0.4062 0.2465 0.3708 0.0427  -0.0528 -0.0375 6914 ALA A O   
986  C  CB  . ALA A 119 ? 0.4080 0.2509 0.3503 0.0428  -0.0594 -0.0191 6914 ALA A CB  
987  N  N   . THR A 120 ? 0.3858 0.2185 0.3301 0.0300  -0.0475 -0.0245 6915 THR A N   
988  C  CA  . THR A 120 ? 0.4004 0.2219 0.3480 0.0292  -0.0480 -0.0285 6915 THR A CA  
989  C  C   . THR A 120 ? 0.4026 0.2318 0.3531 0.0257  -0.0409 -0.0382 6915 THR A C   
990  O  O   . THR A 120 ? 0.4120 0.2333 0.3655 0.0260  -0.0408 -0.0445 6915 THR A O   
991  C  CB  . THR A 120 ? 0.4046 0.2135 0.3437 0.0232  -0.0491 -0.0193 6915 THR A CB  
992  O  OG1 . THR A 120 ? 0.3949 0.2116 0.3283 0.0153  -0.0434 -0.0169 6915 THR A OG1 
993  C  CG2 . THR A 120 ? 0.4189 0.2182 0.3514 0.0252  -0.0543 -0.0081 6915 THR A CG2 
994  N  N   . VAL A 121 ? 0.3964 0.2392 0.3450 0.0228  -0.0354 -0.0394 6916 VAL A N   
995  C  CA  . VAL A 121 ? 0.3981 0.2467 0.3452 0.0186  -0.0281 -0.0469 6916 VAL A CA  
996  C  C   . VAL A 121 ? 0.4120 0.2671 0.3703 0.0237  -0.0245 -0.0582 6916 VAL A C   
997  O  O   . VAL A 121 ? 0.4020 0.2669 0.3691 0.0277  -0.0246 -0.0597 6916 VAL A O   
998  C  CB  . VAL A 121 ? 0.3862 0.2445 0.3261 0.0128  -0.0237 -0.0425 6916 VAL A CB  
999  C  CG1 . VAL A 121 ? 0.3835 0.2464 0.3198 0.0091  -0.0167 -0.0494 6916 VAL A CG1 
1000 C  CG2 . VAL A 121 ? 0.3829 0.2361 0.3146 0.0077  -0.0263 -0.0326 6916 VAL A CG2 
1001 N  N   . HIS A 122 ? 0.4253 0.2752 0.3839 0.0234  -0.0212 -0.0665 6917 HIS A N   
1002 C  CA  . HIS A 122 ? 0.4591 0.3152 0.4286 0.0277  -0.0153 -0.0786 6917 HIS A CA  
1003 C  C   . HIS A 122 ? 0.4623 0.3199 0.4212 0.0218  -0.0062 -0.0842 6917 HIS A C   
1004 O  O   . HIS A 122 ? 0.4472 0.2962 0.3923 0.0166  -0.0076 -0.0811 6917 HIS A O   
1005 C  CB  . HIS A 122 ? 0.5088 0.3557 0.4895 0.0349  -0.0203 -0.0844 6917 HIS A CB  
1006 C  CG  . HIS A 122 ? 0.5501 0.3945 0.5389 0.0409  -0.0299 -0.0781 6917 HIS A CG  
1007 N  ND1 . HIS A 122 ? 0.6041 0.4583 0.6085 0.0477  -0.0317 -0.0821 6917 HIS A ND1 
1008 C  CD2 . HIS A 122 ? 0.5896 0.4226 0.5719 0.0409  -0.0383 -0.0678 6917 HIS A CD2 
1009 C  CE1 . HIS A 122 ? 0.6123 0.4603 0.6176 0.0522  -0.0420 -0.0745 6917 HIS A CE1 
1010 N  NE2 . HIS A 122 ? 0.6245 0.4590 0.6154 0.0480  -0.0453 -0.0652 6917 HIS A NE2 
1011 N  N   A THR A 123 ? 0.4589 0.3273 0.4237 0.0224  0.0027  -0.0918 6918 THR A N   
1012 N  N   B THR A 123 ? 0.4660 0.3341 0.4313 0.0226  0.0026  -0.0922 6918 THR A N   
1013 C  CA  A THR A 123 ? 0.4718 0.3404 0.4238 0.0170  0.0127  -0.0972 6918 THR A CA  
1014 C  CA  B THR A 123 ? 0.4814 0.3500 0.4340 0.0172  0.0126  -0.0974 6918 THR A CA  
1015 C  C   A THR A 123 ? 0.4885 0.3628 0.4526 0.0210  0.0220  -0.1101 6918 THR A C   
1016 C  C   B THR A 123 ? 0.4936 0.3679 0.4581 0.0212  0.0220  -0.1103 6918 THR A C   
1017 O  O   A THR A 123 ? 0.4926 0.3775 0.4765 0.0259  0.0226  -0.1130 6918 THR A O   
1018 O  O   B THR A 123 ? 0.4912 0.3761 0.4754 0.0260  0.0227  -0.1133 6918 THR A O   
1019 C  CB  A THR A 123 ? 0.4678 0.3437 0.4100 0.0106  0.0167  -0.0904 6918 THR A CB  
1020 C  CB  B THR A 123 ? 0.4770 0.3535 0.4209 0.0112  0.0166  -0.0907 6918 THR A CB  
1021 O  OG1 A THR A 123 ? 0.4409 0.3301 0.3976 0.0126  0.0211  -0.0919 6918 THR A OG1 
1022 O  OG1 B THR A 123 ? 0.4904 0.3658 0.4213 0.0068  0.0264  -0.0960 6918 THR A OG1 
1023 C  CG2 A THR A 123 ? 0.4552 0.3276 0.3890 0.0073  0.0083  -0.0785 6918 THR A CG2 
1024 C  CG2 B THR A 123 ? 0.4622 0.3522 0.4222 0.0138  0.0181  -0.0900 6918 THR A CG2 
1025 N  N   . ALA A 124 ? 0.5127 0.3801 0.4658 0.0193  0.0286  -0.1182 6919 ALA A N   
1026 C  CA  . ALA A 124 ? 0.5372 0.4099 0.5003 0.0226  0.0399  -0.1315 6919 ALA A CA  
1027 C  C   . ALA A 124 ? 0.5506 0.4348 0.5109 0.0176  0.0525  -0.1320 6919 ALA A C   
1028 O  O   . ALA A 124 ? 0.5804 0.4752 0.5580 0.0204  0.0621  -0.1409 6919 ALA A O   
1029 C  CB  . ALA A 124 ? 0.5568 0.4164 0.5057 0.0223  0.0424  -0.1398 6919 ALA A CB  
1030 N  N   . ASN A 125 ? 0.5455 0.4279 0.4871 0.0105  0.0519  -0.1224 6920 ASN A N   
1031 C  CA  . ASN A 125 ? 0.5253 0.4149 0.4595 0.0046  0.0636  -0.1213 6920 ASN A CA  
1032 C  C   . ASN A 125 ? 0.4871 0.3883 0.4347 0.0037  0.0613  -0.1137 6920 ASN A C   
1033 O  O   . ASN A 125 ? 0.4550 0.3573 0.4118 0.0069  0.0496  -0.1077 6920 ASN A O   
1034 C  CB  . ASN A 125 ? 0.5564 0.4349 0.4597 -0.0024 0.0643  -0.1158 6920 ASN A CB  
1035 C  CG  . ASN A 125 ? 0.5718 0.4446 0.4666 -0.0044 0.0507  -0.1042 6920 ASN A CG  
1036 O  OD1 . ASN A 125 ? 0.5773 0.4429 0.4732 -0.0018 0.0407  -0.1034 6920 ASN A OD1 
1037 N  ND2 . ASN A 125 ? 0.5501 0.4256 0.4367 -0.0094 0.0507  -0.0953 6920 ASN A ND2 
1038 N  N   . LYS A 126 ? 0.4563 0.3652 0.4042 -0.0007 0.0728  -0.1144 6921 LYS A N   
1039 C  CA  . LYS A 126 ? 0.4286 0.3473 0.3868 -0.0030 0.0716  -0.1076 6921 LYS A CA  
1040 C  C   . LYS A 126 ? 0.4056 0.3165 0.3396 -0.0096 0.0694  -0.0969 6921 LYS A C   
1041 O  O   . LYS A 126 ? 0.4116 0.3114 0.3222 -0.0130 0.0717  -0.0965 6921 LYS A O   
1042 C  CB  . LYS A 126 ? 0.4369 0.3685 0.4139 -0.0041 0.0846  -0.1146 6921 LYS A CB  
1043 C  CG  . LYS A 126 ? 0.4557 0.3973 0.4623 0.0034  0.0843  -0.1249 6921 LYS A CG  
1044 C  CD  . LYS A 126 ? 0.4689 0.4265 0.5018 0.0028  0.0922  -0.1300 6921 LYS A CD  
1045 C  CE  . LYS A 126 ? 0.4836 0.4514 0.5481 0.0114  0.0891  -0.1403 6921 LYS A CE  
1046 N  NZ  . LYS A 126 ? 0.4976 0.4821 0.5913 0.0112  0.0922  -0.1441 6921 LYS A NZ  
1047 N  N   . TRP A 127 ? 0.3774 0.2938 0.3173 -0.0110 0.0644  -0.0893 6922 TRP A N   
1048 C  CA  . TRP A 127 ? 0.3720 0.2819 0.2932 -0.0161 0.0603  -0.0788 6922 TRP A CA  
1049 C  C   . TRP A 127 ? 0.3604 0.2758 0.2841 -0.0210 0.0684  -0.0760 6922 TRP A C   
1050 O  O   . TRP A 127 ? 0.3587 0.2852 0.3036 -0.0198 0.0735  -0.0811 6922 TRP A O   
1051 C  CB  . TRP A 127 ? 0.3631 0.2727 0.2883 -0.0129 0.0465  -0.0720 6922 TRP A CB  
1052 C  CG  . TRP A 127 ? 0.3714 0.2735 0.2931 -0.0093 0.0397  -0.0740 6922 TRP A CG  
1053 C  CD1 . TRP A 127 ? 0.3847 0.2887 0.3210 -0.0032 0.0373  -0.0804 6922 TRP A CD1 
1054 C  CD2 . TRP A 127 ? 0.3808 0.2713 0.2837 -0.0116 0.0347  -0.0706 6922 TRP A CD2 
1055 N  NE1 . TRP A 127 ? 0.3991 0.2926 0.3266 -0.0019 0.0316  -0.0807 6922 TRP A NE1 
1056 C  CE2 . TRP A 127 ? 0.3931 0.2787 0.3007 -0.0073 0.0299  -0.0751 6922 TRP A CE2 
1057 C  CE3 . TRP A 127 ? 0.3879 0.2714 0.2717 -0.0168 0.0328  -0.0643 6922 TRP A CE3 
1058 C  CZ2 . TRP A 127 ? 0.3974 0.2716 0.2918 -0.0086 0.0237  -0.0739 6922 TRP A CZ2 
1059 C  CZ3 . TRP A 127 ? 0.3984 0.2716 0.2696 -0.0177 0.0261  -0.0634 6922 TRP A CZ3 
1060 C  CH2 . TRP A 127 ? 0.3979 0.2667 0.2747 -0.0140 0.0218  -0.0682 6922 TRP A CH2 
1061 N  N   . ASP A 128 ? 0.3603 0.2676 0.2637 -0.0263 0.0687  -0.0685 6923 ASP A N   
1062 C  CA  . ASP A 128 ? 0.3641 0.2732 0.2666 -0.0318 0.0761  -0.0645 6923 ASP A CA  
1063 C  C   . ASP A 128 ? 0.3421 0.2545 0.2520 -0.0312 0.0668  -0.0571 6923 ASP A C   
1064 O  O   . ASP A 128 ? 0.3384 0.2555 0.2571 -0.0342 0.0713  -0.0555 6923 ASP A O   
1065 C  CB  . ASP A 128 ? 0.3885 0.2846 0.2626 -0.0375 0.0818  -0.0604 6923 ASP A CB  
1066 C  CG  . ASP A 128 ? 0.4173 0.3091 0.2808 -0.0380 0.0918  -0.0685 6923 ASP A CG  
1067 O  OD1 . ASP A 128 ? 0.4157 0.3170 0.2977 -0.0363 0.1009  -0.0772 6923 ASP A OD1 
1068 O  OD2 . ASP A 128 ? 0.4377 0.3169 0.2756 -0.0394 0.0896  -0.0669 6923 ASP A OD2 
1069 N  N   . LEU A 129 ? 0.3336 0.2434 0.2402 -0.0280 0.0549  -0.0530 6924 LEU A N   
1070 C  CA  . LEU A 129 ? 0.3203 0.2329 0.2324 -0.0271 0.0466  -0.0465 6924 LEU A CA  
1071 C  C   . LEU A 129 ? 0.3158 0.2295 0.2327 -0.0219 0.0363  -0.0458 6924 LEU A C   
1072 O  O   . LEU A 129 ? 0.3122 0.2190 0.2187 -0.0214 0.0328  -0.0456 6924 LEU A O   
1073 C  CB  . LEU A 129 ? 0.3360 0.2396 0.2302 -0.0315 0.0447  -0.0383 6924 LEU A CB  
1074 C  CG  . LEU A 129 ? 0.3348 0.2406 0.2340 -0.0307 0.0372  -0.0319 6924 LEU A CG  
1075 C  CD1 . LEU A 129 ? 0.3353 0.2492 0.2508 -0.0310 0.0409  -0.0336 6924 LEU A CD1 
1076 C  CD2 . LEU A 129 ? 0.3456 0.2417 0.2278 -0.0340 0.0341  -0.0243 6924 LEU A CD2 
1077 N  N   . ILE A 130 ? 0.3008 0.2224 0.2327 -0.0185 0.0318  -0.0460 6925 ILE A N   
1078 C  CA  . ILE A 130 ? 0.2991 0.2208 0.2340 -0.0138 0.0225  -0.0440 6925 ILE A CA  
1079 C  C   . ILE A 130 ? 0.2898 0.2130 0.2239 -0.0141 0.0176  -0.0375 6925 ILE A C   
1080 O  O   . ILE A 130 ? 0.2826 0.2118 0.2254 -0.0143 0.0191  -0.0385 6925 ILE A O   
1081 C  CB  . ILE A 130 ? 0.3042 0.2326 0.2552 -0.0083 0.0206  -0.0501 6925 ILE A CB  
1082 C  CG1 . ILE A 130 ? 0.3150 0.2431 0.2702 -0.0072 0.0262  -0.0578 6925 ILE A CG1 
1083 C  CG2 . ILE A 130 ? 0.3028 0.2291 0.2534 -0.0039 0.0112  -0.0464 6925 ILE A CG2 
1084 C  CD1 . ILE A 130 ? 0.3269 0.2633 0.3020 -0.0018 0.0250  -0.0650 6925 ILE A CD1 
1085 N  N   . ILE A 131 ? 0.2880 0.2060 0.2132 -0.0145 0.0122  -0.0317 6926 ILE A N   
1086 C  CA  . ILE A 131 ? 0.2812 0.2011 0.2067 -0.0142 0.0080  -0.0260 6926 ILE A CA  
1087 C  C   . ILE A 131 ? 0.2750 0.1951 0.2027 -0.0103 0.0024  -0.0245 6926 ILE A C   
1088 O  O   . ILE A 131 ? 0.2780 0.1928 0.2018 -0.0100 0.0004  -0.0242 6926 ILE A O   
1089 C  CB  . ILE A 131 ? 0.2955 0.2100 0.2110 -0.0180 0.0068  -0.0204 6926 ILE A CB  
1090 C  CG1 . ILE A 131 ? 0.3140 0.2247 0.2224 -0.0220 0.0118  -0.0207 6926 ILE A CG1 
1091 C  CG2 . ILE A 131 ? 0.2911 0.2088 0.2099 -0.0171 0.0035  -0.0157 6926 ILE A CG2 
1092 C  CD1 . ILE A 131 ? 0.3195 0.2344 0.2349 -0.0229 0.0161  -0.0217 6926 ILE A CD1 
1093 N  N   . SER A 132 ? 0.2648 0.1897 0.1976 -0.0073 0.0001  -0.0238 6927 SER A N   
1094 C  CA  . SER A 132 ? 0.2676 0.1909 0.1989 -0.0040 -0.0045 -0.0208 6927 SER A CA  
1095 C  C   . SER A 132 ? 0.2710 0.1966 0.2002 -0.0041 -0.0053 -0.0163 6927 SER A C   
1096 O  O   . SER A 132 ? 0.2659 0.1964 0.1990 -0.0034 -0.0044 -0.0184 6927 SER A O   
1097 C  CB  . SER A 132 ? 0.2771 0.2023 0.2140 0.0009  -0.0074 -0.0249 6927 SER A CB  
1098 O  OG  . SER A 132 ? 0.2803 0.2025 0.2123 0.0039  -0.0117 -0.0206 6927 SER A OG  
1099 N  N   . ASP A 133 ? 0.2652 0.1875 0.1900 -0.0051 -0.0066 -0.0108 6928 ASP A N   
1100 C  CA  . ASP A 133 ? 0.2727 0.1976 0.1963 -0.0046 -0.0063 -0.0069 6928 ASP A CA  
1101 C  C   . ASP A 133 ? 0.2696 0.1911 0.1885 -0.0020 -0.0082 -0.0038 6928 ASP A C   
1102 O  O   . ASP A 133 ? 0.2704 0.1922 0.1866 -0.0025 -0.0066 0.0005  6928 ASP A O   
1103 C  CB  . ASP A 133 ? 0.2858 0.2107 0.2102 -0.0085 -0.0051 -0.0029 6928 ASP A CB  
1104 C  CG  . ASP A 133 ? 0.3085 0.2381 0.2350 -0.0078 -0.0034 -0.0008 6928 ASP A CG  
1105 O  OD1 . ASP A 133 ? 0.3160 0.2489 0.2427 -0.0049 -0.0027 -0.0038 6928 ASP A OD1 
1106 O  OD2 . ASP A 133 ? 0.3191 0.2493 0.2481 -0.0100 -0.0027 0.0031  6928 ASP A OD2 
1107 N  N   . MET A 134 ? 0.2704 0.1881 0.1884 0.0006  -0.0111 -0.0059 6929 MET A N   
1108 C  CA  . MET A 134 ? 0.2802 0.1921 0.1918 0.0034  -0.0137 -0.0020 6929 MET A CA  
1109 C  C   . MET A 134 ? 0.2869 0.2016 0.1928 0.0065  -0.0138 -0.0012 6929 MET A C   
1110 O  O   . MET A 134 ? 0.2831 0.2033 0.1920 0.0087  -0.0147 -0.0064 6929 MET A O   
1111 C  CB  . MET A 134 ? 0.2928 0.1999 0.2058 0.0071  -0.0181 -0.0051 6929 MET A CB  
1112 C  CG  . MET A 134 ? 0.2983 0.2004 0.2144 0.0042  -0.0177 -0.0057 6929 MET A CG  
1113 S  SD  . MET A 134 ? 0.3205 0.2159 0.2398 0.0091  -0.0226 -0.0095 6929 MET A SD  
1114 C  CE  . MET A 134 ? 0.3119 0.2170 0.2413 0.0121  -0.0221 -0.0190 6929 MET A CE  
1115 N  N   . TYR A 135 ? 0.2973 0.2075 0.1948 0.0064  -0.0125 0.0050  6930 TYR A N   
1116 C  CA  . TYR A 135 ? 0.3168 0.2283 0.2052 0.0090  -0.0113 0.0061  6930 TYR A CA  
1117 C  C   . TYR A 135 ? 0.3530 0.2567 0.2304 0.0083  -0.0091 0.0141  6930 TYR A C   
1118 O  O   . TYR A 135 ? 0.3499 0.2509 0.2312 0.0038  -0.0061 0.0187  6930 TYR A O   
1119 C  CB  . TYR A 135 ? 0.3195 0.2392 0.2132 0.0066  -0.0063 0.0044  6930 TYR A CB  
1120 C  CG  . TYR A 135 ? 0.3343 0.2557 0.2190 0.0092  -0.0039 0.0044  6930 TYR A CG  
1121 C  CD1 . TYR A 135 ? 0.3371 0.2593 0.2167 0.0139  -0.0082 -0.0009 6930 TYR A CD1 
1122 C  CD2 . TYR A 135 ? 0.3536 0.2761 0.2358 0.0068  0.0028  0.0088  6930 TYR A CD2 
1123 C  CE1 . TYR A 135 ? 0.3612 0.2840 0.2302 0.0166  -0.0064 -0.0020 6930 TYR A CE1 
1124 C  CE2 . TYR A 135 ? 0.3787 0.3026 0.2514 0.0094  0.0062  0.0079  6930 TYR A CE2 
1125 C  CZ  . TYR A 135 ? 0.3806 0.3040 0.2453 0.0144  0.0013  0.0023  6930 TYR A CZ  
1126 O  OH  . TYR A 135 ? 0.4088 0.3325 0.2618 0.0172  0.0042  0.0004  6930 TYR A OH  
1127 N  N   . ASP A 136 ? 0.3864 0.2862 0.2501 0.0124  -0.0108 0.0154  6931 ASP A N   
1128 C  CA  . ASP A 136 ? 0.4380 0.3291 0.2873 0.0117  -0.0073 0.0237  6931 ASP A CA  
1129 C  C   . ASP A 136 ? 0.4440 0.3388 0.2825 0.0135  -0.0030 0.0227  6931 ASP A C   
1130 O  O   . ASP A 136 ? 0.4343 0.3291 0.2648 0.0187  -0.0084 0.0180  6931 ASP A O   
1131 C  CB  . ASP A 136 ? 0.4821 0.3612 0.3210 0.0157  -0.0146 0.0270  6931 ASP A CB  
1132 C  CG  . ASP A 136 ? 0.5393 0.4069 0.3606 0.0148  -0.0109 0.0367  6931 ASP A CG  
1133 O  OD1 . ASP A 136 ? 0.5683 0.4388 0.3865 0.0108  -0.0014 0.0404  6931 ASP A OD1 
1134 O  OD2 . ASP A 136 ? 0.5996 0.4553 0.4110 0.0181  -0.0172 0.0406  6931 ASP A OD2 
1135 N  N   . PRO A 137 ? 0.4623 0.3612 0.3021 0.0095  0.0065  0.0258  6932 PRO A N   
1136 C  CA  . PRO A 137 ? 0.4930 0.3956 0.3230 0.0115  0.0118  0.0236  6932 PRO A CA  
1137 C  C   . PRO A 137 ? 0.5393 0.4316 0.3439 0.0158  0.0102  0.0268  6932 PRO A C   
1138 O  O   . PRO A 137 ? 0.5511 0.4456 0.3449 0.0189  0.0121  0.0227  6932 PRO A O   
1139 C  CB  . PRO A 137 ? 0.5049 0.4131 0.3435 0.0060  0.0229  0.0274  6932 PRO A CB  
1140 C  CG  . PRO A 137 ? 0.5167 0.4204 0.3642 0.0010  0.0230  0.0339  6932 PRO A CG  
1141 C  CD  . PRO A 137 ? 0.4832 0.3838 0.3353 0.0031  0.0125  0.0306  6932 PRO A CD  
1142 N  N   . LYS A 138 ? 0.5266 0.5836 0.3933 -0.1095 0.0667  -0.0312 6933 LYS A N   
1143 C  CA  . LYS A 138 ? 0.6039 0.6045 0.4203 -0.1237 0.0751  -0.0169 6933 LYS A CA  
1144 C  C   . LYS A 138 ? 0.6110 0.5724 0.4052 -0.0995 0.0542  -0.0004 6933 LYS A C   
1145 O  O   . LYS A 138 ? 0.6278 0.5500 0.3793 -0.1019 0.0555  0.0097  6933 LYS A O   
1146 C  CB  . LYS A 138 ? 0.6722 0.6306 0.4626 -0.1521 0.0874  -0.0130 6933 LYS A CB  
1147 C  CG  . LYS A 138 ? 0.7111 0.7061 0.5198 -0.1853 0.1145  -0.0335 6933 LYS A CG  
1148 C  CD  . LYS A 138 ? 0.7964 0.7383 0.5735 -0.2179 0.1315  -0.0305 6933 LYS A CD  
1149 C  CE  . LYS A 138 ? 0.8381 0.8207 0.6369 -0.2573 0.1632  -0.0559 6933 LYS A CE  
1150 N  NZ  . LYS A 138 ? 0.9254 0.8435 0.6866 -0.2935 0.1846  -0.0532 6933 LYS A NZ  
1151 N  N   A THR A 139 ? 0.5657 0.5401 0.3867 -0.0773 0.0366  -0.0003 6934 THR A N   
1152 N  N   B THR A 139 ? 0.5725 0.5450 0.3932 -0.0783 0.0365  0.0000  6934 THR A N   
1153 C  CA  A THR A 139 ? 0.5752 0.5224 0.3844 -0.0576 0.0191  0.0090  6934 THR A CA  
1154 C  CA  B THR A 139 ? 0.5812 0.5276 0.3920 -0.0580 0.0184  0.0093  6934 THR A CA  
1155 C  C   A THR A 139 ? 0.5880 0.5463 0.3910 -0.0491 0.0219  0.0055  6934 THR A C   
1156 C  C   B THR A 139 ? 0.5963 0.5498 0.3973 -0.0503 0.0208  0.0068  6934 THR A C   
1157 O  O   A THR A 139 ? 0.6283 0.5624 0.4124 -0.0401 0.0109  0.0102  6934 THR A O   
1158 O  O   B THR A 139 ? 0.6418 0.5670 0.4184 -0.0434 0.0105  0.0128  6934 THR A O   
1159 C  CB  A THR A 139 ? 0.5438 0.5018 0.3828 -0.0409 0.0059  0.0075  6934 THR A CB  
1160 C  CB  B THR A 139 ? 0.5471 0.5101 0.3905 -0.0412 0.0068  0.0063  6934 THR A CB  
1161 O  OG1 A THR A 139 ? 0.5251 0.5238 0.3911 -0.0316 0.0112  -0.0019 6934 THR A OG1 
1162 O  OG1 B THR A 139 ? 0.5409 0.4780 0.3775 -0.0289 -0.0079 0.0120  6934 THR A OG1 
1163 C  CG2 A THR A 139 ? 0.5251 0.4698 0.3688 -0.0471 0.0017  0.0096  6934 THR A CG2 
1164 C  CG2 B THR A 139 ? 0.5157 0.5166 0.3830 -0.0280 0.0109  -0.0024 6934 THR A CG2 
1165 N  N   A LYS A 140 ? 0.5880 0.5848 0.4081 -0.0504 0.0354  -0.0055 6935 LYS A N   
1166 N  N   B LYS A 140 ? 0.5905 0.5833 0.4107 -0.0494 0.0330  -0.0041 6935 LYS A N   
1167 C  CA  A LYS A 140 ? 0.6208 0.6271 0.4352 -0.0409 0.0400  -0.0112 6935 LYS A CA  
1168 C  CA  B LYS A 140 ? 0.6141 0.6150 0.4263 -0.0415 0.0381  -0.0094 6935 LYS A CA  
1169 C  C   A LYS A 140 ? 0.6798 0.6641 0.4537 -0.0566 0.0501  -0.0080 6935 LYS A C   
1170 C  C   B LYS A 140 ? 0.6715 0.6485 0.4422 -0.0580 0.0479  -0.0054 6935 LYS A C   
1171 O  O   A LYS A 140 ? 0.6809 0.6851 0.4528 -0.0730 0.0695  -0.0153 6935 LYS A O   
1172 O  O   B LYS A 140 ? 0.6710 0.6588 0.4360 -0.0778 0.0659  -0.0094 6935 LYS A O   
1173 C  CB  A LYS A 140 ? 0.6245 0.6792 0.4694 -0.0314 0.0497  -0.0255 6935 LYS A CB  
1174 C  CB  B LYS A 140 ? 0.6091 0.6579 0.4509 -0.0328 0.0484  -0.0236 6935 LYS A CB  
1175 C  CG  A LYS A 140 ? 0.6557 0.7173 0.4949 -0.0188 0.0558  -0.0332 6935 LYS A CG  
1176 C  CG  B LYS A 140 ? 0.6326 0.6879 0.4679 -0.0211 0.0545  -0.0311 6935 LYS A CG  
1177 C  CD  A LYS A 140 ? 0.6662 0.7727 0.5340 -0.0011 0.0620  -0.0478 6935 LYS A CD  
1178 C  CD  B LYS A 140 ? 0.6340 0.7336 0.4977 -0.0037 0.0612  -0.0455 6935 LYS A CD  
1179 C  CE  A LYS A 140 ? 0.7061 0.8121 0.5653 0.0137  0.0688  -0.0560 6935 LYS A CE  
1180 C  CE  B LYS A 140 ? 0.6635 0.7616 0.5181 0.0107  0.0675  -0.0535 6935 LYS A CE  
1181 N  NZ  A LYS A 140 ? 0.7125 0.8596 0.5968 0.0380  0.0724  -0.0706 6935 LYS A NZ  
1182 N  NZ  B LYS A 140 ? 0.6668 0.8044 0.5462 0.0349  0.0715  -0.0676 6935 LYS A NZ  
1183 N  N   A ASN A 141 ? 0.7124 0.6591 0.4544 -0.0515 0.0376  0.0003  6936 ASN A N   
1184 N  N   B ASN A 141 ? 0.7036 0.6494 0.4447 -0.0508 0.0370  0.0003  6936 ASN A N   
1185 C  CA  A ASN A 141 ? 0.7686 0.6855 0.4591 -0.0615 0.0437  0.0053  6936 ASN A CA  
1186 C  CA  B ASN A 141 ? 0.7660 0.6818 0.4554 -0.0615 0.0434  0.0056  6936 ASN A CA  
1187 C  C   A ASN A 141 ? 0.7690 0.6838 0.4493 -0.0469 0.0339  -0.0006 6936 ASN A C   
1188 C  C   B ASN A 141 ? 0.7737 0.6866 0.4511 -0.0474 0.0340  -0.0002 6936 ASN A C   
1189 O  O   A ASN A 141 ? 0.7606 0.6591 0.4389 -0.0345 0.0130  0.0014  6936 ASN A O   
1190 O  O   B ASN A 141 ? 0.7744 0.6686 0.4454 -0.0355 0.0130  0.0025  6936 ASN A O   
1191 C  CB  A ASN A 141 ? 0.8123 0.6792 0.4618 -0.0673 0.0352  0.0208  6936 ASN A CB  
1192 C  CB  B ASN A 141 ? 0.8095 0.6757 0.4588 -0.0670 0.0346  0.0210  6936 ASN A CB  
1193 C  CG  A ASN A 141 ? 0.9009 0.7277 0.4846 -0.0751 0.0419  0.0285  6936 ASN A CG  
1194 C  CG  B ASN A 141 ? 0.8928 0.7185 0.4763 -0.0759 0.0424  0.0290  6936 ASN A CG  
1195 O  OD1 A ASN A 141 ? 0.9064 0.7470 0.4776 -0.0796 0.0553  0.0209  6936 ASN A OD1 
1196 O  OD1 B ASN A 141 ? 0.9059 0.7457 0.4768 -0.0823 0.0577  0.0215  6936 ASN A OD1 
1197 N  ND2 A ASN A 141 ? 0.9595 0.7323 0.4957 -0.0744 0.0332  0.0436  6936 ASN A ND2 
1198 N  ND2 B ASN A 141 ? 0.9486 0.7203 0.4848 -0.0740 0.0325  0.0440  6936 ASN A ND2 
1199 N  N   . VAL A 142 ? 0.7959 0.7302 0.4731 -0.0489 0.0493  -0.0113 6937 VAL A N   
1200 C  CA  . VAL A 142 ? 0.8174 0.7499 0.4843 -0.0374 0.0435  -0.0211 6937 VAL A CA  
1201 C  C   . VAL A 142 ? 0.8672 0.7663 0.4745 -0.0420 0.0387  -0.0160 6937 VAL A C   
1202 O  O   . VAL A 142 ? 0.9213 0.8191 0.5151 -0.0343 0.0327  -0.0265 6937 VAL A O   
1203 C  CB  . VAL A 142 ? 0.8155 0.7806 0.5029 -0.0339 0.0621  -0.0363 6937 VAL A CB  
1204 C  CG1 . VAL A 142 ? 0.7796 0.7733 0.5166 -0.0225 0.0636  -0.0406 6937 VAL A CG1 
1205 C  CG2 . VAL A 142 ? 0.8503 0.8268 0.5154 -0.0503 0.0857  -0.0397 6937 VAL A CG2 
1206 N  N   . THR A 143 ? 0.9001 0.7684 0.4684 -0.0531 0.0409  -0.0012 6938 THR A N   
1207 C  CA  . THR A 143 ? 0.9622 0.7882 0.4586 -0.0543 0.0368  0.0067  6938 THR A CA  
1208 C  C   . THR A 143 ? 0.9553 0.7509 0.4320 -0.0368 0.0049  0.0155  6938 THR A C   
1209 O  O   . THR A 143 ? 1.0215 0.7800 0.4344 -0.0301 -0.0053 0.0224  6938 THR A O   
1210 C  CB  . THR A 143 ? 1.0260 0.8239 0.4768 -0.0772 0.0631  0.0180  6938 THR A CB  
1211 O  OG1 . THR A 143 ? 1.0505 0.8194 0.4973 -0.0818 0.0585  0.0328  6938 THR A OG1 
1212 C  CG2 . THR A 143 ? 1.0078 0.8483 0.4908 -0.0956 0.0952  0.0048  6938 THR A CG2 
1213 N  N   . LYS A 144 ? 0.8728 0.6847 0.3999 -0.0277 -0.0101 0.0141  6939 LYS A N   
1214 C  CA  . LYS A 144 ? 0.8631 0.6559 0.3811 -0.0089 -0.0407 0.0179  6939 LYS A CA  
1215 C  C   . LYS A 144 ? 0.7464 0.5788 0.3286 0.0008  -0.0540 0.0013  6939 LYS A C   
1216 O  O   . LYS A 144 ? 0.6682 0.5290 0.2942 -0.0068 -0.0379 -0.0059 6939 LYS A O   
1217 C  CB  . LYS A 144 ? 0.9482 0.7046 0.4473 -0.0120 -0.0401 0.0361  6939 LYS A CB  
1218 C  CG  . LYS A 144 ? 1.0119 0.7445 0.4973 0.0111  -0.0709 0.0407  6939 LYS A CG  
1219 C  CD  . LYS A 144 ? 0.9734 0.7414 0.5281 0.0191  -0.0832 0.0306  6939 LYS A CD  
1220 C  CE  . LYS A 144 ? 1.0125 0.7683 0.5606 0.0447  -0.1146 0.0291  6939 LYS A CE  
1221 N  NZ  . LYS A 144 ? 0.9384 0.7329 0.5562 0.0490  -0.1217 0.0163  6939 LYS A NZ  
1222 N  N   . GLU A 145 ? 0.7177 0.5513 0.3026 0.0178  -0.0815 -0.0058 6940 GLU A N   
1223 C  CA  . GLU A 145 ? 0.6616 0.5318 0.3065 0.0225  -0.0906 -0.0250 6940 GLU A CA  
1224 C  C   . GLU A 145 ? 0.5755 0.4564 0.2676 0.0158  -0.0781 -0.0195 6940 GLU A C   
1225 O  O   . GLU A 145 ? 0.5642 0.4259 0.2461 0.0148  -0.0766 -0.0039 6940 GLU A O   
1226 C  CB  . GLU A 145 ? 0.7209 0.5974 0.3652 0.0415  -0.1223 -0.0363 6940 GLU A CB  
1227 C  CG  . GLU A 145 ? 0.7216 0.6379 0.4297 0.0411  -0.1275 -0.0597 6940 GLU A CG  
1228 C  CD  . GLU A 145 ? 0.8040 0.7430 0.5213 0.0588  -0.1588 -0.0802 6940 GLU A CD  
1229 O  OE1 . GLU A 145 ? 0.8366 0.8057 0.6079 0.0584  -0.1625 -0.0965 6940 GLU A OE1 
1230 O  OE2 . GLU A 145 ? 0.8846 0.8138 0.5546 0.0735  -0.1791 -0.0818 6940 GLU A OE2 
1231 N  N   . ASN A 146 ? 0.5018 0.4074 0.2383 0.0114  -0.0685 -0.0326 6941 ASN A N   
1232 C  CA  . ASN A 146 ? 0.4588 0.3732 0.2343 0.0078  -0.0571 -0.0283 6941 ASN A CA  
1233 C  C   . ASN A 146 ? 0.4480 0.3719 0.2532 0.0148  -0.0727 -0.0365 6941 ASN A C   
1234 O  O   . ASN A 146 ? 0.4398 0.3804 0.2760 0.0126  -0.0704 -0.0535 6941 ASN A O   
1235 C  CB  . ASN A 146 ? 0.4314 0.3567 0.2278 0.0030  -0.0373 -0.0358 6941 ASN A CB  
1236 C  CG  . ASN A 146 ? 0.3966 0.3269 0.2223 0.0034  -0.0271 -0.0304 6941 ASN A CG  
1237 O  OD1 . ASN A 146 ? 0.3718 0.3006 0.2029 0.0040  -0.0324 -0.0209 6941 ASN A OD1 
1238 N  ND2 . ASN A 146 ? 0.3815 0.3128 0.2203 0.0046  -0.0124 -0.0364 6941 ASN A ND2 
1239 N  N   A ASP A 147 ? 0.4685 0.3798 0.2631 0.0222  -0.0858 -0.0263 6942 ASP A N   
1240 N  N   B ASP A 147 ? 0.4613 0.3727 0.2559 0.0222  -0.0859 -0.0264 6942 ASP A N   
1241 C  CA  A ASP A 147 ? 0.4695 0.3930 0.2927 0.0323  -0.1020 -0.0360 6942 ASP A CA  
1242 C  CA  B ASP A 147 ? 0.4537 0.3776 0.2773 0.0323  -0.1021 -0.0363 6942 ASP A CA  
1243 C  C   A ASP A 147 ? 0.4209 0.3471 0.2740 0.0275  -0.0899 -0.0302 6942 ASP A C   
1244 C  C   B ASP A 147 ? 0.4137 0.3403 0.2672 0.0274  -0.0897 -0.0306 6942 ASP A C   
1245 O  O   A ASP A 147 ? 0.4071 0.3232 0.2518 0.0192  -0.0743 -0.0168 6942 ASP A O   
1246 O  O   B ASP A 147 ? 0.4031 0.3199 0.2484 0.0190  -0.0738 -0.0173 6942 ASP A O   
1247 C  CB  A ASP A 147 ? 0.5357 0.4394 0.3251 0.0497  -0.1262 -0.0300 6942 ASP A CB  
1248 C  CB  B ASP A 147 ? 0.5040 0.4081 0.2942 0.0496  -0.1261 -0.0302 6942 ASP A CB  
1249 C  CG  A ASP A 147 ? 0.5978 0.5062 0.3608 0.0614  -0.1460 -0.0416 6942 ASP A CG  
1250 C  CG  B ASP A 147 ? 0.5369 0.4009 0.2889 0.0469  -0.1191 -0.0063 6942 ASP A CG  
1251 O  OD1 A ASP A 147 ? 0.6156 0.5571 0.4084 0.0574  -0.1473 -0.0641 6942 ASP A OD1 
1252 O  OD1 B ASP A 147 ? 0.5275 0.3880 0.2781 0.0301  -0.0968 0.0026  6942 ASP A OD1 
1253 O  OD2 A ASP A 147 ? 0.6821 0.5576 0.3909 0.0739  -0.1590 -0.0287 6942 ASP A OD2 
1254 O  OD2 B ASP A 147 ? 0.5920 0.4283 0.3158 0.0620  -0.1355 0.0010  6942 ASP A OD2 
1255 N  N   . SER A 148 ? 0.3938 0.3378 0.2816 0.0328  -0.0970 -0.0432 6943 SER A N   
1256 C  CA  . SER A 148 ? 0.3601 0.3062 0.2732 0.0298  -0.0866 -0.0398 6943 SER A CA  
1257 C  C   . SER A 148 ? 0.3745 0.2944 0.2618 0.0328  -0.0896 -0.0212 6943 SER A C   
1258 O  O   . SER A 148 ? 0.3969 0.2972 0.2565 0.0437  -0.1063 -0.0163 6943 SER A O   
1259 C  CB  . SER A 148 ? 0.3507 0.3211 0.3016 0.0354  -0.0945 -0.0593 6943 SER A CB  
1260 O  OG  . SER A 148 ? 0.3206 0.2903 0.2899 0.0334  -0.0846 -0.0560 6943 SER A OG  
1261 N  N   . LYS A 149 ? 0.3533 0.2703 0.2457 0.0240  -0.0740 -0.0125 6944 LYS A N   
1262 C  CA  . LYS A 149 ? 0.3788 0.2726 0.2494 0.0209  -0.0730 0.0009  6944 LYS A CA  
1263 C  C   . LYS A 149 ? 0.3898 0.2816 0.2791 0.0269  -0.0777 -0.0023 6944 LYS A C   
1264 O  O   . LYS A 149 ? 0.3763 0.2899 0.2972 0.0279  -0.0727 -0.0123 6944 LYS A O   
1265 C  CB  . LYS A 149 ? 0.3654 0.2660 0.2330 0.0077  -0.0548 0.0072  6944 LYS A CB  
1266 C  CG  . LYS A 149 ? 0.3682 0.2737 0.2198 0.0025  -0.0473 0.0084  6944 LYS A CG  
1267 C  CD  . LYS A 149 ? 0.4053 0.2856 0.2177 0.0017  -0.0543 0.0148  6944 LYS A CD  
1268 C  CE  . LYS A 149 ? 0.4122 0.2983 0.2069 -0.0053 -0.0434 0.0148  6944 LYS A CE  
1269 N  NZ  . LYS A 149 ? 0.3896 0.2961 0.2031 0.0004  -0.0433 0.0036  6944 LYS A NZ  
1270 N  N   A GLU A 150 ? 0.4239 0.2849 0.2894 0.0298  -0.0844 0.0055  6945 GLU A N   
1271 N  N   B GLU A 150 ? 0.4241 0.2851 0.2898 0.0301  -0.0848 0.0053  6945 GLU A N   
1272 C  CA  A GLU A 150 ? 0.4341 0.2879 0.3136 0.0367  -0.0887 0.0014  6945 GLU A CA  
1273 C  CA  B GLU A 150 ? 0.4292 0.2837 0.3094 0.0368  -0.0887 0.0012  6945 GLU A CA  
1274 C  C   A GLU A 150 ? 0.4227 0.2708 0.2996 0.0205  -0.0734 0.0067  6945 GLU A C   
1275 C  C   B GLU A 150 ? 0.4205 0.2688 0.2977 0.0206  -0.0734 0.0067  6945 GLU A C   
1276 O  O   A GLU A 150 ? 0.3910 0.2682 0.2885 0.0128  -0.0617 0.0032  6945 GLU A O   
1277 O  O   B GLU A 150 ? 0.3874 0.2647 0.2852 0.0129  -0.0617 0.0031  6945 GLU A O   
1278 C  CB  A GLU A 150 ? 0.4967 0.3159 0.3497 0.0550  -0.1077 0.0039  6945 GLU A CB  
1279 C  CB  B GLU A 150 ? 0.4847 0.3053 0.3400 0.0553  -0.1078 0.0031  6945 GLU A CB  
1280 C  CG  A GLU A 150 ? 0.5173 0.3566 0.3803 0.0740  -0.1266 -0.0075 6945 GLU A CG  
1281 C  CG  B GLU A 150 ? 0.4950 0.3376 0.3639 0.0749  -0.1268 -0.0094 6945 GLU A CG  
1282 C  CD  A GLU A 150 ? 0.5895 0.3970 0.4223 0.1007  -0.1506 -0.0063 6945 GLU A CD  
1283 C  CD  B GLU A 150 ? 0.4607 0.3505 0.3842 0.0771  -0.1249 -0.0298 6945 GLU A CD  
1284 O  OE1 A GLU A 150 ? 0.6574 0.4226 0.4660 0.1063  -0.1515 0.0022  6945 GLU A OE1 
1285 O  OE1 B GLU A 150 ? 0.4550 0.3539 0.3993 0.0663  -0.1094 -0.0312 6945 GLU A OE1 
1286 O  OE2 A GLU A 150 ? 0.6402 0.4634 0.4709 0.1172  -0.1689 -0.0152 6945 GLU A OE2 
1287 O  OE2 B GLU A 150 ? 0.4711 0.3892 0.4148 0.0884  -0.1377 -0.0461 6945 GLU A OE2 
1288 N  N   . GLY A 151 ? 0.4556 0.2657 0.3051 0.0160  -0.0732 0.0136  6946 GLY A N   
1289 C  CA  . GLY A 151 ? 0.4524 0.2616 0.3027 -0.0029 -0.0584 0.0132  6946 GLY A CA  
1290 C  C   . GLY A 151 ? 0.4060 0.2491 0.2920 -0.0011 -0.0551 0.0024  6946 GLY A C   
1291 O  O   . GLY A 151 ? 0.3987 0.2414 0.2994 0.0128  -0.0632 -0.0039 6946 GLY A O   
1292 N  N   . PHE A 152 ? 0.3716 0.2455 0.2699 -0.0124 -0.0440 -0.0009 6947 PHE A N   
1293 C  CA  . PHE A 152 ? 0.3393 0.2396 0.2603 -0.0088 -0.0411 -0.0100 6947 PHE A CA  
1294 C  C   . PHE A 152 ? 0.3128 0.2278 0.2505 0.0057  -0.0431 -0.0124 6947 PHE A C   
1295 O  O   . PHE A 152 ? 0.3002 0.2243 0.2499 0.0104  -0.0404 -0.0193 6947 PHE A O   
1296 C  CB  . PHE A 152 ? 0.3265 0.2586 0.2528 -0.0184 -0.0326 -0.0146 6947 PHE A CB  
1297 C  CG  . PHE A 152 ? 0.3144 0.2695 0.2417 -0.0152 -0.0287 -0.0109 6947 PHE A CG  
1298 C  CD1 . PHE A 152 ? 0.3018 0.2679 0.2355 -0.0007 -0.0281 -0.0095 6947 PHE A CD1 
1299 C  CD2 . PHE A 152 ? 0.3317 0.2948 0.2518 -0.0277 -0.0228 -0.0104 6947 PHE A CD2 
1300 C  CE1 . PHE A 152 ? 0.2974 0.2774 0.2282 0.0040  -0.0237 -0.0068 6947 PHE A CE1 
1301 C  CE2 . PHE A 152 ? 0.3274 0.3124 0.2491 -0.0222 -0.0189 -0.0091 6947 PHE A CE2 
1302 C  CZ  . PHE A 152 ? 0.3025 0.2936 0.2287 -0.0049 -0.0204 -0.0068 6947 PHE A CZ  
1303 N  N   . PHE A 153 ? 0.3125 0.2289 0.2496 0.0102  -0.0454 -0.0089 6948 PHE A N   
1304 C  CA  . PHE A 153 ? 0.3036 0.2332 0.2588 0.0184  -0.0430 -0.0154 6948 PHE A CA  
1305 C  C   . PHE A 153 ? 0.3177 0.2434 0.2887 0.0265  -0.0502 -0.0251 6948 PHE A C   
1306 O  O   . PHE A 153 ? 0.3079 0.2473 0.2969 0.0285  -0.0423 -0.0343 6948 PHE A O   
1307 C  CB  . PHE A 153 ? 0.2988 0.2320 0.2523 0.0190  -0.0437 -0.0143 6948 PHE A CB  
1308 C  CG  . PHE A 153 ? 0.2902 0.2313 0.2337 0.0151  -0.0336 -0.0086 6948 PHE A CG  
1309 C  CD1 . PHE A 153 ? 0.2825 0.2304 0.2286 0.0184  -0.0217 -0.0100 6948 PHE A CD1 
1310 C  CD2 . PHE A 153 ? 0.2967 0.2351 0.2242 0.0105  -0.0351 -0.0025 6948 PHE A CD2 
1311 C  CE1 . PHE A 153 ? 0.2851 0.2376 0.2193 0.0212  -0.0144 -0.0055 6948 PHE A CE1 
1312 C  CE2 . PHE A 153 ? 0.2908 0.2411 0.2129 0.0103  -0.0260 -0.0005 6948 PHE A CE2 
1313 C  CZ  . PHE A 153 ? 0.2837 0.2411 0.2098 0.0177  -0.0172 -0.0021 6948 PHE A CZ  
1314 N  N   . THR A 154 ? 0.3479 0.2530 0.3092 0.0324  -0.0636 -0.0237 6949 THR A N   
1315 C  CA  . THR A 154 ? 0.3766 0.2791 0.3532 0.0461  -0.0732 -0.0351 6949 THR A CA  
1316 C  C   . THR A 154 ? 0.3577 0.2639 0.3442 0.0430  -0.0635 -0.0414 6949 THR A C   
1317 O  O   . THR A 154 ? 0.3414 0.2656 0.3526 0.0491  -0.0600 -0.0551 6949 THR A O   
1318 C  CB  . THR A 154 ? 0.4310 0.2975 0.3822 0.0572  -0.0895 -0.0293 6949 THR A CB  
1319 O  OG1 . THR A 154 ? 0.4686 0.3311 0.4027 0.0593  -0.0973 -0.0225 6949 THR A OG1 
1320 C  CG2 . THR A 154 ? 0.4607 0.3256 0.4271 0.0785  -0.1028 -0.0427 6949 THR A CG2 
1321 N  N   . TYR A 155 ? 0.3503 0.2442 0.3190 0.0322  -0.0579 -0.0343 6950 TYR A N   
1322 C  CA  . TYR A 155 ? 0.3471 0.2453 0.3206 0.0291  -0.0504 -0.0420 6950 TYR A CA  
1323 C  C   . TYR A 155 ? 0.3209 0.2464 0.3060 0.0286  -0.0377 -0.0463 6950 TYR A C   
1324 O  O   . TYR A 155 ? 0.3077 0.2397 0.3039 0.0328  -0.0318 -0.0570 6950 TYR A O   
1325 C  CB  . TYR A 155 ? 0.3593 0.2471 0.3144 0.0151  -0.0474 -0.0379 6950 TYR A CB  
1326 C  CG  . TYR A 155 ? 0.3575 0.2564 0.3161 0.0116  -0.0413 -0.0483 6950 TYR A CG  
1327 C  CD1 . TYR A 155 ? 0.3862 0.2653 0.3452 0.0141  -0.0433 -0.0582 6950 TYR A CD1 
1328 C  CD2 . TYR A 155 ? 0.3396 0.2673 0.2975 0.0091  -0.0346 -0.0492 6950 TYR A CD2 
1329 C  CE1 . TYR A 155 ? 0.3878 0.2783 0.3480 0.0108  -0.0378 -0.0701 6950 TYR A CE1 
1330 C  CE2 . TYR A 155 ? 0.3484 0.2876 0.3042 0.0087  -0.0312 -0.0598 6950 TYR A CE2 
1331 C  CZ  . TYR A 155 ? 0.3711 0.2932 0.3289 0.0079  -0.0324 -0.0709 6950 TYR A CZ  
1332 O  OH  . TYR A 155 ? 0.3913 0.3256 0.3447 0.0070  -0.0293 -0.0834 6950 TYR A OH  
1333 N  N   A ILE A 156 ? 0.3123 0.2484 0.2900 0.0245  -0.0320 -0.0381 6951 ILE A N   
1334 N  N   B ILE A 156 ? 0.3069 0.2426 0.2845 0.0245  -0.0323 -0.0379 6951 ILE A N   
1335 C  CA  A ILE A 156 ? 0.3145 0.2623 0.2900 0.0259  -0.0178 -0.0390 6951 ILE A CA  
1336 C  CA  B ILE A 156 ? 0.3020 0.2497 0.2772 0.0257  -0.0183 -0.0381 6951 ILE A CA  
1337 C  C   A ILE A 156 ? 0.3066 0.2584 0.3012 0.0277  -0.0097 -0.0491 6951 ILE A C   
1338 C  C   B ILE A 156 ? 0.3019 0.2535 0.2960 0.0277  -0.0100 -0.0487 6951 ILE A C   
1339 O  O   A ILE A 156 ? 0.3056 0.2589 0.2977 0.0275  0.0044  -0.0548 6951 ILE A O   
1340 O  O   B ILE A 156 ? 0.3059 0.2588 0.2970 0.0277  0.0034  -0.0543 6951 ILE A O   
1341 C  CB  A ILE A 156 ? 0.3287 0.2802 0.2895 0.0253  -0.0141 -0.0287 6951 ILE A CB  
1342 C  CB  B ILE A 156 ? 0.2992 0.2497 0.2627 0.0246  -0.0156 -0.0280 6951 ILE A CB  
1343 C  CG1 A ILE A 156 ? 0.3395 0.3006 0.2875 0.0238  -0.0189 -0.0255 6951 ILE A CG1 
1344 C  CG1 B ILE A 156 ? 0.3009 0.2597 0.2507 0.0228  -0.0198 -0.0229 6951 ILE A CG1 
1345 C  CG2 A ILE A 156 ? 0.3470 0.2945 0.2979 0.0291  0.0017  -0.0278 6951 ILE A CG2 
1346 C  CG2 B ILE A 156 ? 0.3077 0.2549 0.2635 0.0275  0.0001  -0.0274 6951 ILE A CG2 
1347 C  CD1 A ILE A 156 ? 0.3585 0.3283 0.2961 0.0290  -0.0156 -0.0308 6951 ILE A CD1 
1348 C  CD1 B ILE A 156 ? 0.2964 0.2617 0.2370 0.0249  -0.0173 -0.0157 6951 ILE A CD1 
1349 N  N   . CYS A 157 ? 0.3019 0.2577 0.3138 0.0289  -0.0173 -0.0533 6952 CYS A N   
1350 C  CA  . CYS A 157 ? 0.3054 0.2767 0.3447 0.0283  -0.0093 -0.0699 6952 CYS A CA  
1351 C  C   . CYS A 157 ? 0.3026 0.2809 0.3582 0.0336  -0.0081 -0.0839 6952 CYS A C   
1352 O  O   . CYS A 157 ? 0.2992 0.2880 0.3663 0.0281  0.0107  -0.0959 6952 CYS A O   
1353 C  CB  . CYS A 157 ? 0.3140 0.2964 0.3711 0.0318  -0.0231 -0.0764 6952 CYS A CB  
1354 S  SG  . CYS A 157 ? 0.3345 0.3119 0.3766 0.0231  -0.0183 -0.0665 6952 CYS A SG  
1355 N  N   . GLY A 158 ? 0.3053 0.2732 0.3579 0.0429  -0.0245 -0.0828 6953 GLY A N   
1356 C  CA  . GLY A 158 ? 0.3136 0.2852 0.3807 0.0506  -0.0240 -0.0977 6953 GLY A CA  
1357 C  C   . GLY A 158 ? 0.3194 0.2866 0.3698 0.0435  -0.0075 -0.0970 6953 GLY A C   
1358 O  O   . GLY A 158 ? 0.3287 0.3073 0.3932 0.0447  0.0043  -0.1125 6953 GLY A O   
1359 N  N   . PHE A 159 ? 0.3230 0.2781 0.3444 0.0376  -0.0071 -0.0817 6954 PHE A N   
1360 C  CA  . PHE A 159 ? 0.3327 0.2859 0.3322 0.0350  0.0036  -0.0816 6954 PHE A CA  
1361 C  C   . PHE A 159 ? 0.3467 0.3037 0.3389 0.0318  0.0258  -0.0835 6954 PHE A C   
1362 O  O   . PHE A 159 ? 0.3671 0.3235 0.3497 0.0321  0.0387  -0.0918 6954 PHE A O   
1363 C  CB  . PHE A 159 ? 0.3386 0.2877 0.3141 0.0319  -0.0042 -0.0692 6954 PHE A CB  
1364 C  CG  . PHE A 159 ? 0.3455 0.2984 0.2996 0.0328  -0.0004 -0.0733 6954 PHE A CG  
1365 C  CD1 . PHE A 159 ? 0.3661 0.3215 0.2946 0.0375  0.0103  -0.0681 6954 PHE A CD1 
1366 C  CD2 . PHE A 159 ? 0.3615 0.3116 0.3165 0.0302  -0.0079 -0.0835 6954 PHE A CD2 
1367 C  CE1 . PHE A 159 ? 0.3828 0.3434 0.2865 0.0424  0.0106  -0.0730 6954 PHE A CE1 
1368 C  CE2 . PHE A 159 ? 0.3802 0.3388 0.3160 0.0310  -0.0062 -0.0911 6954 PHE A CE2 
1369 C  CZ  . PHE A 159 ? 0.3836 0.3503 0.2937 0.0385  0.0014  -0.0860 6954 PHE A CZ  
1370 N  N   . ILE A 160 ? 0.3493 0.3054 0.3422 0.0275  0.0324  -0.0768 6955 ILE A N   
1371 C  CA  . ILE A 160 ? 0.3869 0.3349 0.3671 0.0208  0.0587  -0.0785 6955 ILE A CA  
1372 C  C   . ILE A 160 ? 0.3990 0.3625 0.4099 0.0150  0.0730  -0.1004 6955 ILE A C   
1373 O  O   . ILE A 160 ? 0.4344 0.3894 0.4273 0.0107  0.0952  -0.1055 6955 ILE A O   
1374 C  CB  . ILE A 160 ? 0.3847 0.3249 0.3623 0.0154  0.0635  -0.0703 6955 ILE A CB  
1375 C  CG1 . ILE A 160 ? 0.3897 0.3165 0.3344 0.0234  0.0540  -0.0510 6955 ILE A CG1 
1376 C  CG2 . ILE A 160 ? 0.4248 0.3510 0.3946 0.0032  0.0945  -0.0768 6955 ILE A CG2 
1377 C  CD1 . ILE A 160 ? 0.3920 0.3113 0.3356 0.0203  0.0550  -0.0439 6955 ILE A CD1 
1378 N  N   . GLN A 161 ? 0.3846 0.3717 0.4384 0.0170  0.0600  -0.1142 6956 GLN A N   
1379 C  CA  . GLN A 161 ? 0.3994 0.4140 0.4934 0.0138  0.0715  -0.1409 6956 GLN A CA  
1380 C  C   . GLN A 161 ? 0.4025 0.4201 0.4973 0.0215  0.0730  -0.1517 6956 GLN A C   
1381 O  O   . GLN A 161 ? 0.4144 0.4495 0.5283 0.0150  0.0946  -0.1723 6956 GLN A O   
1382 C  CB  . GLN A 161 ? 0.4084 0.4509 0.5452 0.0212  0.0504  -0.1539 6956 GLN A CB  
1383 C  CG  . GLN A 161 ? 0.4416 0.4896 0.5855 0.0095  0.0554  -0.1532 6956 GLN A CG  
1384 C  CD  . GLN A 161 ? 0.4670 0.5449 0.6479 0.0202  0.0305  -0.1670 6956 GLN A CD  
1385 O  OE1 . GLN A 161 ? 0.5243 0.5906 0.6933 0.0359  0.0032  -0.1542 6956 GLN A OE1 
1386 N  NE2 . GLN A 161 ? 0.4890 0.6047 0.7118 0.0110  0.0409  -0.1945 6956 GLN A NE2 
1387 N  N   . GLN A 162 ? 0.3947 0.3659 0.4493 0.0375  0.0301  -0.0974 6957 GLN A N   
1388 C  CA  . GLN A 162 ? 0.4188 0.3818 0.4719 0.0406  0.0366  -0.1037 6957 GLN A CA  
1389 C  C   . GLN A 162 ? 0.4000 0.3534 0.4325 0.0303  0.0463  -0.1025 6957 GLN A C   
1390 O  O   . GLN A 162 ? 0.3937 0.3468 0.4280 0.0302  0.0558  -0.1106 6957 GLN A O   
1391 C  CB  . GLN A 162 ? 0.4557 0.4022 0.5024 0.0494  0.0269  -0.1004 6957 GLN A CB  
1392 C  CG  . GLN A 162 ? 0.4940 0.4470 0.5581 0.0605  0.0156  -0.1008 6957 GLN A CG  
1393 C  CD  . GLN A 162 ? 0.5550 0.4886 0.6071 0.0673  0.0050  -0.0943 6957 GLN A CD  
1394 O  OE1 . GLN A 162 ? 0.6209 0.5372 0.6594 0.0667  0.0074  -0.0936 6957 GLN A OE1 
1395 N  NE2 . GLN A 162 ? 0.5839 0.5194 0.6400 0.0732  -0.0068 -0.0894 6957 GLN A NE2 
1396 N  N   . LYS A 163 ? 0.3769 0.3234 0.3910 0.0222  0.0440  -0.0935 6958 LYS A N   
1397 C  CA  . LYS A 163 ? 0.3921 0.3274 0.3850 0.0134  0.0506  -0.0917 6958 LYS A CA  
1398 C  C   . LYS A 163 ? 0.3760 0.3169 0.3612 0.0029  0.0554  -0.0876 6958 LYS A C   
1399 O  O   . LYS A 163 ? 0.3972 0.3285 0.3635 -0.0043 0.0590  -0.0848 6958 LYS A O   
1400 C  CB  . LYS A 163 ? 0.4072 0.3246 0.3827 0.0137  0.0427  -0.0846 6958 LYS A CB  
1401 C  CG  . LYS A 163 ? 0.4391 0.3464 0.4186 0.0232  0.0382  -0.0879 6958 LYS A CG  
1402 C  CD  . LYS A 163 ? 0.4742 0.3783 0.4556 0.0250  0.0471  -0.0981 6958 LYS A CD  
1403 C  CE  . LYS A 163 ? 0.5167 0.4098 0.5039 0.0354  0.0427  -0.1021 6958 LYS A CE  
1404 N  NZ  . LYS A 163 ? 0.5383 0.4269 0.5251 0.0362  0.0524  -0.1127 6958 LYS A NZ  
1405 N  N   . LEU A 164 ? 0.3476 0.3023 0.3461 0.0019  0.0551  -0.0871 6959 LEU A N   
1406 C  CA  . LEU A 164 ? 0.3366 0.2943 0.3274 -0.0081 0.0602  -0.0831 6959 LEU A CA  
1407 C  C   . LEU A 164 ? 0.3332 0.3005 0.3318 -0.0123 0.0730  -0.0910 6959 LEU A C   
1408 O  O   . LEU A 164 ? 0.3329 0.3137 0.3534 -0.0076 0.0754  -0.0983 6959 LEU A O   
1409 C  CB  . LEU A 164 ? 0.3226 0.2879 0.3214 -0.0083 0.0536  -0.0782 6959 LEU A CB  
1410 C  CG  . LEU A 164 ? 0.3243 0.2909 0.3161 -0.0179 0.0576  -0.0736 6959 LEU A CG  
1411 C  CD1 . LEU A 164 ? 0.3330 0.2855 0.3017 -0.0232 0.0562  -0.0661 6959 LEU A CD1 
1412 C  CD2 . LEU A 164 ? 0.3156 0.2900 0.3179 -0.0171 0.0513  -0.0708 6959 LEU A CD2 
1413 N  N   . ALA A 165 ? 0.3363 0.2969 0.3173 -0.0211 0.0807  -0.0894 6960 ALA A N   
1414 C  CA  . ALA A 165 ? 0.3489 0.3172 0.3336 -0.0268 0.0943  -0.0961 6960 ALA A CA  
1415 C  C   . ALA A 165 ? 0.3423 0.3245 0.3428 -0.0306 0.0966  -0.0956 6960 ALA A C   
1416 O  O   . ALA A 165 ? 0.3323 0.3126 0.3298 -0.0326 0.0890  -0.0878 6960 ALA A O   
1417 C  CB  . ALA A 165 ? 0.3620 0.3180 0.3204 -0.0360 0.1001  -0.0926 6960 ALA A CB  
1418 N  N   . LEU A 166 ? 0.3455 0.3416 0.3636 -0.0315 0.1068  -0.1044 6961 LEU A N   
1419 C  CA  . LEU A 166 ? 0.3461 0.3545 0.3780 -0.0375 0.1103  -0.1040 6961 LEU A CA  
1420 C  C   . LEU A 166 ? 0.3438 0.3407 0.3521 -0.0487 0.1141  -0.0954 6961 LEU A C   
1421 O  O   . LEU A 166 ? 0.3589 0.3453 0.3465 -0.0535 0.1208  -0.0948 6961 LEU A O   
1422 C  CB  . LEU A 166 ? 0.3593 0.3848 0.4133 -0.0383 0.1226  -0.1151 6961 LEU A CB  
1423 C  CG  . LEU A 166 ? 0.3703 0.4077 0.4492 -0.0262 0.1193  -0.1245 6961 LEU A CG  
1424 C  CD1 . LEU A 166 ? 0.3882 0.4447 0.4912 -0.0279 0.1326  -0.1359 6961 LEU A CD1 
1425 C  CD2 . LEU A 166 ? 0.3597 0.4024 0.4532 -0.0184 0.1040  -0.1216 6961 LEU A CD2 
1426 N  N   . GLY A 167 ? 0.3343 0.3321 0.3451 -0.0526 0.1092  -0.0891 6962 GLY A N   
1427 C  CA  . GLY A 167 ? 0.3423 0.3277 0.3317 -0.0620 0.1105  -0.0798 6962 GLY A CA  
1428 C  C   . GLY A 167 ? 0.3382 0.3103 0.3112 -0.0588 0.0982  -0.0709 6962 GLY A C   
1429 O  O   . GLY A 167 ? 0.3495 0.3127 0.3095 -0.0645 0.0960  -0.0626 6962 GLY A O   
1430 N  N   . GLY A 168 ? 0.3305 0.3011 0.3050 -0.0500 0.0907  -0.0725 6963 GLY A N   
1431 C  CA  . GLY A 168 ? 0.3252 0.2845 0.2860 -0.0471 0.0798  -0.0648 6963 GLY A CA  
1432 C  C   . GLY A 168 ? 0.3090 0.2713 0.2784 -0.0449 0.0709  -0.0602 6963 GLY A C   
1433 O  O   . GLY A 168 ? 0.3038 0.2774 0.2912 -0.0445 0.0720  -0.0640 6963 GLY A O   
1434 N  N   . SER A 169 ? 0.3028 0.2560 0.2604 -0.0437 0.0626  -0.0529 6964 SER A N   
1435 C  CA  . SER A 169 ? 0.2911 0.2461 0.2546 -0.0417 0.0548  -0.0486 6964 SER A CA  
1436 C  C   . SER A 169 ? 0.2834 0.2341 0.2431 -0.0353 0.0456  -0.0457 6964 SER A C   
1437 O  O   . SER A 169 ? 0.2860 0.2301 0.2360 -0.0338 0.0450  -0.0455 6964 SER A O   
1438 C  CB  . SER A 169 ? 0.2972 0.2457 0.2512 -0.0485 0.0555  -0.0419 6964 SER A CB  
1439 O  OG  . SER A 169 ? 0.3048 0.2570 0.2636 -0.0549 0.0640  -0.0442 6964 SER A OG  
1440 N  N   . VAL A 170 ? 0.2690 0.2230 0.2357 -0.0321 0.0391  -0.0441 6965 VAL A N   
1441 C  CA  . VAL A 170 ? 0.2674 0.2174 0.2297 -0.0267 0.0311  -0.0408 6965 VAL A CA  
1442 C  C   . VAL A 170 ? 0.2575 0.2064 0.2182 -0.0277 0.0267  -0.0358 6965 VAL A C   
1443 O  O   . VAL A 170 ? 0.2577 0.2105 0.2251 -0.0304 0.0283  -0.0366 6965 VAL A O   
1444 C  CB  . VAL A 170 ? 0.2676 0.2235 0.2408 -0.0193 0.0272  -0.0457 6965 VAL A CB  
1445 C  CG1 . VAL A 170 ? 0.2782 0.2365 0.2569 -0.0172 0.0319  -0.0519 6965 VAL A CG1 
1446 C  CG2 . VAL A 170 ? 0.2693 0.2348 0.2560 -0.0176 0.0243  -0.0485 6965 VAL A CG2 
1447 N  N   . ALA A 171 ? 0.2508 0.1941 0.2032 -0.0258 0.0218  -0.0312 6966 ALA A N   
1448 C  CA  . ALA A 171 ? 0.2460 0.1892 0.1979 -0.0252 0.0175  -0.0274 6966 ALA A CA  
1449 C  C   . ALA A 171 ? 0.2507 0.1921 0.1993 -0.0204 0.0125  -0.0263 6966 ALA A C   
1450 O  O   . ALA A 171 ? 0.2587 0.1941 0.1988 -0.0210 0.0119  -0.0233 6966 ALA A O   
1451 C  CB  . ALA A 171 ? 0.2477 0.1854 0.1919 -0.0297 0.0181  -0.0219 6966 ALA A CB  
1452 N  N   . ILE A 172 ? 0.2529 0.1990 0.2075 -0.0162 0.0091  -0.0288 6967 ILE A N   
1453 C  CA  . ILE A 172 ? 0.2570 0.2006 0.2072 -0.0115 0.0043  -0.0276 6967 ILE A CA  
1454 C  C   . ILE A 172 ? 0.2558 0.2002 0.2034 -0.0109 0.0016  -0.0255 6967 ILE A C   
1455 O  O   . ILE A 172 ? 0.2434 0.1934 0.1976 -0.0102 0.0006  -0.0287 6967 ILE A O   
1456 C  CB  . ILE A 172 ? 0.2640 0.2116 0.2216 -0.0063 0.0016  -0.0326 6967 ILE A CB  
1457 C  CG1 . ILE A 172 ? 0.2701 0.2190 0.2334 -0.0066 0.0058  -0.0366 6967 ILE A CG1 
1458 C  CG2 . ILE A 172 ? 0.2693 0.2114 0.2197 -0.0015 -0.0037 -0.0301 6967 ILE A CG2 
1459 C  CD1 . ILE A 172 ? 0.2772 0.2171 0.2310 -0.0077 0.0078  -0.0341 6967 ILE A CD1 
1460 N  N   . LYS A 173 ? 0.2578 0.1972 0.1968 -0.0114 0.0007  -0.0208 6968 LYS A N   
1461 C  CA  . LYS A 173 ? 0.2625 0.2031 0.1987 -0.0111 -0.0003 -0.0192 6968 LYS A CA  
1462 C  C   . LYS A 173 ? 0.2674 0.2090 0.2012 -0.0067 -0.0044 -0.0212 6968 LYS A C   
1463 O  O   . LYS A 173 ? 0.2609 0.1983 0.1901 -0.0040 -0.0072 -0.0202 6968 LYS A O   
1464 C  CB  . LYS A 173 ? 0.2792 0.2159 0.2086 -0.0136 0.0008  -0.0139 6968 LYS A CB  
1465 C  CG  . LYS A 173 ? 0.2936 0.2332 0.2227 -0.0139 0.0016  -0.0130 6968 LYS A CG  
1466 C  CD  . LYS A 173 ? 0.3231 0.2613 0.2445 -0.0119 0.0004  -0.0121 6968 LYS A CD  
1467 C  CE  . LYS A 173 ? 0.3355 0.2694 0.2501 -0.0143 0.0016  -0.0071 6968 LYS A CE  
1468 N  NZ  . LYS A 173 ? 0.3384 0.2758 0.2576 -0.0177 0.0046  -0.0051 6968 LYS A NZ  
1469 N  N   . ILE A 174 ? 0.2594 0.2053 0.1957 -0.0061 -0.0053 -0.0239 6969 ILE A N   
1470 C  CA  . ILE A 174 ? 0.2633 0.2102 0.1950 -0.0025 -0.0099 -0.0261 6969 ILE A CA  
1471 C  C   . ILE A 174 ? 0.2596 0.2067 0.1860 -0.0036 -0.0081 -0.0257 6969 ILE A C   
1472 O  O   . ILE A 174 ? 0.2481 0.1960 0.1781 -0.0064 -0.0039 -0.0247 6969 ILE A O   
1473 C  CB  . ILE A 174 ? 0.2680 0.2212 0.2094 -0.0004 -0.0133 -0.0324 6969 ILE A CB  
1474 C  CG1 . ILE A 174 ? 0.2745 0.2323 0.2250 -0.0037 -0.0103 -0.0361 6969 ILE A CG1 
1475 C  CG2 . ILE A 174 ? 0.2692 0.2235 0.2176 0.0013  -0.0143 -0.0336 6969 ILE A CG2 
1476 C  CD1 . ILE A 174 ? 0.2928 0.2573 0.2523 -0.0026 -0.0140 -0.0428 6969 ILE A CD1 
1477 N  N   . THR A 175 ? 0.2689 0.2150 0.1864 -0.0011 -0.0114 -0.0267 6970 THR A N   
1478 C  CA  . THR A 175 ? 0.2704 0.2172 0.1818 -0.0018 -0.0093 -0.0280 6970 THR A CA  
1479 C  C   . THR A 175 ? 0.2782 0.2265 0.1848 0.0010  -0.0150 -0.0329 6970 THR A C   
1480 O  O   . THR A 175 ? 0.2726 0.2225 0.1832 0.0035  -0.0207 -0.0348 6970 THR A O   
1481 C  CB  . THR A 175 ? 0.2831 0.2253 0.1827 -0.0031 -0.0060 -0.0226 6970 THR A CB  
1482 O  OG1 . THR A 175 ? 0.2898 0.2264 0.1772 -0.0010 -0.0104 -0.0198 6970 THR A OG1 
1483 C  CG2 . THR A 175 ? 0.2833 0.2246 0.1876 -0.0062 -0.0017 -0.0179 6970 THR A CG2 
1484 N  N   . GLU A 176 ? 0.2905 0.2387 0.1891 0.0008  -0.0137 -0.0354 6971 GLU A N   
1485 C  CA  . GLU A 176 ? 0.3021 0.2510 0.1932 0.0032  -0.0200 -0.0402 6971 GLU A CA  
1486 C  C   . GLU A 176 ? 0.3108 0.2552 0.1913 0.0063  -0.0267 -0.0362 6971 GLU A C   
1487 O  O   . GLU A 176 ? 0.3229 0.2700 0.2065 0.0093  -0.0346 -0.0397 6971 GLU A O   
1488 C  CB  . GLU A 176 ? 0.3154 0.2628 0.1945 0.0023  -0.0165 -0.0426 6971 GLU A CB  
1489 C  CG  . GLU A 176 ? 0.3370 0.2831 0.2026 0.0043  -0.0233 -0.0467 6971 GLU A CG  
1490 C  CD  . GLU A 176 ? 0.3564 0.3002 0.2071 0.0032  -0.0187 -0.0493 6971 GLU A CD  
1491 O  OE1 . GLU A 176 ? 0.3623 0.3055 0.2127 0.0011  -0.0099 -0.0467 6971 GLU A OE1 
1492 O  OE2 . GLU A 176 ? 0.3720 0.3150 0.2117 0.0043  -0.0239 -0.0544 6971 GLU A OE2 
1493 N  N   . HIS A 177 ? 0.3163 0.2539 0.1858 0.0056  -0.0239 -0.0290 6972 HIS A N   
1494 C  CA  . HIS A 177 ? 0.3280 0.2579 0.1844 0.0087  -0.0302 -0.0241 6972 HIS A CA  
1495 C  C   . HIS A 177 ? 0.3225 0.2498 0.1875 0.0101  -0.0315 -0.0203 6972 HIS A C   
1496 O  O   . HIS A 177 ? 0.3301 0.2520 0.1894 0.0141  -0.0386 -0.0179 6972 HIS A O   
1497 C  CB  . HIS A 177 ? 0.3530 0.2749 0.1890 0.0064  -0.0263 -0.0186 6972 HIS A CB  
1498 C  CG  . HIS A 177 ? 0.3681 0.2914 0.1923 0.0058  -0.0256 -0.0229 6972 HIS A CG  
1499 N  ND1 . HIS A 177 ? 0.4108 0.3299 0.2190 0.0086  -0.0336 -0.0237 6972 HIS A ND1 
1500 C  CD2 . HIS A 177 ? 0.3672 0.2951 0.1927 0.0029  -0.0183 -0.0271 6972 HIS A CD2 
1501 C  CE1 . HIS A 177 ? 0.4083 0.3293 0.2072 0.0070  -0.0308 -0.0286 6972 HIS A CE1 
1502 N  NE2 . HIS A 177 ? 0.3943 0.3206 0.2042 0.0037  -0.0209 -0.0310 6972 HIS A NE2 
1503 N  N   . SER A 178 ? 0.3052 0.2354 0.1826 0.0071  -0.0254 -0.0199 6973 SER A N   
1504 C  CA  . SER A 178 ? 0.3013 0.2284 0.1855 0.0081  -0.0259 -0.0172 6973 SER A CA  
1505 C  C   . SER A 178 ? 0.2890 0.2246 0.1909 0.0096  -0.0276 -0.0233 6973 SER A C   
1506 O  O   . SER A 178 ? 0.2768 0.2170 0.1888 0.0062  -0.0222 -0.0250 6973 SER A O   
1507 C  CB  . SER A 178 ? 0.2998 0.2236 0.1838 0.0034  -0.0188 -0.0128 6973 SER A CB  
1508 O  OG  . SER A 178 ? 0.2949 0.2138 0.1823 0.0042  -0.0196 -0.0105 6973 SER A OG  
1509 N  N   . TRP A 179 ? 0.2918 0.2294 0.1972 0.0145  -0.0351 -0.0262 6974 TRP A N   
1510 C  CA  . TRP A 179 ? 0.2822 0.2299 0.2062 0.0157  -0.0365 -0.0328 6974 TRP A CA  
1511 C  C   . TRP A 179 ? 0.2901 0.2382 0.2185 0.0222  -0.0446 -0.0341 6974 TRP A C   
1512 O  O   . TRP A 179 ? 0.3021 0.2419 0.2168 0.0260  -0.0505 -0.0299 6974 TRP A O   
1513 C  CB  . TRP A 179 ? 0.2801 0.2359 0.2091 0.0139  -0.0373 -0.0387 6974 TRP A CB  
1514 C  CG  . TRP A 179 ? 0.2941 0.2497 0.2137 0.0175  -0.0458 -0.0404 6974 TRP A CG  
1515 C  CD1 . TRP A 179 ? 0.3113 0.2599 0.2117 0.0174  -0.0469 -0.0371 6974 TRP A CD1 
1516 C  CD2 . TRP A 179 ? 0.2990 0.2619 0.2274 0.0215  -0.0548 -0.0460 6974 TRP A CD2 
1517 N  NE1 . TRP A 179 ? 0.3199 0.2696 0.2140 0.0210  -0.0562 -0.0399 6974 TRP A NE1 
1518 C  CE2 . TRP A 179 ? 0.3155 0.2745 0.2274 0.0238  -0.0620 -0.0455 6974 TRP A CE2 
1519 C  CE3 . TRP A 179 ? 0.2925 0.2658 0.2415 0.0231  -0.0574 -0.0518 6974 TRP A CE3 
1520 C  CZ2 . TRP A 179 ? 0.3248 0.2896 0.2399 0.0279  -0.0730 -0.0503 6974 TRP A CZ2 
1521 C  CZ3 . TRP A 179 ? 0.3003 0.2808 0.2552 0.0271  -0.0676 -0.0569 6974 TRP A CZ3 
1522 C  CH2 . TRP A 179 ? 0.3213 0.2975 0.2593 0.0296  -0.0760 -0.0561 6974 TRP A CH2 
1523 N  N   . ASN A 180 ? 0.2838 0.2412 0.2306 0.0233  -0.0446 -0.0397 6975 ASN A N   
1524 C  CA  . ASN A 180 ? 0.2919 0.2523 0.2483 0.0301  -0.0517 -0.0423 6975 ASN A CA  
1525 C  C   . ASN A 180 ? 0.2844 0.2603 0.2620 0.0300  -0.0531 -0.0509 6975 ASN A C   
1526 O  O   . ASN A 180 ? 0.2696 0.2513 0.2577 0.0246  -0.0449 -0.0538 6975 ASN A O   
1527 C  CB  . ASN A 180 ? 0.2971 0.2504 0.2547 0.0318  -0.0481 -0.0394 6975 ASN A CB  
1528 C  CG  . ASN A 180 ? 0.3101 0.2673 0.2810 0.0394  -0.0541 -0.0431 6975 ASN A CG  
1529 O  OD1 . ASN A 180 ? 0.3146 0.2837 0.3049 0.0395  -0.0516 -0.0498 6975 ASN A OD1 
1530 N  ND2 . ASN A 180 ? 0.3448 0.2916 0.3059 0.0457  -0.0616 -0.0387 6975 ASN A ND2 
1531 N  N   . ALA A 181 ? 0.2936 0.2756 0.2771 0.0357  -0.0633 -0.0545 6976 ALA A N   
1532 C  CA  . ALA A 181 ? 0.2961 0.2944 0.3014 0.0352  -0.0658 -0.0633 6976 ALA A CA  
1533 C  C   . ALA A 181 ? 0.2938 0.3002 0.3199 0.0357  -0.0598 -0.0674 6976 ALA A C   
1534 O  O   . ALA A 181 ? 0.2864 0.3039 0.3284 0.0304  -0.0542 -0.0733 6976 ALA A O   
1535 C  CB  . ALA A 181 ? 0.3050 0.3078 0.3113 0.0417  -0.0796 -0.0659 6976 ALA A CB  
1536 N  N   . ASP A 182 ? 0.3060 0.3062 0.3313 0.0413  -0.0603 -0.0647 6977 ASP A N   
1537 C  CA  . ASP A 182 ? 0.3177 0.3253 0.3621 0.0424  -0.0540 -0.0695 6977 ASP A CA  
1538 C  C   . ASP A 182 ? 0.2993 0.3049 0.3417 0.0335  -0.0404 -0.0687 6977 ASP A C   
1539 O  O   . ASP A 182 ? 0.2883 0.3043 0.3478 0.0307  -0.0335 -0.0746 6977 ASP A O   
1540 C  CB  . ASP A 182 ? 0.3564 0.3552 0.3986 0.0508  -0.0576 -0.0670 6977 ASP A CB  
1541 C  CG  . ASP A 182 ? 0.4116 0.4151 0.4623 0.0607  -0.0713 -0.0691 6977 ASP A CG  
1542 O  OD1 . ASP A 182 ? 0.4276 0.4466 0.4944 0.0612  -0.0765 -0.0755 6977 ASP A OD1 
1543 O  OD2 . ASP A 182 ? 0.4928 0.4839 0.5341 0.0679  -0.0771 -0.0644 6977 ASP A OD2 
1544 N  N   . LEU A 183 ? 0.2892 0.2824 0.3117 0.0291  -0.0369 -0.0618 6978 LEU A N   
1545 C  CA  . LEU A 183 ? 0.2800 0.2706 0.2993 0.0210  -0.0257 -0.0604 6978 LEU A CA  
1546 C  C   . LEU A 183 ? 0.2643 0.2653 0.2944 0.0148  -0.0223 -0.0649 6978 LEU A C   
1547 O  O   . LEU A 183 ? 0.2589 0.2638 0.2971 0.0096  -0.0136 -0.0673 6978 LEU A O   
1548 C  CB  . LEU A 183 ? 0.2847 0.2615 0.2827 0.0184  -0.0244 -0.0523 6978 LEU A CB  
1549 C  CG  . LEU A 183 ? 0.2895 0.2627 0.2829 0.0109  -0.0149 -0.0499 6978 LEU A CG  
1550 C  CD1 . LEU A 183 ? 0.2981 0.2710 0.2969 0.0102  -0.0085 -0.0519 6978 LEU A CD1 
1551 C  CD2 . LEU A 183 ? 0.2959 0.2579 0.2714 0.0088  -0.0146 -0.0426 6978 LEU A CD2 
1552 N  N   . TYR A 184 ? 0.2629 0.2669 0.2918 0.0147  -0.0285 -0.0660 6979 TYR A N   
1553 C  CA  . TYR A 184 ? 0.2630 0.2762 0.3036 0.0087  -0.0258 -0.0712 6979 TYR A CA  
1554 C  C   . TYR A 184 ? 0.2649 0.2927 0.3291 0.0089  -0.0245 -0.0790 6979 TYR A C   
1555 O  O   . TYR A 184 ? 0.2682 0.3013 0.3424 0.0019  -0.0165 -0.0819 6979 TYR A O   
1556 C  CB  . TYR A 184 ? 0.2621 0.2763 0.2980 0.0092  -0.0337 -0.0728 6979 TYR A CB  
1557 C  CG  . TYR A 184 ? 0.2626 0.2661 0.2806 0.0060  -0.0317 -0.0678 6979 TYR A CG  
1558 C  CD1 . TYR A 184 ? 0.2605 0.2627 0.2802 -0.0008 -0.0248 -0.0682 6979 TYR A CD1 
1559 C  CD2 . TYR A 184 ? 0.2686 0.2635 0.2688 0.0099  -0.0367 -0.0631 6979 TYR A CD2 
1560 C  CE1 . TYR A 184 ? 0.2622 0.2558 0.2683 -0.0028 -0.0231 -0.0646 6979 TYR A CE1 
1561 C  CE2 . TYR A 184 ? 0.2735 0.2606 0.2595 0.0071  -0.0340 -0.0596 6979 TYR A CE2 
1562 C  CZ  . TYR A 184 ? 0.2630 0.2500 0.2530 0.0011  -0.0274 -0.0607 6979 TYR A CZ  
1563 O  OH  . TYR A 184 ? 0.2728 0.2531 0.2514 -0.0008 -0.0247 -0.0580 6979 TYR A OH  
1564 N  N   . LYS A 185 ? 0.2799 0.3141 0.3532 0.0167  -0.0324 -0.0821 6980 LYS A N   
1565 C  CA  . LYS A 185 ? 0.2868 0.3373 0.3860 0.0179  -0.0314 -0.0904 6980 LYS A CA  
1566 C  C   . LYS A 185 ? 0.2770 0.3274 0.3810 0.0140  -0.0185 -0.0908 6980 LYS A C   
1567 O  O   . LYS A 185 ? 0.2658 0.3280 0.3875 0.0086  -0.0114 -0.0968 6980 LYS A O   
1568 C  CB  . LYS A 185 ? 0.3231 0.3781 0.4293 0.0287  -0.0429 -0.0923 6980 LYS A CB  
1569 C  CG  . LYS A 185 ? 0.3586 0.4323 0.4942 0.0318  -0.0437 -0.1015 6980 LYS A CG  
1570 C  CD  . LYS A 185 ? 0.4052 0.4824 0.5475 0.0436  -0.0572 -0.1028 6980 LYS A CD  
1571 C  CE  . LYS A 185 ? 0.4447 0.5426 0.6197 0.0475  -0.0581 -0.1126 6980 LYS A CE  
1572 N  NZ  . LYS A 185 ? 0.5021 0.6023 0.6837 0.0602  -0.0726 -0.1133 6980 LYS A NZ  
1573 N  N   A LEU A 186 ? 0.2751 0.3121 0.3630 0.0160  -0.0152 -0.0849 6981 LEU A N   
1574 N  N   B LEU A 186 ? 0.2773 0.3141 0.3648 0.0159  -0.0152 -0.0848 6981 LEU A N   
1575 C  CA  A LEU A 186 ? 0.2741 0.3091 0.3628 0.0123  -0.0033 -0.0854 6981 LEU A CA  
1576 C  CA  B LEU A 186 ? 0.2779 0.3124 0.3658 0.0125  -0.0036 -0.0851 6981 LEU A CA  
1577 C  C   A LEU A 186 ? 0.2705 0.3036 0.3545 0.0016  0.0062  -0.0837 6981 LEU A C   
1578 C  C   B LEU A 186 ? 0.2728 0.3054 0.3561 0.0017  0.0061  -0.0835 6981 LEU A C   
1579 O  O   A LEU A 186 ? 0.2734 0.3091 0.3623 -0.0030 0.0165  -0.0861 6981 LEU A O   
1580 O  O   B LEU A 186 ? 0.2762 0.3110 0.3639 -0.0027 0.0164  -0.0857 6981 LEU A O   
1581 C  CB  A LEU A 186 ? 0.2792 0.2989 0.3499 0.0163  -0.0034 -0.0794 6981 LEU A CB  
1582 C  CB  B LEU A 186 ? 0.2860 0.3049 0.3553 0.0166  -0.0044 -0.0788 6981 LEU A CB  
1583 C  CG  A LEU A 186 ? 0.2883 0.3082 0.3655 0.0266  -0.0097 -0.0817 6981 LEU A CG  
1584 C  CG  B LEU A 186 ? 0.2932 0.3087 0.3620 0.0154  0.0052  -0.0803 6981 LEU A CG  
1585 C  CD1 A LEU A 186 ? 0.2936 0.2960 0.3514 0.0291  -0.0096 -0.0755 6981 LEU A CD1 
1586 C  CD1 B LEU A 186 ? 0.2969 0.3271 0.3896 0.0192  0.0082  -0.0896 6981 LEU A CD1 
1587 C  CD2 A LEU A 186 ? 0.2922 0.3258 0.3924 0.0285  -0.0038 -0.0907 6981 LEU A CD2 
1588 C  CD2 B LEU A 186 ? 0.3043 0.3042 0.3563 0.0201  0.0023  -0.0750 6981 LEU A CD2 
1589 N  N   . MET A 187 ? 0.2675 0.2954 0.3416 -0.0021 0.0031  -0.0798 6982 MET A N   
1590 C  CA  . MET A 187 ? 0.2710 0.2955 0.3411 -0.0117 0.0113  -0.0778 6982 MET A CA  
1591 C  C   . MET A 187 ? 0.2689 0.3073 0.3600 -0.0170 0.0171  -0.0852 6982 MET A C   
1592 O  O   . MET A 187 ? 0.2700 0.3059 0.3596 -0.0252 0.0267  -0.0841 6982 MET A O   
1593 C  CB  . MET A 187 ? 0.2783 0.2963 0.3382 -0.0137 0.0065  -0.0740 6982 MET A CB  
1594 C  CG  . MET A 187 ? 0.2882 0.2928 0.3274 -0.0110 0.0035  -0.0663 6982 MET A CG  
1595 S  SD  . MET A 187 ? 0.3088 0.3017 0.3334 -0.0152 0.0121  -0.0597 6982 MET A SD  
1596 C  CE  . MET A 187 ? 0.3204 0.3122 0.3435 -0.0081 0.0103  -0.0603 6982 MET A CE  
1597 N  N   . GLY A 188 ? 0.2655 0.3182 0.3760 -0.0126 0.0113  -0.0923 6983 GLY A N   
1598 C  CA  . GLY A 188 ? 0.2708 0.3393 0.4049 -0.0178 0.0166  -0.1004 6983 GLY A CA  
1599 C  C   . GLY A 188 ? 0.2738 0.3485 0.4173 -0.0185 0.0271  -0.1039 6983 GLY A C   
1600 O  O   . GLY A 188 ? 0.2829 0.3714 0.4466 -0.0237 0.0337  -0.1107 6983 GLY A O   
1601 N  N   . HIS A 189 ? 0.2769 0.3415 0.4062 -0.0140 0.0291  -0.1000 6984 HIS A N   
1602 C  CA  . HIS A 189 ? 0.2820 0.3500 0.4167 -0.0140 0.0395  -0.1038 6984 HIS A CA  
1603 C  C   . HIS A 189 ? 0.2827 0.3387 0.3989 -0.0234 0.0509  -0.0985 6984 HIS A C   
1604 O  O   . HIS A 189 ? 0.2899 0.3447 0.4035 -0.0242 0.0600  -0.1004 6984 HIS A O   
1605 C  CB  . HIS A 189 ? 0.2904 0.3539 0.4212 -0.0031 0.0339  -0.1037 6984 HIS A CB  
1606 C  CG  . HIS A 189 ? 0.2976 0.3729 0.4473 0.0066  0.0229  -0.1089 6984 HIS A CG  
1607 N  ND1 . HIS A 189 ? 0.3162 0.3983 0.4800 0.0151  0.0227  -0.1148 6984 HIS A ND1 
1608 C  CD2 . HIS A 189 ? 0.3022 0.3835 0.4589 0.0096  0.0112  -0.1095 6984 HIS A CD2 
1609 C  CE1 . HIS A 189 ? 0.3173 0.4089 0.4962 0.0233  0.0105  -0.1180 6984 HIS A CE1 
1610 N  NE2 . HIS A 189 ? 0.3098 0.4013 0.4839 0.0197  0.0032  -0.1149 6984 HIS A NE2 
1611 N  N   . PHE A 190 ? 0.2766 0.3232 0.3798 -0.0296 0.0498  -0.0921 6985 PHE A N   
1612 C  CA  . PHE A 190 ? 0.2819 0.3158 0.3666 -0.0384 0.0586  -0.0859 6985 PHE A CA  
1613 C  C   . PHE A 190 ? 0.2864 0.3253 0.3804 -0.0485 0.0651  -0.0874 6985 PHE A C   
1614 O  O   . PHE A 190 ? 0.2895 0.3386 0.4004 -0.0482 0.0601  -0.0919 6985 PHE A O   
1615 C  CB  . PHE A 190 ? 0.2733 0.2912 0.3360 -0.0371 0.0518  -0.0767 6985 PHE A CB  
1616 C  CG  . PHE A 190 ? 0.2655 0.2759 0.3163 -0.0295 0.0471  -0.0741 6985 PHE A CG  
1617 C  CD1 . PHE A 190 ? 0.2598 0.2734 0.3159 -0.0205 0.0372  -0.0756 6985 PHE A CD1 
1618 C  CD2 . PHE A 190 ? 0.2735 0.2728 0.3069 -0.0319 0.0521  -0.0699 6985 PHE A CD2 
1619 C  CE1 . PHE A 190 ? 0.2608 0.2659 0.3057 -0.0144 0.0332  -0.0727 6985 PHE A CE1 
1620 C  CE2 . PHE A 190 ? 0.2687 0.2605 0.2918 -0.0258 0.0477  -0.0679 6985 PHE A CE2 
1621 C  CZ  . PHE A 190 ? 0.2608 0.2552 0.2900 -0.0172 0.0387  -0.0691 6985 PHE A CZ  
1622 N  N   . ALA A 191 ? 0.2973 0.3278 0.3793 -0.0573 0.0754  -0.0837 6986 ALA A N   
1623 C  CA  . ALA A 191 ? 0.3064 0.3384 0.3946 -0.0681 0.0825  -0.0839 6986 ALA A CA  
1624 C  C   . ALA A 191 ? 0.3032 0.3269 0.3867 -0.0690 0.0740  -0.0791 6986 ALA A C   
1625 O  O   . ALA A 191 ? 0.2973 0.3256 0.3933 -0.0752 0.0756  -0.0819 6986 ALA A O   
1626 C  CB  . ALA A 191 ? 0.3267 0.3484 0.3982 -0.0768 0.0944  -0.0793 6986 ALA A CB  
1627 N  N   . TRP A 192 ? 0.2969 0.3091 0.3638 -0.0632 0.0658  -0.0727 6987 TRP A N   
1628 C  CA  . TRP A 192 ? 0.3038 0.3075 0.3652 -0.0631 0.0583  -0.0684 6987 TRP A CA  
1629 C  C   . TRP A 192 ? 0.2873 0.2858 0.3376 -0.0539 0.0486  -0.0649 6987 TRP A C   
1630 O  O   . TRP A 192 ? 0.2750 0.2710 0.3164 -0.0499 0.0491  -0.0630 6987 TRP A O   
1631 C  CB  . TRP A 192 ? 0.3301 0.3188 0.3771 -0.0714 0.0638  -0.0609 6987 TRP A CB  
1632 C  CG  . TRP A 192 ? 0.3477 0.3276 0.3916 -0.0719 0.0577  -0.0576 6987 TRP A CG  
1633 C  CD1 . TRP A 192 ? 0.3696 0.3509 0.4252 -0.0770 0.0579  -0.0610 6987 TRP A CD1 
1634 C  CD2 . TRP A 192 ? 0.3585 0.3262 0.3872 -0.0674 0.0512  -0.0507 6987 TRP A CD2 
1635 N  NE1 . TRP A 192 ? 0.3753 0.3454 0.4233 -0.0754 0.0519  -0.0570 6987 TRP A NE1 
1636 C  CE2 . TRP A 192 ? 0.3717 0.3342 0.4040 -0.0693 0.0479  -0.0507 6987 TRP A CE2 
1637 C  CE3 . TRP A 192 ? 0.3737 0.3353 0.3875 -0.0622 0.0479  -0.0452 6987 TRP A CE3 
1638 C  CZ2 . TRP A 192 ? 0.3852 0.3371 0.4073 -0.0655 0.0421  -0.0456 6987 TRP A CZ2 
1639 C  CZ3 . TRP A 192 ? 0.3785 0.3306 0.3831 -0.0590 0.0420  -0.0399 6987 TRP A CZ3 
1640 C  CH2 . TRP A 192 ? 0.3769 0.3245 0.3858 -0.0603 0.0394  -0.0402 6987 TRP A CH2 
1641 N  N   . TRP A 193 ? 0.2705 0.2673 0.3215 -0.0510 0.0405  -0.0646 6988 TRP A N   
1642 C  CA  . TRP A 193 ? 0.2659 0.2578 0.3058 -0.0431 0.0323  -0.0611 6988 TRP A CA  
1643 C  C   . TRP A 193 ? 0.2649 0.2497 0.3000 -0.0433 0.0275  -0.0587 6988 TRP A C   
1644 O  O   . TRP A 193 ? 0.2634 0.2491 0.3070 -0.0482 0.0287  -0.0617 6988 TRP A O   
1645 C  CB  . TRP A 193 ? 0.2659 0.2685 0.3151 -0.0354 0.0258  -0.0666 6988 TRP A CB  
1646 C  CG  . TRP A 193 ? 0.2663 0.2765 0.3272 -0.0343 0.0193  -0.0722 6988 TRP A CG  
1647 C  CD1 . TRP A 193 ? 0.2730 0.2946 0.3525 -0.0381 0.0206  -0.0794 6988 TRP A CD1 
1648 C  CD2 . TRP A 193 ? 0.2651 0.2718 0.3192 -0.0299 0.0108  -0.0714 6988 TRP A CD2 
1649 N  NE1 . TRP A 193 ? 0.2718 0.2970 0.3561 -0.0363 0.0124  -0.0833 6988 TRP A NE1 
1650 C  CE2 . TRP A 193 ? 0.2684 0.2841 0.3362 -0.0311 0.0066  -0.0785 6988 TRP A CE2 
1651 C  CE3 . TRP A 193 ? 0.2639 0.2612 0.3016 -0.0256 0.0068  -0.0657 6988 TRP A CE3 
1652 C  CZ2 . TRP A 193 ? 0.2752 0.2897 0.3388 -0.0279 -0.0016 -0.0803 6988 TRP A CZ2 
1653 C  CZ3 . TRP A 193 ? 0.2705 0.2672 0.3048 -0.0225 -0.0001 -0.0673 6988 TRP A CZ3 
1654 C  CH2 . TRP A 193 ? 0.2703 0.2750 0.3163 -0.0235 -0.0044 -0.0745 6988 TRP A CH2 
1655 N  N   . THR A 194 ? 0.2592 0.2372 0.2818 -0.0383 0.0227  -0.0540 6989 THR A N   
1656 C  CA  . THR A 194 ? 0.2592 0.2317 0.2779 -0.0371 0.0183  -0.0528 6989 THR A CA  
1657 C  C   . THR A 194 ? 0.2529 0.2228 0.2608 -0.0305 0.0131  -0.0496 6989 THR A C   
1658 O  O   . THR A 194 ? 0.2563 0.2269 0.2594 -0.0277 0.0130  -0.0476 6989 THR A O   
1659 C  CB  . THR A 194 ? 0.2739 0.2354 0.2869 -0.0422 0.0222  -0.0477 6989 THR A CB  
1660 O  OG1 . THR A 194 ? 0.2698 0.2281 0.2839 -0.0410 0.0184  -0.0494 6989 THR A OG1 
1661 C  CG2 . THR A 194 ? 0.2820 0.2352 0.2814 -0.0414 0.0233  -0.0398 6989 THR A CG2 
1662 N  N   . ALA A 195 ? 0.2464 0.2134 0.2512 -0.0286 0.0094  -0.0499 6990 ALA A N   
1663 C  CA  . ALA A 195 ? 0.2439 0.2073 0.2376 -0.0237 0.0060  -0.0463 6990 ALA A CA  
1664 C  C   . ALA A 195 ? 0.2451 0.2001 0.2342 -0.0257 0.0085  -0.0416 6990 ALA A C   
1665 O  O   . ALA A 195 ? 0.2486 0.2009 0.2422 -0.0276 0.0090  -0.0440 6990 ALA A O   
1666 C  CB  . ALA A 195 ? 0.2472 0.2145 0.2406 -0.0198 0.0004  -0.0510 6990 ALA A CB  
1667 N  N   . PHE A 196 ? 0.2473 0.1980 0.2286 -0.0253 0.0098  -0.0353 6991 PHE A N   
1668 C  CA  . PHE A 196 ? 0.2488 0.1922 0.2269 -0.0267 0.0112  -0.0302 6991 PHE A CA  
1669 C  C   . PHE A 196 ? 0.2457 0.1888 0.2187 -0.0226 0.0090  -0.0280 6991 PHE A C   
1670 O  O   . PHE A 196 ? 0.2415 0.1867 0.2089 -0.0207 0.0079  -0.0260 6991 PHE A O   
1671 C  CB  . PHE A 196 ? 0.2567 0.1959 0.2302 -0.0302 0.0139  -0.0248 6991 PHE A CB  
1672 C  CG  . PHE A 196 ? 0.2648 0.1966 0.2345 -0.0310 0.0135  -0.0188 6991 PHE A CG  
1673 C  CD1 . PHE A 196 ? 0.2800 0.2054 0.2532 -0.0333 0.0145  -0.0179 6991 PHE A CD1 
1674 C  CD2 . PHE A 196 ? 0.2733 0.2043 0.2367 -0.0294 0.0117  -0.0140 6991 PHE A CD2 
1675 C  CE1 . PHE A 196 ? 0.2865 0.2045 0.2568 -0.0330 0.0130  -0.0121 6991 PHE A CE1 
1676 C  CE2 . PHE A 196 ? 0.2825 0.2081 0.2444 -0.0295 0.0101  -0.0086 6991 PHE A CE2 
1677 C  CZ  . PHE A 196 ? 0.2875 0.2065 0.2528 -0.0308 0.0105  -0.0075 6991 PHE A CZ  
1678 N  N   . VAL A 197 ? 0.2501 0.1901 0.2256 -0.0216 0.0090  -0.0284 6992 VAL A N   
1679 C  CA  . VAL A 197 ? 0.2490 0.1897 0.2219 -0.0179 0.0083  -0.0271 6992 VAL A CA  
1680 C  C   . VAL A 197 ? 0.2507 0.1870 0.2248 -0.0183 0.0086  -0.0212 6992 VAL A C   
1681 O  O   . VAL A 197 ? 0.2573 0.1877 0.2357 -0.0195 0.0089  -0.0207 6992 VAL A O   
1682 C  CB  . VAL A 197 ? 0.2588 0.2001 0.2346 -0.0156 0.0081  -0.0333 6992 VAL A CB  
1683 C  CG1 . VAL A 197 ? 0.2666 0.2093 0.2408 -0.0121 0.0090  -0.0327 6992 VAL A CG1 
1684 C  CG2 . VAL A 197 ? 0.2650 0.2109 0.2389 -0.0151 0.0062  -0.0390 6992 VAL A CG2 
1685 N  N   . THR A 198 ? 0.2472 0.1857 0.2176 -0.0175 0.0079  -0.0168 6993 THR A N   
1686 C  CA  . THR A 198 ? 0.2480 0.1836 0.2208 -0.0174 0.0067  -0.0114 6993 THR A CA  
1687 C  C   . THR A 198 ? 0.2534 0.1893 0.2337 -0.0135 0.0071  -0.0137 6993 THR A C   
1688 O  O   . THR A 198 ? 0.2572 0.1978 0.2380 -0.0110 0.0089  -0.0184 6993 THR A O   
1689 C  CB  . THR A 198 ? 0.2515 0.1904 0.2202 -0.0181 0.0054  -0.0069 6993 THR A CB  
1690 O  OG1 . THR A 198 ? 0.2571 0.2022 0.2265 -0.0157 0.0066  -0.0089 6993 THR A OG1 
1691 C  CG2 . THR A 198 ? 0.2526 0.1902 0.2136 -0.0215 0.0054  -0.0057 6993 THR A CG2 
1692 N  N   . ASN A 199 ? 0.2613 0.1917 0.2466 -0.0128 0.0056  -0.0106 6994 ASN A N   
1693 C  CA  . ASN A 199 ? 0.2656 0.1958 0.2600 -0.0081 0.0060  -0.0132 6994 ASN A CA  
1694 C  C   . ASN A 199 ? 0.2617 0.2010 0.2601 -0.0050 0.0066  -0.0128 6994 ASN A C   
1695 O  O   . ASN A 199 ? 0.2665 0.2089 0.2711 -0.0011 0.0091  -0.0177 6994 ASN A O   
1696 C  CB  . ASN A 199 ? 0.2803 0.2008 0.2795 -0.0074 0.0034  -0.0093 6994 ASN A CB  
1697 C  CG  . ASN A 199 ? 0.2980 0.2094 0.2977 -0.0091 0.0048  -0.0128 6994 ASN A CG  
1698 O  OD1 . ASN A 199 ? 0.2956 0.2093 0.2953 -0.0093 0.0074  -0.0199 6994 ASN A OD1 
1699 N  ND2 . ASN A 199 ? 0.3045 0.2048 0.3044 -0.0106 0.0028  -0.0080 6994 ASN A ND2 
1700 N  N   A VAL A 200 ? 0.2513 0.1949 0.2465 -0.0070 0.0048  -0.0078 6995 VAL A N   
1701 N  N   B VAL A 200 ? 0.2598 0.2033 0.2547 -0.0072 0.0049  -0.0079 6995 VAL A N   
1702 C  CA  A VAL A 200 ? 0.2497 0.2030 0.2505 -0.0051 0.0058  -0.0075 6995 VAL A CA  
1703 C  CA  B VAL A 200 ? 0.2616 0.2145 0.2616 -0.0055 0.0055  -0.0071 6995 VAL A CA  
1704 C  C   A VAL A 200 ? 0.2517 0.2104 0.2470 -0.0055 0.0104  -0.0122 6995 VAL A C   
1705 C  C   B VAL A 200 ? 0.2589 0.2175 0.2538 -0.0058 0.0101  -0.0116 6995 VAL A C   
1706 O  O   A VAL A 200 ? 0.2479 0.2141 0.2485 -0.0036 0.0135  -0.0141 6995 VAL A O   
1707 O  O   B VAL A 200 ? 0.2570 0.2235 0.2572 -0.0043 0.0129  -0.0128 6995 VAL A O   
1708 C  CB  A VAL A 200 ? 0.2447 0.2011 0.2445 -0.0079 0.0021  -0.0013 6995 VAL A CB  
1709 C  CB  B VAL A 200 ? 0.2655 0.2201 0.2631 -0.0087 0.0016  -0.0006 6995 VAL A CB  
1710 C  CG1 A VAL A 200 ? 0.2458 0.1981 0.2515 -0.0066 -0.0032 0.0036  6995 VAL A CG1 
1711 C  CG1 B VAL A 200 ? 0.2627 0.2167 0.2483 -0.0132 0.0024  -0.0001 6995 VAL A CG1 
1712 C  CG2 A VAL A 200 ? 0.2428 0.1960 0.2299 -0.0128 0.0017  0.0004  6995 VAL A CG2 
1713 C  CG2 B VAL A 200 ? 0.2701 0.2343 0.2779 -0.0071 0.0010  0.0005  6995 VAL A CG2 
1714 N  N   . ASN A 201 ? 0.2541 0.2094 0.2395 -0.0078 0.0108  -0.0139 6996 ASN A N   
1715 C  CA  . ASN A 201 ? 0.2681 0.2269 0.2461 -0.0079 0.0138  -0.0174 6996 ASN A CA  
1716 C  C   . ASN A 201 ? 0.2804 0.2362 0.2556 -0.0063 0.0148  -0.0239 6996 ASN A C   
1717 O  O   . ASN A 201 ? 0.3062 0.2625 0.2724 -0.0069 0.0151  -0.0261 6996 ASN A O   
1718 C  CB  . ASN A 201 ? 0.2714 0.2295 0.2400 -0.0113 0.0124  -0.0140 6996 ASN A CB  
1719 C  CG  . ASN A 201 ? 0.2849 0.2464 0.2463 -0.0117 0.0150  -0.0147 6996 ASN A CG  
1720 O  OD1 . ASN A 201 ? 0.2915 0.2580 0.2560 -0.0105 0.0187  -0.0162 6996 ASN A OD1 
1721 N  ND2 . ASN A 201 ? 0.2699 0.2283 0.2217 -0.0133 0.0135  -0.0134 6996 ASN A ND2 
1722 N  N   . ALA A 202 ? 0.2862 0.2385 0.2688 -0.0043 0.0148  -0.0268 6997 ALA A N   
1723 C  CA  . ALA A 202 ? 0.2983 0.2469 0.2795 -0.0035 0.0152  -0.0337 6997 ALA A CA  
1724 C  C   . ALA A 202 ? 0.2999 0.2525 0.2753 -0.0016 0.0183  -0.0396 6997 ALA A C   
1725 O  O   . ALA A 202 ? 0.3080 0.2582 0.2790 -0.0017 0.0175  -0.0455 6997 ALA A O   
1726 C  CB  . ALA A 202 ? 0.3203 0.2628 0.3111 -0.0019 0.0148  -0.0351 6997 ALA A CB  
1727 N  N   . SER A 203 ? 0.2943 0.2526 0.2691 -0.0005 0.0218  -0.0384 6998 SER A N   
1728 C  CA  . SER A 203 ? 0.3091 0.2706 0.2758 0.0006  0.0260  -0.0437 6998 SER A CA  
1729 C  C   . SER A 203 ? 0.2990 0.2609 0.2511 -0.0018 0.0246  -0.0415 6998 SER A C   
1730 O  O   . SER A 203 ? 0.3141 0.2774 0.2558 -0.0016 0.0276  -0.0446 6998 SER A O   
1731 C  CB  . SER A 203 ? 0.3305 0.2986 0.3041 0.0026  0.0317  -0.0441 6998 SER A CB  
1732 O  OG  . SER A 203 ? 0.3516 0.3245 0.3283 0.0004  0.0316  -0.0369 6998 SER A OG  
1733 N  N   . SER A 204 ? 0.2816 0.2415 0.2323 -0.0040 0.0203  -0.0364 6999 SER A N   
1734 C  CA  . SER A 204 ? 0.2820 0.2408 0.2203 -0.0056 0.0179  -0.0338 6999 SER A CA  
1735 C  C   . SER A 204 ? 0.2725 0.2281 0.2087 -0.0054 0.0127  -0.0367 6999 SER A C   
1736 O  O   . SER A 204 ? 0.2646 0.2189 0.2103 -0.0058 0.0112  -0.0380 6999 SER A O   
1737 C  CB  . SER A 204 ? 0.2808 0.2399 0.2200 -0.0079 0.0173  -0.0265 6999 SER A CB  
1738 O  OG  . SER A 204 ? 0.2845 0.2405 0.2131 -0.0089 0.0143  -0.0242 6999 SER A OG  
1739 N  N   . SER A 205 ? 0.2742 0.2288 0.1989 -0.0050 0.0098  -0.0375 7000 SER A N   
1740 C  CA  . SER A 205 ? 0.2754 0.2291 0.2000 -0.0045 0.0040  -0.0404 7000 SER A CA  
1741 C  C   . SER A 205 ? 0.2665 0.2197 0.1966 -0.0057 0.0020  -0.0357 7000 SER A C   
1742 O  O   . SER A 205 ? 0.2617 0.2156 0.1948 -0.0054 -0.0020 -0.0379 7000 SER A O   
1743 C  CB  . SER A 205 ? 0.2891 0.2418 0.1998 -0.0030 0.0004  -0.0420 7000 SER A CB  
1744 O  OG  . SER A 205 ? 0.2915 0.2417 0.1929 -0.0032 0.0004  -0.0356 7000 SER A OG  
1745 N  N   . GLU A 206 ? 0.2693 0.2219 0.2009 -0.0072 0.0048  -0.0300 7001 GLU A N   
1746 C  CA  . GLU A 206 ? 0.2612 0.2124 0.1966 -0.0088 0.0036  -0.0261 7001 GLU A CA  
1747 C  C   . GLU A 206 ? 0.2559 0.2076 0.2013 -0.0099 0.0030  -0.0287 7001 GLU A C   
1748 O  O   . GLU A 206 ? 0.2448 0.1966 0.1962 -0.0102 0.0046  -0.0311 7001 GLU A O   
1749 C  CB  . GLU A 206 ? 0.2677 0.2184 0.2041 -0.0108 0.0064  -0.0206 7001 GLU A CB  
1750 C  CG  . GLU A 206 ? 0.2666 0.2154 0.2062 -0.0130 0.0056  -0.0174 7001 GLU A CG  
1751 C  CD  . GLU A 206 ? 0.2816 0.2304 0.2223 -0.0153 0.0072  -0.0125 7001 GLU A CD  
1752 O  OE1 . GLU A 206 ? 0.2836 0.2311 0.2184 -0.0164 0.0074  -0.0095 7001 GLU A OE1 
1753 O  OE2 . GLU A 206 ? 0.2878 0.2377 0.2355 -0.0159 0.0079  -0.0117 7001 GLU A OE2 
1754 N  N   . ALA A 207 ? 0.2478 0.1994 0.1950 -0.0105 0.0013  -0.0284 7002 ALA A N   
1755 C  CA  . ALA A 207 ? 0.2510 0.2028 0.2069 -0.0130 0.0024  -0.0297 7002 ALA A CA  
1756 C  C   . ALA A 207 ? 0.2446 0.1955 0.1995 -0.0140 0.0025  -0.0272 7002 ALA A C   
1757 O  O   . ALA A 207 ? 0.2453 0.1954 0.1942 -0.0120 0.0007  -0.0258 7002 ALA A O   
1758 C  CB  . ALA A 207 ? 0.2531 0.2080 0.2153 -0.0128 0.0006  -0.0361 7002 ALA A CB  
1759 N  N   . PHE A 208 ? 0.2453 0.1951 0.2046 -0.0172 0.0050  -0.0264 7003 PHE A N   
1760 C  CA  . PHE A 208 ? 0.2499 0.1992 0.2086 -0.0184 0.0062  -0.0258 7003 PHE A CA  
1761 C  C   . PHE A 208 ? 0.2439 0.1980 0.2117 -0.0189 0.0069  -0.0314 7003 PHE A C   
1762 O  O   . PHE A 208 ? 0.2442 0.1988 0.2178 -0.0221 0.0091  -0.0329 7003 PHE A O   
1763 C  CB  . PHE A 208 ? 0.2611 0.2057 0.2162 -0.0222 0.0089  -0.0212 7003 PHE A CB  
1764 C  CG  . PHE A 208 ? 0.2726 0.2144 0.2208 -0.0218 0.0075  -0.0164 7003 PHE A CG  
1765 C  CD1 . PHE A 208 ? 0.2837 0.2232 0.2259 -0.0216 0.0069  -0.0149 7003 PHE A CD1 
1766 C  CD2 . PHE A 208 ? 0.2759 0.2176 0.2249 -0.0216 0.0070  -0.0140 7003 PHE A CD2 
1767 C  CE1 . PHE A 208 ? 0.2876 0.2248 0.2246 -0.0223 0.0058  -0.0108 7003 PHE A CE1 
1768 C  CE2 . PHE A 208 ? 0.2899 0.2310 0.2350 -0.0217 0.0061  -0.0101 7003 PHE A CE2 
1769 C  CZ  . PHE A 208 ? 0.2921 0.2310 0.2311 -0.0225 0.0055  -0.0084 7003 PHE A CZ  
1770 N  N   A LEU A 209 ? 0.2384 0.1962 0.2083 -0.0158 0.0047  -0.0344 7004 LEU A N   
1771 N  N   B LEU A 209 ? 0.2492 0.2068 0.2190 -0.0159 0.0049  -0.0343 7004 LEU A N   
1772 C  CA  A LEU A 209 ? 0.2381 0.2028 0.2195 -0.0162 0.0056  -0.0402 7004 LEU A CA  
1773 C  CA  B LEU A 209 ? 0.2557 0.2204 0.2370 -0.0161 0.0054  -0.0403 7004 LEU A CA  
1774 C  C   A LEU A 209 ? 0.2459 0.2090 0.2278 -0.0200 0.0114  -0.0393 7004 LEU A C   
1775 C  C   B LEU A 209 ? 0.2574 0.2211 0.2401 -0.0198 0.0113  -0.0398 7004 LEU A C   
1776 O  O   A LEU A 209 ? 0.2436 0.2032 0.2193 -0.0186 0.0119  -0.0373 7004 LEU A O   
1777 O  O   B LEU A 209 ? 0.2581 0.2192 0.2358 -0.0180 0.0117  -0.0385 7004 LEU A O   
1778 C  CB  A LEU A 209 ? 0.2404 0.2099 0.2253 -0.0106 0.0005  -0.0438 7004 LEU A CB  
1779 C  CB  B LEU A 209 ? 0.2716 0.2402 0.2547 -0.0102 0.0000  -0.0432 7004 LEU A CB  
1780 C  CG  A LEU A 209 ? 0.2368 0.2083 0.2201 -0.0073 -0.0057 -0.0456 7004 LEU A CG  
1781 C  CG  B LEU A 209 ? 0.2794 0.2579 0.2765 -0.0089 -0.0024 -0.0503 7004 LEU A CG  
1782 C  CD1 A LEU A 209 ? 0.2419 0.2180 0.2292 -0.0016 -0.0118 -0.0490 7004 LEU A CD1 
1783 C  CD1 B LEU A 209 ? 0.2782 0.2598 0.2809 -0.0122 -0.0027 -0.0534 7004 LEU A CD1 
1784 C  CD2 A LEU A 209 ? 0.2375 0.2128 0.2282 -0.0106 -0.0050 -0.0496 7004 LEU A CD2 
1785 C  CD2 B LEU A 209 ? 0.2856 0.2663 0.2821 -0.0021 -0.0099 -0.0518 7004 LEU A CD2 
1786 N  N   . ILE A 210 ? 0.2531 0.2175 0.2407 -0.0251 0.0159  -0.0407 7005 ILE A N   
1787 C  CA  . ILE A 210 ? 0.2650 0.2270 0.2505 -0.0299 0.0225  -0.0396 7005 ILE A CA  
1788 C  C   . ILE A 210 ? 0.2718 0.2428 0.2707 -0.0315 0.0266  -0.0462 7005 ILE A C   
1789 O  O   . ILE A 210 ? 0.2663 0.2426 0.2757 -0.0336 0.0266  -0.0498 7005 ILE A O   
1790 C  CB  . ILE A 210 ? 0.2749 0.2292 0.2540 -0.0353 0.0251  -0.0344 7005 ILE A CB  
1791 C  CG1 . ILE A 210 ? 0.2855 0.2331 0.2541 -0.0331 0.0210  -0.0284 7005 ILE A CG1 
1792 C  CG2 . ILE A 210 ? 0.2825 0.2335 0.2573 -0.0411 0.0320  -0.0331 7005 ILE A CG2 
1793 C  CD1 . ILE A 210 ? 0.2964 0.2372 0.2613 -0.0365 0.0215  -0.0235 7005 ILE A CD1 
1794 N  N   . GLY A 211 ? 0.2766 0.2495 0.2757 -0.0303 0.0298  -0.0484 7006 GLY A N   
1795 C  CA  . GLY A 211 ? 0.2777 0.2599 0.2900 -0.0321 0.0356  -0.0550 7006 GLY A CA  
1796 C  C   . GLY A 211 ? 0.2887 0.2655 0.2928 -0.0392 0.0447  -0.0529 7006 GLY A C   
1797 O  O   . GLY A 211 ? 0.2850 0.2540 0.2755 -0.0388 0.0456  -0.0496 7006 GLY A O   
1798 N  N   . CYS A 212 ? 0.2988 0.2784 0.3091 -0.0461 0.0509  -0.0543 7007 CYS A N   
1799 C  CA  . CYS A 212 ? 0.3269 0.2993 0.3259 -0.0539 0.0597  -0.0511 7007 CYS A CA  
1800 C  C   . CYS A 212 ? 0.3230 0.3052 0.3330 -0.0573 0.0696  -0.0583 7007 CYS A C   
1801 O  O   . CYS A 212 ? 0.3092 0.3014 0.3363 -0.0601 0.0722  -0.0633 7007 CYS A O   
1802 C  CB  . CYS A 212 ? 0.3544 0.3189 0.3482 -0.0604 0.0603  -0.0456 7007 CYS A CB  
1803 S  SG  . CYS A 212 ? 0.4404 0.3919 0.4144 -0.0694 0.0687  -0.0390 7007 CYS A SG  
1804 N  N   . ASN A 213 ? 0.3257 0.3053 0.3267 -0.0573 0.0749  -0.0595 7008 ASN A N   
1805 C  CA  . ASN A 213 ? 0.3280 0.3161 0.3372 -0.0606 0.0862  -0.0667 7008 ASN A CA  
1806 C  C   . ASN A 213 ? 0.3129 0.3167 0.3455 -0.0529 0.0841  -0.0759 7008 ASN A C   
1807 O  O   . ASN A 213 ? 0.2979 0.3142 0.3504 -0.0543 0.0851  -0.0808 7008 ASN A O   
1808 C  CB  . ASN A 213 ? 0.3462 0.3349 0.3569 -0.0713 0.0957  -0.0660 7008 ASN A CB  
1809 C  CG  . ASN A 213 ? 0.3661 0.3377 0.3528 -0.0781 0.0964  -0.0561 7008 ASN A CG  
1810 O  OD1 . ASN A 213 ? 0.3891 0.3562 0.3757 -0.0835 0.0962  -0.0518 7008 ASN A OD1 
1811 N  ND2 . ASN A 213 ? 0.3663 0.3276 0.3326 -0.0775 0.0964  -0.0525 7008 ASN A ND2 
1812 N  N   . TYR A 214 ? 0.3022 0.3049 0.3324 -0.0453 0.0813  -0.0784 7009 TYR A N   
1813 C  CA  . TYR A 214 ? 0.3017 0.3167 0.3523 -0.0360 0.0772  -0.0862 7009 TYR A CA  
1814 C  C   . TYR A 214 ? 0.3081 0.3380 0.3780 -0.0382 0.0883  -0.0958 7009 TYR A C   
1815 O  O   . TYR A 214 ? 0.3160 0.3425 0.3768 -0.0431 0.0995  -0.0977 7009 TYR A O   
1816 C  CB  . TYR A 214 ? 0.3052 0.3109 0.3448 -0.0282 0.0718  -0.0849 7009 TYR A CB  
1817 C  CG  . TYR A 214 ? 0.3100 0.3243 0.3672 -0.0175 0.0658  -0.0912 7009 TYR A CG  
1818 C  CD1 . TYR A 214 ? 0.3071 0.3294 0.3782 -0.0124 0.0559  -0.0916 7009 TYR A CD1 
1819 C  CD2 . TYR A 214 ? 0.3233 0.3358 0.3813 -0.0121 0.0690  -0.0964 7009 TYR A CD2 
1820 C  CE1 . TYR A 214 ? 0.3133 0.3424 0.3991 -0.0022 0.0489  -0.0965 7009 TYR A CE1 
1821 C  CE2 . TYR A 214 ? 0.3287 0.3474 0.4026 -0.0014 0.0624  -0.1015 7009 TYR A CE2 
1822 C  CZ  . TYR A 214 ? 0.3221 0.3491 0.4098 0.0036  0.0520  -0.1011 7009 TYR A CZ  
1823 O  OH  . TYR A 214 ? 0.3447 0.3768 0.4470 0.0145  0.0444  -0.1054 7009 TYR A OH  
1824 N  N   . LEU A 215 ? 0.3087 0.3550 0.4044 -0.0346 0.0852  -0.1023 7010 LEU A N   
1825 C  CA  . LEU A 215 ? 0.3248 0.3891 0.4443 -0.0367 0.0955  -0.1125 7010 LEU A CA  
1826 C  C   . LEU A 215 ? 0.3367 0.4111 0.4742 -0.0249 0.0921  -0.1207 7010 LEU A C   
1827 O  O   . LEU A 215 ? 0.3366 0.4263 0.4947 -0.0252 0.1014  -0.1301 7010 LEU A O   
1828 C  CB  . LEU A 215 ? 0.3207 0.3978 0.4594 -0.0421 0.0946  -0.1146 7010 LEU A CB  
1829 C  CG  . LEU A 215 ? 0.3286 0.3946 0.4514 -0.0533 0.0975  -0.1067 7010 LEU A CG  
1830 C  CD1 . LEU A 215 ? 0.3328 0.4112 0.4763 -0.0585 0.0962  -0.1101 7010 LEU A CD1 
1831 C  CD2 . LEU A 215 ? 0.3446 0.4024 0.4511 -0.0631 0.1121  -0.1045 7010 LEU A CD2 
1832 N  N   . GLY A 216 ? 0.3488 0.4147 0.4793 -0.0150 0.0796  -0.1172 7011 GLY A N   
1833 C  CA  . GLY A 216 ? 0.3738 0.4454 0.5186 -0.0029 0.0749  -0.1237 7011 GLY A CA  
1834 C  C   . GLY A 216 ? 0.3879 0.4800 0.5642 0.0030  0.0686  -0.1310 7011 GLY A C   
1835 O  O   . GLY A 216 ? 0.4055 0.5053 0.5988 0.0131  0.0661  -0.1378 7011 GLY A O   
1836 N  N   . LYS A 217 ? 0.3878 0.4883 0.5724 -0.0030 0.0658  -0.1299 7012 LYS A N   
1837 C  CA  . LYS A 217 ? 0.4059 0.5266 0.6204 0.0015  0.0580  -0.1369 7012 LYS A CA  
1838 C  C   . LYS A 217 ? 0.3947 0.5143 0.6048 -0.0048 0.0511  -0.1320 7012 LYS A C   
1839 O  O   . LYS A 217 ? 0.3731 0.4807 0.5638 -0.0142 0.0565  -0.1255 7012 LYS A O   
1840 C  CB  . LYS A 217 ? 0.4325 0.5745 0.6757 -0.0017 0.0702  -0.1480 7012 LYS A CB  
1841 C  CG  . LYS A 217 ? 0.4659 0.6110 0.7076 -0.0169 0.0845  -0.1480 7012 LYS A CG  
1842 C  CD  . LYS A 217 ? 0.5014 0.6689 0.7728 -0.0205 0.0975  -0.1595 7012 LYS A CD  
1843 C  CE  . LYS A 217 ? 0.5281 0.6986 0.7990 -0.0366 0.1111  -0.1591 7012 LYS A CE  
1844 N  NZ  . LYS A 217 ? 0.5592 0.7531 0.8607 -0.0406 0.1246  -0.1707 7012 LYS A NZ  
1845 N  N   . PRO A 218 ? 0.3970 0.5284 0.6245 0.0002  0.0386  -0.1352 7013 PRO A N   
1846 C  CA  . PRO A 218 ? 0.3985 0.5281 0.6212 -0.0054 0.0317  -0.1317 7013 PRO A CA  
1847 C  C   . PRO A 218 ? 0.4028 0.5427 0.6387 -0.0183 0.0418  -0.1357 7013 PRO A C   
1848 O  O   . PRO A 218 ? 0.4299 0.5900 0.6942 -0.0194 0.0453  -0.1449 7013 PRO A O   
1849 C  CB  . PRO A 218 ? 0.3964 0.5370 0.6350 0.0043  0.0153  -0.1356 7013 PRO A CB  
1850 C  CG  . PRO A 218 ? 0.4039 0.5612 0.6689 0.0120  0.0171  -0.1445 7013 PRO A CG  
1851 C  CD  . PRO A 218 ? 0.4048 0.5508 0.6563 0.0121  0.0296  -0.1425 7013 PRO A CD  
1852 N  N   A ARG A 219 ? 0.4021 0.5276 0.6178 -0.0279 0.0467  -0.1286 7014 ARG A N   
1853 N  N   B ARG A 219 ? 0.3955 0.5206 0.6106 -0.0277 0.0466  -0.1285 7014 ARG A N   
1854 C  CA  A ARG A 219 ? 0.4131 0.5447 0.6388 -0.0409 0.0557  -0.1312 7014 ARG A CA  
1855 C  CA  B ARG A 219 ? 0.3981 0.5275 0.6207 -0.0409 0.0556  -0.1302 7014 ARG A CA  
1856 C  C   A ARG A 219 ? 0.4071 0.5429 0.6405 -0.0417 0.0437  -0.1327 7014 ARG A C   
1857 C  C   B ARG A 219 ? 0.3976 0.5328 0.6301 -0.0417 0.0440  -0.1324 7014 ARG A C   
1858 O  O   A ARG A 219 ? 0.4000 0.5472 0.6519 -0.0504 0.0476  -0.1382 7014 ARG A O   
1859 O  O   B ARG A 219 ? 0.3946 0.5419 0.6464 -0.0503 0.0481  -0.1382 7014 ARG A O   
1860 C  CB  A ARG A 219 ? 0.4297 0.5430 0.6308 -0.0508 0.0667  -0.1230 7014 ARG A CB  
1861 C  CB  B ARG A 219 ? 0.4004 0.5090 0.5949 -0.0492 0.0640  -0.1207 7014 ARG A CB  
1862 C  CG  A ARG A 219 ? 0.4434 0.5377 0.6202 -0.0514 0.0591  -0.1137 7014 ARG A CG  
1863 C  CG  B ARG A 219 ? 0.4073 0.5155 0.6052 -0.0629 0.0728  -0.1205 7014 ARG A CG  
1864 C  CD  A ARG A 219 ? 0.4618 0.5402 0.6188 -0.0617 0.0694  -0.1063 7014 ARG A CD  
1865 C  CD  B ARG A 219 ? 0.4176 0.5030 0.5862 -0.0690 0.0770  -0.1099 7014 ARG A CD  
1866 N  NE  A ARG A 219 ? 0.4839 0.5690 0.6544 -0.0735 0.0793  -0.1098 7014 ARG A NE  
1867 N  NE  B ARG A 219 ? 0.4120 0.4846 0.5639 -0.0627 0.0646  -0.1036 7014 ARG A NE  
1868 C  CZ  A ARG A 219 ? 0.4875 0.5720 0.6642 -0.0798 0.0763  -0.1104 7014 ARG A CZ  
1869 C  CZ  B ARG A 219 ? 0.4203 0.4905 0.5739 -0.0643 0.0569  -0.1034 7014 ARG A CZ  
1870 N  NH1 A ARG A 219 ? 0.4984 0.5883 0.6874 -0.0914 0.0864  -0.1135 7014 ARG A NH1 
1871 N  NH1 B ARG A 219 ? 0.4211 0.4800 0.5588 -0.0584 0.0471  -0.0981 7014 ARG A NH1 
1872 N  NH2 A ARG A 219 ? 0.4873 0.5655 0.6578 -0.0749 0.0638  -0.1082 7014 ARG A NH2 
1873 N  NH2 B ARG A 219 ? 0.4307 0.5101 0.6023 -0.0722 0.0597  -0.1089 7014 ARG A NH2 
1874 N  N   . GLU A 220 ? 0.3923 0.5184 0.6108 -0.0336 0.0303  -0.1281 7015 GLU A N   
1875 C  CA  . GLU A 220 ? 0.3961 0.5257 0.6195 -0.0331 0.0177  -0.1303 7015 GLU A CA  
1876 C  C   . GLU A 220 ? 0.3695 0.4973 0.5863 -0.0201 0.0030  -0.1289 7015 GLU A C   
1877 O  O   . GLU A 220 ? 0.3600 0.4753 0.5584 -0.0139 0.0031  -0.1225 7015 GLU A O   
1878 C  CB  . GLU A 220 ? 0.4302 0.5436 0.6349 -0.0412 0.0190  -0.1244 7015 GLU A CB  
1879 C  CG  . GLU A 220 ? 0.4534 0.5457 0.6276 -0.0374 0.0175  -0.1142 7015 GLU A CG  
1880 C  CD  . GLU A 220 ? 0.4809 0.5595 0.6398 -0.0422 0.0149  -0.1099 7015 GLU A CD  
1881 O  OE1 . GLU A 220 ? 0.5179 0.5801 0.6557 -0.0435 0.0190  -0.1017 7015 GLU A OE1 
1882 O  OE2 . GLU A 220 ? 0.5002 0.5846 0.6687 -0.0441 0.0083  -0.1151 7015 GLU A OE2 
1883 N  N   A GLN A 221 ? 0.3563 0.4957 0.5870 -0.0166 -0.0095 -0.1346 7016 GLN A N   
1884 N  N   B GLN A 221 ? 0.3554 0.4950 0.5864 -0.0164 -0.0095 -0.1347 7016 GLN A N   
1885 C  CA  A GLN A 221 ? 0.3545 0.4921 0.5782 -0.0045 -0.0250 -0.1332 7016 GLN A CA  
1886 C  CA  B GLN A 221 ? 0.3529 0.4901 0.5761 -0.0042 -0.0247 -0.1329 7016 GLN A CA  
1887 C  C   A GLN A 221 ? 0.3478 0.4680 0.5444 -0.0053 -0.0313 -0.1265 7016 GLN A C   
1888 C  C   B GLN A 221 ? 0.3471 0.4676 0.5440 -0.0051 -0.0313 -0.1266 7016 GLN A C   
1889 O  O   A GLN A 221 ? 0.3432 0.4652 0.5423 -0.0118 -0.0338 -0.1297 7016 GLN A O   
1890 O  O   B GLN A 221 ? 0.3441 0.4670 0.5444 -0.0115 -0.0341 -0.1301 7016 GLN A O   
1891 C  CB  A GLN A 221 ? 0.3714 0.5303 0.6225 -0.0005 -0.0363 -0.1427 7016 GLN A CB  
1892 C  CB  B GLN A 221 ? 0.3679 0.5265 0.6189 0.0008  -0.0360 -0.1423 7016 GLN A CB  
1893 C  CG  A GLN A 221 ? 0.3848 0.5428 0.6309 0.0128  -0.0523 -0.1412 7016 GLN A CG  
1894 C  CG  B GLN A 221 ? 0.3722 0.5490 0.6518 0.0028  -0.0291 -0.1494 7016 GLN A CG  
1895 C  CD  A GLN A 221 ? 0.3957 0.5538 0.6460 0.0219  -0.0496 -0.1399 7016 GLN A CD  
1896 C  CD  B GLN A 221 ? 0.3885 0.5572 0.6593 0.0121  -0.0262 -0.1452 7016 GLN A CD  
1897 O  OE1 A GLN A 221 ? 0.4043 0.5721 0.6722 0.0195  -0.0379 -0.1443 7016 GLN A OE1 
1898 O  OE1 B GLN A 221 ? 0.4207 0.5713 0.6655 0.0178  -0.0314 -0.1369 7016 GLN A OE1 
1899 N  NE2 A GLN A 221 ? 0.4127 0.5595 0.6464 0.0324  -0.0602 -0.1342 7016 GLN A NE2 
1900 N  NE2 B GLN A 221 ? 0.3926 0.5749 0.6856 0.0133  -0.0173 -0.1513 7016 GLN A NE2 
1901 N  N   . ILE A 222 ? 0.3295 0.4334 0.5017 0.0004  -0.0329 -0.1182 7017 ILE A N   
1902 C  CA  . ILE A 222 ? 0.3266 0.4147 0.4732 0.0001  -0.0379 -0.1120 7017 ILE A CA  
1903 C  C   . ILE A 222 ? 0.3227 0.4076 0.4588 0.0105  -0.0517 -0.1098 7017 ILE A C   
1904 O  O   . ILE A 222 ? 0.3209 0.4040 0.4559 0.0180  -0.0533 -0.1072 7017 ILE A O   
1905 C  CB  . ILE A 222 ? 0.3114 0.3824 0.4370 -0.0035 -0.0275 -0.1034 7017 ILE A CB  
1906 C  CG1 . ILE A 222 ? 0.3133 0.3845 0.4450 -0.0144 -0.0154 -0.1045 7017 ILE A CG1 
1907 C  CG2 . ILE A 222 ? 0.3149 0.3712 0.4157 -0.0017 -0.0329 -0.0972 7017 ILE A CG2 
1908 C  CD1 . ILE A 222 ? 0.3139 0.3694 0.4265 -0.0177 -0.0061 -0.0962 7017 ILE A CD1 
1909 N  N   . ASP A 223 ? 0.3162 0.3998 0.4445 0.0104  -0.0613 -0.1113 7018 ASP A N   
1910 C  CA  . ASP A 223 ? 0.3251 0.4022 0.4367 0.0189  -0.0744 -0.1079 7018 ASP A CA  
1911 C  C   . ASP A 223 ? 0.3135 0.3712 0.3962 0.0177  -0.0695 -0.0989 7018 ASP A C   
1912 O  O   . ASP A 223 ? 0.2962 0.3487 0.3704 0.0113  -0.0659 -0.0992 7018 ASP A O   
1913 C  CB  . ASP A 223 ? 0.3485 0.4343 0.4652 0.0188  -0.0867 -0.1147 7018 ASP A CB  
1914 C  CG  . ASP A 223 ? 0.3783 0.4558 0.4739 0.0264  -0.1001 -0.1110 7018 ASP A CG  
1915 O  OD1 . ASP A 223 ? 0.3786 0.4399 0.4495 0.0283  -0.0975 -0.1025 7018 ASP A OD1 
1916 O  OD2 . ASP A 223 ? 0.4155 0.5032 0.5195 0.0300  -0.1133 -0.1165 7018 ASP A OD2 
1917 N  N   . GLY A 224 ? 0.3070 0.3547 0.3769 0.0234  -0.0691 -0.0918 7019 GLY A N   
1918 C  CA  . GLY A 224 ? 0.3098 0.3405 0.3548 0.0220  -0.0637 -0.0832 7019 GLY A CA  
1919 C  C   . GLY A 224 ? 0.3157 0.3384 0.3402 0.0220  -0.0697 -0.0811 7019 GLY A C   
1920 O  O   . GLY A 224 ? 0.3122 0.3256 0.3230 0.0175  -0.0627 -0.0774 7019 GLY A O   
1921 N  N   A TYR A 225 ? 0.3298 0.3556 0.3513 0.0274  -0.0823 -0.0833 7020 TYR A N   
1922 N  N   B TYR A 225 ? 0.3300 0.3562 0.3522 0.0272  -0.0823 -0.0836 7020 TYR A N   
1923 C  CA  A TYR A 225 ? 0.3457 0.3636 0.3453 0.0270  -0.0878 -0.0821 7020 TYR A CA  
1924 C  CA  B TYR A 225 ? 0.3466 0.3650 0.3468 0.0272  -0.0883 -0.0824 7020 TYR A CA  
1925 C  C   A TYR A 225 ? 0.3398 0.3618 0.3443 0.0194  -0.0837 -0.0886 7020 TYR A C   
1926 C  C   B TYR A 225 ? 0.3410 0.3631 0.3454 0.0196  -0.0842 -0.0887 7020 TYR A C   
1927 O  O   A TYR A 225 ? 0.3487 0.3611 0.3361 0.0162  -0.0791 -0.0863 7020 TYR A O   
1928 O  O   B TYR A 225 ? 0.3523 0.3648 0.3390 0.0166  -0.0801 -0.0865 7020 TYR A O   
1929 C  CB  A TYR A 225 ? 0.3709 0.3907 0.3649 0.0340  -0.1032 -0.0832 7020 TYR A CB  
1930 C  CB  B TYR A 225 ? 0.3709 0.3925 0.3680 0.0344  -0.1038 -0.0839 7020 TYR A CB  
1931 C  CG  A TYR A 225 ? 0.3865 0.3926 0.3592 0.0403  -0.1072 -0.0740 7020 TYR A CG  
1932 C  CG  B TYR A 225 ? 0.3804 0.3965 0.3743 0.0424  -0.1084 -0.0776 7020 TYR A CG  
1933 C  CD1 A TYR A 225 ? 0.3908 0.3956 0.3709 0.0464  -0.1087 -0.0702 7020 TYR A CD1 
1934 C  CD1 B TYR A 225 ? 0.3787 0.4053 0.3966 0.0468  -0.1100 -0.0807 7020 TYR A CD1 
1935 C  CD2 A TYR A 225 ? 0.4056 0.3992 0.3501 0.0397  -0.1090 -0.0692 7020 TYR A CD2 
1936 C  CD2 B TYR A 225 ? 0.3978 0.3978 0.3653 0.0455  -0.1102 -0.0687 7020 TYR A CD2 
1937 C  CE1 A TYR A 225 ? 0.4067 0.3969 0.3668 0.0516  -0.1124 -0.0614 7020 TYR A CE1 
1938 C  CE1 B TYR A 225 ? 0.3891 0.4093 0.4047 0.0548  -0.1140 -0.0754 7020 TYR A CE1 
1939 C  CE2 A TYR A 225 ? 0.4223 0.4021 0.3462 0.0442  -0.1119 -0.0602 7020 TYR A CE2 
1940 C  CE2 B TYR A 225 ? 0.4084 0.4011 0.3725 0.0527  -0.1144 -0.0626 7020 TYR A CE2 
1941 C  CZ  A TYR A 225 ? 0.4201 0.3975 0.3517 0.0501  -0.1140 -0.0560 7020 TYR A CZ  
1942 C  CZ  B TYR A 225 ? 0.4034 0.4057 0.3917 0.0577  -0.1166 -0.0661 7020 TYR A CZ  
1943 O  OH  A TYR A 225 ? 0.4433 0.4052 0.3542 0.0541  -0.1169 -0.0467 7020 TYR A OH  
1944 O  OH  B TYR A 225 ? 0.4290 0.4228 0.4147 0.0654  -0.1207 -0.0607 7020 TYR A OH  
1945 N  N   . VAL A 226 ? 0.3245 0.3600 0.3527 0.0164  -0.0846 -0.0966 7021 VAL A N   
1946 C  CA  . VAL A 226 ? 0.3174 0.3558 0.3519 0.0085  -0.0808 -0.1032 7021 VAL A CA  
1947 C  C   . VAL A 226 ? 0.2945 0.3245 0.3263 0.0028  -0.0667 -0.0989 7021 VAL A C   
1948 O  O   . VAL A 226 ? 0.2865 0.3091 0.3084 -0.0011 -0.0632 -0.0996 7021 VAL A O   
1949 C  CB  . VAL A 226 ? 0.3175 0.3727 0.3798 0.0057  -0.0844 -0.1125 7021 VAL A CB  
1950 C  CG1 . VAL A 226 ? 0.3221 0.3779 0.3922 -0.0035 -0.0783 -0.1184 7021 VAL A CG1 
1951 C  CG2 . VAL A 226 ? 0.3309 0.3953 0.3965 0.0111  -0.1002 -0.1177 7021 VAL A CG2 
1952 N  N   . MET A 227 ? 0.2776 0.3079 0.3171 0.0028  -0.0592 -0.0946 7022 MET A N   
1953 C  CA  . MET A 227 ? 0.2682 0.2909 0.3054 -0.0028 -0.0469 -0.0905 7022 MET A CA  
1954 C  C   . MET A 227 ? 0.2682 0.2772 0.2824 -0.0013 -0.0445 -0.0835 7022 MET A C   
1955 O  O   . MET A 227 ? 0.2593 0.2621 0.2698 -0.0059 -0.0378 -0.0826 7022 MET A O   
1956 C  CB  . MET A 227 ? 0.2613 0.2869 0.3095 -0.0036 -0.0395 -0.0878 7022 MET A CB  
1957 C  CG  . MET A 227 ? 0.2612 0.2810 0.3100 -0.0107 -0.0284 -0.0852 7022 MET A CG  
1958 S  SD  . MET A 227 ? 0.2718 0.2965 0.3356 -0.0192 -0.0261 -0.0929 7022 MET A SD  
1959 C  CE  . MET A 227 ? 0.2739 0.3160 0.3636 -0.0205 -0.0260 -0.0995 7022 MET A CE  
1960 N  N   . HIS A 228 ? 0.2734 0.2778 0.2733 0.0045  -0.0494 -0.0788 7023 HIS A N   
1961 C  CA  . HIS A 228 ? 0.2737 0.2664 0.2527 0.0049  -0.0461 -0.0727 7023 HIS A CA  
1962 C  C   . HIS A 228 ? 0.2830 0.2738 0.2538 0.0030  -0.0483 -0.0775 7023 HIS A C   
1963 O  O   . HIS A 228 ? 0.2809 0.2647 0.2433 0.0006  -0.0418 -0.0754 7023 HIS A O   
1964 C  CB  . HIS A 228 ? 0.2822 0.2691 0.2470 0.0106  -0.0504 -0.0664 7023 HIS A CB  
1965 C  CG  . HIS A 228 ? 0.2799 0.2562 0.2270 0.0097  -0.0448 -0.0597 7023 HIS A CG  
1966 N  ND1 . HIS A 228 ? 0.2758 0.2487 0.2252 0.0063  -0.0356 -0.0556 7023 HIS A ND1 
1967 C  CD2 . HIS A 228 ? 0.2925 0.2616 0.2200 0.0115  -0.0468 -0.0563 7023 HIS A CD2 
1968 C  CE1 . HIS A 228 ? 0.2824 0.2477 0.2166 0.0061  -0.0325 -0.0505 7023 HIS A CE1 
1969 N  NE2 . HIS A 228 ? 0.2830 0.2458 0.2034 0.0089  -0.0385 -0.0509 7023 HIS A NE2 
1970 N  N   . ALA A 229 ? 0.2875 0.2845 0.2613 0.0043  -0.0574 -0.0842 7024 ALA A N   
1971 C  CA  . ALA A 229 ? 0.2988 0.2937 0.2642 0.0021  -0.0598 -0.0903 7024 ALA A CA  
1972 C  C   . ALA A 229 ? 0.2913 0.2857 0.2685 -0.0040 -0.0520 -0.0942 7024 ALA A C   
1973 O  O   . ALA A 229 ? 0.2987 0.2860 0.2661 -0.0058 -0.0481 -0.0957 7024 ALA A O   
1974 C  CB  . ALA A 229 ? 0.3097 0.3123 0.2778 0.0041  -0.0721 -0.0973 7024 ALA A CB  
1975 N  N   . ASN A 230 ? 0.2783 0.2794 0.2756 -0.0073 -0.0493 -0.0958 7025 ASN A N   
1976 C  CA  . ASN A 230 ? 0.2750 0.2740 0.2837 -0.0139 -0.0418 -0.0985 7025 ASN A CA  
1977 C  C   . ASN A 230 ? 0.2701 0.2586 0.2696 -0.0142 -0.0327 -0.0910 7025 ASN A C   
1978 O  O   . ASN A 230 ? 0.2745 0.2564 0.2731 -0.0173 -0.0284 -0.0929 7025 ASN A O   
1979 C  CB  . ASN A 230 ? 0.2684 0.2763 0.2986 -0.0177 -0.0396 -0.1005 7025 ASN A CB  
1980 C  CG  . ASN A 230 ? 0.2760 0.2964 0.3203 -0.0184 -0.0482 -0.1092 7025 ASN A CG  
1981 O  OD1 . ASN A 230 ? 0.2896 0.3106 0.3281 -0.0176 -0.0559 -0.1150 7025 ASN A OD1 
1982 N  ND2 . ASN A 230 ? 0.2750 0.3060 0.3383 -0.0202 -0.0469 -0.1107 7025 ASN A ND2 
1983 N  N   . TYR A 231 ? 0.2616 0.2486 0.2553 -0.0111 -0.0305 -0.0832 7026 TYR A N   
1984 C  CA  . TYR A 231 ? 0.2638 0.2424 0.2497 -0.0113 -0.0230 -0.0759 7026 TYR A CA  
1985 C  C   . TYR A 231 ? 0.2722 0.2444 0.2437 -0.0096 -0.0225 -0.0763 7026 TYR A C   
1986 O  O   . TYR A 231 ? 0.2767 0.2432 0.2486 -0.0114 -0.0169 -0.0757 7026 TYR A O   
1987 C  CB  . TYR A 231 ? 0.2597 0.2383 0.2418 -0.0085 -0.0219 -0.0686 7026 TYR A CB  
1988 C  CG  . TYR A 231 ? 0.2570 0.2279 0.2291 -0.0083 -0.0163 -0.0616 7026 TYR A CG  
1989 C  CD1 . TYR A 231 ? 0.2494 0.2165 0.2266 -0.0118 -0.0101 -0.0589 7026 TYR A CD1 
1990 C  CD2 . TYR A 231 ? 0.2679 0.2354 0.2255 -0.0050 -0.0176 -0.0579 7026 TYR A CD2 
1991 C  CE1 . TYR A 231 ? 0.2499 0.2115 0.2200 -0.0114 -0.0061 -0.0531 7026 TYR A CE1 
1992 C  CE2 . TYR A 231 ? 0.2668 0.2292 0.2178 -0.0053 -0.0123 -0.0524 7026 TYR A CE2 
1993 C  CZ  . TYR A 231 ? 0.2568 0.2169 0.2149 -0.0083 -0.0070 -0.0502 7026 TYR A CZ  
1994 O  OH  . TYR A 231 ? 0.2598 0.2164 0.2133 -0.0083 -0.0030 -0.0451 7026 TYR A OH  
1995 N  N   A ILE A 232 ? 0.2836 0.2565 0.2426 -0.0059 -0.0281 -0.0773 7027 ILE A N   
1996 N  N   B ILE A 232 ? 0.2857 0.2586 0.2446 -0.0059 -0.0281 -0.0774 7027 ILE A N   
1997 C  CA  A ILE A 232 ? 0.2958 0.2632 0.2392 -0.0045 -0.0267 -0.0783 7027 ILE A CA  
1998 C  CA  B ILE A 232 ? 0.2987 0.2660 0.2422 -0.0046 -0.0264 -0.0782 7027 ILE A CA  
1999 C  C   A ILE A 232 ? 0.3000 0.2658 0.2476 -0.0072 -0.0260 -0.0868 7027 ILE A C   
2000 C  C   B ILE A 232 ? 0.3030 0.2688 0.2503 -0.0071 -0.0261 -0.0869 7027 ILE A C   
2001 O  O   A ILE A 232 ? 0.2990 0.2593 0.2419 -0.0072 -0.0203 -0.0872 7027 ILE A O   
2002 O  O   B ILE A 232 ? 0.3041 0.2644 0.2459 -0.0071 -0.0206 -0.0875 7027 ILE A O   
2003 C  CB  A ILE A 232 ? 0.3107 0.2782 0.2377 -0.0008 -0.0332 -0.0776 7027 ILE A CB  
2004 C  CB  B ILE A 232 ? 0.3146 0.2817 0.2413 -0.0008 -0.0326 -0.0769 7027 ILE A CB  
2005 C  CG1 A ILE A 232 ? 0.3102 0.2765 0.2325 0.0016  -0.0334 -0.0687 7027 ILE A CG1 
2006 C  CG1 B ILE A 232 ? 0.3148 0.2804 0.2371 0.0013  -0.0318 -0.0679 7027 ILE A CG1 
2007 C  CG2 A ILE A 232 ? 0.3255 0.2878 0.2356 -0.0003 -0.0309 -0.0798 7027 ILE A CG2 
2008 C  CG2 B ILE A 232 ? 0.3289 0.2910 0.2389 -0.0003 -0.0304 -0.0794 7027 ILE A CG2 
2009 C  CD1 A ILE A 232 ? 0.3049 0.2663 0.2232 0.0007  -0.0248 -0.0618 7027 ILE A CD1 
2010 C  CD1 B ILE A 232 ? 0.3320 0.2942 0.2356 0.0047  -0.0369 -0.0648 7027 ILE A CD1 
2011 N  N   . PHE A 233 ? 0.3070 0.2777 0.2645 -0.0093 -0.0316 -0.0938 7028 PHE A N   
2012 C  CA  . PHE A 233 ? 0.3164 0.2845 0.2784 -0.0126 -0.0315 -0.1028 7028 PHE A CA  
2013 C  C   . PHE A 233 ? 0.2974 0.2590 0.2688 -0.0154 -0.0230 -0.1006 7028 PHE A C   
2014 O  O   . PHE A 233 ? 0.3030 0.2578 0.2712 -0.0156 -0.0195 -0.1044 7028 PHE A O   
2015 C  CB  . PHE A 233 ? 0.3336 0.3093 0.3077 -0.0155 -0.0389 -0.1103 7028 PHE A CB  
2016 C  CG  . PHE A 233 ? 0.3557 0.3278 0.3360 -0.0200 -0.0387 -0.1197 7028 PHE A CG  
2017 C  CD1 . PHE A 233 ? 0.3864 0.3538 0.3532 -0.0190 -0.0411 -0.1267 7028 PHE A CD1 
2018 C  CD2 . PHE A 233 ? 0.3707 0.3433 0.3696 -0.0257 -0.0359 -0.1218 7028 PHE A CD2 
2019 C  CE1 . PHE A 233 ? 0.4044 0.3672 0.3768 -0.0232 -0.0410 -0.1362 7028 PHE A CE1 
2020 C  CE2 . PHE A 233 ? 0.3819 0.3493 0.3863 -0.0303 -0.0358 -0.1305 7028 PHE A CE2 
2021 C  CZ  . PHE A 233 ? 0.3997 0.3621 0.3913 -0.0289 -0.0385 -0.1379 7028 PHE A CZ  
2022 N  N   . TRP A 234 ? 0.2836 0.2470 0.2664 -0.0174 -0.0200 -0.0948 7029 TRP A N   
2023 C  CA  . TRP A 234 ? 0.2855 0.2416 0.2752 -0.0199 -0.0128 -0.0909 7029 TRP A CA  
2024 C  C   . TRP A 234 ? 0.2818 0.2320 0.2613 -0.0160 -0.0083 -0.0864 7029 TRP A C   
2025 O  O   . TRP A 234 ? 0.2881 0.2312 0.2694 -0.0162 -0.0048 -0.0888 7029 TRP A O   
2026 C  CB  . TRP A 234 ? 0.2776 0.2365 0.2764 -0.0224 -0.0104 -0.0845 7029 TRP A CB  
2027 C  CG  . TRP A 234 ? 0.2810 0.2317 0.2822 -0.0240 -0.0041 -0.0783 7029 TRP A CG  
2028 C  CD1 . TRP A 234 ? 0.2978 0.2397 0.3039 -0.0266 -0.0011 -0.0800 7029 TRP A CD1 
2029 C  CD2 . TRP A 234 ? 0.2768 0.2265 0.2750 -0.0230 -0.0008 -0.0692 7029 TRP A CD2 
2030 N  NE1 . TRP A 234 ? 0.2930 0.2285 0.2989 -0.0267 0.0031  -0.0720 7029 TRP A NE1 
2031 C  CE2 . TRP A 234 ? 0.2819 0.2226 0.2829 -0.0248 0.0033  -0.0656 7029 TRP A CE2 
2032 C  CE3 . TRP A 234 ? 0.2741 0.2287 0.2673 -0.0207 -0.0015 -0.0641 7029 TRP A CE3 
2033 C  CZ2 . TRP A 234 ? 0.2843 0.2219 0.2828 -0.0246 0.0061  -0.0570 7029 TRP A CZ2 
2034 C  CZ3 . TRP A 234 ? 0.2727 0.2239 0.2636 -0.0210 0.0020  -0.0563 7029 TRP A CZ3 
2035 C  CH2 . TRP A 234 ? 0.2752 0.2185 0.2685 -0.0230 0.0055  -0.0528 7029 TRP A CH2 
2036 N  N   . ARG A 235 ? 0.2822 0.2354 0.2525 -0.0127 -0.0082 -0.0803 7030 ARG A N   
2037 C  CA  . ARG A 235 ? 0.2826 0.2323 0.2452 -0.0098 -0.0034 -0.0760 7030 ARG A CA  
2038 C  C   . ARG A 235 ? 0.2968 0.2438 0.2518 -0.0079 -0.0024 -0.0832 7030 ARG A C   
2039 O  O   . ARG A 235 ? 0.2998 0.2427 0.2563 -0.0064 0.0027  -0.0829 7030 ARG A O   
2040 C  CB  . ARG A 235 ? 0.2792 0.2324 0.2324 -0.0075 -0.0039 -0.0693 7030 ARG A CB  
2041 C  CG  . ARG A 235 ? 0.2711 0.2260 0.2301 -0.0089 -0.0040 -0.0624 7030 ARG A CG  
2042 C  CD  . ARG A 235 ? 0.2667 0.2178 0.2345 -0.0109 0.0003  -0.0582 7030 ARG A CD  
2043 N  NE  . ARG A 235 ? 0.2686 0.2166 0.2344 -0.0090 0.0043  -0.0561 7030 ARG A NE  
2044 C  CZ  . ARG A 235 ? 0.2758 0.2251 0.2366 -0.0076 0.0063  -0.0503 7030 ARG A CZ  
2045 N  NH1 . ARG A 235 ? 0.2729 0.2246 0.2286 -0.0078 0.0047  -0.0458 7030 ARG A NH1 
2046 N  NH2 . ARG A 235 ? 0.2926 0.2409 0.2547 -0.0058 0.0099  -0.0496 7030 ARG A NH2 
2047 N  N   . ASN A 236 ? 0.3056 0.2549 0.2524 -0.0077 -0.0074 -0.0897 7031 ASN A N   
2048 C  CA  . ASN A 236 ? 0.3311 0.2774 0.2672 -0.0062 -0.0064 -0.0974 7031 ASN A CA  
2049 C  C   . ASN A 236 ? 0.3386 0.2789 0.2841 -0.0077 -0.0041 -0.1051 7031 ASN A C   
2050 O  O   . ASN A 236 ? 0.3480 0.2842 0.2873 -0.0057 0.0000  -0.1103 7031 ASN A O   
2051 C  CB  . ASN A 236 ? 0.3479 0.2973 0.2716 -0.0060 -0.0138 -0.1027 7031 ASN A CB  
2052 C  CG  . ASN A 236 ? 0.3618 0.3134 0.2696 -0.0035 -0.0151 -0.0964 7031 ASN A CG  
2053 O  OD1 . ASN A 236 ? 0.3874 0.3382 0.2924 -0.0023 -0.0092 -0.0895 7031 ASN A OD1 
2054 N  ND2 . ASN A 236 ? 0.3729 0.3269 0.2706 -0.0029 -0.0233 -0.0987 7031 ASN A ND2 
2055 N  N   . THR A 237 ? 0.3332 0.2721 0.2928 -0.0113 -0.0061 -0.1059 7032 THR A N   
2056 C  CA  . THR A 237 ? 0.3432 0.2743 0.3112 -0.0136 -0.0048 -0.1136 7032 THR A CA  
2057 C  C   . THR A 237 ? 0.3488 0.2730 0.3291 -0.0142 0.0002  -0.1077 7032 THR A C   
2058 O  O   . THR A 237 ? 0.3599 0.2753 0.3473 -0.0157 0.0017  -0.1129 7032 THR A O   
2059 C  CB  . THR A 237 ? 0.3477 0.2813 0.3218 -0.0185 -0.0113 -0.1206 7032 THR A CB  
2060 O  OG1 . THR A 237 ? 0.3275 0.2664 0.3121 -0.0214 -0.0127 -0.1142 7032 THR A OG1 
2061 C  CG2 . THR A 237 ? 0.3629 0.3022 0.3240 -0.0174 -0.0179 -0.1270 7032 THR A CG2 
2062 N  N   . ASN A 238 ? 0.3369 0.2639 0.3186 -0.0130 0.0023  -0.0974 7033 ASN A N   
2063 C  CA  . ASN A 238 ? 0.3519 0.2720 0.3433 -0.0135 0.0059  -0.0908 7033 ASN A CA  
2064 C  C   . ASN A 238 ? 0.3535 0.2754 0.3418 -0.0088 0.0095  -0.0838 7033 ASN A C   
2065 O  O   . ASN A 238 ? 0.3366 0.2631 0.3238 -0.0092 0.0093  -0.0756 7033 ASN A O   
2066 C  CB  . ASN A 238 ? 0.3575 0.2788 0.3559 -0.0183 0.0047  -0.0849 7033 ASN A CB  
2067 C  CG  . ASN A 238 ? 0.3873 0.3071 0.3929 -0.0239 0.0022  -0.0917 7033 ASN A CG  
2068 O  OD1 . ASN A 238 ? 0.4015 0.3282 0.4047 -0.0248 -0.0019 -0.0982 7033 ASN A OD1 
2069 N  ND2 . ASN A 238 ? 0.4030 0.3136 0.4173 -0.0279 0.0044  -0.0900 7033 ASN A ND2 
2070 N  N   . PRO A 239 ? 0.3763 0.2952 0.3639 -0.0046 0.0130  -0.0874 7034 PRO A N   
2071 C  CA  . PRO A 239 ? 0.3834 0.3055 0.3712 -0.0004 0.0165  -0.0815 7034 PRO A CA  
2072 C  C   . PRO A 239 ? 0.3715 0.2896 0.3684 -0.0013 0.0160  -0.0723 7034 PRO A C   
2073 O  O   . PRO A 239 ? 0.3868 0.2957 0.3910 -0.0028 0.0153  -0.0727 7034 PRO A O   
2074 C  CB  . PRO A 239 ? 0.4013 0.3197 0.3913 0.0039  0.0207  -0.0889 7034 PRO A CB  
2075 C  CG  . PRO A 239 ? 0.4207 0.3358 0.4048 0.0020  0.0191  -0.0997 7034 PRO A CG  
2076 C  CD  . PRO A 239 ? 0.4095 0.3227 0.3967 -0.0035 0.0139  -0.0983 7034 PRO A CD  
2077 N  N   . ILE A 240 ? 0.3639 0.2881 0.3590 -0.0008 0.0162  -0.0642 7035 ILE A N   
2078 C  CA  . ILE A 240 ? 0.3610 0.2815 0.3623 -0.0017 0.0150  -0.0552 7035 ILE A CA  
2079 C  C   . ILE A 240 ? 0.3664 0.2890 0.3734 0.0032  0.0170  -0.0524 7035 ILE A C   
2080 O  O   . ILE A 240 ? 0.3746 0.3061 0.3779 0.0051  0.0193  -0.0528 7035 ILE A O   
2081 C  CB  . ILE A 240 ? 0.3516 0.2769 0.3473 -0.0055 0.0130  -0.0488 7035 ILE A CB  
2082 C  CG1 . ILE A 240 ? 0.3538 0.2785 0.3475 -0.0099 0.0112  -0.0526 7035 ILE A CG1 
2083 C  CG2 . ILE A 240 ? 0.3473 0.2691 0.3464 -0.0065 0.0119  -0.0399 7035 ILE A CG2 
2084 C  CD1 . ILE A 240 ? 0.3575 0.2884 0.3461 -0.0125 0.0097  -0.0485 7035 ILE A CD1 
2085 N  N   . GLN A 241 ? 0.3716 0.2861 0.3878 0.0053  0.0161  -0.0499 7036 GLN A N   
2086 C  CA  . GLN A 241 ? 0.3853 0.3023 0.4105 0.0110  0.0169  -0.0475 7036 GLN A CA  
2087 C  C   . GLN A 241 ? 0.3512 0.2759 0.3748 0.0097  0.0150  -0.0387 7036 GLN A C   
2088 O  O   . GLN A 241 ? 0.3496 0.2701 0.3695 0.0058  0.0116  -0.0320 7036 GLN A O   
2089 C  CB  . GLN A 241 ? 0.4313 0.3356 0.4662 0.0137  0.0148  -0.0461 7036 GLN A CB  
2090 C  CG  . GLN A 241 ? 0.4801 0.3870 0.5270 0.0203  0.0140  -0.0430 7036 GLN A CG  
2091 C  CD  . GLN A 241 ? 0.5359 0.4281 0.5915 0.0236  0.0106  -0.0407 7036 GLN A CD  
2092 O  OE1 . GLN A 241 ? 0.6064 0.4858 0.6601 0.0215  0.0106  -0.0439 7036 GLN A OE1 
2093 N  NE2 . GLN A 241 ? 0.5696 0.4632 0.6353 0.0288  0.0073  -0.0350 7036 GLN A NE2 
2094 N  N   . LEU A 242 ? 0.3249 0.2606 0.3506 0.0122  0.0176  -0.0392 7037 LEU A N   
2095 C  CA  . LEU A 242 ? 0.3164 0.2594 0.3421 0.0108  0.0155  -0.0313 7037 LEU A CA  
2096 C  C   . LEU A 242 ? 0.3089 0.2463 0.3432 0.0126  0.0104  -0.0246 7037 LEU A C   
2097 O  O   . LEU A 242 ? 0.3046 0.2383 0.3502 0.0180  0.0102  -0.0268 7037 LEU A O   
2098 C  CB  . LEU A 242 ? 0.3284 0.2838 0.3584 0.0132  0.0200  -0.0338 7037 LEU A CB  
2099 C  CG  . LEU A 242 ? 0.3441 0.3049 0.3617 0.0103  0.0242  -0.0373 7037 LEU A CG  
2100 C  CD1 . LEU A 242 ? 0.3719 0.3426 0.3938 0.0129  0.0307  -0.0418 7037 LEU A CD1 
2101 C  CD2 . LEU A 242 ? 0.3382 0.3010 0.3468 0.0052  0.0214  -0.0306 7037 LEU A CD2 
2102 N  N   . SER A 243 ? 0.2917 0.2275 0.3202 0.0085  0.0062  -0.0170 7038 SER A N   
2103 C  CA  . SER A 243 ? 0.2972 0.2263 0.3308 0.0099  0.0004  -0.0098 7038 SER A CA  
2104 C  C   . SER A 243 ? 0.2843 0.2168 0.3115 0.0058  -0.0037 -0.0022 7038 SER A C   
2105 O  O   . SER A 243 ? 0.2797 0.2126 0.2954 0.0005  -0.0024 -0.0015 7038 SER A O   
2106 C  CB  . SER A 243 ? 0.3091 0.2231 0.3391 0.0083  -0.0010 -0.0088 7038 SER A CB  
2107 O  OG  . SER A 243 ? 0.3288 0.2347 0.3599 0.0089  -0.0071 -0.0006 7038 SER A OG  
2108 N  N   A SER A 244 ? 0.2862 0.2214 0.3217 0.0087  -0.0088 0.0027  7039 SER A N   
2109 N  N   B SER A 244 ? 0.2875 0.2219 0.3229 0.0088  -0.0090 0.0029  7039 SER A N   
2110 C  CA  A SER A 244 ? 0.2850 0.2230 0.3151 0.0051  -0.0141 0.0098  7039 SER A CA  
2111 C  CA  B SER A 244 ? 0.2861 0.2225 0.3160 0.0052  -0.0145 0.0102  7039 SER A CA  
2112 C  C   A SER A 244 ? 0.2921 0.2173 0.3183 0.0049  -0.0211 0.0172  7039 SER A C   
2113 C  C   B SER A 244 ? 0.2967 0.2202 0.3238 0.0056  -0.0215 0.0174  7039 SER A C   
2114 O  O   A SER A 244 ? 0.2932 0.2186 0.3131 0.0019  -0.0266 0.0234  7039 SER A O   
2115 O  O   B SER A 244 ? 0.2979 0.2221 0.3211 0.0037  -0.0277 0.0238  7039 SER A O   
2116 C  CB  A SER A 244 ? 0.2887 0.2408 0.3316 0.0079  -0.0156 0.0098  7039 SER A CB  
2117 C  CB  B SER A 244 ? 0.2850 0.2359 0.3266 0.0075  -0.0160 0.0104  7039 SER A CB  
2118 O  OG  A SER A 244 ? 0.3068 0.2596 0.3660 0.0152  -0.0182 0.0093  7039 SER A OG  
2119 O  OG  B SER A 244 ? 0.2804 0.2417 0.3220 0.0061  -0.0092 0.0048  7039 SER A OG  
2120 N  N   A TYR A 245 ? 0.2978 0.2110 0.3259 0.0075  -0.0208 0.0166  7040 TYR A N   
2121 N  N   B TYR A 245 ? 0.3043 0.2154 0.3321 0.0075  -0.0208 0.0166  7040 TYR A N   
2122 C  CA  A TYR A 245 ? 0.3109 0.2094 0.3355 0.0080  -0.0275 0.0242  7040 TYR A CA  
2123 C  CA  B TYR A 245 ? 0.3204 0.2169 0.3443 0.0079  -0.0275 0.0245  7040 TYR A CA  
2124 C  C   A TYR A 245 ? 0.3166 0.2086 0.3231 0.0005  -0.0303 0.0312  7040 TYR A C   
2125 C  C   B TYR A 245 ? 0.3219 0.2128 0.3280 0.0005  -0.0303 0.0314  7040 TYR A C   
2126 O  O   A TYR A 245 ? 0.3234 0.2110 0.3268 0.0011  -0.0382 0.0388  7040 TYR A O   
2127 O  O   B TYR A 245 ? 0.3274 0.2138 0.3304 0.0010  -0.0382 0.0390  7040 TYR A O   
2128 C  CB  A TYR A 245 ? 0.3199 0.2038 0.3453 0.0093  -0.0250 0.0221  7040 TYR A CB  
2129 C  CB  B TYR A 245 ? 0.3351 0.2164 0.3582 0.0083  -0.0249 0.0227  7040 TYR A CB  
2130 C  CG  A TYR A 245 ? 0.3164 0.2026 0.3580 0.0168  -0.0223 0.0148  7040 TYR A CG  
2131 C  CG  B TYR A 245 ? 0.3546 0.2183 0.3680 0.0060  -0.0305 0.0318  7040 TYR A CG  
2132 C  CD1 A TYR A 245 ? 0.3100 0.2095 0.3671 0.0234  -0.0233 0.0121  7040 TYR A CD1 
2133 C  CD1 B TYR A 245 ? 0.3720 0.2282 0.3928 0.0123  -0.0384 0.0376  7040 TYR A CD1 
2134 C  CD2 A TYR A 245 ? 0.3260 0.1997 0.3683 0.0172  -0.0190 0.0106  7040 TYR A CD2 
2135 C  CD2 B TYR A 245 ? 0.3621 0.2169 0.3587 -0.0023 -0.0280 0.0351  7040 TYR A CD2 
2136 C  CE1 A TYR A 245 ? 0.3123 0.2137 0.3840 0.0305  -0.0198 0.0045  7040 TYR A CE1 
2137 C  CE1 B TYR A 245 ? 0.3911 0.2294 0.4005 0.0100  -0.0441 0.0471  7040 TYR A CE1 
2138 C  CE2 A TYR A 245 ? 0.3259 0.2000 0.3822 0.0242  -0.0164 0.0032  7040 TYR A CE2 
2139 C  CE2 B TYR A 245 ? 0.3844 0.2223 0.3697 -0.0054 -0.0323 0.0439  7040 TYR A CE2 
2140 C  CZ  A TYR A 245 ? 0.3233 0.2114 0.3940 0.0311  -0.0164 0.0000  7040 TYR A CZ  
2141 C  CZ  B TYR A 245 ? 0.4006 0.2292 0.3910 0.0006  -0.0406 0.0504  7040 TYR A CZ  
2142 O  OH  A TYR A 245 ? 0.3302 0.2190 0.4145 0.0381  -0.0129 -0.0082 7040 TYR A OH  
2143 O  OH  B TYR A 245 ? 0.4325 0.2424 0.4094 -0.0024 -0.0453 0.0601  7040 TYR A OH  
2144 N  N   . SER A 246 ? 0.3121 0.2032 0.3069 -0.0058 -0.0243 0.0285  7041 SER A N   
2145 C  CA  . SER A 246 ? 0.3232 0.2079 0.3005 -0.0130 -0.0252 0.0339  7041 SER A CA  
2146 C  C   . SER A 246 ? 0.3298 0.2222 0.3026 -0.0144 -0.0304 0.0376  7041 SER A C   
2147 O  O   . SER A 246 ? 0.3413 0.2264 0.2992 -0.0194 -0.0332 0.0431  7041 SER A O   
2148 C  CB  . SER A 246 ? 0.3159 0.2011 0.2858 -0.0185 -0.0175 0.0288  7041 SER A CB  
2149 O  OG  . SER A 246 ? 0.2947 0.1931 0.2659 -0.0188 -0.0147 0.0240  7041 SER A OG  
2150 N  N   . LEU A 247 ? 0.3222 0.2285 0.3070 -0.0107 -0.0313 0.0344  7042 LEU A N   
2151 C  CA  . LEU A 247 ? 0.3298 0.2445 0.3120 -0.0129 -0.0360 0.0370  7042 LEU A CA  
2152 C  C   . LEU A 247 ? 0.3497 0.2602 0.3323 -0.0109 -0.0464 0.0445  7042 LEU A C   
2153 O  O   . LEU A 247 ? 0.3644 0.2775 0.3393 -0.0145 -0.0516 0.0477  7042 LEU A O   
2154 C  CB  . LEU A 247 ? 0.3150 0.2457 0.3115 -0.0100 -0.0334 0.0316  7042 LEU A CB  
2155 C  CG  . LEU A 247 ? 0.3139 0.2493 0.3102 -0.0110 -0.0244 0.0244  7042 LEU A CG  
2156 C  CD1 . LEU A 247 ? 0.3106 0.2605 0.3188 -0.0090 -0.0223 0.0207  7042 LEU A CD1 
2157 C  CD2 . LEU A 247 ? 0.3198 0.2511 0.3000 -0.0174 -0.0213 0.0240  7042 LEU A CD2 
2158 N  N   . PHE A 248 ? 0.3516 0.2551 0.3425 -0.0053 -0.0501 0.0472  7043 PHE A N   
2159 C  CA  . PHE A 248 ? 0.3696 0.2691 0.3634 -0.0016 -0.0616 0.0547  7043 PHE A CA  
2160 C  C   . PHE A 248 ? 0.4078 0.2897 0.3795 -0.0066 -0.0662 0.0630  7043 PHE A C   
2161 O  O   . PHE A 248 ? 0.4689 0.3470 0.4388 -0.0045 -0.0771 0.0701  7043 PHE A O   
2162 C  CB  . PHE A 248 ? 0.3651 0.2647 0.3789 0.0076  -0.0634 0.0535  7043 PHE A CB  
2163 C  CG  . PHE A 248 ? 0.3458 0.2647 0.3815 0.0126  -0.0607 0.0464  7043 PHE A CG  
2164 C  CD1 . PHE A 248 ? 0.3309 0.2564 0.3716 0.0124  -0.0499 0.0379  7043 PHE A CD1 
2165 C  CD2 . PHE A 248 ? 0.3450 0.2760 0.3958 0.0169  -0.0688 0.0483  7043 PHE A CD2 
2166 C  CE1 . PHE A 248 ? 0.3220 0.2647 0.3804 0.0161  -0.0463 0.0317  7043 PHE A CE1 
2167 C  CE2 . PHE A 248 ? 0.3318 0.2816 0.4034 0.0205  -0.0649 0.0416  7043 PHE A CE2 
2168 C  CZ  . PHE A 248 ? 0.3191 0.2741 0.3934 0.0199  -0.0531 0.0335  7043 PHE A CZ  
2169 N  N   . ASP A 249 ? 0.4141 0.2859 0.3700 -0.0129 -0.0586 0.0623  7044 ASP A N   
2170 C  CA  . ASP A 249 ? 0.4438 0.2990 0.3768 -0.0189 -0.0614 0.0701  7044 ASP A CA  
2171 C  C   . ASP A 249 ? 0.4241 0.2819 0.3407 -0.0273 -0.0552 0.0673  7044 ASP A C   
2172 O  O   . ASP A 249 ? 0.4210 0.2777 0.3352 -0.0307 -0.0451 0.0623  7044 ASP A O   
2173 C  CB  . ASP A 249 ? 0.4795 0.3173 0.4079 -0.0194 -0.0580 0.0730  7044 ASP A CB  
2174 C  CG  . ASP A 249 ? 0.5274 0.3472 0.4312 -0.0259 -0.0606 0.0819  7044 ASP A CG  
2175 O  OD1 . ASP A 249 ? 0.5272 0.3482 0.4164 -0.0299 -0.0653 0.0855  7044 ASP A OD1 
2176 O  OD2 . ASP A 249 ? 0.6140 0.4179 0.5125 -0.0275 -0.0579 0.0854  7044 ASP A OD2 
2177 N  N   . MET A 250 ? 0.4168 0.2779 0.3235 -0.0301 -0.0614 0.0700  7045 MET A N   
2178 C  CA  . MET A 250 ? 0.4148 0.2780 0.3059 -0.0376 -0.0562 0.0668  7045 MET A CA  
2179 C  C   . MET A 250 ? 0.4394 0.2872 0.3045 -0.0441 -0.0584 0.0735  7045 MET A C   
2180 O  O   . MET A 250 ? 0.4396 0.2880 0.2900 -0.0502 -0.0552 0.0712  7045 MET A O   
2181 C  CB  . MET A 250 ? 0.4038 0.2813 0.3015 -0.0371 -0.0610 0.0639  7045 MET A CB  
2182 C  CG  . MET A 250 ? 0.3841 0.2765 0.3045 -0.0322 -0.0570 0.0571  7045 MET A CG  
2183 S  SD  . MET A 250 ? 0.3641 0.2592 0.2836 -0.0349 -0.0432 0.0488  7045 MET A SD  
2184 C  CE  . MET A 250 ? 0.3600 0.2577 0.2648 -0.0416 -0.0426 0.0465  7045 MET A CE  
2185 N  N   . SER A 251 ? 0.4712 0.3046 0.3301 -0.0430 -0.0630 0.0814  7046 SER A N   
2186 C  CA  . SER A 251 ? 0.5045 0.3213 0.3358 -0.0496 -0.0656 0.0892  7046 SER A CA  
2187 C  C   . SER A 251 ? 0.5220 0.3339 0.3375 -0.0581 -0.0524 0.0853  7046 SER A C   
2188 O  O   . SER A 251 ? 0.5660 0.3702 0.3576 -0.0648 -0.0526 0.0882  7046 SER A O   
2189 C  CB  . SER A 251 ? 0.5282 0.3287 0.3560 -0.0467 -0.0723 0.0988  7046 SER A CB  
2190 O  OG  . SER A 251 ? 0.5221 0.3166 0.3586 -0.0461 -0.0635 0.0969  7046 SER A OG  
2191 N  N   . LYS A 252 ? 0.5006 0.3168 0.3286 -0.0579 -0.0416 0.0788  7047 LYS A N   
2192 C  CA  . LYS A 252 ? 0.5253 0.3388 0.3420 -0.0655 -0.0289 0.0745  7047 LYS A CA  
2193 C  C   . LYS A 252 ? 0.4793 0.3093 0.3081 -0.0646 -0.0222 0.0639  7047 LYS A C   
2194 O  O   . LYS A 252 ? 0.4840 0.3160 0.3146 -0.0679 -0.0116 0.0583  7047 LYS A O   
2195 C  CB  . LYS A 252 ? 0.5671 0.3707 0.3873 -0.0671 -0.0223 0.0760  7047 LYS A CB  
2196 C  CG  . LYS A 252 ? 0.6341 0.4182 0.4406 -0.0685 -0.0283 0.0872  7047 LYS A CG  
2197 C  CD  . LYS A 252 ? 0.6888 0.4618 0.4990 -0.0711 -0.0212 0.0884  7047 LYS A CD  
2198 C  CE  . LYS A 252 ? 0.7541 0.5050 0.5488 -0.0729 -0.0272 0.1005  7047 LYS A CE  
2199 N  NZ  . LYS A 252 ? 0.8073 0.5462 0.6053 -0.0768 -0.0193 0.1013  7047 LYS A NZ  
2200 N  N   . PHE A 253 ? 0.4494 0.2902 0.2853 -0.0608 -0.0283 0.0615  7048 PHE A N   
2201 C  CA  . PHE A 253 ? 0.4132 0.2681 0.2611 -0.0593 -0.0228 0.0524  7048 PHE A CA  
2202 C  C   . PHE A 253 ? 0.4246 0.2794 0.2583 -0.0653 -0.0156 0.0477  7048 PHE A C   
2203 O  O   . PHE A 253 ? 0.3974 0.2582 0.2383 -0.0655 -0.0071 0.0408  7048 PHE A O   
2204 C  CB  . PHE A 253 ? 0.3899 0.2558 0.2498 -0.0544 -0.0307 0.0514  7048 PHE A CB  
2205 C  CG  . PHE A 253 ? 0.3588 0.2367 0.2290 -0.0531 -0.0255 0.0433  7048 PHE A CG  
2206 C  CD1 . PHE A 253 ? 0.3433 0.2273 0.2288 -0.0494 -0.0199 0.0385  7048 PHE A CD1 
2207 C  CD2 . PHE A 253 ? 0.3543 0.2361 0.2179 -0.0558 -0.0267 0.0406  7048 PHE A CD2 
2208 C  CE1 . PHE A 253 ? 0.3230 0.2165 0.2160 -0.0481 -0.0158 0.0320  7048 PHE A CE1 
2209 C  CE2 . PHE A 253 ? 0.3413 0.2318 0.2134 -0.0545 -0.0222 0.0339  7048 PHE A CE2 
2210 C  CZ  . PHE A 253 ? 0.3222 0.2184 0.2085 -0.0505 -0.0170 0.0301  7048 PHE A CZ  
2211 N  N   . PRO A 254 ? 0.3266 0.3026 0.3149 0.0064  0.0043  0.0095  7049 PRO A N   
2212 C  CA  . PRO A 254 ? 0.3359 0.3112 0.3086 -0.0014 0.0048  0.0113  7049 PRO A CA  
2213 C  C   . PRO A 254 ? 0.3458 0.3077 0.3142 -0.0047 0.0074  0.0104  7049 PRO A C   
2214 O  O   . PRO A 254 ? 0.3626 0.3148 0.3427 -0.0024 0.0083  0.0158  7049 PRO A O   
2215 C  CB  . PRO A 254 ? 0.3554 0.3403 0.3237 -0.0007 -0.0008 0.0189  7049 PRO A CB  
2216 C  CG  . PRO A 254 ? 0.3585 0.3530 0.3403 0.0063  -0.0042 0.0211  7049 PRO A CG  
2217 C  CD  . PRO A 254 ? 0.3489 0.3320 0.3440 0.0109  -0.0001 0.0187  7049 PRO A CD  
2218 N  N   . LEU A 255 ? 0.3339 0.2962 0.2922 -0.0094 0.0097  0.0052  7050 LEU A N   
2219 C  CA  . LEU A 255 ? 0.3472 0.3000 0.3027 -0.0130 0.0117  0.0029  7050 LEU A CA  
2220 C  C   . LEU A 255 ? 0.3866 0.3365 0.3363 -0.0160 0.0121  0.0139  7050 LEU A C   
2221 O  O   . LEU A 255 ? 0.3861 0.3460 0.3246 -0.0175 0.0097  0.0150  7050 LEU A O   
2222 C  CB  . LEU A 255 ? 0.3309 0.2885 0.2766 -0.0154 0.0141  -0.0019 7050 LEU A CB  
2223 C  CG  . LEU A 255 ? 0.3326 0.2838 0.2759 -0.0185 0.0153  -0.0059 7050 LEU A CG  
2224 C  CD1 . LEU A 255 ? 0.3525 0.3015 0.3109 -0.0140 0.0133  -0.0172 7050 LEU A CD1 
2225 C  CD2 . LEU A 255 ? 0.3315 0.2894 0.2668 -0.0186 0.0181  -0.0065 7050 LEU A CD2 
2226 N  N   . LYS A 256 ? 0.4276 0.3682 0.3893 -0.0153 0.0157  0.0208  7051 LYS A N   
2227 C  CA  . LYS A 256 ? 0.4814 0.4261 0.4355 -0.0138 0.0195  0.0372  7051 LYS A CA  
2228 C  C   . LYS A 256 ? 0.4615 0.4099 0.3993 -0.0191 0.0210  0.0321  7051 LYS A C   
2229 O  O   . LYS A 256 ? 0.4331 0.3726 0.3775 -0.0242 0.0228  0.0229  7051 LYS A O   
2230 C  CB  . LYS A 256 ? 0.5454 0.4795 0.5272 -0.0105 0.0272  0.0526  7051 LYS A CB  
2231 C  CG  . LYS A 256 ? 0.6114 0.5432 0.6130 -0.0031 0.0263  0.0609  7051 LYS A CG  
2232 C  CD  . LYS A 256 ? 0.6709 0.5919 0.7105 0.0014  0.0366  0.0822  7051 LYS A CD  
2233 C  CE  . LYS A 256 ? 0.7121 0.6315 0.7733 0.0104  0.0359  0.0927  7051 LYS A CE  
2234 N  NZ  . LYS A 256 ? 0.7324 0.6461 0.8053 0.0084  0.0274  0.0651  7051 LYS A NZ  
2235 N  N   . LEU A 257 ? 0.4963 0.4613 0.4151 -0.0161 0.0188  0.0346  7052 LEU A N   
2236 C  CA  . LEU A 257 ? 0.5137 0.4854 0.4197 -0.0193 0.0201  0.0274  7052 LEU A CA  
2237 C  C   . LEU A 257 ? 0.5416 0.5112 0.4510 -0.0172 0.0303  0.0429  7052 LEU A C   
2238 O  O   . LEU A 257 ? 0.5819 0.5654 0.4858 -0.0074 0.0350  0.0617  7052 LEU A O   
2239 C  CB  . LEU A 257 ? 0.5352 0.5316 0.4261 -0.0137 0.0127  0.0193  7052 LEU A CB  
2240 C  CG  . LEU A 257 ? 0.5561 0.5647 0.4376 -0.0144 0.0124  0.0063  7052 LEU A CG  
2241 C  CD1 . LEU A 257 ? 0.5368 0.5270 0.4313 -0.0253 0.0138  -0.0059 7052 LEU A CD1 
2242 C  CD2 . LEU A 257 ? 0.5841 0.6224 0.4592 -0.0072 0.0016  -0.0104 7052 LEU A CD2 
2243 N  N   A ARG A 258 ? 0.5293 0.4854 0.4502 -0.0244 0.0346  0.0373  7053 ARG A N   
2244 N  N   B ARG A 258 ? 0.5232 0.4792 0.4441 -0.0244 0.0345  0.0372  7053 ARG A N   
2245 C  CA  A ARG A 258 ? 0.5436 0.4966 0.4793 -0.0240 0.0461  0.0518  7053 ARG A CA  
2246 C  CA  B ARG A 258 ? 0.5331 0.4857 0.4690 -0.0243 0.0459  0.0511  7053 ARG A CA  
2247 C  C   A ARG A 258 ? 0.5379 0.5064 0.4548 -0.0224 0.0504  0.0511  7053 ARG A C   
2248 C  C   B ARG A 258 ? 0.5320 0.5008 0.4486 -0.0222 0.0503  0.0512  7053 ARG A C   
2249 O  O   A ARG A 258 ? 0.5436 0.5172 0.4695 -0.0192 0.0626  0.0683  7053 ARG A O   
2250 O  O   B ARG A 258 ? 0.5380 0.5128 0.4627 -0.0184 0.0626  0.0693  7053 ARG A O   
2251 C  CB  A ARG A 258 ? 0.5411 0.4757 0.5075 -0.0315 0.0467  0.0418  7053 ARG A CB  
2252 C  CB  B ARG A 258 ? 0.5224 0.4573 0.4864 -0.0321 0.0460  0.0394  7053 ARG A CB  
2253 C  CG  A ARG A 258 ? 0.5489 0.4734 0.5337 -0.0309 0.0407  0.0343  7053 ARG A CG  
2254 C  CG  B ARG A 258 ? 0.5264 0.4505 0.5123 -0.0317 0.0409  0.0327  7053 ARG A CG  
2255 C  CD  A ARG A 258 ? 0.5630 0.4760 0.5902 -0.0340 0.0418  0.0243  7053 ARG A CD  
2256 C  CD  B ARG A 258 ? 0.5545 0.4748 0.5642 -0.0265 0.0480  0.0535  7053 ARG A CD  
2257 N  NE  A ARG A 258 ? 0.5724 0.4871 0.6024 -0.0381 0.0381  0.0053  7053 ARG A NE  
2258 N  NE  B ARG A 258 ? 0.5556 0.4663 0.5902 -0.0253 0.0424  0.0432  7053 ARG A NE  
2259 C  CZ  A ARG A 258 ? 0.5775 0.4899 0.6437 -0.0391 0.0345  -0.0132 7053 ARG A CZ  
2260 C  CZ  B ARG A 258 ? 0.5809 0.4847 0.6472 -0.0207 0.0477  0.0579  7053 ARG A CZ  
2261 N  NH1 A ARG A 258 ? 0.5668 0.4866 0.6319 -0.0401 0.0297  -0.0301 7053 ARG A NH1 
2262 N  NH1 B ARG A 258 ? 0.5889 0.4856 0.6796 -0.0190 0.0414  0.0425  7053 ARG A NH1 
2263 N  NH2 A ARG A 258 ? 0.5948 0.4998 0.7025 -0.0376 0.0345  -0.0175 7053 ARG A NH2 
2264 N  NH2 B ARG A 258 ? 0.6075 0.5143 0.6825 -0.0155 0.0602  0.0892  7053 ARG A NH2 
2265 N  N   . GLY A 259 ? 0.5105 0.4873 0.4087 -0.0238 0.0420  0.0322  7054 GLY A N   
2266 C  CA  . GLY A 259 ? 0.5172 0.5104 0.4015 -0.0213 0.0446  0.0250  7054 GLY A CA  
2267 C  C   . GLY A 259 ? 0.5090 0.4901 0.4086 -0.0279 0.0521  0.0248  7054 GLY A C   
2268 O  O   . GLY A 259 ? 0.4948 0.4901 0.3893 -0.0236 0.0608  0.0305  7054 GLY A O   
2269 N  N   . THR A 260 ? 0.4494 0.4102 0.3674 -0.0357 0.0488  0.0180  7055 THR A N   
2270 C  CA  . THR A 260 ? 0.4415 0.3937 0.3786 -0.0410 0.0526  0.0134  7055 THR A CA  
2271 C  C   . THR A 260 ? 0.4610 0.4223 0.3883 -0.0410 0.0544  0.0044  7055 THR A C   
2272 O  O   . THR A 260 ? 0.4485 0.4129 0.3642 -0.0405 0.0477  -0.0079 7055 THR A O   
2273 C  CB  . THR A 260 ? 0.4150 0.3556 0.3637 -0.0442 0.0441  0.0006  7055 THR A CB  
2274 O  OG1 . THR A 260 ? 0.3971 0.3320 0.3554 -0.0428 0.0418  0.0049  7055 THR A OG1 
2275 C  CG2 . THR A 260 ? 0.4086 0.3470 0.3791 -0.0469 0.0449  -0.0074 7055 THR A CG2 
2276 N  N   . ALA A 261 ? 0.4633 0.4283 0.4030 -0.0416 0.0637  0.0098  7056 ALA A N   
2277 C  CA  . ALA A 261 ? 0.4709 0.4464 0.4043 -0.0404 0.0668  0.0007  7056 ALA A CA  
2278 C  C   . ALA A 261 ? 0.4631 0.4285 0.4022 -0.0443 0.0581  -0.0160 7056 ALA A C   
2279 O  O   . ALA A 261 ? 0.4245 0.3797 0.3779 -0.0470 0.0535  -0.0181 7056 ALA A O   
2280 C  CB  . ALA A 261 ? 0.4923 0.4742 0.4441 -0.0405 0.0801  0.0121  7056 ALA A CB  
2281 N  N   . VAL A 262 ? 0.4543 0.4264 0.3857 -0.0421 0.0559  -0.0281 7057 VAL A N   
2282 C  CA  . VAL A 262 ? 0.4683 0.4324 0.4116 -0.0434 0.0512  -0.0388 7057 VAL A CA  
2283 C  C   . VAL A 262 ? 0.4992 0.4716 0.4500 -0.0418 0.0570  -0.0460 7057 VAL A C   
2284 O  O   . VAL A 262 ? 0.5005 0.4880 0.4423 -0.0378 0.0603  -0.0533 7057 VAL A O   
2285 C  CB  . VAL A 262 ? 0.4721 0.4340 0.4169 -0.0428 0.0453  -0.0473 7057 VAL A CB  
2286 C  CG1 . VAL A 262 ? 0.4713 0.4255 0.4373 -0.0423 0.0448  -0.0515 7057 VAL A CG1 
2287 C  CG2 . VAL A 262 ? 0.4742 0.4304 0.4129 -0.0438 0.0408  -0.0397 7057 VAL A CG2 
2288 N  N   . MET A 263 ? 0.5121 0.4798 0.4782 -0.0427 0.0574  -0.0457 7058 MET A N   
2289 C  CA  . MET A 263 ? 0.5673 0.5431 0.5444 -0.0409 0.0630  -0.0526 7058 MET A CA  
2290 C  C   . MET A 263 ? 0.5694 0.5385 0.5630 -0.0383 0.0584  -0.0572 7058 MET A C   
2291 O  O   . MET A 263 ? 0.5220 0.4851 0.5175 -0.0368 0.0526  -0.0507 7058 MET A O   
2292 C  CB  . MET A 263 ? 0.5807 0.5625 0.5694 -0.0430 0.0700  -0.0453 7058 MET A CB  
2293 C  CG  . MET A 263 ? 0.6316 0.6210 0.6125 -0.0433 0.0790  -0.0323 7058 MET A CG  
2294 S  SD  . MET A 263 ? 0.6836 0.6779 0.6981 -0.0470 0.0908  -0.0208 7058 MET A SD  
2295 C  CE  . MET A 263 ? 0.7024 0.7057 0.7085 -0.0437 0.1045  0.0037  7058 MET A CE  
2296 N  N   . SER A 264 ? 0.5878 0.5615 0.5935 -0.0355 0.0618  -0.0671 7059 SER A N   
2297 C  CA  . SER A 264 ? 0.6518 0.6202 0.6794 -0.0308 0.0598  -0.0676 7059 SER A CA  
2298 C  C   . SER A 264 ? 0.6915 0.6691 0.7303 -0.0286 0.0624  -0.0687 7059 SER A C   
2299 O  O   . SER A 264 ? 0.7670 0.7512 0.8171 -0.0268 0.0678  -0.0787 7059 SER A O   
2300 C  CB  . SER A 264 ? 0.6831 0.6482 0.7289 -0.0288 0.0612  -0.0800 7059 SER A CB  
2301 O  OG  . SER A 264 ? 0.7446 0.7032 0.8183 -0.0230 0.0618  -0.0748 7059 SER A OG  
2302 N  N   . LEU A 265 ? 0.7023 0.6837 0.7418 -0.0280 0.0577  -0.0622 7060 LEU A N   
2303 C  CA  . LEU A 265 ? 0.7393 0.7330 0.7970 -0.0262 0.0580  -0.0662 7060 LEU A CA  
2304 C  C   . LEU A 265 ? 0.8036 0.8032 0.8731 -0.0150 0.0508  -0.0637 7060 LEU A C   
2305 O  O   . LEU A 265 ? 0.8207 0.8176 0.8810 -0.0086 0.0456  -0.0543 7060 LEU A O   
2306 C  CB  . LEU A 265 ? 0.7205 0.7192 0.7823 -0.0313 0.0558  -0.0661 7060 LEU A CB  
2307 C  CG  . LEU A 265 ? 0.7207 0.7156 0.7744 -0.0395 0.0653  -0.0606 7060 LEU A CG  
2308 C  CD1 . LEU A 265 ? 0.7224 0.7185 0.7937 -0.0442 0.0634  -0.0593 7060 LEU A CD1 
2309 C  CD2 . LEU A 265 ? 0.7326 0.7372 0.7919 -0.0403 0.0788  -0.0605 7060 LEU A CD2 
2310 N  N   . LYS A 266 ? 0.8763 0.8872 0.9662 -0.0109 0.0517  -0.0694 7061 LYS A N   
2311 C  CA  . LYS A 266 ? 0.9425 0.9653 1.0444 0.0035  0.0446  -0.0647 7061 LYS A CA  
2312 C  C   . LYS A 266 ? 0.9765 1.0203 1.0795 0.0090  0.0325  -0.0705 7061 LYS A C   
2313 O  O   . LYS A 266 ? 0.9790 1.0234 1.0861 -0.0013 0.0320  -0.0803 7061 LYS A O   
2314 C  CB  . LYS A 266 ? 0.9841 1.0130 1.1105 0.0074  0.0494  -0.0702 7061 LYS A CB  
2315 C  CG  . LYS A 266 ? 1.0121 1.0265 1.1451 0.0029  0.0603  -0.0745 7061 LYS A CG  
2316 C  CD  . LYS A 266 ? 1.0359 1.0557 1.1975 0.0116  0.0635  -0.0779 7061 LYS A CD  
2317 C  CE  . LYS A 266 ? 1.0556 1.0692 1.2281 0.0074  0.0735  -0.0928 7061 LYS A CE  
2318 N  NZ  . LYS A 266 ? 1.0645 1.0916 1.2291 0.0000  0.0806  -0.1041 7061 LYS A NZ  
2319 N  N   . GLU A 267 ? 1.0164 1.0802 1.1201 0.0269  0.0232  -0.0651 7062 GLU A N   
2320 C  CA  . GLU A 267 ? 1.0470 1.1410 1.1519 0.0373  0.0078  -0.0775 7062 GLU A CA  
2321 C  C   . GLU A 267 ? 1.0141 1.1207 1.1517 0.0294  0.0041  -0.1002 7062 GLU A C   
2322 O  O   . GLU A 267 ? 1.0171 1.1391 1.1671 0.0282  -0.0063 -0.1188 7062 GLU A O   
2323 C  CB  . GLU A 267 ? 1.1083 1.2310 1.2062 0.0635  -0.0003 -0.0655 7062 GLU A CB  
2324 C  CG  . GLU A 267 ? 1.1592 1.2721 1.2348 0.0728  0.0068  -0.0375 7062 GLU A CG  
2325 C  CD  . GLU A 267 ? 1.2175 1.3641 1.2859 0.1030  0.0025  -0.0168 7062 GLU A CD  
2326 O  OE1 . GLU A 267 ? 1.2486 1.4282 1.3267 0.1183  -0.0082 -0.0264 7062 GLU A OE1 
2327 O  OE2 . GLU A 267 ? 1.2510 1.3942 1.3063 0.1128  0.0107  0.0104  7062 GLU A OE2 
2328 N  N   . GLY A 268 ? 0.9702 1.0714 1.1274 0.0245  0.0131  -0.1001 7063 GLY A N   
2329 C  CA  . GLY A 268 ? 0.9359 1.0506 1.1315 0.0171  0.0131  -0.1182 7063 GLY A CA  
2330 C  C   . GLY A 268 ? 0.8995 0.9973 1.1073 -0.0028 0.0249  -0.1209 7063 GLY A C   
2331 O  O   . GLY A 268 ? 0.9133 1.0227 1.1623 -0.0098 0.0272  -0.1331 7063 GLY A O   
2332 N  N   . GLN A 269 ? 0.8519 0.9260 1.0302 -0.0105 0.0330  -0.1080 7064 GLN A N   
2333 C  CA  . GLN A 269 ? 0.8209 0.8815 1.0069 -0.0260 0.0462  -0.1037 7064 GLN A CA  
2334 C  C   . GLN A 269 ? 0.7796 0.8371 0.9664 -0.0292 0.0381  -0.1082 7064 GLN A C   
2335 O  O   . GLN A 269 ? 0.7770 0.8237 0.9751 -0.0403 0.0489  -0.1015 7064 GLN A O   
2336 C  CB  . GLN A 269 ? 0.8504 0.8929 1.0047 -0.0298 0.0601  -0.0891 7064 GLN A CB  
2337 C  CG  . GLN A 269 ? 0.8774 0.9238 1.0339 -0.0253 0.0676  -0.0898 7064 GLN A CG  
2338 C  CD  . GLN A 269 ? 0.9104 0.9457 1.0405 -0.0269 0.0781  -0.0844 7064 GLN A CD  
2339 O  OE1 . GLN A 269 ? 0.9480 0.9788 1.0624 -0.0326 0.0851  -0.0777 7064 GLN A OE1 
2340 N  NE2 . GLN A 269 ? 0.9564 0.9904 1.0861 -0.0201 0.0787  -0.0891 7064 GLN A NE2 
2341 N  N   A ILE A 270 ? 0.7561 0.8262 0.9324 -0.0175 0.0206  -0.1180 7065 ILE A N   
2342 N  N   B ILE A 270 ? 0.7497 0.8200 0.9261 -0.0175 0.0206  -0.1180 7065 ILE A N   
2343 C  CA  A ILE A 270 ? 0.7394 0.8113 0.9172 -0.0177 0.0109  -0.1276 7065 ILE A CA  
2344 C  CA  B ILE A 270 ? 0.7293 0.8015 0.9072 -0.0175 0.0107  -0.1278 7065 ILE A CA  
2345 C  C   A ILE A 270 ? 0.7129 0.8044 0.9477 -0.0202 0.0023  -0.1537 7065 ILE A C   
2346 C  C   B ILE A 270 ? 0.7073 0.7990 0.9425 -0.0201 0.0022  -0.1539 7065 ILE A C   
2347 O  O   A ILE A 270 ? 0.7435 0.8652 0.9879 -0.0058 -0.0167 -0.1763 7065 ILE A O   
2348 O  O   B ILE A 270 ? 0.7388 0.8608 0.9839 -0.0058 -0.0166 -0.1765 7065 ILE A O   
2349 C  CB  A ILE A 270 ? 0.7527 0.8369 0.8936 -0.0006 -0.0024 -0.1268 7065 ILE A CB  
2350 C  CB  B ILE A 270 ? 0.7345 0.8198 0.8761 -0.0002 -0.0028 -0.1274 7065 ILE A CB  
2351 C  CG1 A ILE A 270 ? 0.7551 0.8198 0.8566 0.0009  0.0075  -0.1015 7065 ILE A CG1 
2352 C  CG1 B ILE A 270 ? 0.7299 0.7962 0.8319 0.0018  0.0068  -0.1020 7065 ILE A CG1 
2353 C  CG2 A ILE A 270 ? 0.7581 0.8471 0.8989 0.0008  -0.0120 -0.1393 7065 ILE A CG2 
2354 C  CG2 B ILE A 270 ? 0.7405 0.8305 0.8817 0.0013  -0.0124 -0.1398 7065 ILE A CG2 
2355 C  CD1 A ILE A 270 ? 0.7652 0.8430 0.8378 0.0187  -0.0003 -0.0925 7065 ILE A CD1 
2356 C  CD1 B ILE A 270 ? 0.7175 0.7551 0.8041 -0.0124 0.0190  -0.0894 7065 ILE A CD1 
2357 N  N   . ASN A 271 ? 0.7621 0.9074 1.1771 -0.0868 0.1885  -0.0472 7066 ASN A N   
2358 C  CA  . ASN A 271 ? 0.7119 0.8724 1.1672 -0.1005 0.1791  -0.0358 7066 ASN A CA  
2359 C  C   . ASN A 271 ? 0.6729 0.8126 1.0643 -0.1120 0.1558  -0.0375 7066 ASN A C   
2360 O  O   . ASN A 271 ? 0.6388 0.7560 0.9648 -0.1077 0.1494  -0.0464 7066 ASN A O   
2361 C  CB  . ASN A 271 ? 0.7084 0.8780 1.1998 -0.1020 0.2201  -0.0352 7066 ASN A CB  
2362 C  CG  . ASN A 271 ? 0.7267 0.8673 1.1449 -0.1022 0.2503  -0.0481 7066 ASN A CG  
2363 O  OD1 . ASN A 271 ? 0.6994 0.8180 1.0480 -0.1062 0.2351  -0.0538 7066 ASN A OD1 
2364 N  ND2 . ASN A 271 ? 0.7432 0.8804 1.1767 -0.0990 0.2934  -0.0519 7066 ASN A ND2 
2365 N  N   . ASP A 272 ? 0.6388 0.7850 1.0520 -0.1261 0.1446  -0.0284 7067 ASP A N   
2366 C  CA  . ASP A 272 ? 0.6272 0.7506 0.9833 -0.1378 0.1236  -0.0293 7067 ASP A CA  
2367 C  C   . ASP A 272 ? 0.6147 0.7161 0.9066 -0.1357 0.1477  -0.0405 7067 ASP A C   
2368 O  O   . ASP A 272 ? 0.5944 0.6719 0.8278 -0.1379 0.1335  -0.0449 7067 ASP A O   
2369 C  CB  . ASP A 272 ? 0.6413 0.7748 1.0372 -0.1546 0.1082  -0.0166 7067 ASP A CB  
2370 C  CG  . ASP A 272 ? 0.6496 0.7971 1.0999 -0.1614 0.0726  -0.0025 7067 ASP A CG  
2371 O  OD1 . ASP A 272 ? 0.6491 0.7908 1.0887 -0.1546 0.0545  -0.0039 7067 ASP A OD1 
2372 O  OD2 . ASP A 272 ? 0.6646 0.8272 1.1683 -0.1746 0.0615  0.0109  7067 ASP A OD2 
2373 N  N   . MET A 273 ? 0.5971 0.7028 0.8990 -0.1324 0.1831  -0.0441 7068 MET A N   
2374 C  CA  . MET A 273 ? 0.6155 0.6955 0.8536 -0.1330 0.2034  -0.0528 7068 MET A CA  
2375 C  C   . MET A 273 ? 0.5833 0.6449 0.7702 -0.1222 0.1978  -0.0614 7068 MET A C   
2376 O  O   . MET A 273 ? 0.5751 0.6140 0.7068 -0.1244 0.1917  -0.0647 7068 MET A O   
2377 C  CB  . MET A 273 ? 0.6765 0.7574 0.9302 -0.1336 0.2436  -0.0547 7068 MET A CB  
2378 C  CG  . MET A 273 ? 0.7348 0.7837 0.9197 -0.1384 0.2614  -0.0614 7068 MET A CG  
2379 S  SD  . MET A 273 ? 0.8318 0.8527 0.9545 -0.1277 0.2672  -0.0721 7068 MET A SD  
2380 C  CE  . MET A 273 ? 0.8319 0.8606 0.9959 -0.1189 0.3037  -0.0760 7068 MET A CE  
2381 N  N   . ILE A 274 ? 0.5441 0.6157 0.7538 -0.1111 0.1990  -0.0635 7069 ILE A N   
2382 C  CA  . ILE A 274 ? 0.5333 0.5890 0.6999 -0.1011 0.1927  -0.0706 7069 ILE A CA  
2383 C  C   . ILE A 274 ? 0.5061 0.5550 0.6493 -0.1024 0.1610  -0.0685 7069 ILE A C   
2384 O  O   . ILE A 274 ? 0.4789 0.5079 0.5735 -0.1000 0.1571  -0.0724 7069 ILE A O   
2385 C  CB  . ILE A 274 ? 0.5318 0.5990 0.7314 -0.0894 0.2015  -0.0728 7069 ILE A CB  
2386 C  CG1 . ILE A 274 ? 0.5616 0.6255 0.7736 -0.0873 0.2400  -0.0770 7069 ILE A CG1 
2387 C  CG2 . ILE A 274 ? 0.5257 0.5789 0.6863 -0.0807 0.1890  -0.0781 7069 ILE A CG2 
2388 C  CD1 . ILE A 274 ? 0.5933 0.6234 0.7362 -0.0902 0.2577  -0.0847 7069 ILE A CD1 
2389 N  N   . LEU A 275 ? 0.4910 0.5524 0.6675 -0.1072 0.1396  -0.0617 7070 LEU A N   
2390 C  CA  . LEU A 275 ? 0.4893 0.5353 0.6361 -0.1106 0.1118  -0.0602 7070 LEU A CA  
2391 C  C   . LEU A 275 ? 0.4816 0.5058 0.5829 -0.1174 0.1128  -0.0619 7070 LEU A C   
2392 O  O   . LEU A 275 ? 0.4727 0.4763 0.5344 -0.1150 0.1032  -0.0644 7070 LEU A O   
2393 C  CB  . LEU A 275 ? 0.5066 0.5630 0.6926 -0.1192 0.0874  -0.0510 7070 LEU A CB  
2394 C  CG  . LEU A 275 ? 0.5091 0.5831 0.7390 -0.1124 0.0785  -0.0472 7070 LEU A CG  
2395 C  CD1 . LEU A 275 ? 0.5263 0.6114 0.8040 -0.1241 0.0517  -0.0343 7070 LEU A CD1 
2396 C  CD2 . LEU A 275 ? 0.5127 0.5701 0.7035 -0.1042 0.0677  -0.0523 7070 LEU A CD2 
2397 N  N   A SER A 276 ? 0.4839 0.5114 0.5934 -0.1252 0.1260  -0.0600 7071 SER A N   
2398 N  N   B SER A 276 ? 0.4811 0.5085 0.5904 -0.1252 0.1260  -0.0600 7071 SER A N   
2399 C  CA  A SER A 276 ? 0.4953 0.5018 0.5654 -0.1321 0.1273  -0.0605 7071 SER A CA  
2400 C  CA  B SER A 276 ? 0.4897 0.4959 0.5593 -0.1321 0.1270  -0.0605 7071 SER A CA  
2401 C  C   A SER A 276 ? 0.4877 0.4780 0.5169 -0.1242 0.1378  -0.0655 7071 SER A C   
2402 C  C   B SER A 276 ? 0.4849 0.4750 0.5139 -0.1243 0.1380  -0.0655 7071 SER A C   
2403 O  O   A SER A 276 ? 0.4961 0.4663 0.4923 -0.1239 0.1301  -0.0656 7071 SER A O   
2404 O  O   B SER A 276 ? 0.4927 0.4627 0.4886 -0.1242 0.1305  -0.0656 7071 SER A O   
2405 C  CB  A SER A 276 ? 0.5129 0.5268 0.6025 -0.1429 0.1393  -0.0565 7071 SER A CB  
2406 C  CB  B SER A 276 ? 0.5020 0.5154 0.5913 -0.1431 0.1381  -0.0563 7071 SER A CB  
2407 O  OG  A SER A 276 ? 0.5313 0.5234 0.5831 -0.1495 0.1392  -0.0563 7071 SER A OG  
2408 O  OG  B SER A 276 ? 0.5002 0.5276 0.6305 -0.1522 0.1230  -0.0490 7071 SER A OG  
2409 N  N   . LEU A 277 ? 0.4775 0.4733 0.5099 -0.1187 0.1549  -0.0686 7072 LEU A N   
2410 C  CA  . LEU A 277 ? 0.4789 0.4563 0.4721 -0.1138 0.1608  -0.0714 7072 LEU A CA  
2411 C  C   . LEU A 277 ? 0.4515 0.4242 0.4331 -0.1044 0.1458  -0.0724 7072 LEU A C   
2412 O  O   . LEU A 277 ? 0.4580 0.4138 0.4118 -0.1029 0.1412  -0.0707 7072 LEU A O   
2413 C  CB  . LEU A 277 ? 0.4941 0.4718 0.4879 -0.1117 0.1816  -0.0752 7072 LEU A CB  
2414 C  CG  . LEU A 277 ? 0.5347 0.5073 0.5271 -0.1217 0.2031  -0.0746 7072 LEU A CG  
2415 C  CD1 . LEU A 277 ? 0.5587 0.5254 0.5489 -0.1190 0.2280  -0.0797 7072 LEU A CD1 
2416 C  CD2 . LEU A 277 ? 0.5599 0.5075 0.5088 -0.1305 0.2003  -0.0715 7072 LEU A CD2 
2417 N  N   . LEU A 278 ? 0.4337 0.4204 0.4395 -0.0987 0.1387  -0.0738 7073 LEU A N   
2418 C  CA  . LEU A 278 ? 0.4298 0.4109 0.4246 -0.0906 0.1259  -0.0746 7073 LEU A CA  
2419 C  C   . LEU A 278 ? 0.4440 0.4079 0.4179 -0.0939 0.1153  -0.0724 7073 LEU A C   
2420 O  O   . LEU A 278 ? 0.4425 0.3927 0.3959 -0.0882 0.1138  -0.0720 7073 LEU A O   
2421 C  CB  . LEU A 278 ? 0.4233 0.4203 0.4486 -0.0869 0.1178  -0.0749 7073 LEU A CB  
2422 C  CG  . LEU A 278 ? 0.4212 0.4322 0.4696 -0.0805 0.1304  -0.0777 7073 LEU A CG  
2423 C  CD1 . LEU A 278 ? 0.4158 0.4437 0.5037 -0.0778 0.1196  -0.0754 7073 LEU A CD1 
2424 C  CD2 . LEU A 278 ? 0.4232 0.4223 0.4439 -0.0729 0.1350  -0.0811 7073 LEU A CD2 
2425 N  N   . SER A 279 ? 0.4529 0.4155 0.4335 -0.1033 0.1095  -0.0704 7074 SER A N   
2426 C  CA  . SER A 279 ? 0.4870 0.4260 0.4429 -0.1082 0.1008  -0.0693 7074 SER A CA  
2427 C  C   . SER A 279 ? 0.5072 0.4294 0.4402 -0.1076 0.1097  -0.0681 7074 SER A C   
2428 O  O   . SER A 279 ? 0.5174 0.4161 0.4287 -0.1076 0.1078  -0.0679 7074 SER A O   
2429 C  CB  . SER A 279 ? 0.5031 0.4423 0.4706 -0.1207 0.0902  -0.0665 7074 SER A CB  
2430 O  OG  . SER A 279 ? 0.5024 0.4544 0.4944 -0.1220 0.0770  -0.0648 7074 SER A OG  
2431 N  N   . LYS A 280 ? 0.5190 0.4488 0.4552 -0.1078 0.1195  -0.0669 7075 LYS A N   
2432 C  CA  . LYS A 280 ? 0.5489 0.4621 0.4665 -0.1090 0.1240  -0.0631 7075 LYS A CA  
2433 C  C   . LYS A 280 ? 0.5166 0.4263 0.4276 -0.1004 0.1251  -0.0607 7075 LYS A C   
2434 O  O   . LYS A 280 ? 0.5263 0.4228 0.4273 -0.1016 0.1254  -0.0549 7075 LYS A O   
2435 C  CB  . LYS A 280 ? 0.5975 0.5137 0.5159 -0.1189 0.1311  -0.0613 7075 LYS A CB  
2436 C  CG  . LYS A 280 ? 0.6438 0.5610 0.5706 -0.1294 0.1288  -0.0609 7075 LYS A CG  
2437 C  CD  . LYS A 280 ? 0.6841 0.6053 0.6142 -0.1394 0.1389  -0.0586 7075 LYS A CD  
2438 C  CE  . LYS A 280 ? 0.7353 0.6555 0.6743 -0.1510 0.1349  -0.0563 7075 LYS A CE  
2439 N  NZ  . LYS A 280 ? 0.7559 0.6926 0.7239 -0.1533 0.1261  -0.0569 7075 LYS A NZ  
2440 N  N   . GLY A 281 ? 0.4846 0.4044 0.4030 -0.0930 0.1234  -0.0634 7076 GLY A N   
2441 C  CA  . GLY A 281 ? 0.4824 0.3988 0.3963 -0.0864 0.1219  -0.0600 7076 GLY A CA  
2442 C  C   . GLY A 281 ? 0.4917 0.4054 0.3946 -0.0918 0.1251  -0.0582 7076 GLY A C   
2443 O  O   . GLY A 281 ? 0.5052 0.4077 0.3985 -0.0911 0.1195  -0.0519 7076 GLY A O   
2444 N  N   A ARG A 282 ? 0.4886 0.4093 0.3928 -0.0982 0.1340  -0.0627 7077 ARG A N   
2445 N  N   B ARG A 282 ? 0.4940 0.4146 0.3981 -0.0982 0.1341  -0.0627 7077 ARG A N   
2446 C  CA  A ARG A 282 ? 0.5129 0.4226 0.3970 -0.1056 0.1424  -0.0625 7077 ARG A CA  
2447 C  CA  B ARG A 282 ? 0.5217 0.4312 0.4056 -0.1056 0.1423  -0.0624 7077 ARG A CA  
2448 C  C   A ARG A 282 ? 0.5074 0.4234 0.3943 -0.1018 0.1514  -0.0689 7077 ARG A C   
2449 C  C   B ARG A 282 ? 0.5123 0.4283 0.3992 -0.1018 0.1514  -0.0689 7077 ARG A C   
2450 O  O   A ARG A 282 ? 0.5216 0.4228 0.3865 -0.1085 0.1632  -0.0706 7077 ARG A O   
2451 O  O   B ARG A 282 ? 0.5261 0.4272 0.3910 -0.1085 0.1632  -0.0707 7077 ARG A O   
2452 C  CB  A ARG A 282 ? 0.5353 0.4435 0.4178 -0.1161 0.1524  -0.0627 7077 ARG A CB  
2453 C  CB  B ARG A 282 ? 0.5519 0.4593 0.4334 -0.1162 0.1522  -0.0625 7077 ARG A CB  
2454 C  CG  A ARG A 282 ? 0.5501 0.4467 0.4251 -0.1210 0.1445  -0.0561 7077 ARG A CG  
2455 C  CG  B ARG A 282 ? 0.5726 0.4692 0.4478 -0.1207 0.1441  -0.0560 7077 ARG A CG  
2456 C  CD  A ARG A 282 ? 0.5748 0.4716 0.4511 -0.1317 0.1535  -0.0563 7077 ARG A CD  
2457 C  CD  B ARG A 282 ? 0.6066 0.5018 0.4810 -0.1318 0.1529  -0.0559 7077 ARG A CD  
2458 N  NE  A ARG A 282 ? 0.6094 0.4961 0.4669 -0.1405 0.1682  -0.0574 7077 ARG A NE  
2459 N  NE  B ARG A 282 ? 0.6285 0.5118 0.4975 -0.1352 0.1446  -0.0501 7077 ARG A NE  
2460 C  CZ  A ARG A 282 ? 0.6258 0.5114 0.4837 -0.1508 0.1811  -0.0574 7077 ARG A CZ  
2461 C  CZ  B ARG A 282 ? 0.6514 0.5314 0.5200 -0.1448 0.1484  -0.0487 7077 ARG A CZ  
2462 N  NH1 A ARG A 282 ? 0.6222 0.5183 0.5004 -0.1541 0.1775  -0.0558 7077 ARG A NH1 
2463 N  NH1 B ARG A 282 ? 0.6675 0.5579 0.5450 -0.1522 0.1613  -0.0519 7077 ARG A NH1 
2464 N  NH2 A ARG A 282 ? 0.6546 0.5250 0.4897 -0.1590 0.1987  -0.0589 7077 ARG A NH2 
2465 N  NH2 B ARG A 282 ? 0.6604 0.5262 0.5229 -0.1468 0.1409  -0.0437 7077 ARG A NH2 
2466 N  N   . LEU A 283 ? 0.4839 0.4161 0.3927 -0.0921 0.1471  -0.0723 7078 LEU A N   
2467 C  CA  . LEU A 283 ? 0.4818 0.4195 0.3974 -0.0874 0.1562  -0.0783 7078 LEU A CA  
2468 C  C   . LEU A 283 ? 0.4536 0.4013 0.3830 -0.0769 0.1449  -0.0791 7078 LEU A C   
2469 O  O   . LEU A 283 ? 0.4185 0.3756 0.3625 -0.0736 0.1347  -0.0774 7078 LEU A O   
2470 C  CB  . LEU A 283 ? 0.4885 0.4429 0.4335 -0.0892 0.1709  -0.0821 7078 LEU A CB  
2471 C  CG  . LEU A 283 ? 0.4985 0.4586 0.4596 -0.0836 0.1856  -0.0879 7078 LEU A CG  
2472 C  CD1 . LEU A 283 ? 0.5413 0.4725 0.4616 -0.0879 0.2010  -0.0912 7078 LEU A CD1 
2473 C  CD2 . LEU A 283 ? 0.4932 0.4747 0.4992 -0.0846 0.1987  -0.0884 7078 LEU A CD2 
2474 N  N   . ILE A 284 ? 0.4587 0.3991 0.3779 -0.0731 0.1478  -0.0819 7079 ILE A N   
2475 C  CA  . ILE A 284 ? 0.4375 0.3856 0.3684 -0.0636 0.1391  -0.0832 7079 ILE A CA  
2476 C  C   . ILE A 284 ? 0.4466 0.4002 0.3921 -0.0596 0.1528  -0.0899 7079 ILE A C   
2477 O  O   . ILE A 284 ? 0.4601 0.3963 0.3846 -0.0640 0.1683  -0.0934 7079 ILE A O   
2478 C  CB  . ILE A 284 ? 0.4495 0.3810 0.3566 -0.0630 0.1279  -0.0783 7079 ILE A CB  
2479 C  CG1 . ILE A 284 ? 0.4400 0.3713 0.3497 -0.0627 0.1159  -0.0703 7079 ILE A CG1 
2480 C  CG2 . ILE A 284 ? 0.4461 0.3807 0.3595 -0.0550 0.1240  -0.0810 7079 ILE A CG2 
2481 C  CD1 . ILE A 284 ? 0.4286 0.3730 0.3585 -0.0552 0.1105  -0.0707 7079 ILE A CD1 
2482 N  N   . ILE A 285 ? 0.4264 0.3994 0.4053 -0.0525 0.1482  -0.0911 7080 ILE A N   
2483 C  CA  . ILE A 285 ? 0.4394 0.4198 0.4434 -0.0468 0.1612  -0.0960 7080 ILE A CA  
2484 C  C   . ILE A 285 ? 0.4302 0.4094 0.4344 -0.0384 0.1505  -0.0968 7080 ILE A C   
2485 O  O   . ILE A 285 ? 0.3951 0.3862 0.4147 -0.0352 0.1334  -0.0933 7080 ILE A O   
2486 C  CB  . ILE A 285 ? 0.4403 0.4449 0.4930 -0.0468 0.1637  -0.0942 7080 ILE A CB  
2487 C  CG1 . ILE A 285 ? 0.4594 0.4640 0.5122 -0.0559 0.1763  -0.0931 7080 ILE A CG1 
2488 C  CG2 . ILE A 285 ? 0.4446 0.4587 0.5345 -0.0388 0.1761  -0.0970 7080 ILE A CG2 
2489 C  CD1 . ILE A 285 ? 0.4675 0.4963 0.5720 -0.0582 0.1757  -0.0888 7080 ILE A CD1 
2490 N  N   . ARG A 286 ? 0.4456 0.4061 0.4278 -0.0365 0.1607  -0.1013 7081 ARG A N   
2491 C  CA  . ARG A 286 ? 0.4470 0.4026 0.4265 -0.0292 0.1523  -0.1024 7081 ARG A CA  
2492 C  C   . ARG A 286 ? 0.4988 0.4249 0.4451 -0.0306 0.1680  -0.1084 7081 ARG A C   
2493 O  O   . ARG A 286 ? 0.5025 0.4081 0.4182 -0.0392 0.1811  -0.1102 7081 ARG A O   
2494 C  CB  . ARG A 286 ? 0.4168 0.3696 0.3787 -0.0298 0.1307  -0.0964 7081 ARG A CB  
2495 C  CG  . ARG A 286 ? 0.4187 0.3526 0.3446 -0.0382 0.1270  -0.0923 7081 ARG A CG  
2496 C  CD  . ARG A 286 ? 0.4096 0.3379 0.3254 -0.0371 0.1095  -0.0855 7081 ARG A CD  
2497 N  NE  . ARG A 286 ? 0.4159 0.3305 0.3110 -0.0449 0.1018  -0.0777 7081 ARG A NE  
2498 C  CZ  . ARG A 286 ? 0.4547 0.3436 0.3177 -0.0531 0.0990  -0.0751 7081 ARG A CZ  
2499 N  NH1 . ARG A 286 ? 0.4523 0.3310 0.3047 -0.0606 0.0875  -0.0650 7081 ARG A NH1 
2500 N  NH2 . ARG A 286 ? 0.4913 0.3607 0.3315 -0.0548 0.1070  -0.0819 7081 ARG A NH2 
2501 N  N   . GLU A 287 ? 0.5390 0.4585 0.4867 -0.0236 0.1666  -0.1113 7082 GLU A N   
2502 C  CA  . GLU A 287 ? 0.6198 0.5021 0.5248 -0.0266 0.1788  -0.1171 7082 GLU A CA  
2503 C  C   . GLU A 287 ? 0.6184 0.4786 0.4765 -0.0371 0.1603  -0.1111 7082 GLU A C   
2504 O  O   . GLU A 287 ? 0.5549 0.4340 0.4262 -0.0369 0.1397  -0.1030 7082 GLU A O   
2505 C  CB  . GLU A 287 ? 0.6775 0.5571 0.5959 -0.0167 0.1789  -0.1208 7082 GLU A CB  
2506 C  CG  . GLU A 287 ? 0.7249 0.6217 0.6941 -0.0064 0.1989  -0.1252 7082 GLU A CG  
2507 C  CD  . GLU A 287 ? 0.8275 0.7009 0.7862 -0.0080 0.2352  -0.1335 7082 GLU A CD  
2508 O  OE1 . GLU A 287 ? 0.8667 0.7594 0.8788 -0.0002 0.2541  -0.1346 7082 GLU A OE1 
2509 O  OE2 . GLU A 287 ? 0.9237 0.7568 0.8210 -0.0178 0.2447  -0.1377 7082 GLU A OE2 
2510 N  N   . ASN A 288 ? 0.6671 0.4859 0.4727 -0.0468 0.1678  -0.1139 7083 ASN A N   
2511 C  CA  . ASN A 288 ? 0.7132 0.5078 0.4768 -0.0592 0.1455  -0.1051 7083 ASN A CA  
2512 C  C   . ASN A 288 ? 0.7554 0.5165 0.4839 -0.0620 0.1375  -0.1062 7083 ASN A C   
2513 O  O   . ASN A 288 ? 0.8099 0.5299 0.4851 -0.0765 0.1275  -0.1022 7083 ASN A O   
2514 C  CB  . ASN A 288 ? 0.7753 0.5447 0.5009 -0.0731 0.1529  -0.1038 7083 ASN A CB  
2515 C  CG  . ASN A 288 ? 0.8070 0.5656 0.5119 -0.0845 0.1248  -0.0903 7083 ASN A CG  
2516 O  OD1 . ASN A 288 ? 0.7519 0.5364 0.4888 -0.0793 0.1044  -0.0813 7083 ASN A OD1 
2517 N  ND2 . ASN A 288 ? 0.8752 0.5941 0.5283 -0.1005 0.1246  -0.0878 7083 ASN A ND2 
2518 N  N   . ASN A 289 ? 0.7377 0.5137 0.4943 -0.0498 0.1395  -0.1106 7084 ASN A N   
2519 C  CA  . ASN A 289 ? 0.7946 0.5409 0.5230 -0.0509 0.1319  -0.1122 7084 ASN A CA  
2520 C  C   . ASN A 289 ? 0.7608 0.5130 0.4904 -0.0556 0.0987  -0.0988 7084 ASN A C   
2521 O  O   . ASN A 289 ? 0.7266 0.5043 0.4797 -0.0568 0.0857  -0.0891 7084 ASN A O   
2522 C  CB  . ASN A 289 ? 0.8010 0.5629 0.5650 -0.0355 0.1453  -0.1204 7084 ASN A CB  
2523 C  CG  . ASN A 289 ? 0.8426 0.5986 0.6160 -0.0298 0.1806  -0.1319 7084 ASN A CG  
2524 O  OD1 . ASN A 289 ? 0.8801 0.6019 0.6118 -0.0392 0.1996  -0.1370 7084 ASN A OD1 
2525 N  ND2 . ASN A 289 ? 0.8365 0.6230 0.6656 -0.0152 0.1896  -0.1348 7084 ASN A ND2 
2526 N  N   . ARG A 290 ? 0.7559 0.4833 0.4628 -0.0582 0.0872  -0.0979 7085 ARG A N   
2527 C  CA  . ARG A 290 ? 0.7480 0.4790 0.4606 -0.0631 0.0563  -0.0837 7085 ARG A CA  
2528 C  C   . ARG A 290 ? 0.6498 0.4309 0.4222 -0.0501 0.0507  -0.0784 7085 ARG A C   
2529 O  O   . ARG A 290 ? 0.6332 0.4363 0.4340 -0.0375 0.0648  -0.0869 7085 ARG A O   
2530 C  CB  . ARG A 290 ? 0.8412 0.5343 0.5183 -0.0678 0.0486  -0.0858 7085 ARG A CB  
2531 C  CG  . ARG A 290 ? 0.9010 0.5940 0.5873 -0.0543 0.0711  -0.1003 7085 ARG A CG  
2532 C  CD  . ARG A 290 ? 0.9988 0.6376 0.6316 -0.0610 0.0735  -0.1070 7085 ARG A CD  
2533 N  NE  . ARG A 290 ? 1.0462 0.6815 0.6819 -0.0621 0.0493  -0.0994 7085 ARG A NE  
2534 C  CZ  . ARG A 290 ? 1.0589 0.7154 0.7295 -0.0483 0.0517  -0.1026 7085 ARG A CZ  
2535 N  NH1 . ARG A 290 ? 1.0781 0.7276 0.7470 -0.0516 0.0293  -0.0948 7085 ARG A NH1 
2536 N  NH2 . ARG A 290 ? 1.0402 0.7242 0.7495 -0.0324 0.0743  -0.1120 7085 ARG A NH2 
2537 N  N   . VAL A 291 ? 0.5753 0.3702 0.3658 -0.0542 0.0311  -0.0640 7086 VAL A N   
2538 C  CA  . VAL A 291 ? 0.5129 0.3462 0.3515 -0.0438 0.0282  -0.0585 7086 VAL A CA  
2539 C  C   . VAL A 291 ? 0.4856 0.3168 0.3312 -0.0411 0.0167  -0.0547 7086 VAL A C   
2540 O  O   . VAL A 291 ? 0.4915 0.3039 0.3243 -0.0507 -0.0015 -0.0442 7086 VAL A O   
2541 C  CB  . VAL A 291 ? 0.4977 0.3447 0.3564 -0.0481 0.0193  -0.0450 7086 VAL A CB  
2542 C  CG1 . VAL A 291 ? 0.4700 0.3451 0.3691 -0.0393 0.0190  -0.0387 7086 VAL A CG1 
2543 C  CG2 . VAL A 291 ? 0.5003 0.3506 0.3532 -0.0499 0.0315  -0.0496 7086 VAL A CG2 
2544 N  N   . VAL A 292 ? 0.4552 0.3031 0.3203 -0.0297 0.0250  -0.0620 7087 VAL A N   
2545 C  CA  . VAL A 292 ? 0.4512 0.2970 0.3227 -0.0263 0.0157  -0.0595 7087 VAL A CA  
2546 C  C   . VAL A 292 ? 0.4094 0.2837 0.3148 -0.0182 0.0171  -0.0560 7087 VAL A C   
2547 O  O   . VAL A 292 ? 0.3919 0.2815 0.3096 -0.0117 0.0280  -0.0631 7087 VAL A O   
2548 C  CB  . VAL A 292 ? 0.4797 0.3074 0.3339 -0.0216 0.0239  -0.0720 7087 VAL A CB  
2549 C  CG1 . VAL A 292 ? 0.4845 0.3086 0.3446 -0.0184 0.0131  -0.0691 7087 VAL A CG1 
2550 C  CG2 . VAL A 292 ? 0.5298 0.3196 0.3395 -0.0310 0.0276  -0.0772 7087 VAL A CG2 
2551 N  N   . ILE A 293 ? 0.3852 0.2624 0.3031 -0.0200 0.0065  -0.0446 7088 ILE A N   
2552 C  CA  . ILE A 293 ? 0.3570 0.2524 0.2982 -0.0145 0.0104  -0.0406 7088 ILE A CA  
2553 C  C   . ILE A 293 ? 0.3499 0.2395 0.2937 -0.0135 0.0018  -0.0363 7088 ILE A C   
2554 O  O   . ILE A 293 ? 0.3565 0.2306 0.2898 -0.0186 -0.0094 -0.0327 7088 ILE A O   
2555 C  CB  . ILE A 293 ? 0.3503 0.2550 0.3099 -0.0176 0.0131  -0.0290 7088 ILE A CB  
2556 C  CG1 . ILE A 293 ? 0.3611 0.2596 0.3327 -0.0245 0.0003  -0.0137 7088 ILE A CG1 
2557 C  CG2 . ILE A 293 ? 0.3599 0.2677 0.3149 -0.0196 0.0196  -0.0326 7088 ILE A CG2 
2558 C  CD1 . ILE A 293 ? 0.3594 0.2682 0.3610 -0.0261 0.0045  0.0000  7088 ILE A CD1 
2559 N  N   . SER A 294 ? 0.3388 0.2363 0.2919 -0.0088 0.0061  -0.0362 7089 SER A N   
2560 C  CA  . SER A 294 ? 0.3494 0.2402 0.3042 -0.0088 -0.0013 -0.0308 7089 SER A CA  
2561 C  C   . SER A 294 ? 0.3463 0.2412 0.3067 -0.0071 0.0063  -0.0273 7089 SER A C   
2562 O  O   . SER A 294 ? 0.3428 0.2423 0.2999 -0.0053 0.0149  -0.0322 7089 SER A O   
2563 C  CB  . SER A 294 ? 0.3611 0.2418 0.3039 -0.0050 -0.0078 -0.0398 7089 SER A CB  
2564 O  OG  . SER A 294 ? 0.3674 0.2550 0.3126 0.0010  -0.0026 -0.0485 7089 SER A OG  
2565 N  N   A SER A 295 ? 0.3563 0.2452 0.3211 -0.0092 0.0034  -0.0186 7090 SER A N   
2566 N  N   B SER A 295 ? 0.3634 0.2522 0.3280 -0.0091 0.0035  -0.0187 7090 SER A N   
2567 C  CA  A SER A 295 ? 0.3711 0.2542 0.3314 -0.0094 0.0124  -0.0152 7090 SER A CA  
2568 C  CA  B SER A 295 ? 0.3812 0.2646 0.3416 -0.0094 0.0130  -0.0152 7090 SER A CA  
2569 C  C   A SER A 295 ? 0.3840 0.2561 0.3329 -0.0089 0.0012  -0.0164 7090 SER A C   
2570 C  C   B SER A 295 ? 0.3920 0.2638 0.3410 -0.0092 0.0024  -0.0157 7090 SER A C   
2571 O  O   A SER A 295 ? 0.3901 0.2589 0.3448 -0.0105 -0.0085 -0.0116 7090 SER A O   
2572 O  O   B SER A 295 ? 0.4044 0.2729 0.3608 -0.0114 -0.0054 -0.0091 7090 SER A O   
2573 C  CB  A SER A 295 ? 0.3758 0.2595 0.3543 -0.0126 0.0250  -0.0022 7090 SER A CB  
2574 C  CB  B SER A 295 ? 0.3896 0.2743 0.3689 -0.0124 0.0261  -0.0025 7090 SER A CB  
2575 O  OG  A SER A 295 ? 0.3894 0.2594 0.3544 -0.0138 0.0379  -0.0003 7090 SER A OG  
2576 O  OG  B SER A 295 ? 0.4045 0.2911 0.4034 -0.0158 0.0166  0.0083  7090 SER A OG  
2577 N  N   . ASP A 296 ? 0.3979 0.2625 0.3305 -0.0077 -0.0004 -0.0222 7091 ASP A N   
2578 C  CA  . ASP A 296 ? 0.4142 0.2661 0.3362 -0.0077 -0.0130 -0.0220 7091 ASP A CA  
2579 C  C   . ASP A 296 ? 0.4317 0.2708 0.3482 -0.0131 -0.0077 -0.0114 7091 ASP A C   
2580 O  O   . ASP A 296 ? 0.4387 0.2712 0.3486 -0.0168 0.0089  -0.0068 7091 ASP A O   
2581 C  CB  . ASP A 296 ? 0.4368 0.2811 0.3445 -0.0078 -0.0196 -0.0271 7091 ASP A CB  
2582 C  CG  . ASP A 296 ? 0.4459 0.3026 0.3683 -0.0016 -0.0277 -0.0359 7091 ASP A CG  
2583 O  OD1 . ASP A 296 ? 0.4417 0.3071 0.3775 0.0029  -0.0272 -0.0397 7091 ASP A OD1 
2584 O  OD2 . ASP A 296 ? 0.4981 0.3526 0.4178 -0.0025 -0.0344 -0.0380 7091 ASP A OD2 
2585 N  N   . VAL A 297 ? 0.4255 0.2588 0.3444 -0.0136 -0.0192 -0.0077 7092 VAL A N   
2586 C  CA  . VAL A 297 ? 0.4493 0.2701 0.3654 -0.0194 -0.0145 0.0033  7092 VAL A CA  
2587 C  C   . VAL A 297 ? 0.4807 0.2816 0.3732 -0.0212 -0.0264 0.0025  7092 VAL A C   
2588 O  O   . VAL A 297 ? 0.4541 0.2549 0.3490 -0.0171 -0.0440 -0.0022 7092 VAL A O   
2589 C  CB  . VAL A 297 ? 0.4498 0.2775 0.3888 -0.0211 -0.0207 0.0114  7092 VAL A CB  
2590 C  CG1 . VAL A 297 ? 0.4735 0.2894 0.4145 -0.0273 -0.0173 0.0237  7092 VAL A CG1 
2591 C  CG2 . VAL A 297 ? 0.4385 0.2826 0.4019 -0.0215 -0.0132 0.0156  7092 VAL A CG2 
2592 N  N   A LEU A 298 ? 0.5075 0.2880 0.3754 -0.0277 -0.0164 0.0070  7093 LEU A N   
2593 N  N   B LEU A 298 ? 0.5119 0.2924 0.3802 -0.0278 -0.0162 0.0073  7093 LEU A N   
2594 C  CA  A LEU A 298 ? 0.5532 0.3086 0.3930 -0.0324 -0.0301 0.0087  7093 LEU A CA  
2595 C  CA  B LEU A 298 ? 0.5558 0.3106 0.3951 -0.0327 -0.0293 0.0091  7093 LEU A CA  
2596 C  C   A LEU A 298 ? 0.5712 0.3204 0.4177 -0.0355 -0.0322 0.0179  7093 LEU A C   
2597 C  C   B LEU A 298 ? 0.5722 0.3205 0.4179 -0.0357 -0.0320 0.0182  7093 LEU A C   
2598 O  O   A LEU A 298 ? 0.5819 0.3313 0.4379 -0.0394 -0.0130 0.0265  7093 LEU A O   
2599 O  O   B LEU A 298 ? 0.5806 0.3272 0.4336 -0.0402 -0.0127 0.0270  7093 LEU A O   
2600 C  CB  A LEU A 298 ? 0.5961 0.3224 0.3955 -0.0413 -0.0183 0.0103  7093 LEU A CB  
2601 C  CB  B LEU A 298 ? 0.5964 0.3225 0.3959 -0.0415 -0.0162 0.0108  7093 LEU A CB  
2602 C  CG  A LEU A 298 ? 0.6429 0.3349 0.4042 -0.0499 -0.0329 0.0145  7093 LEU A CG  
2603 C  CG  B LEU A 298 ? 0.5995 0.3266 0.3878 -0.0411 -0.0154 0.0030  7093 LEU A CG  
2604 C  CD1 A LEU A 298 ? 0.6387 0.3352 0.4069 -0.0458 -0.0642 0.0102  7093 LEU A CD1 
2605 C  CD1 B LEU A 298 ? 0.6525 0.3389 0.3884 -0.0529 -0.0062 0.0049  7093 LEU A CD1 
2606 C  CD2 A LEU A 298 ? 0.6927 0.3464 0.4027 -0.0617 -0.0187 0.0160  7093 LEU A CD2 
2607 C  CD2 B LEU A 298 ? 0.5880 0.3284 0.3903 -0.0354 -0.0421 -0.0032 7093 LEU A CD2 
2608 N  N   . VAL A 299 ? 0.5785 0.3232 0.4256 -0.0333 -0.0540 0.0169  7094 VAL A N   
2609 C  CA  . VAL A 299 ? 0.6166 0.3528 0.4680 -0.0371 -0.0593 0.0256  7094 VAL A CA  
2610 C  C   . VAL A 299 ? 0.6933 0.3980 0.5099 -0.0451 -0.0651 0.0308  7094 VAL A C   
2611 O  O   . VAL A 299 ? 0.6926 0.3866 0.4946 -0.0436 -0.0839 0.0264  7094 VAL A O   
2612 C  CB  . VAL A 299 ? 0.5949 0.3402 0.4652 -0.0303 -0.0784 0.0211  7094 VAL A CB  
2613 C  CG1 . VAL A 299 ? 0.6098 0.3457 0.4848 -0.0356 -0.0846 0.0307  7094 VAL A CG1 
2614 C  CG2 . VAL A 299 ? 0.5648 0.3328 0.4573 -0.0244 -0.0741 0.0145  7094 VAL A CG2 
2615 N  N   . ASN A 300 ? 0.7955 0.4848 0.6014 -0.0538 -0.0495 0.0413  7095 ASN A N   
2616 C  CA  . ASN A 300 ? 0.9286 0.5805 0.6926 -0.0642 -0.0526 0.0473  7095 ASN A CA  
2617 C  C   . ASN A 300 ? 0.9929 0.6371 0.7642 -0.0710 -0.0408 0.0597  7095 ASN A C   
2618 O  O   . ASN A 300 ? 0.9767 0.6467 0.7898 -0.0675 -0.0352 0.0639  7095 ASN A O   
2619 C  CB  . ASN A 300 ? 1.0005 0.6261 0.7217 -0.0717 -0.0377 0.0455  7095 ASN A CB  
2620 C  CG  . ASN A 300 ? 1.0327 0.6672 0.7647 -0.0715 -0.0030 0.0463  7095 ASN A CG  
2621 O  OD1 . ASN A 300 ? 1.0831 0.7378 0.8531 -0.0690 0.0123  0.0529  7095 ASN A OD1 
2622 N  ND2 . ASN A 300 ? 1.0769 0.6948 0.7779 -0.0748 0.0082  0.0409  7095 ASN A ND2 
2623 N  N   . ASN A 301 ? 1.1164 0.7241 0.8482 -0.0819 -0.0394 0.0665  7096 ASN A N   
2624 C  CA  . ASN A 301 ? 1.1819 0.7787 0.9189 -0.0900 -0.0264 0.0795  7096 ASN A CA  
2625 C  C   . ASN A 301 ? 1.2784 0.8262 0.9562 -0.1041 -0.0121 0.0850  7096 ASN A C   
2626 O  O   . ASN A 301 ? 1.3354 0.8587 0.9705 -0.1083 -0.0057 0.0793  7096 ASN A O   
2627 C  CB  . ASN A 301 ? 1.1809 0.7862 0.9394 -0.0875 -0.0541 0.0826  7096 ASN A CB  
2628 C  CG  . ASN A 301 ? 1.2119 0.7950 0.9396 -0.0876 -0.0851 0.0783  7096 ASN A CG  
2629 O  OD1 . ASN A 301 ? 1.2524 0.8141 0.9434 -0.0908 -0.0901 0.0743  7096 ASN A OD1 
2630 N  ND2 . ASN A 301 ? 1.2027 0.7884 0.9461 -0.0848 -0.1076 0.0801  7096 ASN A ND2 
2631 O  OXT . ASN A 301 ? 1.3423 0.8694 1.0091 -0.1130 -0.0068 0.0953  7096 ASN A OXT 
2632 N  N   . ALA B 21  ? 0.9964 0.5727 0.8241 -0.0191 -0.0141 0.0242  4271 ALA B N   
2633 C  CA  . ALA B 21  ? 1.0100 0.5750 0.8320 -0.0203 -0.0470 0.0146  4271 ALA B CA  
2634 C  C   . ALA B 21  ? 0.9201 0.5612 0.8184 -0.0302 -0.0448 0.0156  4271 ALA B C   
2635 O  O   . ALA B 21  ? 0.9426 0.5779 0.8355 -0.0274 -0.0595 0.0119  4271 ALA B O   
2636 C  CB  . ALA B 21  ? 1.0537 0.5924 0.8740 -0.0270 -0.0921 -0.0003 4271 ALA B CB  
2637 N  N   . PHE B 22  ? 0.8301 0.5290 0.7862 -0.0398 -0.0285 0.0200  4272 PHE B N   
2638 C  CA  . PHE B 22  ? 0.7517 0.5096 0.7664 -0.0475 -0.0252 0.0213  4272 PHE B CA  
2639 C  C   . PHE B 22  ? 0.7595 0.5244 0.7694 -0.0382 -0.0064 0.0300  4272 PHE B C   
2640 O  O   . PHE B 22  ? 0.7971 0.5439 0.7887 -0.0286 0.0176  0.0381  4272 PHE B O   
2641 C  CB  . PHE B 22  ? 0.6821 0.4757 0.7348 -0.0558 -0.0122 0.0244  4272 PHE B CB  
2642 C  CG  . PHE B 22  ? 0.6163 0.4514 0.7079 -0.0600 -0.0068 0.0269  4272 PHE B CG  
2643 C  CD1 . PHE B 22  ? 0.5904 0.4450 0.7161 -0.0693 -0.0167 0.0199  4272 PHE B CD1 
2644 C  CD2 . PHE B 22  ? 0.5806 0.4305 0.6781 -0.0536 0.0059  0.0352  4272 PHE B CD2 
2645 C  CE1 . PHE B 22  ? 0.5565 0.4388 0.7065 -0.0717 -0.0090 0.0226  4272 PHE B CE1 
2646 C  CE2 . PHE B 22  ? 0.5579 0.4336 0.6798 -0.0560 0.0054  0.0365  4272 PHE B CE2 
2647 C  CZ  . PHE B 22  ? 0.5440 0.4332 0.6848 -0.0648 0.0003  0.0309  4272 PHE B CZ  
2648 N  N   . ALA B 23  ? 0.7360 0.5266 0.7707 -0.0414 -0.0149 0.0278  4273 ALA B N   
2649 C  CA  . ALA B 23  ? 0.7471 0.5475 0.7875 -0.0348 0.0019  0.0348  4273 ALA B CA  
2650 C  C   . ALA B 23  ? 0.7015 0.5468 0.7857 -0.0429 -0.0091 0.0320  4273 ALA B C   
2651 O  O   . ALA B 23  ? 0.7023 0.5464 0.7899 -0.0473 -0.0308 0.0235  4273 ALA B O   
2652 C  CB  . ALA B 23  ? 0.8116 0.5532 0.7915 -0.0231 0.0064  0.0353  4273 ALA B CB  
2653 N  N   . VAL B 24  ? 0.6738 0.5527 0.7928 -0.0438 0.0022  0.0378  4274 VAL B N   
2654 C  CA  . VAL B 24  ? 0.6554 0.5676 0.8055 -0.0498 -0.0056 0.0360  4274 VAL B CA  
2655 C  C   . VAL B 24  ? 0.6579 0.5607 0.7957 -0.0464 -0.0105 0.0340  4274 VAL B C   
2656 O  O   . VAL B 24  ? 0.7055 0.5842 0.8222 -0.0379 0.0043  0.0389  4274 VAL B O   
2657 C  CB  . VAL B 24  ? 0.6642 0.5979 0.8418 -0.0480 0.0004  0.0417  4274 VAL B CB  
2658 C  CG1 . VAL B 24  ? 0.6675 0.6225 0.8628 -0.0523 -0.0076 0.0401  4274 VAL B CG1 
2659 C  CG2 . VAL B 24  ? 0.6784 0.6071 0.8543 -0.0478 0.0004  0.0430  4274 VAL B CG2 
2660 N  N   . ASP B 25  ? 0.6056 0.5204 0.7567 -0.0517 -0.0273 0.0271  4275 ASP B N   
2661 C  CA  . ASP B 25  ? 0.6103 0.5114 0.7461 -0.0470 -0.0378 0.0240  4275 ASP B CA  
2662 C  C   . ASP B 25  ? 0.5420 0.4785 0.7106 -0.0506 -0.0340 0.0262  4275 ASP B C   
2663 O  O   . ASP B 25  ? 0.5238 0.4784 0.7187 -0.0559 -0.0457 0.0202  4275 ASP B O   
2664 C  CB  . ASP B 25  ? 0.6341 0.5153 0.7649 -0.0474 -0.0673 0.0124  4275 ASP B CB  
2665 C  CG  . ASP B 25  ? 0.6952 0.5448 0.7944 -0.0383 -0.0859 0.0079  4275 ASP B CG  
2666 O  OD1 . ASP B 25  ? 0.6916 0.5376 0.7727 -0.0334 -0.0688 0.0149  4275 ASP B OD1 
2667 O  OD2 . ASP B 25  ? 0.7399 0.5641 0.8346 -0.0356 -0.1198 -0.0034 4275 ASP B OD2 
2668 N  N   . ALA B 26  ? 0.5155 0.4587 0.6888 -0.0476 -0.0176 0.0338  4276 ALA B N   
2669 C  CA  . ALA B 26  ? 0.4683 0.4383 0.6686 -0.0503 -0.0172 0.0357  4276 ALA B CA  
2670 C  C   . ALA B 26  ? 0.4495 0.4142 0.6401 -0.0485 -0.0259 0.0320  4276 ALA B C   
2671 O  O   . ALA B 26  ? 0.4250 0.4117 0.6366 -0.0527 -0.0321 0.0298  4276 ALA B O   
2672 C  CB  . ALA B 26  ? 0.4644 0.4379 0.6835 -0.0469 -0.0032 0.0424  4276 ALA B CB  
2673 N  N   . ALA B 27  ? 0.4830 0.4096 0.6341 -0.0407 -0.0255 0.0313  4277 ALA B N   
2674 C  CA  . ALA B 27  ? 0.5038 0.4113 0.6326 -0.0357 -0.0381 0.0270  4277 ALA B CA  
2675 C  C   . ALA B 27  ? 0.4980 0.4258 0.6552 -0.0400 -0.0651 0.0172  4277 ALA B C   
2676 O  O   . ALA B 27  ? 0.4660 0.4147 0.6461 -0.0418 -0.0696 0.0155  4277 ALA B O   
2677 C  CB  . ALA B 27  ? 0.5807 0.4211 0.6406 -0.0235 -0.0365 0.0268  4277 ALA B CB  
2678 N  N   . LYS B 28  ? 0.5097 0.4303 0.6728 -0.0418 -0.0803 0.0106  4278 LYS B N   
2679 C  CA  . LYS B 28  ? 0.5013 0.4418 0.7147 -0.0470 -0.1025 -0.0002 4278 LYS B CA  
2680 C  C   . LYS B 28  ? 0.4378 0.4233 0.7019 -0.0571 -0.0815 0.0029  4278 LYS B C   
2681 O  O   . LYS B 28  ? 0.4190 0.4216 0.7234 -0.0590 -0.0869 -0.0025 4278 LYS B O   
2682 C  CB  . LYS B 28  ? 0.5444 0.4681 0.7648 -0.0487 -0.1196 -0.0079 4278 LYS B CB  
2683 C  CG  . LYS B 28  ? 0.5560 0.5047 0.8540 -0.0565 -0.1356 -0.0197 4278 LYS B CG  
2684 C  CD  . LYS B 28  ? 0.6012 0.5308 0.9147 -0.0590 -0.1565 -0.0290 4278 LYS B CD  
2685 C  CE  . LYS B 28  ? 0.6013 0.5616 1.0159 -0.0696 -0.1609 -0.0402 4278 LYS B CE  
2686 N  NZ  . LYS B 28  ? 0.6190 0.5889 1.0867 -0.0655 -0.1866 -0.0506 4278 LYS B NZ  
2687 N  N   . ALA B 29  ? 0.4258 0.4204 0.6823 -0.0612 -0.0592 0.0112  4279 ALA B N   
2688 C  CA  . ALA B 29  ? 0.4057 0.4193 0.6843 -0.0676 -0.0404 0.0144  4279 ALA B CA  
2689 C  C   . ALA B 29  ? 0.3973 0.4202 0.6761 -0.0655 -0.0379 0.0170  4279 ALA B C   
2690 O  O   . ALA B 29  ? 0.4000 0.4294 0.7007 -0.0688 -0.0275 0.0153  4279 ALA B O   
2691 C  CB  . ALA B 29  ? 0.4131 0.4200 0.6692 -0.0681 -0.0279 0.0217  4279 ALA B CB  
2692 N  N   . TYR B 30  ? 0.4068 0.4248 0.6620 -0.0601 -0.0425 0.0210  4280 TYR B N   
2693 C  CA  . TYR B 30  ? 0.4011 0.4262 0.6565 -0.0586 -0.0411 0.0233  4280 TYR B CA  
2694 C  C   . TYR B 30  ? 0.4077 0.4357 0.6797 -0.0565 -0.0524 0.0161  4280 TYR B C   
2695 O  O   . TYR B 30  ? 0.3969 0.4348 0.6853 -0.0580 -0.0465 0.0156  4280 TYR B O   
2696 C  CB  . TYR B 30  ? 0.3978 0.4153 0.6357 -0.0547 -0.0378 0.0292  4280 TYR B CB  
2697 C  CG  . TYR B 30  ? 0.3764 0.3996 0.6180 -0.0543 -0.0374 0.0313  4280 TYR B CG  
2698 C  CD1 . TYR B 30  ? 0.3737 0.4022 0.6209 -0.0571 -0.0375 0.0325  4280 TYR B CD1 
2699 C  CD2 . TYR B 30  ? 0.3911 0.4031 0.6205 -0.0500 -0.0364 0.0320  4280 TYR B CD2 
2700 C  CE1 . TYR B 30  ? 0.3654 0.3934 0.6120 -0.0565 -0.0405 0.0338  4280 TYR B CE1 
2701 C  CE2 . TYR B 30  ? 0.3764 0.3927 0.6110 -0.0505 -0.0357 0.0336  4280 TYR B CE2 
2702 C  CZ  . TYR B 30  ? 0.3653 0.3925 0.6117 -0.0541 -0.0395 0.0342  4280 TYR B CZ  
2703 O  OH  . TYR B 30  ? 0.3469 0.3729 0.5947 -0.0542 -0.0421 0.0352  4280 TYR B OH  
2704 N  N   . LYS B 31  ? 0.4551 0.4670 0.7193 -0.0514 -0.0708 0.0101  4281 LYS B N   
2705 C  CA  . LYS B 31  ? 0.4869 0.4955 0.7717 -0.0466 -0.0928 0.0006  4281 LYS B CA  
2706 C  C   . LYS B 31  ? 0.4662 0.5006 0.8183 -0.0533 -0.0878 -0.0057 4281 LYS B C   
2707 O  O   . LYS B 31  ? 0.4516 0.4970 0.8351 -0.0518 -0.0885 -0.0093 4281 LYS B O   
2708 C  CB  . LYS B 31  ? 0.5484 0.5183 0.8024 -0.0376 -0.1221 -0.0064 4281 LYS B CB  
2709 C  CG  . LYS B 31  ? 0.6115 0.5378 0.7900 -0.0283 -0.1174 0.0000  4281 LYS B CG  
2710 C  CD  . LYS B 31  ? 0.6977 0.5623 0.8196 -0.0164 -0.1438 -0.0063 4281 LYS B CD  
2711 C  CE  . LYS B 31  ? 0.7633 0.5701 0.8013 -0.0066 -0.1237 0.0022  4281 LYS B CE  
2712 N  NZ  . LYS B 31  ? 0.8669 0.5910 0.8255 0.0081  -0.1482 -0.0038 4281 LYS B NZ  
2713 N  N   . ASP B 32  ? 0.4757 0.5150 0.8507 -0.0602 -0.0782 -0.0069 4282 ASP B N   
2714 C  CA  . ASP B 32  ? 0.4738 0.5293 0.9176 -0.0676 -0.0610 -0.0123 4282 ASP B CA  
2715 C  C   . ASP B 32  ? 0.4566 0.5144 0.8905 -0.0700 -0.0262 -0.0043 4282 ASP B C   
2716 O  O   . ASP B 32  ? 0.4400 0.5041 0.9249 -0.0715 -0.0096 -0.0084 4282 ASP B O   
2717 C  CB  . ASP B 32  ? 0.5004 0.5519 0.9604 -0.0745 -0.0536 -0.0142 4282 ASP B CB  
2718 C  CG  . ASP B 32  ? 0.5314 0.5717 1.0039 -0.0716 -0.0918 -0.0245 4282 ASP B CG  
2719 O  OD1 . ASP B 32  ? 0.5620 0.5934 1.0399 -0.0633 -0.1266 -0.0326 4282 ASP B OD1 
2720 O  OD2 . ASP B 32  ? 0.5399 0.5717 1.0082 -0.0762 -0.0894 -0.0248 4282 ASP B OD2 
2721 N  N   . TYR B 33  ? 0.4605 0.5068 0.8327 -0.0692 -0.0172 0.0059  4283 TYR B N   
2722 C  CA  . TYR B 33  ? 0.4661 0.4978 0.8083 -0.0687 0.0057  0.0129  4283 TYR B CA  
2723 C  C   . TYR B 33  ? 0.4576 0.4960 0.8089 -0.0645 0.0019  0.0115  4283 TYR B C   
2724 O  O   . TYR B 33  ? 0.4728 0.4987 0.8318 -0.0644 0.0264  0.0122  4283 TYR B O   
2725 C  CB  . TYR B 33  ? 0.4767 0.4944 0.7630 -0.0669 0.0000  0.0209  4283 TYR B CB  
2726 C  CG  . TYR B 33  ? 0.4941 0.4901 0.7411 -0.0634 0.0043  0.0262  4283 TYR B CG  
2727 C  CD1 . TYR B 33  ? 0.5288 0.4841 0.7381 -0.0619 0.0232  0.0292  4283 TYR B CD1 
2728 C  CD2 . TYR B 33  ? 0.4879 0.4928 0.7273 -0.0603 -0.0116 0.0277  4283 TYR B CD2 
2729 C  CE1 . TYR B 33  ? 0.5682 0.4887 0.7282 -0.0564 0.0191  0.0327  4283 TYR B CE1 
2730 C  CE2 . TYR B 33  ? 0.4993 0.4807 0.7053 -0.0572 -0.0143 0.0311  4283 TYR B CE2 
2731 C  CZ  . TYR B 33  ? 0.5510 0.4883 0.7146 -0.0545 -0.0026 0.0331  4283 TYR B CZ  
2732 O  OH  . TYR B 33  ? 0.5808 0.4811 0.6996 -0.0492 -0.0126 0.0351  4283 TYR B OH  
2733 N  N   . LEU B 34  ? 0.4376 0.4862 0.7806 -0.0601 -0.0236 0.0103  4284 LEU B N   
2734 C  CA  . LEU B 34  ? 0.4331 0.4853 0.7805 -0.0551 -0.0299 0.0087  4284 LEU B CA  
2735 C  C   . LEU B 34  ? 0.4376 0.5011 0.8513 -0.0541 -0.0284 -0.0006 4284 LEU B C   
2736 O  O   . LEU B 34  ? 0.4413 0.5034 0.8686 -0.0521 -0.0129 -0.0004 4284 LEU B O   
2737 C  CB  . LEU B 34  ? 0.4211 0.4692 0.7399 -0.0495 -0.0540 0.0088  4284 LEU B CB  
2738 C  CG  . LEU B 34  ? 0.4154 0.4548 0.6913 -0.0505 -0.0499 0.0175  4284 LEU B CG  
2739 C  CD1 . LEU B 34  ? 0.4281 0.4513 0.6767 -0.0445 -0.0614 0.0178  4284 LEU B CD1 
2740 C  CD2 . LEU B 34  ? 0.4119 0.4481 0.6741 -0.0517 -0.0406 0.0225  4284 LEU B CD2 
2741 N  N   . ALA B 35  ? 0.4523 0.5239 0.9110 -0.0549 -0.0452 -0.0094 4285 ALA B N   
2742 C  CA  . ALA B 35  ? 0.4683 0.5537 1.0165 -0.0540 -0.0510 -0.0215 4285 ALA B CA  
2743 C  C   . ALA B 35  ? 0.4884 0.5747 1.0826 -0.0602 -0.0024 -0.0196 4285 ALA B C   
2744 O  O   . ALA B 35  ? 0.4961 0.5926 1.1655 -0.0582 0.0066  -0.0268 4285 ALA B O   
2745 C  CB  . ALA B 35  ? 0.4636 0.5498 1.0478 -0.0545 -0.0824 -0.0318 4285 ALA B CB  
2746 N  N   A SER B 36  ? 0.5093 0.5768 1.0563 -0.0660 0.0291  -0.0104 4286 SER B N   
2747 N  N   B SER B 36  ? 0.5094 0.5769 1.0566 -0.0660 0.0292  -0.0104 4286 SER B N   
2748 C  CA  A SER B 36  ? 0.5394 0.5833 1.1015 -0.0698 0.0833  -0.0068 4286 SER B CA  
2749 C  CA  B SER B 36  ? 0.5396 0.5836 1.1021 -0.0698 0.0834  -0.0068 4286 SER B CA  
2750 C  C   A SER B 36  ? 0.5689 0.5842 1.0701 -0.0640 0.1055  0.0015  4286 SER B C   
2751 C  C   B SER B 36  ? 0.5688 0.5844 1.0710 -0.0640 0.1056  0.0014  4286 SER B C   
2752 O  O   A SER B 36  ? 0.6185 0.5923 1.0988 -0.0641 0.1535  0.0064  4286 SER B O   
2753 O  O   B SER B 36  ? 0.6180 0.5925 1.1009 -0.0641 0.1538  0.0062  4286 SER B O   
2754 C  CB  A SER B 36  ? 0.5661 0.5860 1.0895 -0.0755 0.1035  -0.0014 4286 SER B CB  
2755 C  CB  B SER B 36  ? 0.5668 0.5865 1.0900 -0.0754 0.1038  -0.0014 4286 SER B CB  
2756 O  OG  A SER B 36  ? 0.5539 0.5965 1.1355 -0.0811 0.0846  -0.0097 4286 SER B OG  
2757 O  OG  B SER B 36  ? 0.5778 0.5802 1.0049 -0.0724 0.0879  0.0076  4286 SER B OG  
2758 N  N   . GLY B 37  ? 0.5436 0.5704 1.0102 -0.0586 0.0738  0.0029  4287 GLY B N   
2759 C  CA  . GLY B 37  ? 0.5588 0.5579 0.9681 -0.0531 0.0871  0.0096  4287 GLY B CA  
2760 C  C   . GLY B 37  ? 0.5766 0.5433 0.8907 -0.0524 0.0800  0.0187  4287 GLY B C   
2761 O  O   . GLY B 37  ? 0.6184 0.5465 0.8761 -0.0475 0.0913  0.0237  4287 GLY B O   
2762 N  N   . GLY B 38  ? 0.5358 0.5135 0.8349 -0.0559 0.0588  0.0198  4288 GLY B N   
2763 C  CA  . GLY B 38  ? 0.5553 0.5059 0.7837 -0.0544 0.0456  0.0263  4288 GLY B CA  
2764 C  C   . GLY B 38  ? 0.5305 0.4884 0.7372 -0.0515 0.0194  0.0281  4288 GLY B C   
2765 O  O   . GLY B 38  ? 0.4971 0.4888 0.7378 -0.0516 0.0049  0.0250  4288 GLY B O   
2766 N  N   . GLN B 39  ? 0.5292 0.5715 0.9167 -0.0479 0.0780  0.0884  4289 GLN B N   
2767 C  CA  . GLN B 39  ? 0.5183 0.5496 0.8601 -0.0369 0.0710  0.0787  4289 GLN B CA  
2768 C  C   . GLN B 39  ? 0.4626 0.4816 0.7748 -0.0415 0.0431  0.0689  4289 GLN B C   
2769 O  O   . GLN B 39  ? 0.4537 0.4582 0.7472 -0.0481 0.0397  0.0688  4289 GLN B O   
2770 C  CB  . GLN B 39  ? 0.5793 0.5912 0.8733 -0.0283 0.0951  0.0802  4289 GLN B CB  
2771 C  CG  . GLN B 39  ? 0.6411 0.6616 0.9561 -0.0217 0.1266  0.0884  4289 GLN B CG  
2772 C  CD  . GLN B 39  ? 0.6602 0.6974 1.0042 -0.0121 0.1279  0.0853  4289 GLN B CD  
2773 O  OE1 . GLN B 39  ? 0.6984 0.7348 1.0316 -0.0083 0.1073  0.0767  4289 GLN B OE1 
2774 N  NE2 . GLN B 39  ? 0.7138 0.7657 1.0961 -0.0075 0.1537  0.0932  4289 GLN B NE2 
2775 N  N   . PRO B 40  ? 0.4124 0.4361 0.7199 -0.0377 0.0236  0.0611  4290 PRO B N   
2776 C  CA  . PRO B 40  ? 0.3871 0.3992 0.6648 -0.0412 0.0001  0.0519  4290 PRO B CA  
2777 C  C   . PRO B 40  ? 0.3728 0.3618 0.5986 -0.0389 0.0044  0.0484  4290 PRO B C   
2778 O  O   . PRO B 40  ? 0.3713 0.3522 0.5744 -0.0323 0.0219  0.0512  4290 PRO B O   
2779 C  CB  . PRO B 40  ? 0.3884 0.4070 0.6622 -0.0340 -0.0124 0.0472  4290 PRO B CB  
2780 C  CG  . PRO B 40  ? 0.3967 0.4372 0.7198 -0.0304 -0.0045 0.0544  4290 PRO B CG  
2781 C  CD  . PRO B 40  ? 0.4106 0.4505 0.7429 -0.0294 0.0242  0.0619  4290 PRO B CD  
2782 N  N   . ILE B 41  ? 0.3469 0.3256 0.5559 -0.0442 -0.0117 0.0422  4291 ILE B N   
2783 C  CA  . ILE B 41  ? 0.3511 0.3103 0.5167 -0.0417 -0.0108 0.0391  4291 ILE B CA  
2784 C  C   . ILE B 41  ? 0.3442 0.3004 0.4803 -0.0325 -0.0092 0.0358  4291 ILE B C   
2785 O  O   . ILE B 41  ? 0.3282 0.2918 0.4682 -0.0302 -0.0199 0.0314  4291 ILE B O   
2786 C  CB  . ILE B 41  ? 0.3520 0.3027 0.5101 -0.0475 -0.0283 0.0316  4291 ILE B CB  
2787 C  CG1 . ILE B 41  ? 0.3616 0.3088 0.5446 -0.0569 -0.0276 0.0349  4291 ILE B CG1 
2788 C  CG2 . ILE B 41  ? 0.3582 0.2937 0.4769 -0.0426 -0.0295 0.0277  4291 ILE B CG2 
2789 C  CD1 . ILE B 41  ? 0.3727 0.3096 0.5518 -0.0631 -0.0447 0.0254  4291 ILE B CD1 
2790 N  N   . THR B 42  ? 0.3489 0.2931 0.4564 -0.0281 0.0029  0.0384  4292 THR B N   
2791 C  CA  . THR B 42  ? 0.3558 0.2943 0.4346 -0.0207 0.0045  0.0347  4292 THR B CA  
2792 C  C   . THR B 42  ? 0.3442 0.2726 0.3943 -0.0206 -0.0074 0.0296  4292 THR B C   
2793 O  O   . THR B 42  ? 0.3298 0.2553 0.3821 -0.0249 -0.0152 0.0287  4292 THR B O   
2794 C  CB  . THR B 42  ? 0.3862 0.3164 0.4479 -0.0162 0.0237  0.0395  4292 THR B CB  
2795 O  OG1 . THR B 42  ? 0.4032 0.3221 0.4485 -0.0191 0.0272  0.0448  4292 THR B OG1 
2796 C  CG2 . THR B 42  ? 0.4033 0.3442 0.4945 -0.0146 0.0401  0.0446  4292 THR B CG2 
2797 N  N   . ASN B 43  ? 0.3486 0.2716 0.3757 -0.0158 -0.0082 0.0261  4293 ASN B N   
2798 C  CA  . ASN B 43  ? 0.3495 0.2648 0.3523 -0.0154 -0.0177 0.0226  4293 ASN B CA  
2799 C  C   . ASN B 43  ? 0.3223 0.2430 0.3325 -0.0176 -0.0308 0.0178  4293 ASN B C   
2800 O  O   . ASN B 43  ? 0.3260 0.2423 0.3238 -0.0180 -0.0367 0.0159  4293 ASN B O   
2801 C  CB  . ASN B 43  ? 0.3771 0.2825 0.3642 -0.0161 -0.0149 0.0271  4293 ASN B CB  
2802 C  CG  . ASN B 43  ? 0.4177 0.3141 0.3844 -0.0131 -0.0033 0.0308  4293 ASN B CG  
2803 O  OD1 . ASN B 43  ? 0.4717 0.3650 0.4253 -0.0100 -0.0015 0.0267  4293 ASN B OD1 
2804 N  ND2 . ASN B 43  ? 0.4569 0.3467 0.4186 -0.0141 0.0050  0.0384  4293 ASN B ND2 
2805 N  N   . CYS B 44  ? 0.3120 0.2419 0.3412 -0.0188 -0.0353 0.0164  4294 CYS B N   
2806 C  CA  . CYS B 44  ? 0.3038 0.2359 0.3302 -0.0201 -0.0476 0.0119  4294 CYS B CA  
2807 C  C   . CYS B 44  ? 0.2990 0.2273 0.3072 -0.0166 -0.0482 0.0106  4294 CYS B C   
2808 O  O   . CYS B 44  ? 0.3120 0.2392 0.3198 -0.0133 -0.0424 0.0120  4294 CYS B O   
2809 C  CB  . CYS B 44  ? 0.3092 0.2509 0.3563 -0.0220 -0.0549 0.0118  4294 CYS B CB  
2810 S  SG  . CYS B 44  ? 0.3260 0.2722 0.3995 -0.0286 -0.0562 0.0128  4294 CYS B SG  
2811 N  N   . VAL B 45  ? 0.2915 0.2169 0.2868 -0.0173 -0.0535 0.0080  4295 VAL B N   
2812 C  CA  . VAL B 45  ? 0.2892 0.2112 0.2707 -0.0156 -0.0539 0.0077  4295 VAL B CA  
2813 C  C   . VAL B 45  ? 0.2885 0.2125 0.2708 -0.0150 -0.0584 0.0080  4295 VAL B C   
2814 O  O   . VAL B 45  ? 0.2944 0.2199 0.2727 -0.0164 -0.0636 0.0072  4295 VAL B O   
2815 C  CB  . VAL B 45  ? 0.2868 0.2070 0.2599 -0.0165 -0.0556 0.0065  4295 VAL B CB  
2816 C  CG1 . VAL B 45  ? 0.2924 0.2113 0.2574 -0.0164 -0.0569 0.0069  4295 VAL B CG1 
2817 C  CG2 . VAL B 45  ? 0.2864 0.2032 0.2593 -0.0162 -0.0526 0.0082  4295 VAL B CG2 
2818 N  N   . LYS B 46  ? 0.2897 0.2117 0.2751 -0.0123 -0.0555 0.0095  4296 LYS B N   
2819 C  CA  . LYS B 46  ? 0.2955 0.2174 0.2830 -0.0107 -0.0600 0.0117  4296 LYS B CA  
2820 C  C   . LYS B 46  ? 0.2905 0.2060 0.2645 -0.0123 -0.0609 0.0117  4296 LYS B C   
2821 O  O   . LYS B 46  ? 0.2951 0.2047 0.2624 -0.0129 -0.0576 0.0096  4296 LYS B O   
2822 C  CB  . LYS B 46  ? 0.3071 0.2281 0.3072 -0.0061 -0.0556 0.0133  4296 LYS B CB  
2823 C  CG  . LYS B 46  ? 0.3200 0.2420 0.3279 -0.0035 -0.0620 0.0177  4296 LYS B CG  
2824 C  CD  . LYS B 46  ? 0.3443 0.2694 0.3738 0.0024  -0.0581 0.0202  4296 LYS B CD  
2825 C  CE  . LYS B 46  ? 0.3536 0.2668 0.3788 0.0069  -0.0469 0.0172  4296 LYS B CE  
2826 N  NZ  . LYS B 46  ? 0.3633 0.2793 0.4123 0.0146  -0.0414 0.0199  4296 LYS B NZ  
2827 N  N   . MET B 47  ? 0.2973 0.2135 0.2673 -0.0135 -0.0658 0.0145  4297 MET B N   
2828 C  CA  . MET B 47  ? 0.2982 0.2099 0.2594 -0.0160 -0.0651 0.0162  4297 MET B CA  
2829 C  C   . MET B 47  ? 0.3127 0.2164 0.2758 -0.0147 -0.0658 0.0201  4297 MET B C   
2830 O  O   . MET B 47  ? 0.3117 0.2150 0.2818 -0.0108 -0.0685 0.0232  4297 MET B O   
2831 C  CB  . MET B 47  ? 0.3121 0.2270 0.2647 -0.0180 -0.0667 0.0182  4297 MET B CB  
2832 C  CG  . MET B 47  ? 0.3112 0.2310 0.2619 -0.0183 -0.0665 0.0135  4297 MET B CG  
2833 S  SD  . MET B 47  ? 0.3064 0.2280 0.2627 -0.0187 -0.0619 0.0097  4297 MET B SD  
2834 C  CE  . MET B 47  ? 0.3042 0.2265 0.2598 -0.0211 -0.0589 0.0124  4297 MET B CE  
2835 N  N   . LEU B 48  ? 0.3172 0.2144 0.2770 -0.0180 -0.0641 0.0204  4298 LEU B N   
2836 C  CA  . LEU B 48  ? 0.3291 0.2156 0.2904 -0.0180 -0.0648 0.0248  4298 LEU B CA  
2837 C  C   . LEU B 48  ? 0.3381 0.2266 0.2939 -0.0197 -0.0663 0.0329  4298 LEU B C   
2838 O  O   . LEU B 48  ? 0.3423 0.2376 0.2927 -0.0230 -0.0640 0.0331  4298 LEU B O   
2839 C  CB  . LEU B 48  ? 0.3313 0.2092 0.2920 -0.0227 -0.0637 0.0215  4298 LEU B CB  
2840 C  CG  . LEU B 48  ? 0.3398 0.2099 0.2978 -0.0207 -0.0624 0.0134  4298 LEU B CG  
2841 C  CD1 . LEU B 48  ? 0.3535 0.2181 0.3071 -0.0271 -0.0652 0.0089  4298 LEU B CD1 
2842 C  CD2 . LEU B 48  ? 0.3446 0.2018 0.3059 -0.0152 -0.0599 0.0129  4298 LEU B CD2 
2843 N  N   . CYS B 49  ? 0.3484 0.2308 0.3050 -0.0166 -0.0695 0.0398  4299 CYS B N   
2844 C  CA  . CYS B 49  ? 0.3715 0.2530 0.3167 -0.0180 -0.0713 0.0491  4299 CYS B CA  
2845 C  C   . CYS B 49  ? 0.3831 0.2524 0.3318 -0.0151 -0.0746 0.0585  4299 CYS B C   
2846 O  O   . CYS B 49  ? 0.3772 0.2396 0.3391 -0.0112 -0.0748 0.0558  4299 CYS B O   
2847 C  CB  . CYS B 49  ? 0.3812 0.2719 0.3164 -0.0164 -0.0759 0.0482  4299 CYS B CB  
2848 S  SG  . CYS B 49  ? 0.4109 0.3072 0.3597 -0.0103 -0.0851 0.0466  4299 CYS B SG  
2849 N  N   . THR B 50  ? 0.3998 0.2647 0.3356 -0.0165 -0.0759 0.0693  4300 THR B N   
2850 C  CA  . THR B 50  ? 0.4225 0.2736 0.3602 -0.0137 -0.0795 0.0814  4300 THR B CA  
2851 C  C   . THR B 50  ? 0.4228 0.2763 0.3669 -0.0055 -0.0904 0.0851  4300 THR B C   
2852 O  O   . THR B 50  ? 0.4268 0.2691 0.3818 -0.0006 -0.0935 0.0929  4300 THR B O   
2853 C  CB  . THR B 50  ? 0.4485 0.2940 0.3665 -0.0179 -0.0767 0.0938  4300 THR B CB  
2854 O  OG1 . THR B 50  ? 0.4509 0.3050 0.3484 -0.0167 -0.0814 0.0940  4300 THR B OG1 
2855 C  CG2 . THR B 50  ? 0.4502 0.2956 0.3689 -0.0262 -0.0650 0.0926  4300 THR B CG2 
2856 N  N   . HIS B 51  ? 0.4114 0.2785 0.3519 -0.0041 -0.0965 0.0802  4301 HIS B N   
2857 C  CA  . HIS B 51  ? 0.4191 0.2919 0.3692 0.0022  -0.1097 0.0849  4301 HIS B CA  
2858 C  C   . HIS B 51  ? 0.4520 0.3159 0.3855 0.0037  -0.1193 0.1006  4301 HIS B C   
2859 O  O   . HIS B 51  ? 0.4672 0.3311 0.4153 0.0105  -0.1306 0.1089  4301 HIS B O   
2860 C  CB  . HIS B 51  ? 0.4049 0.2787 0.3863 0.0092  -0.1081 0.0817  4301 HIS B CB  
2861 C  CG  . HIS B 51  ? 0.3888 0.2716 0.3797 0.0078  -0.1000 0.0678  4301 HIS B CG  
2862 N  ND1 . HIS B 51  ? 0.3808 0.2787 0.3840 0.0092  -0.1046 0.0631  4301 HIS B ND1 
2863 C  CD2 . HIS B 51  ? 0.3764 0.2548 0.3650 0.0044  -0.0887 0.0586  4301 HIS B CD2 
2864 C  CE1 . HIS B 51  ? 0.3671 0.2685 0.3741 0.0072  -0.0946 0.0526  4301 HIS B CE1 
2865 N  NE2 . HIS B 51  ? 0.3704 0.2600 0.3669 0.0046  -0.0858 0.0496  4301 HIS B NE2 
2866 N  N   . THR B 52  ? 0.4724 0.3293 0.3774 -0.0019 -0.1143 0.1053  4302 THR B N   
2867 C  CA  . THR B 52  ? 0.5171 0.3635 0.3963 -0.0016 -0.1217 0.1213  4302 THR B CA  
2868 C  C   . THR B 52  ? 0.5371 0.3867 0.3807 -0.0064 -0.1218 0.1177  4302 THR B C   
2869 O  O   . THR B 52  ? 0.5697 0.4083 0.3823 -0.0086 -0.1194 0.1287  4302 THR B O   
2870 C  CB  . THR B 52  ? 0.5387 0.3684 0.4157 -0.0036 -0.1117 0.1330  4302 THR B CB  
2871 O  OG1 . THR B 52  ? 0.5343 0.3651 0.4050 -0.0113 -0.0955 0.1262  4302 THR B OG1 
2872 C  CG2 . THR B 52  ? 0.5344 0.3563 0.4438 0.0013  -0.1113 0.1347  4302 THR B CG2 
2873 N  N   . GLY B 53  ? 0.5157 0.3780 0.3628 -0.0077 -0.1237 0.1030  4303 GLY B N   
2874 C  CA  . GLY B 53  ? 0.5313 0.3945 0.3463 -0.0117 -0.1227 0.0958  4303 GLY B CA  
2875 C  C   . GLY B 53  ? 0.5647 0.4253 0.3554 -0.0106 -0.1425 0.0997  4303 GLY B C   
2876 O  O   . GLY B 53  ? 0.5693 0.4302 0.3728 -0.0063 -0.1583 0.1100  4303 GLY B O   
2877 N  N   . THR B 54  ? 0.5835 0.4411 0.3409 -0.0142 -0.1422 0.0913  4304 THR B N   
2878 C  CA  . THR B 54  ? 0.6284 0.4801 0.3529 -0.0148 -0.1625 0.0926  4304 THR B CA  
2879 C  C   . THR B 54  ? 0.6083 0.4732 0.3635 -0.0140 -0.1837 0.0868  4304 THR B C   
2880 O  O   . THR B 54  ? 0.6279 0.4906 0.3694 -0.0137 -0.2066 0.0929  4304 THR B O   
2881 C  CB  . THR B 54  ? 0.6619 0.5045 0.3435 -0.0189 -0.1542 0.0809  4304 THR B CB  
2882 O  OG1 . THR B 54  ? 0.6338 0.4864 0.3382 -0.0207 -0.1489 0.0634  4304 THR B OG1 
2883 C  CG2 . THR B 54  ? 0.6836 0.5158 0.3391 -0.0195 -0.1302 0.0866  4304 THR B CG2 
2884 N  N   . GLY B 55  ? 0.5661 0.4444 0.3611 -0.0140 -0.1766 0.0765  4305 GLY B N   
2885 C  CA  . GLY B 55  ? 0.5522 0.4448 0.3813 -0.0139 -0.1930 0.0715  4305 GLY B CA  
2886 C  C   . GLY B 55  ? 0.5611 0.4533 0.3741 -0.0201 -0.2014 0.0569  4305 GLY B C   
2887 O  O   . GLY B 55  ? 0.5586 0.4626 0.4001 -0.0218 -0.2166 0.0530  4305 GLY B O   
2888 N  N   . GLN B 56  ? 0.5817 0.4604 0.3529 -0.0233 -0.1913 0.0490  4306 GLN B N   
2889 C  CA  . GLN B 56  ? 0.6004 0.4741 0.3539 -0.0289 -0.1973 0.0327  4306 GLN B CA  
2890 C  C   . GLN B 56  ? 0.5476 0.4337 0.3430 -0.0303 -0.1890 0.0221  4306 GLN B C   
2891 O  O   . GLN B 56  ? 0.4996 0.3937 0.3224 -0.0269 -0.1726 0.0255  4306 GLN B O   
2892 C  CB  . GLN B 56  ? 0.6541 0.5092 0.3552 -0.0299 -0.1834 0.0265  4306 GLN B CB  
2893 C  CG  . GLN B 56  ? 0.7311 0.5711 0.3826 -0.0298 -0.1947 0.0360  4306 GLN B CG  
2894 C  CD  . GLN B 56  ? 0.7932 0.6139 0.3910 -0.0302 -0.1773 0.0295  4306 GLN B CD  
2895 O  OE1 . GLN B 56  ? 0.8489 0.6702 0.4527 -0.0288 -0.1524 0.0233  4306 GLN B OE1 
2896 N  NE2 . GLN B 56  ? 0.8719 0.6752 0.4162 -0.0317 -0.1903 0.0315  4306 GLN B NE2 
2897 N  N   . ALA B 57  ? 0.5420 0.4272 0.3392 -0.0358 -0.2003 0.0098  4307 ALA B N   
2898 C  CA  . ALA B 57  ? 0.5098 0.4057 0.3473 -0.0383 -0.1956 0.0014  4307 ALA B CA  
2899 C  C   . ALA B 57  ? 0.4890 0.3806 0.3252 -0.0366 -0.1707 -0.0059 4307 ALA B C   
2900 O  O   . ALA B 57  ? 0.4576 0.3605 0.3281 -0.0344 -0.1597 -0.0032 4307 ALA B O   
2901 C  CB  . ALA B 57  ? 0.5318 0.4241 0.3678 -0.0460 -0.2153 -0.0092 4307 ALA B CB  
2902 N  N   . ILE B 58  ? 0.5145 0.3901 0.3130 -0.0373 -0.1626 -0.0151 4308 ILE B N   
2903 C  CA  . ILE B 58  ? 0.5072 0.3793 0.3075 -0.0351 -0.1403 -0.0223 4308 ILE B CA  
2904 C  C   . ILE B 58  ? 0.5280 0.3904 0.2932 -0.0313 -0.1253 -0.0197 4308 ILE B C   
2905 O  O   . ILE B 58  ? 0.5627 0.4100 0.2865 -0.0325 -0.1295 -0.0244 4308 ILE B O   
2906 C  CB  . ILE B 58  ? 0.5253 0.3874 0.3235 -0.0393 -0.1431 -0.0377 4308 ILE B CB  
2907 C  CG1 . ILE B 58  ? 0.5186 0.3910 0.3542 -0.0446 -0.1584 -0.0383 4308 ILE B CG1 
2908 C  CG2 . ILE B 58  ? 0.5160 0.3743 0.3187 -0.0356 -0.1214 -0.0436 4308 ILE B CG2 
2909 C  CD1 . ILE B 58  ? 0.5420 0.4022 0.3765 -0.0507 -0.1647 -0.0528 4308 ILE B CD1 
2910 N  N   . THR B 59  ? 0.4973 0.3677 0.2784 -0.0275 -0.1082 -0.0126 4309 THR B N   
2911 C  CA  . THR B 59  ? 0.5143 0.3794 0.2709 -0.0247 -0.0930 -0.0066 4309 THR B CA  
2912 C  C   . THR B 59  ? 0.4960 0.3661 0.2694 -0.0218 -0.0719 -0.0089 4309 THR B C   
2913 O  O   . THR B 59  ? 0.4611 0.3397 0.2660 -0.0215 -0.0711 -0.0119 4309 THR B O   
2914 C  CB  . THR B 59  ? 0.5139 0.3841 0.2750 -0.0241 -0.0983 0.0088  4309 THR B CB  
2915 O  OG1 . THR B 59  ? 0.4728 0.3565 0.2754 -0.0234 -0.0994 0.0123  4309 THR B OG1 
2916 C  CG2 . THR B 59  ? 0.5489 0.4134 0.2899 -0.0257 -0.1195 0.0132  4309 THR B CG2 
2917 N  N   A VAL B 60  ? 0.5127 0.3785 0.2672 -0.0197 -0.0555 -0.0055 4310 VAL B N   
2918 N  N   B VAL B 60  ? 0.5156 0.3807 0.2687 -0.0197 -0.0555 -0.0065 4310 VAL B N   
2919 C  CA  A VAL B 60  ? 0.5038 0.3768 0.2783 -0.0168 -0.0358 -0.0063 4310 VAL B CA  
2920 C  CA  B VAL B 60  ? 0.5087 0.3803 0.2801 -0.0166 -0.0353 -0.0076 4310 VAL B CA  
2921 C  C   A VAL B 60  ? 0.4677 0.3552 0.2766 -0.0177 -0.0354 0.0042  4310 VAL B C   
2922 C  C   B VAL B 60  ? 0.4702 0.3568 0.2776 -0.0174 -0.0343 0.0024  4310 VAL B C   
2923 O  O   A VAL B 60  ? 0.4362 0.3325 0.2718 -0.0164 -0.0280 0.0024  4310 VAL B O   
2924 O  O   B VAL B 60  ? 0.4402 0.3353 0.2723 -0.0157 -0.0246 0.0012  4310 VAL B O   
2925 C  CB  A VAL B 60  ? 0.5393 0.4050 0.2870 -0.0142 -0.0164 -0.0056 4310 VAL B CB  
2926 C  CB  B VAL B 60  ? 0.5471 0.4110 0.2899 -0.0142 -0.0166 -0.0060 4310 VAL B CB  
2927 C  CG1 A VAL B 60  ? 0.5832 0.4312 0.2943 -0.0125 -0.0148 -0.0193 4310 VAL B CG1 
2928 C  CG1 B VAL B 60  ? 0.5337 0.4081 0.3031 -0.0109 0.0036  -0.0052 4310 VAL B CG1 
2929 C  CG2 A VAL B 60  ? 0.5575 0.4211 0.2868 -0.0162 -0.0146 0.0084  4310 VAL B CG2 
2930 C  CG2 B VAL B 60  ? 0.5964 0.4412 0.2967 -0.0131 -0.0169 -0.0183 4310 VAL B CG2 
2931 N  N   A THR B 61  ? 0.4717 0.3595 0.2786 -0.0198 -0.0437 0.0145  4311 THR B N   
2932 N  N   B THR B 61  ? 0.4686 0.3567 0.2777 -0.0196 -0.0447 0.0119  4311 THR B N   
2933 C  CA  A THR B 61  ? 0.4525 0.3494 0.2888 -0.0210 -0.0445 0.0227  4311 THR B CA  
2934 C  CA  B THR B 61  ? 0.4472 0.3448 0.2854 -0.0207 -0.0451 0.0203  4311 THR B CA  
2935 C  C   A THR B 61  ? 0.4404 0.3368 0.2823 -0.0213 -0.0612 0.0257  4311 THR B C   
2936 C  C   B THR B 61  ? 0.4387 0.3355 0.2815 -0.0213 -0.0614 0.0245  4311 THR B C   
2937 O  O   A THR B 61  ? 0.4645 0.3548 0.2869 -0.0213 -0.0720 0.0253  4311 THR B O   
2938 O  O   B THR B 61  ? 0.4605 0.3512 0.2840 -0.0213 -0.0721 0.0241  4311 THR B O   
2939 C  CB  A THR B 61  ? 0.4710 0.3676 0.3050 -0.0226 -0.0331 0.0338  4311 THR B CB  
2940 C  CB  B THR B 61  ? 0.4629 0.3609 0.2993 -0.0220 -0.0320 0.0303  4311 THR B CB  
2941 O  OG1 A THR B 61  ? 0.5159 0.4020 0.3203 -0.0230 -0.0375 0.0414  4311 THR B OG1 
2942 O  OG1 B THR B 61  ? 0.4437 0.3496 0.3102 -0.0240 -0.0317 0.0348  4311 THR B OG1 
2943 C  CG2 A THR B 61  ? 0.4805 0.3811 0.3161 -0.0219 -0.0145 0.0320  4311 THR B CG2 
2944 C  CG2 B THR B 61  ? 0.4956 0.3837 0.3052 -0.0230 -0.0352 0.0403  4311 THR B CG2 
2945 N  N   . PRO B 62  ? 0.4164 0.3189 0.2850 -0.0214 -0.0642 0.0281  4312 PRO B N   
2946 C  CA  . PRO B 62  ? 0.4086 0.3111 0.2864 -0.0202 -0.0769 0.0317  4312 PRO B CA  
2947 C  C   . PRO B 62  ? 0.4328 0.3277 0.2917 -0.0197 -0.0839 0.0418  4312 PRO B C   
2948 O  O   . PRO B 62  ? 0.4419 0.3317 0.2915 -0.0207 -0.0763 0.0498  4312 PRO B O   
2949 C  CB  . PRO B 62  ? 0.3850 0.2906 0.2870 -0.0199 -0.0731 0.0336  4312 PRO B CB  
2950 C  CG  . PRO B 62  ? 0.3747 0.2851 0.2836 -0.0213 -0.0637 0.0272  4312 PRO B CG  
2951 C  CD  . PRO B 62  ? 0.3972 0.3058 0.2876 -0.0222 -0.0558 0.0276  4312 PRO B CD  
2952 N  N   . GLU B 63  ? 0.4404 0.3353 0.2954 -0.0186 -0.0988 0.0420  4313 GLU B N   
2953 C  CA  . GLU B 63  ? 0.4691 0.3565 0.3045 -0.0176 -0.1097 0.0527  4313 GLU B CA  
2954 C  C   . GLU B 63  ? 0.4543 0.3472 0.3142 -0.0143 -0.1246 0.0579  4313 GLU B C   
2955 O  O   . GLU B 63  ? 0.4759 0.3654 0.3235 -0.0131 -0.1395 0.0655  4313 GLU B O   
2956 C  CB  . GLU B 63  ? 0.5069 0.3872 0.3060 -0.0196 -0.1156 0.0484  4313 GLU B CB  
2957 C  CG  . GLU B 63  ? 0.5311 0.4036 0.3025 -0.0210 -0.0981 0.0468  4313 GLU B CG  
2958 C  CD  . GLU B 63  ? 0.5623 0.4270 0.3182 -0.0209 -0.0896 0.0613  4313 GLU B CD  
2959 O  OE1 . GLU B 63  ? 0.5765 0.4389 0.3391 -0.0194 -0.0993 0.0733  4313 GLU B OE1 
2960 O  OE2 . GLU B 63  ? 0.5965 0.4571 0.3353 -0.0221 -0.0724 0.0613  4313 GLU B OE2 
2961 N  N   . ALA B 64  ? 0.4224 0.3230 0.3153 -0.0123 -0.1203 0.0546  4314 ALA B N   
2962 C  CA  . ALA B 64  ? 0.4101 0.3170 0.3314 -0.0077 -0.1306 0.0594  4314 ALA B CA  
2963 C  C   . ALA B 64  ? 0.4381 0.3367 0.3555 -0.0038 -0.1369 0.0738  4314 ALA B C   
2964 O  O   . ALA B 64  ? 0.4334 0.3215 0.3390 -0.0045 -0.1268 0.0793  4314 ALA B O   
2965 C  CB  . ALA B 64  ? 0.3872 0.2991 0.3371 -0.0056 -0.1197 0.0542  4314 ALA B CB  
2966 N  N   . ASN B 65  ? 0.4457 0.3492 0.3747 -0.0002 -0.1537 0.0807  4315 ASN B N   
2967 C  CA  . ASN B 65  ? 0.4737 0.3697 0.4058 0.0054  -0.1616 0.0963  4315 ASN B CA  
2968 C  C   . ASN B 65  ? 0.4633 0.3639 0.4374 0.0123  -0.1559 0.0966  4315 ASN B C   
2969 O  O   . ASN B 65  ? 0.4308 0.3382 0.4215 0.0114  -0.1443 0.0851  4315 ASN B O   
2970 C  CB  . ASN B 65  ? 0.5081 0.4054 0.4268 0.0061  -0.1848 0.1052  4315 ASN B CB  
2971 C  CG  . ASN B 65  ? 0.4976 0.4126 0.4468 0.0068  -0.2000 0.1007  4315 ASN B CG  
2972 O  OD1 . ASN B 65  ? 0.4694 0.3956 0.4570 0.0097  -0.1923 0.0953  4315 ASN B OD1 
2973 N  ND2 . ASN B 65  ? 0.5222 0.4390 0.4541 0.0039  -0.2216 0.1032  4315 ASN B ND2 
2974 N  N   . MET B 66  ? 0.4794 0.3754 0.4689 0.0197  -0.1633 0.1096  4316 MET B N   
2975 C  CA  . MET B 66  ? 0.4895 0.3865 0.5179 0.0279  -0.1551 0.1093  4316 MET B CA  
2976 C  C   . MET B 66  ? 0.4629 0.3802 0.5268 0.0309  -0.1584 0.1030  4316 MET B C   
2977 O  O   . MET B 66  ? 0.4530 0.3720 0.5457 0.0370  -0.1457 0.0987  4316 MET B O   
2978 C  CB  . MET B 66  ? 0.5348 0.4212 0.5739 0.0363  -0.1632 0.1258  4316 MET B CB  
2979 C  CG  . MET B 66  ? 0.5868 0.4823 0.6286 0.0392  -0.1875 0.1382  4316 MET B CG  
2980 S  SD  . MET B 66  ? 0.6698 0.5484 0.7156 0.0488  -0.1978 0.1609  4316 MET B SD  
2981 C  CE  . MET B 66  ? 0.6755 0.5699 0.7259 0.0511  -0.2305 0.1735  4316 MET B CE  
2982 N  N   . ASP B 67  ? 0.4626 0.3935 0.5234 0.0263  -0.1737 0.1019  4317 ASP B N   
2983 C  CA  . ASP B 67  ? 0.4530 0.4050 0.5523 0.0275  -0.1792 0.0979  4317 ASP B CA  
2984 C  C   . ASP B 67  ? 0.4215 0.3796 0.5127 0.0189  -0.1703 0.0832  4317 ASP B C   
2985 O  O   . ASP B 67  ? 0.4061 0.3811 0.5254 0.0171  -0.1760 0.0801  4317 ASP B O   
2986 C  CB  . ASP B 67  ? 0.4931 0.4562 0.5996 0.0269  -0.2066 0.1071  4317 ASP B CB  
2987 C  CG  . ASP B 67  ? 0.5378 0.4949 0.6505 0.0356  -0.2198 0.1244  4317 ASP B CG  
2988 O  OD1 . ASP B 67  ? 0.5532 0.5055 0.6904 0.0450  -0.2076 0.1291  4317 ASP B OD1 
2989 O  OD2 . ASP B 67  ? 0.5765 0.5316 0.6668 0.0330  -0.2423 0.1330  4317 ASP B OD2 
2990 N  N   . GLN B 68  ? 0.3931 0.3385 0.4516 0.0140  -0.1569 0.0756  4318 GLN B N   
2991 C  CA  . GLN B 68  ? 0.3761 0.3255 0.4254 0.0065  -0.1498 0.0630  4318 GLN B CA  
2992 C  C   . GLN B 68  ? 0.3587 0.2994 0.3986 0.0060  -0.1290 0.0556  4318 GLN B C   
2993 O  O   . GLN B 68  ? 0.3504 0.2795 0.3835 0.0094  -0.1215 0.0591  4318 GLN B O   
2994 C  CB  . GLN B 68  ? 0.3902 0.3330 0.4011 -0.0007 -0.1594 0.0603  4318 GLN B CB  
2995 C  CG  . GLN B 68  ? 0.4086 0.3566 0.4171 -0.0025 -0.1833 0.0653  4318 GLN B CG  
2996 C  CD  . GLN B 68  ? 0.4374 0.3725 0.3977 -0.0082 -0.1895 0.0628  4318 GLN B CD  
2997 O  OE1 . GLN B 68  ? 0.4350 0.3576 0.3670 -0.0084 -0.1769 0.0632  4318 GLN B OE1 
2998 N  NE2 . GLN B 68  ? 0.4572 0.3947 0.4078 -0.0131 -0.2088 0.0600  4318 GLN B NE2 
2999 N  N   . GLU B 69  ? 0.3423 0.2876 0.3825 0.0014  -0.1218 0.0462  4319 GLU B N   
3000 C  CA  . GLU B 69  ? 0.3379 0.2760 0.3651 -0.0005 -0.1059 0.0388  4319 GLU B CA  
3001 C  C   . GLU B 69  ? 0.3472 0.2833 0.3500 -0.0073 -0.1081 0.0330  4319 GLU B C   
3002 O  O   . GLU B 69  ? 0.3639 0.3055 0.3676 -0.0105 -0.1190 0.0313  4319 GLU B O   
3003 C  CB  . GLU B 69  ? 0.3305 0.2749 0.3802 0.0013  -0.0947 0.0344  4319 GLU B CB  
3004 C  CG  . GLU B 69  ? 0.3393 0.2842 0.4128 0.0094  -0.0883 0.0384  4319 GLU B CG  
3005 C  CD  . GLU B 69  ? 0.3615 0.2907 0.4220 0.0126  -0.0769 0.0362  4319 GLU B CD  
3006 O  OE1 . GLU B 69  ? 0.3683 0.2950 0.4433 0.0186  -0.0659 0.0347  4319 GLU B OE1 
3007 O  OE2 . GLU B 69  ? 0.3816 0.3008 0.4178 0.0087  -0.0784 0.0356  4319 GLU B OE2 
3008 N  N   . SER B 70  ? 0.3405 0.2684 0.3239 -0.0092 -0.0990 0.0300  4320 SER B N   
3009 C  CA  . SER B 70  ? 0.3425 0.2683 0.3060 -0.0139 -0.0975 0.0242  4320 SER B CA  
3010 C  C   . SER B 70  ? 0.3322 0.2599 0.3033 -0.0149 -0.0879 0.0178  4320 SER B C   
3011 O  O   . SER B 70  ? 0.3208 0.2465 0.2978 -0.0130 -0.0802 0.0182  4320 SER B O   
3012 C  CB  . SER B 70  ? 0.3582 0.2761 0.2994 -0.0150 -0.0934 0.0270  4320 SER B CB  
3013 O  OG  . SER B 70  ? 0.3771 0.2911 0.3040 -0.0146 -0.1023 0.0338  4320 SER B OG  
3014 N  N   . PHE B 71  ? 0.3287 0.2579 0.2975 -0.0179 -0.0893 0.0120  4321 PHE B N   
3015 C  CA  . PHE B 71  ? 0.3112 0.2408 0.2864 -0.0187 -0.0812 0.0077  4321 PHE B CA  
3016 C  C   . PHE B 71  ? 0.3180 0.2429 0.2786 -0.0205 -0.0787 0.0026  4321 PHE B C   
3017 O  O   . PHE B 71  ? 0.3278 0.2492 0.2746 -0.0220 -0.0840 -0.0001 4321 PHE B O   
3018 C  CB  . PHE B 71  ? 0.3058 0.2409 0.3008 -0.0201 -0.0835 0.0065  4321 PHE B CB  
3019 C  CG  . PHE B 71  ? 0.2943 0.2358 0.3102 -0.0172 -0.0818 0.0113  4321 PHE B CG  
3020 C  CD1 . PHE B 71  ? 0.3061 0.2534 0.3337 -0.0159 -0.0912 0.0154  4321 PHE B CD1 
3021 C  CD2 . PHE B 71  ? 0.2886 0.2297 0.3120 -0.0150 -0.0704 0.0121  4321 PHE B CD2 
3022 C  CE1 . PHE B 71  ? 0.2993 0.2534 0.3510 -0.0116 -0.0877 0.0200  4321 PHE B CE1 
3023 C  CE2 . PHE B 71  ? 0.2895 0.2352 0.3314 -0.0111 -0.0654 0.0156  4321 PHE B CE2 
3024 C  CZ  . PHE B 71  ? 0.2902 0.2433 0.3491 -0.0090 -0.0734 0.0195  4321 PHE B CZ  
3025 N  N   . GLY B 72  ? 0.3040 0.2278 0.2662 -0.0197 -0.0709 0.0015  4322 GLY B N   
3026 C  CA  . GLY B 72  ? 0.3109 0.2310 0.2663 -0.0199 -0.0674 -0.0030 4322 GLY B CA  
3027 C  C   . GLY B 72  ? 0.3236 0.2403 0.2821 -0.0222 -0.0721 -0.0083 4322 GLY B C   
3028 O  O   . GLY B 72  ? 0.3284 0.2475 0.3021 -0.0237 -0.0736 -0.0070 4322 GLY B O   
3029 N  N   . GLY B 73  ? 0.3456 0.2555 0.2895 -0.0229 -0.0736 -0.0144 4323 GLY B N   
3030 C  CA  . GLY B 73  ? 0.3586 0.2616 0.3018 -0.0265 -0.0806 -0.0216 4323 GLY B CA  
3031 C  C   . GLY B 73  ? 0.3595 0.2592 0.3194 -0.0276 -0.0775 -0.0234 4323 GLY B C   
3032 O  O   . GLY B 73  ? 0.3694 0.2700 0.3439 -0.0322 -0.0841 -0.0238 4323 GLY B O   
3033 N  N   . ALA B 74  ? 0.3560 0.2521 0.3164 -0.0238 -0.0684 -0.0234 4324 ALA B N   
3034 C  CA  . ALA B 74  ? 0.3615 0.2514 0.3360 -0.0242 -0.0655 -0.0235 4324 ALA B CA  
3035 C  C   . ALA B 74  ? 0.3496 0.2463 0.3416 -0.0270 -0.0663 -0.0159 4324 ALA B C   
3036 O  O   . ALA B 74  ? 0.3416 0.2333 0.3468 -0.0309 -0.0675 -0.0164 4324 ALA B O   
3037 C  CB  . ALA B 74  ? 0.3641 0.2520 0.3390 -0.0183 -0.0570 -0.0215 4324 ALA B CB  
3038 N  N   . SER B 75  ? 0.3288 0.2352 0.3210 -0.0251 -0.0645 -0.0095 4325 SER B N   
3039 C  CA  . SER B 75  ? 0.3200 0.2315 0.3257 -0.0262 -0.0614 -0.0027 4325 SER B CA  
3040 C  C   . SER B 75  ? 0.3251 0.2422 0.3466 -0.0309 -0.0670 -0.0030 4325 SER B C   
3041 O  O   . SER B 75  ? 0.3153 0.2367 0.3530 -0.0321 -0.0619 0.0024  4325 SER B O   
3042 C  CB  . SER B 75  ? 0.3198 0.2364 0.3187 -0.0226 -0.0575 0.0020  4325 SER B CB  
3043 O  OG  . SER B 75  ? 0.3214 0.2432 0.3169 -0.0223 -0.0620 0.0009  4325 SER B OG  
3044 N  N   . CYS B 76  ? 0.3331 0.2504 0.3503 -0.0333 -0.0770 -0.0087 4326 CYS B N   
3045 C  CA  . CYS B 76  ? 0.3461 0.2708 0.3813 -0.0381 -0.0866 -0.0086 4326 CYS B CA  
3046 C  C   . CYS B 76  ? 0.3578 0.2744 0.3988 -0.0450 -0.0948 -0.0157 4326 CYS B C   
3047 O  O   . CYS B 76  ? 0.3639 0.2863 0.4202 -0.0506 -0.1065 -0.0168 4326 CYS B O   
3048 C  CB  . CYS B 76  ? 0.3676 0.2972 0.3925 -0.0366 -0.0960 -0.0088 4326 CYS B CB  
3049 S  SG  . CYS B 76  ? 0.3823 0.3185 0.4039 -0.0295 -0.0877 -0.0011 4326 CYS B SG  
3050 N  N   . CYS B 77  ? 0.3648 0.2679 0.3952 -0.0446 -0.0898 -0.0205 4327 CYS B N   
3051 C  CA  . CYS B 77  ? 0.3836 0.2737 0.4167 -0.0511 -0.0970 -0.0293 4327 CYS B CA  
3052 C  C   . CYS B 77  ? 0.3715 0.2595 0.4313 -0.0556 -0.0914 -0.0243 4327 CYS B C   
3053 O  O   . CYS B 77  ? 0.3503 0.2337 0.4087 -0.0511 -0.0794 -0.0188 4327 CYS B O   
3054 C  CB  . CYS B 77  ? 0.4038 0.2777 0.4110 -0.0471 -0.0935 -0.0382 4327 CYS B CB  
3055 S  SG  . CYS B 77  ? 0.4358 0.2874 0.4431 -0.0540 -0.1001 -0.0513 4327 CYS B SG  
3056 N  N   . LEU B 78  ? 0.3838 0.2747 0.4675 -0.0646 -0.1006 -0.0253 4328 LEU B N   
3057 C  CA  . LEU B 78  ? 0.3821 0.2709 0.4950 -0.0704 -0.0940 -0.0190 4328 LEU B CA  
3058 C  C   . LEU B 78  ? 0.3859 0.2529 0.4886 -0.0692 -0.0875 -0.0225 4328 LEU B C   
3059 O  O   . LEU B 78  ? 0.3739 0.2382 0.4864 -0.0677 -0.0751 -0.0125 4328 LEU B O   
3060 C  CB  . LEU B 78  ? 0.3984 0.2919 0.5402 -0.0821 -0.1080 -0.0220 4328 LEU B CB  
3061 C  CG  . LEU B 78  ? 0.4124 0.3050 0.5898 -0.0900 -0.1009 -0.0143 4328 LEU B CG  
3062 C  CD1 . LEU B 78  ? 0.3986 0.3099 0.5962 -0.0863 -0.0853 0.0008  4328 LEU B CD1 
3063 C  CD2 . LEU B 78  ? 0.4297 0.3229 0.6356 -0.1036 -0.1182 -0.0203 4328 LEU B CD2 
3064 N  N   . TYR B 79  ? 0.4131 0.2637 0.4956 -0.0695 -0.0951 -0.0359 4329 TYR B N   
3065 C  CA  . TYR B 79  ? 0.4365 0.2637 0.5124 -0.0677 -0.0894 -0.0411 4329 TYR B CA  
3066 C  C   . TYR B 79  ? 0.4279 0.2555 0.4904 -0.0559 -0.0758 -0.0337 4329 TYR B C   
3067 O  O   . TYR B 79  ? 0.4408 0.2585 0.5127 -0.0540 -0.0676 -0.0267 4329 TYR B O   
3068 C  CB  . TYR B 79  ? 0.4735 0.2825 0.5297 -0.0706 -0.1004 -0.0591 4329 TYR B CB  
3069 C  CG  . TYR B 79  ? 0.4891 0.3008 0.5587 -0.0832 -0.1179 -0.0651 4329 TYR B CG  
3070 C  CD1 . TYR B 79  ? 0.5118 0.3155 0.6114 -0.0943 -0.1226 -0.0649 4329 TYR B CD1 
3071 C  CD2 . TYR B 79  ? 0.4944 0.3184 0.5507 -0.0844 -0.1307 -0.0688 4329 TYR B CD2 
3072 C  CE1 . TYR B 79  ? 0.5298 0.3389 0.6480 -0.1069 -0.1408 -0.0695 4329 TYR B CE1 
3073 C  CE2 . TYR B 79  ? 0.5157 0.3445 0.5876 -0.0958 -0.1498 -0.0729 4329 TYR B CE2 
3074 C  CZ  . TYR B 79  ? 0.5284 0.3510 0.6330 -0.1074 -0.1554 -0.0736 4329 TYR B CZ  
3075 O  OH  . TYR B 79  ? 0.5495 0.3789 0.6747 -0.1198 -0.1763 -0.0772 4329 TYR B OH  
3076 N  N   . CYS B 80  ? 0.4201 0.2587 0.4629 -0.0489 -0.0747 -0.0342 4330 CYS B N   
3077 C  CA  . CYS B 80  ? 0.4151 0.2572 0.4492 -0.0389 -0.0643 -0.0266 4330 CYS B CA  
3078 C  C   . CYS B 80  ? 0.3967 0.2471 0.4446 -0.0390 -0.0577 -0.0117 4330 CYS B C   
3079 O  O   . CYS B 80  ? 0.4089 0.2512 0.4584 -0.0347 -0.0512 -0.0047 4330 CYS B O   
3080 C  CB  . CYS B 80  ? 0.4132 0.2678 0.4289 -0.0337 -0.0647 -0.0280 4330 CYS B CB  
3081 S  SG  . CYS B 80  ? 0.4379 0.2813 0.4293 -0.0299 -0.0655 -0.0424 4330 CYS B SG  
3082 N  N   . ARG B 81  ? 0.3834 0.2479 0.4406 -0.0433 -0.0591 -0.0070 4331 ARG B N   
3083 C  CA  . ARG B 81  ? 0.3721 0.2444 0.4370 -0.0425 -0.0501 0.0061  4331 ARG B CA  
3084 C  C   . ARG B 81  ? 0.3977 0.2592 0.4794 -0.0470 -0.0440 0.0138  4331 ARG B C   
3085 O  O   . ARG B 81  ? 0.3934 0.2526 0.4698 -0.0434 -0.0349 0.0251  4331 ARG B O   
3086 C  CB  . ARG B 81  ? 0.3557 0.2450 0.4301 -0.0451 -0.0512 0.0080  4331 ARG B CB  
3087 C  CG  . ARG B 81  ? 0.3387 0.2373 0.3958 -0.0397 -0.0546 0.0046  4331 ARG B CG  
3088 C  CD  . ARG B 81  ? 0.3311 0.2290 0.3699 -0.0326 -0.0478 0.0097  4331 ARG B CD  
3089 N  NE  . ARG B 81  ? 0.3320 0.2312 0.3731 -0.0317 -0.0379 0.0195  4331 ARG B NE  
3090 C  CZ  . ARG B 81  ? 0.3284 0.2366 0.3713 -0.0306 -0.0330 0.0224  4331 ARG B CZ  
3091 N  NH1 . ARG B 81  ? 0.3252 0.2427 0.3712 -0.0301 -0.0387 0.0176  4331 ARG B NH1 
3092 N  NH2 . ARG B 81  ? 0.3313 0.2374 0.3714 -0.0293 -0.0216 0.0305  4331 ARG B NH2 
3093 N  N   . CYS B 82  ? 0.4192 0.2728 0.5190 -0.0552 -0.0494 0.0083  4332 CYS B N   
3094 C  CA  . CYS B 82  ? 0.4520 0.2943 0.5722 -0.0612 -0.0431 0.0168  4332 CYS B CA  
3095 C  C   . CYS B 82  ? 0.4710 0.2904 0.5843 -0.0578 -0.0424 0.0151  4332 CYS B C   
3096 O  O   . CYS B 82  ? 0.4737 0.2798 0.6023 -0.0622 -0.0371 0.0231  4332 CYS B O   
3097 C  CB  . CYS B 82  ? 0.4724 0.3181 0.6218 -0.0734 -0.0498 0.0129  4332 CYS B CB  
3098 S  SG  . CYS B 82  ? 0.4927 0.3669 0.6611 -0.0760 -0.0480 0.0189  4332 CYS B SG  
3099 N  N   . HIS B 83  ? 0.4808 0.2958 0.5741 -0.0499 -0.0462 0.0061  4333 HIS B N   
3100 C  CA  . HIS B 83  ? 0.5214 0.3153 0.6107 -0.0442 -0.0446 0.0036  4333 HIS B CA  
3101 C  C   . HIS B 83  ? 0.5458 0.3194 0.6510 -0.0528 -0.0488 -0.0050 4333 HIS B C   
3102 O  O   . HIS B 83  ? 0.5689 0.3248 0.6868 -0.0538 -0.0440 0.0026  4333 HIS B O   
3103 C  CB  . HIS B 83  ? 0.5566 0.3464 0.6445 -0.0376 -0.0365 0.0205  4333 HIS B CB  
3104 C  CG  . HIS B 83  ? 0.5676 0.3755 0.6398 -0.0319 -0.0341 0.0286  4333 HIS B CG  
3105 N  ND1 . HIS B 83  ? 0.6089 0.4209 0.6788 -0.0329 -0.0274 0.0437  4333 HIS B ND1 
3106 C  CD2 . HIS B 83  ? 0.5792 0.4007 0.6362 -0.0262 -0.0373 0.0233  4333 HIS B CD2 
3107 C  CE1 . HIS B 83  ? 0.6076 0.4333 0.6597 -0.0277 -0.0278 0.0457  4333 HIS B CE1 
3108 N  NE2 . HIS B 83  ? 0.5701 0.4024 0.6166 -0.0240 -0.0343 0.0338  4333 HIS B NE2 
3109 N  N   . ILE B 84  ? 0.5353 0.3099 0.6387 -0.0593 -0.0588 -0.0201 4334 ILE B N   
3110 C  CA  . ILE B 84  ? 0.5676 0.3213 0.6832 -0.0694 -0.0665 -0.0319 4334 ILE B CA  
3111 C  C   . ILE B 84  ? 0.5725 0.3163 0.6635 -0.0668 -0.0743 -0.0522 4334 ILE B C   
3112 O  O   . ILE B 84  ? 0.5639 0.3229 0.6341 -0.0601 -0.0744 -0.0545 4334 ILE B O   
3113 C  CB  . ILE B 84  ? 0.5769 0.3415 0.7193 -0.0837 -0.0731 -0.0282 4334 ILE B CB  
3114 C  CG1 . ILE B 84  ? 0.5625 0.3519 0.6992 -0.0856 -0.0821 -0.0321 4334 ILE B CG1 
3115 C  CG2 . ILE B 84  ? 0.5804 0.3511 0.7450 -0.0857 -0.0610 -0.0078 4334 ILE B CG2 
3116 C  CD1 . ILE B 84  ? 0.5706 0.3733 0.7397 -0.0989 -0.0900 -0.0289 4334 ILE B CD1 
3117 N  N   . ASP B 85  ? 0.5835 0.3004 0.6749 -0.0722 -0.0798 -0.0663 4335 ASP B N   
3118 C  CA  . ASP B 85  ? 0.6128 0.3143 0.6746 -0.0694 -0.0853 -0.0874 4335 ASP B CA  
3119 C  C   . ASP B 85  ? 0.6018 0.3201 0.6504 -0.0764 -0.0994 -0.0944 4335 ASP B C   
3120 O  O   . ASP B 85  ? 0.5803 0.3130 0.6517 -0.0874 -0.1090 -0.0880 4335 ASP B O   
3121 C  CB  . ASP B 85  ? 0.6589 0.3242 0.7229 -0.0750 -0.0890 -0.1026 4335 ASP B CB  
3122 C  CG  . ASP B 85  ? 0.6806 0.3250 0.7562 -0.0661 -0.0752 -0.0967 4335 ASP B CG  
3123 O  OD1 . ASP B 85  ? 0.6774 0.3354 0.7537 -0.0539 -0.0637 -0.0828 4335 ASP B OD1 
3124 O  OD2 . ASP B 85  ? 0.7362 0.3498 0.8209 -0.0717 -0.0774 -0.1059 4335 ASP B OD2 
3125 N  N   . HIS B 86  ? 0.6111 0.3280 0.6254 -0.0695 -0.0998 -0.1055 4336 HIS B N   
3126 C  CA  . HIS B 86  ? 0.6235 0.3524 0.6190 -0.0751 -0.1145 -0.1120 4336 HIS B CA  
3127 C  C   . HIS B 86  ? 0.6964 0.4017 0.6855 -0.0876 -0.1317 -0.1298 4336 HIS B C   
3128 O  O   . HIS B 86  ? 0.7250 0.3996 0.7006 -0.0863 -0.1282 -0.1442 4336 HIS B O   
3129 C  CB  . HIS B 86  ? 0.6055 0.3397 0.5658 -0.0636 -0.1067 -0.1151 4336 HIS B CB  
3130 C  CG  . HIS B 86  ? 0.5507 0.3116 0.5210 -0.0553 -0.0958 -0.0975 4336 HIS B CG  
3131 N  ND1 . HIS B 86  ? 0.5317 0.2939 0.5165 -0.0467 -0.0810 -0.0876 4336 HIS B ND1 
3132 C  CD2 . HIS B 86  ? 0.5247 0.3098 0.4921 -0.0544 -0.0988 -0.0884 4336 HIS B CD2 
3133 C  CE1 . HIS B 86  ? 0.4971 0.2831 0.4856 -0.0418 -0.0763 -0.0742 4336 HIS B CE1 
3134 N  NE2 . HIS B 86  ? 0.4827 0.2823 0.4612 -0.0463 -0.0860 -0.0748 4336 HIS B NE2 
3135 N  N   . PRO B 87  ? 0.7501 0.4682 0.7501 -0.0998 -0.1513 -0.1297 4337 PRO B N   
3136 C  CA  . PRO B 87  ? 0.8469 0.5443 0.8460 -0.1142 -0.1718 -0.1458 4337 PRO B CA  
3137 C  C   . PRO B 87  ? 0.9554 0.6300 0.9013 -0.1133 -0.1819 -0.1669 4337 PRO B C   
3138 O  O   . PRO B 87  ? 1.0190 0.7031 0.9507 -0.1195 -0.2012 -0.1698 4337 PRO B O   
3139 C  CB  . PRO B 87  ? 0.8173 0.5440 0.8507 -0.1253 -0.1886 -0.1343 4337 PRO B CB  
3140 C  CG  . PRO B 87  ? 0.7678 0.5231 0.7902 -0.1145 -0.1818 -0.1214 4337 PRO B CG  
3141 C  CD  . PRO B 87  ? 0.7383 0.4911 0.7529 -0.1002 -0.1560 -0.1145 4337 PRO B CD  
3142 N  N   . ASN B 88  ? 1.0376 0.6819 0.9554 -0.1052 -0.1682 -0.1807 4338 ASN B N   
3143 C  CA  . ASN B 88  ? 1.1269 0.7436 0.9881 -0.1027 -0.1723 -0.2027 4338 ASN B CA  
3144 C  C   . ASN B 88  ? 1.1769 0.7634 1.0228 -0.0910 -0.1499 -0.2139 4338 ASN B C   
3145 O  O   . ASN B 88  ? 1.1518 0.7472 1.0250 -0.0813 -0.1306 -0.2007 4338 ASN B O   
3146 C  CB  . ASN B 88  ? 1.1274 0.7636 0.9540 -0.0954 -0.1719 -0.1975 4338 ASN B CB  
3147 C  CG  . ASN B 88  ? 1.0938 0.7473 0.9224 -0.0790 -0.1455 -0.1837 4338 ASN B CG  
3148 O  OD1 . ASN B 88  ? 1.1156 0.7523 0.9370 -0.0686 -0.1255 -0.1894 4338 ASN B OD1 
3149 N  ND2 . ASN B 88  ? 1.0664 0.7530 0.9056 -0.0764 -0.1459 -0.1661 4338 ASN B ND2 
3150 N  N   . PRO B 89  ? 1.2526 0.8013 1.0548 -0.0912 -0.1519 -0.2385 4339 PRO B N   
3151 C  CA  . PRO B 89  ? 1.2796 0.7984 1.0676 -0.0780 -0.1284 -0.2502 4339 PRO B CA  
3152 C  C   . PRO B 89  ? 1.2566 0.7963 1.0357 -0.0595 -0.1031 -0.2382 4339 PRO B C   
3153 O  O   . PRO B 89  ? 1.2558 0.8143 1.0090 -0.0578 -0.1053 -0.2337 4339 PRO B O   
3154 C  CB  . PRO B 89  ? 1.3612 0.8377 1.0943 -0.0825 -0.1374 -0.2799 4339 PRO B CB  
3155 C  CG  . PRO B 89  ? 1.3733 0.8544 1.1066 -0.1027 -0.1720 -0.2834 4339 PRO B CG  
3156 C  CD  . PRO B 89  ? 1.3084 0.8395 1.0721 -0.1036 -0.1773 -0.2567 4339 PRO B CD  
3157 N  N   . LYS B 90  ? 1.2333 0.7695 1.0373 -0.0469 -0.0812 -0.2321 4340 LYS B N   
3158 C  CA  . LYS B 90  ? 1.1922 0.7494 0.9993 -0.0296 -0.0573 -0.2194 4340 LYS B CA  
3159 C  C   . LYS B 90  ? 1.0845 0.6837 0.9303 -0.0306 -0.0600 -0.1924 4340 LYS B C   
3160 O  O   . LYS B 90  ? 1.0513 0.6686 0.9119 -0.0180 -0.0431 -0.1793 4340 LYS B O   
3161 C  CB  . LYS B 90  ? 1.2400 0.7966 0.9973 -0.0227 -0.0485 -0.2284 4340 LYS B CB  
3162 C  CG  . LYS B 90  ? 1.3437 0.8570 1.0553 -0.0188 -0.0404 -0.2557 4340 LYS B CG  
3163 C  CD  . LYS B 90  ? 1.3842 0.8976 1.0507 -0.0077 -0.0219 -0.2611 4340 LYS B CD  
3164 C  CE  . LYS B 90  ? 1.3740 0.9083 1.0677 0.0096  0.0063  -0.2470 4340 LYS B CE  
3165 N  NZ  . LYS B 90  ? 1.4161 0.9493 1.0685 0.0198  0.0271  -0.2522 4340 LYS B NZ  
3166 N  N   . GLY B 91  ? 1.0243 0.6377 0.8863 -0.0449 -0.0804 -0.1851 4341 GLY B N   
3167 C  CA  . GLY B 91  ? 0.9615 0.6113 0.8580 -0.0462 -0.0822 -0.1612 4341 GLY B CA  
3168 C  C   . GLY B 91  ? 0.9081 0.5856 0.7911 -0.0380 -0.0745 -0.1507 4341 GLY B C   
3169 O  O   . GLY B 91  ? 0.8908 0.5897 0.7980 -0.0311 -0.0646 -0.1337 4341 GLY B O   
3170 N  N   . PHE B 92  ? 0.9013 0.5769 0.7459 -0.0392 -0.0797 -0.1600 4342 PHE B N   
3171 C  CA  . PHE B 92  ? 0.8754 0.5747 0.7054 -0.0325 -0.0724 -0.1498 4342 PHE B CA  
3172 C  C   . PHE B 92  ? 0.7813 0.5102 0.6320 -0.0397 -0.0860 -0.1335 4342 PHE B C   
3173 O  O   . PHE B 92  ? 0.7773 0.5061 0.6395 -0.0511 -0.1043 -0.1347 4342 PHE B O   
3174 C  CB  . PHE B 92  ? 0.9542 0.6376 0.7325 -0.0312 -0.0718 -0.1642 4342 PHE B CB  
3175 C  CG  . PHE B 92  ? 0.9792 0.6841 0.7404 -0.0265 -0.0661 -0.1533 4342 PHE B CG  
3176 C  CD1 . PHE B 92  ? 0.9951 0.7088 0.7580 -0.0144 -0.0431 -0.1471 4342 PHE B CD1 
3177 C  CD2 . PHE B 92  ? 1.0051 0.7213 0.7513 -0.0344 -0.0841 -0.1483 4342 PHE B CD2 
3178 C  CE1 . PHE B 92  ? 0.9879 0.7202 0.7376 -0.0116 -0.0377 -0.1364 4342 PHE B CE1 
3179 C  CE2 . PHE B 92  ? 0.9989 0.7320 0.7299 -0.0303 -0.0785 -0.1373 4342 PHE B CE2 
3180 C  CZ  . PHE B 92  ? 0.9912 0.7316 0.7235 -0.0195 -0.0550 -0.1315 4342 PHE B CZ  
3181 N  N   . CYS B 93  ? 0.7082 0.4613 0.5660 -0.0331 -0.0770 -0.1188 4343 CYS B N   
3182 C  CA  . CYS B 93  ? 0.6352 0.4147 0.5111 -0.0379 -0.0870 -0.1038 4343 CYS B CA  
3183 C  C   . CYS B 93  ? 0.6286 0.4170 0.4756 -0.0364 -0.0894 -0.1016 4343 CYS B C   
3184 O  O   . CYS B 93  ? 0.6380 0.4265 0.4685 -0.0282 -0.0743 -0.1010 4343 CYS B O   
3185 C  CB  . CYS B 93  ? 0.5855 0.3833 0.4927 -0.0326 -0.0766 -0.0883 4343 CYS B CB  
3186 S  SG  . CYS B 93  ? 0.5279 0.3534 0.4556 -0.0372 -0.0856 -0.0723 4343 CYS B SG  
3187 N  N   . ASP B 94  ? 0.6253 0.4214 0.4696 -0.0441 -0.1075 -0.0990 4344 ASP B N   
3188 C  CA  . ASP B 94  ? 0.6523 0.4549 0.4684 -0.0432 -0.1124 -0.0949 4344 ASP B CA  
3189 C  C   . ASP B 94  ? 0.5788 0.4060 0.4155 -0.0391 -0.1064 -0.0777 4344 ASP B C   
3190 O  O   . ASP B 94  ? 0.5889 0.4208 0.4050 -0.0370 -0.1067 -0.0721 4344 ASP B O   
3191 C  CB  . ASP B 94  ? 0.7016 0.5018 0.5077 -0.0526 -0.1373 -0.0984 4344 ASP B CB  
3192 C  CG  . ASP B 94  ? 0.7957 0.5686 0.5730 -0.0584 -0.1477 -0.1172 4344 ASP B CG  
3193 O  OD1 . ASP B 94  ? 0.8625 0.6157 0.6233 -0.0538 -0.1329 -0.1287 4344 ASP B OD1 
3194 O  OD2 . ASP B 94  ? 0.8572 0.6281 0.6297 -0.0675 -0.1713 -0.1206 4344 ASP B OD2 
3195 N  N   . LEU B 95  ? 0.5547 0.3469 0.4327 -0.0104 -0.0898 -0.0513 4345 LEU B N   
3196 C  CA  . LEU B 95  ? 0.5137 0.3354 0.4056 -0.0132 -0.0899 -0.0369 4345 LEU B CA  
3197 C  C   . LEU B 95  ? 0.4862 0.3244 0.3814 -0.0042 -0.0760 -0.0233 4345 LEU B C   
3198 O  O   . LEU B 95  ? 0.4582 0.3166 0.3501 -0.0050 -0.0759 -0.0160 4345 LEU B O   
3199 C  CB  . LEU B 95  ? 0.5036 0.3300 0.4236 -0.0226 -0.0952 -0.0326 4345 LEU B CB  
3200 C  CG  . LEU B 95  ? 0.5212 0.3434 0.4459 -0.0330 -0.1108 -0.0413 4345 LEU B CG  
3201 C  CD1 . LEU B 95  ? 0.5193 0.3447 0.4760 -0.0410 -0.1124 -0.0360 4345 LEU B CD1 
3202 C  CD2 . LEU B 95  ? 0.5244 0.3636 0.4408 -0.0342 -0.1180 -0.0385 4345 LEU B CD2 
3203 N  N   . LYS B 96  ? 0.4862 0.3165 0.3900 0.0032  -0.0654 -0.0190 4346 LYS B N   
3204 C  CA  . LYS B 96  ? 0.4819 0.3332 0.3935 0.0121  -0.0535 -0.0032 4346 LYS B CA  
3205 C  C   . LYS B 96  ? 0.4657 0.3309 0.3607 0.0183  -0.0490 -0.0007 4346 LYS B C   
3206 O  O   . LYS B 96  ? 0.4784 0.3270 0.3530 0.0250  -0.0459 -0.0104 4346 LYS B O   
3207 C  CB  . LYS B 96  ? 0.5246 0.3598 0.4457 0.0226  -0.0419 0.0006  4346 LYS B CB  
3208 C  CG  . LYS B 96  ? 0.5446 0.4033 0.4770 0.0339  -0.0299 0.0194  4346 LYS B CG  
3209 C  CD  . LYS B 96  ? 0.5859 0.4246 0.5274 0.0474  -0.0167 0.0240  4346 LYS B CD  
3210 C  CE  . LYS B 96  ? 0.6071 0.4736 0.5619 0.0610  -0.0050 0.0455  4346 LYS B CE  
3211 N  NZ  . LYS B 96  ? 0.6066 0.5043 0.5793 0.0545  -0.0099 0.0624  4346 LYS B NZ  
3212 N  N   . GLY B 97  ? 0.4279 0.3226 0.3307 0.0152  -0.0487 0.0118  4347 GLY B N   
3213 C  CA  . GLY B 97  ? 0.4274 0.3400 0.3213 0.0190  -0.0438 0.0181  4347 GLY B CA  
3214 C  C   . GLY B 97  ? 0.4294 0.3394 0.3079 0.0112  -0.0521 0.0114  4347 GLY B C   
3215 O  O   . GLY B 97  ? 0.4387 0.3626 0.3103 0.0132  -0.0476 0.0179  4347 GLY B O   
3216 N  N   . LYS B 98  ? 0.4301 0.3252 0.3064 0.0030  -0.0633 0.0013  4348 LYS B N   
3217 C  CA  . LYS B 98  ? 0.4523 0.3449 0.3163 -0.0032 -0.0723 -0.0028 4348 LYS B CA  
3218 C  C   . LYS B 98  ? 0.4176 0.3167 0.2971 -0.0140 -0.0803 -0.0007 4348 LYS B C   
3219 O  O   . LYS B 98  ? 0.3986 0.3054 0.2941 -0.0164 -0.0781 0.0032  4348 LYS B O   
3220 C  CB  . LYS B 98  ? 0.5014 0.3715 0.3481 -0.0017 -0.0795 -0.0167 4348 LYS B CB  
3221 C  CG  . LYS B 98  ? 0.5739 0.4296 0.3988 0.0095  -0.0713 -0.0239 4348 LYS B CG  
3222 C  CD  . LYS B 98  ? 0.6163 0.4831 0.4224 0.0169  -0.0630 -0.0173 4348 LYS B CD  
3223 C  CE  . LYS B 98  ? 0.6829 0.5307 0.4573 0.0279  -0.0573 -0.0290 4348 LYS B CE  
3224 N  NZ  . LYS B 98  ? 0.7317 0.5630 0.5091 0.0376  -0.0463 -0.0349 4348 LYS B NZ  
3225 N  N   . TYR B 99  ? 0.4069 0.3032 0.2805 -0.0186 -0.0880 -0.0025 4349 TYR B N   
3226 C  CA  . TYR B 99  ? 0.3917 0.2902 0.2786 -0.0264 -0.0938 -0.0015 4349 TYR B CA  
3227 C  C   . TYR B 99  ? 0.4065 0.2944 0.2932 -0.0273 -0.1041 -0.0081 4349 TYR B C   
3228 O  O   . TYR B 99  ? 0.4444 0.3265 0.3142 -0.0243 -0.1091 -0.0112 4349 TYR B O   
3229 C  CB  . TYR B 99  ? 0.3858 0.2923 0.2714 -0.0307 -0.0919 0.0057  4349 TYR B CB  
3230 C  CG  . TYR B 99  ? 0.3637 0.2851 0.2540 -0.0325 -0.0844 0.0122  4349 TYR B CG  
3231 C  CD1 . TYR B 99  ? 0.3647 0.2950 0.2479 -0.0274 -0.0779 0.0182  4349 TYR B CD1 
3232 C  CD2 . TYR B 99  ? 0.3437 0.2730 0.2455 -0.0383 -0.0838 0.0129  4349 TYR B CD2 
3233 C  CE1 . TYR B 99  ? 0.3518 0.3014 0.2442 -0.0287 -0.0719 0.0264  4349 TYR B CE1 
3234 C  CE2 . TYR B 99  ? 0.3273 0.2750 0.2341 -0.0406 -0.0796 0.0197  4349 TYR B CE2 
3235 C  CZ  . TYR B 99  ? 0.3306 0.2899 0.2352 -0.0360 -0.0742 0.0273  4349 TYR B CZ  
3236 O  OH  . TYR B 99  ? 0.3214 0.3042 0.2355 -0.0381 -0.0711 0.0364  4349 TYR B OH  
3237 N  N   . VAL B 100 ? 0.4034 0.2913 0.3084 -0.0311 -0.1071 -0.0094 4350 VAL B N   
3238 C  CA  . VAL B 100 ? 0.4099 0.2937 0.3222 -0.0331 -0.1180 -0.0133 4350 VAL B CA  
3239 C  C   . VAL B 100 ? 0.4024 0.2915 0.3255 -0.0342 -0.1194 -0.0075 4350 VAL B C   
3240 O  O   . VAL B 100 ? 0.3919 0.2843 0.3244 -0.0356 -0.1118 -0.0047 4350 VAL B O   
3241 C  CB  . VAL B 100 ? 0.4228 0.3032 0.3525 -0.0359 -0.1196 -0.0174 4350 VAL B CB  
3242 C  CG1 . VAL B 100 ? 0.4184 0.3064 0.3664 -0.0371 -0.1109 -0.0118 4350 VAL B CG1 
3243 C  CG2 . VAL B 100 ? 0.4373 0.3176 0.3775 -0.0400 -0.1329 -0.0207 4350 VAL B CG2 
3244 N  N   . GLN B 101 ? 0.4082 0.2974 0.3274 -0.0329 -0.1285 -0.0056 4351 GLN B N   
3245 C  CA  . GLN B 101 ? 0.4045 0.2967 0.3361 -0.0314 -0.1296 0.0015  4351 GLN B CA  
3246 C  C   . GLN B 101 ? 0.4110 0.3103 0.3678 -0.0323 -0.1356 0.0015  4351 GLN B C   
3247 O  O   . GLN B 101 ? 0.4283 0.3309 0.3868 -0.0349 -0.1472 -0.0021 4351 GLN B O   
3248 C  CB  . GLN B 101 ? 0.4212 0.3128 0.3375 -0.0279 -0.1355 0.0079  4351 GLN B CB  
3249 C  CG  . GLN B 101 ? 0.4275 0.3141 0.3292 -0.0276 -0.1261 0.0129  4351 GLN B CG  
3250 C  CD  . GLN B 101 ? 0.4303 0.3173 0.3175 -0.0290 -0.1199 0.0082  4351 GLN B CD  
3251 O  OE1 . GLN B 101 ? 0.4188 0.3068 0.3094 -0.0323 -0.1110 0.0089  4351 GLN B OE1 
3252 N  NE2 . GLN B 101 ? 0.4395 0.3262 0.3105 -0.0263 -0.1247 0.0032  4351 GLN B NE2 
3253 N  N   . ILE B 102 ? 0.4005 0.3022 0.3758 -0.0308 -0.1275 0.0049  4352 ILE B N   
3254 C  CA  . ILE B 102 ? 0.4012 0.3136 0.4054 -0.0305 -0.1298 0.0079  4352 ILE B CA  
3255 C  C   . ILE B 102 ? 0.4007 0.3160 0.4187 -0.0233 -0.1273 0.0165  4352 ILE B C   
3256 O  O   . ILE B 102 ? 0.3913 0.2959 0.4016 -0.0199 -0.1164 0.0169  4352 ILE B O   
3257 C  CB  . ILE B 102 ? 0.3908 0.3047 0.4057 -0.0325 -0.1185 0.0056  4352 ILE B CB  
3258 C  CG1 . ILE B 102 ? 0.3923 0.3009 0.3943 -0.0372 -0.1181 -0.0002 4352 ILE B CG1 
3259 C  CG2 . ILE B 102 ? 0.3918 0.3194 0.4394 -0.0321 -0.1191 0.0111  4352 ILE B CG2 
3260 C  CD1 . ILE B 102 ? 0.4020 0.3100 0.4090 -0.0422 -0.1301 -0.0043 4352 ILE B CD1 
3261 N  N   . PRO B 103 ? 0.4092 0.3388 0.4489 -0.0208 -0.1376 0.0238  4353 PRO B N   
3262 C  CA  . PRO B 103 ? 0.4157 0.3495 0.4737 -0.0111 -0.1333 0.0346  4353 PRO B CA  
3263 C  C   . PRO B 103 ? 0.4116 0.3391 0.4795 -0.0066 -0.1141 0.0328  4353 PRO B C   
3264 O  O   . PRO B 103 ? 0.4007 0.3350 0.4784 -0.0104 -0.1095 0.0293  4353 PRO B O   
3265 C  CB  . PRO B 103 ? 0.4218 0.3800 0.5086 -0.0111 -0.1480 0.0430  4353 PRO B CB  
3266 C  CG  . PRO B 103 ? 0.4239 0.3840 0.4939 -0.0221 -0.1648 0.0345  4353 PRO B CG  
3267 C  CD  . PRO B 103 ? 0.4203 0.3627 0.4685 -0.0275 -0.1544 0.0223  4353 PRO B CD  
3268 N  N   . THR B 104 ? 0.4201 0.3330 0.4836 0.0013  -0.1029 0.0351  4354 THR B N   
3269 C  CA  . THR B 104 ? 0.4352 0.3375 0.5000 0.0057  -0.0839 0.0301  4354 THR B CA  
3270 C  C   . THR B 104 ? 0.4378 0.3601 0.5344 0.0112  -0.0781 0.0360  4354 THR B C   
3271 O  O   . THR B 104 ? 0.4321 0.3537 0.5257 0.0104  -0.0657 0.0303  4354 THR B O   
3272 C  CB  . THR B 104 ? 0.4651 0.3446 0.5227 0.0138  -0.0736 0.0311  4354 THR B CB  
3273 O  OG1 . THR B 104 ? 0.4730 0.3382 0.5051 0.0062  -0.0796 0.0279  4354 THR B OG1 
3274 C  CG2 . THR B 104 ? 0.4872 0.3505 0.5381 0.0176  -0.0543 0.0218  4354 THR B CG2 
3275 N  N   . THR B 105 ? 0.4413 0.3837 0.5677 0.0163  -0.0872 0.0486  4355 THR B N   
3276 C  CA  . THR B 105 ? 0.4529 0.4201 0.6176 0.0213  -0.0821 0.0579  4355 THR B CA  
3277 C  C   . THR B 105 ? 0.4455 0.4257 0.6160 0.0089  -0.0866 0.0540  4355 THR B C   
3278 O  O   . THR B 105 ? 0.4522 0.4498 0.6510 0.0117  -0.0770 0.0609  4355 THR B O   
3279 C  CB  . THR B 105 ? 0.4595 0.4507 0.6572 0.0273  -0.0952 0.0740  4355 THR B CB  
3280 O  OG1 . THR B 105 ? 0.4583 0.4566 0.6459 0.0153  -0.1189 0.0723  4355 THR B OG1 
3281 C  CG2 . THR B 105 ? 0.4857 0.4652 0.6850 0.0429  -0.0876 0.0824  4355 THR B CG2 
3282 N  N   . CYS B 106 ? 0.4393 0.4108 0.5857 -0.0032 -0.0987 0.0448  4356 CYS B N   
3283 C  CA  . CYS B 106 ? 0.4343 0.4127 0.5861 -0.0147 -0.1028 0.0413  4356 CYS B CA  
3284 C  C   . CYS B 106 ? 0.4333 0.3933 0.5532 -0.0182 -0.0931 0.0310  4356 CYS B C   
3285 O  O   . CYS B 106 ? 0.4236 0.3853 0.5450 -0.0262 -0.0951 0.0291  4356 CYS B O   
3286 C  CB  . CYS B 106 ? 0.4435 0.4264 0.5949 -0.0254 -0.1253 0.0388  4356 CYS B CB  
3287 S  SG  . CYS B 106 ? 0.4731 0.4843 0.6616 -0.0246 -0.1430 0.0517  4356 CYS B SG  
3288 N  N   . ALA B 107 ? 0.4326 0.3763 0.5271 -0.0127 -0.0832 0.0257  4357 ALA B N   
3289 C  CA  . ALA B 107 ? 0.4264 0.3567 0.4904 -0.0170 -0.0769 0.0168  4357 ALA B CA  
3290 C  C   . ALA B 107 ? 0.4225 0.3601 0.4909 -0.0163 -0.0632 0.0183  4357 ALA B C   
3291 O  O   . ALA B 107 ? 0.4022 0.3345 0.4484 -0.0202 -0.0600 0.0136  4357 ALA B O   
3292 C  CB  . ALA B 107 ? 0.4452 0.3580 0.4855 -0.0137 -0.0716 0.0110  4357 ALA B CB  
3293 N  N   . ASN B 108 ? 0.4246 0.3768 0.5212 -0.0111 -0.0551 0.0267  4358 ASN B N   
3294 C  CA  . ASN B 108 ? 0.4311 0.3924 0.5316 -0.0096 -0.0404 0.0310  4358 ASN B CA  
3295 C  C   . ASN B 108 ? 0.4083 0.3763 0.5194 -0.0192 -0.0475 0.0356  4358 ASN B C   
3296 O  O   . ASN B 108 ? 0.3991 0.3727 0.5084 -0.0189 -0.0364 0.0405  4358 ASN B O   
3297 C  CB  . ASN B 108 ? 0.4609 0.4381 0.5910 -0.0002 -0.0269 0.0410  4358 ASN B CB  
3298 C  CG  . ASN B 108 ? 0.4797 0.4757 0.6522 -0.0032 -0.0381 0.0519  4358 ASN B CG  
3299 O  OD1 . ASN B 108 ? 0.5075 0.5009 0.6831 -0.0065 -0.0547 0.0499  4358 ASN B OD1 
3300 N  ND2 . ASN B 108 ? 0.4984 0.5154 0.7040 -0.0028 -0.0295 0.0645  4358 ASN B ND2 
3301 N  N   . ASP B 109 ? 0.3846 0.3506 0.5050 -0.0267 -0.0647 0.0340  4359 ASP B N   
3302 C  CA  . ASP B 109 ? 0.3692 0.3350 0.5002 -0.0361 -0.0713 0.0362  4359 ASP B CA  
3303 C  C   . ASP B 109 ? 0.3604 0.3118 0.4740 -0.0421 -0.0879 0.0262  4359 ASP B C   
3304 O  O   . ASP B 109 ? 0.3570 0.3101 0.4858 -0.0487 -0.1020 0.0249  4359 ASP B O   
3305 C  CB  . ASP B 109 ? 0.3666 0.3497 0.5411 -0.0406 -0.0728 0.0470  4359 ASP B CB  
3306 C  CG  . ASP B 109 ? 0.3776 0.3565 0.5670 -0.0517 -0.0780 0.0493  4359 ASP B CG  
3307 O  OD1 . ASP B 109 ? 0.3787 0.3421 0.5450 -0.0526 -0.0758 0.0450  4359 ASP B OD1 
3308 O  OD2 . ASP B 109 ? 0.3816 0.3730 0.6083 -0.0595 -0.0840 0.0564  4359 ASP B OD2 
3309 N  N   . PRO B 110 ? 0.3498 0.2884 0.4302 -0.0402 -0.0867 0.0190  4360 PRO B N   
3310 C  CA  . PRO B 110 ? 0.3564 0.2823 0.4181 -0.0437 -0.0990 0.0106  4360 PRO B CA  
3311 C  C   . PRO B 110 ? 0.3611 0.2791 0.4313 -0.0506 -0.1052 0.0085  4360 PRO B C   
3312 O  O   . PRO B 110 ? 0.3760 0.2861 0.4406 -0.0549 -0.1184 0.0010  4360 PRO B O   
3313 C  CB  . PRO B 110 ? 0.3523 0.2718 0.3844 -0.0401 -0.0921 0.0075  4360 PRO B CB  
3314 C  CG  . PRO B 110 ? 0.3547 0.2809 0.3861 -0.0355 -0.0808 0.0105  4360 PRO B CG  
3315 C  CD  . PRO B 110 ? 0.3545 0.2921 0.4134 -0.0349 -0.0740 0.0186  4360 PRO B CD  
3316 N  N   . VAL B 111 ? 0.3605 0.2790 0.4422 -0.0515 -0.0953 0.0150  4361 VAL B N   
3317 C  CA  . VAL B 111 ? 0.3720 0.2771 0.4636 -0.0581 -0.0993 0.0132  4361 VAL B CA  
3318 C  C   . VAL B 111 ? 0.3841 0.2922 0.5025 -0.0682 -0.1127 0.0112  4361 VAL B C   
3319 O  O   . VAL B 111 ? 0.4070 0.2994 0.5184 -0.0749 -0.1253 0.0002  4361 VAL B O   
3320 C  CB  . VAL B 111 ? 0.3719 0.2782 0.4754 -0.0564 -0.0848 0.0250  4361 VAL B CB  
3321 C  CG1 . VAL B 111 ? 0.3841 0.2720 0.5023 -0.0636 -0.0876 0.0240  4361 VAL B CG1 
3322 C  CG2 . VAL B 111 ? 0.3664 0.2743 0.4435 -0.0475 -0.0747 0.0278  4361 VAL B CG2 
3323 N  N   . GLY B 112 ? 0.3811 0.3096 0.5285 -0.0690 -0.1099 0.0213  4362 GLY B N   
3324 C  CA  . GLY B 112 ? 0.3926 0.3320 0.5729 -0.0794 -0.1235 0.0227  4362 GLY B CA  
3325 C  C   . GLY B 112 ? 0.4065 0.3461 0.5720 -0.0810 -0.1422 0.0125  4362 GLY B C   
3326 O  O   . GLY B 112 ? 0.4262 0.3632 0.6018 -0.0928 -0.1596 0.0059  4362 GLY B O   
3327 N  N   . PHE B 113 ? 0.4001 0.3417 0.5411 -0.0704 -0.1392 0.0114  4363 PHE B N   
3328 C  CA  . PHE B 113 ? 0.4163 0.3593 0.5417 -0.0701 -0.1555 0.0052  4363 PHE B CA  
3329 C  C   . PHE B 113 ? 0.4466 0.3680 0.5425 -0.0757 -0.1667 -0.0095 4363 PHE B C   
3330 O  O   . PHE B 113 ? 0.4730 0.3968 0.5683 -0.0832 -0.1854 -0.0157 4363 PHE B O   
3331 C  CB  . PHE B 113 ? 0.3995 0.3442 0.5048 -0.0578 -0.1477 0.0082  4363 PHE B CB  
3332 C  CG  . PHE B 113 ? 0.4086 0.3574 0.5018 -0.0560 -0.1627 0.0068  4363 PHE B CG  
3333 C  CD1 . PHE B 113 ? 0.4090 0.3791 0.5285 -0.0536 -0.1699 0.0170  4363 PHE B CD1 
3334 C  CD2 . PHE B 113 ? 0.4219 0.3557 0.4788 -0.0559 -0.1693 -0.0025 4363 PHE B CD2 
3335 C  CE1 . PHE B 113 ? 0.4192 0.3953 0.5277 -0.0511 -0.1844 0.0188  4363 PHE B CE1 
3336 C  CE2 . PHE B 113 ? 0.4381 0.3774 0.4819 -0.0537 -0.1828 -0.0014 4363 PHE B CE2 
3337 C  CZ  . PHE B 113 ? 0.4296 0.3900 0.4987 -0.0515 -0.1910 0.0095  4363 PHE B CZ  
3338 N  N   . THR B 114 ? 0.4631 0.3655 0.5348 -0.0717 -0.1554 -0.0147 4364 THR B N   
3339 C  CA  . THR B 114 ? 0.5100 0.3898 0.5512 -0.0736 -0.1618 -0.0288 4364 THR B CA  
3340 C  C   . THR B 114 ? 0.5436 0.4108 0.5996 -0.0866 -0.1725 -0.0374 4364 THR B C   
3341 O  O   . THR B 114 ? 0.5855 0.4383 0.6188 -0.0913 -0.1858 -0.0518 4364 THR B O   
3342 C  CB  . THR B 114 ? 0.5185 0.3849 0.5374 -0.0647 -0.1455 -0.0292 4364 THR B CB  
3343 O  OG1 . THR B 114 ? 0.5421 0.4062 0.5821 -0.0658 -0.1336 -0.0221 4364 THR B OG1 
3344 C  CG2 . THR B 114 ? 0.4977 0.3749 0.5019 -0.0554 -0.1374 -0.0227 4364 THR B CG2 
3345 N  N   A LEU B 115 ? 0.5347 0.4060 0.6261 -0.0929 -0.1666 -0.0291 4365 LEU B N   
3346 N  N   B LEU B 115 ? 0.5423 0.4146 0.6342 -0.0928 -0.1667 -0.0287 4365 LEU B N   
3347 C  CA  A LEU B 115 ? 0.5654 0.4228 0.6776 -0.1082 -0.1763 -0.0360 4365 LEU B CA  
3348 C  CA  B LEU B 115 ? 0.5744 0.4329 0.6880 -0.1077 -0.1750 -0.0348 4365 LEU B CA  
3349 C  C   A LEU B 115 ? 0.5833 0.4580 0.7131 -0.1210 -0.1995 -0.0393 4365 LEU B C   
3350 C  C   B LEU B 115 ? 0.5874 0.4624 0.7206 -0.1213 -0.1981 -0.0381 4365 LEU B C   
3351 O  O   A LEU B 115 ? 0.6261 0.4834 0.7482 -0.1338 -0.2156 -0.0549 4365 LEU B O   
3352 O  O   B LEU B 115 ? 0.6238 0.4810 0.7542 -0.1350 -0.2131 -0.0526 4365 LEU B O   
3353 C  CB  A LEU B 115 ? 0.5469 0.4087 0.6966 -0.1110 -0.1618 -0.0213 4365 LEU B CB  
3354 C  CB  B LEU B 115 ? 0.5634 0.4273 0.7120 -0.1086 -0.1588 -0.0192 4365 LEU B CB  
3355 C  CG  A LEU B 115 ? 0.5339 0.3781 0.6711 -0.1011 -0.1416 -0.0166 4365 LEU B CG  
3356 C  CG  B LEU B 115 ? 0.5905 0.4329 0.7618 -0.1223 -0.1605 -0.0223 4365 LEU B CG  
3357 C  CD1 A LEU B 115 ? 0.5156 0.3724 0.6888 -0.1020 -0.1270 0.0023  4365 LEU B CD1 
3358 C  CD1 B LEU B 115 ? 0.6159 0.4201 0.7545 -0.1184 -0.1561 -0.0366 4365 LEU B CD1 
3359 C  CD2 A LEU B 115 ? 0.5673 0.3744 0.6862 -0.1044 -0.1436 -0.0316 4365 LEU B CD2 
3360 C  CD2 B LEU B 115 ? 0.5770 0.4314 0.7855 -0.1221 -0.1434 -0.0017 4365 LEU B CD2 
3361 N  N   . LYS B 116 ? 0.5652 0.4726 0.7176 -0.1175 -0.2009 -0.0252 4366 LYS B N   
3362 C  CA  . LYS B 116 ? 0.5745 0.5071 0.7527 -0.1285 -0.2229 -0.0229 4366 LYS B CA  
3363 C  C   . LYS B 116 ? 0.5853 0.5220 0.7295 -0.1251 -0.2405 -0.0313 4366 LYS B C   
3364 O  O   . LYS B 116 ? 0.6020 0.5608 0.7640 -0.1348 -0.2620 -0.0298 4366 LYS B O   
3365 C  CB  . LYS B 116 ? 0.5592 0.5268 0.7787 -0.1225 -0.2142 -0.0015 4366 LYS B CB  
3366 C  CG  . LYS B 116 ? 0.5637 0.5362 0.8215 -0.1256 -0.1971 0.0111  4366 LYS B CG  
3367 C  CD  . LYS B 116 ? 0.5561 0.5609 0.8451 -0.1148 -0.1837 0.0311  4366 LYS B CD  
3368 C  CE  . LYS B 116 ? 0.5613 0.5733 0.8847 -0.1161 -0.1644 0.0455  4366 LYS B CE  
3369 N  NZ  . LYS B 116 ? 0.5473 0.5877 0.8923 -0.1020 -0.1477 0.0628  4366 LYS B NZ  
3370 N  N   . ASN B 117 ? 0.5727 0.4923 0.6719 -0.1125 -0.2324 -0.0380 4367 ASN B N   
3371 C  CA  . ASN B 117 ? 0.5781 0.5048 0.6457 -0.1077 -0.2468 -0.0416 4367 ASN B CA  
3372 C  C   . ASN B 117 ? 0.6071 0.5039 0.6252 -0.1084 -0.2511 -0.0617 4367 ASN B C   
3373 O  O   . ASN B 117 ? 0.6062 0.4758 0.6135 -0.1079 -0.2379 -0.0706 4367 ASN B O   
3374 C  CB  . ASN B 117 ? 0.5430 0.4837 0.6069 -0.0911 -0.2338 -0.0267 4367 ASN B CB  
3375 C  CG  . ASN B 117 ? 0.5214 0.4931 0.6308 -0.0895 -0.2340 -0.0088 4367 ASN B CG  
3376 O  OD1 . ASN B 117 ? 0.5336 0.5286 0.6574 -0.0926 -0.2521 -0.0027 4367 ASN B OD1 
3377 N  ND2 . ASN B 117 ? 0.4878 0.4617 0.6194 -0.0837 -0.2138 0.0004  4367 ASN B ND2 
3378 N  N   A THR B 118 ? 0.6319 0.5352 0.6205 -0.1077 -0.2680 -0.0667 4368 THR B N   
3379 N  N   B THR B 118 ? 0.6296 0.5325 0.6182 -0.1080 -0.2682 -0.0671 4368 THR B N   
3380 C  CA  A THR B 118 ? 0.6734 0.5511 0.6095 -0.1072 -0.2733 -0.0864 4368 THR B CA  
3381 C  CA  B THR B 118 ? 0.6675 0.5436 0.6033 -0.1070 -0.2721 -0.0868 4368 THR B CA  
3382 C  C   A THR B 118 ? 0.6666 0.5510 0.5666 -0.0917 -0.2682 -0.0792 4368 THR B C   
3383 C  C   B THR B 118 ? 0.6643 0.5484 0.5645 -0.0919 -0.2683 -0.0796 4368 THR B C   
3384 O  O   A THR B 118 ? 0.6487 0.5605 0.5626 -0.0872 -0.2744 -0.0627 4368 THR B O   
3385 O  O   B THR B 118 ? 0.6485 0.5603 0.5629 -0.0880 -0.2754 -0.0633 4368 THR B O   
3386 C  CB  A THR B 118 ? 0.7248 0.6035 0.6538 -0.1243 -0.3018 -0.1017 4368 THR B CB  
3387 C  CB  B THR B 118 ? 0.7154 0.5867 0.6429 -0.1246 -0.2986 -0.1045 4368 THR B CB  
3388 O  OG1 A THR B 118 ? 0.7299 0.6061 0.7019 -0.1407 -0.3066 -0.1043 4368 THR B OG1 
3389 O  OG1 B THR B 118 ? 0.7121 0.6197 0.6541 -0.1289 -0.3207 -0.0935 4368 THR B OG1 
3390 C  CG2 A THR B 118 ? 0.7766 0.6238 0.6484 -0.1243 -0.3059 -0.1257 4368 THR B CG2 
3391 C  CG2 B THR B 118 ? 0.7249 0.5818 0.6871 -0.1412 -0.3005 -0.1125 4368 THR B CG2 
3392 N  N   . VAL B 119 ? 0.6806 0.5410 0.5386 -0.0832 -0.2561 -0.0897 4369 VAL B N   
3393 C  CA  . VAL B 119 ? 0.6822 0.5480 0.5050 -0.0690 -0.2493 -0.0820 4369 VAL B CA  
3394 C  C   . VAL B 119 ? 0.7390 0.6045 0.5192 -0.0715 -0.2687 -0.0936 4369 VAL B C   
3395 O  O   . VAL B 119 ? 0.7692 0.6124 0.5275 -0.0796 -0.2764 -0.1157 4369 VAL B O   
3396 C  CB  . VAL B 119 ? 0.6806 0.5268 0.4845 -0.0577 -0.2243 -0.0837 4369 VAL B CB  
3397 C  CG1 . VAL B 119 ? 0.6853 0.5383 0.4569 -0.0449 -0.2165 -0.0743 4369 VAL B CG1 
3398 C  CG2 . VAL B 119 ? 0.6357 0.4840 0.4775 -0.0563 -0.2075 -0.0731 4369 VAL B CG2 
3399 N  N   . CYS B 120 ? 0.7428 0.6307 0.5104 -0.0646 -0.2760 -0.0791 4370 CYS B N   
3400 C  CA  . CYS B 120 ? 0.7985 0.6904 0.5196 -0.0649 -0.2941 -0.0871 4370 CYS B CA  
3401 C  C   . CYS B 120 ? 0.8407 0.7076 0.5099 -0.0540 -0.2771 -0.0987 4370 CYS B C   
3402 O  O   . CYS B 120 ? 0.8135 0.6806 0.4814 -0.0412 -0.2552 -0.0848 4370 CYS B O   
3403 C  CB  . CYS B 120 ? 0.7866 0.7106 0.5115 -0.0580 -0.3038 -0.0633 4370 CYS B CB  
3404 S  SG  . CYS B 120 ? 0.8392 0.7735 0.5029 -0.0558 -0.3253 -0.0679 4370 CYS B SG  
3405 N  N   . THR B 121 ? 0.9108 0.7566 0.5400 -0.0594 -0.2864 -0.1238 4371 THR B N   
3406 C  CA  . THR B 121 ? 0.9614 0.7813 0.5390 -0.0473 -0.2683 -0.1371 4371 THR B CA  
3407 C  C   . THR B 121 ? 0.9865 0.8238 0.5227 -0.0340 -0.2663 -0.1235 4371 THR B C   
3408 O  O   . THR B 121 ? 1.0326 0.8552 0.5312 -0.0207 -0.2462 -0.1275 4371 THR B O   
3409 C  CB  . THR B 121 ? 1.0294 0.8175 0.5738 -0.0567 -0.2788 -0.1702 4371 THR B CB  
3410 O  OG1 . THR B 121 ? 1.0770 0.8804 0.6007 -0.0684 -0.3101 -0.1775 4371 THR B OG1 
3411 C  CG2 . THR B 121 ? 1.0206 0.7867 0.6057 -0.0689 -0.2768 -0.1819 4371 THR B CG2 
3412 N  N   . VAL B 122 ? 0.9677 0.8364 0.5131 -0.0360 -0.2843 -0.1052 4372 VAL B N   
3413 C  CA  . VAL B 122 ? 0.9851 0.8718 0.4913 -0.0233 -0.2835 -0.0887 4372 VAL B CA  
3414 C  C   . VAL B 122 ? 0.9338 0.8344 0.4699 -0.0122 -0.2629 -0.0585 4372 VAL B C   
3415 O  O   . VAL B 122 ? 0.9510 0.8472 0.4595 0.0005  -0.2424 -0.0509 4372 VAL B O   
3416 C  CB  . VAL B 122 ? 1.0213 0.9348 0.5153 -0.0304 -0.3159 -0.0842 4372 VAL B CB  
3417 C  CG1 . VAL B 122 ? 1.0420 0.9769 0.5012 -0.0162 -0.3143 -0.0612 4372 VAL B CG1 
3418 C  CG2 . VAL B 122 ? 1.0814 0.9803 0.5394 -0.0438 -0.3385 -0.1165 4372 VAL B CG2 
3419 N  N   . CYS B 123 ? 0.8652 0.7809 0.4557 -0.0170 -0.2672 -0.0426 4373 CYS B N   
3420 C  CA  . CYS B 123 ? 0.8135 0.7393 0.4313 -0.0080 -0.2497 -0.0154 4373 CYS B CA  
3421 C  C   . CYS B 123 ? 0.7617 0.6728 0.4157 -0.0095 -0.2289 -0.0175 4373 CYS B C   
3422 O  O   . CYS B 123 ? 0.7475 0.6616 0.4175 -0.0033 -0.2125 0.0003  4373 CYS B O   
3423 C  CB  . CYS B 123 ? 0.7954 0.7465 0.4454 -0.0088 -0.2652 0.0058  4373 CYS B CB  
3424 S  SG  . CYS B 123 ? 0.7544 0.7127 0.4616 -0.0224 -0.2801 -0.0010 4373 CYS B SG  
3425 N  N   . GLY B 124 ? 0.7480 0.6440 0.4145 -0.0180 -0.2301 -0.0378 4374 GLY B N   
3426 C  CA  . GLY B 124 ? 0.6997 0.5841 0.3978 -0.0189 -0.2114 -0.0390 4374 GLY B CA  
3427 C  C   . GLY B 124 ? 0.6555 0.5518 0.4038 -0.0235 -0.2130 -0.0263 4374 GLY B C   
3428 O  O   . GLY B 124 ? 0.6167 0.5066 0.3893 -0.0237 -0.1977 -0.0248 4374 GLY B O   
3429 N  N   . MET B 125 ? 0.6575 0.5721 0.4204 -0.0260 -0.2306 -0.0170 4375 MET B N   
3430 C  CA  . MET B 125 ? 0.6248 0.5516 0.4357 -0.0279 -0.2307 -0.0043 4375 MET B CA  
3431 C  C   . MET B 125 ? 0.6125 0.5416 0.4508 -0.0395 -0.2428 -0.0163 4375 MET B C   
3432 O  O   . MET B 125 ? 0.6404 0.5650 0.4590 -0.0471 -0.2576 -0.0321 4375 MET B O   
3433 C  CB  . MET B 125 ? 0.6487 0.5967 0.4672 -0.0222 -0.2418 0.0157  4375 MET B CB  
3434 C  CG  . MET B 125 ? 0.6760 0.6229 0.4673 -0.0115 -0.2323 0.0307  4375 MET B CG  
3435 S  SD  . MET B 125 ? 0.6650 0.5971 0.4738 -0.0068 -0.2046 0.0407  4375 MET B SD  
3436 C  CE  . MET B 125 ? 0.6534 0.5946 0.5118 -0.0050 -0.2058 0.0548  4375 MET B CE  
3437 N  N   . TRP B 126 ? 0.5743 0.5091 0.4553 -0.0411 -0.2361 -0.0092 4376 TRP B N   
3438 C  CA  . TRP B 126 ? 0.5695 0.5109 0.4837 -0.0522 -0.2461 -0.0159 4376 TRP B CA  
3439 C  C   . TRP B 126 ? 0.5993 0.5658 0.5243 -0.0570 -0.2712 -0.0101 4376 TRP B C   
3440 O  O   . TRP B 126 ? 0.5858 0.5701 0.5179 -0.0480 -0.2738 0.0079  4376 TRP B O   
3441 C  CB  . TRP B 126 ? 0.5331 0.4786 0.4886 -0.0503 -0.2310 -0.0067 4376 TRP B CB  
3442 C  CG  . TRP B 126 ? 0.5042 0.4300 0.4549 -0.0487 -0.2102 -0.0128 4376 TRP B CG  
3443 C  CD1 . TRP B 126 ? 0.4911 0.4109 0.4380 -0.0407 -0.1924 -0.0058 4376 TRP B CD1 
3444 C  CD2 . TRP B 126 ? 0.5057 0.4165 0.4567 -0.0558 -0.2061 -0.0259 4376 TRP B CD2 
3445 N  NE1 . TRP B 126 ? 0.4751 0.3818 0.4197 -0.0424 -0.1789 -0.0130 4376 TRP B NE1 
3446 C  CE2 . TRP B 126 ? 0.4860 0.3864 0.4335 -0.0502 -0.1858 -0.0242 4376 TRP B CE2 
3447 C  CE3 . TRP B 126 ? 0.5278 0.4319 0.4829 -0.0669 -0.2177 -0.0385 4376 TRP B CE3 
3448 C  CZ2 . TRP B 126 ? 0.4881 0.3744 0.4361 -0.0529 -0.1765 -0.0320 4376 TRP B CZ2 
3449 C  CZ3 . TRP B 126 ? 0.5300 0.4148 0.4860 -0.0699 -0.2068 -0.0473 4376 TRP B CZ3 
3450 C  CH2 . TRP B 126 ? 0.5061 0.3835 0.4589 -0.0618 -0.1861 -0.0428 4376 TRP B CH2 
3451 N  N   . LYS B 127 ? 0.6324 0.6004 0.5604 -0.0710 -0.2893 -0.0240 4377 LYS B N   
3452 C  CA  . LYS B 127 ? 0.6738 0.6718 0.6175 -0.0782 -0.3165 -0.0178 4377 LYS B CA  
3453 C  C   . LYS B 127 ? 0.6390 0.6621 0.6417 -0.0761 -0.3124 0.0014  4377 LYS B C   
3454 O  O   . LYS B 127 ? 0.6182 0.6329 0.6494 -0.0801 -0.2986 -0.0014 4377 LYS B O   
3455 C  CB  . LYS B 127 ? 0.7245 0.7158 0.6569 -0.0967 -0.3380 -0.0397 4377 LYS B CB  
3456 C  CG  . LYS B 127 ? 0.7848 0.7473 0.6551 -0.0967 -0.3391 -0.0611 4377 LYS B CG  
3457 C  CD  . LYS B 127 ? 0.8538 0.8101 0.7052 -0.1148 -0.3650 -0.0838 4377 LYS B CD  
3458 C  CE  . LYS B 127 ? 0.9011 0.8909 0.7430 -0.1197 -0.3958 -0.0775 4377 LYS B CE  
3459 N  NZ  . LYS B 127 ? 0.9335 0.9238 0.7199 -0.1049 -0.3946 -0.0734 4377 LYS B NZ  
3460 N  N   . GLY B 128 ? 0.6344 0.6860 0.6529 -0.0673 -0.3207 0.0221  4378 GLY B N   
3461 C  CA  . GLY B 128 ? 0.6080 0.6844 0.6824 -0.0613 -0.3145 0.0422  4378 GLY B CA  
3462 C  C   . GLY B 128 ? 0.5835 0.6448 0.6615 -0.0446 -0.2857 0.0528  4378 GLY B C   
3463 O  O   . GLY B 128 ? 0.5691 0.6473 0.6879 -0.0358 -0.2773 0.0696  4378 GLY B O   
3464 N  N   . TYR B 129 ? 0.5774 0.6083 0.6151 -0.0404 -0.2708 0.0433  4379 TYR B N   
3465 C  CA  . TYR B 129 ? 0.5558 0.5700 0.5942 -0.0277 -0.2451 0.0508  4379 TYR B CA  
3466 C  C   . TYR B 129 ? 0.5708 0.5672 0.5650 -0.0211 -0.2398 0.0510  4379 TYR B C   
3467 O  O   . TYR B 129 ? 0.5658 0.5393 0.5446 -0.0196 -0.2213 0.0444  4379 TYR B O   
3468 C  CB  . TYR B 129 ? 0.5317 0.5282 0.5793 -0.0321 -0.2268 0.0393  4379 TYR B CB  
3469 C  CG  . TYR B 129 ? 0.5175 0.5308 0.6099 -0.0373 -0.2268 0.0420  4379 TYR B CG  
3470 C  CD1 . TYR B 129 ? 0.5030 0.5263 0.6292 -0.0272 -0.2128 0.0556  4379 TYR B CD1 
3471 C  CD2 . TYR B 129 ? 0.5261 0.5436 0.6278 -0.0521 -0.2391 0.0312  4379 TYR B CD2 
3472 C  CE1 . TYR B 129 ? 0.4879 0.5293 0.6564 -0.0307 -0.2100 0.0603  4379 TYR B CE1 
3473 C  CE2 . TYR B 129 ? 0.5110 0.5454 0.6574 -0.0578 -0.2378 0.0363  4379 TYR B CE2 
3474 C  CZ  . TYR B 129 ? 0.4959 0.5445 0.6761 -0.0466 -0.2228 0.0518  4379 TYR B CZ  
3475 O  OH  . TYR B 129 ? 0.4992 0.5673 0.7245 -0.0510 -0.2191 0.0590  4379 TYR B OH  
3476 N  N   . GLY B 130 ? 0.5840 0.5936 0.5594 -0.0177 -0.2558 0.0599  4380 GLY B N   
3477 C  CA  . GLY B 130 ? 0.6042 0.6002 0.5391 -0.0106 -0.2495 0.0641  4380 GLY B CA  
3478 C  C   . GLY B 130 ? 0.6342 0.6402 0.5311 -0.0134 -0.2698 0.0608  4380 GLY B C   
3479 O  O   . GLY B 130 ? 0.6651 0.6743 0.5390 -0.0042 -0.2700 0.0753  4380 GLY B O   
3480 N  N   . CYS B 131 ? 0.6461 0.6549 0.5345 -0.0259 -0.2856 0.0420  4381 CYS B N   
3481 C  CA  . CYS B 131 ? 0.6870 0.7027 0.5325 -0.0299 -0.3064 0.0342  4381 CYS B CA  
3482 C  C   . CYS B 131 ? 0.7193 0.7700 0.5770 -0.0267 -0.3293 0.0538  4381 CYS B C   
3483 O  O   . CYS B 131 ? 0.7085 0.7813 0.6096 -0.0328 -0.3420 0.0584  4381 CYS B O   
3484 C  CB  . CYS B 131 ? 0.6918 0.6968 0.5266 -0.0456 -0.3178 0.0070  4381 CYS B CB  
3485 S  SG  . CYS B 131 ? 0.7433 0.7573 0.5262 -0.0530 -0.3476 -0.0064 4381 CYS B SG  
3486 N  N   . SER B 132 ? 0.7665 0.8244 0.5885 -0.0171 -0.3337 0.0669  4382 SER B N   
3487 C  CA  . SER B 132 ? 0.8126 0.9066 0.6416 -0.0114 -0.3559 0.0898  4382 SER B CA  
3488 C  C   . SER B 132 ? 0.8819 0.9869 0.6571 -0.0175 -0.3806 0.0790  4382 SER B C   
3489 O  O   . SER B 132 ? 0.9073 1.0413 0.6720 -0.0103 -0.3976 0.1000  4382 SER B O   
3490 C  CB  . SER B 132 ? 0.8120 0.9070 0.6481 0.0068  -0.3397 0.1196  4382 SER B CB  
3491 O  OG  . SER B 132 ? 0.8331 0.9048 0.6233 0.0128  -0.3230 0.1179  4382 SER B OG  
3492 N  N   . CYS B 133 ? 0.9143 0.9968 0.6563 -0.0298 -0.3826 0.0477  4383 CYS B N   
3493 C  CA  . CYS B 133 ? 0.9992 1.0844 0.6812 -0.0362 -0.4041 0.0310  4383 CYS B CA  
3494 C  C   . CYS B 133 ? 1.0494 1.1727 0.7448 -0.0480 -0.4420 0.0334  4383 CYS B C   
3495 O  O   . CYS B 133 ? 1.1123 1.2510 0.7592 -0.0482 -0.4628 0.0324  4383 CYS B O   
3496 C  CB  . CYS B 133 ? 1.0021 1.0505 0.6532 -0.0468 -0.3967 -0.0049 4383 CYS B CB  
3497 S  SG  . CYS B 133 ? 0.9678 0.9780 0.5934 -0.0328 -0.3559 -0.0078 4383 CYS B SG  
3498 N  N   . ASP B 134 ? 1.0568 1.1976 0.8151 -0.0574 -0.4504 0.0377  4384 ASP B N   
3499 C  CA  . ASP B 134 ? 1.1063 1.2886 0.8878 -0.0713 -0.4877 0.0410  4384 ASP B CA  
3500 C  C   . ASP B 134 ? 1.1223 1.3492 0.9250 -0.0562 -0.4989 0.0797  4384 ASP B C   
3501 O  O   . ASP B 134 ? 1.1617 1.4303 0.9776 -0.0657 -0.5327 0.0867  4384 ASP B O   
3502 C  CB  . ASP B 134 ? 1.0922 1.2782 0.9365 -0.0874 -0.4907 0.0324  4384 ASP B CB  
3503 C  CG  . ASP B 134 ? 1.1196 1.2648 0.9453 -0.1046 -0.4856 -0.0046 4384 ASP B CG  
3504 O  OD1 . ASP B 134 ? 1.1787 1.3038 0.9429 -0.1110 -0.4953 -0.0287 4384 ASP B OD1 
3505 O  OD2 . ASP B 134 ? 1.0859 1.2184 0.9571 -0.1100 -0.4703 -0.0085 4384 ASP B OD2 
3506 N  N   . GLN B 135 ? 1.1158 1.3348 0.9230 -0.0343 -0.4726 0.1047  4385 GLN B N   
3507 C  CA  . GLN B 135 ? 1.1410 1.3979 0.9703 -0.0171 -0.4798 0.1445  4385 GLN B CA  
3508 C  C   . GLN B 135 ? 1.2065 1.4839 0.9750 -0.0139 -0.5028 0.1513  4385 GLN B C   
3509 O  O   . GLN B 135 ? 1.2336 1.4854 0.9382 -0.0196 -0.5016 0.1263  4385 GLN B O   
3510 C  CB  . GLN B 135 ? 1.1098 1.3448 0.9586 0.0038  -0.4439 0.1668  4385 GLN B CB  
3511 C  CG  . GLN B 135 ? 1.0707 1.2899 0.9781 0.0030  -0.4220 0.1633  4385 GLN B CG  
3512 C  CD  . GLN B 135 ? 1.0549 1.2519 0.9794 0.0223  -0.3895 0.1838  4385 GLN B CD  
3513 O  OE1 . GLN B 135 ? 1.0789 1.2746 0.9799 0.0367  -0.3835 0.2050  4385 GLN B OE1 
3514 N  NE2 . GLN B 135 ? 1.0154 1.1937 0.9804 0.0222  -0.3680 0.1777  4385 GLN B NE2 
3515 N  N   . LEU B 136 ? 1.2483 1.5712 1.0360 -0.0035 -0.5216 0.1853  4386 LEU B N   
3516 C  CA  . LEU B 136 ? 1.3096 1.6602 1.0410 0.0013  -0.5458 0.1979  4386 LEU B CA  
3517 C  C   . LEU B 136 ? 1.3337 1.6503 1.0065 0.0166  -0.5187 0.2015  4386 LEU B C   
3518 O  O   . LEU B 136 ? 1.3893 1.7204 1.0047 0.0225  -0.5314 0.2100  4386 LEU B O   
3519 C  CB  . LEU B 136 ? 1.3277 1.7320 1.1024 0.0153  -0.5633 0.2421  4386 LEU B CB  
3520 C  CG  . LEU B 136 ? 1.3219 1.7695 1.1623 0.0021  -0.5902 0.2454  4386 LEU B CG  
3521 C  CD1 . LEU B 136 ? 1.3210 1.8197 1.2099 0.0218  -0.6002 0.2943  4386 LEU B CD1 
3522 C  CD2 . LEU B 136 ? 1.3683 1.8365 1.1751 -0.0248 -0.6308 0.2157  4386 LEU B CD2 
3574 ZN ZN  . ZN  H .   ? 0.4987 0.2772 0.4512 -0.0752 -0.0745 -0.0748 4401 ZN  B ZN  
3575 ZN ZN  . ZN  I .   ? 0.8670 0.7314 0.5116 0.0107  -0.2909 -0.0206 4402 ZN  B ZN  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   6796 ?    ?   ?   A . n 
A 1 2   ASN 2   6797 ?    ?   ?   A . n 
A 1 3   ALA 3   6798 6798 ALA ALA A . n 
A 1 4   SER 4   6799 6799 SER SER A . n 
A 1 5   SER 5   6800 6800 SER SER A . n 
A 1 6   GLN 6   6801 6801 GLN GLN A . n 
A 1 7   ALA 7   6802 6802 ALA ALA A . n 
A 1 8   TRP 8   6803 6803 TRP TRP A . n 
A 1 9   GLN 9   6804 6804 GLN GLN A . n 
A 1 10  PRO 10  6805 6805 PRO PRO A . n 
A 1 11  GLY 11  6806 6806 GLY GLY A . n 
A 1 12  VAL 12  6807 6807 VAL VAL A . n 
A 1 13  ALA 13  6808 6808 ALA ALA A . n 
A 1 14  MET 14  6809 6809 MET MET A . n 
A 1 15  PRO 15  6810 6810 PRO PRO A . n 
A 1 16  ASN 16  6811 6811 ASN ASN A . n 
A 1 17  LEU 17  6812 6812 LEU LEU A . n 
A 1 18  TYR 18  6813 6813 TYR TYR A . n 
A 1 19  LYS 19  6814 6814 LYS LYS A . n 
A 1 20  MET 20  6815 6815 MET MET A . n 
A 1 21  GLN 21  6816 6816 GLN GLN A . n 
A 1 22  ARG 22  6817 6817 ARG ARG A . n 
A 1 23  MET 23  6818 6818 MET MET A . n 
A 1 24  LEU 24  6819 6819 LEU LEU A . n 
A 1 25  LEU 25  6820 6820 LEU LEU A . n 
A 1 26  GLU 26  6821 6821 GLU GLU A . n 
A 1 27  LYS 27  6822 6822 LYS LYS A . n 
A 1 28  CYS 28  6823 6823 CYS CYS A . n 
A 1 29  ASP 29  6824 6824 ASP ASP A . n 
A 1 30  LEU 30  6825 6825 LEU LEU A . n 
A 1 31  GLN 31  6826 6826 GLN GLN A . n 
A 1 32  ASN 32  6827 6827 ASN ASN A . n 
A 1 33  TYR 33  6828 6828 TYR TYR A . n 
A 1 34  GLY 34  6829 6829 GLY GLY A . n 
A 1 35  ASP 35  6830 6830 ASP ASP A . n 
A 1 36  SER 36  6831 6831 SER SER A . n 
A 1 37  ALA 37  6832 6832 ALA ALA A . n 
A 1 38  THR 38  6833 6833 THR THR A . n 
A 1 39  LEU 39  6834 6834 LEU LEU A . n 
A 1 40  PRO 40  6835 6835 PRO PRO A . n 
A 1 41  LYS 41  6836 6836 LYS LYS A . n 
A 1 42  GLY 42  6837 6837 GLY GLY A . n 
A 1 43  ILE 43  6838 6838 ILE ILE A . n 
A 1 44  MET 44  6839 6839 MET MET A . n 
A 1 45  MET 45  6840 6840 MET MET A . n 
A 1 46  ASN 46  6841 6841 ASN ASN A . n 
A 1 47  VAL 47  6842 6842 VAL VAL A . n 
A 1 48  ALA 48  6843 6843 ALA ALA A . n 
A 1 49  LYS 49  6844 6844 LYS LYS A . n 
A 1 50  TYR 50  6845 6845 TYR TYR A . n 
A 1 51  THR 51  6846 6846 THR THR A . n 
A 1 52  GLN 52  6847 6847 GLN GLN A . n 
A 1 53  LEU 53  6848 6848 LEU LEU A . n 
A 1 54  CYS 54  6849 6849 CYS CYS A . n 
A 1 55  GLN 55  6850 6850 GLN GLN A . n 
A 1 56  TYR 56  6851 6851 TYR TYR A . n 
A 1 57  LEU 57  6852 6852 LEU LEU A . n 
A 1 58  ASN 58  6853 6853 ASN ASN A . n 
A 1 59  THR 59  6854 6854 THR THR A . n 
A 1 60  LEU 60  6855 6855 LEU LEU A . n 
A 1 61  THR 61  6856 6856 THR THR A . n 
A 1 62  LEU 62  6857 6857 LEU LEU A . n 
A 1 63  ALA 63  6858 6858 ALA ALA A . n 
A 1 64  VAL 64  6859 6859 VAL VAL A . n 
A 1 65  PRO 65  6860 6860 PRO PRO A . n 
A 1 66  TYR 66  6861 6861 TYR TYR A . n 
A 1 67  ASN 67  6862 6862 ASN ASN A . n 
A 1 68  MET 68  6863 6863 MET MET A . n 
A 1 69  ARG 69  6864 6864 ARG ARG A . n 
A 1 70  VAL 70  6865 6865 VAL VAL A . n 
A 1 71  ILE 71  6866 6866 ILE ILE A . n 
A 1 72  HIS 72  6867 6867 HIS HIS A . n 
A 1 73  PHE 73  6868 6868 PHE PHE A . n 
A 1 74  GLY 74  6869 6869 GLY GLY A . n 
A 1 75  ALA 75  6870 6870 ALA ALA A . n 
A 1 76  GLY 76  6871 6871 GLY GLY A . n 
A 1 77  SER 77  6872 6872 SER SER A . n 
A 1 78  ASP 78  6873 6873 ASP ASP A . n 
A 1 79  LYS 79  6874 6874 LYS LYS A . n 
A 1 80  GLY 80  6875 6875 GLY GLY A . n 
A 1 81  VAL 81  6876 6876 VAL VAL A . n 
A 1 82  ALA 82  6877 6877 ALA ALA A . n 
A 1 83  PRO 83  6878 6878 PRO PRO A . n 
A 1 84  GLY 84  6879 6879 GLY GLY A . n 
A 1 85  THR 85  6880 6880 THR THR A . n 
A 1 86  ALA 86  6881 6881 ALA ALA A . n 
A 1 87  VAL 87  6882 6882 VAL VAL A . n 
A 1 88  LEU 88  6883 6883 LEU LEU A . n 
A 1 89  ARG 89  6884 6884 ARG ARG A . n 
A 1 90  GLN 90  6885 6885 GLN GLN A . n 
A 1 91  TRP 91  6886 6886 TRP TRP A . n 
A 1 92  LEU 92  6887 6887 LEU LEU A . n 
A 1 93  PRO 93  6888 6888 PRO PRO A . n 
A 1 94  THR 94  6889 6889 THR THR A . n 
A 1 95  GLY 95  6890 6890 GLY GLY A . n 
A 1 96  THR 96  6891 6891 THR THR A . n 
A 1 97  LEU 97  6892 6892 LEU LEU A . n 
A 1 98  LEU 98  6893 6893 LEU LEU A . n 
A 1 99  VAL 99  6894 6894 VAL VAL A . n 
A 1 100 ASP 100 6895 6895 ASP ASP A . n 
A 1 101 SER 101 6896 6896 SER SER A . n 
A 1 102 ASP 102 6897 6897 ASP ASP A . n 
A 1 103 LEU 103 6898 6898 LEU LEU A . n 
A 1 104 ASN 104 6899 6899 ASN ASN A . n 
A 1 105 ASP 105 6900 6900 ASP ASP A . n 
A 1 106 PHE 106 6901 6901 PHE PHE A . n 
A 1 107 VAL 107 6902 6902 VAL VAL A . n 
A 1 108 SER 108 6903 6903 SER SER A . n 
A 1 109 ASP 109 6904 6904 ASP ASP A . n 
A 1 110 ALA 110 6905 6905 ALA ALA A . n 
A 1 111 ASP 111 6906 6906 ASP ASP A . n 
A 1 112 SER 112 6907 6907 SER SER A . n 
A 1 113 THR 113 6908 6908 THR THR A . n 
A 1 114 LEU 114 6909 6909 LEU LEU A . n 
A 1 115 ILE 115 6910 6910 ILE ILE A . n 
A 1 116 GLY 116 6911 6911 GLY GLY A . n 
A 1 117 ASP 117 6912 6912 ASP ASP A . n 
A 1 118 CYS 118 6913 6913 CYS CYS A . n 
A 1 119 ALA 119 6914 6914 ALA ALA A . n 
A 1 120 THR 120 6915 6915 THR THR A . n 
A 1 121 VAL 121 6916 6916 VAL VAL A . n 
A 1 122 HIS 122 6917 6917 HIS HIS A . n 
A 1 123 THR 123 6918 6918 THR THR A . n 
A 1 124 ALA 124 6919 6919 ALA ALA A . n 
A 1 125 ASN 125 6920 6920 ASN ASN A . n 
A 1 126 LYS 126 6921 6921 LYS LYS A . n 
A 1 127 TRP 127 6922 6922 TRP TRP A . n 
A 1 128 ASP 128 6923 6923 ASP ASP A . n 
A 1 129 LEU 129 6924 6924 LEU LEU A . n 
A 1 130 ILE 130 6925 6925 ILE ILE A . n 
A 1 131 ILE 131 6926 6926 ILE ILE A . n 
A 1 132 SER 132 6927 6927 SER SER A . n 
A 1 133 ASP 133 6928 6928 ASP ASP A . n 
A 1 134 MET 134 6929 6929 MET MET A . n 
A 1 135 TYR 135 6930 6930 TYR TYR A . n 
A 1 136 ASP 136 6931 6931 ASP ASP A . n 
A 1 137 PRO 137 6932 6932 PRO PRO A . n 
A 1 138 LYS 138 6933 6933 LYS LYS A . n 
A 1 139 THR 139 6934 6934 THR THR A . n 
A 1 140 LYS 140 6935 6935 LYS LYS A . n 
A 1 141 ASN 141 6936 6936 ASN ASN A . n 
A 1 142 VAL 142 6937 6937 VAL VAL A . n 
A 1 143 THR 143 6938 6938 THR THR A . n 
A 1 144 LYS 144 6939 6939 LYS LYS A . n 
A 1 145 GLU 145 6940 6940 GLU GLU A . n 
A 1 146 ASN 146 6941 6941 ASN ASN A . n 
A 1 147 ASP 147 6942 6942 ASP ASP A . n 
A 1 148 SER 148 6943 6943 SER SER A . n 
A 1 149 LYS 149 6944 6944 LYS LYS A . n 
A 1 150 GLU 150 6945 6945 GLU GLU A . n 
A 1 151 GLY 151 6946 6946 GLY GLY A . n 
A 1 152 PHE 152 6947 6947 PHE PHE A . n 
A 1 153 PHE 153 6948 6948 PHE PHE A . n 
A 1 154 THR 154 6949 6949 THR THR A . n 
A 1 155 TYR 155 6950 6950 TYR TYR A . n 
A 1 156 ILE 156 6951 6951 ILE ILE A . n 
A 1 157 CYS 157 6952 6952 CYS CYS A . n 
A 1 158 GLY 158 6953 6953 GLY GLY A . n 
A 1 159 PHE 159 6954 6954 PHE PHE A . n 
A 1 160 ILE 160 6955 6955 ILE ILE A . n 
A 1 161 GLN 161 6956 6956 GLN GLN A . n 
A 1 162 GLN 162 6957 6957 GLN GLN A . n 
A 1 163 LYS 163 6958 6958 LYS LYS A . n 
A 1 164 LEU 164 6959 6959 LEU LEU A . n 
A 1 165 ALA 165 6960 6960 ALA ALA A . n 
A 1 166 LEU 166 6961 6961 LEU LEU A . n 
A 1 167 GLY 167 6962 6962 GLY GLY A . n 
A 1 168 GLY 168 6963 6963 GLY GLY A . n 
A 1 169 SER 169 6964 6964 SER SER A . n 
A 1 170 VAL 170 6965 6965 VAL VAL A . n 
A 1 171 ALA 171 6966 6966 ALA ALA A . n 
A 1 172 ILE 172 6967 6967 ILE ILE A . n 
A 1 173 LYS 173 6968 6968 LYS LYS A . n 
A 1 174 ILE 174 6969 6969 ILE ILE A . n 
A 1 175 THR 175 6970 6970 THR THR A . n 
A 1 176 GLU 176 6971 6971 GLU GLU A . n 
A 1 177 HIS 177 6972 6972 HIS HIS A . n 
A 1 178 SER 178 6973 6973 SER SER A . n 
A 1 179 TRP 179 6974 6974 TRP TRP A . n 
A 1 180 ASN 180 6975 6975 ASN ASN A . n 
A 1 181 ALA 181 6976 6976 ALA ALA A . n 
A 1 182 ASP 182 6977 6977 ASP ASP A . n 
A 1 183 LEU 183 6978 6978 LEU LEU A . n 
A 1 184 TYR 184 6979 6979 TYR TYR A . n 
A 1 185 LYS 185 6980 6980 LYS LYS A . n 
A 1 186 LEU 186 6981 6981 LEU LEU A . n 
A 1 187 MET 187 6982 6982 MET MET A . n 
A 1 188 GLY 188 6983 6983 GLY GLY A . n 
A 1 189 HIS 189 6984 6984 HIS HIS A . n 
A 1 190 PHE 190 6985 6985 PHE PHE A . n 
A 1 191 ALA 191 6986 6986 ALA ALA A . n 
A 1 192 TRP 192 6987 6987 TRP TRP A . n 
A 1 193 TRP 193 6988 6988 TRP TRP A . n 
A 1 194 THR 194 6989 6989 THR THR A . n 
A 1 195 ALA 195 6990 6990 ALA ALA A . n 
A 1 196 PHE 196 6991 6991 PHE PHE A . n 
A 1 197 VAL 197 6992 6992 VAL VAL A . n 
A 1 198 THR 198 6993 6993 THR THR A . n 
A 1 199 ASN 199 6994 6994 ASN ASN A . n 
A 1 200 VAL 200 6995 6995 VAL VAL A . n 
A 1 201 ASN 201 6996 6996 ASN ASN A . n 
A 1 202 ALA 202 6997 6997 ALA ALA A . n 
A 1 203 SER 203 6998 6998 SER SER A . n 
A 1 204 SER 204 6999 6999 SER SER A . n 
A 1 205 SER 205 7000 7000 SER SER A . n 
A 1 206 GLU 206 7001 7001 GLU GLU A . n 
A 1 207 ALA 207 7002 7002 ALA ALA A . n 
A 1 208 PHE 208 7003 7003 PHE PHE A . n 
A 1 209 LEU 209 7004 7004 LEU LEU A . n 
A 1 210 ILE 210 7005 7005 ILE ILE A . n 
A 1 211 GLY 211 7006 7006 GLY GLY A . n 
A 1 212 CYS 212 7007 7007 CYS CYS A . n 
A 1 213 ASN 213 7008 7008 ASN ASN A . n 
A 1 214 TYR 214 7009 7009 TYR TYR A . n 
A 1 215 LEU 215 7010 7010 LEU LEU A . n 
A 1 216 GLY 216 7011 7011 GLY GLY A . n 
A 1 217 LYS 217 7012 7012 LYS LYS A . n 
A 1 218 PRO 218 7013 7013 PRO PRO A . n 
A 1 219 ARG 219 7014 7014 ARG ARG A . n 
A 1 220 GLU 220 7015 7015 GLU GLU A . n 
A 1 221 GLN 221 7016 7016 GLN GLN A . n 
A 1 222 ILE 222 7017 7017 ILE ILE A . n 
A 1 223 ASP 223 7018 7018 ASP ASP A . n 
A 1 224 GLY 224 7019 7019 GLY GLY A . n 
A 1 225 TYR 225 7020 7020 TYR TYR A . n 
A 1 226 VAL 226 7021 7021 VAL VAL A . n 
A 1 227 MET 227 7022 7022 MET MET A . n 
A 1 228 HIS 228 7023 7023 HIS HIS A . n 
A 1 229 ALA 229 7024 7024 ALA ALA A . n 
A 1 230 ASN 230 7025 7025 ASN ASN A . n 
A 1 231 TYR 231 7026 7026 TYR TYR A . n 
A 1 232 ILE 232 7027 7027 ILE ILE A . n 
A 1 233 PHE 233 7028 7028 PHE PHE A . n 
A 1 234 TRP 234 7029 7029 TRP TRP A . n 
A 1 235 ARG 235 7030 7030 ARG ARG A . n 
A 1 236 ASN 236 7031 7031 ASN ASN A . n 
A 1 237 THR 237 7032 7032 THR THR A . n 
A 1 238 ASN 238 7033 7033 ASN ASN A . n 
A 1 239 PRO 239 7034 7034 PRO PRO A . n 
A 1 240 ILE 240 7035 7035 ILE ILE A . n 
A 1 241 GLN 241 7036 7036 GLN GLN A . n 
A 1 242 LEU 242 7037 7037 LEU LEU A . n 
A 1 243 SER 243 7038 7038 SER SER A . n 
A 1 244 SER 244 7039 7039 SER SER A . n 
A 1 245 TYR 245 7040 7040 TYR TYR A . n 
A 1 246 SER 246 7041 7041 SER SER A . n 
A 1 247 LEU 247 7042 7042 LEU LEU A . n 
A 1 248 PHE 248 7043 7043 PHE PHE A . n 
A 1 249 ASP 249 7044 7044 ASP ASP A . n 
A 1 250 MET 250 7045 7045 MET MET A . n 
A 1 251 SER 251 7046 7046 SER SER A . n 
A 1 252 LYS 252 7047 7047 LYS LYS A . n 
A 1 253 PHE 253 7048 7048 PHE PHE A . n 
A 1 254 PRO 254 7049 7049 PRO PRO A . n 
A 1 255 LEU 255 7050 7050 LEU LEU A . n 
A 1 256 LYS 256 7051 7051 LYS LYS A . n 
A 1 257 LEU 257 7052 7052 LEU LEU A . n 
A 1 258 ARG 258 7053 7053 ARG ARG A . n 
A 1 259 GLY 259 7054 7054 GLY GLY A . n 
A 1 260 THR 260 7055 7055 THR THR A . n 
A 1 261 ALA 261 7056 7056 ALA ALA A . n 
A 1 262 VAL 262 7057 7057 VAL VAL A . n 
A 1 263 MET 263 7058 7058 MET MET A . n 
A 1 264 SER 264 7059 7059 SER SER A . n 
A 1 265 LEU 265 7060 7060 LEU LEU A . n 
A 1 266 LYS 266 7061 7061 LYS LYS A . n 
A 1 267 GLU 267 7062 7062 GLU GLU A . n 
A 1 268 GLY 268 7063 7063 GLY GLY A . n 
A 1 269 GLN 269 7064 7064 GLN GLN A . n 
A 1 270 ILE 270 7065 7065 ILE ILE A . n 
A 1 271 ASN 271 7066 7066 ASN ASN A . n 
A 1 272 ASP 272 7067 7067 ASP ASP A . n 
A 1 273 MET 273 7068 7068 MET MET A . n 
A 1 274 ILE 274 7069 7069 ILE ILE A . n 
A 1 275 LEU 275 7070 7070 LEU LEU A . n 
A 1 276 SER 276 7071 7071 SER SER A . n 
A 1 277 LEU 277 7072 7072 LEU LEU A . n 
A 1 278 LEU 278 7073 7073 LEU LEU A . n 
A 1 279 SER 279 7074 7074 SER SER A . n 
A 1 280 LYS 280 7075 7075 LYS LYS A . n 
A 1 281 GLY 281 7076 7076 GLY GLY A . n 
A 1 282 ARG 282 7077 7077 ARG ARG A . n 
A 1 283 LEU 283 7078 7078 LEU LEU A . n 
A 1 284 ILE 284 7079 7079 ILE ILE A . n 
A 1 285 ILE 285 7080 7080 ILE ILE A . n 
A 1 286 ARG 286 7081 7081 ARG ARG A . n 
A 1 287 GLU 287 7082 7082 GLU GLU A . n 
A 1 288 ASN 288 7083 7083 ASN ASN A . n 
A 1 289 ASN 289 7084 7084 ASN ASN A . n 
A 1 290 ARG 290 7085 7085 ARG ARG A . n 
A 1 291 VAL 291 7086 7086 VAL VAL A . n 
A 1 292 VAL 292 7087 7087 VAL VAL A . n 
A 1 293 ILE 293 7088 7088 ILE ILE A . n 
A 1 294 SER 294 7089 7089 SER SER A . n 
A 1 295 SER 295 7090 7090 SER SER A . n 
A 1 296 ASP 296 7091 7091 ASP ASP A . n 
A 1 297 VAL 297 7092 7092 VAL VAL A . n 
A 1 298 LEU 298 7093 7093 LEU LEU A . n 
A 1 299 VAL 299 7094 7094 VAL VAL A . n 
A 1 300 ASN 300 7095 7095 ASN ASN A . n 
A 1 301 ASN 301 7096 7096 ASN ASN A . n 
B 2 1   SER 1   4251 ?    ?   ?   B . n 
B 2 2   ASN 2   4252 ?    ?   ?   B . n 
B 2 3   ALA 3   4253 ?    ?   ?   B . n 
B 2 4   ALA 4   4254 ?    ?   ?   B . n 
B 2 5   GLY 5   4255 ?    ?   ?   B . n 
B 2 6   ASN 6   4256 ?    ?   ?   B . n 
B 2 7   ALA 7   4257 ?    ?   ?   B . n 
B 2 8   THR 8   4258 ?    ?   ?   B . n 
B 2 9   GLU 9   4259 ?    ?   ?   B . n 
B 2 10  VAL 10  4260 ?    ?   ?   B . n 
B 2 11  PRO 11  4261 ?    ?   ?   B . n 
B 2 12  ALA 12  4262 ?    ?   ?   B . n 
B 2 13  ASN 13  4263 ?    ?   ?   B . n 
B 2 14  SER 14  4264 ?    ?   ?   B . n 
B 2 15  THR 15  4265 ?    ?   ?   B . n 
B 2 16  VAL 16  4266 ?    ?   ?   B . n 
B 2 17  LEU 17  4267 ?    ?   ?   B . n 
B 2 18  SER 18  4268 ?    ?   ?   B . n 
B 2 19  PHE 19  4269 ?    ?   ?   B . n 
B 2 20  CYS 20  4270 ?    ?   ?   B . n 
B 2 21  ALA 21  4271 4271 ALA ALA B . n 
B 2 22  PHE 22  4272 4272 PHE PHE B . n 
B 2 23  ALA 23  4273 4273 ALA ALA B . n 
B 2 24  VAL 24  4274 4274 VAL VAL B . n 
B 2 25  ASP 25  4275 4275 ASP ASP B . n 
B 2 26  ALA 26  4276 4276 ALA ALA B . n 
B 2 27  ALA 27  4277 4277 ALA ALA B . n 
B 2 28  LYS 28  4278 4278 LYS LYS B . n 
B 2 29  ALA 29  4279 4279 ALA ALA B . n 
B 2 30  TYR 30  4280 4280 TYR TYR B . n 
B 2 31  LYS 31  4281 4281 LYS LYS B . n 
B 2 32  ASP 32  4282 4282 ASP ASP B . n 
B 2 33  TYR 33  4283 4283 TYR TYR B . n 
B 2 34  LEU 34  4284 4284 LEU LEU B . n 
B 2 35  ALA 35  4285 4285 ALA ALA B . n 
B 2 36  SER 36  4286 4286 SER SER B . n 
B 2 37  GLY 37  4287 4287 GLY GLY B . n 
B 2 38  GLY 38  4288 4288 GLY GLY B . n 
B 2 39  GLN 39  4289 4289 GLN GLN B . n 
B 2 40  PRO 40  4290 4290 PRO PRO B . n 
B 2 41  ILE 41  4291 4291 ILE ILE B . n 
B 2 42  THR 42  4292 4292 THR THR B . n 
B 2 43  ASN 43  4293 4293 ASN ASN B . n 
B 2 44  CYS 44  4294 4294 CYS CYS B . n 
B 2 45  VAL 45  4295 4295 VAL VAL B . n 
B 2 46  LYS 46  4296 4296 LYS LYS B . n 
B 2 47  MET 47  4297 4297 MET MET B . n 
B 2 48  LEU 48  4298 4298 LEU LEU B . n 
B 2 49  CYS 49  4299 4299 CYS CYS B . n 
B 2 50  THR 50  4300 4300 THR THR B . n 
B 2 51  HIS 51  4301 4301 HIS HIS B . n 
B 2 52  THR 52  4302 4302 THR THR B . n 
B 2 53  GLY 53  4303 4303 GLY GLY B . n 
B 2 54  THR 54  4304 4304 THR THR B . n 
B 2 55  GLY 55  4305 4305 GLY GLY B . n 
B 2 56  GLN 56  4306 4306 GLN GLN B . n 
B 2 57  ALA 57  4307 4307 ALA ALA B . n 
B 2 58  ILE 58  4308 4308 ILE ILE B . n 
B 2 59  THR 59  4309 4309 THR THR B . n 
B 2 60  VAL 60  4310 4310 VAL VAL B . n 
B 2 61  THR 61  4311 4311 THR THR B . n 
B 2 62  PRO 62  4312 4312 PRO PRO B . n 
B 2 63  GLU 63  4313 4313 GLU GLU B . n 
B 2 64  ALA 64  4314 4314 ALA ALA B . n 
B 2 65  ASN 65  4315 4315 ASN ASN B . n 
B 2 66  MET 66  4316 4316 MET MET B . n 
B 2 67  ASP 67  4317 4317 ASP ASP B . n 
B 2 68  GLN 68  4318 4318 GLN GLN B . n 
B 2 69  GLU 69  4319 4319 GLU GLU B . n 
B 2 70  SER 70  4320 4320 SER SER B . n 
B 2 71  PHE 71  4321 4321 PHE PHE B . n 
B 2 72  GLY 72  4322 4322 GLY GLY B . n 
B 2 73  GLY 73  4323 4323 GLY GLY B . n 
B 2 74  ALA 74  4324 4324 ALA ALA B . n 
B 2 75  SER 75  4325 4325 SER SER B . n 
B 2 76  CYS 76  4326 4326 CYS CYS B . n 
B 2 77  CYS 77  4327 4327 CYS CYS B . n 
B 2 78  LEU 78  4328 4328 LEU LEU B . n 
B 2 79  TYR 79  4329 4329 TYR TYR B . n 
B 2 80  CYS 80  4330 4330 CYS CYS B . n 
B 2 81  ARG 81  4331 4331 ARG ARG B . n 
B 2 82  CYS 82  4332 4332 CYS CYS B . n 
B 2 83  HIS 83  4333 4333 HIS HIS B . n 
B 2 84  ILE 84  4334 4334 ILE ILE B . n 
B 2 85  ASP 85  4335 4335 ASP ASP B . n 
B 2 86  HIS 86  4336 4336 HIS HIS B . n 
B 2 87  PRO 87  4337 4337 PRO PRO B . n 
B 2 88  ASN 88  4338 4338 ASN ASN B . n 
B 2 89  PRO 89  4339 4339 PRO PRO B . n 
B 2 90  LYS 90  4340 4340 LYS LYS B . n 
B 2 91  GLY 91  4341 4341 GLY GLY B . n 
B 2 92  PHE 92  4342 4342 PHE PHE B . n 
B 2 93  CYS 93  4343 4343 CYS CYS B . n 
B 2 94  ASP 94  4344 4344 ASP ASP B . n 
B 2 95  LEU 95  4345 4345 LEU LEU B . n 
B 2 96  LYS 96  4346 4346 LYS LYS B . n 
B 2 97  GLY 97  4347 4347 GLY GLY B . n 
B 2 98  LYS 98  4348 4348 LYS LYS B . n 
B 2 99  TYR 99  4349 4349 TYR TYR B . n 
B 2 100 VAL 100 4350 4350 VAL VAL B . n 
B 2 101 GLN 101 4351 4351 GLN GLN B . n 
B 2 102 ILE 102 4352 4352 ILE ILE B . n 
B 2 103 PRO 103 4353 4353 PRO PRO B . n 
B 2 104 THR 104 4354 4354 THR THR B . n 
B 2 105 THR 105 4355 4355 THR THR B . n 
B 2 106 CYS 106 4356 4356 CYS CYS B . n 
B 2 107 ALA 107 4357 4357 ALA ALA B . n 
B 2 108 ASN 108 4358 4358 ASN ASN B . n 
B 2 109 ASP 109 4359 4359 ASP ASP B . n 
B 2 110 PRO 110 4360 4360 PRO PRO B . n 
B 2 111 VAL 111 4361 4361 VAL VAL B . n 
B 2 112 GLY 112 4362 4362 GLY GLY B . n 
B 2 113 PHE 113 4363 4363 PHE PHE B . n 
B 2 114 THR 114 4364 4364 THR THR B . n 
B 2 115 LEU 115 4365 4365 LEU LEU B . n 
B 2 116 LYS 116 4366 4366 LYS LYS B . n 
B 2 117 ASN 117 4367 4367 ASN ASN B . n 
B 2 118 THR 118 4368 4368 THR THR B . n 
B 2 119 VAL 119 4369 4369 VAL VAL B . n 
B 2 120 CYS 120 4370 4370 CYS CYS B . n 
B 2 121 THR 121 4371 4371 THR THR B . n 
B 2 122 VAL 122 4372 4372 VAL VAL B . n 
B 2 123 CYS 123 4373 4373 CYS CYS B . n 
B 2 124 GLY 124 4374 4374 GLY GLY B . n 
B 2 125 MET 125 4375 4375 MET MET B . n 
B 2 126 TRP 126 4376 4376 TRP TRP B . n 
B 2 127 LYS 127 4377 4377 LYS LYS B . n 
B 2 128 GLY 128 4378 4378 GLY GLY B . n 
B 2 129 TYR 129 4379 4379 TYR TYR B . n 
B 2 130 GLY 130 4380 4380 GLY GLY B . n 
B 2 131 CYS 131 4381 4381 CYS CYS B . n 
B 2 132 SER 132 4382 4382 SER SER B . n 
B 2 133 CYS 133 4383 4383 CYS CYS B . n 
B 2 134 ASP 134 4384 4384 ASP ASP B . n 
B 2 135 GLN 135 4385 4385 GLN GLN B . n 
B 2 136 LEU 136 4386 4386 LEU LEU B . n 
B 2 137 ARG 137 4387 ?    ?   ?   B . n 
B 2 138 GLU 138 4388 ?    ?   ?   B . n 
B 2 139 PRO 139 4389 ?    ?   ?   B . n 
B 2 140 MET 140 4390 ?    ?   ?   B . n 
B 2 141 LEU 141 4391 ?    ?   ?   B . n 
B 2 142 GLN 142 4392 ?    ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'NIAID, National Institute of Allergy and Infectious Diseases' 
_pdbx_SG_project.full_name_of_center   'Center for Structural Genomics of Infectious Diseases' 
_pdbx_SG_project.initial_of_center     CSGID 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 SO3 1   7101 3   SO3 SO3 A . 
D 4 SAM 1   7102 4   SAM SAM A . 
E 5 ACT 1   7103 5   ACT ACT A . 
F 5 ACT 1   7104 6   ACT ACT A . 
G 6 BDF 1   7105 8   BDF BDF A . 
H 7 ZN  1   4401 1   ZN  ZN  B . 
I 7 ZN  1   4402 2   ZN  ZN  B . 
J 6 BDF 1   4403 7   BDF BDF B . 
K 8 HOH 1   7201 351 HOH HOH A . 
K 8 HOH 2   7202 212 HOH HOH A . 
K 8 HOH 3   7203 360 HOH HOH A . 
K 8 HOH 4   7204 303 HOH HOH A . 
K 8 HOH 5   7205 157 HOH HOH A . 
K 8 HOH 6   7206 108 HOH HOH A . 
K 8 HOH 7   7207 277 HOH HOH A . 
K 8 HOH 8   7208 99  HOH HOH A . 
K 8 HOH 9   7209 337 HOH HOH A . 
K 8 HOH 10  7210 82  HOH HOH A . 
K 8 HOH 11  7211 355 HOH HOH A . 
K 8 HOH 12  7212 350 HOH HOH A . 
K 8 HOH 13  7213 41  HOH HOH A . 
K 8 HOH 14  7214 133 HOH HOH A . 
K 8 HOH 15  7215 259 HOH HOH A . 
K 8 HOH 16  7216 93  HOH HOH A . 
K 8 HOH 17  7217 75  HOH HOH A . 
K 8 HOH 18  7218 12  HOH HOH A . 
K 8 HOH 19  7219 250 HOH HOH A . 
K 8 HOH 20  7220 320 HOH HOH A . 
K 8 HOH 21  7221 223 HOH HOH A . 
K 8 HOH 22  7222 150 HOH HOH A . 
K 8 HOH 23  7223 29  HOH HOH A . 
K 8 HOH 24  7224 258 HOH HOH A . 
K 8 HOH 25  7225 137 HOH HOH A . 
K 8 HOH 26  7226 219 HOH HOH A . 
K 8 HOH 27  7227 66  HOH HOH A . 
K 8 HOH 28  7228 244 HOH HOH A . 
K 8 HOH 29  7229 299 HOH HOH A . 
K 8 HOH 30  7230 51  HOH HOH A . 
K 8 HOH 31  7231 58  HOH HOH A . 
K 8 HOH 32  7232 104 HOH HOH A . 
K 8 HOH 33  7233 297 HOH HOH A . 
K 8 HOH 34  7234 83  HOH HOH A . 
K 8 HOH 35  7235 426 HOH HOH A . 
K 8 HOH 36  7236 13  HOH HOH A . 
K 8 HOH 37  7237 249 HOH HOH A . 
K 8 HOH 38  7238 127 HOH HOH A . 
K 8 HOH 39  7239 57  HOH HOH A . 
K 8 HOH 40  7240 144 HOH HOH A . 
K 8 HOH 41  7241 24  HOH HOH A . 
K 8 HOH 42  7242 287 HOH HOH A . 
K 8 HOH 43  7243 158 HOH HOH A . 
K 8 HOH 44  7244 393 HOH HOH A . 
K 8 HOH 45  7245 225 HOH HOH A . 
K 8 HOH 46  7246 383 HOH HOH A . 
K 8 HOH 47  7247 264 HOH HOH A . 
K 8 HOH 48  7248 335 HOH HOH A . 
K 8 HOH 49  7249 325 HOH HOH A . 
K 8 HOH 50  7250 128 HOH HOH A . 
K 8 HOH 51  7251 420 HOH HOH A . 
K 8 HOH 52  7252 417 HOH HOH A . 
K 8 HOH 53  7253 135 HOH HOH A . 
K 8 HOH 54  7254 78  HOH HOH A . 
K 8 HOH 55  7255 64  HOH HOH A . 
K 8 HOH 56  7256 126 HOH HOH A . 
K 8 HOH 57  7257 190 HOH HOH A . 
K 8 HOH 58  7258 310 HOH HOH A . 
K 8 HOH 59  7259 145 HOH HOH A . 
K 8 HOH 60  7260 403 HOH HOH A . 
K 8 HOH 61  7261 290 HOH HOH A . 
K 8 HOH 62  7262 189 HOH HOH A . 
K 8 HOH 63  7263 238 HOH HOH A . 
K 8 HOH 64  7264 168 HOH HOH A . 
K 8 HOH 65  7265 113 HOH HOH A . 
K 8 HOH 66  7266 170 HOH HOH A . 
K 8 HOH 67  7267 242 HOH HOH A . 
K 8 HOH 68  7268 368 HOH HOH A . 
K 8 HOH 69  7269 276 HOH HOH A . 
K 8 HOH 70  7270 343 HOH HOH A . 
K 8 HOH 71  7271 265 HOH HOH A . 
K 8 HOH 72  7272 252 HOH HOH A . 
K 8 HOH 73  7273 206 HOH HOH A . 
K 8 HOH 74  7274 94  HOH HOH A . 
K 8 HOH 75  7275 160 HOH HOH A . 
K 8 HOH 76  7276 207 HOH HOH A . 
K 8 HOH 77  7277 203 HOH HOH A . 
K 8 HOH 78  7278 308 HOH HOH A . 
K 8 HOH 79  7279 247 HOH HOH A . 
K 8 HOH 80  7280 365 HOH HOH A . 
K 8 HOH 81  7281 67  HOH HOH A . 
K 8 HOH 82  7282 40  HOH HOH A . 
K 8 HOH 83  7283 254 HOH HOH A . 
K 8 HOH 84  7284 70  HOH HOH A . 
K 8 HOH 85  7285 152 HOH HOH A . 
K 8 HOH 86  7286 90  HOH HOH A . 
K 8 HOH 87  7287 338 HOH HOH A . 
K 8 HOH 88  7288 307 HOH HOH A . 
K 8 HOH 89  7289 197 HOH HOH A . 
K 8 HOH 90  7290 36  HOH HOH A . 
K 8 HOH 91  7291 50  HOH HOH A . 
K 8 HOH 92  7292 439 HOH HOH A . 
K 8 HOH 93  7293 96  HOH HOH A . 
K 8 HOH 94  7294 20  HOH HOH A . 
K 8 HOH 95  7295 182 HOH HOH A . 
K 8 HOH 96  7296 204 HOH HOH A . 
K 8 HOH 97  7297 179 HOH HOH A . 
K 8 HOH 98  7298 151 HOH HOH A . 
K 8 HOH 99  7299 279 HOH HOH A . 
K 8 HOH 100 7300 136 HOH HOH A . 
K 8 HOH 101 7301 177 HOH HOH A . 
K 8 HOH 102 7302 239 HOH HOH A . 
K 8 HOH 103 7303 200 HOH HOH A . 
K 8 HOH 104 7304 60  HOH HOH A . 
K 8 HOH 105 7305 17  HOH HOH A . 
K 8 HOH 106 7306 185 HOH HOH A . 
K 8 HOH 107 7307 21  HOH HOH A . 
K 8 HOH 108 7308 68  HOH HOH A . 
K 8 HOH 109 7309 143 HOH HOH A . 
K 8 HOH 110 7310 107 HOH HOH A . 
K 8 HOH 111 7311 388 HOH HOH A . 
K 8 HOH 112 7312 210 HOH HOH A . 
K 8 HOH 113 7313 146 HOH HOH A . 
K 8 HOH 114 7314 359 HOH HOH A . 
K 8 HOH 115 7315 201 HOH HOH A . 
K 8 HOH 116 7316 214 HOH HOH A . 
K 8 HOH 117 7317 147 HOH HOH A . 
K 8 HOH 118 7318 120 HOH HOH A . 
K 8 HOH 119 7319 122 HOH HOH A . 
K 8 HOH 120 7320 47  HOH HOH A . 
K 8 HOH 121 7321 45  HOH HOH A . 
K 8 HOH 122 7322 153 HOH HOH A . 
K 8 HOH 123 7323 56  HOH HOH A . 
K 8 HOH 124 7324 46  HOH HOH A . 
K 8 HOH 125 7325 243 HOH HOH A . 
K 8 HOH 126 7326 71  HOH HOH A . 
K 8 HOH 127 7327 422 HOH HOH A . 
K 8 HOH 128 7328 114 HOH HOH A . 
K 8 HOH 129 7329 284 HOH HOH A . 
K 8 HOH 130 7330 209 HOH HOH A . 
K 8 HOH 131 7331 327 HOH HOH A . 
K 8 HOH 132 7332 15  HOH HOH A . 
K 8 HOH 133 7333 52  HOH HOH A . 
K 8 HOH 134 7334 32  HOH HOH A . 
K 8 HOH 135 7335 9   HOH HOH A . 
K 8 HOH 136 7336 164 HOH HOH A . 
K 8 HOH 137 7337 138 HOH HOH A . 
K 8 HOH 138 7338 358 HOH HOH A . 
K 8 HOH 139 7339 10  HOH HOH A . 
K 8 HOH 140 7340 119 HOH HOH A . 
K 8 HOH 141 7341 256 HOH HOH A . 
K 8 HOH 142 7342 74  HOH HOH A . 
K 8 HOH 143 7343 331 HOH HOH A . 
K 8 HOH 144 7344 19  HOH HOH A . 
K 8 HOH 145 7345 329 HOH HOH A . 
K 8 HOH 146 7346 121 HOH HOH A . 
K 8 HOH 147 7347 304 HOH HOH A . 
K 8 HOH 148 7348 246 HOH HOH A . 
K 8 HOH 149 7349 55  HOH HOH A . 
K 8 HOH 150 7350 385 HOH HOH A . 
K 8 HOH 151 7351 149 HOH HOH A . 
K 8 HOH 152 7352 118 HOH HOH A . 
K 8 HOH 153 7353 269 HOH HOH A . 
K 8 HOH 154 7354 248 HOH HOH A . 
K 8 HOH 155 7355 410 HOH HOH A . 
K 8 HOH 156 7356 270 HOH HOH A . 
K 8 HOH 157 7357 111 HOH HOH A . 
K 8 HOH 158 7358 62  HOH HOH A . 
K 8 HOH 159 7359 275 HOH HOH A . 
K 8 HOH 160 7360 167 HOH HOH A . 
K 8 HOH 161 7361 61  HOH HOH A . 
K 8 HOH 162 7362 102 HOH HOH A . 
K 8 HOH 163 7363 195 HOH HOH A . 
K 8 HOH 164 7364 26  HOH HOH A . 
K 8 HOH 165 7365 251 HOH HOH A . 
K 8 HOH 166 7366 53  HOH HOH A . 
K 8 HOH 167 7367 129 HOH HOH A . 
K 8 HOH 168 7368 37  HOH HOH A . 
K 8 HOH 169 7369 105 HOH HOH A . 
K 8 HOH 170 7370 43  HOH HOH A . 
K 8 HOH 171 7371 273 HOH HOH A . 
K 8 HOH 172 7372 449 HOH HOH A . 
K 8 HOH 173 7373 65  HOH HOH A . 
K 8 HOH 174 7374 162 HOH HOH A . 
K 8 HOH 175 7375 328 HOH HOH A . 
K 8 HOH 176 7376 363 HOH HOH A . 
K 8 HOH 177 7377 332 HOH HOH A . 
K 8 HOH 178 7378 271 HOH HOH A . 
K 8 HOH 179 7379 140 HOH HOH A . 
K 8 HOH 180 7380 253 HOH HOH A . 
K 8 HOH 181 7381 314 HOH HOH A . 
K 8 HOH 182 7382 91  HOH HOH A . 
K 8 HOH 183 7383 18  HOH HOH A . 
K 8 HOH 184 7384 183 HOH HOH A . 
K 8 HOH 185 7385 229 HOH HOH A . 
K 8 HOH 186 7386 23  HOH HOH A . 
K 8 HOH 187 7387 216 HOH HOH A . 
K 8 HOH 188 7388 396 HOH HOH A . 
K 8 HOH 189 7389 89  HOH HOH A . 
K 8 HOH 190 7390 447 HOH HOH A . 
K 8 HOH 191 7391 255 HOH HOH A . 
K 8 HOH 192 7392 435 HOH HOH A . 
K 8 HOH 193 7393 92  HOH HOH A . 
K 8 HOH 194 7394 49  HOH HOH A . 
K 8 HOH 195 7395 280 HOH HOH A . 
K 8 HOH 196 7396 73  HOH HOH A . 
K 8 HOH 197 7397 22  HOH HOH A . 
K 8 HOH 198 7398 112 HOH HOH A . 
K 8 HOH 199 7399 42  HOH HOH A . 
K 8 HOH 200 7400 101 HOH HOH A . 
K 8 HOH 201 7401 100 HOH HOH A . 
K 8 HOH 202 7402 48  HOH HOH A . 
K 8 HOH 203 7403 218 HOH HOH A . 
K 8 HOH 204 7404 262 HOH HOH A . 
K 8 HOH 205 7405 362 HOH HOH A . 
K 8 HOH 206 7406 226 HOH HOH A . 
K 8 HOH 207 7407 186 HOH HOH A . 
K 8 HOH 208 7408 268 HOH HOH A . 
K 8 HOH 209 7409 313 HOH HOH A . 
K 8 HOH 210 7410 431 HOH HOH A . 
K 8 HOH 211 7411 342 HOH HOH A . 
K 8 HOH 212 7412 349 HOH HOH A . 
K 8 HOH 213 7413 39  HOH HOH A . 
K 8 HOH 214 7414 278 HOH HOH A . 
K 8 HOH 215 7415 198 HOH HOH A . 
K 8 HOH 216 7416 172 HOH HOH A . 
K 8 HOH 217 7417 211 HOH HOH A . 
K 8 HOH 218 7418 395 HOH HOH A . 
K 8 HOH 219 7419 194 HOH HOH A . 
K 8 HOH 220 7420 317 HOH HOH A . 
K 8 HOH 221 7421 217 HOH HOH A . 
K 8 HOH 222 7422 106 HOH HOH A . 
K 8 HOH 223 7423 193 HOH HOH A . 
K 8 HOH 224 7424 77  HOH HOH A . 
K 8 HOH 225 7425 130 HOH HOH A . 
K 8 HOH 226 7426 81  HOH HOH A . 
K 8 HOH 227 7427 291 HOH HOH A . 
K 8 HOH 228 7428 35  HOH HOH A . 
K 8 HOH 229 7429 88  HOH HOH A . 
K 8 HOH 230 7430 442 HOH HOH A . 
K 8 HOH 231 7431 421 HOH HOH A . 
K 8 HOH 232 7432 411 HOH HOH A . 
K 8 HOH 233 7433 85  HOH HOH A . 
K 8 HOH 234 7434 274 HOH HOH A . 
K 8 HOH 235 7435 87  HOH HOH A . 
K 8 HOH 236 7436 192 HOH HOH A . 
K 8 HOH 237 7437 178 HOH HOH A . 
K 8 HOH 238 7438 173 HOH HOH A . 
K 8 HOH 239 7439 38  HOH HOH A . 
K 8 HOH 240 7440 353 HOH HOH A . 
K 8 HOH 241 7441 361 HOH HOH A . 
K 8 HOH 242 7442 397 HOH HOH A . 
K 8 HOH 243 7443 326 HOH HOH A . 
K 8 HOH 244 7444 245 HOH HOH A . 
K 8 HOH 245 7445 302 HOH HOH A . 
K 8 HOH 246 7446 436 HOH HOH A . 
K 8 HOH 247 7447 321 HOH HOH A . 
K 8 HOH 248 7448 30  HOH HOH A . 
K 8 HOH 249 7449 222 HOH HOH A . 
K 8 HOH 250 7450 316 HOH HOH A . 
K 8 HOH 251 7451 334 HOH HOH A . 
K 8 HOH 252 7452 184 HOH HOH A . 
K 8 HOH 253 7453 237 HOH HOH A . 
K 8 HOH 254 7454 344 HOH HOH A . 
K 8 HOH 255 7455 382 HOH HOH A . 
K 8 HOH 256 7456 401 HOH HOH A . 
K 8 HOH 257 7457 340 HOH HOH A . 
K 8 HOH 258 7458 366 HOH HOH A . 
K 8 HOH 259 7459 448 HOH HOH A . 
K 8 HOH 260 7460 423 HOH HOH A . 
K 8 HOH 261 7461 227 HOH HOH A . 
K 8 HOH 262 7462 295 HOH HOH A . 
K 8 HOH 263 7463 300 HOH HOH A . 
K 8 HOH 264 7464 181 HOH HOH A . 
K 8 HOH 265 7465 234 HOH HOH A . 
K 8 HOH 266 7466 386 HOH HOH A . 
K 8 HOH 267 7467 285 HOH HOH A . 
K 8 HOH 268 7468 220 HOH HOH A . 
K 8 HOH 269 7469 348 HOH HOH A . 
K 8 HOH 270 7470 221 HOH HOH A . 
K 8 HOH 271 7471 425 HOH HOH A . 
K 8 HOH 272 7472 315 HOH HOH A . 
K 8 HOH 273 7473 433 HOH HOH A . 
K 8 HOH 274 7474 427 HOH HOH A . 
K 8 HOH 275 7475 357 HOH HOH A . 
K 8 HOH 276 7476 155 HOH HOH A . 
K 8 HOH 277 7477 356 HOH HOH A . 
K 8 HOH 278 7478 309 HOH HOH A . 
K 8 HOH 279 7479 324 HOH HOH A . 
K 8 HOH 280 7480 169 HOH HOH A . 
K 8 HOH 281 7481 364 HOH HOH A . 
K 8 HOH 282 7482 34  HOH HOH A . 
K 8 HOH 283 7483 311 HOH HOH A . 
K 8 HOH 284 7484 346 HOH HOH A . 
K 8 HOH 285 7485 434 HOH HOH A . 
K 8 HOH 286 7486 187 HOH HOH A . 
K 8 HOH 287 7487 394 HOH HOH A . 
K 8 HOH 288 7488 115 HOH HOH A . 
K 8 HOH 289 7489 154 HOH HOH A . 
K 8 HOH 290 7490 444 HOH HOH A . 
K 8 HOH 291 7491 59  HOH HOH A . 
K 8 HOH 292 7492 288 HOH HOH A . 
K 8 HOH 293 7493 341 HOH HOH A . 
K 8 HOH 294 7494 443 HOH HOH A . 
K 8 HOH 295 7495 450 HOH HOH A . 
K 8 HOH 296 7496 441 HOH HOH A . 
K 8 HOH 297 7497 124 HOH HOH A . 
K 8 HOH 298 7498 438 HOH HOH A . 
K 8 HOH 299 7499 399 HOH HOH A . 
K 8 HOH 300 7500 188 HOH HOH A . 
K 8 HOH 301 7501 233 HOH HOH A . 
K 8 HOH 302 7502 345 HOH HOH A . 
K 8 HOH 303 7503 156 HOH HOH A . 
K 8 HOH 304 7504 354 HOH HOH A . 
K 8 HOH 305 7505 289 HOH HOH A . 
K 8 HOH 306 7506 418 HOH HOH A . 
K 8 HOH 307 7507 384 HOH HOH A . 
K 8 HOH 308 7508 367 HOH HOH A . 
K 8 HOH 309 7509 405 HOH HOH A . 
K 8 HOH 310 7510 378 HOH HOH A . 
K 8 HOH 311 7511 235 HOH HOH A . 
K 8 HOH 312 7512 400 HOH HOH A . 
K 8 HOH 313 7513 424 HOH HOH A . 
K 8 HOH 314 7514 404 HOH HOH A . 
K 8 HOH 315 7515 165 HOH HOH A . 
K 8 HOH 316 7516 372 HOH HOH A . 
K 8 HOH 317 7517 228 HOH HOH A . 
K 8 HOH 318 7518 79  HOH HOH A . 
K 8 HOH 319 7519 379 HOH HOH A . 
K 8 HOH 320 7520 406 HOH HOH A . 
K 8 HOH 321 7521 402 HOH HOH A . 
K 8 HOH 322 7522 213 HOH HOH A . 
K 8 HOH 323 7523 398 HOH HOH A . 
K 8 HOH 324 7524 381 HOH HOH A . 
K 8 HOH 325 7525 266 HOH HOH A . 
K 8 HOH 326 7526 191 HOH HOH A . 
K 8 HOH 327 7527 419 HOH HOH A . 
K 8 HOH 328 7528 163 HOH HOH A . 
K 8 HOH 329 7529 161 HOH HOH A . 
K 8 HOH 330 7530 148 HOH HOH A . 
K 8 HOH 331 7531 322 HOH HOH A . 
K 8 HOH 332 7532 176 HOH HOH A . 
K 8 HOH 333 7533 174 HOH HOH A . 
K 8 HOH 334 7534 440 HOH HOH A . 
K 8 HOH 335 7535 387 HOH HOH A . 
K 8 HOH 336 7536 412 HOH HOH A . 
K 8 HOH 337 7537 390 HOH HOH A . 
L 8 HOH 1   4501 292 HOH HOH B . 
L 8 HOH 2   4502 263 HOH HOH B . 
L 8 HOH 3   4503 98  HOH HOH B . 
L 8 HOH 4   4504 312 HOH HOH B . 
L 8 HOH 5   4505 116 HOH HOH B . 
L 8 HOH 6   4506 236 HOH HOH B . 
L 8 HOH 7   4507 319 HOH HOH B . 
L 8 HOH 8   4508 305 HOH HOH B . 
L 8 HOH 9   4509 298 HOH HOH B . 
L 8 HOH 10  4510 445 HOH HOH B . 
L 8 HOH 11  4511 33  HOH HOH B . 
L 8 HOH 12  4512 69  HOH HOH B . 
L 8 HOH 13  4513 95  HOH HOH B . 
L 8 HOH 14  4514 80  HOH HOH B . 
L 8 HOH 15  4515 205 HOH HOH B . 
L 8 HOH 16  4516 142 HOH HOH B . 
L 8 HOH 17  4517 180 HOH HOH B . 
L 8 HOH 18  4518 428 HOH HOH B . 
L 8 HOH 19  4519 380 HOH HOH B . 
L 8 HOH 20  4520 171 HOH HOH B . 
L 8 HOH 21  4521 132 HOH HOH B . 
L 8 HOH 22  4522 139 HOH HOH B . 
L 8 HOH 23  4523 175 HOH HOH B . 
L 8 HOH 24  4524 11  HOH HOH B . 
L 8 HOH 25  4525 31  HOH HOH B . 
L 8 HOH 26  4526 430 HOH HOH B . 
L 8 HOH 27  4527 208 HOH HOH B . 
L 8 HOH 28  4528 375 HOH HOH B . 
L 8 HOH 29  4529 408 HOH HOH B . 
L 8 HOH 30  4530 103 HOH HOH B . 
L 8 HOH 31  4531 352 HOH HOH B . 
L 8 HOH 32  4532 282 HOH HOH B . 
L 8 HOH 33  4533 301 HOH HOH B . 
L 8 HOH 34  4534 86  HOH HOH B . 
L 8 HOH 35  4535 376 HOH HOH B . 
L 8 HOH 36  4536 131 HOH HOH B . 
L 8 HOH 37  4537 54  HOH HOH B . 
L 8 HOH 38  4538 286 HOH HOH B . 
L 8 HOH 39  4539 134 HOH HOH B . 
L 8 HOH 40  4540 429 HOH HOH B . 
L 8 HOH 41  4541 125 HOH HOH B . 
L 8 HOH 42  4542 241 HOH HOH B . 
L 8 HOH 43  4543 294 HOH HOH B . 
L 8 HOH 44  4544 257 HOH HOH B . 
L 8 HOH 45  4545 27  HOH HOH B . 
L 8 HOH 46  4546 110 HOH HOH B . 
L 8 HOH 47  4547 63  HOH HOH B . 
L 8 HOH 48  4548 16  HOH HOH B . 
L 8 HOH 49  4549 166 HOH HOH B . 
L 8 HOH 50  4550 240 HOH HOH B . 
L 8 HOH 51  4551 369 HOH HOH B . 
L 8 HOH 52  4552 14  HOH HOH B . 
L 8 HOH 53  4553 293 HOH HOH B . 
L 8 HOH 54  4554 117 HOH HOH B . 
L 8 HOH 55  4555 84  HOH HOH B . 
L 8 HOH 56  4556 196 HOH HOH B . 
L 8 HOH 57  4557 260 HOH HOH B . 
L 8 HOH 58  4558 44  HOH HOH B . 
L 8 HOH 59  4559 261 HOH HOH B . 
L 8 HOH 60  4560 296 HOH HOH B . 
L 8 HOH 61  4561 97  HOH HOH B . 
L 8 HOH 62  4562 323 HOH HOH B . 
L 8 HOH 63  4563 230 HOH HOH B . 
L 8 HOH 64  4564 281 HOH HOH B . 
L 8 HOH 65  4565 76  HOH HOH B . 
L 8 HOH 66  4566 72  HOH HOH B . 
L 8 HOH 67  4567 267 HOH HOH B . 
L 8 HOH 68  4568 333 HOH HOH B . 
L 8 HOH 69  4569 409 HOH HOH B . 
L 8 HOH 70  4570 159 HOH HOH B . 
L 8 HOH 71  4571 123 HOH HOH B . 
L 8 HOH 72  4572 109 HOH HOH B . 
L 8 HOH 73  4573 283 HOH HOH B . 
L 8 HOH 74  4574 25  HOH HOH B . 
L 8 HOH 75  4575 414 HOH HOH B . 
L 8 HOH 76  4576 306 HOH HOH B . 
L 8 HOH 77  4577 28  HOH HOH B . 
L 8 HOH 78  4578 373 HOH HOH B . 
L 8 HOH 79  4579 215 HOH HOH B . 
L 8 HOH 80  4580 231 HOH HOH B . 
L 8 HOH 81  4581 371 HOH HOH B . 
L 8 HOH 82  4582 432 HOH HOH B . 
L 8 HOH 83  4583 318 HOH HOH B . 
L 8 HOH 84  4584 377 HOH HOH B . 
L 8 HOH 85  4585 336 HOH HOH B . 
L 8 HOH 86  4586 141 HOH HOH B . 
L 8 HOH 87  4587 391 HOH HOH B . 
L 8 HOH 88  4588 437 HOH HOH B . 
L 8 HOH 89  4589 415 HOH HOH B . 
L 8 HOH 90  4590 224 HOH HOH B . 
L 8 HOH 91  4591 339 HOH HOH B . 
L 8 HOH 92  4592 272 HOH HOH B . 
L 8 HOH 93  4593 330 HOH HOH B . 
L 8 HOH 94  4594 232 HOH HOH B . 
L 8 HOH 95  4595 374 HOH HOH B . 
L 8 HOH 96  4596 392 HOH HOH B . 
L 8 HOH 97  4597 202 HOH HOH B . 
L 8 HOH 98  4598 407 HOH HOH B . 
L 8 HOH 99  4599 347 HOH HOH B . 
L 8 HOH 100 4600 446 HOH HOH B . 
L 8 HOH 101 4601 413 HOH HOH B . 
L 8 HOH 102 4602 389 HOH HOH B . 
L 8 HOH 103 4603 370 HOH HOH B . 
L 8 HOH 104 4604 416 HOH HOH B . 
L 8 HOH 105 4605 199 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2870  ? 
1 MORE         -15   ? 
1 'SSA (A^2)'  19710 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? B CYS 77  ? B CYS 4327 ? 1_555 ZN ? H ZN . ? B ZN 4401 ? 1_555 SG  ? B CYS 80  ? B CYS 4330 ? 1_555 114.5 ? 
2  SG  ? B CYS 77  ? B CYS 4327 ? 1_555 ZN ? H ZN . ? B ZN 4401 ? 1_555 NE2 ? B HIS 86  ? B HIS 4336 ? 1_555 104.9 ? 
3  SG  ? B CYS 80  ? B CYS 4330 ? 1_555 ZN ? H ZN . ? B ZN 4401 ? 1_555 NE2 ? B HIS 86  ? B HIS 4336 ? 1_555 111.6 ? 
4  SG  ? B CYS 77  ? B CYS 4327 ? 1_555 ZN ? H ZN . ? B ZN 4401 ? 1_555 SG  ? B CYS 93  ? B CYS 4343 ? 1_555 110.4 ? 
5  SG  ? B CYS 80  ? B CYS 4330 ? 1_555 ZN ? H ZN . ? B ZN 4401 ? 1_555 SG  ? B CYS 93  ? B CYS 4343 ? 1_555 114.0 ? 
6  NE2 ? B HIS 86  ? B HIS 4336 ? 1_555 ZN ? H ZN . ? B ZN 4401 ? 1_555 SG  ? B CYS 93  ? B CYS 4343 ? 1_555 100.1 ? 
7  SG  ? B CYS 120 ? B CYS 4370 ? 1_555 ZN ? I ZN . ? B ZN 4402 ? 1_555 SG  ? B CYS 123 ? B CYS 4373 ? 1_555 105.7 ? 
8  SG  ? B CYS 120 ? B CYS 4370 ? 1_555 ZN ? I ZN . ? B ZN 4402 ? 1_555 SG  ? B CYS 131 ? B CYS 4381 ? 1_555 102.9 ? 
9  SG  ? B CYS 123 ? B CYS 4373 ? 1_555 ZN ? I ZN . ? B ZN 4402 ? 1_555 SG  ? B CYS 131 ? B CYS 4381 ? 1_555 111.5 ? 
10 SG  ? B CYS 120 ? B CYS 4370 ? 1_555 ZN ? I ZN . ? B ZN 4402 ? 1_555 SG  ? B CYS 133 ? B CYS 4383 ? 1_555 110.8 ? 
11 SG  ? B CYS 123 ? B CYS 4373 ? 1_555 ZN ? I ZN . ? B ZN 4402 ? 1_555 SG  ? B CYS 133 ? B CYS 4383 ? 1_555 117.2 ? 
12 SG  ? B CYS 131 ? B CYS 4381 ? 1_555 ZN ? I ZN . ? B ZN 4402 ? 1_555 SG  ? B CYS 133 ? B CYS 4383 ? 1_555 107.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-03-18 
2 'Structure model' 1 1 2020-04-01 
3 'Structure model' 1 2 2020-05-06 
4 'Structure model' 1 3 2020-07-29 
5 'Structure model' 1 4 2021-01-27 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Structure summary'    
2 3 'Structure model' 'Database references'  
3 3 'Structure model' 'Source and taxonomy'  
4 3 'Structure model' 'Structure summary'    
5 4 'Structure model' 'Data collection'      
6 4 'Structure model' 'Derived calculations' 
7 4 'Structure model' 'Structure summary'    
8 5 'Structure model' 'Database references'  
9 5 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' entity                    
2  3 'Structure model' entity                    
3  3 'Structure model' entity_name_com           
4  3 'Structure model' entity_src_gen            
5  3 'Structure model' pdbx_related_exp_data_set 
6  3 'Structure model' struct_ref                
7  3 'Structure model' struct_ref_seq            
8  3 'Structure model' struct_ref_seq_dif        
9  4 'Structure model' chem_comp                 
10 4 'Structure model' entity                    
11 4 'Structure model' pdbx_chem_comp_identifier 
12 4 'Structure model' pdbx_entity_nonpoly       
13 4 'Structure model' struct_site               
14 4 'Structure model' struct_site_gen           
15 5 'Structure model' chem_comp                 
16 5 'Structure model' citation                  
17 5 'Structure model' citation_author           
18 5 'Structure model' entity                    
19 5 'Structure model' entity_name_com           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_entity.pdbx_description'                
2  3 'Structure model' '_entity.pdbx_ec'                         
3  3 'Structure model' '_entity.pdbx_fragment'                   
4  3 'Structure model' '_entity_src_gen.gene_src_common_name'    
5  3 'Structure model' '_entity_src_gen.pdbx_gene_src_gene'      
6  3 'Structure model' '_struct_ref.db_code'                     
7  3 'Structure model' '_struct_ref.db_name'                     
8  3 'Structure model' '_struct_ref.pdbx_align_begin'            
9  3 'Structure model' '_struct_ref.pdbx_db_accession'           
10 3 'Structure model' '_struct_ref.pdbx_seq_one_letter_code'    
11 3 'Structure model' '_struct_ref_seq.db_align_beg'            
12 3 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_beg' 
13 3 'Structure model' '_struct_ref_seq.pdbx_db_accession'       
14 3 'Structure model' '_struct_ref_seq.seq_align_beg'           
15 4 'Structure model' '_chem_comp.name'                         
16 4 'Structure model' '_entity.pdbx_description'                
17 4 'Structure model' '_pdbx_entity_nonpoly.name'               
18 5 'Structure model' '_chem_comp.pdbx_synonyms'                
19 5 'Structure model' '_entity.pdbx_description'                
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined 92.7106  37.5769 33.6726 0.1121 ? -0.0205 ? -0.0123 ? 0.0521 ? -0.0755 ? 0.1420 ? 2.8328 ? 0.1141  
? 0.6504  ? 1.4376  ? 0.2818  ? 2.2037 ? -0.0530 ? -0.1785 ? 0.4034  ? 0.1046  ? 0.0545  ? -0.1822 ? -0.1433 ? 0.1214  ? -0.0016 ? 
2 'X-RAY DIFFRACTION' ? refined 84.8509  20.0354 18.6950 0.1163 ? -0.0232 ? -0.0076 ? 0.0192 ? -0.0068 ? 0.0180 ? 1.1583 ? -0.0499 
? 0.1649  ? 1.9178  ? 0.3623  ? 0.7927 ? -0.0148 ? 0.0719  ? -0.0399 ? -0.2093 ? 0.1018  ? 0.0202  ? 0.0562  ? 0.0147  ? -0.0869 ? 
3 'X-RAY DIFFRACTION' ? refined 93.6483  16.9856 35.6139 0.1389 ? 0.0043  ? -0.0455 ? 0.0527 ? 0.0061  ? 0.0288 ? 2.5538 ? -0.6515 
? -1.2383 ? 3.8901  ? 2.9366  ? 5.7842 ? 0.1011  ? -0.1924 ? -0.1545 ? 0.4604  ? 0.0523  ? -0.1975 ? 0.4097  ? -0.1119 ? -0.1534 ? 
4 'X-RAY DIFFRACTION' ? refined 94.2818  28.8532 26.9016 0.0744 ? -0.0207 ? 0.0071  ? 0.0393 ? -0.0421 ? 0.0617 ? 1.0247 ? 0.2122  
? 0.0595  ? 1.4906  ? 0.3060  ? 1.0888 ? -0.0319 ? -0.0547 ? 0.1098  ? -0.0019 ? 0.1340  ? -0.2202 ? -0.0136 ? 0.1503  ? -0.1021 ? 
5 'X-RAY DIFFRACTION' ? refined 101.8656 23.0792 6.3974  0.0863 ? -0.0461 ? 0.0435  ? 0.0346 ? -0.0257 ? 0.0477 ? 7.7604 ? -2.7017 
? -0.6614 ? 2.5286  ? 0.4493  ? 1.0699 ? -0.0197 ? 0.1631  ? 0.2645  ? -0.1341 ? 0.0870  ? -0.3117 ? -0.0419 ? 0.0750  ? -0.0674 ? 
6 'X-RAY DIFFRACTION' ? refined 100.7636 15.4269 12.2787 0.1440 ? -0.0228 ? 0.0944  ? 0.1119 ? -0.0856 ? 0.1198 ? 0.9004 ? 1.3876  
? -0.0168 ? 5.7587  ? -1.3622 ? 1.2851 ? -0.0027 ? 0.0893  ? -0.1138 ? -0.2651 ? 0.0967  ? -0.4347 ? 0.0410  ? 0.2319  ? -0.0940 ? 
7 'X-RAY DIFFRACTION' ? refined 56.0951  4.7767  15.2986 0.0820 ? -0.0624 ? -0.0536 ? 0.0845 ? 0.0131  ? 0.3435 ? 0.2654 ? -1.7056 
? -0.2773 ? 11.9433 ? 0.8343  ? 1.3971 ? 0.0488  ? 0.0327  ? -0.1424 ? -0.4528 ? -0.2131 ? 0.7220  ? 0.1344  ? -0.1350 ? 0.1643  ? 
8 'X-RAY DIFFRACTION' ? refined 69.0475  17.8217 10.6894 0.1397 ? -0.0322 ? -0.1024 ? 0.0577 ? -0.0143 ? 0.1077 ? 2.2104 ? -0.0143 
? -0.0847 ? 3.6373  ? -0.5394 ? 1.6256 ? -0.0243 ? 0.3024  ? -0.1843 ? -0.4276 ? 0.0520  ? 0.4007  ? 0.1414  ? -0.1435 ? -0.0277 ? 
9 'X-RAY DIFFRACTION' ? refined 62.4718  19.8901 4.2832  0.2508 ? -0.0525 ? -0.1997 ? 0.1631 ? -0.0213 ? 0.2055 ? 3.3852 ? -0.3080 
? -0.6470 ? 2.7319  ? -1.2904 ? 2.7697 ? 0.0449  ? 0.5496  ? -0.2003 ? -0.5509 ? 0.0720  ? 0.6134  ? 0.2313  ? -0.3482 ? -0.1169 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1  'X-RAY DIFFRACTION' 1 ? ? A 6798 ? ? A 6827 ? ? 
2  'X-RAY DIFFRACTION' 2 ? ? A 6828 ? ? A 6932 ? ? 
3  'X-RAY DIFFRACTION' 3 ? ? A 6933 ? ? A 6956 ? ? 
4  'X-RAY DIFFRACTION' 4 ? ? A 6957 ? ? A 7048 ? ? 
5  'X-RAY DIFFRACTION' 5 ? ? A 7049 ? ? A 7065 ? ? 
6  'X-RAY DIFFRACTION' 6 ? ? A 7066 ? ? A 7096 ? ? 
7  'X-RAY DIFFRACTION' 7 ? ? B 4271 ? ? B 4288 ? ? 
8  'X-RAY DIFFRACTION' 8 ? ? B 4289 ? ? B 4344 ? ? 
9  'X-RAY DIFFRACTION' 8 ? ? S 1    ? ? S 1    ? ? 
10 'X-RAY DIFFRACTION' 9 ? ? B 4345 ? ? B 4386 ? ? 
11 'X-RAY DIFFRACTION' 9 ? ? S 2    ? ? S 2    ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.8.0258 1 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25     2 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-3000    ? ? ? .        3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-3000    ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .        5 
# 
_pdbx_entry_details.entry_id                 6W4H 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 6945 ? A -100.79 -109.86 
2 1 GLU A 6945 ? B -99.92  -108.41 
3 1 ASN A 7008 ? ? 73.73   87.84   
4 1 ASP B 4275 ? ? -107.97 79.68   
5 1 ASN B 4338 ? ? 179.41  154.34  
6 1 LYS B 4340 ? ? 84.03   -15.07  
7 1 TYR B 4379 ? ? -141.28 46.38   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 6796 ? A SER 1   
2  1 Y 1 A ASN 6797 ? A ASN 2   
3  1 Y 1 B SER 4251 ? B SER 1   
4  1 Y 1 B ASN 4252 ? B ASN 2   
5  1 Y 1 B ALA 4253 ? B ALA 3   
6  1 Y 1 B ALA 4254 ? B ALA 4   
7  1 Y 1 B GLY 4255 ? B GLY 5   
8  1 Y 1 B ASN 4256 ? B ASN 6   
9  1 Y 1 B ALA 4257 ? B ALA 7   
10 1 Y 1 B THR 4258 ? B THR 8   
11 1 Y 1 B GLU 4259 ? B GLU 9   
12 1 Y 1 B VAL 4260 ? B VAL 10  
13 1 Y 1 B PRO 4261 ? B PRO 11  
14 1 Y 1 B ALA 4262 ? B ALA 12  
15 1 Y 1 B ASN 4263 ? B ASN 13  
16 1 Y 1 B SER 4264 ? B SER 14  
17 1 Y 1 B THR 4265 ? B THR 15  
18 1 Y 1 B VAL 4266 ? B VAL 16  
19 1 Y 1 B LEU 4267 ? B LEU 17  
20 1 Y 1 B SER 4268 ? B SER 18  
21 1 Y 1 B PHE 4269 ? B PHE 19  
22 1 Y 1 B CYS 4270 ? B CYS 20  
23 1 Y 1 B ARG 4387 ? B ARG 137 
24 1 Y 1 B GLU 4388 ? B GLU 138 
25 1 Y 1 B PRO 4389 ? B PRO 139 
26 1 Y 1 B MET 4390 ? B MET 140 
27 1 Y 1 B LEU 4391 ? B LEU 141 
28 1 Y 1 B GLN 4392 ? B GLN 142 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BDF 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DFrupb             
BDF 'COMMON NAME'                         GMML     1.0 b-D-fructopyranose 
BDF 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Frup           
BDF 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fru                
# 
loop_
_pdbx_entity_instance_feature.ordinal 
_pdbx_entity_instance_feature.comp_id 
_pdbx_entity_instance_feature.asym_id 
_pdbx_entity_instance_feature.seq_num 
_pdbx_entity_instance_feature.auth_comp_id 
_pdbx_entity_instance_feature.auth_asym_id 
_pdbx_entity_instance_feature.auth_seq_num 
_pdbx_entity_instance_feature.feature_type 
_pdbx_entity_instance_feature.details 
1 SAM ? ? SAM ? ? 'SUBJECT OF INVESTIGATION' ? 
2 ZN  ? ? ZN  ? ? 'SUBJECT OF INVESTIGATION' ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFITE ION'         SO3 
4 S-ADENOSYLMETHIONINE  SAM 
5 'ACETATE ION'         ACT 
6 beta-D-fructopyranose BDF 
7 'ZINC ION'            ZN  
8 water                 HOH 
# 
_pdbx_related_exp_data_set.data_reference       10.18430/m36w4h 
_pdbx_related_exp_data_set.data_set_type        'diffraction image data' 
_pdbx_related_exp_data_set.details              ? 
_pdbx_related_exp_data_set.metadata_reference   ? 
_pdbx_related_exp_data_set.ordinal              1 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#